data_4NSW
# 
_entry.id   4NSW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4NSW         
RCSB  RCSB083614   
WWPDB D_1000083614 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4NSW 
_pdbx_database_status.recvd_initial_deposition_date   2013-11-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pang, X.'  1 
'Zhang, K.' 2 
'Ma, J.'    3 
'Zhou, Q.'  4 
'Sun, F.'   5 
# 
_citation.id                        primary 
_citation.title                     'A PH Domain in ACAP1 Possesses Key Features of the BAR Domain in Promoting Membrane Curvature' 
_citation.journal_abbrev            Dev.Cell 
_citation.journal_volume            31 
_citation.page_first                73 
_citation.page_last                 86 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1534-5807 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25284369 
_citation.pdbx_database_id_DOI      10.1016/j.devcel.2014.08.020 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pang, X.'      1  
primary 'Fan, J.'       2  
primary 'Zhang, Y.'     3  
primary 'Zhang, K.'     4  
primary 'Gao, B.'       5  
primary 'Ma, J.'        6  
primary 'Li, J.'        7  
primary 'Deng, Y.'      8  
primary 'Zhou, Q.'      9  
primary 'Egelman, E.H.' 10 
primary 'Hsu, V.W.'     11 
primary 'Sun, F.'       12 
# 
_cell.entry_id           4NSW 
_cell.length_a           42.460 
_cell.length_b           59.720 
_cell.length_c           168.950 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4NSW 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1' 43334.348 2   ? ? 'UNP residues 1-377' ? 
2 water   nat water                                                                     18.015    146 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Centaurin-beta-1, Cnt-b1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFVVGICDLARLGPPEPM
MAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTHNAEVPRRRAQEAEEA
GAALRTARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREK
RDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKDPVTVVVDDLRLC
TVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIASAFSQARLDDSPRGPGQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFVVGICDLARLGPPEPM
MAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTHNAEVPRRRAQEAEEA
GAALRTARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREK
RDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKDPVTVVVDDLRLC
TVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIASAFSQARLDDSPRGPGQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   THR n 
1 8   VAL n 
1 9   LYS n 
1 10  LEU n 
1 11  ASP n 
1 12  PHE n 
1 13  GLU n 
1 14  GLU n 
1 15  CYS n 
1 16  LEU n 
1 17  LYS n 
1 18  ASP n 
1 19  SER n 
1 20  PRO n 
1 21  ARG n 
1 22  PHE n 
1 23  ARG n 
1 24  ALA n 
1 25  SER n 
1 26  ILE n 
1 27  GLU n 
1 28  LEU n 
1 29  VAL n 
1 30  GLU n 
1 31  ALA n 
1 32  GLU n 
1 33  VAL n 
1 34  SER n 
1 35  GLU n 
1 36  LEU n 
1 37  GLU n 
1 38  THR n 
1 39  ARG n 
1 40  LEU n 
1 41  GLU n 
1 42  LYS n 
1 43  LEU n 
1 44  LEU n 
1 45  LYS n 
1 46  LEU n 
1 47  GLY n 
1 48  THR n 
1 49  GLY n 
1 50  LEU n 
1 51  LEU n 
1 52  GLU n 
1 53  SER n 
1 54  GLY n 
1 55  ARG n 
1 56  HIS n 
1 57  TYR n 
1 58  LEU n 
1 59  ALA n 
1 60  ALA n 
1 61  SER n 
1 62  ARG n 
1 63  ALA n 
1 64  PHE n 
1 65  VAL n 
1 66  VAL n 
1 67  GLY n 
1 68  ILE n 
1 69  CYS n 
1 70  ASP n 
1 71  LEU n 
1 72  ALA n 
1 73  ARG n 
1 74  LEU n 
1 75  GLY n 
1 76  PRO n 
1 77  PRO n 
1 78  GLU n 
1 79  PRO n 
1 80  MET n 
1 81  MET n 
1 82  ALA n 
1 83  GLU n 
1 84  CYS n 
1 85  LEU n 
1 86  GLU n 
1 87  LYS n 
1 88  PHE n 
1 89  THR n 
1 90  VAL n 
1 91  SER n 
1 92  LEU n 
1 93  ASN n 
1 94  HIS n 
1 95  LYS n 
1 96  LEU n 
1 97  ASP n 
1 98  SER n 
1 99  HIS n 
1 100 ALA n 
1 101 GLU n 
1 102 LEU n 
1 103 LEU n 
1 104 ASP n 
1 105 ALA n 
1 106 THR n 
1 107 GLN n 
1 108 HIS n 
1 109 THR n 
1 110 LEU n 
1 111 GLN n 
1 112 GLN n 
1 113 GLN n 
1 114 ILE n 
1 115 GLN n 
1 116 THR n 
1 117 LEU n 
1 118 VAL n 
1 119 LYS n 
1 120 GLU n 
1 121 GLY n 
1 122 LEU n 
1 123 ARG n 
1 124 GLY n 
1 125 PHE n 
1 126 ARG n 
1 127 GLU n 
1 128 ALA n 
1 129 ARG n 
1 130 ARG n 
1 131 ASP n 
1 132 PHE n 
1 133 TRP n 
1 134 ARG n 
1 135 GLY n 
1 136 ALA n 
1 137 GLU n 
1 138 SER n 
1 139 LEU n 
1 140 GLU n 
1 141 ALA n 
1 142 ALA n 
1 143 LEU n 
1 144 THR n 
1 145 HIS n 
1 146 ASN n 
1 147 ALA n 
1 148 GLU n 
1 149 VAL n 
1 150 PRO n 
1 151 ARG n 
1 152 ARG n 
1 153 ARG n 
1 154 ALA n 
1 155 GLN n 
1 156 GLU n 
1 157 ALA n 
1 158 GLU n 
1 159 GLU n 
1 160 ALA n 
1 161 GLY n 
1 162 ALA n 
1 163 ALA n 
1 164 LEU n 
1 165 ARG n 
1 166 THR n 
1 167 ALA n 
1 168 ARG n 
1 169 ALA n 
1 170 GLY n 
1 171 TYR n 
1 172 ARG n 
1 173 GLY n 
1 174 ARG n 
1 175 ALA n 
1 176 LEU n 
1 177 ASP n 
1 178 TYR n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 ILE n 
1 183 ASN n 
1 184 VAL n 
1 185 ILE n 
1 186 GLU n 
1 187 ASP n 
1 188 LYS n 
1 189 ARG n 
1 190 LYS n 
1 191 PHE n 
1 192 ASP n 
1 193 ILE n 
1 194 MET n 
1 195 GLU n 
1 196 PHE n 
1 197 VAL n 
1 198 LEU n 
1 199 ARG n 
1 200 LEU n 
1 201 VAL n 
1 202 GLU n 
1 203 ALA n 
1 204 GLN n 
1 205 ALA n 
1 206 THR n 
1 207 HIS n 
1 208 PHE n 
1 209 GLN n 
1 210 GLN n 
1 211 GLY n 
1 212 HIS n 
1 213 GLU n 
1 214 GLU n 
1 215 LEU n 
1 216 SER n 
1 217 ARG n 
1 218 LEU n 
1 219 SER n 
1 220 GLN n 
1 221 TYR n 
1 222 ARG n 
1 223 LYS n 
1 224 GLU n 
1 225 LEU n 
1 226 GLY n 
1 227 ALA n 
1 228 GLN n 
1 229 LEU n 
1 230 HIS n 
1 231 GLN n 
1 232 LEU n 
1 233 VAL n 
1 234 LEU n 
1 235 ASN n 
1 236 SER n 
1 237 ALA n 
1 238 ARG n 
1 239 GLU n 
1 240 LYS n 
1 241 ARG n 
1 242 ASP n 
1 243 MET n 
1 244 GLU n 
1 245 GLN n 
1 246 ARG n 
1 247 HIS n 
1 248 VAL n 
1 249 LEU n 
1 250 LEU n 
1 251 LYS n 
1 252 GLN n 
1 253 LYS n 
1 254 GLU n 
1 255 LEU n 
1 256 GLY n 
1 257 GLY n 
1 258 GLU n 
1 259 GLU n 
1 260 PRO n 
1 261 GLU n 
1 262 PRO n 
1 263 SER n 
1 264 LEU n 
1 265 ARG n 
1 266 GLU n 
1 267 GLY n 
1 268 PRO n 
1 269 GLY n 
1 270 GLY n 
1 271 LEU n 
1 272 VAL n 
1 273 MET n 
1 274 GLU n 
1 275 GLY n 
1 276 HIS n 
1 277 LEU n 
1 278 PHE n 
1 279 LYS n 
1 280 ARG n 
1 281 ALA n 
1 282 SER n 
1 283 ASN n 
1 284 ALA n 
1 285 PHE n 
1 286 LYS n 
1 287 THR n 
1 288 TRP n 
1 289 SER n 
1 290 ARG n 
1 291 ARG n 
1 292 TRP n 
1 293 PHE n 
1 294 THR n 
1 295 ILE n 
1 296 GLN n 
1 297 SER n 
1 298 ASN n 
1 299 GLN n 
1 300 LEU n 
1 301 VAL n 
1 302 TYR n 
1 303 GLN n 
1 304 LYS n 
1 305 LYS n 
1 306 TYR n 
1 307 LYS n 
1 308 ASP n 
1 309 PRO n 
1 310 VAL n 
1 311 THR n 
1 312 VAL n 
1 313 VAL n 
1 314 VAL n 
1 315 ASP n 
1 316 ASP n 
1 317 LEU n 
1 318 ARG n 
1 319 LEU n 
1 320 CYS n 
1 321 THR n 
1 322 VAL n 
1 323 LYS n 
1 324 LEU n 
1 325 CYS n 
1 326 PRO n 
1 327 ASP n 
1 328 SER n 
1 329 GLU n 
1 330 ARG n 
1 331 ARG n 
1 332 PHE n 
1 333 CYS n 
1 334 PHE n 
1 335 GLU n 
1 336 VAL n 
1 337 VAL n 
1 338 SER n 
1 339 THR n 
1 340 SER n 
1 341 LYS n 
1 342 SER n 
1 343 CYS n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 ALA n 
1 348 ASP n 
1 349 SER n 
1 350 GLU n 
1 351 ARG n 
1 352 LEU n 
1 353 LEU n 
1 354 GLN n 
1 355 LEU n 
1 356 TRP n 
1 357 VAL n 
1 358 SER n 
1 359 ALA n 
1 360 VAL n 
1 361 GLN n 
1 362 SER n 
1 363 SER n 
1 364 ILE n 
1 365 ALA n 
1 366 SER n 
1 367 ALA n 
1 368 PHE n 
1 369 SER n 
1 370 GLN n 
1 371 ALA n 
1 372 ARG n 
1 373 LEU n 
1 374 ASP n 
1 375 ASP n 
1 376 SER n 
1 377 PRO n 
1 378 ARG n 
1 379 GLY n 
1 380 PRO n 
1 381 GLY n 
1 382 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ACAP1, CENTB1, KIAA0050' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX-6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACAP1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFVVGICDLARLGPPEPMMAECL
EKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALR
TARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQ
RHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKDPVTVVVDDLRLCTVKLC
PDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIASAFSQARLDDSPRGPGQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          Q15027 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4NSW A 6 ? 382 ? Q15027 1 ? 377 ? 1 377 
2 1 4NSW B 6 ? 382 ? Q15027 1 ? 377 ? 1 377 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4NSW GLY A 1 ? UNP Q15027 ? ? 'EXPRESSION TAG' -4 1  
1 4NSW PRO A 2 ? UNP Q15027 ? ? 'EXPRESSION TAG' -3 2  
1 4NSW LEU A 3 ? UNP Q15027 ? ? 'EXPRESSION TAG' -2 3  
1 4NSW GLY A 4 ? UNP Q15027 ? ? 'EXPRESSION TAG' -1 4  
1 4NSW SER A 5 ? UNP Q15027 ? ? 'EXPRESSION TAG' 0  5  
2 4NSW GLY B 1 ? UNP Q15027 ? ? 'EXPRESSION TAG' -4 6  
2 4NSW PRO B 2 ? UNP Q15027 ? ? 'EXPRESSION TAG' -3 7  
2 4NSW LEU B 3 ? UNP Q15027 ? ? 'EXPRESSION TAG' -2 8  
2 4NSW GLY B 4 ? UNP Q15027 ? ? 'EXPRESSION TAG' -1 9  
2 4NSW SER B 5 ? UNP Q15027 ? ? 'EXPRESSION TAG' 0  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4NSW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   50.45 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'0.2M AMMONIUM CITRATE, 10% PEG3350, 6.0MM OCTYL BETA-THIOGLUCOPYRANOSIDE, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 315r' 2009-06-07 ? 
2 CCD 'ADSC QUANTUM 270'  2009-06-09 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'SI(111) DOUBLE CRYSTAL'                     'SINGLE WAVELENGTH' x-ray 
2 1 M 'NUMERICAL LINK TYPE SI(111) DOUBLE CRYSTAL' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.00000 1.0 
2 0.97900 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'PHOTON FACTORY BEAMLINE BL-5A'  'Photon Factory' BL-5A  1.00000 1.00000 
2 SYNCHROTRON 'PHOTON FACTORY BEAMLINE BL-17A' 'Photon Factory' BL-17A 0.97900 0.97900 
# 
_reflns.entry_id                     4NSW 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             29.850 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   41826 
_reflns.number_all                   43164 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.08200 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.3000 
_reflns.B_iso_Wilson_estimate        40.90 
_reflns.pdbx_redundancy              3.600 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high                  2.20 
_reflns_shell.d_res_low                   2.24 
_reflns_shell.percent_possible_all        95.6 
_reflns_shell.Rmerge_I_obs                0.41800 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         3.960 
_reflns_shell.pdbx_redundancy             3.20 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1,2 
# 
_refine.entry_id                                 4NSW 
_refine.ls_number_reflns_obs                     39141 
_refine.ls_number_reflns_all                     41114 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.85 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    95.2 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_all                          0.214 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2059 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.914 
_refine.B_iso_mean                               56.373 
_refine.aniso_B[1][1]                            -1.57000 
_refine.aniso_B[2][2]                            3.62000 
_refine.aniso_B[3][3]                            -2.15000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -2.20000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.302 
_refine.pdbx_overall_ESU_R_Free                  0.236 
_refine.overall_SU_ML                            0.179 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             15.900 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5839 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             146 
_refine_hist.number_atoms_total               5985 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        29.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.013  0.022  ? 5935 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.459  1.968  ? 7986 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 6.026  5.000  ? 728  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 36.279 23.186 ? 295  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 20.492 15.000 ? 1114 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 19.053 15.000 ? 66   ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.102  0.200  ? 884  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.006  0.021  ? 4461 ? 'X-RAY DIFFRACTION' 
r_mcbond_it            0.670  1.500  ? 3630 ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1.284  2.000  ? 5808 ? 'X-RAY DIFFRACTION' 
r_scbond_it            2.227  3.000  ? 2305 ? 'X-RAY DIFFRACTION' 
r_scangle_it           3.728  4.500  ? 2178 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.26 
_refine_ls_shell.number_reflns_R_work             2649 
_refine_ls_shell.R_factor_R_work                  0.2780 
_refine_ls_shell.percent_reflns_obs               89.25 
_refine_ls_shell.R_factor_R_free                  0.3390 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             156 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4NSW 
_struct.title                     'Crystal structure of the BAR-PH domain of ACAP1' 
_struct.pdbx_descriptor           'Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4NSW 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            'COILED-COIL, BAR DOMAIN, PH DOMAIN, GTPASE ACTIVATION, PROTEIN TRANSPORT, membrane remodeling' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 11  ? ASP A 18  ? ASP A 6   ASP A 13  1 ? 8  
HELX_P HELX_P2  2  SER A 19  ? LEU A 74  ? SER A 14  LEU A 69  1 ? 56 
HELX_P HELX_P3  3  GLU A 78  ? LYS A 119 ? GLU A 73  LYS A 114 1 ? 42 
HELX_P HELX_P4  4  LEU A 122 ? VAL A 149 ? LEU A 117 VAL A 144 1 ? 28 
HELX_P HELX_P5  5  ARG A 153 ? LEU A 218 ? ARG A 148 LEU A 213 1 ? 66 
HELX_P HELX_P6  6  LEU A 218 ? GLU A 254 ? LEU A 213 GLU A 249 1 ? 37 
HELX_P HELX_P7  7  ASP A 316 ? ARG A 318 ? ASP A 311 ARG A 313 5 ? 3  
HELX_P HELX_P8  8  SER A 349 ? ALA A 367 ? SER A 344 ALA A 362 1 ? 19 
HELX_P HELX_P9  9  ASP B 11  ? ASP B 18  ? ASP B 6   ASP B 13  1 ? 8  
HELX_P HELX_P10 10 SER B 19  ? ARG B 73  ? SER B 14  ARG B 68  1 ? 55 
HELX_P HELX_P11 11 GLU B 78  ? GLN B 113 ? GLU B 73  GLN B 108 1 ? 36 
HELX_P HELX_P12 12 GLN B 113 ? LYS B 119 ? GLN B 108 LYS B 114 1 ? 7  
HELX_P HELX_P13 13 LEU B 122 ? VAL B 149 ? LEU B 117 VAL B 144 1 ? 28 
HELX_P HELX_P14 14 GLN B 155 ? LEU B 218 ? GLN B 150 LEU B 213 1 ? 64 
HELX_P HELX_P15 15 LEU B 218 ? GLU B 254 ? LEU B 213 GLU B 249 1 ? 37 
HELX_P HELX_P16 16 ASP B 316 ? CYS B 320 ? ASP B 311 CYS B 315 5 ? 5  
HELX_P HELX_P17 17 SER B 349 ? ILE B 364 ? SER B 344 ILE B 359 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 263 ? ARG A 265 ? SER A 258 ARG A 260 
A 2 VAL A 272 ? ARG A 280 ? VAL A 267 ARG A 275 
A 3 TRP A 288 ? GLN A 296 ? TRP A 283 GLN A 291 
A 4 GLN A 299 ? GLN A 303 ? GLN A 294 GLN A 298 
A 5 THR A 311 ? VAL A 314 ? THR A 306 VAL A 309 
B 1 SER A 263 ? ARG A 265 ? SER A 258 ARG A 260 
B 2 VAL A 272 ? ARG A 280 ? VAL A 267 ARG A 275 
B 3 SER A 342 ? GLN A 346 ? SER A 337 GLN A 341 
B 4 CYS A 333 ? SER A 338 ? CYS A 328 SER A 333 
B 5 CYS A 320 ? LEU A 324 ? CYS A 315 LEU A 319 
C 1 ARG B 265 ? GLY B 267 ? ARG B 260 GLY B 262 
C 2 GLY B 270 ? ARG B 280 ? GLY B 265 ARG B 275 
C 3 TRP B 288 ? GLN B 296 ? TRP B 283 GLN B 291 
C 4 GLN B 299 ? GLN B 303 ? GLN B 294 GLN B 298 
C 5 THR B 311 ? VAL B 314 ? THR B 306 VAL B 309 
D 1 ARG B 265 ? GLY B 267 ? ARG B 260 GLY B 262 
D 2 GLY B 270 ? ARG B 280 ? GLY B 265 ARG B 275 
D 3 SER B 342 ? GLN B 346 ? SER B 337 GLN B 341 
D 4 CYS B 333 ? VAL B 337 ? CYS B 328 VAL B 332 
D 5 THR B 321 ? LEU B 324 ? THR B 316 LEU B 319 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 263 ? N SER A 258 O GLU A 274 ? O GLU A 269 
A 2 3 N MET A 273 ? N MET A 268 O ILE A 295 ? O ILE A 290 
A 3 4 N TRP A 292 ? N TRP A 287 O GLN A 303 ? O GLN A 298 
A 4 5 N LEU A 300 ? N LEU A 295 O VAL A 313 ? O VAL A 308 
B 1 2 N SER A 263 ? N SER A 258 O GLU A 274 ? O GLU A 269 
B 2 3 N PHE A 278 ? N PHE A 273 O GLN A 346 ? O GLN A 341 
B 3 4 O LEU A 345 ? O LEU A 340 N PHE A 334 ? N PHE A 329 
B 4 5 O GLU A 335 ? O GLU A 330 N LYS A 323 ? N LYS A 318 
C 1 2 N ARG B 265 ? N ARG B 260 O VAL B 272 ? O VAL B 267 
C 2 3 N MET B 273 ? N MET B 268 O ILE B 295 ? O ILE B 290 
C 3 4 N THR B 294 ? N THR B 289 O VAL B 301 ? O VAL B 296 
C 4 5 N TYR B 302 ? N TYR B 297 O THR B 311 ? O THR B 306 
D 1 2 N ARG B 265 ? N ARG B 260 O VAL B 272 ? O VAL B 267 
D 2 3 N PHE B 278 ? N PHE B 273 O GLN B 346 ? O GLN B 341 
D 3 4 O LEU B 345 ? O LEU B 340 N PHE B 334 ? N PHE B 329 
D 4 5 O GLU B 335 ? O GLU B 330 N LYS B 323 ? N LYS B 318 
# 
_database_PDB_matrix.entry_id          4NSW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4NSW 
_atom_sites.fract_transf_matrix[1][1]   0.023552 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000576 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016745 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005921 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 2   ? -29.378 20.531  20.367  1.00 96.44  ? -3  PRO A N   1 
ATOM   2    C CA  . PRO A 1 2   ? -29.399 19.127  19.932  1.00 91.82  ? -3  PRO A CA  1 
ATOM   3    C C   . PRO A 1 2   ? -28.805 18.948  18.527  1.00 91.71  ? -3  PRO A C   1 
ATOM   4    O O   . PRO A 1 2   ? -28.581 19.941  17.820  1.00 95.63  ? -3  PRO A O   1 
ATOM   5    C CB  . PRO A 1 2   ? -30.898 18.771  19.947  1.00 90.45  ? -3  PRO A CB  1 
ATOM   6    C CG  . PRO A 1 2   ? -31.650 20.085  20.324  1.00 94.84  ? -3  PRO A CG  1 
ATOM   7    C CD  . PRO A 1 2   ? -30.673 21.202  20.158  1.00 98.39  ? -3  PRO A CD  1 
ATOM   8    N N   . LEU A 1 3   ? -28.529 17.702  18.144  1.00 87.77  ? -2  LEU A N   1 
ATOM   9    C CA  . LEU A 1 3   ? -28.089 17.374  16.780  1.00 87.60  ? -2  LEU A CA  1 
ATOM   10   C C   . LEU A 1 3   ? -28.562 15.981  16.355  1.00 83.58  ? -2  LEU A C   1 
ATOM   11   O O   . LEU A 1 3   ? -28.591 15.057  17.174  1.00 80.66  ? -2  LEU A O   1 
ATOM   12   C CB  . LEU A 1 3   ? -26.559 17.401  16.646  1.00 88.75  ? -2  LEU A CB  1 
ATOM   13   C CG  . LEU A 1 3   ? -25.611 18.484  17.165  1.00 92.39  ? -2  LEU A CG  1 
ATOM   14   C CD1 . LEU A 1 3   ? -25.233 18.241  18.630  1.00 91.26  ? -2  LEU A CD1 1 
ATOM   15   C CD2 . LEU A 1 3   ? -24.358 18.525  16.287  1.00 93.96  ? -2  LEU A CD2 1 
ATOM   16   N N   . GLY A 1 4   ? -28.913 15.830  15.075  1.00 83.47  ? -1  GLY A N   1 
ATOM   17   C CA  . GLY A 1 4   ? -29.158 14.501  14.489  1.00 79.86  ? -1  GLY A CA  1 
ATOM   18   C C   . GLY A 1 4   ? -27.854 13.752  14.214  1.00 78.40  ? -1  GLY A C   1 
ATOM   19   O O   . GLY A 1 4   ? -26.791 14.390  14.121  1.00 80.54  ? -1  GLY A O   1 
ATOM   20   N N   . SER A 1 5   ? -27.936 12.418  14.074  1.00 74.56  ? 0   SER A N   1 
ATOM   21   C CA  . SER A 1 5   ? -26.764 11.554  13.804  1.00 73.08  ? 0   SER A CA  1 
ATOM   22   C C   . SER A 1 5   ? -27.088 10.074  13.468  1.00 70.01  ? 0   SER A C   1 
ATOM   23   O O   . SER A 1 5   ? -26.521 9.501   12.528  1.00 70.49  ? 0   SER A O   1 
ATOM   24   C CB  . SER A 1 5   ? -25.802 11.602  14.984  1.00 72.54  ? 0   SER A CB  1 
ATOM   25   O OG  . SER A 1 5   ? -25.320 10.306  15.282  1.00 70.74  ? 0   SER A OG  1 
ATOM   26   N N   . MET A 1 6   ? -27.916 9.446   14.305  1.00 66.30  ? 1   MET A N   1 
ATOM   27   C CA  . MET A 1 6   ? -28.689 8.262   13.918  1.00 63.35  ? 1   MET A CA  1 
ATOM   28   C C   . MET A 1 6   ? -30.050 8.782   13.478  1.00 62.81  ? 1   MET A C   1 
ATOM   29   O O   . MET A 1 6   ? -30.798 8.094   12.790  1.00 62.29  ? 1   MET A O   1 
ATOM   30   C CB  . MET A 1 6   ? -28.894 7.305   15.093  1.00 60.98  ? 1   MET A CB  1 
ATOM   31   C CG  . MET A 1 6   ? -27.651 6.561   15.600  1.00 60.69  ? 1   MET A CG  1 
ATOM   32   S SD  . MET A 1 6   ? -28.151 5.199   16.692  1.00 59.18  ? 1   MET A SD  1 
ATOM   33   C CE  . MET A 1 6   ? -27.167 5.456   18.149  1.00 53.22  ? 1   MET A CE  1 
ATOM   34   N N   . THR A 1 7   ? -30.358 10.010  13.892  1.00 62.87  ? 2   THR A N   1 
ATOM   35   C CA  . THR A 1 7   ? -31.618 10.667  13.558  1.00 62.74  ? 2   THR A CA  1 
ATOM   36   C C   . THR A 1 7   ? -31.479 11.608  12.376  1.00 64.36  ? 2   THR A C   1 
ATOM   37   O O   . THR A 1 7   ? -32.484 12.181  11.936  1.00 65.18  ? 2   THR A O   1 
ATOM   38   C CB  . THR A 1 7   ? -32.181 11.572  14.702  1.00 63.35  ? 2   THR A CB  1 
ATOM   39   O OG1 . THR A 1 7   ? -31.378 11.500  15.887  1.00 62.86  ? 2   THR A OG1 1 
ATOM   40   C CG2 . THR A 1 7   ? -33.619 11.206  14.993  1.00 62.44  ? 2   THR A CG2 1 
ATOM   41   N N   . VAL A 1 8   ? -30.250 11.802  11.890  1.00 64.00  ? 3   VAL A N   1 
ATOM   42   C CA  . VAL A 1 8   ? -30.009 12.820  10.850  1.00 66.14  ? 3   VAL A CA  1 
ATOM   43   C C   . VAL A 1 8   ? -30.689 12.450  9.523   1.00 65.24  ? 3   VAL A C   1 
ATOM   44   O O   . VAL A 1 8   ? -31.089 13.311  8.749   1.00 67.80  ? 3   VAL A O   1 
ATOM   45   C CB  . VAL A 1 8   ? -28.478 13.140  10.662  1.00 67.96  ? 3   VAL A CB  1 
ATOM   46   C CG1 . VAL A 1 8   ? -27.695 11.912  10.146  1.00 67.45  ? 3   VAL A CG1 1 
ATOM   47   C CG2 . VAL A 1 8   ? -28.275 14.363  9.756   1.00 72.27  ? 3   VAL A CG2 1 
ATOM   48   N N   . LYS A 1 9   ? -30.828 11.149  9.303   1.00 61.68  ? 4   LYS A N   1 
ATOM   49   C CA  . LYS A 1 9   ? -31.301 10.589  8.043   1.00 61.31  ? 4   LYS A CA  1 
ATOM   50   C C   . LYS A 1 9   ? -32.807 10.318  8.064   1.00 58.31  ? 4   LYS A C   1 
ATOM   51   O O   . LYS A 1 9   ? -33.464 10.368  7.009   1.00 59.32  ? 4   LYS A O   1 
ATOM   52   C CB  . LYS A 1 9   ? -30.523 9.303   7.757   1.00 61.34  ? 4   LYS A CB  1 
ATOM   53   C CG  . LYS A 1 9   ? -29.639 8.899   8.964   1.00 61.25  ? 4   LYS A CG  1 
ATOM   54   C CD  . LYS A 1 9   ? -29.556 7.409   9.159   1.00 62.20  ? 4   LYS A CD  1 
ATOM   55   C CE  . LYS A 1 9   ? -28.626 7.094   10.328  1.00 62.37  ? 4   LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 9   ? -28.205 5.660   10.298  1.00 61.97  ? 4   LYS A NZ  1 
ATOM   57   N N   . LEU A 1 10  ? -33.353 10.056  9.255   1.00 52.90  ? 5   LEU A N   1 
ATOM   58   C CA  . LEU A 1 10  ? -34.770 9.778   9.374   1.00 49.68  ? 5   LEU A CA  1 
ATOM   59   C C   . LEU A 1 10  ? -35.581 10.968  8.857   1.00 50.03  ? 5   LEU A C   1 
ATOM   60   O O   . LEU A 1 10  ? -35.340 12.114  9.233   1.00 51.64  ? 5   LEU A O   1 
ATOM   61   C CB  . LEU A 1 10  ? -35.149 9.427   10.804  1.00 47.44  ? 5   LEU A CB  1 
ATOM   62   C CG  . LEU A 1 10  ? -34.920 8.027   11.365  1.00 46.70  ? 5   LEU A CG  1 
ATOM   63   C CD1 . LEU A 1 10  ? -36.103 7.682   12.243  1.00 47.32  ? 5   LEU A CD1 1 
ATOM   64   C CD2 . LEU A 1 10  ? -34.762 6.929   10.328  1.00 47.22  ? 5   LEU A CD2 1 
ATOM   65   N N   . ASP A 1 11  ? -36.507 10.686  7.953   1.00 47.57  ? 6   ASP A N   1 
ATOM   66   C CA  . ASP A 1 11  ? -37.255 11.730  7.273   1.00 47.98  ? 6   ASP A CA  1 
ATOM   67   C C   . ASP A 1 11  ? -38.722 11.357  7.387   1.00 45.10  ? 6   ASP A C   1 
ATOM   68   O O   . ASP A 1 11  ? -39.127 10.293  6.910   1.00 43.52  ? 6   ASP A O   1 
ATOM   69   C CB  . ASP A 1 11  ? -36.807 11.856  5.803   1.00 50.18  ? 6   ASP A CB  1 
ATOM   70   C CG  . ASP A 1 11  ? -37.415 13.062  5.091   1.00 52.82  ? 6   ASP A CG  1 
ATOM   71   O OD1 . ASP A 1 11  ? -36.687 13.713  4.320   1.00 59.54  ? 6   ASP A OD1 1 
ATOM   72   O OD2 . ASP A 1 11  ? -38.616 13.373  5.270   1.00 54.33  ? 6   ASP A OD2 1 
ATOM   73   N N   . PHE A 1 12  ? -39.489 12.190  8.083   1.00 44.04  ? 7   PHE A N   1 
ATOM   74   C CA  . PHE A 1 12  ? -40.908 11.925  8.299   1.00 43.25  ? 7   PHE A CA  1 
ATOM   75   C C   . PHE A 1 12  ? -41.717 11.833  6.988   1.00 43.82  ? 7   PHE A C   1 
ATOM   76   O O   . PHE A 1 12  ? -42.598 10.985  6.850   1.00 42.73  ? 7   PHE A O   1 
ATOM   77   C CB  . PHE A 1 12  ? -41.541 12.945  9.258   1.00 44.12  ? 7   PHE A CB  1 
ATOM   78   C CG  . PHE A 1 12  ? -42.921 12.558  9.715   1.00 44.00  ? 7   PHE A CG  1 
ATOM   79   C CD1 . PHE A 1 12  ? -43.177 11.278  10.188  1.00 45.64  ? 7   PHE A CD1 1 
ATOM   80   C CD2 . PHE A 1 12  ? -43.968 13.463  9.658   1.00 50.19  ? 7   PHE A CD2 1 
ATOM   81   C CE1 . PHE A 1 12  ? -44.471 10.904  10.603  1.00 47.85  ? 7   PHE A CE1 1 
ATOM   82   C CE2 . PHE A 1 12  ? -45.264 13.102  10.072  1.00 50.79  ? 7   PHE A CE2 1 
ATOM   83   C CZ  . PHE A 1 12  ? -45.506 11.829  10.563  1.00 46.88  ? 7   PHE A CZ  1 
ATOM   84   N N   . GLU A 1 13  ? -41.393 12.663  6.011   1.00 46.38  ? 8   GLU A N   1 
ATOM   85   C CA  . GLU A 1 13  ? -42.074 12.565  4.712   1.00 47.95  ? 8   GLU A CA  1 
ATOM   86   C C   . GLU A 1 13  ? -41.860 11.214  4.013   1.00 45.96  ? 8   GLU A C   1 
ATOM   87   O O   . GLU A 1 13  ? -42.805 10.619  3.505   1.00 44.76  ? 8   GLU A O   1 
ATOM   88   C CB  . GLU A 1 13  ? -41.666 13.706  3.800   1.00 51.75  ? 8   GLU A CB  1 
ATOM   89   C CG  . GLU A 1 13  ? -42.583 14.900  3.902   1.00 58.40  ? 8   GLU A CG  1 
ATOM   90   C CD  . GLU A 1 13  ? -44.052 14.549  3.652   1.00 62.03  ? 8   GLU A CD  1 
ATOM   91   O OE1 . GLU A 1 13  ? -44.394 14.075  2.539   1.00 63.66  ? 8   GLU A OE1 1 
ATOM   92   O OE2 . GLU A 1 13  ? -44.858 14.755  4.578   1.00 63.08  ? 8   GLU A OE2 1 
ATOM   93   N N   . GLU A 1 14  ? -40.623 10.733  4.024   1.00 45.19  ? 9   GLU A N   1 
ATOM   94   C CA  . GLU A 1 14  ? -40.300 9.430   3.468   1.00 45.15  ? 9   GLU A CA  1 
ATOM   95   C C   . GLU A 1 14  ? -41.020 8.296   4.207   1.00 42.11  ? 9   GLU A C   1 
ATOM   96   O O   . GLU A 1 14  ? -41.438 7.338   3.612   1.00 41.50  ? 9   GLU A O   1 
ATOM   97   C CB  . GLU A 1 14  ? -38.779 9.207   3.451   1.00 45.81  ? 9   GLU A CB  1 
ATOM   98   C CG  . GLU A 1 14  ? -38.001 10.200  2.559   1.00 50.95  ? 9   GLU A CG  1 
ATOM   99   C CD  . GLU A 1 14  ? -38.496 10.261  1.101   1.00 56.65  ? 9   GLU A CD  1 
ATOM   100  O OE1 . GLU A 1 14  ? -38.790 9.204   0.503   1.00 57.33  ? 9   GLU A OE1 1 
ATOM   101  O OE2 . GLU A 1 14  ? -38.570 11.383  0.536   1.00 60.83  ? 9   GLU A OE2 1 
ATOM   102  N N   . CYS A 1 15  ? -41.193 8.434   5.504   1.00 41.31  ? 10  CYS A N   1 
ATOM   103  C CA  . CYS A 1 15  ? -41.925 7.441   6.282   1.00 40.12  ? 10  CYS A CA  1 
ATOM   104  C C   . CYS A 1 15  ? -43.389 7.386   5.867   1.00 40.35  ? 10  CYS A C   1 
ATOM   105  O O   . CYS A 1 15  ? -43.941 6.295   5.712   1.00 39.79  ? 10  CYS A O   1 
ATOM   106  C CB  . CYS A 1 15  ? -41.755 7.691   7.794   1.00 38.87  ? 10  CYS A CB  1 
ATOM   107  S SG  . CYS A 1 15  ? -43.002 6.914   8.856   1.00 39.41  ? 10  CYS A SG  1 
ATOM   108  N N   . LEU A 1 16  ? -44.001 8.557   5.678   1.00 41.44  ? 11  LEU A N   1 
ATOM   109  C CA  . LEU A 1 16  ? -45.377 8.655   5.197   1.00 41.93  ? 11  LEU A CA  1 
ATOM   110  C C   . LEU A 1 16  ? -45.573 8.115   3.774   1.00 42.80  ? 11  LEU A C   1 
ATOM   111  O O   . LEU A 1 16  ? -46.619 7.562   3.471   1.00 42.23  ? 11  LEU A O   1 
ATOM   112  C CB  . LEU A 1 16  ? -45.903 10.104  5.261   1.00 43.50  ? 11  LEU A CB  1 
ATOM   113  C CG  . LEU A 1 16  ? -46.122 10.768  6.622   1.00 45.91  ? 11  LEU A CG  1 
ATOM   114  C CD1 . LEU A 1 16  ? -46.695 12.200  6.452   1.00 45.54  ? 11  LEU A CD1 1 
ATOM   115  C CD2 . LEU A 1 16  ? -46.995 9.918   7.577   1.00 45.79  ? 11  LEU A CD2 1 
ATOM   116  N N   . LYS A 1 17  ? -44.598 8.303   2.900   1.00 44.69  ? 12  LYS A N   1 
ATOM   117  C CA  . LYS A 1 17  ? -44.637 7.667   1.586   1.00 47.57  ? 12  LYS A CA  1 
ATOM   118  C C   . LYS A 1 17  ? -44.328 6.155   1.648   1.00 46.77  ? 12  LYS A C   1 
ATOM   119  O O   . LYS A 1 17  ? -44.507 5.432   0.656   1.00 48.44  ? 12  LYS A O   1 
ATOM   120  C CB  . LYS A 1 17  ? -43.627 8.318   0.645   1.00 50.41  ? 12  LYS A CB  1 
ATOM   121  C CG  . LYS A 1 17  ? -43.854 9.790   0.318   1.00 53.19  ? 12  LYS A CG  1 
ATOM   122  C CD  . LYS A 1 17  ? -42.474 10.419  0.072   1.00 56.95  ? 12  LYS A CD  1 
ATOM   123  C CE  . LYS A 1 17  ? -42.390 11.182  -1.236  1.00 61.69  ? 12  LYS A CE  1 
ATOM   124  N NZ  . LYS A 1 17  ? -41.088 10.867  -1.905  1.00 64.38  ? 12  LYS A NZ  1 
ATOM   125  N N   . ASP A 1 18  ? -43.875 5.699   2.809   1.00 45.21  ? 13  ASP A N   1 
ATOM   126  C CA  . ASP A 1 18  ? -43.371 4.343   3.015   1.00 45.51  ? 13  ASP A CA  1 
ATOM   127  C C   . ASP A 1 18  ? -42.380 3.990   1.888   1.00 46.67  ? 13  ASP A C   1 
ATOM   128  O O   . ASP A 1 18  ? -42.516 2.980   1.198   1.00 48.21  ? 13  ASP A O   1 
ATOM   129  C CB  . ASP A 1 18  ? -44.538 3.338   3.165   1.00 45.27  ? 13  ASP A CB  1 
ATOM   130  C CG  . ASP A 1 18  ? -44.073 1.948   3.606   1.00 49.74  ? 13  ASP A CG  1 
ATOM   131  O OD1 . ASP A 1 18  ? -42.999 1.848   4.254   1.00 52.22  ? 13  ASP A OD1 1 
ATOM   132  O OD2 . ASP A 1 18  ? -44.766 0.945   3.265   1.00 55.37  ? 13  ASP A OD2 1 
ATOM   133  N N   . SER A 1 19  ? -41.397 4.861   1.682   1.00 46.54  ? 14  SER A N   1 
ATOM   134  C CA  . SER A 1 19  ? -40.538 4.749   0.529   1.00 48.34  ? 14  SER A CA  1 
ATOM   135  C C   . SER A 1 19  ? -39.374 3.816   0.832   1.00 48.00  ? 14  SER A C   1 
ATOM   136  O O   . SER A 1 19  ? -39.045 3.590   1.992   1.00 44.80  ? 14  SER A O   1 
ATOM   137  C CB  . SER A 1 19  ? -40.008 6.121   0.136   1.00 50.10  ? 14  SER A CB  1 
ATOM   138  O OG  . SER A 1 19  ? -39.017 6.550   1.051   1.00 49.77  ? 14  SER A OG  1 
ATOM   139  N N   . PRO A 1 20  ? -38.744 3.279   -0.222  1.00 50.66  ? 15  PRO A N   1 
ATOM   140  C CA  . PRO A 1 20  ? -37.570 2.429   -0.076  1.00 51.09  ? 15  PRO A CA  1 
ATOM   141  C C   . PRO A 1 20  ? -36.416 3.131   0.637   1.00 51.10  ? 15  PRO A C   1 
ATOM   142  O O   . PRO A 1 20  ? -35.660 2.487   1.357   1.00 50.71  ? 15  PRO A O   1 
ATOM   143  C CB  . PRO A 1 20  ? -37.172 2.135   -1.532  1.00 54.57  ? 15  PRO A CB  1 
ATOM   144  C CG  . PRO A 1 20  ? -38.399 2.356   -2.332  1.00 54.76  ? 15  PRO A CG  1 
ATOM   145  C CD  . PRO A 1 20  ? -39.194 3.377   -1.630  1.00 52.62  ? 15  PRO A CD  1 
ATOM   146  N N   . ARG A 1 21  ? -36.272 4.430   0.409   1.00 52.22  ? 16  ARG A N   1 
ATOM   147  C CA  . ARG A 1 21  ? -35.260 5.247   1.074   1.00 51.94  ? 16  ARG A CA  1 
ATOM   148  C C   . ARG A 1 21  ? -35.545 5.323   2.588   1.00 47.89  ? 16  ARG A C   1 
ATOM   149  O O   . ARG A 1 21  ? -34.625 5.265   3.407   1.00 46.64  ? 16  ARG A O   1 
ATOM   150  C CB  . ARG A 1 21  ? -35.273 6.633   0.441   1.00 54.63  ? 16  ARG A CB  1 
ATOM   151  C CG  . ARG A 1 21  ? -34.381 7.655   1.058   1.00 57.22  ? 16  ARG A CG  1 
ATOM   152  C CD  . ARG A 1 21  ? -34.852 9.047   0.658   1.00 63.35  ? 16  ARG A CD  1 
ATOM   153  N NE  . ARG A 1 21  ? -34.629 9.361   -0.759  1.00 70.76  ? 16  ARG A NE  1 
ATOM   154  C CZ  . ARG A 1 21  ? -33.436 9.654   -1.277  1.00 76.04  ? 16  ARG A CZ  1 
ATOM   155  N NH1 . ARG A 1 21  ? -32.357 9.648   -0.494  1.00 75.54  ? 16  ARG A NH1 1 
ATOM   156  N NH2 . ARG A 1 21  ? -33.318 9.946   -2.574  1.00 80.66  ? 16  ARG A NH2 1 
ATOM   157  N N   . PHE A 1 22  ? -36.817 5.448   2.956   1.00 45.78  ? 17  PHE A N   1 
ATOM   158  C CA  . PHE A 1 22  ? -37.203 5.315   4.353   1.00 42.20  ? 17  PHE A CA  1 
ATOM   159  C C   . PHE A 1 22  ? -36.793 3.943   4.896   1.00 41.41  ? 17  PHE A C   1 
ATOM   160  O O   . PHE A 1 22  ? -36.131 3.865   5.923   1.00 40.25  ? 17  PHE A O   1 
ATOM   161  C CB  . PHE A 1 22  ? -38.701 5.535   4.566   1.00 41.22  ? 17  PHE A CB  1 
ATOM   162  C CG  . PHE A 1 22  ? -39.156 5.240   5.980   1.00 38.92  ? 17  PHE A CG  1 
ATOM   163  C CD1 . PHE A 1 22  ? -38.650 5.977   7.059   1.00 36.90  ? 17  PHE A CD1 1 
ATOM   164  C CD2 . PHE A 1 22  ? -40.065 4.217   6.230   1.00 36.93  ? 17  PHE A CD2 1 
ATOM   165  C CE1 . PHE A 1 22  ? -39.052 5.700   8.374   1.00 35.59  ? 17  PHE A CE1 1 
ATOM   166  C CE2 . PHE A 1 22  ? -40.487 3.935   7.529   1.00 36.59  ? 17  PHE A CE2 1 
ATOM   167  C CZ  . PHE A 1 22  ? -39.982 4.689   8.609   1.00 35.75  ? 17  PHE A CZ  1 
ATOM   168  N N   . ARG A 1 23  ? -37.165 2.863   4.214   1.00 42.12  ? 18  ARG A N   1 
ATOM   169  C CA  . ARG A 1 23  ? -36.742 1.519   4.635   1.00 41.72  ? 18  ARG A CA  1 
ATOM   170  C C   . ARG A 1 23  ? -35.211 1.404   4.827   1.00 41.82  ? 18  ARG A C   1 
ATOM   171  O O   . ARG A 1 23  ? -34.744 0.906   5.843   1.00 39.30  ? 18  ARG A O   1 
ATOM   172  C CB  . ARG A 1 23  ? -37.272 0.451   3.667   1.00 43.81  ? 18  ARG A CB  1 
ATOM   173  C CG  . ARG A 1 23  ? -38.821 0.319   3.660   1.00 44.46  ? 18  ARG A CG  1 
ATOM   174  C CD  . ARG A 1 23  ? -39.365 -0.188  5.004   1.00 46.96  ? 18  ARG A CD  1 
ATOM   175  N NE  . ARG A 1 23  ? -40.814 -0.386  4.929   1.00 48.68  ? 18  ARG A NE  1 
ATOM   176  C CZ  . ARG A 1 23  ? -41.397 -1.403  4.299   1.00 49.56  ? 18  ARG A CZ  1 
ATOM   177  N NH1 . ARG A 1 23  ? -40.657 -2.334  3.711   1.00 54.14  ? 18  ARG A NH1 1 
ATOM   178  N NH2 . ARG A 1 23  ? -42.713 -1.493  4.270   1.00 48.91  ? 18  ARG A NH2 1 
ATOM   179  N N   . ALA A 1 24  ? -34.451 1.875   3.836   1.00 44.49  ? 19  ALA A N   1 
ATOM   180  C CA  . ALA A 1 24  ? -32.996 1.943   3.874   1.00 45.50  ? 19  ALA A CA  1 
ATOM   181  C C   . ALA A 1 24  ? -32.470 2.701   5.086   1.00 44.19  ? 19  ALA A C   1 
ATOM   182  O O   . ALA A 1 24  ? -31.509 2.301   5.702   1.00 44.63  ? 19  ALA A O   1 
ATOM   183  C CB  . ALA A 1 24  ? -32.487 2.596   2.606   1.00 48.92  ? 19  ALA A CB  1 
ATOM   184  N N   . SER A 1 25  ? -33.100 3.805   5.445   1.00 44.49  ? 20  SER A N   1 
ATOM   185  C CA  . SER A 1 25  ? -32.585 4.584   6.537   1.00 43.00  ? 20  SER A CA  1 
ATOM   186  C C   . SER A 1 25  ? -32.809 3.846   7.874   1.00 40.55  ? 20  SER A C   1 
ATOM   187  O O   . SER A 1 25  ? -31.987 3.958   8.789   1.00 40.23  ? 20  SER A O   1 
ATOM   188  C CB  . SER A 1 25  ? -33.227 5.957   6.521   1.00 43.78  ? 20  SER A CB  1 
ATOM   189  O OG  . SER A 1 25  ? -34.578 5.856   6.952   1.00 44.70  ? 20  SER A OG  1 
ATOM   190  N N   . ILE A 1 26  ? -33.901 3.086   7.986   1.00 38.65  ? 21  ILE A N   1 
ATOM   191  C CA  . ILE A 1 26  ? -34.136 2.225   9.146   1.00 36.76  ? 21  ILE A CA  1 
ATOM   192  C C   . ILE A 1 26  ? -33.093 1.073   9.217   1.00 37.08  ? 21  ILE A C   1 
ATOM   193  O O   . ILE A 1 26  ? -32.525 0.781   10.278  1.00 36.54  ? 21  ILE A O   1 
ATOM   194  C CB  . ILE A 1 26  ? -35.590 1.666   9.168   1.00 35.30  ? 21  ILE A CB  1 
ATOM   195  C CG1 . ILE A 1 26  ? -36.621 2.769   9.451   1.00 37.00  ? 21  ILE A CG1 1 
ATOM   196  C CG2 . ILE A 1 26  ? -35.716 0.541   10.183  1.00 33.44  ? 21  ILE A CG2 1 
ATOM   197  C CD1 . ILE A 1 26  ? -36.631 3.310   10.920  1.00 34.46  ? 21  ILE A CD1 1 
ATOM   198  N N   . GLU A 1 27  ? -32.845 0.427   8.097   1.00 39.04  ? 22  GLU A N   1 
ATOM   199  C CA  . GLU A 1 27  ? -31.773 -0.570  8.027   1.00 41.50  ? 22  GLU A CA  1 
ATOM   200  C C   . GLU A 1 27  ? -30.378 -0.001  8.364   1.00 40.93  ? 22  GLU A C   1 
ATOM   201  O O   . GLU A 1 27  ? -29.549 -0.725  8.920   1.00 40.01  ? 22  GLU A O   1 
ATOM   202  C CB  . GLU A 1 27  ? -31.771 -1.316  6.671   1.00 43.70  ? 22  GLU A CB  1 
ATOM   203  C CG  . GLU A 1 27  ? -32.911 -2.350  6.596   1.00 47.36  ? 22  GLU A CG  1 
ATOM   204  C CD  . GLU A 1 27  ? -33.181 -2.912  5.194   1.00 54.39  ? 22  GLU A CD  1 
ATOM   205  O OE1 . GLU A 1 27  ? -32.218 -3.255  4.451   1.00 58.99  ? 22  GLU A OE1 1 
ATOM   206  O OE2 . GLU A 1 27  ? -34.381 -3.027  4.844   1.00 55.92  ? 22  GLU A OE2 1 
ATOM   207  N N   . LEU A 1 28  ? -30.115 1.276   8.070   1.00 41.61  ? 23  LEU A N   1 
ATOM   208  C CA  . LEU A 1 28  ? -28.776 1.791   8.407   1.00 42.75  ? 23  LEU A CA  1 
ATOM   209  C C   . LEU A 1 28  ? -28.647 2.017   9.899   1.00 39.94  ? 23  LEU A C   1 
ATOM   210  O O   . LEU A 1 28  ? -27.602 1.728   10.460  1.00 39.48  ? 23  LEU A O   1 
ATOM   211  C CB  . LEU A 1 28  ? -28.312 3.013   7.595   1.00 44.96  ? 23  LEU A CB  1 
ATOM   212  C CG  . LEU A 1 28  ? -26.866 2.806   7.046   1.00 50.60  ? 23  LEU A CG  1 
ATOM   213  C CD1 . LEU A 1 28  ? -26.786 3.044   5.546   1.00 57.39  ? 23  LEU A CD1 1 
ATOM   214  C CD2 . LEU A 1 28  ? -25.689 3.542   7.768   1.00 52.83  ? 23  LEU A CD2 1 
ATOM   215  N N   . VAL A 1 29  ? -29.720 2.484   10.533  1.00 37.25  ? 24  VAL A N   1 
ATOM   216  C CA  . VAL A 1 29  ? -29.724 2.674   11.975  1.00 35.06  ? 24  VAL A CA  1 
ATOM   217  C C   . VAL A 1 29  ? -29.522 1.357   12.678  1.00 33.71  ? 24  VAL A C   1 
ATOM   218  O O   . VAL A 1 29  ? -28.776 1.302   13.644  1.00 33.15  ? 24  VAL A O   1 
ATOM   219  C CB  . VAL A 1 29  ? -31.018 3.383   12.499  1.00 34.08  ? 24  VAL A CB  1 
ATOM   220  C CG1 . VAL A 1 29  ? -31.049 3.444   14.027  1.00 33.32  ? 24  VAL A CG1 1 
ATOM   221  C CG2 . VAL A 1 29  ? -31.084 4.777   11.962  1.00 34.47  ? 24  VAL A CG2 1 
ATOM   222  N N   . GLU A 1 30  ? -30.174 0.309   12.175  1.00 33.11  ? 25  GLU A N   1 
ATOM   223  C CA  . GLU A 1 30  ? -30.062 -1.052  12.717  1.00 31.94  ? 25  GLU A CA  1 
ATOM   224  C C   . GLU A 1 30  ? -28.642 -1.645  12.577  1.00 32.41  ? 25  GLU A C   1 
ATOM   225  O O   . GLU A 1 30  ? -28.159 -2.296  13.491  1.00 31.51  ? 25  GLU A O   1 
ATOM   226  C CB  . GLU A 1 30  ? -31.138 -1.985  12.099  1.00 31.96  ? 25  GLU A CB  1 
ATOM   227  C CG  . GLU A 1 30  ? -32.598 -1.611  12.509  1.00 34.14  ? 25  GLU A CG  1 
ATOM   228  C CD  . GLU A 1 30  ? -33.694 -2.467  11.823  1.00 35.54  ? 25  GLU A CD  1 
ATOM   229  O OE1 . GLU A 1 30  ? -34.883 -2.264  12.126  1.00 37.91  ? 25  GLU A OE1 1 
ATOM   230  O OE2 . GLU A 1 30  ? -33.388 -3.338  10.995  1.00 38.02  ? 25  GLU A OE2 1 
ATOM   231  N N   . ALA A 1 31  ? -27.992 -1.433  11.438  1.00 33.08  ? 26  ALA A N   1 
ATOM   232  C CA  . ALA A 1 31  ? -26.578 -1.712  11.327  1.00 34.75  ? 26  ALA A CA  1 
ATOM   233  C C   . ALA A 1 31  ? -25.732 -0.939  12.375  1.00 34.16  ? 26  ALA A C   1 
ATOM   234  O O   . ALA A 1 31  ? -24.810 -1.490  12.945  1.00 33.67  ? 26  ALA A O   1 
ATOM   235  C CB  . ALA A 1 31  ? -26.065 -1.441  9.895   1.00 36.81  ? 26  ALA A CB  1 
ATOM   236  N N   . GLU A 1 32  ? -26.038 0.324   12.633  1.00 34.65  ? 27  GLU A N   1 
ATOM   237  C CA  . GLU A 1 32  ? -25.248 1.068   13.610  1.00 36.29  ? 27  GLU A CA  1 
ATOM   238  C C   . GLU A 1 32  ? -25.409 0.541   15.042  1.00 34.39  ? 27  GLU A C   1 
ATOM   239  O O   . GLU A 1 32  ? -24.425 0.327   15.735  1.00 35.07  ? 27  GLU A O   1 
ATOM   240  C CB  . GLU A 1 32  ? -25.581 2.557   13.578  1.00 37.11  ? 27  GLU A CB  1 
ATOM   241  C CG  . GLU A 1 32  ? -24.987 3.301   12.395  1.00 45.06  ? 27  GLU A CG  1 
ATOM   242  C CD  . GLU A 1 32  ? -24.974 4.830   12.612  1.00 54.23  ? 27  GLU A CD  1 
ATOM   243  O OE1 . GLU A 1 32  ? -24.881 5.573   11.593  1.00 57.91  ? 27  GLU A OE1 1 
ATOM   244  O OE2 . GLU A 1 32  ? -25.038 5.278   13.801  1.00 54.96  ? 27  GLU A OE2 1 
ATOM   245  N N   . VAL A 1 33  ? -26.650 0.331   15.470  1.00 32.88  ? 28  VAL A N   1 
ATOM   246  C CA  . VAL A 1 33  ? -26.938 -0.228  16.770  1.00 31.95  ? 28  VAL A CA  1 
ATOM   247  C C   . VAL A 1 33  ? -26.349 -1.631  16.955  1.00 32.37  ? 28  VAL A C   1 
ATOM   248  O O   . VAL A 1 33  ? -25.859 -1.991  18.026  1.00 31.18  ? 28  VAL A O   1 
ATOM   249  C CB  . VAL A 1 33  ? -28.441 -0.304  16.991  1.00 31.72  ? 28  VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 33  ? -28.744 -1.128  18.276  1.00 31.03  ? 28  VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 33  ? -29.034 1.114   17.039  1.00 31.31  ? 28  VAL A CG2 1 
ATOM   252  N N   . SER A 1 34  ? -26.417 -2.427  15.910  1.00 33.56  ? 29  SER A N   1 
ATOM   253  C CA  . SER A 1 34  ? -25.837 -3.745  15.976  1.00 36.16  ? 29  SER A CA  1 
ATOM   254  C C   . SER A 1 34  ? -24.293 -3.670  16.097  1.00 36.57  ? 29  SER A C   1 
ATOM   255  O O   . SER A 1 34  ? -23.691 -4.443  16.820  1.00 36.19  ? 29  SER A O   1 
ATOM   256  C CB  . SER A 1 34  ? -26.294 -4.616  14.795  1.00 37.24  ? 29  SER A CB  1 
ATOM   257  O OG  . SER A 1 34  ? -25.393 -5.702  14.639  1.00 42.16  ? 29  SER A OG  1 
ATOM   258  N N   . GLU A 1 35  ? -23.662 -2.712  15.427  1.00 37.58  ? 30  GLU A N   1 
ATOM   259  C CA  . GLU A 1 35  ? -22.241 -2.478  15.659  1.00 38.14  ? 30  GLU A CA  1 
ATOM   260  C C   . GLU A 1 35  ? -21.988 -1.906  17.067  1.00 36.20  ? 30  GLU A C   1 
ATOM   261  O O   . GLU A 1 35  ? -20.964 -2.184  17.674  1.00 35.29  ? 30  GLU A O   1 
ATOM   262  C CB  . GLU A 1 35  ? -21.672 -1.563  14.582  1.00 40.03  ? 30  GLU A CB  1 
ATOM   263  C CG  . GLU A 1 35  ? -20.192 -1.258  14.718  1.00 44.18  ? 30  GLU A CG  1 
ATOM   264  C CD  . GLU A 1 35  ? -19.294 -2.439  14.352  1.00 50.35  ? 30  GLU A CD  1 
ATOM   265  O OE1 . GLU A 1 35  ? -19.756 -3.364  13.644  1.00 55.73  ? 30  GLU A OE1 1 
ATOM   266  O OE2 . GLU A 1 35  ? -18.110 -2.432  14.754  1.00 52.55  ? 30  GLU A OE2 1 
ATOM   267  N N   . LEU A 1 36  ? -22.919 -1.111  17.593  1.00 35.31  ? 31  LEU A N   1 
ATOM   268  C CA  . LEU A 1 36  ? -22.791 -0.621  18.970  1.00 34.50  ? 31  LEU A CA  1 
ATOM   269  C C   . LEU A 1 36  ? -22.827 -1.789  19.945  1.00 33.88  ? 31  LEU A C   1 
ATOM   270  O O   . LEU A 1 36  ? -22.033 -1.823  20.903  1.00 33.72  ? 31  LEU A O   1 
ATOM   271  C CB  . LEU A 1 36  ? -23.892 0.379   19.312  1.00 33.51  ? 31  LEU A CB  1 
ATOM   272  C CG  . LEU A 1 36  ? -23.942 1.361   20.502  1.00 34.06  ? 31  LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 36  ? -25.228 1.319   21.291  1.00 31.36  ? 31  LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 36  ? -22.757 1.440   21.390  1.00 33.33  ? 31  LEU A CD2 1 
ATOM   275  N N   . GLU A 1 37  ? -23.727 -2.739  19.693  1.00 33.01  ? 32  GLU A N   1 
ATOM   276  C CA  . GLU A 1 37  ? -23.828 -3.932  20.529  1.00 33.54  ? 32  GLU A CA  1 
ATOM   277  C C   . GLU A 1 37  ? -22.530 -4.718  20.504  1.00 33.10  ? 32  GLU A C   1 
ATOM   278  O O   . GLU A 1 37  ? -22.088 -5.180  21.523  1.00 33.71  ? 32  GLU A O   1 
ATOM   279  C CB  . GLU A 1 37  ? -24.956 -4.869  20.097  1.00 33.76  ? 32  GLU A CB  1 
ATOM   280  C CG  . GLU A 1 37  ? -26.346 -4.426  20.403  1.00 38.20  ? 32  GLU A CG  1 
ATOM   281  C CD  . GLU A 1 37  ? -27.408 -5.319  19.717  1.00 46.96  ? 32  GLU A CD  1 
ATOM   282  O OE1 . GLU A 1 37  ? -27.035 -6.139  18.817  1.00 50.96  ? 32  GLU A OE1 1 
ATOM   283  O OE2 . GLU A 1 37  ? -28.614 -5.193  20.068  1.00 48.53  ? 32  GLU A OE2 1 
ATOM   284  N N   . THR A 1 38  ? -21.972 -4.902  19.322  1.00 34.21  ? 33  THR A N   1 
ATOM   285  C CA  . THR A 1 38  ? -20.711 -5.641  19.114  1.00 34.83  ? 33  THR A CA  1 
ATOM   286  C C   . THR A 1 38  ? -19.572 -5.015  19.928  1.00 33.29  ? 33  THR A C   1 
ATOM   287  O O   . THR A 1 38  ? -18.853 -5.707  20.618  1.00 32.33  ? 33  THR A O   1 
ATOM   288  C CB  . THR A 1 38  ? -20.378 -5.709  17.634  1.00 36.51  ? 33  THR A CB  1 
ATOM   289  O OG1 . THR A 1 38  ? -21.401 -6.481  16.987  1.00 42.00  ? 33  THR A OG1 1 
ATOM   290  C CG2 . THR A 1 38  ? -18.970 -6.363  17.326  1.00 35.30  ? 33  THR A CG2 1 
ATOM   291  N N   . ARG A 1 39  ? -19.450 -3.697  19.872  1.00 31.44  ? 34  ARG A N   1 
ATOM   292  C CA  . ARG A 1 39  ? -18.358 -3.063  20.546  1.00 30.51  ? 34  ARG A CA  1 
ATOM   293  C C   . ARG A 1 39  ? -18.553 -3.043  22.061  1.00 29.48  ? 34  ARG A C   1 
ATOM   294  O O   . ARG A 1 39  ? -17.579 -3.044  22.825  1.00 28.38  ? 34  ARG A O   1 
ATOM   295  C CB  . ARG A 1 39  ? -18.106 -1.681  19.970  1.00 30.39  ? 34  ARG A CB  1 
ATOM   296  C CG  . ARG A 1 39  ? -17.465 -1.786  18.581  1.00 31.96  ? 34  ARG A CG  1 
ATOM   297  C CD  . ARG A 1 39  ? -17.000 -0.442  18.023  1.00 33.32  ? 34  ARG A CD  1 
ATOM   298  N NE  . ARG A 1 39  ? -16.825 -0.546  16.583  1.00 37.13  ? 34  ARG A NE  1 
ATOM   299  C CZ  . ARG A 1 39  ? -16.176 0.343   15.837  1.00 42.57  ? 34  ARG A CZ  1 
ATOM   300  N NH1 . ARG A 1 39  ? -15.626 1.422   16.388  1.00 43.39  ? 34  ARG A NH1 1 
ATOM   301  N NH2 . ARG A 1 39  ? -16.038 0.134   14.539  1.00 45.57  ? 34  ARG A NH2 1 
ATOM   302  N N   . LEU A 1 40  ? -19.812 -3.045  22.486  1.00 28.58  ? 35  LEU A N   1 
ATOM   303  C CA  . LEU A 1 40  ? -20.122 -3.031  23.874  1.00 29.35  ? 35  LEU A CA  1 
ATOM   304  C C   . LEU A 1 40  ? -19.742 -4.399  24.433  1.00 30.05  ? 35  LEU A C   1 
ATOM   305  O O   . LEU A 1 40  ? -19.207 -4.494  25.533  1.00 29.04  ? 35  LEU A O   1 
ATOM   306  C CB  . LEU A 1 40  ? -21.634 -2.734  24.130  1.00 28.62  ? 35  LEU A CB  1 
ATOM   307  C CG  . LEU A 1 40  ? -22.048 -1.246  24.079  1.00 30.03  ? 35  LEU A CG  1 
ATOM   308  C CD1 . LEU A 1 40  ? -23.571 -1.131  23.900  1.00 31.20  ? 35  LEU A CD1 1 
ATOM   309  C CD2 . LEU A 1 40  ? -21.619 -0.390  25.315  1.00 27.22  ? 35  LEU A CD2 1 
ATOM   310  N N   . GLU A 1 41  ? -20.045 -5.427  23.653  1.00 32.27  ? 36  GLU A N   1 
ATOM   311  C CA  . GLU A 1 41  ? -19.841 -6.809  24.000  1.00 34.72  ? 36  GLU A CA  1 
ATOM   312  C C   . GLU A 1 41  ? -18.355 -7.049  24.057  1.00 34.11  ? 36  GLU A C   1 
ATOM   313  O O   . GLU A 1 41  ? -17.872 -7.793  24.912  1.00 33.85  ? 36  GLU A O   1 
ATOM   314  C CB  . GLU A 1 41  ? -20.370 -7.676  22.862  1.00 38.18  ? 36  GLU A CB  1 
ATOM   315  C CG  . GLU A 1 41  ? -21.129 -8.894  23.259  1.00 45.41  ? 36  GLU A CG  1 
ATOM   316  C CD  . GLU A 1 41  ? -22.619 -8.590  23.426  1.00 51.31  ? 36  GLU A CD  1 
ATOM   317  O OE1 . GLU A 1 41  ? -23.345 -8.560  22.404  1.00 55.84  ? 36  GLU A OE1 1 
ATOM   318  O OE2 . GLU A 1 41  ? -23.064 -8.406  24.578  1.00 52.73  ? 36  GLU A OE2 1 
ATOM   319  N N   . LYS A 1 42  ? -17.621 -6.435  23.123  1.00 33.33  ? 37  LYS A N   1 
ATOM   320  C CA  . LYS A 1 42  ? -16.159 -6.644  23.087  1.00 33.09  ? 37  LYS A CA  1 
ATOM   321  C C   . LYS A 1 42  ? -15.544 -5.986  24.317  1.00 30.96  ? 37  LYS A C   1 
ATOM   322  O O   . LYS A 1 42  ? -14.607 -6.505  24.889  1.00 29.92  ? 37  LYS A O   1 
ATOM   323  C CB  . LYS A 1 42  ? -15.549 -6.146  21.780  1.00 34.87  ? 37  LYS A CB  1 
ATOM   324  C CG  . LYS A 1 42  ? -14.008 -5.922  21.778  1.00 36.98  ? 37  LYS A CG  1 
ATOM   325  C CD  . LYS A 1 42  ? -13.235 -7.059  21.097  1.00 45.64  ? 37  LYS A CD  1 
ATOM   326  C CE  . LYS A 1 42  ? -12.889 -8.212  22.067  1.00 49.40  ? 37  LYS A CE  1 
ATOM   327  N NZ  . LYS A 1 42  ? -12.592 -9.531  21.348  1.00 56.95  ? 37  LYS A NZ  1 
ATOM   328  N N   . LEU A 1 43  ? -16.126 -4.871  24.751  1.00 29.77  ? 38  LEU A N   1 
ATOM   329  C CA  . LEU A 1 43  ? -15.696 -4.215  25.963  1.00 30.09  ? 38  LEU A CA  1 
ATOM   330  C C   . LEU A 1 43  ? -15.876 -4.978  27.279  1.00 30.82  ? 38  LEU A C   1 
ATOM   331  O O   . LEU A 1 43  ? -15.000 -4.906  28.145  1.00 29.92  ? 38  LEU A O   1 
ATOM   332  C CB  . LEU A 1 43  ? -16.382 -2.876  26.097  1.00 28.73  ? 38  LEU A CB  1 
ATOM   333  C CG  . LEU A 1 43  ? -15.894 -2.052  27.260  1.00 29.06  ? 38  LEU A CG  1 
ATOM   334  C CD1 . LEU A 1 43  ? -14.355 -1.827  27.193  1.00 29.15  ? 38  LEU A CD1 1 
ATOM   335  C CD2 . LEU A 1 43  ? -16.698 -0.672  27.280  1.00 31.66  ? 38  LEU A CD2 1 
ATOM   336  N N   . LEU A 1 44  ? -17.027 -5.651  27.433  1.00 31.47  ? 39  LEU A N   1 
ATOM   337  C CA  . LEU A 1 44  ? -17.301 -6.554  28.533  1.00 32.47  ? 39  LEU A CA  1 
ATOM   338  C C   . LEU A 1 44  ? -16.266 -7.659  28.635  1.00 33.44  ? 39  LEU A C   1 
ATOM   339  O O   . LEU A 1 44  ? -15.813 -8.013  29.729  1.00 34.25  ? 39  LEU A O   1 
ATOM   340  C CB  . LEU A 1 44  ? -18.698 -7.203  28.353  1.00 32.90  ? 39  LEU A CB  1 
ATOM   341  C CG  . LEU A 1 44  ? -19.822 -6.181  28.590  1.00 33.86  ? 39  LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 44  ? -21.252 -6.736  28.321  1.00 31.20  ? 39  LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 44  ? -19.688 -5.609  30.027  1.00 32.02  ? 39  LEU A CD2 1 
ATOM   344  N N   . LYS A 1 45  ? -15.945 -8.255  27.498  1.00 34.09  ? 40  LYS A N   1 
ATOM   345  C CA  . LYS A 1 45  ? -14.989 -9.373  27.437  1.00 35.49  ? 40  LYS A CA  1 
ATOM   346  C C   . LYS A 1 45  ? -13.554 -8.909  27.783  1.00 33.92  ? 40  LYS A C   1 
ATOM   347  O O   . LYS A 1 45  ? -12.807 -9.591  28.464  1.00 32.88  ? 40  LYS A O   1 
ATOM   348  C CB  . LYS A 1 45  ? -15.003 -9.991  26.046  1.00 37.06  ? 40  LYS A CB  1 
ATOM   349  C CG  . LYS A 1 45  ? -13.864 -10.991 25.796  1.00 44.34  ? 40  LYS A CG  1 
ATOM   350  C CD  . LYS A 1 45  ? -14.111 -12.362 26.459  1.00 52.04  ? 40  LYS A CD  1 
ATOM   351  C CE  . LYS A 1 45  ? -12.813 -13.095 26.823  1.00 56.15  ? 40  LYS A CE  1 
ATOM   352  N NZ  . LYS A 1 45  ? -12.208 -12.589 28.119  1.00 55.01  ? 40  LYS A NZ  1 
ATOM   353  N N   . LEU A 1 46  ? -13.201 -7.721  27.310  1.00 31.68  ? 41  LEU A N   1 
ATOM   354  C CA  . LEU A 1 46  ? -11.960 -7.078  27.686  1.00 31.00  ? 41  LEU A CA  1 
ATOM   355  C C   . LEU A 1 46  ? -11.918 -6.805  29.207  1.00 29.37  ? 41  LEU A C   1 
ATOM   356  O O   . LEU A 1 46  ? -10.853 -6.842  29.822  1.00 27.81  ? 41  LEU A O   1 
ATOM   357  C CB  . LEU A 1 46  ? -11.839 -5.758  26.916  1.00 29.25  ? 41  LEU A CB  1 
ATOM   358  C CG  . LEU A 1 46  ? -10.951 -5.585  25.673  1.00 32.14  ? 41  LEU A CG  1 
ATOM   359  C CD1 . LEU A 1 46  ? -10.098 -6.748  25.150  1.00 29.85  ? 41  LEU A CD1 1 
ATOM   360  C CD2 . LEU A 1 46  ? -11.719 -4.868  24.557  1.00 30.86  ? 41  LEU A CD2 1 
ATOM   361  N N   . GLY A 1 47  ? -13.087 -6.503  29.771  1.00 28.47  ? 42  GLY A N   1 
ATOM   362  C CA  . GLY A 1 47  ? -13.258 -6.282  31.195  1.00 29.22  ? 42  GLY A CA  1 
ATOM   363  C C   . GLY A 1 47  ? -13.032 -7.560  31.970  1.00 30.99  ? 42  GLY A C   1 
ATOM   364  O O   . GLY A 1 47  ? -12.323 -7.553  32.966  1.00 31.53  ? 42  GLY A O   1 
ATOM   365  N N   . THR A 1 48  ? -13.617 -8.658  31.502  1.00 32.23  ? 43  THR A N   1 
ATOM   366  C CA  . THR A 1 48  ? -13.354 -9.963  32.085  1.00 34.21  ? 43  THR A CA  1 
ATOM   367  C C   . THR A 1 48  ? -11.840 -10.255 32.090  1.00 34.70  ? 43  THR A C   1 
ATOM   368  O O   . THR A 1 48  ? -11.293 -10.662 33.099  1.00 35.16  ? 43  THR A O   1 
ATOM   369  C CB  . THR A 1 48  ? -14.167 -11.050 31.355  1.00 35.49  ? 43  THR A CB  1 
ATOM   370  O OG1 . THR A 1 48  ? -15.547 -10.737 31.511  1.00 37.15  ? 43  THR A OG1 1 
ATOM   371  C CG2 . THR A 1 48  ? -13.947 -12.481 31.951  1.00 38.48  ? 43  THR A CG2 1 
ATOM   372  N N   . GLY A 1 49  ? -11.176 -10.036 30.966  1.00 34.49  ? 44  GLY A N   1 
ATOM   373  C CA  . GLY A 1 49  ? -9.736  -10.256 30.864  1.00 35.04  ? 44  GLY A CA  1 
ATOM   374  C C   . GLY A 1 49  ? -8.961  -9.421  31.881  1.00 33.44  ? 44  GLY A C   1 
ATOM   375  O O   . GLY A 1 49  ? -8.066  -9.935  32.527  1.00 34.39  ? 44  GLY A O   1 
ATOM   376  N N   . LEU A 1 50  ? -9.336  -8.149  32.023  1.00 31.86  ? 45  LEU A N   1 
ATOM   377  C CA  . LEU A 1 50  ? -8.778  -7.223  32.997  1.00 30.85  ? 45  LEU A CA  1 
ATOM   378  C C   . LEU A 1 50  ? -8.995  -7.708  34.447  1.00 31.89  ? 45  LEU A C   1 
ATOM   379  O O   . LEU A 1 50  ? -8.046  -7.772  35.235  1.00 32.35  ? 45  LEU A O   1 
ATOM   380  C CB  . LEU A 1 50  ? -9.402  -5.824  32.804  1.00 29.47  ? 45  LEU A CB  1 
ATOM   381  C CG  . LEU A 1 50  ? -8.846  -4.725  33.706  1.00 28.19  ? 45  LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 50  ? -9.325  -3.329  33.309  1.00 28.71  ? 45  LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 50  ? -9.233  -5.012  35.164  1.00 30.78  ? 45  LEU A CD2 1 
ATOM   384  N N   . LEU A 1 51  ? -10.234 -8.073  34.779  1.00 31.59  ? 46  LEU A N   1 
ATOM   385  C CA  . LEU A 1 51  ? -10.577 -8.501  36.122  1.00 32.74  ? 46  LEU A CA  1 
ATOM   386  C C   . LEU A 1 51  ? -9.916  -9.820  36.502  1.00 33.87  ? 46  LEU A C   1 
ATOM   387  O O   . LEU A 1 51  ? -9.374  -9.960  37.586  1.00 33.55  ? 46  LEU A O   1 
ATOM   388  C CB  . LEU A 1 51  ? -12.098 -8.579  36.306  1.00 32.59  ? 46  LEU A CB  1 
ATOM   389  C CG  . LEU A 1 51  ? -12.792 -7.222  36.178  1.00 33.46  ? 46  LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 51  ? -14.297 -7.454  35.983  1.00 36.62  ? 46  LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 51  ? -12.520 -6.317  37.404  1.00 33.71  ? 46  LEU A CD2 1 
ATOM   392  N N   . GLU A 1 52  ? -9.963  -10.790 35.610  1.00 34.89  ? 47  GLU A N   1 
ATOM   393  C CA  . GLU A 1 52  ? -9.389  -12.102 35.909  1.00 36.96  ? 47  GLU A CA  1 
ATOM   394  C C   . GLU A 1 52  ? -7.865  -12.041 36.032  1.00 36.90  ? 47  GLU A C   1 
ATOM   395  O O   . GLU A 1 52  ? -7.262  -12.750 36.858  1.00 37.67  ? 47  GLU A O   1 
ATOM   396  C CB  . GLU A 1 52  ? -9.791  -13.087 34.832  1.00 39.59  ? 47  GLU A CB  1 
ATOM   397  C CG  . GLU A 1 52  ? -11.257 -13.570 34.999  1.00 45.05  ? 47  GLU A CG  1 
ATOM   398  C CD  . GLU A 1 52  ? -11.709 -14.496 33.888  1.00 53.63  ? 47  GLU A CD  1 
ATOM   399  O OE1 . GLU A 1 52  ? -12.859 -15.037 33.967  1.00 55.27  ? 47  GLU A OE1 1 
ATOM   400  O OE2 . GLU A 1 52  ? -10.912 -14.678 32.928  1.00 57.03  ? 47  GLU A OE2 1 
ATOM   401  N N   . SER A 1 53  ? -7.257  -11.192 35.205  1.00 34.46  ? 48  SER A N   1 
ATOM   402  C CA  . SER A 1 53  ? -5.814  -10.921 35.214  1.00 33.88  ? 48  SER A CA  1 
ATOM   403  C C   . SER A 1 53  ? -5.397  -10.186 36.443  1.00 31.32  ? 48  SER A C   1 
ATOM   404  O O   . SER A 1 53  ? -4.381  -10.500 37.008  1.00 32.61  ? 48  SER A O   1 
ATOM   405  C CB  . SER A 1 53  ? -5.418  -10.052 34.004  1.00 32.45  ? 48  SER A CB  1 
ATOM   406  O OG  . SER A 1 53  ? -4.900  -10.920 33.023  1.00 38.70  ? 48  SER A OG  1 
ATOM   407  N N   . GLY A 1 54  ? -6.197  -9.207  36.825  1.00 30.76  ? 49  GLY A N   1 
ATOM   408  C CA  . GLY A 1 54  ? -6.004  -8.417  38.033  1.00 31.32  ? 49  GLY A CA  1 
ATOM   409  C C   . GLY A 1 54  ? -6.034  -9.272  39.299  1.00 33.02  ? 49  GLY A C   1 
ATOM   410  O O   . GLY A 1 54  ? -5.174  -9.147  40.200  1.00 32.92  ? 49  GLY A O   1 
ATOM   411  N N   . ARG A 1 55  ? -7.020  -10.147 39.371  1.00 34.88  ? 50  ARG A N   1 
ATOM   412  C CA  . ARG A 1 55  ? -7.145  -11.019 40.534  1.00 37.84  ? 50  ARG A CA  1 
ATOM   413  C C   . ARG A 1 55  ? -5.966  -11.963 40.660  1.00 38.29  ? 50  ARG A C   1 
ATOM   414  O O   . ARG A 1 55  ? -5.505  -12.211 41.762  1.00 40.42  ? 50  ARG A O   1 
ATOM   415  C CB  . ARG A 1 55  ? -8.413  -11.854 40.472  1.00 39.04  ? 50  ARG A CB  1 
ATOM   416  C CG  . ARG A 1 55  ? -9.650  -11.062 40.371  1.00 42.94  ? 50  ARG A CG  1 
ATOM   417  C CD  . ARG A 1 55  ? -9.753  -10.095 41.502  1.00 47.87  ? 50  ARG A CD  1 
ATOM   418  N NE  . ARG A 1 55  ? -11.130 -9.648  41.661  1.00 52.64  ? 50  ARG A NE  1 
ATOM   419  C CZ  . ARG A 1 55  ? -11.521 -8.752  42.558  1.00 53.91  ? 50  ARG A CZ  1 
ATOM   420  N NH1 . ARG A 1 55  ? -12.796 -8.424  42.627  1.00 56.83  ? 50  ARG A NH1 1 
ATOM   421  N NH2 . ARG A 1 55  ? -10.644 -8.174  43.364  1.00 50.83  ? 50  ARG A NH2 1 
ATOM   422  N N   . HIS A 1 56  ? -5.537  -12.541 39.546  1.00 37.77  ? 51  HIS A N   1 
ATOM   423  C CA  . HIS A 1 56  ? -4.433  -13.480 39.559  1.00 39.11  ? 51  HIS A CA  1 
ATOM   424  C C   . HIS A 1 56  ? -3.166  -12.686 39.961  1.00 37.48  ? 51  HIS A C   1 
ATOM   425  O O   . HIS A 1 56  ? -2.311  -13.216 40.653  1.00 39.04  ? 51  HIS A O   1 
ATOM   426  C CB  . HIS A 1 56  ? -4.340  -14.197 38.205  1.00 40.05  ? 51  HIS A CB  1 
ATOM   427  C CG  . HIS A 1 56  ? -3.183  -15.136 38.064  1.00 45.41  ? 51  HIS A CG  1 
ATOM   428  N ND1 . HIS A 1 56  ? -3.252  -16.468 38.418  1.00 51.80  ? 51  HIS A ND1 1 
ATOM   429  C CD2 . HIS A 1 56  ? -1.944  -14.951 37.547  1.00 48.01  ? 51  HIS A CD2 1 
ATOM   430  C CE1 . HIS A 1 56  ? -2.094  -17.055 38.166  1.00 53.22  ? 51  HIS A CE1 1 
ATOM   431  N NE2 . HIS A 1 56  ? -1.281  -16.154 37.641  1.00 52.87  ? 51  HIS A NE2 1 
ATOM   432  N N   . TYR A 1 57  ? -3.096  -11.399 39.607  1.00 34.50  ? 52  TYR A N   1 
ATOM   433  C CA  . TYR A 1 57  ? -1.916  -10.590 39.954  1.00 33.37  ? 52  TYR A CA  1 
ATOM   434  C C   . TYR A 1 57  ? -1.878  -10.193 41.423  1.00 32.91  ? 52  TYR A C   1 
ATOM   435  O O   . TYR A 1 57  ? -0.835  -10.252 42.051  1.00 34.03  ? 52  TYR A O   1 
ATOM   436  C CB  . TYR A 1 57  ? -1.805  -9.348  39.074  1.00 30.74  ? 52  TYR A CB  1 
ATOM   437  C CG  . TYR A 1 57  ? -0.909  -8.262  39.590  1.00 30.04  ? 52  TYR A CG  1 
ATOM   438  C CD1 . TYR A 1 57  ? 0.477   -8.466  39.756  1.00 31.67  ? 52  TYR A CD1 1 
ATOM   439  C CD2 . TYR A 1 57  ? -1.423  -7.011  39.884  1.00 28.81  ? 52  TYR A CD2 1 
ATOM   440  C CE1 . TYR A 1 57  ? 1.310   -7.427  40.183  1.00 30.53  ? 52  TYR A CE1 1 
ATOM   441  C CE2 . TYR A 1 57  ? -0.587  -5.960  40.309  1.00 30.86  ? 52  TYR A CE2 1 
ATOM   442  C CZ  . TYR A 1 57  ? 0.768   -6.188  40.451  1.00 32.72  ? 52  TYR A CZ  1 
ATOM   443  O OH  . TYR A 1 57  ? 1.574   -5.167  40.885  1.00 35.75  ? 52  TYR A OH  1 
ATOM   444  N N   . LEU A 1 58  ? -3.020  -9.804  41.964  1.00 32.04  ? 53  LEU A N   1 
ATOM   445  C CA  . LEU A 1 58  ? -3.156  -9.575  43.388  1.00 32.12  ? 53  LEU A CA  1 
ATOM   446  C C   . LEU A 1 58  ? -2.822  -10.833 44.176  1.00 33.58  ? 53  LEU A C   1 
ATOM   447  O O   . LEU A 1 58  ? -2.103  -10.766 45.159  1.00 34.58  ? 53  LEU A O   1 
ATOM   448  C CB  . LEU A 1 58  ? -4.589  -9.078  43.706  1.00 32.74  ? 53  LEU A CB  1 
ATOM   449  C CG  . LEU A 1 58  ? -4.782  -7.714  43.045  1.00 33.88  ? 53  LEU A CG  1 
ATOM   450  C CD1 . LEU A 1 58  ? -6.050  -7.055  43.481  1.00 35.71  ? 53  LEU A CD1 1 
ATOM   451  C CD2 . LEU A 1 58  ? -3.551  -6.800  43.292  1.00 34.45  ? 53  LEU A CD2 1 
ATOM   452  N N   . ALA A 1 59  ? -3.300  -11.991 43.719  1.00 33.73  ? 54  ALA A N   1 
ATOM   453  C CA  . ALA A 1 59  ? -3.055  -13.229 44.446  1.00 35.10  ? 54  ALA A CA  1 
ATOM   454  C C   . ALA A 1 59  ? -1.559  -13.558 44.456  1.00 34.97  ? 54  ALA A C   1 
ATOM   455  O O   . ALA A 1 59  ? -1.027  -13.898 45.526  1.00 36.35  ? 54  ALA A O   1 
ATOM   456  C CB  . ALA A 1 59  ? -3.858  -14.371 43.879  1.00 36.39  ? 54  ALA A CB  1 
ATOM   457  N N   . ALA A 1 60  ? -0.887  -13.435 43.299  1.00 33.20  ? 55  ALA A N   1 
ATOM   458  C CA  . ALA A 1 60  ? 0.583   -13.629 43.233  1.00 33.81  ? 55  ALA A CA  1 
ATOM   459  C C   . ALA A 1 60  ? 1.322   -12.632 44.113  1.00 32.38  ? 55  ALA A C   1 
ATOM   460  O O   . ALA A 1 60  ? 2.326   -12.972 44.694  1.00 33.49  ? 55  ALA A O   1 
ATOM   461  C CB  . ALA A 1 60  ? 1.142   -13.587 41.801  1.00 32.07  ? 55  ALA A CB  1 
ATOM   462  N N   . SER A 1 61  ? 0.813   -11.414 44.198  1.00 32.49  ? 56  SER A N   1 
ATOM   463  C CA  . SER A 1 61  ? 1.397   -10.391 45.058  1.00 33.56  ? 56  SER A CA  1 
ATOM   464  C C   . SER A 1 61  ? 1.265   -10.694 46.538  1.00 36.23  ? 56  SER A C   1 
ATOM   465  O O   . SER A 1 61  ? 2.246   -10.474 47.281  1.00 35.19  ? 56  SER A O   1 
ATOM   466  C CB  . SER A 1 61  ? 0.774   -9.036  44.806  1.00 31.26  ? 56  SER A CB  1 
ATOM   467  O OG  . SER A 1 61  ? 0.936   -8.686  43.468  1.00 35.17  ? 56  SER A OG  1 
ATOM   468  N N   . ARG A 1 62  ? 0.071   -11.168 46.956  1.00 38.40  ? 57  ARG A N   1 
ATOM   469  C CA  . ARG A 1 62  ? -0.140  -11.535 48.347  1.00 42.38  ? 57  ARG A CA  1 
ATOM   470  C C   . ARG A 1 62  ? 0.833   -12.622 48.728  1.00 43.73  ? 57  ARG A C   1 
ATOM   471  O O   . ARG A 1 62  ? 1.388   -12.607 49.828  1.00 46.58  ? 57  ARG A O   1 
ATOM   472  C CB  . ARG A 1 62  ? -1.571  -12.056 48.643  1.00 44.88  ? 57  ARG A CB  1 
ATOM   473  C CG  . ARG A 1 62  ? -2.667  -11.026 48.497  1.00 47.33  ? 57  ARG A CG  1 
ATOM   474  C CD  . ARG A 1 62  ? -4.097  -11.529 48.913  1.00 51.96  ? 57  ARG A CD  1 
ATOM   475  N NE  . ARG A 1 62  ? -5.047  -10.560 48.354  1.00 57.23  ? 57  ARG A NE  1 
ATOM   476  C CZ  . ARG A 1 62  ? -5.788  -10.738 47.248  1.00 58.41  ? 57  ARG A CZ  1 
ATOM   477  N NH1 . ARG A 1 62  ? -5.801  -11.903 46.587  1.00 55.66  ? 57  ARG A NH1 1 
ATOM   478  N NH2 . ARG A 1 62  ? -6.566  -9.745  46.825  1.00 59.10  ? 57  ARG A NH2 1 
ATOM   479  N N   . ALA A 1 63  ? 1.025   -13.587 47.832  1.00 43.20  ? 58  ALA A N   1 
ATOM   480  C CA  . ALA A 1 63  ? 1.904   -14.714 48.114  1.00 43.09  ? 58  ALA A CA  1 
ATOM   481  C C   . ALA A 1 63  ? 3.365   -14.249 48.159  1.00 41.41  ? 58  ALA A C   1 
ATOM   482  O O   . ALA A 1 63  ? 4.159   -14.788 48.913  1.00 42.44  ? 58  ALA A O   1 
ATOM   483  C CB  . ALA A 1 63  ? 1.710   -15.794 47.088  1.00 44.24  ? 58  ALA A CB  1 
ATOM   484  N N   . PHE A 1 64  ? 3.709   -13.247 47.351  1.00 37.68  ? 59  PHE A N   1 
ATOM   485  C CA  . PHE A 1 64  ? 5.046   -12.616 47.420  1.00 36.65  ? 59  PHE A CA  1 
ATOM   486  C C   . PHE A 1 64  ? 5.286   -12.029 48.816  1.00 37.21  ? 59  PHE A C   1 
ATOM   487  O O   . PHE A 1 64  ? 6.333   -12.238 49.421  1.00 37.30  ? 59  PHE A O   1 
ATOM   488  C CB  . PHE A 1 64  ? 5.144   -11.517 46.375  1.00 33.04  ? 59  PHE A CB  1 
ATOM   489  C CG  . PHE A 1 64  ? 6.458   -10.771 46.336  1.00 31.48  ? 59  PHE A CG  1 
ATOM   490  C CD1 . PHE A 1 64  ? 7.617   -11.393 45.975  1.00 28.99  ? 59  PHE A CD1 1 
ATOM   491  C CD2 . PHE A 1 64  ? 6.489   -9.392  46.559  1.00 30.94  ? 59  PHE A CD2 1 
ATOM   492  C CE1 . PHE A 1 64  ? 8.813   -10.664 45.891  1.00 32.13  ? 59  PHE A CE1 1 
ATOM   493  C CE2 . PHE A 1 64  ? 7.671   -8.652  46.425  1.00 25.75  ? 59  PHE A CE2 1 
ATOM   494  C CZ  . PHE A 1 64  ? 8.835   -9.294  46.113  1.00 28.09  ? 59  PHE A CZ  1 
ATOM   495  N N   . VAL A 1 65  ? 4.296   -11.298 49.317  1.00 38.12  ? 60  VAL A N   1 
ATOM   496  C CA  . VAL A 1 65  ? 4.385   -10.728 50.655  1.00 40.04  ? 60  VAL A CA  1 
ATOM   497  C C   . VAL A 1 65  ? 4.444   -11.804 51.736  1.00 42.23  ? 60  VAL A C   1 
ATOM   498  O O   . VAL A 1 65  ? 5.278   -11.733 52.644  1.00 43.89  ? 60  VAL A O   1 
ATOM   499  C CB  . VAL A 1 65  ? 3.280   -9.691  50.897  1.00 40.35  ? 60  VAL A CB  1 
ATOM   500  C CG1 . VAL A 1 65  ? 3.413   -9.076  52.318  1.00 42.18  ? 60  VAL A CG1 1 
ATOM   501  C CG2 . VAL A 1 65  ? 3.386   -8.625  49.821  1.00 36.03  ? 60  VAL A CG2 1 
ATOM   502  N N   . VAL A 1 66  ? 3.647   -12.853 51.601  1.00 44.07  ? 61  VAL A N   1 
ATOM   503  C CA  . VAL A 1 66  ? 3.812   -14.005 52.530  1.00 46.86  ? 61  VAL A CA  1 
ATOM   504  C C   . VAL A 1 66  ? 5.263   -14.539 52.483  1.00 47.82  ? 61  VAL A C   1 
ATOM   505  O O   . VAL A 1 66  ? 5.850   -14.833 53.519  1.00 49.19  ? 61  VAL A O   1 
ATOM   506  C CB  . VAL A 1 66  ? 2.753   -15.117 52.323  1.00 48.69  ? 61  VAL A CB  1 
ATOM   507  C CG1 . VAL A 1 66  ? 3.000   -16.308 53.263  1.00 51.21  ? 61  VAL A CG1 1 
ATOM   508  C CG2 . VAL A 1 66  ? 1.378   -14.549 52.574  1.00 47.49  ? 61  VAL A CG2 1 
ATOM   509  N N   . GLY A 1 67  ? 5.855   -14.584 51.284  1.00 46.78  ? 62  GLY A N   1 
ATOM   510  C CA  . GLY A 1 67  ? 7.220   -15.072 51.110  1.00 47.27  ? 62  GLY A CA  1 
ATOM   511  C C   . GLY A 1 67  ? 8.262   -14.207 51.779  1.00 46.58  ? 62  GLY A C   1 
ATOM   512  O O   . GLY A 1 67  ? 9.278   -14.712 52.268  1.00 48.02  ? 62  GLY A O   1 
ATOM   513  N N   . ILE A 1 68  ? 8.006   -12.905 51.807  1.00 45.26  ? 63  ILE A N   1 
ATOM   514  C CA  . ILE A 1 68  ? 8.910   -11.953 52.423  1.00 45.32  ? 63  ILE A CA  1 
ATOM   515  C C   . ILE A 1 68  ? 9.034   -12.224 53.941  1.00 49.04  ? 63  ILE A C   1 
ATOM   516  O O   . ILE A 1 68  ? 10.140  -12.309 54.470  1.00 50.37  ? 63  ILE A O   1 
ATOM   517  C CB  . ILE A 1 68  ? 8.477   -10.476 52.152  1.00 42.70  ? 63  ILE A CB  1 
ATOM   518  C CG1 . ILE A 1 68  ? 8.636   -10.105 50.672  1.00 39.67  ? 63  ILE A CG1 1 
ATOM   519  C CG2 . ILE A 1 68  ? 9.323   -9.529  52.970  1.00 42.97  ? 63  ILE A CG2 1 
ATOM   520  C CD1 . ILE A 1 68  ? 7.962   -8.779  50.279  1.00 32.37  ? 63  ILE A CD1 1 
ATOM   521  N N   . CYS A 1 69  ? 7.902   -12.364 54.624  1.00 52.44  ? 64  CYS A N   1 
ATOM   522  C CA  . CYS A 1 69  ? 7.864   -12.725 56.044  1.00 57.63  ? 64  CYS A CA  1 
ATOM   523  C C   . CYS A 1 69  ? 8.570   -14.036 56.364  1.00 59.97  ? 64  CYS A C   1 
ATOM   524  O O   . CYS A 1 69  ? 9.490   -14.079 57.195  1.00 60.47  ? 64  CYS A O   1 
ATOM   525  C CB  . CYS A 1 69  ? 6.430   -12.795 56.506  1.00 58.81  ? 64  CYS A CB  1 
ATOM   526  S SG  . CYS A 1 69  ? 5.606   -11.289 56.112  1.00 63.72  ? 64  CYS A SG  1 
ATOM   527  N N   . ASP A 1 70  ? 8.107   -15.095 55.704  1.00 61.71  ? 65  ASP A N   1 
ATOM   528  C CA  . ASP A 1 70  ? 8.847   -16.343 55.586  1.00 64.63  ? 65  ASP A CA  1 
ATOM   529  C C   . ASP A 1 70  ? 10.347  -16.133 55.648  1.00 64.34  ? 65  ASP A C   1 
ATOM   530  O O   . ASP A 1 70  ? 11.039  -16.671 56.520  1.00 65.89  ? 65  ASP A O   1 
ATOM   531  C CB  . ASP A 1 70  ? 8.551   -16.978 54.239  1.00 63.81  ? 65  ASP A CB  1 
ATOM   532  C CG  . ASP A 1 70  ? 7.722   -18.178 54.359  1.00 68.16  ? 65  ASP A CG  1 
ATOM   533  O OD1 . ASP A 1 70  ? 6.480   -18.021 54.438  1.00 67.62  ? 65  ASP A OD1 1 
ATOM   534  O OD2 . ASP A 1 70  ? 8.330   -19.276 54.384  1.00 72.24  ? 65  ASP A OD2 1 
ATOM   535  N N   . LEU A 1 71  ? 10.848  -15.362 54.686  1.00 62.54  ? 66  LEU A N   1 
ATOM   536  C CA  . LEU A 1 71  ? 12.284  -15.145 54.583  1.00 62.87  ? 66  LEU A CA  1 
ATOM   537  C C   . LEU A 1 71  ? 12.822  -14.506 55.848  1.00 64.06  ? 66  LEU A C   1 
ATOM   538  O O   . LEU A 1 71  ? 13.849  -14.945 56.382  1.00 65.72  ? 66  LEU A O   1 
ATOM   539  C CB  . LEU A 1 71  ? 12.621  -14.289 53.374  1.00 59.43  ? 66  LEU A CB  1 
ATOM   540  C CG  . LEU A 1 71  ? 14.100  -13.974 53.177  1.00 59.49  ? 66  LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 71  ? 14.539  -12.904 54.149  1.00 57.30  ? 66  LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 71  ? 14.973  -15.217 53.295  1.00 60.16  ? 66  LEU A CD2 1 
ATOM   543  N N   . ALA A 1 72  ? 12.116  -13.491 56.337  1.00 64.47  ? 67  ALA A N   1 
ATOM   544  C CA  . ALA A 1 72  ? 12.645  -12.656 57.413  1.00 65.92  ? 67  ALA A CA  1 
ATOM   545  C C   . ALA A 1 72  ? 12.577  -13.258 58.811  1.00 69.58  ? 67  ALA A C   1 
ATOM   546  O O   . ALA A 1 72  ? 13.318  -12.825 59.701  1.00 70.40  ? 67  ALA A O   1 
ATOM   547  C CB  . ALA A 1 72  ? 12.011  -11.269 57.375  1.00 64.28  ? 67  ALA A CB  1 
ATOM   548  N N   . ARG A 1 73  ? 11.717  -14.261 59.006  1.00 73.36  ? 68  ARG A N   1 
ATOM   549  C CA  . ARG A 1 73  ? 11.586  -14.931 60.321  1.00 77.96  ? 68  ARG A CA  1 
ATOM   550  C C   . ARG A 1 73  ? 12.796  -15.803 60.659  1.00 80.38  ? 68  ARG A C   1 
ATOM   551  O O   . ARG A 1 73  ? 13.093  -16.058 61.830  1.00 83.26  ? 68  ARG A O   1 
ATOM   552  C CB  . ARG A 1 73  ? 10.273  -15.718 60.445  1.00 80.47  ? 68  ARG A CB  1 
ATOM   553  C CG  . ARG A 1 73  ? 10.322  -17.200 60.075  1.00 83.28  ? 68  ARG A CG  1 
ATOM   554  C CD  . ARG A 1 73  ? 9.043   -17.922 60.502  1.00 88.91  ? 68  ARG A CD  1 
ATOM   555  N NE  . ARG A 1 73  ? 7.852   -17.195 60.058  1.00 90.77  ? 68  ARG A NE  1 
ATOM   556  C CZ  . ARG A 1 73  ? 7.175   -17.437 58.933  1.00 90.51  ? 68  ARG A CZ  1 
ATOM   557  N NH1 . ARG A 1 73  ? 6.110   -16.703 58.626  1.00 88.61  ? 68  ARG A NH1 1 
ATOM   558  N NH2 . ARG A 1 73  ? 7.547   -18.417 58.118  1.00 91.79  ? 68  ARG A NH2 1 
ATOM   559  N N   . LEU A 1 74  ? 13.497  -16.253 59.628  1.00 79.89  ? 69  LEU A N   1 
ATOM   560  C CA  . LEU A 1 74  ? 14.762  -16.947 59.799  1.00 81.95  ? 69  LEU A CA  1 
ATOM   561  C C   . LEU A 1 74  ? 15.756  -16.193 60.691  1.00 82.30  ? 69  LEU A C   1 
ATOM   562  O O   . LEU A 1 74  ? 15.599  -14.994 60.943  1.00 81.07  ? 69  LEU A O   1 
ATOM   563  C CB  . LEU A 1 74  ? 15.412  -17.165 58.434  1.00 79.96  ? 69  LEU A CB  1 
ATOM   564  C CG  . LEU A 1 74  ? 15.604  -18.573 57.863  1.00 82.69  ? 69  LEU A CG  1 
ATOM   565  C CD1 . LEU A 1 74  ? 16.587  -18.400 56.752  1.00 80.75  ? 69  LEU A CD1 1 
ATOM   566  C CD2 . LEU A 1 74  ? 16.134  -19.611 58.864  1.00 85.25  ? 69  LEU A CD2 1 
ATOM   567  N N   . GLY A 1 75  ? 16.783  -16.913 61.148  1.00 84.63  ? 70  GLY A N   1 
ATOM   568  C CA  . GLY A 1 75  ? 17.932  -16.316 61.824  1.00 84.58  ? 70  GLY A CA  1 
ATOM   569  C C   . GLY A 1 75  ? 17.653  -15.924 63.260  1.00 87.22  ? 70  GLY A C   1 
ATOM   570  O O   . GLY A 1 75  ? 16.551  -16.178 63.777  1.00 89.44  ? 70  GLY A O   1 
ATOM   571  N N   . PRO A 1 76  ? 18.654  -15.318 63.931  1.00 87.34  ? 71  PRO A N   1 
ATOM   572  C CA  . PRO A 1 76  ? 18.399  -14.816 65.289  1.00 89.54  ? 71  PRO A CA  1 
ATOM   573  C C   . PRO A 1 76  ? 17.450  -13.610 65.208  1.00 88.01  ? 71  PRO A C   1 
ATOM   574  O O   . PRO A 1 76  ? 17.667  -12.721 64.367  1.00 85.21  ? 71  PRO A O   1 
ATOM   575  C CB  . PRO A 1 76  ? 19.794  -14.412 65.792  1.00 89.21  ? 71  PRO A CB  1 
ATOM   576  C CG  . PRO A 1 76  ? 20.599  -14.150 64.537  1.00 86.17  ? 71  PRO A CG  1 
ATOM   577  C CD  . PRO A 1 76  ? 20.046  -15.083 63.488  1.00 85.48  ? 71  PRO A CD  1 
ATOM   578  N N   . PRO A 1 77  ? 16.398  -13.583 66.053  1.00 90.25  ? 72  PRO A N   1 
ATOM   579  C CA  . PRO A 1 77  ? 15.385  -12.532 65.915  1.00 88.98  ? 72  PRO A CA  1 
ATOM   580  C C   . PRO A 1 77  ? 15.946  -11.157 66.298  1.00 87.71  ? 72  PRO A C   1 
ATOM   581  O O   . PRO A 1 77  ? 16.794  -11.064 67.201  1.00 89.00  ? 72  PRO A O   1 
ATOM   582  C CB  . PRO A 1 77  ? 14.290  -12.965 66.895  1.00 92.93  ? 72  PRO A CB  1 
ATOM   583  C CG  . PRO A 1 77  ? 14.998  -13.763 67.936  1.00 96.50  ? 72  PRO A CG  1 
ATOM   584  C CD  . PRO A 1 77  ? 16.233  -14.360 67.297  1.00 94.59  ? 72  PRO A CD  1 
ATOM   585  N N   . GLU A 1 78  ? 15.493  -10.107 65.604  1.00 84.51  ? 73  GLU A N   1 
ATOM   586  C CA  . GLU A 1 78  ? 15.915  -8.740  65.933  1.00 83.29  ? 73  GLU A CA  1 
ATOM   587  C C   . GLU A 1 78  ? 14.758  -7.758  65.865  1.00 82.25  ? 73  GLU A C   1 
ATOM   588  O O   . GLU A 1 78  ? 14.063  -7.698  64.849  1.00 80.21  ? 73  GLU A O   1 
ATOM   589  C CB  . GLU A 1 78  ? 17.050  -8.274  65.024  1.00 80.53  ? 73  GLU A CB  1 
ATOM   590  C CG  . GLU A 1 78  ? 17.491  -6.839  65.280  1.00 81.48  ? 73  GLU A CG  1 
ATOM   591  C CD  . GLU A 1 78  ? 18.678  -6.443  64.438  1.00 80.14  ? 73  GLU A CD  1 
ATOM   592  O OE1 . GLU A 1 78  ? 19.795  -6.924  64.722  1.00 80.42  ? 73  GLU A OE1 1 
ATOM   593  O OE2 . GLU A 1 78  ? 18.489  -5.646  63.497  1.00 79.01  ? 73  GLU A OE2 1 
ATOM   594  N N   . PRO A 1 79  ? 14.566  -6.966  66.941  1.00 83.84  ? 74  PRO A N   1 
ATOM   595  C CA  . PRO A 1 79  ? 13.404  -6.071  67.041  1.00 83.74  ? 74  PRO A CA  1 
ATOM   596  C C   . PRO A 1 79  ? 13.335  -5.022  65.938  1.00 79.47  ? 74  PRO A C   1 
ATOM   597  O O   . PRO A 1 79  ? 12.239  -4.644  65.536  1.00 79.17  ? 74  PRO A O   1 
ATOM   598  C CB  . PRO A 1 79  ? 13.581  -5.401  68.405  1.00 87.58  ? 74  PRO A CB  1 
ATOM   599  C CG  . PRO A 1 79  ? 14.523  -6.299  69.160  1.00 89.45  ? 74  PRO A CG  1 
ATOM   600  C CD  . PRO A 1 79  ? 15.440  -6.859  68.123  1.00 85.99  ? 74  PRO A CD  1 
ATOM   601  N N   . MET A 1 80  ? 14.483  -4.557  65.453  1.00 76.16  ? 75  MET A N   1 
ATOM   602  C CA  . MET A 1 80  ? 14.506  -3.616  64.331  1.00 72.43  ? 75  MET A CA  1 
ATOM   603  C C   . MET A 1 80  ? 13.930  -4.235  63.049  1.00 68.59  ? 75  MET A C   1 
ATOM   604  O O   . MET A 1 80  ? 13.152  -3.595  62.350  1.00 66.51  ? 75  MET A O   1 
ATOM   605  C CB  . MET A 1 80  ? 15.919  -3.096  64.077  1.00 71.56  ? 75  MET A CB  1 
ATOM   606  C CG  . MET A 1 80  ? 16.005  -2.170  62.878  1.00 70.57  ? 75  MET A CG  1 
ATOM   607  S SD  . MET A 1 80  ? 17.675  -1.605  62.557  1.00 72.52  ? 75  MET A SD  1 
ATOM   608  C CE  . MET A 1 80  ? 17.492  -0.950  60.906  1.00 68.47  ? 75  MET A CE  1 
ATOM   609  N N   . MET A 1 81  ? 14.326  -5.473  62.761  1.00 66.85  ? 76  MET A N   1 
ATOM   610  C CA  . MET A 1 81  ? 13.783  -6.256  61.648  1.00 64.56  ? 76  MET A CA  1 
ATOM   611  C C   . MET A 1 81  ? 12.287  -6.554  61.795  1.00 64.84  ? 76  MET A C   1 
ATOM   612  O O   . MET A 1 81  ? 11.526  -6.447  60.828  1.00 62.70  ? 76  MET A O   1 
ATOM   613  C CB  . MET A 1 81  ? 14.530  -7.575  61.529  1.00 64.40  ? 76  MET A CB  1 
ATOM   614  C CG  . MET A 1 81  ? 15.789  -7.496  60.720  1.00 65.40  ? 76  MET A CG  1 
ATOM   615  S SD  . MET A 1 81  ? 15.765  -8.550  59.251  1.00 69.84  ? 76  MET A SD  1 
ATOM   616  C CE  . MET A 1 81  ? 14.019  -8.530  58.827  1.00 65.07  ? 76  MET A CE  1 
ATOM   617  N N   . ALA A 1 82  ? 11.877  -6.956  62.993  1.00 66.77  ? 77  ALA A N   1 
ATOM   618  C CA  . ALA A 1 82  ? 10.476  -7.251  63.241  1.00 68.08  ? 77  ALA A CA  1 
ATOM   619  C C   . ALA A 1 82  ? 9.634   -6.001  63.028  1.00 67.40  ? 77  ALA A C   1 
ATOM   620  O O   . ALA A 1 82  ? 8.592   -6.086  62.379  1.00 66.71  ? 77  ALA A O   1 
ATOM   621  C CB  . ALA A 1 82  ? 10.268  -7.818  64.629  1.00 71.88  ? 77  ALA A CB  1 
ATOM   622  N N   . GLU A 1 83  ? 10.096  -4.850  63.534  1.00 67.55  ? 78  GLU A N   1 
ATOM   623  C CA  . GLU A 1 83  ? 9.377   -3.575  63.353  1.00 67.54  ? 78  GLU A CA  1 
ATOM   624  C C   . GLU A 1 83  ? 9.282   -3.231  61.863  1.00 63.65  ? 78  GLU A C   1 
ATOM   625  O O   . GLU A 1 83  ? 8.257   -2.745  61.371  1.00 63.37  ? 78  GLU A O   1 
ATOM   626  C CB  . GLU A 1 83  ? 10.053  -2.419  64.112  1.00 69.01  ? 78  GLU A CB  1 
ATOM   627  C CG  . GLU A 1 83  ? 9.486   -1.035  63.734  1.00 70.25  ? 78  GLU A CG  1 
ATOM   628  C CD  . GLU A 1 83  ? 9.900   0.104   64.655  1.00 75.23  ? 78  GLU A CD  1 
ATOM   629  O OE1 . GLU A 1 83  ? 9.005   0.805   65.188  1.00 80.42  ? 78  GLU A OE1 1 
ATOM   630  O OE2 . GLU A 1 83  ? 11.114  0.313   64.848  1.00 76.79  ? 78  GLU A OE2 1 
ATOM   631  N N   . CYS A 1 84  ? 10.375  -3.495  61.158  1.00 60.66  ? 79  CYS A N   1 
ATOM   632  C CA  . CYS A 1 84  ? 10.456  -3.246  59.757  1.00 57.47  ? 79  CYS A CA  1 
ATOM   633  C C   . CYS A 1 84  ? 9.435   -4.112  59.029  1.00 55.81  ? 79  CYS A C   1 
ATOM   634  O O   . CYS A 1 84  ? 8.603   -3.595  58.275  1.00 54.69  ? 79  CYS A O   1 
ATOM   635  C CB  . CYS A 1 84  ? 11.870  -3.529  59.258  1.00 55.74  ? 79  CYS A CB  1 
ATOM   636  S SG  . CYS A 1 84  ? 12.008  -3.341  57.473  1.00 54.55  ? 79  CYS A SG  1 
ATOM   637  N N   . LEU A 1 85  ? 9.489   -5.420  59.269  1.00 55.66  ? 80  LEU A N   1 
ATOM   638  C CA  . LEU A 1 85  ? 8.600   -6.357  58.589  1.00 55.34  ? 80  LEU A CA  1 
ATOM   639  C C   . LEU A 1 85  ? 7.145   -6.141  58.951  1.00 56.75  ? 80  LEU A C   1 
ATOM   640  O O   . LEU A 1 85  ? 6.277   -6.272  58.110  1.00 55.83  ? 80  LEU A O   1 
ATOM   641  C CB  . LEU A 1 85  ? 9.024   -7.806  58.826  1.00 56.51  ? 80  LEU A CB  1 
ATOM   642  C CG  . LEU A 1 85  ? 10.085  -8.380  57.879  1.00 55.55  ? 80  LEU A CG  1 
ATOM   643  C CD1 . LEU A 1 85  ? 9.432   -8.698  56.540  1.00 55.28  ? 80  LEU A CD1 1 
ATOM   644  C CD2 . LEU A 1 85  ? 11.247  -7.430  57.637  1.00 54.14  ? 80  LEU A CD2 1 
ATOM   645  N N   . GLU A 1 86  ? 6.888   -5.775  60.197  1.00 59.92  ? 81  GLU A N   1 
ATOM   646  C CA  . GLU A 1 86  ? 5.526   -5.475  60.661  1.00 62.26  ? 81  GLU A CA  1 
ATOM   647  C C   . GLU A 1 86  ? 4.894   -4.273  59.934  1.00 60.20  ? 81  GLU A C   1 
ATOM   648  O O   . GLU A 1 86  ? 3.781   -4.394  59.397  1.00 60.54  ? 81  GLU A O   1 
ATOM   649  C CB  . GLU A 1 86  ? 5.513   -5.310  62.187  1.00 65.98  ? 81  GLU A CB  1 
ATOM   650  C CG  . GLU A 1 86  ? 4.592   -4.238  62.748  1.00 71.02  ? 81  GLU A CG  1 
ATOM   651  C CD  . GLU A 1 86  ? 4.819   -4.005  64.229  1.00 77.70  ? 81  GLU A CD  1 
ATOM   652  O OE1 . GLU A 1 86  ? 4.034   -4.554  65.019  1.00 84.76  ? 81  GLU A OE1 1 
ATOM   653  O OE2 . GLU A 1 86  ? 5.781   -3.309  64.626  1.00 77.71  ? 81  GLU A OE2 1 
ATOM   654  N N   . LYS A 1 87  ? 5.586   -3.131  59.900  1.00 58.59  ? 82  LYS A N   1 
ATOM   655  C CA  . LYS A 1 87  ? 5.020   -1.930  59.266  1.00 57.11  ? 82  LYS A CA  1 
ATOM   656  C C   . LYS A 1 87  ? 4.849   -2.108  57.766  1.00 53.11  ? 82  LYS A C   1 
ATOM   657  O O   . LYS A 1 87  ? 3.849   -1.710  57.187  1.00 53.13  ? 82  LYS A O   1 
ATOM   658  C CB  . LYS A 1 87  ? 5.863   -0.689  59.552  1.00 57.64  ? 82  LYS A CB  1 
ATOM   659  C CG  . LYS A 1 87  ? 5.286   0.212   60.633  1.00 62.11  ? 82  LYS A CG  1 
ATOM   660  C CD  . LYS A 1 87  ? 6.370   0.941   61.406  1.00 64.51  ? 82  LYS A CD  1 
ATOM   661  C CE  . LYS A 1 87  ? 5.814   2.138   62.174  1.00 69.80  ? 82  LYS A CE  1 
ATOM   662  N NZ  . LYS A 1 87  ? 4.683   1.810   63.105  1.00 74.07  ? 82  LYS A NZ  1 
ATOM   663  N N   . PHE A 1 88  ? 5.834   -2.725  57.141  1.00 49.94  ? 83  PHE A N   1 
ATOM   664  C CA  . PHE A 1 88  ? 5.853   -2.776  55.732  1.00 45.78  ? 83  PHE A CA  1 
ATOM   665  C C   . PHE A 1 88  ? 4.975   -3.860  55.141  1.00 44.86  ? 83  PHE A C   1 
ATOM   666  O O   . PHE A 1 88  ? 4.323   -3.614  54.135  1.00 44.07  ? 83  PHE A O   1 
ATOM   667  C CB  . PHE A 1 88  ? 7.283   -2.836  55.211  1.00 43.22  ? 83  PHE A CB  1 
ATOM   668  C CG  . PHE A 1 88  ? 8.041   -1.550  55.376  1.00 43.56  ? 83  PHE A CG  1 
ATOM   669  C CD1 . PHE A 1 88  ? 7.391   -0.375  55.737  1.00 43.53  ? 83  PHE A CD1 1 
ATOM   670  C CD2 . PHE A 1 88  ? 9.416   -1.505  55.141  1.00 43.93  ? 83  PHE A CD2 1 
ATOM   671  C CE1 . PHE A 1 88  ? 8.087   0.817   55.877  1.00 44.35  ? 83  PHE A CE1 1 
ATOM   672  C CE2 . PHE A 1 88  ? 10.133  -0.305  55.278  1.00 44.41  ? 83  PHE A CE2 1 
ATOM   673  C CZ  . PHE A 1 88  ? 9.455   0.859   55.646  1.00 46.23  ? 83  PHE A CZ  1 
ATOM   674  N N   . THR A 1 89  ? 4.952   -5.050  55.721  1.00 45.17  ? 84  THR A N   1 
ATOM   675  C CA  . THR A 1 89  ? 4.103   -6.087  55.141  1.00 45.09  ? 84  THR A CA  1 
ATOM   676  C C   . THR A 1 89  ? 2.628   -5.724  55.275  1.00 45.58  ? 84  THR A C   1 
ATOM   677  O O   . THR A 1 89  ? 1.821   -6.107  54.429  1.00 44.13  ? 84  THR A O   1 
ATOM   678  C CB  . THR A 1 89  ? 4.318   -7.504  55.722  1.00 46.47  ? 84  THR A CB  1 
ATOM   679  O OG1 . THR A 1 89  ? 3.921   -7.530  57.084  1.00 51.92  ? 84  THR A OG1 1 
ATOM   680  C CG2 . THR A 1 89  ? 5.749   -7.942  55.602  1.00 46.46  ? 84  THR A CG2 1 
ATOM   681  N N   . VAL A 1 90  ? 2.275   -4.996  56.329  1.00 47.57  ? 85  VAL A N   1 
ATOM   682  C CA  . VAL A 1 90  ? 0.883   -4.554  56.498  1.00 49.24  ? 85  VAL A CA  1 
ATOM   683  C C   . VAL A 1 90  ? 0.559   -3.528  55.423  1.00 46.50  ? 85  VAL A C   1 
ATOM   684  O O   . VAL A 1 90  ? -0.494  -3.582  54.812  1.00 46.66  ? 85  VAL A O   1 
ATOM   685  C CB  . VAL A 1 90  ? 0.574   -4.057  57.948  1.00 53.12  ? 85  VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 90  ? -0.794  -3.371  58.055  1.00 55.13  ? 85  VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 90  ? 0.580   -5.232  58.897  1.00 57.32  ? 85  VAL A CG2 1 
ATOM   688  N N   . SER A 1 91  ? 1.518   -2.653  55.149  1.00 45.04  ? 86  SER A N   1 
ATOM   689  C CA  . SER A 1 91  ? 1.351   -1.562  54.211  1.00 42.41  ? 86  SER A CA  1 
ATOM   690  C C   . SER A 1 91  ? 1.290   -2.038  52.749  1.00 39.63  ? 86  SER A C   1 
ATOM   691  O O   . SER A 1 91  ? 0.501   -1.522  51.951  1.00 37.36  ? 86  SER A O   1 
ATOM   692  C CB  . SER A 1 91  ? 2.441   -0.531  54.465  1.00 42.42  ? 86  SER A CB  1 
ATOM   693  O OG  . SER A 1 91  ? 2.750   0.230   53.321  1.00 41.90  ? 86  SER A OG  1 
ATOM   694  N N   . LEU A 1 92  ? 2.106   -3.036  52.423  1.00 38.75  ? 87  LEU A N   1 
ATOM   695  C CA  . LEU A 1 92  ? 2.061   -3.666  51.122  1.00 37.71  ? 87  LEU A CA  1 
ATOM   696  C C   . LEU A 1 92  ? 0.743   -4.422  50.964  1.00 38.08  ? 87  LEU A C   1 
ATOM   697  O O   . LEU A 1 92  ? 0.127   -4.352  49.918  1.00 36.63  ? 87  LEU A O   1 
ATOM   698  C CB  . LEU A 1 92  ? 3.278   -4.589  50.884  1.00 37.06  ? 87  LEU A CB  1 
ATOM   699  C CG  . LEU A 1 92  ? 4.706   -4.005  50.687  1.00 38.31  ? 87  LEU A CG  1 
ATOM   700  C CD1 . LEU A 1 92  ? 5.805   -5.044  50.915  1.00 37.81  ? 87  LEU A CD1 1 
ATOM   701  C CD2 . LEU A 1 92  ? 4.936   -3.341  49.344  1.00 35.96  ? 87  LEU A CD2 1 
ATOM   702  N N   . ASN A 1 93  ? 0.324   -5.150  51.992  1.00 40.48  ? 88  ASN A N   1 
ATOM   703  C CA  . ASN A 1 93  ? -0.965  -5.806  51.964  1.00 42.60  ? 88  ASN A CA  1 
ATOM   704  C C   . ASN A 1 93  ? -2.087  -4.831  51.814  1.00 42.94  ? 88  ASN A C   1 
ATOM   705  O O   . ASN A 1 93  ? -3.079  -5.145  51.175  1.00 43.69  ? 88  ASN A O   1 
ATOM   706  C CB  . ASN A 1 93  ? -1.213  -6.659  53.193  1.00 45.87  ? 88  ASN A CB  1 
ATOM   707  C CG  . ASN A 1 93  ? -0.655  -8.031  53.037  1.00 48.10  ? 88  ASN A CG  1 
ATOM   708  O OD1 . ASN A 1 93  ? -0.542  -8.532  51.911  1.00 47.17  ? 88  ASN A OD1 1 
ATOM   709  N ND2 . ASN A 1 93  ? -0.266  -8.652  54.155  1.00 50.68  ? 88  ASN A ND2 1 
ATOM   710  N N   . HIS A 1 94  ? -1.937  -3.653  52.411  1.00 43.42  ? 89  HIS A N   1 
ATOM   711  C CA  . HIS A 1 94  ? -2.950  -2.610  52.292  1.00 42.80  ? 89  HIS A CA  1 
ATOM   712  C C   . HIS A 1 94  ? -3.188  -2.206  50.831  1.00 39.61  ? 89  HIS A C   1 
ATOM   713  O O   . HIS A 1 94  ? -4.347  -2.110  50.383  1.00 39.01  ? 89  HIS A O   1 
ATOM   714  C CB  . HIS A 1 94  ? -2.565  -1.403  53.146  1.00 44.60  ? 89  HIS A CB  1 
ATOM   715  C CG  . HIS A 1 94  ? -3.498  -0.244  52.995  1.00 47.04  ? 89  HIS A CG  1 
ATOM   716  N ND1 . HIS A 1 94  ? -3.198  0.851   52.211  1.00 43.88  ? 89  HIS A ND1 1 
ATOM   717  C CD2 . HIS A 1 94  ? -4.740  -0.027  53.502  1.00 47.67  ? 89  HIS A CD2 1 
ATOM   718  C CE1 . HIS A 1 94  ? -4.218  1.693   52.246  1.00 46.91  ? 89  HIS A CE1 1 
ATOM   719  N NE2 . HIS A 1 94  ? -5.162  1.185   53.027  1.00 48.64  ? 89  HIS A NE2 1 
ATOM   720  N N   . LYS A 1 95  ? -2.095  -2.013  50.088  1.00 37.05  ? 90  LYS A N   1 
ATOM   721  C CA  . LYS A 1 95  ? -2.141  -1.581  48.689  1.00 35.08  ? 90  LYS A CA  1 
ATOM   722  C C   . LYS A 1 95  ? -2.888  -2.594  47.822  1.00 33.73  ? 90  LYS A C   1 
ATOM   723  O O   . LYS A 1 95  ? -3.618  -2.219  46.915  1.00 33.66  ? 90  LYS A O   1 
ATOM   724  C CB  . LYS A 1 95  ? -0.718  -1.357  48.111  1.00 33.81  ? 90  LYS A CB  1 
ATOM   725  C CG  . LYS A 1 95  ? 0.090   -0.249  48.781  1.00 34.17  ? 90  LYS A CG  1 
ATOM   726  C CD  . LYS A 1 95  ? -0.753  0.948   49.195  1.00 33.32  ? 90  LYS A CD  1 
ATOM   727  C CE  . LYS A 1 95  ? -0.071  1.769   50.330  1.00 35.09  ? 90  LYS A CE  1 
ATOM   728  N NZ  . LYS A 1 95  ? -0.045  1.091   51.659  1.00 36.62  ? 90  LYS A NZ  1 
ATOM   729  N N   . LEU A 1 96  ? -2.713  -3.873  48.131  1.00 34.43  ? 91  LEU A N   1 
ATOM   730  C CA  . LEU A 1 96  ? -3.432  -4.977  47.481  1.00 34.63  ? 91  LEU A CA  1 
ATOM   731  C C   . LEU A 1 96  ? -4.899  -4.972  47.802  1.00 36.59  ? 91  LEU A C   1 
ATOM   732  O O   . LEU A 1 96  ? -5.690  -5.321  46.938  1.00 37.64  ? 91  LEU A O   1 
ATOM   733  C CB  . LEU A 1 96  ? -2.822  -6.334  47.863  1.00 34.46  ? 91  LEU A CB  1 
ATOM   734  C CG  . LEU A 1 96  ? -1.303  -6.374  47.622  1.00 35.20  ? 91  LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 96  ? -0.713  -7.675  48.099  1.00 36.47  ? 91  LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 96  ? -0.876  -6.047  46.140  1.00 31.87  ? 91  LEU A CD2 1 
ATOM   737  N N   . ASP A 1 97  ? -5.267  -4.605  49.031  1.00 39.33  ? 92  ASP A N   1 
ATOM   738  C CA  . ASP A 1 97  ? -6.686  -4.516  49.414  1.00 42.01  ? 92  ASP A CA  1 
ATOM   739  C C   . ASP A 1 97  ? -7.375  -3.364  48.685  1.00 40.73  ? 92  ASP A C   1 
ATOM   740  O O   . ASP A 1 97  ? -8.451  -3.517  48.159  1.00 40.37  ? 92  ASP A O   1 
ATOM   741  C CB  . ASP A 1 97  ? -6.865  -4.376  50.930  1.00 45.10  ? 92  ASP A CB  1 
ATOM   742  C CG  . ASP A 1 97  ? -6.555  -5.653  51.663  1.00 49.47  ? 92  ASP A CG  1 
ATOM   743  O OD1 . ASP A 1 97  ? -6.316  -6.674  50.983  1.00 51.69  ? 92  ASP A OD1 1 
ATOM   744  O OD2 . ASP A 1 97  ? -6.527  -5.643  52.916  1.00 55.47  ? 92  ASP A OD2 1 
ATOM   745  N N   . SER A 1 98  ? -6.698  -2.228  48.624  1.00 40.81  ? 93  SER A N   1 
ATOM   746  C CA  . SER A 1 98  ? -7.217  -1.055  47.987  1.00 40.42  ? 93  SER A CA  1 
ATOM   747  C C   . SER A 1 98  ? -7.320  -1.342  46.487  1.00 38.72  ? 93  SER A C   1 
ATOM   748  O O   . SER A 1 98  ? -8.222  -0.854  45.802  1.00 38.73  ? 93  SER A O   1 
ATOM   749  C CB  . SER A 1 98  ? -6.298  0.115   48.301  1.00 40.49  ? 93  SER A CB  1 
ATOM   750  O OG  . SER A 1 98  ? -6.541  1.219   47.473  1.00 41.70  ? 93  SER A OG  1 
ATOM   751  N N   . HIS A 1 99  ? -6.430  -2.197  45.994  1.00 37.64  ? 94  HIS A N   1 
ATOM   752  C CA  . HIS A 1 99  ? -6.408  -2.491  44.597  1.00 35.48  ? 94  HIS A CA  1 
ATOM   753  C C   . HIS A 1 99  ? -7.539  -3.419  44.268  1.00 35.78  ? 94  HIS A C   1 
ATOM   754  O O   . HIS A 1 99  ? -8.180  -3.251  43.228  1.00 35.15  ? 94  HIS A O   1 
ATOM   755  C CB  . HIS A 1 99  ? -5.074  -3.084  44.158  1.00 33.93  ? 94  HIS A CB  1 
ATOM   756  C CG  . HIS A 1 99  ? -4.875  -3.052  42.683  1.00 34.08  ? 94  HIS A CG  1 
ATOM   757  N ND1 . HIS A 1 99  ? -3.696  -2.647  42.097  1.00 36.57  ? 94  HIS A ND1 1 
ATOM   758  C CD2 . HIS A 1 99  ? -5.712  -3.370  41.664  1.00 35.38  ? 94  HIS A CD2 1 
ATOM   759  C CE1 . HIS A 1 99  ? -3.827  -2.695  40.783  1.00 36.04  ? 94  HIS A CE1 1 
ATOM   760  N NE2 . HIS A 1 99  ? -5.039  -3.134  40.499  1.00 32.46  ? 94  HIS A NE2 1 
ATOM   761  N N   . ALA A 1 100 ? -7.754  -4.406  45.139  1.00 37.52  ? 95  ALA A N   1 
ATOM   762  C CA  . ALA A 1 100 ? -8.907  -5.332  45.053  1.00 38.72  ? 95  ALA A CA  1 
ATOM   763  C C   . ALA A 1 100 ? -10.225 -4.576  45.082  1.00 39.75  ? 95  ALA A C   1 
ATOM   764  O O   . ALA A 1 100 ? -11.179 -4.948  44.392  1.00 40.27  ? 95  ALA A O   1 
ATOM   765  C CB  . ALA A 1 100 ? -8.870  -6.354  46.167  1.00 39.75  ? 95  ALA A CB  1 
ATOM   766  N N   . GLU A 1 101 ? -10.280 -3.532  45.903  1.00 40.77  ? 96  GLU A N   1 
ATOM   767  C CA  . GLU A 1 101 ? -11.424 -2.622  45.940  1.00 41.31  ? 96  GLU A CA  1 
ATOM   768  C C   . GLU A 1 101 ? -11.589 -1.909  44.565  1.00 38.23  ? 96  GLU A C   1 
ATOM   769  O O   . GLU A 1 101 ? -12.702 -1.731  44.032  1.00 36.89  ? 96  GLU A O   1 
ATOM   770  C CB  . GLU A 1 101 ? -11.230 -1.629  47.107  1.00 43.89  ? 96  GLU A CB  1 
ATOM   771  C CG  . GLU A 1 101 ? -12.165 -0.434  47.055  1.00 48.28  ? 96  GLU A CG  1 
ATOM   772  C CD  . GLU A 1 101 ? -12.032 0.531   48.223  1.00 55.83  ? 96  GLU A CD  1 
ATOM   773  O OE1 . GLU A 1 101 ? -11.181 0.325   49.122  1.00 57.56  ? 96  GLU A OE1 1 
ATOM   774  O OE2 . GLU A 1 101 ? -12.795 1.518   48.221  1.00 59.65  ? 96  GLU A OE2 1 
ATOM   775  N N   . LEU A 1 102 ? -10.456 -1.551  43.969  1.00 35.52  ? 97  LEU A N   1 
ATOM   776  C CA  . LEU A 1 102 ? -10.451 -0.876  42.689  1.00 33.66  ? 97  LEU A CA  1 
ATOM   777  C C   . LEU A 1 102 ? -10.984 -1.794  41.567  1.00 31.99  ? 97  LEU A C   1 
ATOM   778  O O   . LEU A 1 102 ? -11.733 -1.353  40.714  1.00 30.09  ? 97  LEU A O   1 
ATOM   779  C CB  . LEU A 1 102 ? -9.038  -0.292  42.357  1.00 32.41  ? 97  LEU A CB  1 
ATOM   780  C CG  . LEU A 1 102 ? -8.755  0.085   40.885  1.00 29.89  ? 97  LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 102 ? -9.729  1.166   40.351  1.00 30.52  ? 97  LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 102 ? -7.290  0.458   40.593  1.00 26.13  ? 97  LEU A CD2 1 
ATOM   783  N N   . LEU A 1 103 ? -10.569 -3.055  41.557  1.00 32.83  ? 98  LEU A N   1 
ATOM   784  C CA  . LEU A 1 103 ? -11.085 -4.015  40.588  1.00 32.65  ? 98  LEU A CA  1 
ATOM   785  C C   . LEU A 1 103 ? -12.601 -4.222  40.809  1.00 34.34  ? 98  LEU A C   1 
ATOM   786  O O   . LEU A 1 103 ? -13.357 -4.315  39.860  1.00 33.38  ? 98  LEU A O   1 
ATOM   787  C CB  . LEU A 1 103 ? -10.331 -5.344  40.699  1.00 33.12  ? 98  LEU A CB  1 
ATOM   788  C CG  . LEU A 1 103 ? -8.830  -5.380  40.336  1.00 32.97  ? 98  LEU A CG  1 
ATOM   789  C CD1 . LEU A 1 103 ? -8.310  -6.790  40.504  1.00 32.99  ? 98  LEU A CD1 1 
ATOM   790  C CD2 . LEU A 1 103 ? -8.595  -4.907  38.915  1.00 30.14  ? 98  LEU A CD2 1 
ATOM   791  N N   . ASP A 1 104 ? -13.033 -4.280  42.069  1.00 36.88  ? 99  ASP A N   1 
ATOM   792  C CA  . ASP A 1 104 ? -14.470 -4.351  42.402  1.00 39.42  ? 99  ASP A CA  1 
ATOM   793  C C   . ASP A 1 104 ? -15.289 -3.219  41.769  1.00 38.42  ? 99  ASP A C   1 
ATOM   794  O O   . ASP A 1 104 ? -16.309 -3.474  41.149  1.00 38.60  ? 99  ASP A O   1 
ATOM   795  C CB  . ASP A 1 104 ? -14.703 -4.298  43.913  1.00 41.75  ? 99  ASP A CB  1 
ATOM   796  C CG  . ASP A 1 104 ? -14.288 -5.555  44.615  1.00 46.71  ? 99  ASP A CG  1 
ATOM   797  O OD1 . ASP A 1 104 ? -14.219 -6.613  43.969  1.00 48.18  ? 99  ASP A OD1 1 
ATOM   798  O OD2 . ASP A 1 104 ? -14.064 -5.502  45.852  1.00 54.56  ? 99  ASP A OD2 1 
ATOM   799  N N   . ALA A 1 105 ? -14.825 -1.982  41.958  1.00 37.84  ? 100 ALA A N   1 
ATOM   800  C CA  . ALA A 1 105 ? -15.490 -0.803  41.486  1.00 37.44  ? 100 ALA A CA  1 
ATOM   801  C C   . ALA A 1 105 ? -15.523 -0.820  39.969  1.00 35.67  ? 100 ALA A C   1 
ATOM   802  O O   . ALA A 1 105 ? -16.524 -0.490  39.384  1.00 37.00  ? 100 ALA A O   1 
ATOM   803  C CB  . ALA A 1 105 ? -14.796 0.445   42.006  1.00 37.34  ? 100 ALA A CB  1 
ATOM   804  N N   . THR A 1 106 ? -14.431 -1.242  39.347  1.00 34.31  ? 101 THR A N   1 
ATOM   805  C CA  . THR A 1 106 ? -14.326 -1.297  37.924  1.00 31.85  ? 101 THR A CA  1 
ATOM   806  C C   . THR A 1 106 ? -15.339 -2.289  37.372  1.00 33.29  ? 101 THR A C   1 
ATOM   807  O O   . THR A 1 106 ? -16.053 -2.000  36.405  1.00 32.89  ? 101 THR A O   1 
ATOM   808  C CB  . THR A 1 106 ? -12.904 -1.675  37.492  1.00 29.93  ? 101 THR A CB  1 
ATOM   809  O OG1 . THR A 1 106 ? -12.007 -0.667  37.953  1.00 27.62  ? 101 THR A OG1 1 
ATOM   810  C CG2 . THR A 1 106 ? -12.810 -1.750  35.968  1.00 28.80  ? 101 THR A CG2 1 
ATOM   811  N N   . GLN A 1 107 ? -15.389 -3.463  37.976  1.00 33.32  ? 102 GLN A N   1 
ATOM   812  C CA  . GLN A 1 107 ? -16.443 -4.378  37.633  1.00 34.89  ? 102 GLN A CA  1 
ATOM   813  C C   . GLN A 1 107 ? -17.870 -3.783  37.895  1.00 35.43  ? 102 GLN A C   1 
ATOM   814  O O   . GLN A 1 107 ? -18.773 -3.943  37.077  1.00 34.01  ? 102 GLN A O   1 
ATOM   815  C CB  . GLN A 1 107 ? -16.257 -5.693  38.387  1.00 36.29  ? 102 GLN A CB  1 
ATOM   816  C CG  . GLN A 1 107 ? -17.390 -6.616  38.184  1.00 38.60  ? 102 GLN A CG  1 
ATOM   817  C CD  . GLN A 1 107 ? -17.055 -8.025  38.546  1.00 42.63  ? 102 GLN A CD  1 
ATOM   818  O OE1 . GLN A 1 107 ? -16.623 -8.300  39.650  1.00 42.06  ? 102 GLN A OE1 1 
ATOM   819  N NE2 . GLN A 1 107 ? -17.278 -8.942  37.610  1.00 46.23  ? 102 GLN A NE2 1 
ATOM   820  N N   . HIS A 1 108 ? -18.059 -3.088  39.016  1.00 36.60  ? 103 HIS A N   1 
ATOM   821  C CA  . HIS A 1 108 ? -19.375 -2.485  39.262  1.00 38.70  ? 103 HIS A CA  1 
ATOM   822  C C   . HIS A 1 108 ? -19.816 -1.511  38.164  1.00 36.35  ? 103 HIS A C   1 
ATOM   823  O O   . HIS A 1 108 ? -20.970 -1.535  37.747  1.00 35.11  ? 103 HIS A O   1 
ATOM   824  C CB  . HIS A 1 108 ? -19.493 -1.905  40.677  1.00 41.13  ? 103 HIS A CB  1 
ATOM   825  C CG  . HIS A 1 108 ? -19.195 -2.914  41.737  1.00 46.57  ? 103 HIS A CG  1 
ATOM   826  N ND1 . HIS A 1 108 ? -18.869 -2.569  43.032  1.00 51.73  ? 103 HIS A ND1 1 
ATOM   827  C CD2 . HIS A 1 108 ? -19.133 -4.270  41.675  1.00 47.85  ? 103 HIS A CD2 1 
ATOM   828  C CE1 . HIS A 1 108 ? -18.645 -3.674  43.726  1.00 55.07  ? 103 HIS A CE1 1 
ATOM   829  N NE2 . HIS A 1 108 ? -18.781 -4.716  42.920  1.00 51.98  ? 103 HIS A NE2 1 
ATOM   830  N N   . THR A 1 109 ? -18.891 -0.697  37.666  1.00 35.24  ? 104 THR A N   1 
ATOM   831  C CA  . THR A 1 109 ? -19.271 0.232   36.612  1.00 34.39  ? 104 THR A CA  1 
ATOM   832  C C   . THR A 1 109 ? -19.418 -0.450  35.254  1.00 32.69  ? 104 THR A C   1 
ATOM   833  O O   . THR A 1 109 ? -20.195 0.008   34.450  1.00 32.14  ? 104 THR A O   1 
ATOM   834  C CB  . THR A 1 109 ? -18.419 1.524   36.583  1.00 34.59  ? 104 THR A CB  1 
ATOM   835  O OG1 . THR A 1 109 ? -19.068 2.496   35.749  1.00 36.01  ? 104 THR A OG1 1 
ATOM   836  C CG2 . THR A 1 109 ? -17.013 1.276   36.042  1.00 32.51  ? 104 THR A CG2 1 
ATOM   837  N N   . LEU A 1 110 ? -18.682 -1.542  34.996  1.00 31.55  ? 105 LEU A N   1 
ATOM   838  C CA  . LEU A 1 110 ? -18.898 -2.328  33.782  1.00 30.88  ? 105 LEU A CA  1 
ATOM   839  C C   . LEU A 1 110 ? -20.318 -2.874  33.764  1.00 32.16  ? 105 LEU A C   1 
ATOM   840  O O   . LEU A 1 110 ? -20.965 -2.873  32.707  1.00 31.88  ? 105 LEU A O   1 
ATOM   841  C CB  . LEU A 1 110 ? -17.917 -3.516  33.637  1.00 30.25  ? 105 LEU A CB  1 
ATOM   842  C CG  . LEU A 1 110 ? -16.562 -3.206  32.982  1.00 30.87  ? 105 LEU A CG  1 
ATOM   843  C CD1 . LEU A 1 110 ? -15.583 -4.355  33.208  1.00 33.00  ? 105 LEU A CD1 1 
ATOM   844  C CD2 . LEU A 1 110 ? -16.699 -2.863  31.462  1.00 27.40  ? 105 LEU A CD2 1 
ATOM   845  N N   . GLN A 1 111 ? -20.747 -3.392  34.917  1.00 32.96  ? 106 GLN A N   1 
ATOM   846  C CA  . GLN A 1 111 ? -22.065 -3.996  35.095  1.00 35.05  ? 106 GLN A CA  1 
ATOM   847  C C   . GLN A 1 111 ? -23.169 -2.949  34.913  1.00 35.13  ? 106 GLN A C   1 
ATOM   848  O O   . GLN A 1 111 ? -24.061 -3.133  34.083  1.00 35.43  ? 106 GLN A O   1 
ATOM   849  C CB  . GLN A 1 111 ? -22.176 -4.710  36.450  1.00 36.70  ? 106 GLN A CB  1 
ATOM   850  C CG  . GLN A 1 111 ? -21.372 -6.034  36.467  1.00 40.58  ? 106 GLN A CG  1 
ATOM   851  C CD  . GLN A 1 111 ? -21.261 -6.762  37.839  1.00 45.89  ? 106 GLN A CD  1 
ATOM   852  O OE1 . GLN A 1 111 ? -21.529 -6.207  38.901  1.00 46.37  ? 106 GLN A OE1 1 
ATOM   853  N NE2 . GLN A 1 111 ? -20.863 -8.031  37.785  1.00 49.16  ? 106 GLN A NE2 1 
ATOM   854  N N   . GLN A 1 112 ? -23.074 -1.834  35.644  1.00 35.50  ? 107 GLN A N   1 
ATOM   855  C CA  . GLN A 1 112 ? -24.173 -0.839  35.728  1.00 35.70  ? 107 GLN A CA  1 
ATOM   856  C C   . GLN A 1 112 ? -24.267 0.001   34.460  1.00 34.13  ? 107 GLN A C   1 
ATOM   857  O O   . GLN A 1 112 ? -25.335 0.451   34.096  1.00 33.07  ? 107 GLN A O   1 
ATOM   858  C CB  . GLN A 1 112 ? -24.012 0.049   36.953  1.00 36.12  ? 107 GLN A CB  1 
ATOM   859  C CG  . GLN A 1 112 ? -24.130 -0.754  38.267  1.00 42.02  ? 107 GLN A CG  1 
ATOM   860  C CD  . GLN A 1 112 ? -23.900 0.060   39.521  1.00 48.74  ? 107 GLN A CD  1 
ATOM   861  O OE1 . GLN A 1 112 ? -24.151 1.270   39.553  1.00 50.84  ? 107 GLN A OE1 1 
ATOM   862  N NE2 . GLN A 1 112 ? -23.442 -0.616  40.591  1.00 52.64  ? 107 GLN A NE2 1 
ATOM   863  N N   . GLN A 1 113 ? -23.132 0.227   33.800  1.00 33.03  ? 108 GLN A N   1 
ATOM   864  C CA  . GLN A 1 113 ? -23.159 1.107   32.663  1.00 33.46  ? 108 GLN A CA  1 
ATOM   865  C C   . GLN A 1 113 ? -23.130 0.363   31.360  1.00 33.51  ? 108 GLN A C   1 
ATOM   866  O O   . GLN A 1 113 ? -23.904 0.709   30.466  1.00 35.88  ? 108 GLN A O   1 
ATOM   867  C CB  . GLN A 1 113 ? -22.093 2.186   32.723  1.00 34.00  ? 108 GLN A CB  1 
ATOM   868  C CG  . GLN A 1 113 ? -22.515 3.490   33.463  1.00 37.48  ? 108 GLN A CG  1 
ATOM   869  C CD  . GLN A 1 113 ? -22.665 3.313   34.967  1.00 41.45  ? 108 GLN A CD  1 
ATOM   870  O OE1 . GLN A 1 113 ? -21.769 2.797   35.651  1.00 44.81  ? 108 GLN A OE1 1 
ATOM   871  N NE2 . GLN A 1 113 ? -23.799 3.740   35.494  1.00 40.80  ? 108 GLN A NE2 1 
ATOM   872  N N   . ILE A 1 114 ? -22.265 -0.652  31.224  1.00 32.19  ? 109 ILE A N   1 
ATOM   873  C CA  . ILE A 1 114 ? -22.007 -1.224  29.922  1.00 29.08  ? 109 ILE A CA  1 
ATOM   874  C C   . ILE A 1 114 ? -22.876 -2.433  29.691  1.00 29.97  ? 109 ILE A C   1 
ATOM   875  O O   . ILE A 1 114 ? -23.594 -2.512  28.691  1.00 29.94  ? 109 ILE A O   1 
ATOM   876  C CB  . ILE A 1 114 ? -20.477 -1.535  29.737  1.00 28.86  ? 109 ILE A CB  1 
ATOM   877  C CG1 . ILE A 1 114 ? -19.628 -0.283  30.023  1.00 25.71  ? 109 ILE A CG1 1 
ATOM   878  C CG2 . ILE A 1 114 ? -20.201 -2.236  28.412  1.00 26.01  ? 109 ILE A CG2 1 
ATOM   879  C CD1 . ILE A 1 114 ? -19.693 0.826   28.957  1.00 28.33  ? 109 ILE A CD1 1 
ATOM   880  N N   . GLN A 1 115 ? -22.821 -3.380  30.611  1.00 30.95  ? 110 GLN A N   1 
ATOM   881  C CA  . GLN A 1 115 ? -23.647 -4.573  30.531  1.00 32.56  ? 110 GLN A CA  1 
ATOM   882  C C   . GLN A 1 115 ? -25.153 -4.263  30.609  1.00 33.29  ? 110 GLN A C   1 
ATOM   883  O O   . GLN A 1 115 ? -25.920 -4.831  29.859  1.00 32.25  ? 110 GLN A O   1 
ATOM   884  C CB  . GLN A 1 115 ? -23.288 -5.572  31.626  1.00 33.57  ? 110 GLN A CB  1 
ATOM   885  C CG  . GLN A 1 115 ? -23.982 -6.866  31.402  1.00 37.62  ? 110 GLN A CG  1 
ATOM   886  C CD  . GLN A 1 115 ? -23.568 -7.931  32.334  1.00 44.70  ? 110 GLN A CD  1 
ATOM   887  O OE1 . GLN A 1 115 ? -23.675 -7.793  33.557  1.00 48.74  ? 110 GLN A OE1 1 
ATOM   888  N NE2 . GLN A 1 115 ? -23.103 -9.042  31.770  1.00 50.01  ? 110 GLN A NE2 1 
ATOM   889  N N   . THR A 1 116 ? -25.557 -3.386  31.523  1.00 34.05  ? 111 THR A N   1 
ATOM   890  C CA  . THR A 1 116 ? -26.954 -2.902  31.556  1.00 37.07  ? 111 THR A CA  1 
ATOM   891  C C   . THR A 1 116 ? -27.384 -2.170  30.234  1.00 35.73  ? 111 THR A C   1 
ATOM   892  O O   . THR A 1 116 ? -28.470 -2.443  29.741  1.00 36.09  ? 111 THR A O   1 
ATOM   893  C CB  . THR A 1 116 ? -27.260 -2.115  32.863  1.00 38.31  ? 111 THR A CB  1 
ATOM   894  O OG1 . THR A 1 116 ? -27.233 -3.043  33.958  1.00 42.47  ? 111 THR A OG1 1 
ATOM   895  C CG2 . THR A 1 116 ? -28.653 -1.460  32.821  1.00 39.78  ? 111 THR A CG2 1 
ATOM   896  N N   . LEU A 1 117 ? -26.520 -1.335  29.637  1.00 34.19  ? 112 LEU A N   1 
ATOM   897  C CA  . LEU A 1 117 ? -26.789 -0.784  28.283  1.00 33.93  ? 112 LEU A CA  1 
ATOM   898  C C   . LEU A 1 117 ? -27.128 -1.867  27.251  1.00 34.37  ? 112 LEU A C   1 
ATOM   899  O O   . LEU A 1 117 ? -28.152 -1.775  26.598  1.00 35.13  ? 112 LEU A O   1 
ATOM   900  C CB  . LEU A 1 117 ? -25.610 -0.035  27.709  1.00 32.73  ? 112 LEU A CB  1 
ATOM   901  C CG  . LEU A 1 117 ? -25.818 1.325   26.998  1.00 34.66  ? 112 LEU A CG  1 
ATOM   902  C CD1 . LEU A 1 117 ? -24.713 1.628   26.014  1.00 29.47  ? 112 LEU A CD1 1 
ATOM   903  C CD2 . LEU A 1 117 ? -27.168 1.615   26.332  1.00 34.96  ? 112 LEU A CD2 1 
ATOM   904  N N   . VAL A 1 118 ? -26.279 -2.891  27.136  1.00 33.50  ? 113 VAL A N   1 
ATOM   905  C CA  . VAL A 1 118 ? -26.369 -3.866  26.069  1.00 34.34  ? 113 VAL A CA  1 
ATOM   906  C C   . VAL A 1 118 ? -27.533 -4.852  26.277  1.00 36.32  ? 113 VAL A C   1 
ATOM   907  O O   . VAL A 1 118 ? -28.118 -5.335  25.319  1.00 36.65  ? 113 VAL A O   1 
ATOM   908  C CB  . VAL A 1 118 ? -24.962 -4.537  25.757  1.00 34.15  ? 113 VAL A CB  1 
ATOM   909  C CG1 . VAL A 1 118 ? -24.613 -5.627  26.749  1.00 35.38  ? 113 VAL A CG1 1 
ATOM   910  C CG2 . VAL A 1 118 ? -24.907 -5.070  24.342  1.00 35.31  ? 113 VAL A CG2 1 
ATOM   911  N N   . LYS A 1 119 ? -27.894 -5.125  27.527  1.00 37.42  ? 114 LYS A N   1 
ATOM   912  C CA  . LYS A 1 119 ? -29.060 -5.924  27.783  1.00 40.15  ? 114 LYS A CA  1 
ATOM   913  C C   . LYS A 1 119 ? -30.327 -5.054  27.859  1.00 40.26  ? 114 LYS A C   1 
ATOM   914  O O   . LYS A 1 119 ? -30.923 -4.706  26.834  1.00 40.38  ? 114 LYS A O   1 
ATOM   915  C CB  . LYS A 1 119 ? -28.839 -6.819  29.003  1.00 42.63  ? 114 LYS A CB  1 
ATOM   916  C CG  . LYS A 1 119 ? -27.770 -7.910  28.708  1.00 45.17  ? 114 LYS A CG  1 
ATOM   917  C CD  . LYS A 1 119 ? -27.265 -8.522  29.988  1.00 50.92  ? 114 LYS A CD  1 
ATOM   918  C CE  . LYS A 1 119 ? -26.338 -9.717  29.764  1.00 53.33  ? 114 LYS A CE  1 
ATOM   919  N NZ  . LYS A 1 119 ? -26.723 -10.796 30.768  1.00 61.31  ? 114 LYS A NZ  1 
ATOM   920  N N   . GLU A 1 120 ? -30.675 -4.634  29.055  1.00 40.15  ? 115 GLU A N   1 
ATOM   921  C CA  . GLU A 1 120 ? -31.853 -3.819  29.298  1.00 40.42  ? 115 GLU A CA  1 
ATOM   922  C C   . GLU A 1 120 ? -31.913 -2.406  28.652  1.00 37.55  ? 115 GLU A C   1 
ATOM   923  O O   . GLU A 1 120 ? -32.990 -1.927  28.314  1.00 37.77  ? 115 GLU A O   1 
ATOM   924  C CB  . GLU A 1 120 ? -32.085 -3.765  30.810  1.00 41.96  ? 115 GLU A CB  1 
ATOM   925  C CG  . GLU A 1 120 ? -32.350 -5.155  31.407  1.00 46.41  ? 115 GLU A CG  1 
ATOM   926  C CD  . GLU A 1 120 ? -33.571 -5.843  30.799  1.00 50.70  ? 115 GLU A CD  1 
ATOM   927  O OE1 . GLU A 1 120 ? -33.677 -7.091  30.902  1.00 51.48  ? 115 GLU A OE1 1 
ATOM   928  O OE2 . GLU A 1 120 ? -34.433 -5.135  30.213  1.00 50.82  ? 115 GLU A OE2 1 
ATOM   929  N N   . GLY A 1 121 ? -30.776 -1.751  28.478  1.00 34.25  ? 116 GLY A N   1 
ATOM   930  C CA  . GLY A 1 121 ? -30.773 -0.406  27.927  1.00 32.47  ? 116 GLY A CA  1 
ATOM   931  C C   . GLY A 1 121 ? -31.271 -0.387  26.471  1.00 31.16  ? 116 GLY A C   1 
ATOM   932  O O   . GLY A 1 121 ? -31.829 0.621   25.995  1.00 30.55  ? 116 GLY A O   1 
ATOM   933  N N   . LEU A 1 122 ? -31.091 -1.508  25.780  1.00 28.88  ? 117 LEU A N   1 
ATOM   934  C CA  . LEU A 1 122 ? -31.506 -1.611  24.406  1.00 28.42  ? 117 LEU A CA  1 
ATOM   935  C C   . LEU A 1 122 ? -32.872 -2.289  24.263  1.00 28.92  ? 117 LEU A C   1 
ATOM   936  O O   . LEU A 1 122 ? -33.350 -2.458  23.170  1.00 28.11  ? 117 LEU A O   1 
ATOM   937  C CB  . LEU A 1 122 ? -30.460 -2.366  23.611  1.00 28.16  ? 117 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 122 ? -29.218 -1.609  23.177  1.00 29.21  ? 117 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 122 ? -28.278 -2.622  22.522  1.00 32.58  ? 117 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 122 ? -29.580 -0.561  22.199  1.00 30.83  ? 117 LEU A CD2 1 
ATOM   941  N N   . ARG A 1 123 ? -33.506 -2.646  25.370  1.00 30.18  ? 118 ARG A N   1 
ATOM   942  C CA  . ARG A 1 123 ? -34.769 -3.367  25.291  1.00 32.89  ? 118 ARG A CA  1 
ATOM   943  C C   . ARG A 1 123 ? -35.834 -2.555  24.549  1.00 32.59  ? 118 ARG A C   1 
ATOM   944  O O   . ARG A 1 123 ? -36.500 -3.096  23.676  1.00 32.93  ? 118 ARG A O   1 
ATOM   945  C CB  . ARG A 1 123 ? -35.294 -3.789  26.669  1.00 34.35  ? 118 ARG A CB  1 
ATOM   946  C CG  . ARG A 1 123 ? -36.693 -4.400  26.590  1.00 37.87  ? 118 ARG A CG  1 
ATOM   947  C CD  . ARG A 1 123 ? -37.212 -4.688  27.946  1.00 43.79  ? 118 ARG A CD  1 
ATOM   948  N NE  . ARG A 1 123 ? -36.333 -5.657  28.614  1.00 47.71  ? 118 ARG A NE  1 
ATOM   949  C CZ  . ARG A 1 123 ? -36.647 -6.924  28.866  1.00 50.28  ? 118 ARG A CZ  1 
ATOM   950  N NH1 . ARG A 1 123 ? -37.837 -7.415  28.530  1.00 51.45  ? 118 ARG A NH1 1 
ATOM   951  N NH2 . ARG A 1 123 ? -35.757 -7.698  29.470  1.00 52.47  ? 118 ARG A NH2 1 
ATOM   952  N N   . GLY A 1 124 ? -36.004 -1.274  24.903  1.00 32.48  ? 119 GLY A N   1 
ATOM   953  C CA  . GLY A 1 124 ? -37.019 -0.434  24.224  1.00 31.55  ? 119 GLY A CA  1 
ATOM   954  C C   . GLY A 1 124 ? -36.798 -0.425  22.719  1.00 29.76  ? 119 GLY A C   1 
ATOM   955  O O   . GLY A 1 124 ? -37.742 -0.508  21.951  1.00 29.35  ? 119 GLY A O   1 
ATOM   956  N N   . PHE A 1 125 ? -35.529 -0.372  22.307  1.00 28.76  ? 120 PHE A N   1 
ATOM   957  C CA  . PHE A 1 125 ? -35.165 -0.345  20.900  1.00 28.81  ? 120 PHE A CA  1 
ATOM   958  C C   . PHE A 1 125 ? -35.578 -1.628  20.229  1.00 30.10  ? 120 PHE A C   1 
ATOM   959  O O   . PHE A 1 125 ? -36.102 -1.594  19.112  1.00 30.81  ? 120 PHE A O   1 
ATOM   960  C CB  . PHE A 1 125 ? -33.656 -0.068  20.706  1.00 28.28  ? 120 PHE A CB  1 
ATOM   961  C CG  . PHE A 1 125 ? -33.171 -0.194  19.261  1.00 30.18  ? 120 PHE A CG  1 
ATOM   962  C CD1 . PHE A 1 125 ? -33.123 0.914   18.414  1.00 33.49  ? 120 PHE A CD1 1 
ATOM   963  C CD2 . PHE A 1 125 ? -32.765 -1.402  18.763  1.00 30.53  ? 120 PHE A CD2 1 
ATOM   964  C CE1 . PHE A 1 125 ? -32.684 0.792   17.091  1.00 32.40  ? 120 PHE A CE1 1 
ATOM   965  C CE2 . PHE A 1 125 ? -32.324 -1.534  17.455  1.00 33.42  ? 120 PHE A CE2 1 
ATOM   966  C CZ  . PHE A 1 125 ? -32.289 -0.420  16.621  1.00 33.70  ? 120 PHE A CZ  1 
ATOM   967  N N   . ARG A 1 126 ? -35.307 -2.758  20.889  1.00 31.36  ? 121 ARG A N   1 
ATOM   968  C CA  . ARG A 1 126 ? -35.589 -4.090  20.340  1.00 32.94  ? 121 ARG A CA  1 
ATOM   969  C C   . ARG A 1 126 ? -37.083 -4.425  20.256  1.00 34.32  ? 121 ARG A C   1 
ATOM   970  O O   . ARG A 1 126 ? -37.517 -5.164  19.343  1.00 34.70  ? 121 ARG A O   1 
ATOM   971  C CB  . ARG A 1 126 ? -34.795 -5.176  21.112  1.00 34.24  ? 121 ARG A CB  1 
ATOM   972  C CG  . ARG A 1 126 ? -33.276 -5.105  20.761  1.00 35.52  ? 121 ARG A CG  1 
ATOM   973  C CD  . ARG A 1 126 ? -32.446 -6.328  21.170  1.00 40.81  ? 121 ARG A CD  1 
ATOM   974  N NE  . ARG A 1 126 ? -32.301 -6.343  22.596  1.00 43.72  ? 121 ARG A NE  1 
ATOM   975  C CZ  . ARG A 1 126 ? -31.209 -6.033  23.299  1.00 43.23  ? 121 ARG A CZ  1 
ATOM   976  N NH1 . ARG A 1 126 ? -30.047 -5.714  22.729  1.00 38.59  ? 121 ARG A NH1 1 
ATOM   977  N NH2 . ARG A 1 126 ? -31.311 -6.074  24.625  1.00 40.15  ? 121 ARG A NH2 1 
ATOM   978  N N   . GLU A 1 127 ? -37.843 -3.899  21.215  1.00 34.23  ? 122 GLU A N   1 
ATOM   979  C CA  . GLU A 1 127 ? -39.281 -4.033  21.233  1.00 37.32  ? 122 GLU A CA  1 
ATOM   980  C C   . GLU A 1 127 ? -39.925 -3.156  20.137  1.00 35.78  ? 122 GLU A C   1 
ATOM   981  O O   . GLU A 1 127 ? -40.798 -3.620  19.402  1.00 36.42  ? 122 GLU A O   1 
ATOM   982  C CB  . GLU A 1 127 ? -39.874 -3.700  22.621  1.00 37.98  ? 122 GLU A CB  1 
ATOM   983  C CG  . GLU A 1 127 ? -39.615 -4.777  23.689  1.00 45.15  ? 122 GLU A CG  1 
ATOM   984  C CD  . GLU A 1 127 ? -40.098 -4.390  25.105  1.00 52.89  ? 122 GLU A CD  1 
ATOM   985  O OE1 . GLU A 1 127 ? -40.132 -3.173  25.454  1.00 54.51  ? 122 GLU A OE1 1 
ATOM   986  O OE2 . GLU A 1 127 ? -40.448 -5.314  25.882  1.00 56.87  ? 122 GLU A OE2 1 
ATOM   987  N N   . ALA A 1 128 ? -39.493 -1.909  20.019  1.00 34.23  ? 123 ALA A N   1 
ATOM   988  C CA  . ALA A 1 128 ? -40.028 -1.015  18.982  1.00 33.77  ? 123 ALA A CA  1 
ATOM   989  C C   . ALA A 1 128 ? -39.646 -1.519  17.597  1.00 33.75  ? 123 ALA A C   1 
ATOM   990  O O   . ALA A 1 128 ? -40.448 -1.440  16.691  1.00 33.84  ? 123 ALA A O   1 
ATOM   991  C CB  . ALA A 1 128 ? -39.565 0.404   19.184  1.00 33.24  ? 123 ALA A CB  1 
ATOM   992  N N   . ARG A 1 129 ? -38.438 -2.069  17.447  1.00 33.98  ? 124 ARG A N   1 
ATOM   993  C CA  . ARG A 1 129 ? -38.045 -2.727  16.201  1.00 35.16  ? 124 ARG A CA  1 
ATOM   994  C C   . ARG A 1 129 ? -38.978 -3.880  15.841  1.00 37.14  ? 124 ARG A C   1 
ATOM   995  O O   . ARG A 1 129 ? -39.455 -3.971  14.706  1.00 38.15  ? 124 ARG A O   1 
ATOM   996  C CB  . ARG A 1 129 ? -36.604 -3.251  16.290  1.00 35.40  ? 124 ARG A CB  1 
ATOM   997  C CG  . ARG A 1 129 ? -36.020 -3.931  15.032  1.00 36.38  ? 124 ARG A CG  1 
ATOM   998  C CD  . ARG A 1 129 ? -34.502 -4.213  15.203  1.00 37.89  ? 124 ARG A CD  1 
ATOM   999  N NE  . ARG A 1 129 ? -33.996 -5.007  14.086  1.00 47.77  ? 124 ARG A NE  1 
ATOM   1000 C CZ  . ARG A 1 129 ? -32.705 -5.316  13.857  1.00 52.58  ? 124 ARG A CZ  1 
ATOM   1001 N NH1 . ARG A 1 129 ? -31.731 -4.905  14.683  1.00 53.79  ? 124 ARG A NH1 1 
ATOM   1002 N NH2 . ARG A 1 129 ? -32.378 -6.032  12.783  1.00 51.69  ? 124 ARG A NH2 1 
ATOM   1003 N N   . ARG A 1 130 ? -39.228 -4.772  16.791  1.00 38.14  ? 125 ARG A N   1 
ATOM   1004 C CA  . ARG A 1 130 ? -40.106 -5.903  16.516  1.00 40.66  ? 125 ARG A CA  1 
ATOM   1005 C C   . ARG A 1 130 ? -41.484 -5.351  16.109  1.00 39.96  ? 125 ARG A C   1 
ATOM   1006 O O   . ARG A 1 130 ? -42.036 -5.763  15.112  1.00 40.16  ? 125 ARG A O   1 
ATOM   1007 C CB  . ARG A 1 130 ? -40.115 -6.917  17.682  1.00 42.14  ? 125 ARG A CB  1 
ATOM   1008 C CG  . ARG A 1 130 ? -41.402 -7.689  17.949  1.00 48.06  ? 125 ARG A CG  1 
ATOM   1009 C CD  . ARG A 1 130 ? -42.251 -6.979  19.047  1.00 54.19  ? 125 ARG A CD  1 
ATOM   1010 N NE  . ARG A 1 130 ? -41.951 -7.396  20.425  1.00 58.69  ? 125 ARG A NE  1 
ATOM   1011 C CZ  . ARG A 1 130 ? -42.399 -6.799  21.538  1.00 59.12  ? 125 ARG A CZ  1 
ATOM   1012 N NH1 . ARG A 1 130 ? -43.168 -5.719  21.494  1.00 60.17  ? 125 ARG A NH1 1 
ATOM   1013 N NH2 . ARG A 1 130 ? -42.060 -7.283  22.720  1.00 60.63  ? 125 ARG A NH2 1 
ATOM   1014 N N   . ASP A 1 131 ? -42.001 -4.381  16.848  1.00 38.90  ? 126 ASP A N   1 
ATOM   1015 C CA  . ASP A 1 131 ? -43.340 -3.875  16.571  1.00 39.51  ? 126 ASP A CA  1 
ATOM   1016 C C   . ASP A 1 131 ? -43.435 -3.160  15.230  1.00 38.69  ? 126 ASP A C   1 
ATOM   1017 O O   . ASP A 1 131 ? -44.474 -3.236  14.555  1.00 39.95  ? 126 ASP A O   1 
ATOM   1018 C CB  . ASP A 1 131 ? -43.860 -3.014  17.708  1.00 39.72  ? 126 ASP A CB  1 
ATOM   1019 C CG  . ASP A 1 131 ? -43.911 -3.769  19.011  1.00 43.31  ? 126 ASP A CG  1 
ATOM   1020 O OD1 . ASP A 1 131 ? -43.939 -5.034  18.966  1.00 44.97  ? 126 ASP A OD1 1 
ATOM   1021 O OD2 . ASP A 1 131 ? -43.902 -3.115  20.074  1.00 46.55  ? 126 ASP A OD2 1 
ATOM   1022 N N   . PHE A 1 132 ? -42.345 -2.515  14.832  1.00 36.75  ? 127 PHE A N   1 
ATOM   1023 C CA  . PHE A 1 132 ? -42.283 -1.838  13.548  1.00 35.87  ? 127 PHE A CA  1 
ATOM   1024 C C   . PHE A 1 132 ? -42.328 -2.826  12.400  1.00 36.33  ? 127 PHE A C   1 
ATOM   1025 O O   . PHE A 1 132 ? -43.088 -2.612  11.458  1.00 36.37  ? 127 PHE A O   1 
ATOM   1026 C CB  . PHE A 1 132 ? -41.044 -0.941  13.429  1.00 34.58  ? 127 PHE A CB  1 
ATOM   1027 C CG  . PHE A 1 132 ? -40.812 -0.402  12.036  1.00 32.91  ? 127 PHE A CG  1 
ATOM   1028 C CD1 . PHE A 1 132 ? -41.508 0.707   11.584  1.00 35.31  ? 127 PHE A CD1 1 
ATOM   1029 C CD2 . PHE A 1 132 ? -39.892 -0.996  11.192  1.00 32.20  ? 127 PHE A CD2 1 
ATOM   1030 C CE1 . PHE A 1 132 ? -41.299 1.209   10.275  1.00 35.76  ? 127 PHE A CE1 1 
ATOM   1031 C CE2 . PHE A 1 132 ? -39.687 -0.512  9.898   1.00 34.11  ? 127 PHE A CE2 1 
ATOM   1032 C CZ  . PHE A 1 132 ? -40.392 0.595   9.444   1.00 32.89  ? 127 PHE A CZ  1 
ATOM   1033 N N   . TRP A 1 133 ? -41.506 -3.874  12.463  1.00 36.57  ? 128 TRP A N   1 
ATOM   1034 C CA  . TRP A 1 133 ? -41.506 -4.918  11.418  1.00 38.55  ? 128 TRP A CA  1 
ATOM   1035 C C   . TRP A 1 133 ? -42.767 -5.785  11.433  1.00 39.35  ? 128 TRP A C   1 
ATOM   1036 O O   . TRP A 1 133 ? -43.224 -6.227  10.385  1.00 40.14  ? 128 TRP A O   1 
ATOM   1037 C CB  . TRP A 1 133 ? -40.204 -5.743  11.409  1.00 39.29  ? 128 TRP A CB  1 
ATOM   1038 C CG  . TRP A 1 133 ? -39.012 -4.885  11.030  1.00 40.70  ? 128 TRP A CG  1 
ATOM   1039 C CD1 . TRP A 1 133 ? -38.003 -4.436  11.864  1.00 40.07  ? 128 TRP A CD1 1 
ATOM   1040 C CD2 . TRP A 1 133 ? -38.744 -4.320  9.744   1.00 41.80  ? 128 TRP A CD2 1 
ATOM   1041 N NE1 . TRP A 1 133 ? -37.114 -3.648  11.156  1.00 39.21  ? 128 TRP A NE1 1 
ATOM   1042 C CE2 . TRP A 1 133 ? -37.552 -3.551  9.860   1.00 41.09  ? 128 TRP A CE2 1 
ATOM   1043 C CE3 . TRP A 1 133 ? -39.393 -4.386  8.499   1.00 43.66  ? 128 TRP A CE3 1 
ATOM   1044 C CZ2 . TRP A 1 133 ? -36.987 -2.881  8.773   1.00 42.12  ? 128 TRP A CZ2 1 
ATOM   1045 C CZ3 . TRP A 1 133 ? -38.826 -3.715  7.413   1.00 44.97  ? 128 TRP A CZ3 1 
ATOM   1046 C CH2 . TRP A 1 133 ? -37.631 -2.975  7.561   1.00 45.67  ? 128 TRP A CH2 1 
ATOM   1047 N N   . ARG A 1 134 ? -43.345 -6.018  12.605  1.00 39.42  ? 129 ARG A N   1 
ATOM   1048 C CA  . ARG A 1 134 ? -44.693 -6.604  12.632  1.00 42.37  ? 129 ARG A CA  1 
ATOM   1049 C C   . ARG A 1 134 ? -45.673 -5.632  11.940  1.00 40.66  ? 129 ARG A C   1 
ATOM   1050 O O   . ARG A 1 134 ? -46.486 -6.036  11.132  1.00 43.38  ? 129 ARG A O   1 
ATOM   1051 C CB  . ARG A 1 134 ? -45.152 -6.998  14.058  1.00 43.30  ? 129 ARG A CB  1 
ATOM   1052 C CG  . ARG A 1 134 ? -46.490 -7.828  14.079  1.00 50.25  ? 129 ARG A CG  1 
ATOM   1053 C CD  . ARG A 1 134 ? -47.123 -8.048  15.490  1.00 56.02  ? 129 ARG A CD  1 
ATOM   1054 N NE  . ARG A 1 134 ? -46.140 -8.160  16.579  1.00 59.87  ? 129 ARG A NE  1 
ATOM   1055 C CZ  . ARG A 1 134 ? -45.920 -7.221  17.505  1.00 61.40  ? 129 ARG A CZ  1 
ATOM   1056 N NH1 . ARG A 1 134 ? -46.616 -6.075  17.499  1.00 62.90  ? 129 ARG A NH1 1 
ATOM   1057 N NH2 . ARG A 1 134 ? -44.998 -7.420  18.439  1.00 61.33  ? 129 ARG A NH2 1 
ATOM   1058 N N   . GLY A 1 135 ? -45.564 -4.342  12.213  1.00 38.23  ? 130 GLY A N   1 
ATOM   1059 C CA  . GLY A 1 135 ? -46.381 -3.352  11.490  1.00 36.35  ? 130 GLY A CA  1 
ATOM   1060 C C   . GLY A 1 135 ? -46.189 -3.386  9.978   1.00 36.12  ? 130 GLY A C   1 
ATOM   1061 O O   . GLY A 1 135 ? -47.164 -3.389  9.214   1.00 36.99  ? 130 GLY A O   1 
ATOM   1062 N N   . ALA A 1 136 ? -44.934 -3.390  9.535   1.00 35.60  ? 131 ALA A N   1 
ATOM   1063 C CA  . ALA A 1 136 ? -44.616 -3.541  8.110   1.00 37.34  ? 131 ALA A CA  1 
ATOM   1064 C C   . ALA A 1 136 ? -45.276 -4.780  7.474   1.00 39.77  ? 131 ALA A C   1 
ATOM   1065 O O   . ALA A 1 136 ? -45.931 -4.663  6.439   1.00 40.68  ? 131 ALA A O   1 
ATOM   1066 C CB  . ALA A 1 136 ? -43.092 -3.561  7.873   1.00 36.40  ? 131 ALA A CB  1 
ATOM   1067 N N   . GLU A 1 137 ? -45.116 -5.945  8.095   1.00 40.47  ? 132 GLU A N   1 
ATOM   1068 C CA  . GLU A 1 137 ? -45.722 -7.179  7.571   1.00 43.58  ? 132 GLU A CA  1 
ATOM   1069 C C   . GLU A 1 137 ? -47.242 -7.123  7.485   1.00 44.06  ? 132 GLU A C   1 
ATOM   1070 O O   . GLU A 1 137 ? -47.823 -7.653  6.532   1.00 45.35  ? 132 GLU A O   1 
ATOM   1071 C CB  . GLU A 1 137 ? -45.330 -8.388  8.417   1.00 44.83  ? 132 GLU A CB  1 
ATOM   1072 C CG  . GLU A 1 137 ? -45.442 -9.719  7.675   1.00 52.54  ? 132 GLU A CG  1 
ATOM   1073 C CD  . GLU A 1 137 ? -44.170 -10.064 6.916   1.00 59.45  ? 132 GLU A CD  1 
ATOM   1074 O OE1 . GLU A 1 137 ? -43.148 -9.380  7.143   1.00 61.57  ? 132 GLU A OE1 1 
ATOM   1075 O OE2 . GLU A 1 137 ? -44.172 -11.032 6.120   1.00 65.89  ? 132 GLU A OE2 1 
ATOM   1076 N N   . SER A 1 138 ? -47.884 -6.501  8.484   1.00 42.77  ? 133 SER A N   1 
ATOM   1077 C CA  . SER A 1 138 ? -49.340 -6.399  8.515   1.00 43.56  ? 133 SER A CA  1 
ATOM   1078 C C   . SER A 1 138 ? -49.827 -5.487  7.407   1.00 43.03  ? 133 SER A C   1 
ATOM   1079 O O   . SER A 1 138 ? -50.852 -5.766  6.797   1.00 43.96  ? 133 SER A O   1 
ATOM   1080 C CB  . SER A 1 138 ? -49.862 -5.874  9.869   1.00 42.64  ? 133 SER A CB  1 
ATOM   1081 O OG  . SER A 1 138 ? -49.417 -6.678  10.942  1.00 45.33  ? 133 SER A OG  1 
ATOM   1082 N N   . LEU A 1 139 ? -49.115 -4.375  7.189   1.00 41.98  ? 134 LEU A N   1 
ATOM   1083 C CA  . LEU A 1 139 ? -49.411 -3.460  6.083   1.00 41.70  ? 134 LEU A CA  1 
ATOM   1084 C C   . LEU A 1 139 ? -49.359 -4.271  4.829   1.00 44.16  ? 134 LEU A C   1 
ATOM   1085 O O   . LEU A 1 139 ? -50.300 -4.271  4.031   1.00 46.57  ? 134 LEU A O   1 
ATOM   1086 C CB  . LEU A 1 139 ? -48.311 -2.430  5.917   1.00 39.87  ? 134 LEU A CB  1 
ATOM   1087 C CG  . LEU A 1 139 ? -48.647 -0.989  5.532   1.00 40.73  ? 134 LEU A CG  1 
ATOM   1088 C CD1 . LEU A 1 139 ? -47.442 -0.311  4.911   1.00 40.20  ? 134 LEU A CD1 1 
ATOM   1089 C CD2 . LEU A 1 139 ? -49.899 -0.808  4.680   1.00 37.61  ? 134 LEU A CD2 1 
ATOM   1090 N N   . GLU A 1 140 ? -48.241 -4.959  4.658   1.00 44.04  ? 135 GLU A N   1 
ATOM   1091 C CA  . GLU A 1 140 ? -47.962 -5.653  3.423   1.00 47.23  ? 135 GLU A CA  1 
ATOM   1092 C C   . GLU A 1 140 ? -49.073 -6.675  3.088   1.00 48.33  ? 135 GLU A C   1 
ATOM   1093 O O   . GLU A 1 140 ? -49.579 -6.680  1.974   1.00 49.93  ? 135 GLU A O   1 
ATOM   1094 C CB  . GLU A 1 140 ? -46.557 -6.274  3.461   1.00 47.12  ? 135 GLU A CB  1 
ATOM   1095 C CG  . GLU A 1 140 ? -45.905 -6.454  2.079   1.00 54.91  ? 135 GLU A CG  1 
ATOM   1096 C CD  . GLU A 1 140 ? -45.505 -5.139  1.325   1.00 59.91  ? 135 GLU A CD  1 
ATOM   1097 O OE1 . GLU A 1 140 ? -44.880 -5.248  0.228   1.00 64.69  ? 135 GLU A OE1 1 
ATOM   1098 O OE2 . GLU A 1 140 ? -45.806 -4.014  1.794   1.00 58.06  ? 135 GLU A OE2 1 
ATOM   1099 N N   . ALA A 1 141 ? -49.461 -7.499  4.063   1.00 48.01  ? 136 ALA A N   1 
ATOM   1100 C CA  . ALA A 1 141 ? -50.611 -8.396  3.918   1.00 49.98  ? 136 ALA A CA  1 
ATOM   1101 C C   . ALA A 1 141 ? -51.925 -7.641  3.691   1.00 48.78  ? 136 ALA A C   1 
ATOM   1102 O O   . ALA A 1 141 ? -52.784 -8.089  2.942   1.00 50.55  ? 136 ALA A O   1 
ATOM   1103 C CB  . ALA A 1 141 ? -50.715 -9.363  5.112   1.00 50.54  ? 136 ALA A CB  1 
ATOM   1104 N N   . ALA A 1 142 ? -52.082 -6.476  4.300   1.00 46.06  ? 137 ALA A N   1 
ATOM   1105 C CA  . ALA A 1 142 ? -53.313 -5.715  4.074   1.00 45.41  ? 137 ALA A CA  1 
ATOM   1106 C C   . ALA A 1 142 ? -53.376 -5.179  2.637   1.00 46.11  ? 137 ALA A C   1 
ATOM   1107 O O   . ALA A 1 142 ? -54.467 -5.064  2.053   1.00 45.88  ? 137 ALA A O   1 
ATOM   1108 C CB  . ALA A 1 142 ? -53.450 -4.607  5.063   1.00 42.90  ? 137 ALA A CB  1 
ATOM   1109 N N   . LEU A 1 143 ? -52.204 -4.893  2.065   1.00 46.04  ? 138 LEU A N   1 
ATOM   1110 C CA  . LEU A 1 143 ? -52.121 -4.361  0.688   1.00 47.31  ? 138 LEU A CA  1 
ATOM   1111 C C   . LEU A 1 143 ? -52.432 -5.438  -0.377  1.00 50.14  ? 138 LEU A C   1 
ATOM   1112 O O   . LEU A 1 143 ? -53.163 -5.198  -1.343  1.00 50.11  ? 138 LEU A O   1 
ATOM   1113 C CB  . LEU A 1 143 ? -50.722 -3.755  0.432   1.00 46.30  ? 138 LEU A CB  1 
ATOM   1114 C CG  . LEU A 1 143 ? -50.491 -2.360  1.050   1.00 45.56  ? 138 LEU A CG  1 
ATOM   1115 C CD1 . LEU A 1 143 ? -48.980 -2.048  1.196   1.00 44.21  ? 138 LEU A CD1 1 
ATOM   1116 C CD2 . LEU A 1 143 ? -51.210 -1.276  0.264   1.00 44.09  ? 138 LEU A CD2 1 
ATOM   1117 N N   . THR A 1 144 ? -51.840 -6.611  -0.202  1.00 52.29  ? 139 THR A N   1 
ATOM   1118 C CA  . THR A 1 144 ? -52.068 -7.729  -1.110  1.00 57.43  ? 139 THR A CA  1 
ATOM   1119 C C   . THR A 1 144 ? -53.542 -8.169  -1.001  1.00 58.93  ? 139 THR A C   1 
ATOM   1120 O O   . THR A 1 144 ? -54.216 -8.330  -2.008  1.00 61.42  ? 139 THR A O   1 
ATOM   1121 C CB  . THR A 1 144 ? -51.132 -8.875  -0.797  1.00 58.92  ? 139 THR A CB  1 
ATOM   1122 O OG1 . THR A 1 144 ? -51.393 -9.308  0.535   1.00 59.93  ? 139 THR A OG1 1 
ATOM   1123 C CG2 . THR A 1 144 ? -49.673 -8.415  -0.852  1.00 57.50  ? 139 THR A CG2 1 
ATOM   1124 N N   . HIS A 1 145 ? -54.048 -8.293  0.225   1.00 58.30  ? 140 HIS A N   1 
ATOM   1125 C CA  . HIS A 1 145 ? -55.440 -8.658  0.453   1.00 59.27  ? 140 HIS A CA  1 
ATOM   1126 C C   . HIS A 1 145 ? -56.352 -7.686  -0.237  1.00 58.44  ? 140 HIS A C   1 
ATOM   1127 O O   . HIS A 1 145 ? -57.306 -8.099  -0.902  1.00 60.62  ? 140 HIS A O   1 
ATOM   1128 C CB  . HIS A 1 145 ? -55.791 -8.727  1.944   1.00 58.29  ? 140 HIS A CB  1 
ATOM   1129 C CG  . HIS A 1 145 ? -57.199 -9.168  2.195   1.00 61.36  ? 140 HIS A CG  1 
ATOM   1130 N ND1 . HIS A 1 145 ? -57.616 -10.470 1.991   1.00 64.75  ? 140 HIS A ND1 1 
ATOM   1131 C CD2 . HIS A 1 145 ? -58.298 -8.474  2.583   1.00 59.86  ? 140 HIS A CD2 1 
ATOM   1132 C CE1 . HIS A 1 145 ? -58.908 -10.560 2.256   1.00 66.51  ? 140 HIS A CE1 1 
ATOM   1133 N NE2 . HIS A 1 145 ? -59.346 -9.363  2.614   1.00 64.62  ? 140 HIS A NE2 1 
ATOM   1134 N N   . ASN A 1 146 ? -56.059 -6.395  -0.076  1.00 55.66  ? 141 ASN A N   1 
ATOM   1135 C CA  . ASN A 1 146 ? -56.785 -5.340  -0.761  1.00 54.51  ? 141 ASN A CA  1 
ATOM   1136 C C   . ASN A 1 146 ? -56.734 -5.496  -2.273  1.00 57.34  ? 141 ASN A C   1 
ATOM   1137 O O   . ASN A 1 146 ? -57.773 -5.524  -2.942  1.00 58.44  ? 141 ASN A O   1 
ATOM   1138 C CB  . ASN A 1 146 ? -56.253 -3.968  -0.362  1.00 51.55  ? 141 ASN A CB  1 
ATOM   1139 C CG  . ASN A 1 146 ? -57.084 -2.826  -0.935  1.00 50.62  ? 141 ASN A CG  1 
ATOM   1140 O OD1 . ASN A 1 146 ? -56.550 -1.953  -1.635  1.00 48.35  ? 141 ASN A OD1 1 
ATOM   1141 N ND2 . ASN A 1 146 ? -58.405 -2.822  -0.637  1.00 46.49  ? 141 ASN A ND2 1 
ATOM   1142 N N   . ALA A 1 147 ? -55.521 -5.620  -2.804  1.00 58.66  ? 142 ALA A N   1 
ATOM   1143 C CA  . ALA A 1 147 ? -55.308 -5.744  -4.238  1.00 61.89  ? 142 ALA A CA  1 
ATOM   1144 C C   . ALA A 1 147 ? -56.030 -6.963  -4.841  1.00 66.10  ? 142 ALA A C   1 
ATOM   1145 O O   . ALA A 1 147 ? -56.355 -6.966  -6.026  1.00 68.28  ? 142 ALA A O   1 
ATOM   1146 C CB  . ALA A 1 147 ? -53.807 -5.812  -4.530  1.00 62.26  ? 142 ALA A CB  1 
ATOM   1147 N N   . GLU A 1 148 ? -56.242 -8.002  -4.025  1.00 68.07  ? 143 GLU A N   1 
ATOM   1148 C CA  . GLU A 1 148 ? -56.857 -9.268  -4.460  1.00 72.75  ? 143 GLU A CA  1 
ATOM   1149 C C   . GLU A 1 148 ? -58.391 -9.339  -4.374  1.00 73.96  ? 143 GLU A C   1 
ATOM   1150 O O   . GLU A 1 148 ? -58.984 -10.254 -4.931  1.00 76.61  ? 143 GLU A O   1 
ATOM   1151 C CB  . GLU A 1 148 ? -56.271 -10.438 -3.672  1.00 73.94  ? 143 GLU A CB  1 
ATOM   1152 C CG  . GLU A 1 148 ? -55.012 -11.022 -4.275  1.00 77.52  ? 143 GLU A CG  1 
ATOM   1153 C CD  . GLU A 1 148 ? -54.257 -11.899 -3.300  1.00 81.38  ? 143 GLU A CD  1 
ATOM   1154 O OE1 . GLU A 1 148 ? -54.664 -11.950 -2.119  1.00 81.95  ? 143 GLU A OE1 1 
ATOM   1155 O OE2 . GLU A 1 148 ? -53.249 -12.535 -3.697  1.00 84.89  ? 143 GLU A OE2 1 
ATOM   1156 N N   . VAL A 1 149 ? -59.043 -8.413  -3.666  1.00 72.80  ? 144 VAL A N   1 
ATOM   1157 C CA  . VAL A 1 149 ? -60.504 -8.534  -3.545  1.00 75.15  ? 144 VAL A CA  1 
ATOM   1158 C C   . VAL A 1 149 ? -61.237 -8.270  -4.870  1.00 77.72  ? 144 VAL A C   1 
ATOM   1159 O O   . VAL A 1 149 ? -60.937 -7.298  -5.572  1.00 76.68  ? 144 VAL A O   1 
ATOM   1160 C CB  . VAL A 1 149 ? -61.131 -7.837  -2.296  1.00 72.85  ? 144 VAL A CB  1 
ATOM   1161 C CG1 . VAL A 1 149 ? -60.817 -8.654  -1.037  1.00 73.41  ? 144 VAL A CG1 1 
ATOM   1162 C CG2 . VAL A 1 149 ? -60.671 -6.383  -2.126  1.00 69.72  ? 144 VAL A CG2 1 
ATOM   1163 N N   . PRO A 1 150 ? -62.156 -9.189  -5.229  1.00 81.75  ? 145 PRO A N   1 
ATOM   1164 C CA  . PRO A 1 150 ? -62.843 -9.265  -6.510  1.00 84.92  ? 145 PRO A CA  1 
ATOM   1165 C C   . PRO A 1 150 ? -63.641 -8.050  -6.914  1.00 84.41  ? 145 PRO A C   1 
ATOM   1166 O O   . PRO A 1 150 ? -64.086 -7.268  -6.070  1.00 81.74  ? 145 PRO A O   1 
ATOM   1167 C CB  . PRO A 1 150 ? -63.771 -10.461 -6.325  1.00 87.84  ? 145 PRO A CB  1 
ATOM   1168 C CG  . PRO A 1 150 ? -63.004 -11.342 -5.402  1.00 88.62  ? 145 PRO A CG  1 
ATOM   1169 C CD  . PRO A 1 150 ? -62.455 -10.377 -4.407  1.00 83.69  ? 145 PRO A CD  1 
ATOM   1170 N N   . ARG A 1 151 ? -63.806 -7.947  -8.230  1.00 87.82  ? 146 ARG A N   1 
ATOM   1171 C CA  . ARG A 1 151 ? -64.473 -6.865  -8.942  1.00 88.51  ? 146 ARG A CA  1 
ATOM   1172 C C   . ARG A 1 151 ? -65.701 -6.327  -8.222  1.00 87.50  ? 146 ARG A C   1 
ATOM   1173 O O   . ARG A 1 151 ? -65.634 -5.256  -7.613  1.00 85.24  ? 146 ARG A O   1 
ATOM   1174 C CB  . ARG A 1 151 ? -64.827 -7.343  -10.358 1.00 92.21  ? 146 ARG A CB  1 
ATOM   1175 C CG  . ARG A 1 151 ? -65.398 -6.287  -11.302 1.00 93.67  ? 146 ARG A CG  1 
ATOM   1176 C CD  . ARG A 1 151 ? -64.298 -5.565  -12.062 1.00 96.00  ? 146 ARG A CD  1 
ATOM   1177 N NE  . ARG A 1 151 ? -63.812 -4.385  -11.349 1.00 93.70  ? 146 ARG A NE  1 
ATOM   1178 C CZ  . ARG A 1 151 ? -62.756 -3.670  -11.729 1.00 93.78  ? 146 ARG A CZ  1 
ATOM   1179 N NH1 . ARG A 1 151 ? -62.069 -4.018  -12.813 1.00 96.36  ? 146 ARG A NH1 1 
ATOM   1180 N NH2 . ARG A 1 151 ? -62.386 -2.608  -11.023 1.00 90.87  ? 146 ARG A NH2 1 
ATOM   1181 N N   . ARG A 1 152 ? -66.812 -7.063  -8.277  1.00 90.19  ? 147 ARG A N   1 
ATOM   1182 C CA  . ARG A 1 152 ? -68.074 -6.566  -7.708  1.00 89.93  ? 147 ARG A CA  1 
ATOM   1183 C C   . ARG A 1 152 ? -68.426 -7.146  -6.323  1.00 89.47  ? 147 ARG A C   1 
ATOM   1184 O O   . ARG A 1 152 ? -69.592 -7.420  -6.031  1.00 90.68  ? 147 ARG A O   1 
ATOM   1185 C CB  . ARG A 1 152 ? -69.233 -6.703  -8.715  1.00 92.45  ? 147 ARG A CB  1 
ATOM   1186 C CG  . ARG A 1 152 ? -68.978 -6.107  -10.127 1.00 94.72  ? 147 ARG A CG  1 
ATOM   1187 C CD  . ARG A 1 152 ? -68.789 -4.579  -10.127 1.00 94.81  ? 147 ARG A CD  1 
ATOM   1188 N NE  . ARG A 1 152 ? -67.441 -4.181  -9.708  1.00 94.66  ? 147 ARG A NE  1 
ATOM   1189 C CZ  . ARG A 1 152 ? -66.995 -2.926  -9.608  1.00 92.69  ? 147 ARG A CZ  1 
ATOM   1190 N NH1 . ARG A 1 152 ? -65.741 -2.710  -9.218  1.00 90.90  ? 147 ARG A NH1 1 
ATOM   1191 N NH2 . ARG A 1 152 ? -67.780 -1.893  -9.902  1.00 90.60  ? 147 ARG A NH2 1 
ATOM   1192 N N   . ARG A 1 153 ? -67.405 -7.323  -5.482  1.00 88.08  ? 148 ARG A N   1 
ATOM   1193 C CA  . ARG A 1 153 ? -67.592 -7.637  -4.060  1.00 87.36  ? 148 ARG A CA  1 
ATOM   1194 C C   . ARG A 1 153 ? -67.497 -6.363  -3.218  1.00 83.74  ? 148 ARG A C   1 
ATOM   1195 O O   . ARG A 1 153 ? -66.604 -6.230  -2.373  1.00 81.97  ? 148 ARG A O   1 
ATOM   1196 C CB  . ARG A 1 153 ? -66.594 -8.709  -3.581  1.00 88.54  ? 148 ARG A CB  1 
ATOM   1197 C CG  . ARG A 1 153 ? -67.149 -10.139 -3.581  1.00 92.79  ? 148 ARG A CG  1 
ATOM   1198 C CD  . ARG A 1 153 ? -66.036 -11.168 -3.683  1.00 95.67  ? 148 ARG A CD  1 
ATOM   1199 N NE  . ARG A 1 153 ? -66.462 -12.488 -4.169  1.00 101.07 ? 148 ARG A NE  1 
ATOM   1200 C CZ  . ARG A 1 153 ? -66.869 -12.762 -5.412  1.00 104.52 ? 148 ARG A CZ  1 
ATOM   1201 N NH1 . ARG A 1 153 ? -67.215 -14.004 -5.735  1.00 108.35 ? 148 ARG A NH1 1 
ATOM   1202 N NH2 . ARG A 1 153 ? -66.954 -11.804 -6.334  1.00 103.37 ? 148 ARG A NH2 1 
ATOM   1203 N N   . ALA A 1 154 ? -68.431 -5.434  -3.454  1.00 82.74  ? 149 ALA A N   1 
ATOM   1204 C CA  . ALA A 1 154 ? -68.416 -4.095  -2.823  1.00 80.08  ? 149 ALA A CA  1 
ATOM   1205 C C   . ALA A 1 154 ? -68.328 -4.107  -1.285  1.00 78.80  ? 149 ALA A C   1 
ATOM   1206 O O   . ALA A 1 154 ? -67.759 -3.189  -0.681  1.00 76.49  ? 149 ALA A O   1 
ATOM   1207 C CB  . ALA A 1 154 ? -69.609 -3.272  -3.283  1.00 80.32  ? 149 ALA A CB  1 
ATOM   1208 N N   . GLN A 1 155 ? -68.903 -5.155  -0.688  1.00 80.43  ? 150 GLN A N   1 
ATOM   1209 C CA  . GLN A 1 155 ? -68.817 -5.447  0.742   1.00 80.20  ? 150 GLN A CA  1 
ATOM   1210 C C   . GLN A 1 155 ? -67.394 -5.846  1.169   1.00 78.76  ? 150 GLN A C   1 
ATOM   1211 O O   . GLN A 1 155 ? -66.839 -5.257  2.093   1.00 77.05  ? 150 GLN A O   1 
ATOM   1212 C CB  . GLN A 1 155 ? -69.858 -6.524  1.135   1.00 83.37  ? 150 GLN A CB  1 
ATOM   1213 C CG  . GLN A 1 155 ? -69.556 -7.354  2.415   1.00 84.88  ? 150 GLN A CG  1 
ATOM   1214 C CD  . GLN A 1 155 ? -69.525 -6.525  3.702   1.00 84.01  ? 150 GLN A CD  1 
ATOM   1215 O OE1 . GLN A 1 155 ? -69.897 -5.347  3.712   1.00 82.97  ? 150 GLN A OE1 1 
ATOM   1216 N NE2 . GLN A 1 155 ? -69.073 -7.143  4.793   1.00 84.81  ? 150 GLN A NE2 1 
ATOM   1217 N N   . GLU A 1 156 ? -66.810 -6.845  0.512   1.00 79.41  ? 151 GLU A N   1 
ATOM   1218 C CA  . GLU A 1 156 ? -65.443 -7.243  0.836   1.00 78.19  ? 151 GLU A CA  1 
ATOM   1219 C C   . GLU A 1 156 ? -64.425 -6.137  0.539   1.00 74.57  ? 151 GLU A C   1 
ATOM   1220 O O   . GLU A 1 156 ? -63.429 -6.004  1.237   1.00 73.02  ? 151 GLU A O   1 
ATOM   1221 C CB  . GLU A 1 156 ? -65.066 -8.558  0.156   1.00 80.84  ? 151 GLU A CB  1 
ATOM   1222 C CG  . GLU A 1 156 ? -65.200 -9.757  1.089   1.00 84.21  ? 151 GLU A CG  1 
ATOM   1223 C CD  . GLU A 1 156 ? -64.298 -10.918 0.706   1.00 87.83  ? 151 GLU A CD  1 
ATOM   1224 O OE1 . GLU A 1 156 ? -64.842 -12.016 0.440   1.00 92.36  ? 151 GLU A OE1 1 
ATOM   1225 O OE2 . GLU A 1 156 ? -63.052 -10.738 0.672   1.00 86.57  ? 151 GLU A OE2 1 
ATOM   1226 N N   . ALA A 1 157 ? -64.704 -5.348  -0.493  1.00 73.39  ? 152 ALA A N   1 
ATOM   1227 C CA  . ALA A 1 157 ? -63.960 -4.137  -0.794  1.00 70.43  ? 152 ALA A CA  1 
ATOM   1228 C C   . ALA A 1 157 ? -64.015 -3.174  0.386   1.00 68.42  ? 152 ALA A C   1 
ATOM   1229 O O   . ALA A 1 157 ? -62.983 -2.619  0.777   1.00 67.02  ? 152 ALA A O   1 
ATOM   1230 C CB  . ALA A 1 157 ? -64.515 -3.473  -2.050  1.00 70.70  ? 152 ALA A CB  1 
ATOM   1231 N N   . GLU A 1 158 ? -65.218 -2.981  0.942   1.00 68.24  ? 153 GLU A N   1 
ATOM   1232 C CA  . GLU A 1 158 ? -65.401 -2.227  2.188   1.00 66.70  ? 153 GLU A CA  1 
ATOM   1233 C C   . GLU A 1 158 ? -64.451 -2.695  3.295   1.00 64.87  ? 153 GLU A C   1 
ATOM   1234 O O   . GLU A 1 158 ? -63.709 -1.893  3.853   1.00 62.89  ? 153 GLU A O   1 
ATOM   1235 C CB  . GLU A 1 158 ? -66.858 -2.310  2.688   1.00 68.63  ? 153 GLU A CB  1 
ATOM   1236 C CG  . GLU A 1 158 ? -67.718 -1.092  2.407   1.00 70.46  ? 153 GLU A CG  1 
ATOM   1237 C CD  . GLU A 1 158 ? -67.539 0.036   3.420   1.00 72.04  ? 153 GLU A CD  1 
ATOM   1238 O OE1 . GLU A 1 158 ? -68.465 0.870   3.516   1.00 74.08  ? 153 GLU A OE1 1 
ATOM   1239 O OE2 . GLU A 1 158 ? -66.494 0.108   4.115   1.00 71.63  ? 153 GLU A OE2 1 
ATOM   1240 N N   . GLU A 1 159 ? -64.483 -3.993  3.593   1.00 65.38  ? 154 GLU A N   1 
ATOM   1241 C CA  . GLU A 1 159 ? -63.675 -4.562  4.664   1.00 64.59  ? 154 GLU A CA  1 
ATOM   1242 C C   . GLU A 1 159 ? -62.170 -4.565  4.405   1.00 61.91  ? 154 GLU A C   1 
ATOM   1243 O O   . GLU A 1 159 ? -61.393 -4.241  5.306   1.00 60.42  ? 154 GLU A O   1 
ATOM   1244 C CB  . GLU A 1 159 ? -64.155 -5.973  5.021   1.00 67.59  ? 154 GLU A CB  1 
ATOM   1245 C CG  . GLU A 1 159 ? -65.412 -5.964  5.886   1.00 72.49  ? 154 GLU A CG  1 
ATOM   1246 C CD  . GLU A 1 159 ? -65.841 -7.355  6.341   1.00 79.10  ? 154 GLU A CD  1 
ATOM   1247 O OE1 . GLU A 1 159 ? -66.270 -8.157  5.480   1.00 81.71  ? 154 GLU A OE1 1 
ATOM   1248 O OE2 . GLU A 1 159 ? -65.769 -7.634  7.565   1.00 80.76  ? 154 GLU A OE2 1 
ATOM   1249 N N   . ALA A 1 160 ? -61.747 -4.951  3.204   1.00 61.01  ? 155 ALA A N   1 
ATOM   1250 C CA  . ALA A 1 160 ? -60.314 -4.910  2.882   1.00 58.49  ? 155 ALA A CA  1 
ATOM   1251 C C   . ALA A 1 160 ? -59.781 -3.479  3.053   1.00 55.26  ? 155 ALA A C   1 
ATOM   1252 O O   . ALA A 1 160 ? -58.703 -3.281  3.615   1.00 53.63  ? 155 ALA A O   1 
ATOM   1253 C CB  . ALA A 1 160 ? -60.052 -5.413  1.495   1.00 58.90  ? 155 ALA A CB  1 
ATOM   1254 N N   . GLY A 1 161 ? -60.561 -2.498  2.597   1.00 54.26  ? 156 GLY A N   1 
ATOM   1255 C CA  . GLY A 1 161 ? -60.175 -1.091  2.685   1.00 52.25  ? 156 GLY A CA  1 
ATOM   1256 C C   . GLY A 1 161 ? -59.986 -0.611  4.114   1.00 51.20  ? 156 GLY A C   1 
ATOM   1257 O O   . GLY A 1 161 ? -59.057 0.152   4.420   1.00 50.05  ? 156 GLY A O   1 
ATOM   1258 N N   . ALA A 1 162 ? -60.872 -1.059  4.999   1.00 51.44  ? 157 ALA A N   1 
ATOM   1259 C CA  . ALA A 1 162 ? -60.862 -0.570  6.357   1.00 50.22  ? 157 ALA A CA  1 
ATOM   1260 C C   . ALA A 1 162 ? -59.733 -1.250  7.113   1.00 49.16  ? 157 ALA A C   1 
ATOM   1261 O O   . ALA A 1 162 ? -59.056 -0.618  7.909   1.00 47.21  ? 157 ALA A O   1 
ATOM   1262 C CB  . ALA A 1 162 ? -62.234 -0.766  7.041   1.00 52.05  ? 157 ALA A CB  1 
ATOM   1263 N N   . ALA A 1 163 ? -59.513 -2.533  6.831   1.00 49.73  ? 158 ALA A N   1 
ATOM   1264 C CA  . ALA A 1 163 ? -58.376 -3.246  7.377   1.00 48.54  ? 158 ALA A CA  1 
ATOM   1265 C C   . ALA A 1 163 ? -57.048 -2.613  6.917   1.00 46.37  ? 158 ALA A C   1 
ATOM   1266 O O   . ALA A 1 163 ? -56.087 -2.528  7.694   1.00 44.24  ? 158 ALA A O   1 
ATOM   1267 C CB  . ALA A 1 163 ? -58.432 -4.716  6.986   1.00 50.26  ? 158 ALA A CB  1 
ATOM   1268 N N   . LEU A 1 164 ? -57.013 -2.171  5.663   1.00 46.02  ? 159 LEU A N   1 
ATOM   1269 C CA  . LEU A 1 164 ? -55.842 -1.487  5.137   1.00 45.45  ? 159 LEU A CA  1 
ATOM   1270 C C   . LEU A 1 164 ? -55.611 -0.178  5.868   1.00 44.30  ? 159 LEU A C   1 
ATOM   1271 O O   . LEU A 1 164 ? -54.494 0.115   6.263   1.00 43.19  ? 159 LEU A O   1 
ATOM   1272 C CB  . LEU A 1 164 ? -55.935 -1.226  3.617   1.00 45.79  ? 159 LEU A CB  1 
ATOM   1273 C CG  . LEU A 1 164 ? -54.782 -0.413  2.956   1.00 45.39  ? 159 LEU A CG  1 
ATOM   1274 C CD1 . LEU A 1 164 ? -53.405 -1.032  3.186   1.00 43.43  ? 159 LEU A CD1 1 
ATOM   1275 C CD2 . LEU A 1 164 ? -55.006 -0.170  1.466   1.00 44.55  ? 159 LEU A CD2 1 
ATOM   1276 N N   . ARG A 1 165 ? -56.669 0.608   6.016   1.00 45.43  ? 160 ARG A N   1 
ATOM   1277 C CA  . ARG A 1 165 ? -56.600 1.891   6.700   1.00 45.97  ? 160 ARG A CA  1 
ATOM   1278 C C   . ARG A 1 165 ? -56.033 1.747   8.099   1.00 45.00  ? 160 ARG A C   1 
ATOM   1279 O O   . ARG A 1 165 ? -55.181 2.555   8.499   1.00 43.91  ? 160 ARG A O   1 
ATOM   1280 C CB  . ARG A 1 165 ? -57.977 2.576   6.767   1.00 47.62  ? 160 ARG A CB  1 
ATOM   1281 C CG  . ARG A 1 165 ? -58.423 3.185   5.441   1.00 52.44  ? 160 ARG A CG  1 
ATOM   1282 C CD  . ARG A 1 165 ? -59.520 4.261   5.588   1.00 59.51  ? 160 ARG A CD  1 
ATOM   1283 N NE  . ARG A 1 165 ? -59.554 5.088   4.372   1.00 66.89  ? 160 ARG A NE  1 
ATOM   1284 C CZ  . ARG A 1 165 ? -58.951 6.277   4.217   1.00 69.32  ? 160 ARG A CZ  1 
ATOM   1285 N NH1 . ARG A 1 165 ? -59.040 6.912   3.051   1.00 71.20  ? 160 ARG A NH1 1 
ATOM   1286 N NH2 . ARG A 1 165 ? -58.267 6.846   5.211   1.00 68.49  ? 160 ARG A NH2 1 
ATOM   1287 N N   . THR A 1 166 ? -56.476 0.721   8.835   1.00 45.11  ? 161 THR A N   1 
ATOM   1288 C CA  . THR A 1 166 ? -55.988 0.546   10.200  1.00 44.89  ? 161 THR A CA  1 
ATOM   1289 C C   . THR A 1 166 ? -54.569 -0.018  10.210  1.00 44.03  ? 161 THR A C   1 
ATOM   1290 O O   . THR A 1 166 ? -53.758 0.285   11.099  1.00 43.31  ? 161 THR A O   1 
ATOM   1291 C CB  . THR A 1 166 ? -56.985 -0.208  11.124  1.00 47.06  ? 161 THR A CB  1 
ATOM   1292 O OG1 . THR A 1 166 ? -56.896 -1.615  10.945  1.00 47.62  ? 161 THR A OG1 1 
ATOM   1293 C CG2 . THR A 1 166 ? -58.407 0.223   10.845  1.00 46.95  ? 161 THR A CG2 1 
ATOM   1294 N N   . ALA A 1 167 ? -54.268 -0.814  9.195   1.00 43.60  ? 162 ALA A N   1 
ATOM   1295 C CA  . ALA A 1 167 ? -52.931 -1.348  9.022   1.00 43.17  ? 162 ALA A CA  1 
ATOM   1296 C C   . ALA A 1 167 ? -51.906 -0.229  8.728   1.00 41.66  ? 162 ALA A C   1 
ATOM   1297 O O   . ALA A 1 167 ? -50.787 -0.259  9.240   1.00 41.34  ? 162 ALA A O   1 
ATOM   1298 C CB  . ALA A 1 167 ? -52.927 -2.395  7.911   1.00 43.36  ? 162 ALA A CB  1 
ATOM   1299 N N   . ARG A 1 168 ? -52.294 0.726   7.884   1.00 41.09  ? 163 ARG A N   1 
ATOM   1300 C CA  . ARG A 1 168 ? -51.472 1.892   7.540   1.00 40.10  ? 163 ARG A CA  1 
ATOM   1301 C C   . ARG A 1 168 ? -51.185 2.827   8.748   1.00 39.94  ? 163 ARG A C   1 
ATOM   1302 O O   . ARG A 1 168 ? -50.032 3.275   8.950   1.00 39.66  ? 163 ARG A O   1 
ATOM   1303 C CB  . ARG A 1 168 ? -52.161 2.675   6.401   1.00 40.69  ? 163 ARG A CB  1 
ATOM   1304 C CG  . ARG A 1 168 ? -51.461 3.960   5.931   1.00 40.60  ? 163 ARG A CG  1 
ATOM   1305 C CD  . ARG A 1 168 ? -50.114 3.691   5.276   1.00 42.38  ? 163 ARG A CD  1 
ATOM   1306 N NE  . ARG A 1 168 ? -50.193 2.809   4.104   1.00 45.24  ? 163 ARG A NE  1 
ATOM   1307 C CZ  . ARG A 1 168 ? -49.150 2.470   3.339   1.00 47.18  ? 163 ARG A CZ  1 
ATOM   1308 N NH1 . ARG A 1 168 ? -49.315 1.651   2.301   1.00 47.29  ? 163 ARG A NH1 1 
ATOM   1309 N NH2 . ARG A 1 168 ? -47.934 2.939   3.606   1.00 44.86  ? 163 ARG A NH2 1 
ATOM   1310 N N   . ALA A 1 169 ? -52.232 3.129   9.524   1.00 39.57  ? 164 ALA A N   1 
ATOM   1311 C CA  . ALA A 1 169 ? -52.130 4.039   10.659  1.00 39.50  ? 164 ALA A CA  1 
ATOM   1312 C C   . ALA A 1 169 ? -51.259 3.408   11.746  1.00 38.54  ? 164 ALA A C   1 
ATOM   1313 O O   . ALA A 1 169 ? -50.459 4.114   12.388  1.00 37.68  ? 164 ALA A O   1 
ATOM   1314 C CB  . ALA A 1 169 ? -53.554 4.394   11.218  1.00 39.72  ? 164 ALA A CB  1 
ATOM   1315 N N   . GLY A 1 170 ? -51.406 2.083   11.926  1.00 37.52  ? 165 GLY A N   1 
ATOM   1316 C CA  . GLY A 1 170 ? -50.596 1.315   12.857  1.00 36.22  ? 165 GLY A CA  1 
ATOM   1317 C C   . GLY A 1 170 ? -49.137 1.373   12.442  1.00 36.01  ? 165 GLY A C   1 
ATOM   1318 O O   . GLY A 1 170 ? -48.262 1.701   13.252  1.00 35.99  ? 165 GLY A O   1 
ATOM   1319 N N   . TYR A 1 171 ? -48.873 1.051   11.175  1.00 35.95  ? 166 TYR A N   1 
ATOM   1320 C CA  . TYR A 1 171 ? -47.551 1.184   10.605  1.00 35.20  ? 166 TYR A CA  1 
ATOM   1321 C C   . TYR A 1 171 ? -46.894 2.527   10.909  1.00 35.16  ? 166 TYR A C   1 
ATOM   1322 O O   . TYR A 1 171 ? -45.719 2.561   11.290  1.00 35.16  ? 166 TYR A O   1 
ATOM   1323 C CB  . TYR A 1 171 ? -47.580 0.968   9.095   1.00 36.13  ? 166 TYR A CB  1 
ATOM   1324 C CG  . TYR A 1 171 ? -46.213 1.025   8.438   1.00 34.30  ? 166 TYR A CG  1 
ATOM   1325 C CD1 . TYR A 1 171 ? -45.281 0.009   8.620   1.00 37.22  ? 166 TYR A CD1 1 
ATOM   1326 C CD2 . TYR A 1 171 ? -45.866 2.085   7.625   1.00 36.18  ? 166 TYR A CD2 1 
ATOM   1327 C CE1 . TYR A 1 171 ? -44.010 0.065   8.009   1.00 37.61  ? 166 TYR A CE1 1 
ATOM   1328 C CE2 . TYR A 1 171 ? -44.626 2.146   7.007   1.00 37.14  ? 166 TYR A CE2 1 
ATOM   1329 C CZ  . TYR A 1 171 ? -43.706 1.140   7.210   1.00 37.82  ? 166 TYR A CZ  1 
ATOM   1330 O OH  . TYR A 1 171 ? -42.484 1.238   6.603   1.00 41.34  ? 166 TYR A OH  1 
ATOM   1331 N N   . ARG A 1 172 ? -47.629 3.622   10.711  1.00 35.04  ? 167 ARG A N   1 
ATOM   1332 C CA  . ARG A 1 172 ? -47.066 4.936   10.964  1.00 35.28  ? 167 ARG A CA  1 
ATOM   1333 C C   . ARG A 1 172 ? -46.825 5.200   12.460  1.00 35.13  ? 167 ARG A C   1 
ATOM   1334 O O   . ARG A 1 172 ? -45.816 5.828   12.826  1.00 34.39  ? 167 ARG A O   1 
ATOM   1335 C CB  . ARG A 1 172 ? -47.960 6.029   10.369  1.00 35.69  ? 167 ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 172 ? -47.804 6.098   8.863   1.00 36.44  ? 167 ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 172 ? -49.034 6.639   8.157   1.00 36.89  ? 167 ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 172 ? -48.743 6.900   6.744   1.00 37.57  ? 167 ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 172 ? -49.599 7.440   5.880   1.00 37.75  ? 167 ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 172 ? -50.820 7.775   6.268   1.00 37.72  ? 167 ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 172 ? -49.233 7.627   4.622   1.00 38.65  ? 167 ARG A NH2 1 
ATOM   1342 N N   . GLY A 1 173 ? -47.781 4.766   13.289  1.00 34.90  ? 168 GLY A N   1 
ATOM   1343 C CA  . GLY A 1 173 ? -47.644 4.800   14.728  1.00 35.18  ? 168 GLY A CA  1 
ATOM   1344 C C   . GLY A 1 173 ? -46.371 4.090   15.190  1.00 34.52  ? 168 GLY A C   1 
ATOM   1345 O O   . GLY A 1 173 ? -45.607 4.647   15.968  1.00 34.66  ? 168 GLY A O   1 
ATOM   1346 N N   . ARG A 1 174 ? -46.143 2.878   14.698  1.00 33.05  ? 169 ARG A N   1 
ATOM   1347 C CA  . ARG A 1 174 ? -44.964 2.132   15.065  1.00 32.81  ? 169 ARG A CA  1 
ATOM   1348 C C   . ARG A 1 174 ? -43.665 2.773   14.577  1.00 31.67  ? 169 ARG A C   1 
ATOM   1349 O O   . ARG A 1 174 ? -42.656 2.673   15.243  1.00 31.15  ? 169 ARG A O   1 
ATOM   1350 C CB  . ARG A 1 174 ? -45.043 0.670   14.574  1.00 31.58  ? 169 ARG A CB  1 
ATOM   1351 C CG  . ARG A 1 174 ? -46.136 -0.187  15.207  1.00 35.38  ? 169 ARG A CG  1 
ATOM   1352 C CD  . ARG A 1 174 ? -45.984 -0.378  16.758  1.00 40.73  ? 169 ARG A CD  1 
ATOM   1353 N NE  . ARG A 1 174 ? -46.954 -1.344  17.286  1.00 46.19  ? 169 ARG A NE  1 
ATOM   1354 C CZ  . ARG A 1 174 ? -47.148 -1.677  18.570  1.00 48.25  ? 169 ARG A CZ  1 
ATOM   1355 N NH1 . ARG A 1 174 ? -46.439 -1.108  19.538  1.00 48.86  ? 169 ARG A NH1 1 
ATOM   1356 N NH2 . ARG A 1 174 ? -48.082 -2.588  18.888  1.00 47.15  ? 169 ARG A NH2 1 
ATOM   1357 N N   . ALA A 1 175 ? -43.660 3.369   13.391  1.00 31.73  ? 170 ALA A N   1 
ATOM   1358 C CA  . ALA A 1 175 ? -42.463 4.102   12.927  1.00 30.94  ? 170 ALA A CA  1 
ATOM   1359 C C   . ALA A 1 175 ? -42.093 5.239   13.889  1.00 30.97  ? 170 ALA A C   1 
ATOM   1360 O O   . ALA A 1 175 ? -40.927 5.473   14.177  1.00 29.28  ? 170 ALA A O   1 
ATOM   1361 C CB  . ALA A 1 175 ? -42.689 4.654   11.532  1.00 31.48  ? 170 ALA A CB  1 
ATOM   1362 N N   . LEU A 1 176 ? -43.099 5.942   14.376  1.00 31.29  ? 171 LEU A N   1 
ATOM   1363 C CA  . LEU A 1 176 ? -42.868 7.004   15.355  1.00 33.70  ? 171 LEU A CA  1 
ATOM   1364 C C   . LEU A 1 176 ? -42.306 6.431   16.668  1.00 33.87  ? 171 LEU A C   1 
ATOM   1365 O O   . LEU A 1 176 ? -41.383 6.998   17.221  1.00 34.35  ? 171 LEU A O   1 
ATOM   1366 C CB  . LEU A 1 176 ? -44.164 7.748   15.652  1.00 33.75  ? 171 LEU A CB  1 
ATOM   1367 C CG  . LEU A 1 176 ? -44.679 8.791   14.655  1.00 36.60  ? 171 LEU A CG  1 
ATOM   1368 C CD1 . LEU A 1 176 ? -46.060 9.261   15.090  1.00 35.93  ? 171 LEU A CD1 1 
ATOM   1369 C CD2 . LEU A 1 176 ? -43.724 10.002  14.567  1.00 35.43  ? 171 LEU A CD2 1 
ATOM   1370 N N   . ASP A 1 177 ? -42.876 5.320   17.160  1.00 33.80  ? 172 ASP A N   1 
ATOM   1371 C CA  . ASP A 1 177 ? -42.396 4.701   18.411  1.00 34.34  ? 172 ASP A CA  1 
ATOM   1372 C C   . ASP A 1 177 ? -40.945 4.288   18.254  1.00 31.57  ? 172 ASP A C   1 
ATOM   1373 O O   . ASP A 1 177 ? -40.133 4.481   19.143  1.00 31.04  ? 172 ASP A O   1 
ATOM   1374 C CB  . ASP A 1 177 ? -43.220 3.470   18.802  1.00 34.89  ? 172 ASP A CB  1 
ATOM   1375 C CG  . ASP A 1 177 ? -44.682 3.803   19.069  1.00 39.19  ? 172 ASP A CG  1 
ATOM   1376 O OD1 . ASP A 1 177 ? -45.017 4.978   19.411  1.00 40.85  ? 172 ASP A OD1 1 
ATOM   1377 O OD2 . ASP A 1 177 ? -45.498 2.871   18.880  1.00 43.35  ? 172 ASP A OD2 1 
ATOM   1378 N N   . TYR A 1 178 ? -40.654 3.706   17.111  1.00 30.46  ? 173 TYR A N   1 
ATOM   1379 C CA  . TYR A 1 178 ? -39.290 3.359   16.747  1.00 30.58  ? 173 TYR A CA  1 
ATOM   1380 C C   . TYR A 1 178 ? -38.351 4.590   16.690  1.00 29.34  ? 173 TYR A C   1 
ATOM   1381 O O   . TYR A 1 178 ? -37.286 4.597   17.286  1.00 30.20  ? 173 TYR A O   1 
ATOM   1382 C CB  . TYR A 1 178 ? -39.286 2.670   15.403  1.00 29.67  ? 173 TYR A CB  1 
ATOM   1383 C CG  . TYR A 1 178 ? -38.101 1.762   15.144  1.00 31.46  ? 173 TYR A CG  1 
ATOM   1384 C CD1 . TYR A 1 178 ? -38.025 1.033   13.951  1.00 31.12  ? 173 TYR A CD1 1 
ATOM   1385 C CD2 . TYR A 1 178 ? -37.104 1.567   16.102  1.00 31.08  ? 173 TYR A CD2 1 
ATOM   1386 C CE1 . TYR A 1 178 ? -36.979 0.198   13.685  1.00 30.55  ? 173 TYR A CE1 1 
ATOM   1387 C CE2 . TYR A 1 178 ? -36.018 0.686   15.850  1.00 29.96  ? 173 TYR A CE2 1 
ATOM   1388 C CZ  . TYR A 1 178 ? -35.962 0.025   14.640  1.00 31.66  ? 173 TYR A CZ  1 
ATOM   1389 O OH  . TYR A 1 178 ? -34.939 -0.872  14.370  1.00 30.38  ? 173 TYR A OH  1 
ATOM   1390 N N   . ALA A 1 179 ? -38.740 5.595   15.922  1.00 30.10  ? 174 ALA A N   1 
ATOM   1391 C CA  . ALA A 1 179 ? -38.003 6.856   15.861  1.00 29.70  ? 174 ALA A CA  1 
ATOM   1392 C C   . ALA A 1 179 ? -37.695 7.320   17.258  1.00 28.26  ? 174 ALA A C   1 
ATOM   1393 O O   . ALA A 1 179 ? -36.561 7.682   17.531  1.00 28.11  ? 174 ALA A O   1 
ATOM   1394 C CB  . ALA A 1 179 ? -38.782 7.939   15.061  1.00 30.91  ? 174 ALA A CB  1 
ATOM   1395 N N   . LEU A 1 180 ? -38.684 7.284   18.142  1.00 27.37  ? 175 LEU A N   1 
ATOM   1396 C CA  . LEU A 1 180 ? -38.472 7.655   19.533  1.00 29.41  ? 175 LEU A CA  1 
ATOM   1397 C C   . LEU A 1 180 ? -37.328 6.870   20.208  1.00 28.72  ? 175 LEU A C   1 
ATOM   1398 O O   . LEU A 1 180 ? -36.430 7.454   20.881  1.00 28.84  ? 175 LEU A O   1 
ATOM   1399 C CB  . LEU A 1 180 ? -39.776 7.500   20.316  1.00 30.58  ? 175 LEU A CB  1 
ATOM   1400 C CG  . LEU A 1 180 ? -39.745 7.981   21.772  1.00 35.96  ? 175 LEU A CG  1 
ATOM   1401 C CD1 . LEU A 1 180 ? -39.503 9.481   21.834  1.00 40.45  ? 175 LEU A CD1 1 
ATOM   1402 C CD2 . LEU A 1 180 ? -41.071 7.683   22.517  1.00 39.90  ? 175 LEU A CD2 1 
ATOM   1403 N N   . GLN A 1 181 ? -37.350 5.555   20.025  1.00 26.84  ? 176 GLN A N   1 
ATOM   1404 C CA  . GLN A 1 181 ? -36.407 4.696   20.711  1.00 27.19  ? 176 GLN A CA  1 
ATOM   1405 C C   . GLN A 1 181 ? -34.997 4.865   20.147  1.00 28.11  ? 176 GLN A C   1 
ATOM   1406 O O   . GLN A 1 181 ? -34.024 4.744   20.883  1.00 28.21  ? 176 GLN A O   1 
ATOM   1407 C CB  . GLN A 1 181 ? -36.832 3.228   20.593  1.00 26.56  ? 176 GLN A CB  1 
ATOM   1408 C CG  . GLN A 1 181 ? -38.030 2.871   21.471  1.00 27.63  ? 176 GLN A CG  1 
ATOM   1409 C CD  . GLN A 1 181 ? -37.857 3.281   22.928  1.00 32.63  ? 176 GLN A CD  1 
ATOM   1410 O OE1 . GLN A 1 181 ? -38.764 3.880   23.525  1.00 34.61  ? 176 GLN A OE1 1 
ATOM   1411 N NE2 . GLN A 1 181 ? -36.699 2.946   23.516  1.00 31.30  ? 176 GLN A NE2 1 
ATOM   1412 N N   . ILE A 1 182 ? -34.900 5.109   18.838  1.00 29.62  ? 177 ILE A N   1 
ATOM   1413 C CA  . ILE A 1 182 ? -33.644 5.497   18.177  1.00 30.05  ? 177 ILE A CA  1 
ATOM   1414 C C   . ILE A 1 182 ? -33.058 6.798   18.794  1.00 31.62  ? 177 ILE A C   1 
ATOM   1415 O O   . ILE A 1 182 ? -31.859 6.864   19.061  1.00 31.35  ? 177 ILE A O   1 
ATOM   1416 C CB  . ILE A 1 182 ? -33.834 5.625   16.618  1.00 30.72  ? 177 ILE A CB  1 
ATOM   1417 C CG1 . ILE A 1 182 ? -34.103 4.241   16.001  1.00 31.85  ? 177 ILE A CG1 1 
ATOM   1418 C CG2 . ILE A 1 182 ? -32.639 6.312   15.950  1.00 30.61  ? 177 ILE A CG2 1 
ATOM   1419 C CD1 . ILE A 1 182 ? -34.714 4.248   14.620  1.00 30.43  ? 177 ILE A CD1 1 
ATOM   1420 N N   . ASN A 1 183 ? -33.871 7.829   19.027  1.00 32.90  ? 178 ASN A N   1 
ATOM   1421 C CA  . ASN A 1 183 ? -33.331 8.999   19.746  1.00 35.65  ? 178 ASN A CA  1 
ATOM   1422 C C   . ASN A 1 183 ? -32.865 8.656   21.138  1.00 35.52  ? 178 ASN A C   1 
ATOM   1423 O O   . ASN A 1 183 ? -31.869 9.172   21.562  1.00 36.82  ? 178 ASN A O   1 
ATOM   1424 C CB  . ASN A 1 183 ? -34.314 10.146  19.913  1.00 37.63  ? 178 ASN A CB  1 
ATOM   1425 C CG  . ASN A 1 183 ? -34.521 10.925  18.659  1.00 41.43  ? 178 ASN A CG  1 
ATOM   1426 O OD1 . ASN A 1 183 ? -35.072 10.414  17.672  1.00 42.09  ? 178 ASN A OD1 1 
ATOM   1427 N ND2 . ASN A 1 183 ? -34.130 12.190  18.690  1.00 46.99  ? 178 ASN A ND2 1 
ATOM   1428 N N   . VAL A 1 184 ? -33.601 7.805   21.854  1.00 35.32  ? 179 VAL A N   1 
ATOM   1429 C CA  . VAL A 1 184 ? -33.311 7.551   23.248  1.00 35.75  ? 179 VAL A CA  1 
ATOM   1430 C C   . VAL A 1 184 ? -31.951 6.902   23.311  1.00 36.16  ? 179 VAL A C   1 
ATOM   1431 O O   . VAL A 1 184 ? -31.110 7.278   24.139  1.00 37.20  ? 179 VAL A O   1 
ATOM   1432 C CB  . VAL A 1 184 ? -34.375 6.642   23.918  1.00 36.45  ? 179 VAL A CB  1 
ATOM   1433 C CG1 . VAL A 1 184 ? -33.846 6.020   25.246  1.00 35.55  ? 179 VAL A CG1 1 
ATOM   1434 C CG2 . VAL A 1 184 ? -35.697 7.381   24.109  1.00 32.66  ? 179 VAL A CG2 1 
ATOM   1435 N N   . ILE A 1 185 ? -31.754 5.939   22.417  1.00 35.53  ? 180 ILE A N   1 
ATOM   1436 C CA  . ILE A 1 185 ? -30.569 5.143   22.384  1.00 36.72  ? 180 ILE A CA  1 
ATOM   1437 C C   . ILE A 1 185 ? -29.354 5.988   21.972  1.00 37.60  ? 180 ILE A C   1 
ATOM   1438 O O   . ILE A 1 185 ? -28.255 5.761   22.461  1.00 36.59  ? 180 ILE A O   1 
ATOM   1439 C CB  . ILE A 1 185 ? -30.767 3.951   21.451  1.00 36.74  ? 180 ILE A CB  1 
ATOM   1440 C CG1 . ILE A 1 185 ? -31.349 2.779   22.225  1.00 39.90  ? 180 ILE A CG1 1 
ATOM   1441 C CG2 . ILE A 1 185 ? -29.467 3.538   20.753  1.00 38.98  ? 180 ILE A CG2 1 
ATOM   1442 C CD1 . ILE A 1 185 ? -30.954 2.691   23.722  1.00 44.27  ? 180 ILE A CD1 1 
ATOM   1443 N N   . GLU A 1 186 ? -29.575 6.972   21.103  1.00 38.98  ? 181 GLU A N   1 
ATOM   1444 C CA  . GLU A 1 186 ? -28.536 7.929   20.758  1.00 42.01  ? 181 GLU A CA  1 
ATOM   1445 C C   . GLU A 1 186 ? -28.034 8.659   22.018  1.00 42.36  ? 181 GLU A C   1 
ATOM   1446 O O   . GLU A 1 186 ? -26.830 8.822   22.175  1.00 41.45  ? 181 GLU A O   1 
ATOM   1447 C CB  . GLU A 1 186 ? -29.040 8.919   19.701  1.00 44.07  ? 181 GLU A CB  1 
ATOM   1448 C CG  . GLU A 1 186 ? -27.991 9.872   19.179  1.00 51.29  ? 181 GLU A CG  1 
ATOM   1449 C CD  . GLU A 1 186 ? -27.363 9.416   17.855  1.00 58.89  ? 181 GLU A CD  1 
ATOM   1450 O OE1 . GLU A 1 186 ? -27.858 9.873   16.780  1.00 61.25  ? 181 GLU A OE1 1 
ATOM   1451 O OE2 . GLU A 1 186 ? -26.370 8.623   17.885  1.00 59.21  ? 181 GLU A OE2 1 
ATOM   1452 N N   . ASP A 1 187 ? -28.956 9.039   22.920  1.00 42.79  ? 182 ASP A N   1 
ATOM   1453 C CA  . ASP A 1 187 ? -28.605 9.735   24.180  1.00 43.99  ? 182 ASP A CA  1 
ATOM   1454 C C   . ASP A 1 187 ? -27.960 8.817   25.236  1.00 42.47  ? 182 ASP A C   1 
ATOM   1455 O O   . ASP A 1 187 ? -27.021 9.225   25.930  1.00 41.93  ? 182 ASP A O   1 
ATOM   1456 C CB  . ASP A 1 187 ? -29.807 10.505  24.787  1.00 45.51  ? 182 ASP A CB  1 
ATOM   1457 C CG  . ASP A 1 187 ? -30.093 11.818  24.063  1.00 50.47  ? 182 ASP A CG  1 
ATOM   1458 O OD1 . ASP A 1 187 ? -29.431 12.089  23.036  1.00 53.60  ? 182 ASP A OD1 1 
ATOM   1459 O OD2 . ASP A 1 187 ? -30.984 12.593  24.500  1.00 53.14  ? 182 ASP A OD2 1 
ATOM   1460 N N   . LYS A 1 188 ? -28.477 7.596   25.373  1.00 40.79  ? 183 LYS A N   1 
ATOM   1461 C CA  . LYS A 1 188 ? -27.893 6.629   26.320  1.00 40.38  ? 183 LYS A CA  1 
ATOM   1462 C C   . LYS A 1 188 ? -26.472 6.337   25.905  1.00 39.60  ? 183 LYS A C   1 
ATOM   1463 O O   . LYS A 1 188 ? -25.549 6.311   26.717  1.00 40.67  ? 183 LYS A O   1 
ATOM   1464 C CB  . LYS A 1 188 ? -28.658 5.307   26.336  1.00 38.66  ? 183 LYS A CB  1 
ATOM   1465 C CG  . LYS A 1 188 ? -29.960 5.376   27.025  1.00 42.03  ? 183 LYS A CG  1 
ATOM   1466 C CD  . LYS A 1 188 ? -30.401 3.984   27.439  1.00 45.42  ? 183 LYS A CD  1 
ATOM   1467 C CE  . LYS A 1 188 ? -30.826 3.983   28.913  1.00 52.05  ? 183 LYS A CE  1 
ATOM   1468 N NZ  . LYS A 1 188 ? -29.577 3.967   29.782  1.00 52.71  ? 183 LYS A NZ  1 
ATOM   1469 N N   . ARG A 1 189 ? -26.285 6.121   24.623  1.00 39.18  ? 184 ARG A N   1 
ATOM   1470 C CA  . ARG A 1 189 ? -24.974 5.803   24.152  1.00 40.22  ? 184 ARG A CA  1 
ATOM   1471 C C   . ARG A 1 189 ? -23.950 6.826   24.667  1.00 41.25  ? 184 ARG A C   1 
ATOM   1472 O O   . ARG A 1 189 ? -22.923 6.437   25.224  1.00 42.79  ? 184 ARG A O   1 
ATOM   1473 C CB  . ARG A 1 189 ? -24.963 5.718   22.641  1.00 40.18  ? 184 ARG A CB  1 
ATOM   1474 C CG  . ARG A 1 189 ? -23.586 5.711   22.090  1.00 46.15  ? 184 ARG A CG  1 
ATOM   1475 C CD  . ARG A 1 189 ? -23.582 6.381   20.762  1.00 52.48  ? 184 ARG A CD  1 
ATOM   1476 N NE  . ARG A 1 189 ? -23.652 5.386   19.714  1.00 55.70  ? 184 ARG A NE  1 
ATOM   1477 C CZ  . ARG A 1 189 ? -23.835 5.675   18.436  1.00 60.33  ? 184 ARG A CZ  1 
ATOM   1478 N NH1 . ARG A 1 189 ? -23.994 6.940   18.056  1.00 61.71  ? 184 ARG A NH1 1 
ATOM   1479 N NH2 . ARG A 1 189 ? -23.869 4.691   17.543  1.00 64.02  ? 184 ARG A NH2 1 
ATOM   1480 N N   . LYS A 1 190 ? -24.207 8.126   24.513  1.00 41.87  ? 185 LYS A N   1 
ATOM   1481 C CA  . LYS A 1 190 ? -23.174 9.049   24.903  1.00 41.58  ? 185 LYS A CA  1 
ATOM   1482 C C   . LYS A 1 190 ? -23.097 9.193   26.409  1.00 40.84  ? 185 LYS A C   1 
ATOM   1483 O O   . LYS A 1 190 ? -22.012 9.221   26.944  1.00 39.40  ? 185 LYS A O   1 
ATOM   1484 C CB  . LYS A 1 190 ? -23.216 10.380  24.154  1.00 43.34  ? 185 LYS A CB  1 
ATOM   1485 C CG  . LYS A 1 190 ? -24.557 10.949  23.861  1.00 47.36  ? 185 LYS A CG  1 
ATOM   1486 C CD  . LYS A 1 190 ? -24.440 11.988  22.742  1.00 52.54  ? 185 LYS A CD  1 
ATOM   1487 C CE  . LYS A 1 190 ? -25.465 13.097  22.870  1.00 58.39  ? 185 LYS A CE  1 
ATOM   1488 N NZ  . LYS A 1 190 ? -24.931 14.272  23.634  1.00 61.32  ? 185 LYS A NZ  1 
ATOM   1489 N N   . PHE A 1 191 ? -24.245 9.216   27.090  1.00 40.29  ? 186 PHE A N   1 
ATOM   1490 C CA  . PHE A 1 191 ? -24.254 9.489   28.531  1.00 40.79  ? 186 PHE A CA  1 
ATOM   1491 C C   . PHE A 1 191 ? -23.762 8.336   29.380  1.00 38.93  ? 186 PHE A C   1 
ATOM   1492 O O   . PHE A 1 191 ? -23.093 8.541   30.376  1.00 38.33  ? 186 PHE A O   1 
ATOM   1493 C CB  . PHE A 1 191 ? -25.640 9.949   28.988  1.00 42.35  ? 186 PHE A CB  1 
ATOM   1494 C CG  . PHE A 1 191 ? -26.071 11.213  28.332  1.00 45.70  ? 186 PHE A CG  1 
ATOM   1495 C CD1 . PHE A 1 191 ? -27.410 11.454  28.052  1.00 47.80  ? 186 PHE A CD1 1 
ATOM   1496 C CD2 . PHE A 1 191 ? -25.120 12.152  27.945  1.00 48.46  ? 186 PHE A CD2 1 
ATOM   1497 C CE1 . PHE A 1 191 ? -27.802 12.643  27.422  1.00 51.20  ? 186 PHE A CE1 1 
ATOM   1498 C CE2 . PHE A 1 191 ? -25.493 13.329  27.307  1.00 51.02  ? 186 PHE A CE2 1 
ATOM   1499 C CZ  . PHE A 1 191 ? -26.846 13.577  27.047  1.00 52.55  ? 186 PHE A CZ  1 
ATOM   1500 N N   . ASP A 1 192 ? -24.117 7.125   28.978  1.00 37.04  ? 187 ASP A N   1 
ATOM   1501 C CA  . ASP A 1 192 ? -23.718 5.951   29.703  1.00 38.08  ? 187 ASP A CA  1 
ATOM   1502 C C   . ASP A 1 192 ? -22.202 5.630   29.547  1.00 36.90  ? 187 ASP A C   1 
ATOM   1503 O O   . ASP A 1 192 ? -21.571 5.224   30.514  1.00 37.34  ? 187 ASP A O   1 
ATOM   1504 C CB  . ASP A 1 192 ? -24.593 4.759   29.304  1.00 37.53  ? 187 ASP A CB  1 
ATOM   1505 C CG  . ASP A 1 192 ? -26.059 4.895   29.805  1.00 43.29  ? 187 ASP A CG  1 
ATOM   1506 O OD1 . ASP A 1 192 ? -26.492 5.968   30.364  1.00 47.38  ? 187 ASP A OD1 1 
ATOM   1507 O OD2 . ASP A 1 192 ? -26.791 3.908   29.631  1.00 44.72  ? 187 ASP A OD2 1 
ATOM   1508 N N   . ILE A 1 193 ? -21.631 5.816   28.357  1.00 36.23  ? 188 ILE A N   1 
ATOM   1509 C CA  . ILE A 1 193 ? -20.176 5.622   28.134  1.00 34.92  ? 188 ILE A CA  1 
ATOM   1510 C C   . ILE A 1 193 ? -19.388 6.730   28.883  1.00 35.64  ? 188 ILE A C   1 
ATOM   1511 O O   . ILE A 1 193 ? -18.355 6.460   29.505  1.00 36.37  ? 188 ILE A O   1 
ATOM   1512 C CB  . ILE A 1 193 ? -19.796 5.633   26.622  1.00 35.31  ? 188 ILE A CB  1 
ATOM   1513 C CG1 . ILE A 1 193 ? -20.274 4.392   25.842  1.00 36.21  ? 188 ILE A CG1 1 
ATOM   1514 C CG2 . ILE A 1 193 ? -18.252 5.685   26.420  1.00 34.63  ? 188 ILE A CG2 1 
ATOM   1515 C CD1 . ILE A 1 193 ? -21.532 3.666   26.327  1.00 39.72  ? 188 ILE A CD1 1 
ATOM   1516 N N   . MET A 1 194 ? -19.862 7.960   28.850  1.00 34.93  ? 189 MET A N   1 
ATOM   1517 C CA  . MET A 1 194 ? -19.176 9.015   29.599  1.00 36.40  ? 189 MET A CA  1 
ATOM   1518 C C   . MET A 1 194 ? -19.229 8.802   31.123  1.00 36.51  ? 189 MET A C   1 
ATOM   1519 O O   . MET A 1 194 ? -18.211 8.897   31.836  1.00 35.85  ? 189 MET A O   1 
ATOM   1520 C CB  . MET A 1 194 ? -19.715 10.390  29.252  1.00 37.68  ? 189 MET A CB  1 
ATOM   1521 C CG  . MET A 1 194 ? -19.143 10.967  27.992  1.00 39.77  ? 189 MET A CG  1 
ATOM   1522 S SD  . MET A 1 194 ? -19.566 12.736  27.805  1.00 45.95  ? 189 MET A SD  1 
ATOM   1523 C CE  . MET A 1 194 ? -21.160 12.604  27.034  1.00 44.96  ? 189 MET A CE  1 
ATOM   1524 N N   . GLU A 1 195 ? -20.427 8.519   31.610  1.00 35.80  ? 190 GLU A N   1 
ATOM   1525 C CA  . GLU A 1 195 ? -20.608 8.135   32.991  1.00 36.81  ? 190 GLU A CA  1 
ATOM   1526 C C   . GLU A 1 195 ? -19.715 6.899   33.354  1.00 33.12  ? 190 GLU A C   1 
ATOM   1527 O O   . GLU A 1 195 ? -19.064 6.871   34.373  1.00 32.93  ? 190 GLU A O   1 
ATOM   1528 C CB  . GLU A 1 195 ? -22.106 7.864   33.250  1.00 37.71  ? 190 GLU A CB  1 
ATOM   1529 C CG  . GLU A 1 195 ? -22.418 7.275   34.609  1.00 41.91  ? 190 GLU A CG  1 
ATOM   1530 C CD  . GLU A 1 195 ? -22.384 8.303   35.690  1.00 50.86  ? 190 GLU A CD  1 
ATOM   1531 O OE1 . GLU A 1 195 ? -22.586 9.500   35.372  1.00 56.25  ? 190 GLU A OE1 1 
ATOM   1532 O OE2 . GLU A 1 195 ? -22.154 7.925   36.865  1.00 55.19  ? 190 GLU A OE2 1 
ATOM   1533 N N   . PHE A 1 196 ? -19.677 5.912   32.508  1.00 29.94  ? 191 PHE A N   1 
ATOM   1534 C CA  . PHE A 1 196 ? -18.774 4.781   32.729  1.00 29.11  ? 191 PHE A CA  1 
ATOM   1535 C C   . PHE A 1 196 ? -17.285 5.222   32.919  1.00 29.53  ? 191 PHE A C   1 
ATOM   1536 O O   . PHE A 1 196 ? -16.618 4.832   33.879  1.00 28.60  ? 191 PHE A O   1 
ATOM   1537 C CB  . PHE A 1 196 ? -18.934 3.815   31.571  1.00 26.69  ? 191 PHE A CB  1 
ATOM   1538 C CG  . PHE A 1 196 ? -17.856 2.771   31.465  1.00 28.14  ? 191 PHE A CG  1 
ATOM   1539 C CD1 . PHE A 1 196 ? -17.787 1.711   32.396  1.00 28.89  ? 191 PHE A CD1 1 
ATOM   1540 C CD2 . PHE A 1 196 ? -16.961 2.795   30.396  1.00 24.57  ? 191 PHE A CD2 1 
ATOM   1541 C CE1 . PHE A 1 196 ? -16.807 0.718   32.284  1.00 27.82  ? 191 PHE A CE1 1 
ATOM   1542 C CE2 . PHE A 1 196 ? -15.971 1.793   30.263  1.00 28.15  ? 191 PHE A CE2 1 
ATOM   1543 C CZ  . PHE A 1 196 ? -15.879 0.766   31.213  1.00 24.70  ? 191 PHE A CZ  1 
ATOM   1544 N N   . VAL A 1 197 ? -16.788 6.051   32.014  1.00 29.08  ? 192 VAL A N   1 
ATOM   1545 C CA  . VAL A 1 197 ? -15.391 6.467   32.074  1.00 31.15  ? 192 VAL A CA  1 
ATOM   1546 C C   . VAL A 1 197 ? -15.140 7.398   33.296  1.00 32.80  ? 192 VAL A C   1 
ATOM   1547 O O   . VAL A 1 197 ? -14.121 7.304   33.983  1.00 32.39  ? 192 VAL A O   1 
ATOM   1548 C CB  . VAL A 1 197 ? -14.995 7.126   30.719  1.00 32.44  ? 192 VAL A CB  1 
ATOM   1549 C CG1 . VAL A 1 197 ? -13.612 7.839   30.808  1.00 34.20  ? 192 VAL A CG1 1 
ATOM   1550 C CG2 . VAL A 1 197 ? -15.030 6.067   29.631  1.00 30.49  ? 192 VAL A CG2 1 
ATOM   1551 N N   . LEU A 1 198 ? -16.100 8.253   33.584  1.00 33.85  ? 193 LEU A N   1 
ATOM   1552 C CA  . LEU A 1 198 ? -16.046 9.040   34.810  1.00 37.02  ? 193 LEU A CA  1 
ATOM   1553 C C   . LEU A 1 198 ? -15.901 8.161   36.064  1.00 36.49  ? 193 LEU A C   1 
ATOM   1554 O O   . LEU A 1 198 ? -15.167 8.496   36.977  1.00 38.57  ? 193 LEU A O   1 
ATOM   1555 C CB  . LEU A 1 198 ? -17.281 9.908   34.918  1.00 37.99  ? 193 LEU A CB  1 
ATOM   1556 C CG  . LEU A 1 198 ? -17.366 10.890  36.075  1.00 43.71  ? 193 LEU A CG  1 
ATOM   1557 C CD1 . LEU A 1 198 ? -16.108 11.797  36.205  1.00 45.79  ? 193 LEU A CD1 1 
ATOM   1558 C CD2 . LEU A 1 198 ? -18.604 11.722  35.860  1.00 45.96  ? 193 LEU A CD2 1 
ATOM   1559 N N   . ARG A 1 199 ? -16.571 7.030   36.079  1.00 34.64  ? 194 ARG A N   1 
ATOM   1560 C CA  . ARG A 1 199 ? -16.613 6.192   37.253  1.00 36.03  ? 194 ARG A CA  1 
ATOM   1561 C C   . ARG A 1 199 ? -15.343 5.345   37.406  1.00 33.99  ? 194 ARG A C   1 
ATOM   1562 O O   . ARG A 1 199 ? -14.923 5.039   38.518  1.00 34.43  ? 194 ARG A O   1 
ATOM   1563 C CB  . ARG A 1 199 ? -17.900 5.338   37.241  1.00 36.61  ? 194 ARG A CB  1 
ATOM   1564 C CG  . ARG A 1 199 ? -19.081 6.076   37.935  1.00 40.40  ? 194 ARG A CG  1 
ATOM   1565 C CD  . ARG A 1 199 ? -20.410 5.355   37.781  1.00 48.61  ? 194 ARG A CD  1 
ATOM   1566 N NE  . ARG A 1 199 ? -20.381 3.950   38.228  1.00 57.17  ? 194 ARG A NE  1 
ATOM   1567 C CZ  . ARG A 1 199 ? -21.430 3.267   38.710  1.00 60.10  ? 194 ARG A CZ  1 
ATOM   1568 N NH1 . ARG A 1 199 ? -22.631 3.845   38.826  1.00 62.24  ? 194 ARG A NH1 1 
ATOM   1569 N NH2 . ARG A 1 199 ? -21.275 1.997   39.085  1.00 59.14  ? 194 ARG A NH2 1 
ATOM   1570 N N   . LEU A 1 200 ? -14.730 4.988   36.285  1.00 31.75  ? 195 LEU A N   1 
ATOM   1571 C CA  . LEU A 1 200 ? -13.400 4.359   36.310  1.00 30.55  ? 195 LEU A CA  1 
ATOM   1572 C C   . LEU A 1 200 ? -12.395 5.323   36.937  1.00 30.57  ? 195 LEU A C   1 
ATOM   1573 O O   . LEU A 1 200 ? -11.633 4.948   37.788  1.00 30.78  ? 195 LEU A O   1 
ATOM   1574 C CB  . LEU A 1 200 ? -12.957 3.982   34.904  1.00 28.61  ? 195 LEU A CB  1 
ATOM   1575 C CG  . LEU A 1 200 ? -13.825 2.931   34.224  1.00 30.56  ? 195 LEU A CG  1 
ATOM   1576 C CD1 . LEU A 1 200 ? -13.386 2.775   32.756  1.00 31.37  ? 195 LEU A CD1 1 
ATOM   1577 C CD2 . LEU A 1 200 ? -13.726 1.616   34.998  1.00 28.52  ? 195 LEU A CD2 1 
ATOM   1578 N N   . VAL A 1 201 ? -12.441 6.572   36.517  1.00 30.99  ? 196 VAL A N   1 
ATOM   1579 C CA  . VAL A 1 201 ? -11.583 7.610   37.059  1.00 33.39  ? 196 VAL A CA  1 
ATOM   1580 C C   . VAL A 1 201 ? -11.784 7.819   38.558  1.00 34.74  ? 196 VAL A C   1 
ATOM   1581 O O   . VAL A 1 201 ? -10.808 7.831   39.307  1.00 34.22  ? 196 VAL A O   1 
ATOM   1582 C CB  . VAL A 1 201 ? -11.697 8.907   36.238  1.00 35.10  ? 196 VAL A CB  1 
ATOM   1583 C CG1 . VAL A 1 201 ? -10.892 10.033  36.857  1.00 38.49  ? 196 VAL A CG1 1 
ATOM   1584 C CG2 . VAL A 1 201 ? -11.168 8.649   34.844  1.00 37.26  ? 196 VAL A CG2 1 
ATOM   1585 N N   . GLU A 1 202 ? -13.044 7.958   39.002  1.00 35.60  ? 197 GLU A N   1 
ATOM   1586 C CA  . GLU A 1 202 ? -13.323 8.071   40.431  1.00 37.45  ? 197 GLU A CA  1 
ATOM   1587 C C   . GLU A 1 202 ? -12.770 6.910   41.232  1.00 35.40  ? 197 GLU A C   1 
ATOM   1588 O O   . GLU A 1 202 ? -12.202 7.101   42.297  1.00 36.31  ? 197 GLU A O   1 
ATOM   1589 C CB  . GLU A 1 202 ? -14.827 8.244   40.699  1.00 39.37  ? 197 GLU A CB  1 
ATOM   1590 C CG  . GLU A 1 202 ? -15.324 9.575   40.274  1.00 44.57  ? 197 GLU A CG  1 
ATOM   1591 C CD  . GLU A 1 202 ? -14.664 10.712  41.041  1.00 53.65  ? 197 GLU A CD  1 
ATOM   1592 O OE1 . GLU A 1 202 ? -14.287 10.525  42.235  1.00 56.64  ? 197 GLU A OE1 1 
ATOM   1593 O OE2 . GLU A 1 202 ? -14.528 11.810  40.449  1.00 57.25  ? 197 GLU A OE2 1 
ATOM   1594 N N   . ALA A 1 203 ? -12.953 5.713   40.710  1.00 33.14  ? 198 ALA A N   1 
ATOM   1595 C CA  . ALA A 1 203 ? -12.454 4.518   41.343  1.00 33.46  ? 198 ALA A CA  1 
ATOM   1596 C C   . ALA A 1 203 ? -10.903 4.537   41.427  1.00 33.38  ? 198 ALA A C   1 
ATOM   1597 O O   . ALA A 1 203 ? -10.345 4.181   42.463  1.00 34.40  ? 198 ALA A O   1 
ATOM   1598 C CB  . ALA A 1 203 ? -12.953 3.286   40.581  1.00 31.14  ? 198 ALA A CB  1 
ATOM   1599 N N   . GLN A 1 204 ? -10.225 4.971   40.364  1.00 32.73  ? 199 GLN A N   1 
ATOM   1600 C CA  . GLN A 1 204 ? -8.763  5.206   40.429  1.00 32.64  ? 199 GLN A CA  1 
ATOM   1601 C C   . GLN A 1 204 ? -8.352  6.213   41.514  1.00 35.41  ? 199 GLN A C   1 
ATOM   1602 O O   . GLN A 1 204 ? -7.410  5.938   42.271  1.00 35.03  ? 199 GLN A O   1 
ATOM   1603 C CB  . GLN A 1 204 ? -8.177  5.629   39.080  1.00 32.71  ? 199 GLN A CB  1 
ATOM   1604 C CG  . GLN A 1 204 ? -8.288  4.599   37.920  1.00 30.45  ? 199 GLN A CG  1 
ATOM   1605 C CD  . GLN A 1 204 ? -7.346  3.412   38.007  1.00 32.13  ? 199 GLN A CD  1 
ATOM   1606 O OE1 . GLN A 1 204 ? -6.256  3.481   38.590  1.00 35.29  ? 199 GLN A OE1 1 
ATOM   1607 N NE2 . GLN A 1 204 ? -7.763  2.298   37.408  1.00 28.02  ? 199 GLN A NE2 1 
ATOM   1608 N N   . ALA A 1 205 ? -9.060  7.337   41.605  1.00 36.38  ? 200 ALA A N   1 
ATOM   1609 C CA  . ALA A 1 205 ? -8.720  8.389   42.564  1.00 39.68  ? 200 ALA A CA  1 
ATOM   1610 C C   . ALA A 1 205 ? -8.822  7.934   44.021  1.00 40.64  ? 200 ALA A C   1 
ATOM   1611 O O   . ALA A 1 205 ? -7.955  8.250   44.836  1.00 42.10  ? 200 ALA A O   1 
ATOM   1612 C CB  . ALA A 1 205 ? -9.589  9.618   42.330  1.00 40.58  ? 200 ALA A CB  1 
ATOM   1613 N N   . THR A 1 206 ? -9.873  7.186   44.344  1.00 40.49  ? 201 THR A N   1 
ATOM   1614 C CA  . THR A 1 206 ? -10.003 6.580   45.668  1.00 42.27  ? 201 THR A CA  1 
ATOM   1615 C C   . THR A 1 206 ? -8.808  5.678   45.982  1.00 40.37  ? 201 THR A C   1 
ATOM   1616 O O   . THR A 1 206 ? -8.260  5.720   47.075  1.00 42.60  ? 201 THR A O   1 
ATOM   1617 C CB  . THR A 1 206 ? -11.293 5.752   45.775  1.00 41.93  ? 201 THR A CB  1 
ATOM   1618 O OG1 . THR A 1 206 ? -12.409 6.612   45.531  1.00 44.72  ? 201 THR A OG1 1 
ATOM   1619 C CG2 . THR A 1 206 ? -11.424 5.154   47.186  1.00 44.41  ? 201 THR A CG2 1 
ATOM   1620 N N   . HIS A 1 207 ? -8.411  4.880   45.008  1.00 37.28  ? 202 HIS A N   1 
ATOM   1621 C CA  . HIS A 1 207 ? -7.349  3.907   45.199  1.00 36.50  ? 202 HIS A CA  1 
ATOM   1622 C C   . HIS A 1 207 ? -6.058  4.632   45.451  1.00 37.33  ? 202 HIS A C   1 
ATOM   1623 O O   . HIS A 1 207 ? -5.360  4.335   46.430  1.00 38.30  ? 202 HIS A O   1 
ATOM   1624 C CB  . HIS A 1 207 ? -7.237  2.974   43.990  1.00 32.61  ? 202 HIS A CB  1 
ATOM   1625 C CG  . HIS A 1 207 ? -5.964  2.192   43.940  1.00 32.52  ? 202 HIS A CG  1 
ATOM   1626 N ND1 . HIS A 1 207 ? -5.609  1.269   44.906  1.00 33.53  ? 202 HIS A ND1 1 
ATOM   1627 C CD2 . HIS A 1 207 ? -4.956  2.192   43.031  1.00 31.57  ? 202 HIS A CD2 1 
ATOM   1628 C CE1 . HIS A 1 207 ? -4.452  0.719   44.577  1.00 28.94  ? 202 HIS A CE1 1 
ATOM   1629 N NE2 . HIS A 1 207 ? -4.035  1.266   43.446  1.00 29.40  ? 202 HIS A NE2 1 
ATOM   1630 N N   . PHE A 1 208 ? -5.774  5.625   44.605  1.00 37.92  ? 203 PHE A N   1 
ATOM   1631 C CA  . PHE A 1 208 ? -4.514  6.363   44.657  1.00 38.57  ? 203 PHE A CA  1 
ATOM   1632 C C   . PHE A 1 208 ? -4.437  7.308   45.853  1.00 42.03  ? 203 PHE A C   1 
ATOM   1633 O O   . PHE A 1 208 ? -3.384  7.512   46.440  1.00 42.61  ? 203 PHE A O   1 
ATOM   1634 C CB  . PHE A 1 208 ? -4.249  7.096   43.343  1.00 37.27  ? 203 PHE A CB  1 
ATOM   1635 C CG  . PHE A 1 208 ? -3.589  6.236   42.339  1.00 34.79  ? 203 PHE A CG  1 
ATOM   1636 C CD1 . PHE A 1 208 ? -2.209  5.972   42.423  1.00 34.33  ? 203 PHE A CD1 1 
ATOM   1637 C CD2 . PHE A 1 208 ? -4.337  5.631   41.323  1.00 31.77  ? 203 PHE A CD2 1 
ATOM   1638 C CE1 . PHE A 1 208 ? -1.586  5.128   41.516  1.00 29.57  ? 203 PHE A CE1 1 
ATOM   1639 C CE2 . PHE A 1 208 ? -3.730  4.791   40.405  1.00 29.76  ? 203 PHE A CE2 1 
ATOM   1640 C CZ  . PHE A 1 208 ? -2.339  4.542   40.500  1.00 30.26  ? 203 PHE A CZ  1 
ATOM   1641 N N   . GLN A 1 209 ? -5.570  7.850   46.239  1.00 44.43  ? 204 GLN A N   1 
ATOM   1642 C CA  . GLN A 1 209 ? -5.621  8.603   47.447  1.00 48.31  ? 204 GLN A CA  1 
ATOM   1643 C C   . GLN A 1 209 ? -5.405  7.705   48.683  1.00 48.36  ? 204 GLN A C   1 
ATOM   1644 O O   . GLN A 1 209 ? -4.657  8.072   49.573  1.00 49.77  ? 204 GLN A O   1 
ATOM   1645 C CB  . GLN A 1 209 ? -6.949  9.326   47.522  1.00 51.14  ? 204 GLN A CB  1 
ATOM   1646 C CG  . GLN A 1 209 ? -7.015  10.303  48.641  1.00 57.86  ? 204 GLN A CG  1 
ATOM   1647 C CD  . GLN A 1 209 ? -8.193  10.001  49.512  1.00 65.65  ? 204 GLN A CD  1 
ATOM   1648 O OE1 . GLN A 1 209 ? -9.233  10.670  49.431  1.00 68.69  ? 204 GLN A OE1 1 
ATOM   1649 N NE2 . GLN A 1 209 ? -8.060  8.956   50.341  1.00 66.56  ? 204 GLN A NE2 1 
ATOM   1650 N N   . GLN A 1 210 ? -6.059  6.537   48.729  1.00 47.21  ? 205 GLN A N   1 
ATOM   1651 C CA  . GLN A 1 210 ? -5.871  5.577   49.853  1.00 47.62  ? 205 GLN A CA  1 
ATOM   1652 C C   . GLN A 1 210 ? -4.430  5.081   49.956  1.00 45.33  ? 205 GLN A C   1 
ATOM   1653 O O   . GLN A 1 210 ? -3.900  4.946   51.041  1.00 46.27  ? 205 GLN A O   1 
ATOM   1654 C CB  . GLN A 1 210 ? -6.770  4.347   49.709  1.00 46.43  ? 205 GLN A CB  1 
ATOM   1655 C CG  . GLN A 1 210 ? -8.213  4.530   50.193  1.00 50.56  ? 205 GLN A CG  1 
ATOM   1656 C CD  . GLN A 1 210 ? -9.137  3.448   49.645  1.00 50.05  ? 205 GLN A CD  1 
ATOM   1657 O OE1 . GLN A 1 210 ? -8.714  2.563   48.886  1.00 48.42  ? 205 GLN A OE1 1 
ATOM   1658 N NE2 . GLN A 1 210 ? -10.407 3.524   50.013  1.00 53.82  ? 205 GLN A NE2 1 
ATOM   1659 N N   . GLY A 1 211 ? -3.810  4.783   48.821  1.00 41.70  ? 206 GLY A N   1 
ATOM   1660 C CA  . GLY A 1 211 ? -2.426  4.312   48.840  1.00 39.82  ? 206 GLY A CA  1 
ATOM   1661 C C   . GLY A 1 211 ? -1.492  5.426   49.225  1.00 41.48  ? 206 GLY A C   1 
ATOM   1662 O O   . GLY A 1 211 ? -0.580  5.239   50.042  1.00 42.51  ? 206 GLY A O   1 
ATOM   1663 N N   . HIS A 1 212 ? -1.712  6.604   48.647  1.00 41.53  ? 207 HIS A N   1 
ATOM   1664 C CA  . HIS A 1 212 ? -0.815  7.698   48.898  1.00 42.20  ? 207 HIS A CA  1 
ATOM   1665 C C   . HIS A 1 212 ? -0.823  8.094   50.393  1.00 46.37  ? 207 HIS A C   1 
ATOM   1666 O O   . HIS A 1 212 ? 0.243   8.236   51.022  1.00 46.29  ? 207 HIS A O   1 
ATOM   1667 C CB  . HIS A 1 212 ? -1.088  8.888   47.972  1.00 41.55  ? 207 HIS A CB  1 
ATOM   1668 C CG  . HIS A 1 212 ? -0.210  10.070  48.259  1.00 45.20  ? 207 HIS A CG  1 
ATOM   1669 N ND1 . HIS A 1 212 ? 1.167   10.034  48.105  1.00 44.04  ? 207 HIS A ND1 1 
ATOM   1670 C CD2 . HIS A 1 212 ? -0.503  11.300  48.741  1.00 44.38  ? 207 HIS A CD2 1 
ATOM   1671 C CE1 . HIS A 1 212 ? 1.677   11.198  48.467  1.00 45.36  ? 207 HIS A CE1 1 
ATOM   1672 N NE2 . HIS A 1 212 ? 0.685   11.981  48.856  1.00 49.22  ? 207 HIS A NE2 1 
ATOM   1673 N N   . GLU A 1 213 ? -2.024  8.247   50.961  1.00 49.17  ? 208 GLU A N   1 
ATOM   1674 C CA  . GLU A 1 213 ? -2.170  8.684   52.344  1.00 53.54  ? 208 GLU A CA  1 
ATOM   1675 C C   . GLU A 1 213 ? -1.469  7.775   53.340  1.00 53.07  ? 208 GLU A C   1 
ATOM   1676 O O   . GLU A 1 213 ? -0.798  8.248   54.240  1.00 54.81  ? 208 GLU A O   1 
ATOM   1677 C CB  . GLU A 1 213 ? -3.648  8.810   52.746  1.00 56.47  ? 208 GLU A CB  1 
ATOM   1678 C CG  . GLU A 1 213 ? -3.770  9.499   54.112  1.00 65.59  ? 208 GLU A CG  1 
ATOM   1679 C CD  . GLU A 1 213 ? -4.859  8.926   55.022  1.00 74.95  ? 208 GLU A CD  1 
ATOM   1680 O OE1 . GLU A 1 213 ? -5.993  8.630   54.529  1.00 74.45  ? 208 GLU A OE1 1 
ATOM   1681 O OE2 . GLU A 1 213 ? -4.570  8.807   56.248  1.00 79.47  ? 208 GLU A OE2 1 
ATOM   1682 N N   . GLU A 1 214 ? -1.663  6.469   53.191  1.00 50.81  ? 209 GLU A N   1 
ATOM   1683 C CA  . GLU A 1 214 ? -1.085  5.506   54.104  1.00 51.85  ? 209 GLU A CA  1 
ATOM   1684 C C   . GLU A 1 214 ? 0.466   5.587   54.042  1.00 51.14  ? 209 GLU A C   1 
ATOM   1685 O O   . GLU A 1 214 ? 1.142   5.681   55.103  1.00 53.48  ? 209 GLU A O   1 
ATOM   1686 C CB  . GLU A 1 214 ? -1.633  4.106   53.791  1.00 49.51  ? 209 GLU A CB  1 
ATOM   1687 C CG  . GLU A 1 214 ? -0.624  2.944   54.029  1.00 54.05  ? 209 GLU A CG  1 
ATOM   1688 C CD  . GLU A 1 214 ? -0.712  2.333   55.405  1.00 61.61  ? 209 GLU A CD  1 
ATOM   1689 O OE1 . GLU A 1 214 ? -1.696  2.618   56.129  1.00 68.86  ? 209 GLU A OE1 1 
ATOM   1690 O OE2 . GLU A 1 214 ? 0.217   1.577   55.779  1.00 63.45  ? 209 GLU A OE2 1 
ATOM   1691 N N   . LEU A 1 215 ? 1.007   5.610   52.820  1.00 47.42  ? 210 LEU A N   1 
ATOM   1692 C CA  . LEU A 1 215 ? 2.459   5.761   52.588  1.00 46.87  ? 210 LEU A CA  1 
ATOM   1693 C C   . LEU A 1 215 ? 3.109   7.065   53.125  1.00 49.67  ? 210 LEU A C   1 
ATOM   1694 O O   . LEU A 1 215 ? 4.250   7.047   53.588  1.00 49.20  ? 210 LEU A O   1 
ATOM   1695 C CB  . LEU A 1 215 ? 2.773   5.562   51.106  1.00 43.00  ? 210 LEU A CB  1 
ATOM   1696 C CG  . LEU A 1 215 ? 2.600   4.105   50.653  1.00 42.05  ? 210 LEU A CG  1 
ATOM   1697 C CD1 . LEU A 1 215 ? 2.441   3.961   49.122  1.00 37.65  ? 210 LEU A CD1 1 
ATOM   1698 C CD2 . LEU A 1 215 ? 3.742   3.225   51.138  1.00 41.18  ? 210 LEU A CD2 1 
ATOM   1699 N N   . SER A 1 216 ? 2.390   8.183   53.050  1.00 52.77  ? 211 SER A N   1 
ATOM   1700 C CA  . SER A 1 216 ? 2.839   9.427   53.681  1.00 57.46  ? 211 SER A CA  1 
ATOM   1701 C C   . SER A 1 216 ? 2.870   9.354   55.201  1.00 60.67  ? 211 SER A C   1 
ATOM   1702 O O   . SER A 1 216 ? 3.802   9.860   55.810  1.00 62.79  ? 211 SER A O   1 
ATOM   1703 C CB  . SER A 1 216 ? 1.980   10.615  53.258  1.00 60.02  ? 211 SER A CB  1 
ATOM   1704 O OG  . SER A 1 216 ? 2.133   10.861  51.873  1.00 60.21  ? 211 SER A OG  1 
ATOM   1705 N N   . ARG A 1 217 ? 1.859   8.741   55.813  1.00 61.92  ? 212 ARG A N   1 
ATOM   1706 C CA  . ARG A 1 217 ? 1.885   8.479   57.264  1.00 65.81  ? 212 ARG A CA  1 
ATOM   1707 C C   . ARG A 1 217 ? 3.125   7.641   57.644  1.00 64.63  ? 212 ARG A C   1 
ATOM   1708 O O   . ARG A 1 217 ? 3.657   7.789   58.733  1.00 68.09  ? 212 ARG A O   1 
ATOM   1709 C CB  . ARG A 1 217 ? 0.596   7.792   57.758  1.00 66.71  ? 212 ARG A CB  1 
ATOM   1710 C CG  . ARG A 1 217 ? -0.678  8.630   57.693  1.00 70.64  ? 212 ARG A CG  1 
ATOM   1711 C CD  . ARG A 1 217 ? -1.828  7.973   58.487  1.00 77.61  ? 212 ARG A CD  1 
ATOM   1712 N NE  . ARG A 1 217 ? -2.802  7.287   57.624  1.00 79.94  ? 212 ARG A NE  1 
ATOM   1713 C CZ  . ARG A 1 217 ? -2.766  5.989   57.298  1.00 79.33  ? 212 ARG A CZ  1 
ATOM   1714 N NH1 . ARG A 1 217 ? -1.812  5.191   57.777  1.00 78.87  ? 212 ARG A NH1 1 
ATOM   1715 N NH2 . ARG A 1 217 ? -3.695  5.479   56.488  1.00 77.59  ? 212 ARG A NH2 1 
ATOM   1716 N N   . LEU A 1 218 ? 3.582   6.786   56.730  1.00 60.82  ? 213 LEU A N   1 
ATOM   1717 C CA  . LEU A 1 218 ? 4.770   5.965   56.928  1.00 59.34  ? 213 LEU A CA  1 
ATOM   1718 C C   . LEU A 1 218 ? 6.055   6.727   56.655  1.00 59.42  ? 213 LEU A C   1 
ATOM   1719 O O   . LEU A 1 218 ? 7.133   6.202   56.905  1.00 58.41  ? 213 LEU A O   1 
ATOM   1720 C CB  . LEU A 1 218 ? 4.740   4.741   56.000  1.00 55.92  ? 213 LEU A CB  1 
ATOM   1721 C CG  . LEU A 1 218 ? 4.121   3.410   56.439  1.00 56.29  ? 213 LEU A CG  1 
ATOM   1722 C CD1 . LEU A 1 218 ? 4.381   2.380   55.352  1.00 52.26  ? 213 LEU A CD1 1 
ATOM   1723 C CD2 . LEU A 1 218 ? 4.722   2.931   57.762  1.00 57.91  ? 213 LEU A CD2 1 
ATOM   1724 N N   . SER A 1 219 ? 5.936   7.955   56.148  1.00 60.82  ? 214 SER A N   1 
ATOM   1725 C CA  . SER A 1 219 ? 7.075   8.733   55.615  1.00 61.81  ? 214 SER A CA  1 
ATOM   1726 C C   . SER A 1 219 ? 8.276   9.039   56.566  1.00 64.16  ? 214 SER A C   1 
ATOM   1727 O O   . SER A 1 219 ? 9.434   8.875   56.167  1.00 63.24  ? 214 SER A O   1 
ATOM   1728 C CB  . SER A 1 219 ? 6.558   9.996   54.899  1.00 63.42  ? 214 SER A CB  1 
ATOM   1729 O OG  . SER A 1 219 ? 7.426   11.101  55.094  1.00 68.43  ? 214 SER A OG  1 
ATOM   1730 N N   . GLN A 1 220 ? 8.027   9.470   57.800  1.00 67.60  ? 215 GLN A N   1 
ATOM   1731 C CA  . GLN A 1 220 ? 9.145   9.699   58.724  1.00 70.18  ? 215 GLN A CA  1 
ATOM   1732 C C   . GLN A 1 220 ? 9.830   8.381   59.099  1.00 67.32  ? 215 GLN A C   1 
ATOM   1733 O O   . GLN A 1 220 ? 11.065  8.329   59.218  1.00 67.13  ? 215 GLN A O   1 
ATOM   1734 C CB  . GLN A 1 220 ? 8.734   10.500  59.973  1.00 75.23  ? 215 GLN A CB  1 
ATOM   1735 C CG  . GLN A 1 220 ? 9.318   11.936  60.056  1.00 81.63  ? 215 GLN A CG  1 
ATOM   1736 C CD  . GLN A 1 220 ? 10.654  12.045  60.835  1.00 87.10  ? 215 GLN A CD  1 
ATOM   1737 O OE1 . GLN A 1 220 ? 11.728  11.768  60.299  1.00 86.93  ? 215 GLN A OE1 1 
ATOM   1738 N NE2 . GLN A 1 220 ? 10.580  12.483  62.094  1.00 92.59  ? 215 GLN A NE2 1 
ATOM   1739 N N   . TYR A 1 221 ? 9.045   7.315   59.251  1.00 64.99  ? 216 TYR A N   1 
ATOM   1740 C CA  . TYR A 1 221 ? 9.622   6.016   59.586  1.00 62.60  ? 216 TYR A CA  1 
ATOM   1741 C C   . TYR A 1 221 ? 10.576  5.486   58.498  1.00 58.82  ? 216 TYR A C   1 
ATOM   1742 O O   . TYR A 1 221 ? 11.630  4.922   58.823  1.00 57.51  ? 216 TYR A O   1 
ATOM   1743 C CB  . TYR A 1 221 ? 8.551   4.979   59.928  1.00 62.25  ? 216 TYR A CB  1 
ATOM   1744 C CG  . TYR A 1 221 ? 9.152   3.620   60.134  1.00 60.76  ? 216 TYR A CG  1 
ATOM   1745 C CD1 . TYR A 1 221 ? 9.804   3.300   61.320  1.00 63.37  ? 216 TYR A CD1 1 
ATOM   1746 C CD2 . TYR A 1 221 ? 9.118   2.662   59.119  1.00 57.97  ? 216 TYR A CD2 1 
ATOM   1747 C CE1 . TYR A 1 221 ? 10.396  2.055   61.493  1.00 62.06  ? 216 TYR A CE1 1 
ATOM   1748 C CE2 . TYR A 1 221 ? 9.698   1.419   59.287  1.00 55.09  ? 216 TYR A CE2 1 
ATOM   1749 C CZ  . TYR A 1 221 ? 10.333  1.122   60.475  1.00 57.97  ? 216 TYR A CZ  1 
ATOM   1750 O OH  . TYR A 1 221 ? 10.906  -0.114  60.638  1.00 57.96  ? 216 TYR A OH  1 
ATOM   1751 N N   . ARG A 1 222 ? 10.192  5.677   57.229  1.00 56.25  ? 217 ARG A N   1 
ATOM   1752 C CA  . ARG A 1 222 ? 11.022  5.360   56.058  1.00 54.09  ? 217 ARG A CA  1 
ATOM   1753 C C   . ARG A 1 222 ? 12.348  6.124   56.068  1.00 55.32  ? 217 ARG A C   1 
ATOM   1754 O O   . ARG A 1 222 ? 13.414  5.540   55.869  1.00 54.28  ? 217 ARG A O   1 
ATOM   1755 C CB  . ARG A 1 222 ? 10.281  5.680   54.746  1.00 52.33  ? 217 ARG A CB  1 
ATOM   1756 C CG  . ARG A 1 222 ? 9.287   4.637   54.273  1.00 51.94  ? 217 ARG A CG  1 
ATOM   1757 C CD  . ARG A 1 222 ? 8.063   5.288   53.548  1.00 51.51  ? 217 ARG A CD  1 
ATOM   1758 N NE  . ARG A 1 222 ? 8.454   5.974   52.315  1.00 49.10  ? 217 ARG A NE  1 
ATOM   1759 C CZ  . ARG A 1 222 ? 7.729   6.893   51.670  1.00 47.57  ? 217 ARG A CZ  1 
ATOM   1760 N NH1 . ARG A 1 222 ? 8.214   7.429   50.567  1.00 47.99  ? 217 ARG A NH1 1 
ATOM   1761 N NH2 . ARG A 1 222 ? 6.540   7.286   52.108  1.00 45.80  ? 217 ARG A NH2 1 
ATOM   1762 N N   . LYS A 1 223 ? 12.271  7.431   56.281  1.00 58.79  ? 218 LYS A N   1 
ATOM   1763 C CA  . LYS A 1 223 ? 13.455  8.268   56.282  1.00 61.23  ? 218 LYS A CA  1 
ATOM   1764 C C   . LYS A 1 223 ? 14.366  7.936   57.478  1.00 62.52  ? 218 LYS A C   1 
ATOM   1765 O O   . LYS A 1 223 ? 15.594  7.922   57.333  1.00 62.67  ? 218 LYS A O   1 
ATOM   1766 C CB  . LYS A 1 223 ? 13.074  9.756   56.135  1.00 64.55  ? 218 LYS A CB  1 
ATOM   1767 C CG  . LYS A 1 223 ? 13.028  10.621  57.395  1.00 70.01  ? 218 LYS A CG  1 
ATOM   1768 C CD  . LYS A 1 223 ? 14.230  11.584  57.435  1.00 74.87  ? 218 LYS A CD  1 
ATOM   1769 C CE  . LYS A 1 223 ? 13.947  12.887  58.212  1.00 79.44  ? 218 LYS A CE  1 
ATOM   1770 N NZ  . LYS A 1 223 ? 14.298  12.784  59.656  1.00 81.76  ? 218 LYS A NZ  1 
ATOM   1771 N N   . GLU A 1 224 ? 13.760  7.606   58.623  1.00 63.89  ? 219 GLU A N   1 
ATOM   1772 C CA  . GLU A 1 224 ? 14.495  7.179   59.829  1.00 65.08  ? 219 GLU A CA  1 
ATOM   1773 C C   . GLU A 1 224 ? 15.145  5.795   59.648  1.00 61.91  ? 219 GLU A C   1 
ATOM   1774 O O   . GLU A 1 224 ? 16.332  5.620   59.953  1.00 61.49  ? 219 GLU A O   1 
ATOM   1775 C CB  . GLU A 1 224 ? 13.591  7.223   61.080  1.00 68.03  ? 219 GLU A CB  1 
ATOM   1776 C CG  . GLU A 1 224 ? 13.433  8.641   61.705  1.00 74.02  ? 219 GLU A CG  1 
ATOM   1777 C CD  . GLU A 1 224 ? 12.122  8.860   62.507  1.00 79.43  ? 219 GLU A CD  1 
ATOM   1778 O OE1 . GLU A 1 224 ? 11.205  8.007   62.468  1.00 77.87  ? 219 GLU A OE1 1 
ATOM   1779 O OE2 . GLU A 1 224 ? 12.001  9.918   63.178  1.00 85.23  ? 219 GLU A OE2 1 
ATOM   1780 N N   . LEU A 1 225 ? 14.377  4.831   59.132  1.00 59.18  ? 220 LEU A N   1 
ATOM   1781 C CA  . LEU A 1 225 ? 14.902  3.507   58.817  1.00 56.71  ? 220 LEU A CA  1 
ATOM   1782 C C   . LEU A 1 225 ? 16.052  3.593   57.802  1.00 55.62  ? 220 LEU A C   1 
ATOM   1783 O O   . LEU A 1 225 ? 17.069  2.884   57.923  1.00 54.07  ? 220 LEU A O   1 
ATOM   1784 C CB  . LEU A 1 225 ? 13.783  2.586   58.307  1.00 54.87  ? 220 LEU A CB  1 
ATOM   1785 C CG  . LEU A 1 225 ? 14.120  1.227   57.663  1.00 52.32  ? 220 LEU A CG  1 
ATOM   1786 C CD1 . LEU A 1 225 ? 14.828  0.272   58.632  1.00 52.18  ? 220 LEU A CD1 1 
ATOM   1787 C CD2 . LEU A 1 225 ? 12.847  0.594   57.174  1.00 49.72  ? 220 LEU A CD2 1 
ATOM   1788 N N   . GLY A 1 226 ? 15.903  4.477   56.815  1.00 56.11  ? 221 GLY A N   1 
ATOM   1789 C CA  . GLY A 1 226 ? 16.936  4.644   55.784  1.00 56.00  ? 221 GLY A CA  1 
ATOM   1790 C C   . GLY A 1 226 ? 18.227  5.128   56.419  1.00 58.54  ? 221 GLY A C   1 
ATOM   1791 O O   . GLY A 1 226 ? 19.322  4.705   56.036  1.00 58.01  ? 221 GLY A O   1 
ATOM   1792 N N   . ALA A 1 227 ? 18.076  6.006   57.409  1.00 61.69  ? 222 ALA A N   1 
ATOM   1793 C CA  . ALA A 1 227 ? 19.183  6.543   58.197  1.00 64.70  ? 222 ALA A CA  1 
ATOM   1794 C C   . ALA A 1 227 ? 19.854  5.486   59.079  1.00 64.30  ? 222 ALA A C   1 
ATOM   1795 O O   . ALA A 1 227 ? 21.068  5.321   59.017  1.00 64.71  ? 222 ALA A O   1 
ATOM   1796 C CB  . ALA A 1 227 ? 18.703  7.737   59.039  1.00 67.87  ? 222 ALA A CB  1 
ATOM   1797 N N   . GLN A 1 228 ? 19.062  4.777   59.885  1.00 64.60  ? 223 GLN A N   1 
ATOM   1798 C CA  . GLN A 1 228 ? 19.546  3.695   60.746  1.00 64.79  ? 223 GLN A CA  1 
ATOM   1799 C C   . GLN A 1 228 ? 20.280  2.634   59.940  1.00 62.21  ? 223 GLN A C   1 
ATOM   1800 O O   . GLN A 1 228 ? 21.234  2.025   60.424  1.00 62.44  ? 223 GLN A O   1 
ATOM   1801 C CB  . GLN A 1 228 ? 18.380  3.003   61.458  1.00 65.49  ? 223 GLN A CB  1 
ATOM   1802 C CG  . GLN A 1 228 ? 17.716  3.784   62.585  1.00 70.44  ? 223 GLN A CG  1 
ATOM   1803 C CD  . GLN A 1 228 ? 16.475  3.079   63.148  1.00 73.51  ? 223 GLN A CD  1 
ATOM   1804 O OE1 . GLN A 1 228 ? 16.388  1.851   63.157  1.00 73.06  ? 223 GLN A OE1 1 
ATOM   1805 N NE2 . GLN A 1 228 ? 15.512  3.864   63.623  1.00 77.01  ? 223 GLN A NE2 1 
ATOM   1806 N N   . LEU A 1 229 ? 19.814  2.405   58.718  1.00 59.90  ? 224 LEU A N   1 
ATOM   1807 C CA  . LEU A 1 229 ? 20.327  1.340   57.881  1.00 57.86  ? 224 LEU A CA  1 
ATOM   1808 C C   . LEU A 1 229 ? 21.730  1.670   57.379  1.00 58.08  ? 224 LEU A C   1 
ATOM   1809 O O   . LEU A 1 229 ? 22.641  0.864   57.511  1.00 56.33  ? 224 LEU A O   1 
ATOM   1810 C CB  . LEU A 1 229 ? 19.394  1.126   56.698  1.00 56.01  ? 224 LEU A CB  1 
ATOM   1811 C CG  . LEU A 1 229 ? 18.891  -0.289  56.403  1.00 56.19  ? 224 LEU A CG  1 
ATOM   1812 C CD1 . LEU A 1 229 ? 18.565  -1.078  57.689  1.00 57.37  ? 224 LEU A CD1 1 
ATOM   1813 C CD2 . LEU A 1 229 ? 17.666  -0.222  55.504  1.00 53.27  ? 224 LEU A CD2 1 
ATOM   1814 N N   . HIS A 1 230 ? 21.877  2.861   56.799  1.00 59.66  ? 225 HIS A N   1 
ATOM   1815 C CA  . HIS A 1 230 ? 23.177  3.397   56.386  1.00 61.34  ? 225 HIS A CA  1 
ATOM   1816 C C   . HIS A 1 230 ? 24.151  3.430   57.574  1.00 62.46  ? 225 HIS A C   1 
ATOM   1817 O O   . HIS A 1 230 ? 25.340  3.200   57.413  1.00 62.33  ? 225 HIS A O   1 
ATOM   1818 C CB  . HIS A 1 230 ? 22.995  4.784   55.748  1.00 63.25  ? 225 HIS A CB  1 
ATOM   1819 C CG  . HIS A 1 230 ? 24.272  5.539   55.560  1.00 67.38  ? 225 HIS A CG  1 
ATOM   1820 N ND1 . HIS A 1 230 ? 25.235  5.164   54.644  1.00 68.51  ? 225 HIS A ND1 1 
ATOM   1821 C CD2 . HIS A 1 230 ? 24.748  6.650   56.174  1.00 70.36  ? 225 HIS A CD2 1 
ATOM   1822 C CE1 . HIS A 1 230 ? 26.253  6.006   54.711  1.00 70.58  ? 225 HIS A CE1 1 
ATOM   1823 N NE2 . HIS A 1 230 ? 25.981  6.917   55.629  1.00 72.02  ? 225 HIS A NE2 1 
ATOM   1824 N N   . GLN A 1 231 ? 23.617  3.670   58.765  1.00 63.71  ? 226 GLN A N   1 
ATOM   1825 C CA  . GLN A 1 231 ? 24.394  3.619   59.996  1.00 65.70  ? 226 GLN A CA  1 
ATOM   1826 C C   . GLN A 1 231 ? 24.908  2.210   60.287  1.00 64.12  ? 226 GLN A C   1 
ATOM   1827 O O   . GLN A 1 231 ? 26.100  2.016   60.536  1.00 63.80  ? 226 GLN A O   1 
ATOM   1828 C CB  . GLN A 1 231 ? 23.536  4.078   61.168  1.00 67.84  ? 226 GLN A CB  1 
ATOM   1829 C CG  . GLN A 1 231 ? 24.322  4.549   62.344  1.00 72.26  ? 226 GLN A CG  1 
ATOM   1830 C CD  . GLN A 1 231 ? 24.581  6.042   62.296  1.00 77.37  ? 226 GLN A CD  1 
ATOM   1831 O OE1 . GLN A 1 231 ? 24.713  6.691   63.339  1.00 81.38  ? 226 GLN A OE1 1 
ATOM   1832 N NE2 . GLN A 1 231 ? 24.640  6.602   61.084  1.00 76.37  ? 226 GLN A NE2 1 
ATOM   1833 N N   . LEU A 1 232 ? 24.004  1.233   60.244  1.00 62.34  ? 227 LEU A N   1 
ATOM   1834 C CA  . LEU A 1 232 ? 24.353  -0.134  60.610  1.00 61.58  ? 227 LEU A CA  1 
ATOM   1835 C C   . LEU A 1 232 ? 25.415  -0.692  59.684  1.00 60.31  ? 227 LEU A C   1 
ATOM   1836 O O   . LEU A 1 232 ? 26.245  -1.483  60.110  1.00 60.97  ? 227 LEU A O   1 
ATOM   1837 C CB  . LEU A 1 232 ? 23.110  -1.040  60.662  1.00 60.86  ? 227 LEU A CB  1 
ATOM   1838 C CG  . LEU A 1 232 ? 22.349  -1.234  62.005  1.00 63.36  ? 227 LEU A CG  1 
ATOM   1839 C CD1 . LEU A 1 232 ? 23.237  -1.832  63.129  1.00 65.59  ? 227 LEU A CD1 1 
ATOM   1840 C CD2 . LEU A 1 232 ? 21.658  0.020   62.522  1.00 64.77  ? 227 LEU A CD2 1 
ATOM   1841 N N   . VAL A 1 233 ? 25.409  -0.244  58.432  1.00 59.40  ? 228 VAL A N   1 
ATOM   1842 C CA  . VAL A 1 233 ? 26.321  -0.743  57.404  1.00 58.41  ? 228 VAL A CA  1 
ATOM   1843 C C   . VAL A 1 233 ? 27.716  -0.166  57.613  1.00 60.24  ? 228 VAL A C   1 
ATOM   1844 O O   . VAL A 1 233 ? 28.711  -0.838  57.327  1.00 60.96  ? 228 VAL A O   1 
ATOM   1845 C CB  . VAL A 1 233 ? 25.778  -0.446  55.970  1.00 58.18  ? 228 VAL A CB  1 
ATOM   1846 C CG1 . VAL A 1 233 ? 26.640  -1.091  54.886  1.00 56.86  ? 228 VAL A CG1 1 
ATOM   1847 C CG2 . VAL A 1 233 ? 24.335  -0.939  55.836  1.00 55.64  ? 228 VAL A CG2 1 
ATOM   1848 N N   . LEU A 1 234 ? 27.786  1.066   58.128  1.00 61.61  ? 229 LEU A N   1 
ATOM   1849 C CA  . LEU A 1 234 ? 29.038  1.655   58.611  1.00 63.15  ? 229 LEU A CA  1 
ATOM   1850 C C   . LEU A 1 234 ? 29.634  0.920   59.824  1.00 62.99  ? 229 LEU A C   1 
ATOM   1851 O O   . LEU A 1 234 ? 30.817  0.560   59.808  1.00 63.41  ? 229 LEU A O   1 
ATOM   1852 C CB  . LEU A 1 234 ? 28.867  3.148   58.928  1.00 65.80  ? 229 LEU A CB  1 
ATOM   1853 C CG  . LEU A 1 234 ? 29.638  4.173   58.081  1.00 68.27  ? 229 LEU A CG  1 
ATOM   1854 C CD1 . LEU A 1 234 ? 29.235  4.127   56.600  1.00 65.94  ? 229 LEU A CD1 1 
ATOM   1855 C CD2 . LEU A 1 234 ? 29.435  5.586   58.651  1.00 71.79  ? 229 LEU A CD2 1 
ATOM   1856 N N   . ASN A 1 235 ? 28.827  0.713   60.864  1.00 62.39  ? 230 ASN A N   1 
ATOM   1857 C CA  . ASN A 1 235 ? 29.251  -0.028  62.055  1.00 62.61  ? 230 ASN A CA  1 
ATOM   1858 C C   . ASN A 1 235 ? 29.836  -1.376  61.665  1.00 60.82  ? 230 ASN A C   1 
ATOM   1859 O O   . ASN A 1 235 ? 30.931  -1.761  62.093  1.00 61.03  ? 230 ASN A O   1 
ATOM   1860 C CB  . ASN A 1 235 ? 28.065  -0.287  62.998  1.00 62.75  ? 230 ASN A CB  1 
ATOM   1861 C CG  . ASN A 1 235 ? 27.529  0.970   63.641  1.00 64.55  ? 230 ASN A CG  1 
ATOM   1862 O OD1 . ASN A 1 235 ? 28.109  2.053   63.528  1.00 64.97  ? 230 ASN A OD1 1 
ATOM   1863 N ND2 . ASN A 1 235 ? 26.395  0.832   64.322  1.00 65.14  ? 230 ASN A ND2 1 
ATOM   1864 N N   . SER A 1 236 ? 29.072  -2.080  60.841  1.00 58.52  ? 231 SER A N   1 
ATOM   1865 C CA  . SER A 1 236 ? 29.401  -3.413  60.421  1.00 57.32  ? 231 SER A CA  1 
ATOM   1866 C C   . SER A 1 236 ? 30.713  -3.457  59.637  1.00 57.07  ? 231 SER A C   1 
ATOM   1867 O O   . SER A 1 236 ? 31.456  -4.438  59.733  1.00 57.14  ? 231 SER A O   1 
ATOM   1868 C CB  . SER A 1 236 ? 28.252  -3.997  59.608  1.00 55.69  ? 231 SER A CB  1 
ATOM   1869 O OG  . SER A 1 236 ? 28.536  -5.341  59.275  1.00 56.44  ? 231 SER A OG  1 
ATOM   1870 N N   . ALA A 1 237 ? 30.994  -2.401  58.872  1.00 57.06  ? 232 ALA A N   1 
ATOM   1871 C CA  . ALA A 1 237 ? 32.303  -2.254  58.226  1.00 57.76  ? 232 ALA A CA  1 
ATOM   1872 C C   . ALA A 1 237 ? 33.390  -2.016  59.274  1.00 59.47  ? 232 ALA A C   1 
ATOM   1873 O O   . ALA A 1 237 ? 34.440  -2.652  59.226  1.00 59.56  ? 232 ALA A O   1 
ATOM   1874 C CB  . ALA A 1 237 ? 32.289  -1.128  57.193  1.00 58.08  ? 232 ALA A CB  1 
ATOM   1875 N N   . ARG A 1 238 ? 33.126  -1.122  60.226  1.00 60.76  ? 233 ARG A N   1 
ATOM   1876 C CA  . ARG A 1 238 ? 34.064  -0.863  61.327  1.00 63.47  ? 233 ARG A CA  1 
ATOM   1877 C C   . ARG A 1 238 ? 34.412  -2.109  62.177  1.00 63.01  ? 233 ARG A C   1 
ATOM   1878 O O   . ARG A 1 238 ? 35.578  -2.319  62.502  1.00 63.57  ? 233 ARG A O   1 
ATOM   1879 C CB  . ARG A 1 238 ? 33.577  0.308   62.204  1.00 65.19  ? 233 ARG A CB  1 
ATOM   1880 C CG  . ARG A 1 238 ? 34.474  0.659   63.426  1.00 69.61  ? 233 ARG A CG  1 
ATOM   1881 C CD  . ARG A 1 238 ? 33.907  1.847   64.244  1.00 75.17  ? 233 ARG A CD  1 
ATOM   1882 N NE  . ARG A 1 238 ? 32.493  2.109   63.930  1.00 76.16  ? 233 ARG A NE  1 
ATOM   1883 C CZ  . ARG A 1 238 ? 31.734  3.037   64.511  1.00 78.85  ? 233 ARG A CZ  1 
ATOM   1884 N NH1 . ARG A 1 238 ? 32.230  3.819   65.467  1.00 81.17  ? 233 ARG A NH1 1 
ATOM   1885 N NH2 . ARG A 1 238 ? 30.467  3.178   64.130  1.00 76.92  ? 233 ARG A NH2 1 
ATOM   1886 N N   . GLU A 1 239 ? 33.407  -2.925  62.508  1.00 62.34  ? 234 GLU A N   1 
ATOM   1887 C CA  . GLU A 1 239 ? 33.595  -4.141  63.319  1.00 62.90  ? 234 GLU A CA  1 
ATOM   1888 C C   . GLU A 1 239 ? 34.353  -5.214  62.537  1.00 61.69  ? 234 GLU A C   1 
ATOM   1889 O O   . GLU A 1 239 ? 35.180  -5.954  63.094  1.00 62.90  ? 234 GLU A O   1 
ATOM   1890 C CB  . GLU A 1 239 ? 32.239  -4.702  63.790  1.00 62.75  ? 234 GLU A CB  1 
ATOM   1891 C CG  . GLU A 1 239 ? 31.630  -3.964  65.008  1.00 67.19  ? 234 GLU A CG  1 
ATOM   1892 C CD  . GLU A 1 239 ? 30.122  -4.204  65.214  1.00 70.03  ? 234 GLU A CD  1 
ATOM   1893 O OE1 . GLU A 1 239 ? 29.417  -4.611  64.254  1.00 70.44  ? 234 GLU A OE1 1 
ATOM   1894 O OE2 . GLU A 1 239 ? 29.630  -3.968  66.346  1.00 73.86  ? 234 GLU A OE2 1 
ATOM   1895 N N   . LYS A 1 240 ? 34.052  -5.295  61.245  1.00 59.38  ? 235 LYS A N   1 
ATOM   1896 C CA  . LYS A 1 240 ? 34.650  -6.285  60.374  1.00 58.31  ? 235 LYS A CA  1 
ATOM   1897 C C   . LYS A 1 240 ? 36.123  -5.980  60.243  1.00 58.74  ? 235 LYS A C   1 
ATOM   1898 O O   . LYS A 1 240 ? 36.931  -6.894  60.177  1.00 59.58  ? 235 LYS A O   1 
ATOM   1899 C CB  . LYS A 1 240 ? 33.968  -6.305  58.997  1.00 56.94  ? 235 LYS A CB  1 
ATOM   1900 C CG  . LYS A 1 240 ? 34.387  -7.480  58.112  1.00 57.81  ? 235 LYS A CG  1 
ATOM   1901 C CD  . LYS A 1 240 ? 34.182  -7.195  56.616  1.00 59.09  ? 235 LYS A CD  1 
ATOM   1902 C CE  . LYS A 1 240 ? 35.117  -8.051  55.769  1.00 60.21  ? 235 LYS A CE  1 
ATOM   1903 N NZ  . LYS A 1 240 ? 34.951  -7.823  54.304  1.00 60.99  ? 235 LYS A NZ  1 
ATOM   1904 N N   . ARG A 1 241 ? 36.473  -4.696  60.232  1.00 58.77  ? 236 ARG A N   1 
ATOM   1905 C CA  . ARG A 1 241 ? 37.875  -4.302  60.155  1.00 60.06  ? 236 ARG A CA  1 
ATOM   1906 C C   . ARG A 1 241 ? 38.565  -4.641  61.463  1.00 60.48  ? 236 ARG A C   1 
ATOM   1907 O O   . ARG A 1 241 ? 39.724  -5.055  61.461  1.00 60.49  ? 236 ARG A O   1 
ATOM   1908 C CB  . ARG A 1 241 ? 38.015  -2.816  59.841  1.00 61.46  ? 236 ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 241 ? 37.177  -2.351  58.632  1.00 63.19  ? 236 ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 241 ? 38.000  -2.100  57.370  1.00 66.46  ? 236 ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 241 ? 38.692  -0.802  57.425  1.00 70.71  ? 236 ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 241 ? 38.093  0.394   57.368  1.00 71.92  ? 236 ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 241 ? 36.760  0.502   57.261  1.00 68.09  ? 236 ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 241 ? 38.840  1.494   57.422  1.00 73.26  ? 236 ARG A NH2 1 
ATOM   1915 N N   . ASP A 1 242 ? 37.845  -4.466  62.574  1.00 60.14  ? 237 ASP A N   1 
ATOM   1916 C CA  . ASP A 1 242 ? 38.367  -4.826  63.896  1.00 61.65  ? 237 ASP A CA  1 
ATOM   1917 C C   . ASP A 1 242 ? 38.689  -6.325  63.991  1.00 60.95  ? 237 ASP A C   1 
ATOM   1918 O O   . ASP A 1 242 ? 39.746  -6.706  64.490  1.00 62.02  ? 237 ASP A O   1 
ATOM   1919 C CB  . ASP A 1 242 ? 37.410  -4.402  65.013  1.00 62.56  ? 237 ASP A CB  1 
ATOM   1920 C CG  . ASP A 1 242 ? 37.386  -2.879  65.247  1.00 65.78  ? 237 ASP A CG  1 
ATOM   1921 O OD1 . ASP A 1 242 ? 38.081  -2.133  64.514  1.00 67.97  ? 237 ASP A OD1 1 
ATOM   1922 O OD2 . ASP A 1 242 ? 36.645  -2.426  66.167  1.00 68.41  ? 237 ASP A OD2 1 
ATOM   1923 N N   . MET A 1 243 ? 37.798  -7.159  63.460  1.00 59.69  ? 238 MET A N   1 
ATOM   1924 C CA  . MET A 1 243 ? 37.969  -8.614  63.480  1.00 59.48  ? 238 MET A CA  1 
ATOM   1925 C C   . MET A 1 243 ? 39.115  -9.098  62.609  1.00 58.80  ? 238 MET A C   1 
ATOM   1926 O O   . MET A 1 243 ? 39.862  -9.982  63.021  1.00 59.29  ? 238 MET A O   1 
ATOM   1927 C CB  . MET A 1 243 ? 36.675  -9.313  63.070  1.00 59.05  ? 238 MET A CB  1 
ATOM   1928 C CG  . MET A 1 243 ? 35.678  -9.521  64.195  1.00 62.24  ? 238 MET A CG  1 
ATOM   1929 S SD  . MET A 1 243 ? 34.397  -10.716 63.691  1.00 70.31  ? 238 MET A SD  1 
ATOM   1930 C CE  . MET A 1 243 ? 35.313  -12.267 63.871  1.00 67.77  ? 238 MET A CE  1 
ATOM   1931 N N   . GLU A 1 244 ? 39.257  -8.527  61.408  1.00 57.39  ? 239 GLU A N   1 
ATOM   1932 C CA  . GLU A 1 244 ? 40.423  -8.846  60.545  1.00 57.60  ? 239 GLU A CA  1 
ATOM   1933 C C   . GLU A 1 244 ? 41.711  -8.423  61.206  1.00 57.09  ? 239 GLU A C   1 
ATOM   1934 O O   . GLU A 1 244 ? 42.708  -9.132  61.127  1.00 57.78  ? 239 GLU A O   1 
ATOM   1935 C CB  . GLU A 1 244 ? 40.348  -8.169  59.161  1.00 57.84  ? 239 GLU A CB  1 
ATOM   1936 C CG  . GLU A 1 244 ? 39.152  -8.538  58.302  1.00 59.67  ? 239 GLU A CG  1 
ATOM   1937 C CD  . GLU A 1 244 ? 39.129  -7.774  56.975  1.00 63.81  ? 239 GLU A CD  1 
ATOM   1938 O OE1 . GLU A 1 244 ? 40.088  -7.882  56.180  1.00 67.02  ? 239 GLU A OE1 1 
ATOM   1939 O OE2 . GLU A 1 244 ? 38.145  -7.058  56.733  1.00 65.62  ? 239 GLU A OE2 1 
ATOM   1940 N N   . GLN A 1 245 ? 41.689  -7.248  61.835  1.00 55.91  ? 240 GLN A N   1 
ATOM   1941 C CA  . GLN A 1 245 ? 42.855  -6.743  62.575  1.00 56.40  ? 240 GLN A CA  1 
ATOM   1942 C C   . GLN A 1 245 ? 43.239  -7.785  63.639  1.00 56.05  ? 240 GLN A C   1 
ATOM   1943 O O   . GLN A 1 245 ? 44.404  -8.213  63.712  1.00 55.61  ? 240 GLN A O   1 
ATOM   1944 C CB  . GLN A 1 245 ? 42.568  -5.366  63.201  1.00 56.54  ? 240 GLN A CB  1 
ATOM   1945 C CG  . GLN A 1 245 ? 43.794  -4.740  63.902  1.00 60.74  ? 240 GLN A CG  1 
ATOM   1946 C CD  . GLN A 1 245 ? 43.490  -3.448  64.709  1.00 63.37  ? 240 GLN A CD  1 
ATOM   1947 O OE1 . GLN A 1 245 ? 42.601  -2.664  64.349  1.00 63.68  ? 240 GLN A OE1 1 
ATOM   1948 N NE2 . GLN A 1 245 ? 44.242  -3.233  65.794  1.00 61.77  ? 240 GLN A NE2 1 
ATOM   1949 N N   . ARG A 1 246 ? 42.229  -8.226  64.402  1.00 54.67  ? 241 ARG A N   1 
ATOM   1950 C CA  . ARG A 1 246 ? 42.388  -9.249  65.448  1.00 56.03  ? 241 ARG A CA  1 
ATOM   1951 C C   . ARG A 1 246 ? 42.962  -10.553 64.910  1.00 56.53  ? 241 ARG A C   1 
ATOM   1952 O O   . ARG A 1 246 ? 43.871  -11.127 65.501  1.00 57.40  ? 241 ARG A O   1 
ATOM   1953 C CB  . ARG A 1 246 ? 41.036  -9.539  66.142  1.00 55.65  ? 241 ARG A CB  1 
ATOM   1954 C CG  . ARG A 1 246 ? 41.089  -10.732 67.139  1.00 59.11  ? 241 ARG A CG  1 
ATOM   1955 C CD  . ARG A 1 246 ? 39.752  -10.991 67.822  1.00 60.56  ? 241 ARG A CD  1 
ATOM   1956 N NE  . ARG A 1 246 ? 39.558  -10.108 68.967  1.00 62.11  ? 241 ARG A NE  1 
ATOM   1957 C CZ  . ARG A 1 246 ? 38.426  -9.484  69.246  1.00 62.12  ? 241 ARG A CZ  1 
ATOM   1958 N NH1 . ARG A 1 246 ? 37.378  -9.624  68.456  1.00 63.27  ? 241 ARG A NH1 1 
ATOM   1959 N NH2 . ARG A 1 246 ? 38.345  -8.706  70.310  1.00 65.15  ? 241 ARG A NH2 1 
ATOM   1960 N N   . HIS A 1 247 ? 42.409  -11.019 63.789  1.00 56.39  ? 242 HIS A N   1 
ATOM   1961 C CA  . HIS A 1 247 ? 42.778  -12.316 63.229  1.00 58.18  ? 242 HIS A CA  1 
ATOM   1962 C C   . HIS A 1 247 ? 44.205  -12.295 62.715  1.00 60.30  ? 242 HIS A C   1 
ATOM   1963 O O   . HIS A 1 247 ? 44.976  -13.248 62.916  1.00 62.54  ? 242 HIS A O   1 
ATOM   1964 C CB  . HIS A 1 247 ? 41.758  -12.744 62.166  1.00 57.34  ? 242 HIS A CB  1 
ATOM   1965 C CG  . HIS A 1 247 ? 40.396  -13.033 62.725  1.00 55.98  ? 242 HIS A CG  1 
ATOM   1966 N ND1 . HIS A 1 247 ? 39.377  -13.571 61.969  1.00 57.11  ? 242 HIS A ND1 1 
ATOM   1967 C CD2 . HIS A 1 247 ? 39.887  -12.866 63.971  1.00 55.98  ? 242 HIS A CD2 1 
ATOM   1968 C CE1 . HIS A 1 247 ? 38.290  -13.693 62.717  1.00 55.93  ? 242 HIS A CE1 1 
ATOM   1969 N NE2 . HIS A 1 247 ? 38.577  -13.280 63.938  1.00 55.32  ? 242 HIS A NE2 1 
ATOM   1970 N N   . VAL A 1 248 ? 44.578  -11.173 62.105  1.00 60.76  ? 243 VAL A N   1 
ATOM   1971 C CA  . VAL A 1 248 ? 45.958  -10.942 61.678  1.00 62.64  ? 243 VAL A CA  1 
ATOM   1972 C C   . VAL A 1 248 ? 46.893  -10.971 62.877  1.00 64.60  ? 243 VAL A C   1 
ATOM   1973 O O   . VAL A 1 248 ? 48.030  -11.436 62.775  1.00 66.67  ? 243 VAL A O   1 
ATOM   1974 C CB  . VAL A 1 248 ? 46.101  -9.594  60.933  1.00 62.19  ? 243 VAL A CB  1 
ATOM   1975 C CG1 . VAL A 1 248 ? 47.566  -9.205  60.756  1.00 63.79  ? 243 VAL A CG1 1 
ATOM   1976 C CG2 . VAL A 1 248 ? 45.420  -9.666  59.602  1.00 61.28  ? 243 VAL A CG2 1 
ATOM   1977 N N   . LEU A 1 249 ? 46.403  -10.477 64.012  1.00 64.93  ? 244 LEU A N   1 
ATOM   1978 C CA  . LEU A 1 249 ? 47.164  -10.470 65.257  1.00 67.04  ? 244 LEU A CA  1 
ATOM   1979 C C   . LEU A 1 249 ? 47.281  -11.874 65.843  1.00 68.69  ? 244 LEU A C   1 
ATOM   1980 O O   . LEU A 1 249 ? 48.340  -12.270 66.291  1.00 69.66  ? 244 LEU A O   1 
ATOM   1981 C CB  . LEU A 1 249 ? 46.526  -9.517  66.270  1.00 66.36  ? 244 LEU A CB  1 
ATOM   1982 C CG  . LEU A 1 249 ? 46.675  -8.007  66.063  1.00 66.10  ? 244 LEU A CG  1 
ATOM   1983 C CD1 . LEU A 1 249 ? 45.761  -7.278  67.029  1.00 65.04  ? 244 LEU A CD1 1 
ATOM   1984 C CD2 . LEU A 1 249 ? 48.125  -7.553  66.239  1.00 69.25  ? 244 LEU A CD2 1 
ATOM   1985 N N   . LEU A 1 250 ? 46.178  -12.616 65.826  1.00 69.59  ? 245 LEU A N   1 
ATOM   1986 C CA  . LEU A 1 250 ? 46.173  -13.990 66.304  1.00 72.71  ? 245 LEU A CA  1 
ATOM   1987 C C   . LEU A 1 250 ? 47.147  -14.859 65.508  1.00 75.89  ? 245 LEU A C   1 
ATOM   1988 O O   . LEU A 1 250 ? 47.987  -15.542 66.088  1.00 78.11  ? 245 LEU A O   1 
ATOM   1989 C CB  . LEU A 1 250 ? 44.746  -14.557 66.270  1.00 71.59  ? 245 LEU A CB  1 
ATOM   1990 C CG  . LEU A 1 250 ? 43.928  -14.255 67.525  1.00 71.39  ? 245 LEU A CG  1 
ATOM   1991 C CD1 . LEU A 1 250 ? 42.476  -14.657 67.422  1.00 69.30  ? 245 LEU A CD1 1 
ATOM   1992 C CD2 . LEU A 1 250 ? 44.586  -14.925 68.737  1.00 73.50  ? 245 LEU A CD2 1 
ATOM   1993 N N   . LYS A 1 251 ? 47.050  -14.812 64.180  1.00 77.63  ? 246 LYS A N   1 
ATOM   1994 C CA  . LYS A 1 251 ? 47.967  -15.564 63.313  1.00 81.51  ? 246 LYS A CA  1 
ATOM   1995 C C   . LYS A 1 251 ? 49.417  -15.162 63.551  1.00 83.91  ? 246 LYS A C   1 
ATOM   1996 O O   . LYS A 1 251 ? 50.282  -16.015 63.758  1.00 86.06  ? 246 LYS A O   1 
ATOM   1997 C CB  . LYS A 1 251 ? 47.585  -15.404 61.834  1.00 80.78  ? 246 LYS A CB  1 
ATOM   1998 C CG  . LYS A 1 251 ? 46.658  -16.500 61.296  1.00 82.39  ? 246 LYS A CG  1 
ATOM   1999 C CD  . LYS A 1 251 ? 45.171  -16.261 61.571  1.00 79.64  ? 246 LYS A CD  1 
ATOM   2000 C CE  . LYS A 1 251 ? 44.502  -15.543 60.411  1.00 78.73  ? 246 LYS A CE  1 
ATOM   2001 N NZ  . LYS A 1 251 ? 43.001  -15.548 60.493  1.00 77.10  ? 246 LYS A NZ  1 
ATOM   2002 N N   . GLN A 1 252 ? 49.664  -13.857 63.556  1.00 84.77  ? 247 GLN A N   1 
ATOM   2003 C CA  . GLN A 1 252 ? 51.011  -13.319 63.726  1.00 88.03  ? 247 GLN A CA  1 
ATOM   2004 C C   . GLN A 1 252 ? 51.532  -13.475 65.152  1.00 90.10  ? 247 GLN A C   1 
ATOM   2005 O O   . GLN A 1 252 ? 52.248  -14.432 65.465  1.00 92.27  ? 247 GLN A O   1 
ATOM   2006 C CB  . GLN A 1 252 ? 51.039  -11.839 63.310  1.00 87.22  ? 247 GLN A CB  1 
ATOM   2007 C CG  . GLN A 1 252 ? 52.436  -11.218 63.186  1.00 89.65  ? 247 GLN A CG  1 
ATOM   2008 C CD  . GLN A 1 252 ? 53.285  -11.835 62.072  1.00 92.41  ? 247 GLN A CD  1 
ATOM   2009 O OE1 . GLN A 1 252 ? 52.815  -12.038 60.941  1.00 92.01  ? 247 GLN A OE1 1 
ATOM   2010 N NE2 . GLN A 1 252 ? 54.549  -12.121 62.390  1.00 94.14  ? 247 GLN A NE2 1 
ATOM   2011 N N   . LYS A 1 253 ? 51.154  -12.522 66.004  1.00 90.57  ? 248 LYS A N   1 
ATOM   2012 C CA  . LYS A 1 253 ? 51.661  -12.362 67.379  1.00 92.55  ? 248 LYS A CA  1 
ATOM   2013 C C   . LYS A 1 253 ? 51.746  -13.670 68.185  1.00 94.76  ? 248 LYS A C   1 
ATOM   2014 O O   . LYS A 1 253 ? 52.638  -13.825 69.030  1.00 96.80  ? 248 LYS A O   1 
ATOM   2015 C CB  . LYS A 1 253 ? 50.763  -11.337 68.104  1.00 91.10  ? 248 LYS A CB  1 
ATOM   2016 C CG  . LYS A 1 253 ? 51.213  -10.783 69.463  1.00 91.68  ? 248 LYS A CG  1 
ATOM   2017 C CD  . LYS A 1 253 ? 49.978  -10.166 70.160  1.00 90.39  ? 248 LYS A CD  1 
ATOM   2018 C CE  . LYS A 1 253 ? 50.308  -9.294  71.355  1.00 90.73  ? 248 LYS A CE  1 
ATOM   2019 N NZ  . LYS A 1 253 ? 50.564  -7.883  70.957  1.00 90.00  ? 248 LYS A NZ  1 
ATOM   2020 N N   . GLU A 1 254 ? 50.837  -14.608 67.911  1.00 95.48  ? 249 GLU A N   1 
ATOM   2021 C CA  . GLU A 1 254 ? 50.635  -15.761 68.796  1.00 97.71  ? 249 GLU A CA  1 
ATOM   2022 C C   . GLU A 1 254 ? 51.241  -17.088 68.320  1.00 100.16 ? 249 GLU A C   1 
ATOM   2023 O O   . GLU A 1 254 ? 52.389  -17.126 67.867  1.00 101.49 ? 249 GLU A O   1 
ATOM   2024 C CB  . GLU A 1 254 ? 49.148  -15.916 69.171  1.00 96.79  ? 249 GLU A CB  1 
ATOM   2025 C CG  . GLU A 1 254 ? 48.548  -14.721 69.936  1.00 96.40  ? 249 GLU A CG  1 
ATOM   2026 C CD  . GLU A 1 254 ? 49.146  -14.489 71.330  1.00 99.46  ? 249 GLU A CD  1 
ATOM   2027 O OE1 . GLU A 1 254 ? 49.921  -15.340 71.831  1.00 102.09 ? 249 GLU A OE1 1 
ATOM   2028 O OE2 . GLU A 1 254 ? 48.827  -13.438 71.936  1.00 99.75  ? 249 GLU A OE2 1 
ATOM   2029 N N   . LEU A 1 255 ? 50.446  -18.156 68.432  1.00 101.32 ? 250 LEU A N   1 
ATOM   2030 C CA  . LEU A 1 255 ? 50.889  -19.568 68.389  1.00 104.23 ? 250 LEU A CA  1 
ATOM   2031 C C   . LEU A 1 255 ? 52.027  -19.968 67.430  1.00 105.76 ? 250 LEU A C   1 
ATOM   2032 O O   . LEU A 1 255 ? 52.119  -19.471 66.299  1.00 105.03 ? 250 LEU A O   1 
ATOM   2033 C CB  . LEU A 1 255 ? 49.676  -20.490 68.151  1.00 104.92 ? 250 LEU A CB  1 
ATOM   2034 C CG  . LEU A 1 255 ? 49.107  -20.649 66.730  1.00 104.37 ? 250 LEU A CG  1 
ATOM   2035 C CD1 . LEU A 1 255 ? 48.413  -21.992 66.569  1.00 107.17 ? 250 LEU A CD1 1 
ATOM   2036 C CD2 . LEU A 1 255 ? 48.175  -19.500 66.318  1.00 101.16 ? 250 LEU A CD2 1 
ATOM   2037 N N   . GLY A 1 256 ? 52.876  -20.883 67.900  1.00 113.31 ? 251 GLY A N   1 
ATOM   2038 C CA  . GLY A 1 256 ? 53.786  -21.625 67.028  1.00 115.76 ? 251 GLY A CA  1 
ATOM   2039 C C   . GLY A 1 256 ? 53.065  -22.832 66.439  1.00 111.62 ? 251 GLY A C   1 
ATOM   2040 O O   . GLY A 1 256 ? 53.551  -23.459 65.490  1.00 114.43 ? 251 GLY A O   1 
ATOM   2041 N N   . GLY A 1 257 ? 51.896  -23.138 67.009  1.00 105.47 ? 252 GLY A N   1 
ATOM   2042 C CA  . GLY A 1 257 ? 51.042  -24.254 66.590  1.00 101.08 ? 252 GLY A CA  1 
ATOM   2043 C C   . GLY A 1 257 ? 50.500  -25.044 67.774  1.00 95.35  ? 252 GLY A C   1 
ATOM   2044 O O   . GLY A 1 257 ? 50.039  -26.172 67.609  1.00 92.91  ? 252 GLY A O   1 
ATOM   2045 N N   . GLU A 1 258 ? 50.545  -24.438 68.961  1.00 93.50  ? 253 GLU A N   1 
ATOM   2046 C CA  . GLU A 1 258 ? 50.201  -25.106 70.224  1.00 89.37  ? 253 GLU A CA  1 
ATOM   2047 C C   . GLU A 1 258 ? 48.757  -25.634 70.304  1.00 84.56  ? 253 GLU A C   1 
ATOM   2048 O O   . GLU A 1 258 ? 47.826  -24.972 69.842  1.00 84.04  ? 253 GLU A O   1 
ATOM   2049 C CB  . GLU A 1 258 ? 50.468  -24.169 71.418  1.00 89.86  ? 253 GLU A CB  1 
ATOM   2050 C CG  . GLU A 1 258 ? 51.948  -23.887 71.723  1.00 94.75  ? 253 GLU A CG  1 
ATOM   2051 C CD  . GLU A 1 258 ? 52.235  -23.736 73.224  1.00 95.28  ? 253 GLU A CD  1 
ATOM   2052 O OE1 . GLU A 1 258 ? 53.216  -23.041 73.585  1.00 99.52  ? 253 GLU A OE1 1 
ATOM   2053 O OE2 . GLU A 1 258 ? 51.489  -24.319 74.045  1.00 91.18  ? 253 GLU A OE2 1 
ATOM   2054 N N   . GLU A 1 259 ? 48.581  -26.821 70.893  1.00 81.37  ? 254 GLU A N   1 
ATOM   2055 C CA  . GLU A 1 259 ? 47.254  -27.328 71.253  1.00 77.20  ? 254 GLU A CA  1 
ATOM   2056 C C   . GLU A 1 259 ? 46.583  -26.332 72.201  1.00 75.54  ? 254 GLU A C   1 
ATOM   2057 O O   . GLU A 1 259 ? 47.277  -25.627 72.943  1.00 76.87  ? 254 GLU A O   1 
ATOM   2058 C CB  . GLU A 1 259 ? 47.345  -28.690 71.957  1.00 75.50  ? 254 GLU A CB  1 
ATOM   2059 C CG  . GLU A 1 259 ? 47.563  -29.908 71.063  1.00 76.86  ? 254 GLU A CG  1 
ATOM   2060 C CD  . GLU A 1 259 ? 46.428  -30.148 70.066  1.00 76.76  ? 254 GLU A CD  1 
ATOM   2061 O OE1 . GLU A 1 259 ? 45.331  -30.611 70.470  1.00 73.63  ? 254 GLU A OE1 1 
ATOM   2062 O OE2 . GLU A 1 259 ? 46.653  -29.885 68.869  1.00 78.02  ? 254 GLU A OE2 1 
ATOM   2063 N N   . PRO A 1 260 ? 45.235  -26.249 72.174  1.00 73.30  ? 255 PRO A N   1 
ATOM   2064 C CA  . PRO A 1 260 ? 44.619  -25.410 73.186  1.00 71.99  ? 255 PRO A CA  1 
ATOM   2065 C C   . PRO A 1 260 ? 44.889  -26.035 74.549  1.00 70.31  ? 255 PRO A C   1 
ATOM   2066 O O   . PRO A 1 260 ? 44.838  -27.260 74.696  1.00 68.48  ? 255 PRO A O   1 
ATOM   2067 C CB  . PRO A 1 260 ? 43.124  -25.474 72.845  1.00 70.25  ? 255 PRO A CB  1 
ATOM   2068 C CG  . PRO A 1 260 ? 42.956  -26.707 72.049  1.00 69.52  ? 255 PRO A CG  1 
ATOM   2069 C CD  . PRO A 1 260 ? 44.235  -26.901 71.306  1.00 72.42  ? 255 PRO A CD  1 
ATOM   2070 N N   . GLU A 1 261 ? 45.216  -25.199 75.525  1.00 71.52  ? 256 GLU A N   1 
ATOM   2071 C CA  . GLU A 1 261 ? 45.454  -25.674 76.884  1.00 70.71  ? 256 GLU A CA  1 
ATOM   2072 C C   . GLU A 1 261 ? 44.090  -25.663 77.533  1.00 68.52  ? 256 GLU A C   1 
ATOM   2073 O O   . GLU A 1 261 ? 43.343  -24.711 77.325  1.00 69.94  ? 256 GLU A O   1 
ATOM   2074 C CB  . GLU A 1 261 ? 46.417  -24.740 77.615  1.00 73.56  ? 256 GLU A CB  1 
ATOM   2075 C CG  . GLU A 1 261 ? 47.475  -24.108 76.701  1.00 77.47  ? 256 GLU A CG  1 
ATOM   2076 C CD  . GLU A 1 261 ? 48.879  -24.192 77.265  1.00 80.41  ? 256 GLU A CD  1 
ATOM   2077 O OE1 . GLU A 1 261 ? 49.047  -23.973 78.484  1.00 80.50  ? 256 GLU A OE1 1 
ATOM   2078 O OE2 . GLU A 1 261 ? 49.817  -24.472 76.482  1.00 82.46  ? 256 GLU A OE2 1 
ATOM   2079 N N   . PRO A 1 262 ? 43.732  -26.721 78.284  1.00 65.93  ? 257 PRO A N   1 
ATOM   2080 C CA  . PRO A 1 262 ? 42.381  -26.735 78.831  1.00 64.46  ? 257 PRO A CA  1 
ATOM   2081 C C   . PRO A 1 262 ? 42.108  -25.426 79.544  1.00 66.20  ? 257 PRO A C   1 
ATOM   2082 O O   . PRO A 1 262 ? 42.987  -24.909 80.232  1.00 68.21  ? 257 PRO A O   1 
ATOM   2083 C CB  . PRO A 1 262 ? 42.400  -27.902 79.830  1.00 62.45  ? 257 PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 262 ? 43.826  -28.284 79.982  1.00 63.83  ? 257 PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 262 ? 44.493  -27.905 78.698  1.00 65.52  ? 257 PRO A CD  1 
ATOM   2086 N N   . SER A 1 263 ? 40.906  -24.895 79.366  1.00 66.45  ? 258 SER A N   1 
ATOM   2087 C CA  . SER A 1 263 ? 40.588  -23.580 79.883  1.00 69.74  ? 258 SER A CA  1 
ATOM   2088 C C   . SER A 1 263 ? 39.837  -23.616 81.217  1.00 69.93  ? 258 SER A C   1 
ATOM   2089 O O   . SER A 1 263 ? 39.032  -24.521 81.482  1.00 67.58  ? 258 SER A O   1 
ATOM   2090 C CB  . SER A 1 263 ? 39.818  -22.767 78.842  1.00 71.21  ? 258 SER A CB  1 
ATOM   2091 O OG  . SER A 1 263 ? 38.440  -23.077 78.876  1.00 71.16  ? 258 SER A OG  1 
ATOM   2092 N N   . LEU A 1 264 ? 40.135  -22.618 82.046  1.00 73.26  ? 259 LEU A N   1 
ATOM   2093 C CA  . LEU A 1 264 ? 39.531  -22.456 83.354  1.00 74.91  ? 259 LEU A CA  1 
ATOM   2094 C C   . LEU A 1 264 ? 38.546  -21.314 83.226  1.00 78.61  ? 259 LEU A C   1 
ATOM   2095 O O   . LEU A 1 264 ? 38.888  -20.262 82.690  1.00 81.68  ? 259 LEU A O   1 
ATOM   2096 C CB  . LEU A 1 264 ? 40.593  -22.079 84.394  1.00 77.15  ? 259 LEU A CB  1 
ATOM   2097 C CG  . LEU A 1 264 ? 41.755  -22.965 84.870  1.00 75.62  ? 259 LEU A CG  1 
ATOM   2098 C CD1 . LEU A 1 264 ? 41.277  -24.167 85.689  1.00 73.17  ? 259 LEU A CD1 1 
ATOM   2099 C CD2 . LEU A 1 264 ? 42.678  -23.395 83.730  1.00 74.56  ? 259 LEU A CD2 1 
ATOM   2100 N N   . ARG A 1 265 ? 37.324  -21.510 83.704  1.00 79.25  ? 260 ARG A N   1 
ATOM   2101 C CA  . ARG A 1 265 ? 36.301  -20.481 83.557  1.00 83.65  ? 260 ARG A CA  1 
ATOM   2102 C C   . ARG A 1 265 ? 35.125  -20.634 84.514  1.00 85.34  ? 260 ARG A C   1 
ATOM   2103 O O   . ARG A 1 265 ? 34.951  -21.687 85.128  1.00 82.60  ? 260 ARG A O   1 
ATOM   2104 C CB  . ARG A 1 265 ? 35.794  -20.425 82.103  1.00 83.42  ? 260 ARG A CB  1 
ATOM   2105 C CG  . ARG A 1 265 ? 35.594  -21.778 81.428  1.00 79.60  ? 260 ARG A CG  1 
ATOM   2106 C CD  . ARG A 1 265 ? 34.569  -21.716 80.298  1.00 81.71  ? 260 ARG A CD  1 
ATOM   2107 N NE  . ARG A 1 265 ? 33.190  -21.682 80.796  1.00 84.68  ? 260 ARG A NE  1 
ATOM   2108 C CZ  . ARG A 1 265 ? 32.457  -22.751 81.114  1.00 82.96  ? 260 ARG A CZ  1 
ATOM   2109 N NH1 . ARG A 1 265 ? 32.947  -23.981 81.002  1.00 78.25  ? 260 ARG A NH1 1 
ATOM   2110 N NH2 . ARG A 1 265 ? 31.221  -22.583 81.556  1.00 86.13  ? 260 ARG A NH2 1 
ATOM   2111 N N   . GLU A 1 266 ? 34.351  -19.553 84.651  1.00 90.57  ? 261 GLU A N   1 
ATOM   2112 C CA  . GLU A 1 266 ? 32.980  -19.581 85.195  1.00 93.29  ? 261 GLU A CA  1 
ATOM   2113 C C   . GLU A 1 266 ? 32.817  -20.013 86.663  1.00 93.97  ? 261 GLU A C   1 
ATOM   2114 O O   . GLU A 1 266 ? 33.555  -20.877 87.157  1.00 90.76  ? 261 GLU A O   1 
ATOM   2115 C CB  . GLU A 1 266 ? 32.069  -20.416 84.273  1.00 90.88  ? 261 GLU A CB  1 
ATOM   2116 C CG  . GLU A 1 266 ? 31.261  -19.598 83.261  1.00 94.53  ? 261 GLU A CG  1 
ATOM   2117 C CD  . GLU A 1 266 ? 32.115  -18.653 82.411  1.00 97.13  ? 261 GLU A CD  1 
ATOM   2118 O OE1 . GLU A 1 266 ? 32.813  -19.123 81.479  1.00 93.76  ? 261 GLU A OE1 1 
ATOM   2119 O OE2 . GLU A 1 266 ? 32.072  -17.431 82.673  1.00 101.23 ? 261 GLU A OE2 1 
ATOM   2120 N N   . GLY A 1 267 ? 31.825  -19.431 87.343  1.00 98.50  ? 262 GLY A N   1 
ATOM   2121 C CA  . GLY A 1 267 ? 31.555  -19.773 88.743  1.00 100.00 ? 262 GLY A CA  1 
ATOM   2122 C C   . GLY A 1 267 ? 30.411  -20.724 89.141  1.00 99.31  ? 262 GLY A C   1 
ATOM   2123 O O   . GLY A 1 267 ? 29.702  -20.431 90.115  1.00 103.71 ? 262 GLY A O   1 
ATOM   2124 N N   . PRO A 1 268 ? 30.222  -21.876 88.433  1.00 94.36  ? 263 PRO A N   1 
ATOM   2125 C CA  . PRO A 1 268 ? 29.217  -22.815 88.966  1.00 93.95  ? 263 PRO A CA  1 
ATOM   2126 C C   . PRO A 1 268 ? 29.848  -23.876 89.874  1.00 90.11  ? 263 PRO A C   1 
ATOM   2127 O O   . PRO A 1 268 ? 30.304  -24.906 89.390  1.00 85.63  ? 263 PRO A O   1 
ATOM   2128 C CB  . PRO A 1 268 ? 28.625  -23.460 87.700  1.00 91.80  ? 263 PRO A CB  1 
ATOM   2129 C CG  . PRO A 1 268 ? 29.605  -23.123 86.554  1.00 89.38  ? 263 PRO A CG  1 
ATOM   2130 C CD  . PRO A 1 268 ? 30.770  -22.371 87.156  1.00 90.04  ? 263 PRO A CD  1 
ATOM   2131 N N   . GLY A 1 269 ? 29.865  -23.612 91.180  1.00 92.50  ? 264 GLY A N   1 
ATOM   2132 C CA  . GLY A 1 269 ? 30.532  -24.478 92.157  1.00 89.51  ? 264 GLY A CA  1 
ATOM   2133 C C   . GLY A 1 269 ? 32.038  -24.278 92.137  1.00 86.59  ? 264 GLY A C   1 
ATOM   2134 O O   . GLY A 1 269 ? 32.803  -25.241 91.993  1.00 82.90  ? 264 GLY A O   1 
ATOM   2135 N N   . GLY A 1 270 ? 32.456  -23.022 92.285  1.00 89.07  ? 265 GLY A N   1 
ATOM   2136 C CA  . GLY A 1 270 ? 33.858  -22.627 92.156  1.00 86.87  ? 265 GLY A CA  1 
ATOM   2137 C C   . GLY A 1 270 ? 34.251  -22.459 90.698  1.00 83.16  ? 265 GLY A C   1 
ATOM   2138 O O   . GLY A 1 270 ? 33.410  -22.159 89.845  1.00 83.65  ? 265 GLY A O   1 
ATOM   2139 N N   . LEU A 1 271 ? 35.534  -22.648 90.412  1.00 79.87  ? 266 LEU A N   1 
ATOM   2140 C CA  . LEU A 1 271 ? 36.025  -22.646 89.037  1.00 75.91  ? 266 LEU A CA  1 
ATOM   2141 C C   . LEU A 1 271 ? 35.804  -24.004 88.345  1.00 70.20  ? 266 LEU A C   1 
ATOM   2142 O O   . LEU A 1 271 ? 35.590  -25.028 88.997  1.00 68.50  ? 266 LEU A O   1 
ATOM   2143 C CB  . LEU A 1 271 ? 37.507  -22.261 89.006  1.00 76.59  ? 266 LEU A CB  1 
ATOM   2144 C CG  . LEU A 1 271 ? 38.121  -21.866 87.659  1.00 75.67  ? 266 LEU A CG  1 
ATOM   2145 C CD1 . LEU A 1 271 ? 37.684  -20.471 87.211  1.00 79.54  ? 266 LEU A CD1 1 
ATOM   2146 C CD2 . LEU A 1 271 ? 39.621  -21.957 87.760  1.00 76.40  ? 266 LEU A CD2 1 
ATOM   2147 N N   . VAL A 1 272 ? 35.866  -23.990 87.016  1.00 67.03  ? 267 VAL A N   1 
ATOM   2148 C CA  . VAL A 1 272 ? 35.671  -25.173 86.195  1.00 61.83  ? 267 VAL A CA  1 
ATOM   2149 C C   . VAL A 1 272 ? 36.917  -25.356 85.319  1.00 58.76  ? 267 VAL A C   1 
ATOM   2150 O O   . VAL A 1 272 ? 37.557  -24.365 84.958  1.00 60.22  ? 267 VAL A O   1 
ATOM   2151 C CB  . VAL A 1 272 ? 34.363  -25.014 85.344  1.00 62.42  ? 267 VAL A CB  1 
ATOM   2152 C CG1 . VAL A 1 272 ? 34.607  -24.246 84.038  1.00 63.54  ? 267 VAL A CG1 1 
ATOM   2153 C CG2 . VAL A 1 272 ? 33.749  -26.337 85.042  1.00 60.74  ? 267 VAL A CG2 1 
ATOM   2154 N N   . MET A 1 273 ? 37.286  -26.602 85.005  1.00 54.06  ? 268 MET A N   1 
ATOM   2155 C CA  . MET A 1 273 ? 38.263  -26.834 83.936  1.00 51.84  ? 268 MET A CA  1 
ATOM   2156 C C   . MET A 1 273 ? 37.712  -27.777 82.862  1.00 49.59  ? 268 MET A C   1 
ATOM   2157 O O   . MET A 1 273 ? 37.026  -28.746 83.166  1.00 48.83  ? 268 MET A O   1 
ATOM   2158 C CB  . MET A 1 273 ? 39.620  -27.298 84.452  1.00 51.64  ? 268 MET A CB  1 
ATOM   2159 C CG  . MET A 1 273 ? 40.774  -27.143 83.430  1.00 53.07  ? 268 MET A CG  1 
ATOM   2160 S SD  . MET A 1 273 ? 42.404  -27.757 83.998  1.00 55.89  ? 268 MET A SD  1 
ATOM   2161 C CE  . MET A 1 273 ? 42.442  -29.370 83.280  1.00 55.67  ? 268 MET A CE  1 
ATOM   2162 N N   . GLU A 1 274 ? 37.992  -27.469 81.601  1.00 49.13  ? 269 GLU A N   1 
ATOM   2163 C CA  . GLU A 1 274 ? 37.460  -28.247 80.490  1.00 47.73  ? 269 GLU A CA  1 
ATOM   2164 C C   . GLU A 1 274 ? 38.438  -28.309 79.328  1.00 46.78  ? 269 GLU A C   1 
ATOM   2165 O O   . GLU A 1 274 ? 39.170  -27.362 79.065  1.00 47.92  ? 269 GLU A O   1 
ATOM   2166 C CB  . GLU A 1 274 ? 36.125  -27.667 80.038  1.00 48.74  ? 269 GLU A CB  1 
ATOM   2167 C CG  . GLU A 1 274 ? 36.213  -26.206 79.724  1.00 52.70  ? 269 GLU A CG  1 
ATOM   2168 C CD  . GLU A 1 274 ? 34.899  -25.598 79.278  1.00 57.55  ? 269 GLU A CD  1 
ATOM   2169 O OE1 . GLU A 1 274 ? 34.934  -24.428 78.837  1.00 61.81  ? 269 GLU A OE1 1 
ATOM   2170 O OE2 . GLU A 1 274 ? 33.841  -26.267 79.369  1.00 58.14  ? 269 GLU A OE2 1 
ATOM   2171 N N   . GLY A 1 275 ? 38.439  -29.431 78.631  1.00 44.82  ? 270 GLY A N   1 
ATOM   2172 C CA  . GLY A 1 275 ? 39.292  -29.597 77.482  1.00 44.30  ? 270 GLY A CA  1 
ATOM   2173 C C   . GLY A 1 275 ? 39.116  -30.999 76.944  1.00 44.15  ? 270 GLY A C   1 
ATOM   2174 O O   . GLY A 1 275 ? 38.564  -31.875 77.620  1.00 41.97  ? 270 GLY A O   1 
ATOM   2175 N N   . HIS A 1 276 ? 39.571  -31.197 75.710  1.00 45.34  ? 271 HIS A N   1 
ATOM   2176 C CA  . HIS A 1 276 ? 39.514  -32.507 75.092  1.00 46.57  ? 271 HIS A CA  1 
ATOM   2177 C C   . HIS A 1 276 ? 40.569  -33.438 75.704  1.00 47.01  ? 271 HIS A C   1 
ATOM   2178 O O   . HIS A 1 276 ? 41.657  -32.999 76.059  1.00 46.91  ? 271 HIS A O   1 
ATOM   2179 C CB  . HIS A 1 276 ? 39.721  -32.405 73.595  1.00 48.03  ? 271 HIS A CB  1 
ATOM   2180 C CG  . HIS A 1 276 ? 38.517  -31.928 72.846  1.00 48.97  ? 271 HIS A CG  1 
ATOM   2181 N ND1 . HIS A 1 276 ? 37.388  -32.705 72.673  1.00 49.82  ? 271 HIS A ND1 1 
ATOM   2182 C CD2 . HIS A 1 276 ? 38.275  -30.762 72.201  1.00 47.32  ? 271 HIS A CD2 1 
ATOM   2183 C CE1 . HIS A 1 276 ? 36.503  -32.037 71.954  1.00 49.73  ? 271 HIS A CE1 1 
ATOM   2184 N NE2 . HIS A 1 276 ? 37.017  -30.855 71.660  1.00 49.60  ? 271 HIS A NE2 1 
ATOM   2185 N N   . LEU A 1 277 ? 40.201  -34.705 75.868  1.00 48.30  ? 272 LEU A N   1 
ATOM   2186 C CA  . LEU A 1 277 ? 41.149  -35.781 76.160  1.00 50.20  ? 272 LEU A CA  1 
ATOM   2187 C C   . LEU A 1 277 ? 40.695  -37.036 75.402  1.00 53.77  ? 272 LEU A C   1 
ATOM   2188 O O   . LEU A 1 277 ? 39.494  -37.242 75.167  1.00 53.85  ? 272 LEU A O   1 
ATOM   2189 C CB  . LEU A 1 277 ? 41.242  -36.068 77.663  1.00 48.85  ? 272 LEU A CB  1 
ATOM   2190 C CG  . LEU A 1 277 ? 41.810  -35.056 78.690  1.00 46.14  ? 272 LEU A CG  1 
ATOM   2191 C CD1 . LEU A 1 277 ? 41.638  -35.538 80.111  1.00 41.50  ? 272 LEU A CD1 1 
ATOM   2192 C CD2 . LEU A 1 277 ? 43.283  -34.765 78.426  1.00 47.82  ? 272 LEU A CD2 1 
ATOM   2193 N N   . PHE A 1 278 ? 41.663  -37.853 74.987  1.00 57.03  ? 273 PHE A N   1 
ATOM   2194 C CA  . PHE A 1 278 ? 41.369  -39.187 74.498  1.00 60.89  ? 273 PHE A CA  1 
ATOM   2195 C C   . PHE A 1 278 ? 41.139  -40.082 75.722  1.00 61.74  ? 273 PHE A C   1 
ATOM   2196 O O   . PHE A 1 278 ? 41.836  -39.976 76.746  1.00 60.45  ? 273 PHE A O   1 
ATOM   2197 C CB  . PHE A 1 278 ? 42.526  -39.747 73.660  1.00 64.15  ? 273 PHE A CB  1 
ATOM   2198 C CG  . PHE A 1 278 ? 42.618  -39.185 72.261  1.00 65.71  ? 273 PHE A CG  1 
ATOM   2199 C CD1 . PHE A 1 278 ? 41.926  -39.780 71.209  1.00 68.85  ? 273 PHE A CD1 1 
ATOM   2200 C CD2 . PHE A 1 278 ? 43.415  -38.074 71.988  1.00 64.82  ? 273 PHE A CD2 1 
ATOM   2201 C CE1 . PHE A 1 278 ? 42.017  -39.270 69.898  1.00 70.55  ? 273 PHE A CE1 1 
ATOM   2202 C CE2 . PHE A 1 278 ? 43.510  -37.554 70.688  1.00 66.89  ? 273 PHE A CE2 1 
ATOM   2203 C CZ  . PHE A 1 278 ? 42.814  -38.164 69.641  1.00 69.41  ? 273 PHE A CZ  1 
ATOM   2204 N N   . LYS A 1 279 ? 40.155  -40.958 75.623  1.00 64.30  ? 274 LYS A N   1 
ATOM   2205 C CA  . LYS A 1 279 ? 39.931  -41.901 76.677  1.00 66.27  ? 274 LYS A CA  1 
ATOM   2206 C C   . LYS A 1 279 ? 39.739  -43.303 76.123  1.00 71.57  ? 274 LYS A C   1 
ATOM   2207 O O   . LYS A 1 279 ? 38.918  -43.529 75.226  1.00 73.50  ? 274 LYS A O   1 
ATOM   2208 C CB  . LYS A 1 279 ? 38.762  -41.472 77.571  1.00 63.76  ? 274 LYS A CB  1 
ATOM   2209 C CG  . LYS A 1 279 ? 37.464  -41.275 76.861  1.00 65.73  ? 274 LYS A CG  1 
ATOM   2210 C CD  . LYS A 1 279 ? 36.333  -41.936 77.616  1.00 68.81  ? 274 LYS A CD  1 
ATOM   2211 C CE  . LYS A 1 279 ? 35.094  -42.035 76.726  1.00 71.49  ? 274 LYS A CE  1 
ATOM   2212 N NZ  . LYS A 1 279 ? 35.369  -42.661 75.400  1.00 75.88  ? 274 LYS A NZ  1 
ATOM   2213 N N   . ARG A 1 280 ? 40.536  -44.232 76.648  1.00 74.65  ? 275 ARG A N   1 
ATOM   2214 C CA  . ARG A 1 280 ? 40.312  -45.658 76.447  1.00 80.58  ? 275 ARG A CA  1 
ATOM   2215 C C   . ARG A 1 280 ? 39.016  -45.982 77.176  1.00 80.44  ? 275 ARG A C   1 
ATOM   2216 O O   . ARG A 1 280 ? 38.805  -45.526 78.301  1.00 77.70  ? 275 ARG A O   1 
ATOM   2217 C CB  . ARG A 1 280 ? 41.476  -46.469 77.027  1.00 83.33  ? 275 ARG A CB  1 
ATOM   2218 C CG  . ARG A 1 280 ? 41.311  -47.976 76.901  1.00 90.72  ? 275 ARG A CG  1 
ATOM   2219 C CD  . ARG A 1 280 ? 42.325  -48.752 77.740  1.00 95.95  ? 275 ARG A CD  1 
ATOM   2220 N NE  . ARG A 1 280 ? 43.667  -48.791 77.151  1.00 100.02 ? 275 ARG A NE  1 
ATOM   2221 C CZ  . ARG A 1 280 ? 44.049  -49.602 76.163  1.00 106.56 ? 275 ARG A CZ  1 
ATOM   2222 N NH1 . ARG A 1 280 ? 43.193  -50.459 75.614  1.00 111.54 ? 275 ARG A NH1 1 
ATOM   2223 N NH2 . ARG A 1 280 ? 45.296  -49.546 75.710  1.00 108.95 ? 275 ARG A NH2 1 
ATOM   2224 N N   . ALA A 1 281 ? 38.123  -46.711 76.528  1.00 84.68  ? 276 ALA A N   1 
ATOM   2225 C CA  . ALA A 1 281 ? 36.909  -47.146 77.196  1.00 86.15  ? 276 ALA A CA  1 
ATOM   2226 C C   . ALA A 1 281 ? 37.293  -48.365 78.035  1.00 89.91  ? 276 ALA A C   1 
ATOM   2227 O O   . ALA A 1 281 ? 37.979  -49.267 77.549  1.00 94.63  ? 276 ALA A O   1 
ATOM   2228 C CB  . ALA A 1 281 ? 35.819  -47.471 76.189  1.00 89.94  ? 276 ALA A CB  1 
ATOM   2229 N N   . SER A 1 282 ? 36.827  -48.379 79.283  1.00 88.52  ? 277 SER A N   1 
ATOM   2230 C CA  . SER A 1 282 ? 37.466  -49.115 80.382  1.00 90.15  ? 277 SER A CA  1 
ATOM   2231 C C   . SER A 1 282 ? 37.040  -50.579 80.654  1.00 96.58  ? 277 SER A C   1 
ATOM   2232 O O   . SER A 1 282 ? 36.655  -50.919 81.781  1.00 96.97  ? 277 SER A O   1 
ATOM   2233 C CB  . SER A 1 282 ? 37.348  -48.277 81.668  1.00 85.02  ? 277 SER A CB  1 
ATOM   2234 O OG  . SER A 1 282 ? 38.143  -48.815 82.707  1.00 86.77  ? 277 SER A OG  1 
ATOM   2235 N N   . ASN A 1 283 ? 37.124  -51.441 79.642  1.00 102.41 ? 278 ASN A N   1 
ATOM   2236 C CA  . ASN A 1 283 ? 37.053  -52.894 79.872  1.00 109.86 ? 278 ASN A CA  1 
ATOM   2237 C C   . ASN A 1 283 ? 37.685  -53.674 78.718  1.00 116.26 ? 278 ASN A C   1 
ATOM   2238 O O   . ASN A 1 283 ? 36.996  -54.410 77.989  1.00 122.44 ? 278 ASN A O   1 
ATOM   2239 C CB  . ASN A 1 283 ? 35.617  -53.376 80.178  1.00 112.52 ? 278 ASN A CB  1 
ATOM   2240 C CG  . ASN A 1 283 ? 35.582  -54.703 80.963  1.00 118.51 ? 278 ASN A CG  1 
ATOM   2241 O OD1 . ASN A 1 283 ? 36.327  -55.644 80.675  1.00 123.07 ? 278 ASN A OD1 1 
ATOM   2242 N ND2 . ASN A 1 283 ? 34.699  -54.774 81.951  1.00 117.73 ? 278 ASN A ND2 1 
ATOM   2243 N N   . ALA A 1 284 ? 39.003  -53.511 78.565  1.00 115.67 ? 279 ALA A N   1 
ATOM   2244 C CA  . ALA A 1 284 ? 39.777  -54.146 77.483  1.00 121.71 ? 279 ALA A CA  1 
ATOM   2245 C C   . ALA A 1 284 ? 39.154  -53.910 76.103  1.00 123.15 ? 279 ALA A C   1 
ATOM   2246 O O   . ALA A 1 284 ? 39.361  -54.695 75.176  1.00 129.93 ? 279 ALA A O   1 
ATOM   2247 C CB  . ALA A 1 284 ? 39.976  -55.664 77.753  1.00 130.24 ? 279 ALA A CB  1 
ATOM   2248 N N   . PHE A 1 285 ? 38.395  -52.818 75.989  1.00 117.26 ? 280 PHE A N   1 
ATOM   2249 C CA  . PHE A 1 285 ? 37.644  -52.500 74.778  1.00 118.43 ? 280 PHE A CA  1 
ATOM   2250 C C   . PHE A 1 285 ? 38.579  -52.269 73.596  1.00 119.65 ? 280 PHE A C   1 
ATOM   2251 O O   . PHE A 1 285 ? 38.397  -52.867 72.524  1.00 125.68 ? 280 PHE A O   1 
ATOM   2252 C CB  . PHE A 1 285 ? 36.723  -51.285 75.001  1.00 111.83 ? 280 PHE A CB  1 
ATOM   2253 C CG  . PHE A 1 285 ? 35.388  -51.630 75.622  1.00 113.74 ? 280 PHE A CG  1 
ATOM   2254 C CD1 . PHE A 1 285 ? 34.505  -52.507 74.981  1.00 121.92 ? 280 PHE A CD1 1 
ATOM   2255 C CD2 . PHE A 1 285 ? 35.005  -51.063 76.835  1.00 109.50 ? 280 PHE A CD2 1 
ATOM   2256 C CE1 . PHE A 1 285 ? 33.271  -52.829 75.551  1.00 124.46 ? 280 PHE A CE1 1 
ATOM   2257 C CE2 . PHE A 1 285 ? 33.772  -51.369 77.413  1.00 111.72 ? 280 PHE A CE2 1 
ATOM   2258 C CZ  . PHE A 1 285 ? 32.903  -52.253 76.770  1.00 119.03 ? 280 PHE A CZ  1 
ATOM   2259 N N   . LYS A 1 286 ? 39.584  -51.416 73.822  1.00 114.01 ? 281 LYS A N   1 
ATOM   2260 C CA  . LYS A 1 286 ? 40.597  -51.045 72.825  1.00 114.41 ? 281 LYS A CA  1 
ATOM   2261 C C   . LYS A 1 286 ? 40.214  -49.793 72.042  1.00 109.77 ? 281 LYS A C   1 
ATOM   2262 O O   . LYS A 1 286 ? 40.667  -49.607 70.908  1.00 112.39 ? 281 LYS A O   1 
ATOM   2263 C CB  . LYS A 1 286 ? 40.898  -52.201 71.854  1.00 123.17 ? 281 LYS A CB  1 
ATOM   2264 C CG  . LYS A 1 286 ? 42.020  -53.103 72.289  1.00 127.24 ? 281 LYS A CG  1 
ATOM   2265 C CD  . LYS A 1 286 ? 42.184  -54.277 71.327  1.00 136.01 ? 281 LYS A CD  1 
ATOM   2266 C CE  . LYS A 1 286 ? 43.597  -54.827 71.374  1.00 140.27 ? 281 LYS A CE  1 
ATOM   2267 N NZ  . LYS A 1 286 ? 43.958  -55.411 72.691  1.00 140.89 ? 281 LYS A NZ  1 
ATOM   2268 N N   . THR A 1 287 ? 39.394  -48.928 72.635  1.00 103.39 ? 282 THR A N   1 
ATOM   2269 C CA  . THR A 1 287 ? 38.917  -47.767 71.885  1.00 99.40  ? 282 THR A CA  1 
ATOM   2270 C C   . THR A 1 287 ? 39.348  -46.432 72.481  1.00 91.58  ? 282 THR A C   1 
ATOM   2271 O O   . THR A 1 287 ? 38.765  -45.947 73.449  1.00 87.20  ? 282 THR A O   1 
ATOM   2272 C CB  . THR A 1 287 ? 37.390  -47.804 71.631  1.00 100.69 ? 282 THR A CB  1 
ATOM   2273 O OG1 . THR A 1 287 ? 36.929  -49.162 71.636  1.00 107.36 ? 282 THR A OG1 1 
ATOM   2274 C CG2 . THR A 1 287 ? 37.072  -47.172 70.278  1.00 101.41 ? 282 THR A CG2 1 
ATOM   2275 N N   . TRP A 1 288 ? 40.387  -45.856 71.880  1.00 90.20  ? 283 TRP A N   1 
ATOM   2276 C CA  . TRP A 1 288 ? 40.807  -44.500 72.187  1.00 83.61  ? 283 TRP A CA  1 
ATOM   2277 C C   . TRP A 1 288 ? 39.821  -43.551 71.508  1.00 81.12  ? 283 TRP A C   1 
ATOM   2278 O O   . TRP A 1 288 ? 39.825  -43.388 70.282  1.00 83.71  ? 283 TRP A O   1 
ATOM   2279 C CB  . TRP A 1 288 ? 42.262  -44.257 71.747  1.00 84.74  ? 283 TRP A CB  1 
ATOM   2280 C CG  . TRP A 1 288 ? 43.250  -45.014 72.590  1.00 85.80  ? 283 TRP A CG  1 
ATOM   2281 C CD1 . TRP A 1 288 ? 43.932  -46.143 72.242  1.00 91.56  ? 283 TRP A CD1 1 
ATOM   2282 C CD2 . TRP A 1 288 ? 43.629  -44.716 73.942  1.00 81.04  ? 283 TRP A CD2 1 
ATOM   2283 N NE1 . TRP A 1 288 ? 44.723  -46.562 73.289  1.00 90.90  ? 283 TRP A NE1 1 
ATOM   2284 C CE2 . TRP A 1 288 ? 44.561  -45.700 74.340  1.00 84.32  ? 283 TRP A CE2 1 
ATOM   2285 C CE3 . TRP A 1 288 ? 43.283  -43.704 74.847  1.00 74.01  ? 283 TRP A CE3 1 
ATOM   2286 C CZ2 . TRP A 1 288 ? 45.145  -45.706 75.603  1.00 82.09  ? 283 TRP A CZ2 1 
ATOM   2287 C CZ3 . TRP A 1 288 ? 43.864  -43.710 76.103  1.00 72.06  ? 283 TRP A CZ3 1 
ATOM   2288 C CH2 . TRP A 1 288 ? 44.786  -44.702 76.469  1.00 77.15  ? 283 TRP A CH2 1 
ATOM   2289 N N   . SER A 1 289 ? 38.950  -42.976 72.330  1.00 76.23  ? 284 SER A N   1 
ATOM   2290 C CA  . SER A 1 289 ? 37.900  -42.073 71.890  1.00 73.72  ? 284 SER A CA  1 
ATOM   2291 C C   . SER A 1 289 ? 38.115  -40.692 72.510  1.00 67.57  ? 284 SER A C   1 
ATOM   2292 O O   . SER A 1 289 ? 38.285  -40.563 73.717  1.00 64.11  ? 284 SER A O   1 
ATOM   2293 C CB  . SER A 1 289 ? 36.545  -42.634 72.319  1.00 75.31  ? 284 SER A CB  1 
ATOM   2294 O OG  . SER A 1 289 ? 35.478  -42.032 71.615  1.00 75.97  ? 284 SER A OG  1 
ATOM   2295 N N   . ARG A 1 290 ? 38.102  -39.666 71.669  1.00 66.14  ? 285 ARG A N   1 
ATOM   2296 C CA  . ARG A 1 290 ? 38.341  -38.303 72.098  1.00 61.35  ? 285 ARG A CA  1 
ATOM   2297 C C   . ARG A 1 290 ? 37.031  -37.684 72.589  1.00 59.38  ? 285 ARG A C   1 
ATOM   2298 O O   . ARG A 1 290 ? 36.045  -37.622 71.845  1.00 61.50  ? 285 ARG A O   1 
ATOM   2299 C CB  . ARG A 1 290 ? 38.954  -37.506 70.956  1.00 61.96  ? 285 ARG A CB  1 
ATOM   2300 C CG  . ARG A 1 290 ? 39.302  -36.059 71.276  1.00 60.30  ? 285 ARG A CG  1 
ATOM   2301 C CD  . ARG A 1 290 ? 40.301  -35.561 70.263  1.00 62.04  ? 285 ARG A CD  1 
ATOM   2302 N NE  . ARG A 1 290 ? 40.561  -34.124 70.313  1.00 60.68  ? 285 ARG A NE  1 
ATOM   2303 C CZ  . ARG A 1 290 ? 41.624  -33.561 70.887  1.00 60.06  ? 285 ARG A CZ  1 
ATOM   2304 N NH1 . ARG A 1 290 ? 42.530  -34.307 71.518  1.00 58.75  ? 285 ARG A NH1 1 
ATOM   2305 N NH2 . ARG A 1 290 ? 41.778  -32.240 70.841  1.00 59.56  ? 285 ARG A NH2 1 
ATOM   2306 N N   . ARG A 1 291 ? 37.015  -37.273 73.856  1.00 55.57  ? 286 ARG A N   1 
ATOM   2307 C CA  . ARG A 1 291 ? 35.863  -36.589 74.439  1.00 53.78  ? 286 ARG A CA  1 
ATOM   2308 C C   . ARG A 1 291 ? 36.264  -35.313 75.155  1.00 50.00  ? 286 ARG A C   1 
ATOM   2309 O O   . ARG A 1 291 ? 37.445  -35.065 75.386  1.00 48.49  ? 286 ARG A O   1 
ATOM   2310 C CB  . ARG A 1 291 ? 35.077  -37.505 75.376  1.00 54.17  ? 286 ARG A CB  1 
ATOM   2311 C CG  . ARG A 1 291 ? 33.847  -38.116 74.744  1.00 59.93  ? 286 ARG A CG  1 
ATOM   2312 C CD  . ARG A 1 291 ? 34.216  -39.318 73.938  1.00 65.20  ? 286 ARG A CD  1 
ATOM   2313 N NE  . ARG A 1 291 ? 33.057  -40.115 73.590  1.00 70.29  ? 286 ARG A NE  1 
ATOM   2314 C CZ  . ARG A 1 291 ? 32.761  -40.497 72.358  1.00 74.25  ? 286 ARG A CZ  1 
ATOM   2315 N NH1 . ARG A 1 291 ? 33.546  -40.146 71.352  1.00 74.19  ? 286 ARG A NH1 1 
ATOM   2316 N NH2 . ARG A 1 291 ? 31.678  -41.230 72.138  1.00 78.50  ? 286 ARG A NH2 1 
ATOM   2317 N N   . TRP A 1 292 ? 35.257  -34.502 75.468  1.00 49.52  ? 287 TRP A N   1 
ATOM   2318 C CA  . TRP A 1 292 ? 35.414  -33.234 76.175  1.00 46.94  ? 287 TRP A CA  1 
ATOM   2319 C C   . TRP A 1 292 ? 35.181  -33.427 77.658  1.00 45.83  ? 287 TRP A C   1 
ATOM   2320 O O   . TRP A 1 292 ? 34.041  -33.625 78.092  1.00 45.87  ? 287 TRP A O   1 
ATOM   2321 C CB  . TRP A 1 292 ? 34.377  -32.254 75.644  1.00 47.67  ? 287 TRP A CB  1 
ATOM   2322 C CG  . TRP A 1 292 ? 34.498  -30.802 76.101  1.00 45.11  ? 287 TRP A CG  1 
ATOM   2323 C CD1 . TRP A 1 292 ? 33.655  -30.132 76.954  1.00 45.18  ? 287 TRP A CD1 1 
ATOM   2324 C CD2 . TRP A 1 292 ? 35.476  -29.844 75.675  1.00 41.97  ? 287 TRP A CD2 1 
ATOM   2325 N NE1 . TRP A 1 292 ? 34.058  -28.815 77.086  1.00 43.24  ? 287 TRP A NE1 1 
ATOM   2326 C CE2 . TRP A 1 292 ? 35.170  -28.616 76.310  1.00 42.40  ? 287 TRP A CE2 1 
ATOM   2327 C CE3 . TRP A 1 292 ? 36.569  -29.897 74.809  1.00 40.49  ? 287 TRP A CE3 1 
ATOM   2328 C CZ2 . TRP A 1 292 ? 35.921  -27.454 76.096  1.00 42.51  ? 287 TRP A CZ2 1 
ATOM   2329 C CZ3 . TRP A 1 292 ? 37.317  -28.737 74.592  1.00 40.15  ? 287 TRP A CZ3 1 
ATOM   2330 C CH2 . TRP A 1 292 ? 36.993  -27.534 75.243  1.00 41.07  ? 287 TRP A CH2 1 
ATOM   2331 N N   . PHE A 1 293 ? 36.264  -33.338 78.425  1.00 45.36  ? 288 PHE A N   1 
ATOM   2332 C CA  . PHE A 1 293 ? 36.227  -33.491 79.887  1.00 45.68  ? 288 PHE A CA  1 
ATOM   2333 C C   . PHE A 1 293 ? 36.051  -32.167 80.625  1.00 45.16  ? 288 PHE A C   1 
ATOM   2334 O O   . PHE A 1 293 ? 36.555  -31.119 80.187  1.00 45.90  ? 288 PHE A O   1 
ATOM   2335 C CB  . PHE A 1 293 ? 37.495  -34.161 80.387  1.00 45.00  ? 288 PHE A CB  1 
ATOM   2336 C CG  . PHE A 1 293 ? 37.555  -35.628 80.088  1.00 48.74  ? 288 PHE A CG  1 
ATOM   2337 C CD1 . PHE A 1 293 ? 37.842  -36.080 78.795  1.00 50.63  ? 288 PHE A CD1 1 
ATOM   2338 C CD2 . PHE A 1 293 ? 37.309  -36.564 81.098  1.00 49.40  ? 288 PHE A CD2 1 
ATOM   2339 C CE1 . PHE A 1 293 ? 37.894  -37.430 78.514  1.00 54.43  ? 288 PHE A CE1 1 
ATOM   2340 C CE2 . PHE A 1 293 ? 37.356  -37.927 80.837  1.00 52.13  ? 288 PHE A CE2 1 
ATOM   2341 C CZ  . PHE A 1 293 ? 37.650  -38.369 79.544  1.00 55.46  ? 288 PHE A CZ  1 
ATOM   2342 N N   . THR A 1 294 ? 35.312  -32.230 81.730  1.00 44.90  ? 289 THR A N   1 
ATOM   2343 C CA  . THR A 1 294 ? 35.156  -31.106 82.641  1.00 45.06  ? 289 THR A CA  1 
ATOM   2344 C C   . THR A 1 294 ? 35.440  -31.520 84.087  1.00 44.25  ? 289 THR A C   1 
ATOM   2345 O O   . THR A 1 294 ? 34.962  -32.531 84.558  1.00 44.14  ? 289 THR A O   1 
ATOM   2346 C CB  . THR A 1 294 ? 33.732  -30.479 82.525  1.00 46.72  ? 289 THR A CB  1 
ATOM   2347 O OG1 . THR A 1 294 ? 33.463  -30.189 81.155  1.00 49.33  ? 289 THR A OG1 1 
ATOM   2348 C CG2 . THR A 1 294 ? 33.639  -29.192 83.287  1.00 48.21  ? 289 THR A CG2 1 
ATOM   2349 N N   . ILE A 1 295 ? 36.248  -30.738 84.776  1.00 45.12  ? 290 ILE A N   1 
ATOM   2350 C CA  . ILE A 1 295 ? 36.304  -30.819 86.229  1.00 45.57  ? 290 ILE A CA  1 
ATOM   2351 C C   . ILE A 1 295 ? 35.303  -29.808 86.756  1.00 48.35  ? 290 ILE A C   1 
ATOM   2352 O O   . ILE A 1 295 ? 35.418  -28.579 86.496  1.00 49.34  ? 290 ILE A O   1 
ATOM   2353 C CB  . ILE A 1 295 ? 37.712  -30.568 86.781  1.00 46.15  ? 290 ILE A CB  1 
ATOM   2354 C CG1 . ILE A 1 295 ? 38.674  -31.643 86.261  1.00 42.40  ? 290 ILE A CG1 1 
ATOM   2355 C CG2 . ILE A 1 295 ? 37.679  -30.542 88.336  1.00 45.98  ? 290 ILE A CG2 1 
ATOM   2356 C CD1 . ILE A 1 295 ? 40.133  -31.325 86.488  1.00 43.85  ? 290 ILE A CD1 1 
ATOM   2357 N N   . GLN A 1 296 ? 34.296  -30.330 87.452  1.00 49.44  ? 291 GLN A N   1 
ATOM   2358 C CA  . GLN A 1 296 ? 33.147  -29.529 87.831  1.00 53.24  ? 291 GLN A CA  1 
ATOM   2359 C C   . GLN A 1 296 ? 32.459  -30.099 89.043  1.00 55.05  ? 291 GLN A C   1 
ATOM   2360 O O   . GLN A 1 296 ? 32.224  -31.315 89.138  1.00 54.54  ? 291 GLN A O   1 
ATOM   2361 C CB  . GLN A 1 296 ? 32.143  -29.426 86.668  1.00 54.09  ? 291 GLN A CB  1 
ATOM   2362 C CG  . GLN A 1 296 ? 30.924  -28.522 86.963  1.00 60.40  ? 291 GLN A CG  1 
ATOM   2363 C CD  . GLN A 1 296 ? 30.035  -28.299 85.751  1.00 64.65  ? 291 GLN A CD  1 
ATOM   2364 O OE1 . GLN A 1 296 ? 30.225  -28.926 84.703  1.00 65.25  ? 291 GLN A OE1 1 
ATOM   2365 N NE2 . GLN A 1 296 ? 29.054  -27.408 85.888  1.00 67.51  ? 291 GLN A NE2 1 
ATOM   2366 N N   . SER A 1 297 ? 32.142  -29.205 89.968  1.00 57.95  ? 292 SER A N   1 
ATOM   2367 C CA  . SER A 1 297 ? 31.440  -29.541 91.192  1.00 61.15  ? 292 SER A CA  1 
ATOM   2368 C C   . SER A 1 297 ? 31.976  -30.829 91.781  1.00 59.88  ? 292 SER A C   1 
ATOM   2369 O O   . SER A 1 297 ? 31.224  -31.780 91.994  1.00 61.04  ? 292 SER A O   1 
ATOM   2370 C CB  . SER A 1 297 ? 29.935  -29.647 90.936  1.00 63.54  ? 292 SER A CB  1 
ATOM   2371 O OG  . SER A 1 297 ? 29.454  -28.478 90.296  1.00 66.02  ? 292 SER A OG  1 
ATOM   2372 N N   . ASN A 1 298 ? 33.288  -30.871 92.002  1.00 58.55  ? 293 ASN A N   1 
ATOM   2373 C CA  . ASN A 1 298 ? 33.892  -31.971 92.735  1.00 58.44  ? 293 ASN A CA  1 
ATOM   2374 C C   . ASN A 1 298 ? 33.887  -33.279 91.945  1.00 56.17  ? 293 ASN A C   1 
ATOM   2375 O O   . ASN A 1 298 ? 33.926  -34.362 92.525  1.00 56.82  ? 293 ASN A O   1 
ATOM   2376 C CB  . ASN A 1 298 ? 33.155  -32.138 94.079  1.00 62.21  ? 293 ASN A CB  1 
ATOM   2377 C CG  . ASN A 1 298 ? 33.955  -32.915 95.100  1.00 63.77  ? 293 ASN A CG  1 
ATOM   2378 O OD1 . ASN A 1 298 ? 35.188  -32.933 95.057  1.00 65.48  ? 293 ASN A OD1 1 
ATOM   2379 N ND2 . ASN A 1 298 ? 33.258  -33.565 96.028  1.00 66.32  ? 293 ASN A ND2 1 
ATOM   2380 N N   . GLN A 1 299 ? 33.839  -33.165 90.615  1.00 54.68  ? 294 GLN A N   1 
ATOM   2381 C CA  . GLN A 1 299 ? 33.717  -34.309 89.718  1.00 53.29  ? 294 GLN A CA  1 
ATOM   2382 C C   . GLN A 1 299 ? 34.584  -34.151 88.484  1.00 51.17  ? 294 GLN A C   1 
ATOM   2383 O O   . GLN A 1 299 ? 34.910  -33.033 88.089  1.00 50.33  ? 294 GLN A O   1 
ATOM   2384 C CB  . GLN A 1 299 ? 32.258  -34.507 89.303  1.00 54.60  ? 294 GLN A CB  1 
ATOM   2385 C CG  . GLN A 1 299 ? 31.323  -34.643 90.504  1.00 59.26  ? 294 GLN A CG  1 
ATOM   2386 C CD  . GLN A 1 299 ? 29.965  -35.211 90.158  1.00 62.63  ? 294 GLN A CD  1 
ATOM   2387 O OE1 . GLN A 1 299 ? 29.443  -35.006 89.058  1.00 61.12  ? 294 GLN A OE1 1 
ATOM   2388 N NE2 . GLN A 1 299 ? 29.381  -35.933 91.107  1.00 64.49  ? 294 GLN A NE2 1 
ATOM   2389 N N   . LEU A 1 300 ? 34.992  -35.282 87.904  1.00 50.47  ? 295 LEU A N   1 
ATOM   2390 C CA  . LEU A 1 300 ? 35.576  -35.277 86.583  1.00 48.94  ? 295 LEU A CA  1 
ATOM   2391 C C   . LEU A 1 300 ? 34.543  -35.951 85.697  1.00 50.31  ? 295 LEU A C   1 
ATOM   2392 O O   . LEU A 1 300 ? 34.116  -37.096 85.983  1.00 51.69  ? 295 LEU A O   1 
ATOM   2393 C CB  . LEU A 1 300 ? 36.906  -36.019 86.550  1.00 48.54  ? 295 LEU A CB  1 
ATOM   2394 C CG  . LEU A 1 300 ? 37.552  -36.200 85.168  1.00 48.27  ? 295 LEU A CG  1 
ATOM   2395 C CD1 . LEU A 1 300 ? 38.126  -34.872 84.609  1.00 47.71  ? 295 LEU A CD1 1 
ATOM   2396 C CD2 . LEU A 1 300 ? 38.649  -37.224 85.254  1.00 48.03  ? 295 LEU A CD2 1 
ATOM   2397 N N   . VAL A 1 301 ? 34.122  -35.224 84.654  1.00 49.47  ? 296 VAL A N   1 
ATOM   2398 C CA  . VAL A 1 301 ? 33.037  -35.645 83.760  1.00 50.73  ? 296 VAL A CA  1 
ATOM   2399 C C   . VAL A 1 301 ? 33.453  -35.504 82.294  1.00 50.80  ? 296 VAL A C   1 
ATOM   2400 O O   . VAL A 1 301 ? 34.389  -34.768 81.977  1.00 50.01  ? 296 VAL A O   1 
ATOM   2401 C CB  . VAL A 1 301 ? 31.774  -34.785 83.995  1.00 51.91  ? 296 VAL A CB  1 
ATOM   2402 C CG1 . VAL A 1 301 ? 31.352  -34.805 85.465  1.00 52.30  ? 296 VAL A CG1 1 
ATOM   2403 C CG2 . VAL A 1 301 ? 32.010  -33.348 83.555  1.00 50.57  ? 296 VAL A CG2 1 
ATOM   2404 N N   . TYR A 1 302 ? 32.768  -36.189 81.387  1.00 52.82  ? 297 TYR A N   1 
ATOM   2405 C CA  . TYR A 1 302 ? 33.051  -35.968 79.956  1.00 53.47  ? 297 TYR A CA  1 
ATOM   2406 C C   . TYR A 1 302 ? 31.794  -35.919 79.090  1.00 55.51  ? 297 TYR A C   1 
ATOM   2407 O O   . TYR A 1 302 ? 30.738  -36.408 79.491  1.00 57.54  ? 297 TYR A O   1 
ATOM   2408 C CB  . TYR A 1 302 ? 34.060  -36.989 79.402  1.00 54.22  ? 297 TYR A CB  1 
ATOM   2409 C CG  . TYR A 1 302 ? 33.457  -38.350 79.156  1.00 58.50  ? 297 TYR A CG  1 
ATOM   2410 C CD1 . TYR A 1 302 ? 32.619  -38.575 78.053  1.00 62.81  ? 297 TYR A CD1 1 
ATOM   2411 C CD2 . TYR A 1 302 ? 33.707  -39.412 80.025  1.00 59.97  ? 297 TYR A CD2 1 
ATOM   2412 C CE1 . TYR A 1 302 ? 32.048  -39.837 77.817  1.00 66.64  ? 297 TYR A CE1 1 
ATOM   2413 C CE2 . TYR A 1 302 ? 33.139  -40.676 79.800  1.00 64.44  ? 297 TYR A CE2 1 
ATOM   2414 C CZ  . TYR A 1 302 ? 32.314  -40.875 78.693  1.00 67.61  ? 297 TYR A CZ  1 
ATOM   2415 O OH  . TYR A 1 302 ? 31.744  -42.106 78.459  1.00 72.73  ? 297 TYR A OH  1 
ATOM   2416 N N   . GLN A 1 303 ? 31.927  -35.311 77.908  1.00 55.66  ? 298 GLN A N   1 
ATOM   2417 C CA  . GLN A 1 303 ? 30.859  -35.258 76.888  1.00 58.01  ? 298 GLN A CA  1 
ATOM   2418 C C   . GLN A 1 303 ? 31.441  -35.507 75.511  1.00 58.41  ? 298 GLN A C   1 
ATOM   2419 O O   . GLN A 1 303 ? 32.612  -35.210 75.260  1.00 56.14  ? 298 GLN A O   1 
ATOM   2420 C CB  . GLN A 1 303 ? 30.207  -33.878 76.857  1.00 58.51  ? 298 GLN A CB  1 
ATOM   2421 C CG  . GLN A 1 303 ? 29.725  -33.377 78.202  1.00 59.48  ? 298 GLN A CG  1 
ATOM   2422 C CD  . GLN A 1 303 ? 29.109  -31.980 78.139  1.00 61.51  ? 298 GLN A CD  1 
ATOM   2423 O OE1 . GLN A 1 303 ? 29.599  -31.037 78.777  1.00 58.65  ? 298 GLN A OE1 1 
ATOM   2424 N NE2 . GLN A 1 303 ? 28.028  -31.846 77.376  1.00 64.21  ? 298 GLN A NE2 1 
ATOM   2425 N N   . LYS A 1 304 ? 30.625  -36.046 74.612  1.00 61.78  ? 299 LYS A N   1 
ATOM   2426 C CA  . LYS A 1 304 ? 30.957  -36.000 73.189  1.00 63.12  ? 299 LYS A CA  1 
ATOM   2427 C C   . LYS A 1 304 ? 30.462  -34.686 72.560  1.00 63.41  ? 299 LYS A C   1 
ATOM   2428 O O   . LYS A 1 304 ? 31.242  -33.939 71.982  1.00 61.87  ? 299 LYS A O   1 
ATOM   2429 C CB  . LYS A 1 304 ? 30.406  -37.211 72.446  1.00 67.61  ? 299 LYS A CB  1 
ATOM   2430 C CG  . LYS A 1 304 ? 30.823  -37.246 70.987  1.00 70.98  ? 299 LYS A CG  1 
ATOM   2431 C CD  . LYS A 1 304 ? 30.564  -38.585 70.339  1.00 77.87  ? 299 LYS A CD  1 
ATOM   2432 C CE  . LYS A 1 304 ? 29.142  -39.077 70.544  1.00 82.07  ? 299 LYS A CE  1 
ATOM   2433 N NZ  . LYS A 1 304 ? 28.850  -40.160 69.578  1.00 88.81  ? 299 LYS A NZ  1 
ATOM   2434 N N   . LYS A 1 305 ? 29.183  -34.388 72.722  1.00 65.76  ? 300 LYS A N   1 
ATOM   2435 C CA  . LYS A 1 305 ? 28.571  -33.247 72.052  1.00 68.49  ? 300 LYS A CA  1 
ATOM   2436 C C   . LYS A 1 305 ? 28.128  -32.221 73.079  1.00 67.66  ? 300 LYS A C   1 
ATOM   2437 O O   . LYS A 1 305 ? 27.965  -32.545 74.257  1.00 66.44  ? 300 LYS A O   1 
ATOM   2438 C CB  . LYS A 1 305 ? 27.366  -33.715 71.230  1.00 73.41  ? 300 LYS A CB  1 
ATOM   2439 C CG  . LYS A 1 305 ? 27.154  -32.999 69.920  1.00 78.54  ? 300 LYS A CG  1 
ATOM   2440 C CD  . LYS A 1 305 ? 26.047  -31.936 69.987  1.00 81.82  ? 300 LYS A CD  1 
ATOM   2441 C CE  . LYS A 1 305 ? 25.834  -31.266 68.641  1.00 85.35  ? 300 LYS A CE  1 
ATOM   2442 N NZ  . LYS A 1 305 ? 27.097  -30.796 67.999  1.00 82.40  ? 300 LYS A NZ  1 
ATOM   2443 N N   . TYR A 1 306 ? 27.925  -30.989 72.624  1.00 69.27  ? 301 TYR A N   1 
ATOM   2444 C CA  . TYR A 1 306 ? 27.381  -29.919 73.453  1.00 70.50  ? 301 TYR A CA  1 
ATOM   2445 C C   . TYR A 1 306 ? 26.094  -30.317 74.173  1.00 73.92  ? 301 TYR A C   1 
ATOM   2446 O O   . TYR A 1 306 ? 26.009  -30.182 75.400  1.00 72.81  ? 301 TYR A O   1 
ATOM   2447 C CB  . TYR A 1 306 ? 27.135  -28.656 72.617  1.00 72.85  ? 301 TYR A CB  1 
ATOM   2448 C CG  . TYR A 1 306 ? 26.738  -27.444 73.431  1.00 73.22  ? 301 TYR A CG  1 
ATOM   2449 C CD1 . TYR A 1 306 ? 25.565  -26.753 73.152  1.00 79.42  ? 301 TYR A CD1 1 
ATOM   2450 C CD2 . TYR A 1 306 ? 27.537  -26.986 74.476  1.00 69.47  ? 301 TYR A CD2 1 
ATOM   2451 C CE1 . TYR A 1 306 ? 25.199  -25.627 73.892  1.00 81.65  ? 301 TYR A CE1 1 
ATOM   2452 C CE2 . TYR A 1 306 ? 27.181  -25.874 75.218  1.00 71.40  ? 301 TYR A CE2 1 
ATOM   2453 C CZ  . TYR A 1 306 ? 26.015  -25.203 74.925  1.00 77.94  ? 301 TYR A CZ  1 
ATOM   2454 O OH  . TYR A 1 306 ? 25.656  -24.100 75.655  1.00 81.94  ? 301 TYR A OH  1 
ATOM   2455 N N   . LYS A 1 307 ? 25.113  -30.821 73.426  1.00 78.70  ? 302 LYS A N   1 
ATOM   2456 C CA  . LYS A 1 307 ? 23.844  -31.249 74.025  1.00 83.64  ? 302 LYS A CA  1 
ATOM   2457 C C   . LYS A 1 307 ? 23.977  -32.388 75.074  1.00 82.16  ? 302 LYS A C   1 
ATOM   2458 O O   . LYS A 1 307 ? 23.229  -32.418 76.055  1.00 83.71  ? 302 LYS A O   1 
ATOM   2459 C CB  . LYS A 1 307 ? 22.825  -31.607 72.928  1.00 89.80  ? 302 LYS A CB  1 
ATOM   2460 C CG  . LYS A 1 307 ? 22.678  -33.101 72.594  1.00 92.87  ? 302 LYS A CG  1 
ATOM   2461 C CD  . LYS A 1 307 ? 21.437  -33.719 73.262  1.00 97.78  ? 302 LYS A CD  1 
ATOM   2462 C CE  . LYS A 1 307 ? 21.698  -35.164 73.681  1.00 96.89  ? 302 LYS A CE  1 
ATOM   2463 N NZ  . LYS A 1 307 ? 20.457  -35.826 74.166  1.00 102.52 ? 302 LYS A NZ  1 
ATOM   2464 N N   . ASP A 1 308 ? 24.956  -33.279 74.872  1.00 79.61  ? 303 ASP A N   1 
ATOM   2465 C CA  . ASP A 1 308 ? 25.015  -34.601 75.527  1.00 79.32  ? 303 ASP A CA  1 
ATOM   2466 C C   . ASP A 1 308 ? 25.021  -34.577 77.052  1.00 77.43  ? 303 ASP A C   1 
ATOM   2467 O O   . ASP A 1 308 ? 25.899  -33.948 77.657  1.00 73.30  ? 303 ASP A O   1 
ATOM   2468 C CB  . ASP A 1 308 ? 26.240  -35.398 75.039  1.00 76.81  ? 303 ASP A CB  1 
ATOM   2469 C CG  . ASP A 1 308 ? 26.170  -35.761 73.555  1.00 80.54  ? 303 ASP A CG  1 
ATOM   2470 O OD1 . ASP A 1 308 ? 25.140  -35.477 72.882  1.00 84.21  ? 303 ASP A OD1 1 
ATOM   2471 O OD2 . ASP A 1 308 ? 27.169  -36.333 73.056  1.00 79.66  ? 303 ASP A OD2 1 
ATOM   2472 N N   . PRO A 1 309 ? 24.063  -35.293 77.684  1.00 80.68  ? 304 PRO A N   1 
ATOM   2473 C CA  . PRO A 1 309 ? 24.075  -35.377 79.145  1.00 79.19  ? 304 PRO A CA  1 
ATOM   2474 C C   . PRO A 1 309 ? 25.453  -35.810 79.593  1.00 74.46  ? 304 PRO A C   1 
ATOM   2475 O O   . PRO A 1 309 ? 26.086  -36.651 78.945  1.00 74.02  ? 304 PRO A O   1 
ATOM   2476 C CB  . PRO A 1 309 ? 23.049  -36.472 79.460  1.00 83.60  ? 304 PRO A CB  1 
ATOM   2477 C CG  . PRO A 1 309 ? 22.883  -37.234 78.179  1.00 86.86  ? 304 PRO A CG  1 
ATOM   2478 C CD  . PRO A 1 309 ? 23.077  -36.214 77.091  1.00 86.04  ? 304 PRO A CD  1 
ATOM   2479 N N   . VAL A 1 310 ? 25.925  -35.211 80.676  1.00 71.76  ? 305 VAL A N   1 
ATOM   2480 C CA  . VAL A 1 310 ? 27.266  -35.465 81.181  1.00 67.65  ? 305 VAL A CA  1 
ATOM   2481 C C   . VAL A 1 310 ? 27.321  -36.867 81.798  1.00 68.29  ? 305 VAL A C   1 
ATOM   2482 O O   . VAL A 1 310 ? 26.441  -37.236 82.566  1.00 70.58  ? 305 VAL A O   1 
ATOM   2483 C CB  . VAL A 1 310 ? 27.657  -34.345 82.178  1.00 65.61  ? 305 VAL A CB  1 
ATOM   2484 C CG1 . VAL A 1 310 ? 28.669  -34.810 83.162  1.00 63.58  ? 305 VAL A CG1 1 
ATOM   2485 C CG2 . VAL A 1 310 ? 28.167  -33.101 81.427  1.00 63.63  ? 305 VAL A CG2 1 
ATOM   2486 N N   . THR A 1 311 ? 28.316  -37.659 81.414  1.00 66.98  ? 306 THR A N   1 
ATOM   2487 C CA  . THR A 1 311 ? 28.540  -38.957 82.055  1.00 68.79  ? 306 THR A CA  1 
ATOM   2488 C C   . THR A 1 311 ? 29.678  -38.852 83.083  1.00 65.35  ? 306 THR A C   1 
ATOM   2489 O O   . THR A 1 311 ? 30.774  -38.356 82.767  1.00 62.20  ? 306 THR A O   1 
ATOM   2490 C CB  . THR A 1 311 ? 28.864  -40.092 81.049  1.00 71.01  ? 306 THR A CB  1 
ATOM   2491 O OG1 . THR A 1 311 ? 30.254  -40.034 80.688  1.00 69.37  ? 306 THR A OG1 1 
ATOM   2492 C CG2 . THR A 1 311 ? 27.987  -40.001 79.800  1.00 73.80  ? 306 THR A CG2 1 
ATOM   2493 N N   . VAL A 1 312 ? 29.414  -39.320 84.302  1.00 66.41  ? 307 VAL A N   1 
ATOM   2494 C CA  . VAL A 1 312 ? 30.337  -39.098 85.430  1.00 64.46  ? 307 VAL A CA  1 
ATOM   2495 C C   . VAL A 1 312 ? 31.479  -40.115 85.439  1.00 64.02  ? 307 VAL A C   1 
ATOM   2496 O O   . VAL A 1 312 ? 31.235  -41.322 85.345  1.00 66.91  ? 307 VAL A O   1 
ATOM   2497 C CB  . VAL A 1 312 ? 29.602  -39.124 86.800  1.00 66.16  ? 307 VAL A CB  1 
ATOM   2498 C CG1 . VAL A 1 312 ? 30.555  -38.734 87.925  1.00 65.18  ? 307 VAL A CG1 1 
ATOM   2499 C CG2 . VAL A 1 312 ? 28.382  -38.202 86.801  1.00 67.77  ? 307 VAL A CG2 1 
ATOM   2500 N N   . VAL A 1 313 ? 32.715  -39.630 85.568  1.00 61.18  ? 308 VAL A N   1 
ATOM   2501 C CA  . VAL A 1 313 ? 33.891  -40.514 85.660  1.00 61.24  ? 308 VAL A CA  1 
ATOM   2502 C C   . VAL A 1 313 ? 34.466  -40.604 87.091  1.00 60.82  ? 308 VAL A C   1 
ATOM   2503 O O   . VAL A 1 313 ? 35.084  -41.597 87.468  1.00 62.05  ? 308 VAL A O   1 
ATOM   2504 C CB  . VAL A 1 313 ? 35.004  -40.073 84.684  1.00 59.59  ? 308 VAL A CB  1 
ATOM   2505 C CG1 . VAL A 1 313 ? 36.311  -40.824 84.957  1.00 59.97  ? 308 VAL A CG1 1 
ATOM   2506 C CG2 . VAL A 1 313 ? 34.560  -40.273 83.250  1.00 61.23  ? 308 VAL A CG2 1 
ATOM   2507 N N   . VAL A 1 314 ? 34.278  -39.532 87.858  1.00 59.39  ? 309 VAL A N   1 
ATOM   2508 C CA  . VAL A 1 314 ? 34.738  -39.425 89.237  1.00 58.67  ? 309 VAL A CA  1 
ATOM   2509 C C   . VAL A 1 314 ? 33.621  -38.724 89.969  1.00 59.41  ? 309 VAL A C   1 
ATOM   2510 O O   . VAL A 1 314 ? 33.417  -37.519 89.788  1.00 58.44  ? 309 VAL A O   1 
ATOM   2511 C CB  . VAL A 1 314 ? 36.016  -38.573 89.343  1.00 56.63  ? 309 VAL A CB  1 
ATOM   2512 C CG1 . VAL A 1 314 ? 36.458  -38.437 90.783  1.00 56.83  ? 309 VAL A CG1 1 
ATOM   2513 C CG2 . VAL A 1 314 ? 37.136  -39.182 88.511  1.00 56.62  ? 309 VAL A CG2 1 
ATOM   2514 N N   . ASP A 1 315 ? 32.872  -39.472 90.775  1.00 61.52  ? 310 ASP A N   1 
ATOM   2515 C CA  . ASP A 1 315 ? 31.725  -38.882 91.446  1.00 62.97  ? 310 ASP A CA  1 
ATOM   2516 C C   . ASP A 1 315 ? 32.159  -37.855 92.493  1.00 61.99  ? 310 ASP A C   1 
ATOM   2517 O O   . ASP A 1 315 ? 31.477  -36.854 92.696  1.00 63.43  ? 310 ASP A O   1 
ATOM   2518 C CB  . ASP A 1 315 ? 30.793  -39.957 92.021  1.00 66.72  ? 310 ASP A CB  1 
ATOM   2519 C CG  . ASP A 1 315 ? 31.441  -40.785 93.121  1.00 70.09  ? 310 ASP A CG  1 
ATOM   2520 O OD1 . ASP A 1 315 ? 32.673  -40.679 93.336  1.00 70.23  ? 310 ASP A OD1 1 
ATOM   2521 O OD2 . ASP A 1 315 ? 30.706  -41.559 93.781  1.00 77.31  ? 310 ASP A OD2 1 
ATOM   2522 N N   . ASP A 1 316 ? 33.315  -38.091 93.113  1.00 60.31  ? 311 ASP A N   1 
ATOM   2523 C CA  . ASP A 1 316 ? 33.833  -37.255 94.186  1.00 59.95  ? 311 ASP A CA  1 
ATOM   2524 C C   . ASP A 1 316 ? 35.365  -37.216 94.137  1.00 57.82  ? 311 ASP A C   1 
ATOM   2525 O O   . ASP A 1 316 ? 36.027  -38.227 94.383  1.00 58.48  ? 311 ASP A O   1 
ATOM   2526 C CB  . ASP A 1 316 ? 33.358  -37.794 95.552  1.00 63.13  ? 311 ASP A CB  1 
ATOM   2527 C CG  . ASP A 1 316 ? 33.610  -36.816 96.703  1.00 64.82  ? 311 ASP A CG  1 
ATOM   2528 O OD1 . ASP A 1 316 ? 32.879  -36.896 97.711  1.00 67.52  ? 311 ASP A OD1 1 
ATOM   2529 O OD2 . ASP A 1 316 ? 34.524  -35.964 96.613  1.00 62.66  ? 311 ASP A OD2 1 
ATOM   2530 N N   . LEU A 1 317 ? 35.920  -36.043 93.851  1.00 55.34  ? 312 LEU A N   1 
ATOM   2531 C CA  . LEU A 1 317 ? 37.369  -35.865 93.782  1.00 54.31  ? 312 LEU A CA  1 
ATOM   2532 C C   . LEU A 1 317 ? 38.125  -36.160 95.088  1.00 56.34  ? 312 LEU A C   1 
ATOM   2533 O O   . LEU A 1 317 ? 39.338  -36.336 95.079  1.00 56.19  ? 312 LEU A O   1 
ATOM   2534 C CB  . LEU A 1 317 ? 37.707  -34.447 93.328  1.00 53.06  ? 312 LEU A CB  1 
ATOM   2535 C CG  . LEU A 1 317 ? 37.379  -34.065 91.894  1.00 52.13  ? 312 LEU A CG  1 
ATOM   2536 C CD1 . LEU A 1 317 ? 37.386  -32.540 91.749  1.00 50.98  ? 312 LEU A CD1 1 
ATOM   2537 C CD2 . LEU A 1 317 ? 38.329  -34.764 90.895  1.00 50.83  ? 312 LEU A CD2 1 
ATOM   2538 N N   . ARG A 1 318 ? 37.419  -36.194 96.212  1.00 58.83  ? 313 ARG A N   1 
ATOM   2539 C CA  . ARG A 1 318 ? 38.059  -36.481 97.488  1.00 61.61  ? 313 ARG A CA  1 
ATOM   2540 C C   . ARG A 1 318 ? 38.394  -37.952 97.542  1.00 62.30  ? 313 ARG A C   1 
ATOM   2541 O O   . ARG A 1 318 ? 39.309  -38.352 98.237  1.00 64.24  ? 313 ARG A O   1 
ATOM   2542 C CB  . ARG A 1 318 ? 37.175  -36.060 98.666  1.00 64.60  ? 313 ARG A CB  1 
ATOM   2543 C CG  . ARG A 1 318 ? 36.993  -34.547 98.766  1.00 65.18  ? 313 ARG A CG  1 
ATOM   2544 C CD  . ARG A 1 318 ? 35.986  -34.127 99.830  1.00 67.72  ? 313 ARG A CD  1 
ATOM   2545 N NE  . ARG A 1 318 ? 34.604  -34.482 99.499  1.00 66.93  ? 313 ARG A NE  1 
ATOM   2546 C CZ  . ARG A 1 318 ? 33.571  -34.263 100.314 1.00 70.19  ? 313 ARG A CZ  1 
ATOM   2547 N NH1 . ARG A 1 318 ? 33.770  -33.692 101.485 1.00 73.30  ? 313 ARG A NH1 1 
ATOM   2548 N NH2 . ARG A 1 318 ? 32.343  -34.617 99.973  1.00 70.17  ? 313 ARG A NH2 1 
ATOM   2549 N N   . LEU A 1 319 ? 37.662  -38.740 96.760  1.00 61.90  ? 314 LEU A N   1 
ATOM   2550 C CA  . LEU A 1 319 ? 37.801  -40.188 96.738  1.00 63.95  ? 314 LEU A CA  1 
ATOM   2551 C C   . LEU A 1 319 ? 38.388  -40.691 95.428  1.00 63.08  ? 314 LEU A C   1 
ATOM   2552 O O   . LEU A 1 319 ? 37.932  -41.698 94.898  1.00 64.47  ? 314 LEU A O   1 
ATOM   2553 C CB  . LEU A 1 319 ? 36.442  -40.852 96.973  1.00 65.11  ? 314 LEU A CB  1 
ATOM   2554 C CG  . LEU A 1 319 ? 35.656  -40.411 98.201  1.00 67.11  ? 314 LEU A CG  1 
ATOM   2555 C CD1 . LEU A 1 319 ? 34.209  -40.803 98.065  1.00 68.89  ? 314 LEU A CD1 1 
ATOM   2556 C CD2 . LEU A 1 319 ? 36.257  -41.002 99.464  1.00 70.50  ? 314 LEU A CD2 1 
ATOM   2557 N N   . CYS A 1 320 ? 39.392  -40.001 94.897  1.00 62.10  ? 315 CYS A N   1 
ATOM   2558 C CA  . CYS A 1 320 ? 40.104  -40.527 93.743  1.00 61.94  ? 315 CYS A CA  1 
ATOM   2559 C C   . CYS A 1 320 ? 41.625  -40.311 93.807  1.00 62.74  ? 315 CYS A C   1 
ATOM   2560 O O   . CYS A 1 320 ? 42.123  -39.548 94.640  1.00 63.70  ? 315 CYS A O   1 
ATOM   2561 C CB  . CYS A 1 320 ? 39.505  -39.979 92.444  1.00 59.66  ? 315 CYS A CB  1 
ATOM   2562 S SG  . CYS A 1 320 ? 40.328  -38.525 91.743  1.00 59.86  ? 315 CYS A SG  1 
ATOM   2563 N N   . THR A 1 321 ? 42.350  -41.007 92.936  1.00 63.26  ? 316 THR A N   1 
ATOM   2564 C CA  . THR A 1 321 ? 43.786  -40.813 92.774  1.00 64.64  ? 316 THR A CA  1 
ATOM   2565 C C   . THR A 1 321 ? 44.154  -40.554 91.310  1.00 62.89  ? 316 THR A C   1 
ATOM   2566 O O   . THR A 1 321 ? 43.404  -40.890 90.390  1.00 61.08  ? 316 THR A O   1 
ATOM   2567 C CB  . THR A 1 321 ? 44.583  -42.026 93.268  1.00 68.56  ? 316 THR A CB  1 
ATOM   2568 O OG1 . THR A 1 321 ? 43.976  -42.563 94.452  1.00 71.26  ? 316 THR A OG1 1 
ATOM   2569 C CG2 . THR A 1 321 ? 46.011  -41.615 93.591  1.00 71.54  ? 316 THR A CG2 1 
ATOM   2570 N N   . VAL A 1 322 ? 45.314  -39.932 91.113  1.00 63.66  ? 317 VAL A N   1 
ATOM   2571 C CA  . VAL A 1 322 ? 45.873  -39.709 89.788  1.00 62.57  ? 317 VAL A CA  1 
ATOM   2572 C C   . VAL A 1 322 ? 47.323  -40.146 89.818  1.00 66.51  ? 317 VAL A C   1 
ATOM   2573 O O   . VAL A 1 322 ? 48.014  -39.994 90.834  1.00 68.78  ? 317 VAL A O   1 
ATOM   2574 C CB  . VAL A 1 322 ? 45.820  -38.224 89.346  1.00 60.28  ? 317 VAL A CB  1 
ATOM   2575 C CG1 . VAL A 1 322 ? 45.646  -38.130 87.848  1.00 57.19  ? 317 VAL A CG1 1 
ATOM   2576 C CG2 . VAL A 1 322 ? 44.716  -37.492 90.044  1.00 57.56  ? 317 VAL A CG2 1 
ATOM   2577 N N   . LYS A 1 323 ? 47.774  -40.674 88.690  1.00 67.98  ? 318 LYS A N   1 
ATOM   2578 C CA  . LYS A 1 323 ? 49.111  -41.236 88.550  1.00 73.14  ? 318 LYS A CA  1 
ATOM   2579 C C   . LYS A 1 323 ? 49.577  -41.132 87.094  1.00 73.99  ? 318 LYS A C   1 
ATOM   2580 O O   . LYS A 1 323 ? 48.830  -41.471 86.175  1.00 72.25  ? 318 LYS A O   1 
ATOM   2581 C CB  . LYS A 1 323 ? 49.105  -42.697 89.023  1.00 76.27  ? 318 LYS A CB  1 
ATOM   2582 C CG  . LYS A 1 323 ? 47.869  -43.478 88.559  1.00 75.15  ? 318 LYS A CG  1 
ATOM   2583 C CD  . LYS A 1 323 ? 47.489  -44.612 89.493  1.00 77.94  ? 318 LYS A CD  1 
ATOM   2584 C CE  . LYS A 1 323 ? 48.066  -45.929 89.036  1.00 83.41  ? 318 LYS A CE  1 
ATOM   2585 N NZ  . LYS A 1 323 ? 47.176  -47.061 89.414  1.00 85.76  ? 318 LYS A NZ  1 
ATOM   2586 N N   . LEU A 1 324 ? 50.798  -40.630 86.902  1.00 77.38  ? 319 LEU A N   1 
ATOM   2587 C CA  . LEU A 1 324 ? 51.465  -40.618 85.598  1.00 79.79  ? 319 LEU A CA  1 
ATOM   2588 C C   . LEU A 1 324 ? 51.599  -42.028 85.044  1.00 83.64  ? 319 LEU A C   1 
ATOM   2589 O O   . LEU A 1 324 ? 51.457  -43.005 85.782  1.00 85.65  ? 319 LEU A O   1 
ATOM   2590 C CB  . LEU A 1 324 ? 52.870  -40.004 85.700  1.00 83.29  ? 319 LEU A CB  1 
ATOM   2591 C CG  . LEU A 1 324 ? 53.121  -38.488 85.641  1.00 82.17  ? 319 LEU A CG  1 
ATOM   2592 C CD1 . LEU A 1 324 ? 51.950  -37.708 85.015  1.00 76.02  ? 319 LEU A CD1 1 
ATOM   2593 C CD2 . LEU A 1 324 ? 53.467  -37.948 87.024  1.00 82.96  ? 319 LEU A CD2 1 
ATOM   2594 N N   . CYS A 1 325 ? 51.867  -42.133 83.742  1.00 85.58  ? 320 CYS A N   1 
ATOM   2595 C CA  . CYS A 1 325 ? 52.179  -43.429 83.131  1.00 90.85  ? 320 CYS A CA  1 
ATOM   2596 C C   . CYS A 1 325 ? 53.293  -43.354 82.071  1.00 94.90  ? 320 CYS A C   1 
ATOM   2597 O O   . CYS A 1 325 ? 53.054  -43.653 80.900  1.00 95.84  ? 320 CYS A O   1 
ATOM   2598 C CB  . CYS A 1 325 ? 50.910  -44.086 82.569  1.00 88.97  ? 320 CYS A CB  1 
ATOM   2599 S SG  . CYS A 1 325 ? 49.820  -44.737 83.845  1.00 88.81  ? 320 CYS A SG  1 
ATOM   2600 N N   . PRO A 1 326 ? 54.526  -42.985 82.487  1.00 98.42  ? 321 PRO A N   1 
ATOM   2601 C CA  . PRO A 1 326 ? 55.587  -42.852 81.486  1.00 102.78 ? 321 PRO A CA  1 
ATOM   2602 C C   . PRO A 1 326 ? 56.096  -44.233 81.035  1.00 109.14 ? 321 PRO A C   1 
ATOM   2603 O O   . PRO A 1 326 ? 57.133  -44.335 80.373  1.00 114.26 ? 321 PRO A O   1 
ATOM   2604 C CB  . PRO A 1 326 ? 56.677  -42.056 82.227  1.00 105.06 ? 321 PRO A CB  1 
ATOM   2605 C CG  . PRO A 1 326 ? 56.313  -42.113 83.712  1.00 103.24 ? 321 PRO A CG  1 
ATOM   2606 C CD  . PRO A 1 326 ? 55.064  -42.935 83.862  1.00 99.98  ? 321 PRO A CD  1 
ATOM   2607 N N   . ASP A 1 327 ? 55.320  -45.267 81.375  1.00 108.86 ? 322 ASP A N   1 
ATOM   2608 C CA  . ASP A 1 327 ? 55.658  -46.671 81.162  1.00 115.07 ? 322 ASP A CA  1 
ATOM   2609 C C   . ASP A 1 327 ? 54.676  -47.397 80.228  1.00 114.54 ? 322 ASP A C   1 
ATOM   2610 O O   . ASP A 1 327 ? 54.901  -48.560 79.861  1.00 120.57 ? 322 ASP A O   1 
ATOM   2611 C CB  . ASP A 1 327 ? 55.672  -47.379 82.517  1.00 117.04 ? 322 ASP A CB  1 
ATOM   2612 C CG  . ASP A 1 327 ? 56.662  -48.522 82.574  1.00 125.57 ? 322 ASP A CG  1 
ATOM   2613 O OD1 . ASP A 1 327 ? 57.776  -48.377 82.030  1.00 130.81 ? 322 ASP A OD1 1 
ATOM   2614 O OD2 . ASP A 1 327 ? 56.331  -49.561 83.184  1.00 128.62 ? 322 ASP A OD2 1 
ATOM   2615 N N   . SER A 1 328 ? 53.593  -46.708 79.858  1.00 107.79 ? 323 SER A N   1 
ATOM   2616 C CA  . SER A 1 328 ? 52.519  -47.274 79.034  1.00 106.79 ? 323 SER A CA  1 
ATOM   2617 C C   . SER A 1 328 ? 52.838  -47.278 77.535  1.00 109.53 ? 323 SER A C   1 
ATOM   2618 O O   . SER A 1 328 ? 53.861  -46.736 77.109  1.00 111.49 ? 323 SER A O   1 
ATOM   2619 C CB  . SER A 1 328 ? 51.197  -46.545 79.306  1.00 99.55  ? 323 SER A CB  1 
ATOM   2620 O OG  . SER A 1 328 ? 50.740  -46.806 80.628  1.00 98.45  ? 323 SER A OG  1 
ATOM   2621 N N   . GLU A 1 329 ? 51.959  -47.893 76.743  1.00 109.96 ? 324 GLU A N   1 
ATOM   2622 C CA  . GLU A 1 329 ? 52.179  -48.021 75.296  1.00 113.50 ? 324 GLU A CA  1 
ATOM   2623 C C   . GLU A 1 329 ? 51.919  -46.731 74.499  1.00 108.46 ? 324 GLU A C   1 
ATOM   2624 O O   . GLU A 1 329 ? 52.630  -46.470 73.528  1.00 111.85 ? 324 GLU A O   1 
ATOM   2625 C CB  . GLU A 1 329 ? 51.402  -49.215 74.715  1.00 117.93 ? 324 GLU A CB  1 
ATOM   2626 C CG  . GLU A 1 329 ? 50.075  -48.880 74.035  1.00 114.53 ? 324 GLU A CG  1 
ATOM   2627 C CD  . GLU A 1 329 ? 49.032  -49.971 74.205  1.00 117.62 ? 324 GLU A CD  1 
ATOM   2628 O OE1 . GLU A 1 329 ? 47.867  -49.613 74.506  1.00 112.11 ? 324 GLU A OE1 1 
ATOM   2629 O OE2 . GLU A 1 329 ? 49.376  -51.174 74.049  1.00 124.76 ? 324 GLU A OE2 1 
ATOM   2630 N N   . ARG A 1 330 ? 50.912  -45.946 74.895  1.00 100.43 ? 325 ARG A N   1 
ATOM   2631 C CA  . ARG A 1 330 ? 50.660  -44.645 74.262  1.00 95.98  ? 325 ARG A CA  1 
ATOM   2632 C C   . ARG A 1 330 ? 51.435  -43.556 74.994  1.00 92.49  ? 325 ARG A C   1 
ATOM   2633 O O   . ARG A 1 330 ? 51.614  -43.613 76.209  1.00 90.73  ? 325 ARG A O   1 
ATOM   2634 C CB  . ARG A 1 330 ? 49.157  -44.270 74.235  1.00 90.58  ? 325 ARG A CB  1 
ATOM   2635 C CG  . ARG A 1 330 ? 48.192  -45.284 73.591  1.00 94.43  ? 325 ARG A CG  1 
ATOM   2636 C CD  . ARG A 1 330 ? 48.054  -45.137 72.065  1.00 98.76  ? 325 ARG A CD  1 
ATOM   2637 N NE  . ARG A 1 330 ? 47.168  -46.152 71.475  1.00 103.39 ? 325 ARG A NE  1 
ATOM   2638 C CZ  . ARG A 1 330 ? 47.523  -47.063 70.560  1.00 111.10 ? 325 ARG A CZ  1 
ATOM   2639 N NH1 . ARG A 1 330 ? 48.760  -47.112 70.073  1.00 115.60 ? 325 ARG A NH1 1 
ATOM   2640 N NH2 . ARG A 1 330 ? 46.622  -47.929 70.111  1.00 114.24 ? 325 ARG A NH2 1 
ATOM   2641 N N   . ARG A 1 331 ? 51.879  -42.558 74.239  1.00 91.61  ? 326 ARG A N   1 
ATOM   2642 C CA  . ARG A 1 331 ? 52.501  -41.368 74.802  1.00 88.74  ? 326 ARG A CA  1 
ATOM   2643 C C   . ARG A 1 331 ? 51.477  -40.590 75.649  1.00 81.90  ? 326 ARG A C   1 
ATOM   2644 O O   . ARG A 1 331 ? 50.273  -40.689 75.424  1.00 78.01  ? 326 ARG A O   1 
ATOM   2645 C CB  . ARG A 1 331 ? 53.047  -40.488 73.674  1.00 90.34  ? 326 ARG A CB  1 
ATOM   2646 C CG  . ARG A 1 331 ? 54.002  -41.207 72.700  1.00 97.33  ? 326 ARG A CG  1 
ATOM   2647 C CD  . ARG A 1 331 ? 53.860  -40.702 71.259  1.00 98.17  ? 326 ARG A CD  1 
ATOM   2648 N NE  . ARG A 1 331 ? 53.926  -39.242 71.164  1.00 96.11  ? 326 ARG A NE  1 
ATOM   2649 C CZ  . ARG A 1 331 ? 53.495  -38.520 70.129  1.00 95.89  ? 326 ARG A CZ  1 
ATOM   2650 N NH1 . ARG A 1 331 ? 52.952  -39.107 69.069  1.00 97.81  ? 326 ARG A NH1 1 
ATOM   2651 N NH2 . ARG A 1 331 ? 53.605  -37.197 70.155  1.00 94.13  ? 326 ARG A NH2 1 
ATOM   2652 N N   . PHE A 1 332 ? 51.976  -39.865 76.649  1.00 80.55  ? 327 PHE A N   1 
ATOM   2653 C CA  . PHE A 1 332 ? 51.190  -38.915 77.449  1.00 75.72  ? 327 PHE A CA  1 
ATOM   2654 C C   . PHE A 1 332 ? 49.905  -39.459 78.120  1.00 72.57  ? 327 PHE A C   1 
ATOM   2655 O O   . PHE A 1 332 ? 48.853  -38.804 78.103  1.00 68.82  ? 327 PHE A O   1 
ATOM   2656 C CB  . PHE A 1 332 ? 50.881  -37.648 76.633  1.00 73.17  ? 327 PHE A CB  1 
ATOM   2657 C CG  . PHE A 1 332 ? 52.002  -37.215 75.720  1.00 77.51  ? 327 PHE A CG  1 
ATOM   2658 C CD1 . PHE A 1 332 ? 51.775  -37.057 74.354  1.00 78.77  ? 327 PHE A CD1 1 
ATOM   2659 C CD2 . PHE A 1 332 ? 53.281  -36.958 76.221  1.00 81.11  ? 327 PHE A CD2 1 
ATOM   2660 C CE1 . PHE A 1 332 ? 52.805  -36.659 73.491  1.00 83.25  ? 327 PHE A CE1 1 
ATOM   2661 C CE2 . PHE A 1 332 ? 54.319  -36.560 75.364  1.00 85.79  ? 327 PHE A CE2 1 
ATOM   2662 C CZ  . PHE A 1 332 ? 54.078  -36.409 73.997  1.00 86.57  ? 327 PHE A CZ  1 
ATOM   2663 N N   . CYS A 1 333 ? 50.009  -40.642 78.721  1.00 74.53  ? 328 CYS A N   1 
ATOM   2664 C CA  . CYS A 1 333 ? 48.901  -41.252 79.469  1.00 72.47  ? 328 CYS A CA  1 
ATOM   2665 C C   . CYS A 1 333 ? 48.935  -40.989 80.977  1.00 69.93  ? 328 CYS A C   1 
ATOM   2666 O O   . CYS A 1 333 ? 49.958  -40.613 81.530  1.00 71.38  ? 328 CYS A O   1 
ATOM   2667 C CB  . CYS A 1 333 ? 48.869  -42.761 79.243  1.00 76.49  ? 328 CYS A CB  1 
ATOM   2668 S SG  . CYS A 1 333 ? 48.211  -43.206 77.672  1.00 80.57  ? 328 CYS A SG  1 
ATOM   2669 N N   . PHE A 1 334 ? 47.793  -41.205 81.621  1.00 66.73  ? 329 PHE A N   1 
ATOM   2670 C CA  . PHE A 1 334 ? 47.624  -41.009 83.053  1.00 65.20  ? 329 PHE A CA  1 
ATOM   2671 C C   . PHE A 1 334 ? 46.277  -41.574 83.447  1.00 63.39  ? 329 PHE A C   1 
ATOM   2672 O O   . PHE A 1 334 ? 45.368  -41.618 82.623  1.00 62.39  ? 329 PHE A O   1 
ATOM   2673 C CB  . PHE A 1 334 ? 47.781  -39.537 83.471  1.00 62.60  ? 329 PHE A CB  1 
ATOM   2674 C CG  . PHE A 1 334 ? 46.608  -38.648 83.130  1.00 60.03  ? 329 PHE A CG  1 
ATOM   2675 C CD1 . PHE A 1 334 ? 45.656  -38.321 84.109  1.00 58.60  ? 329 PHE A CD1 1 
ATOM   2676 C CD2 . PHE A 1 334 ? 46.481  -38.092 81.864  1.00 59.63  ? 329 PHE A CD2 1 
ATOM   2677 C CE1 . PHE A 1 334 ? 44.593  -37.485 83.832  1.00 54.95  ? 329 PHE A CE1 1 
ATOM   2678 C CE2 . PHE A 1 334 ? 45.404  -37.228 81.560  1.00 57.93  ? 329 PHE A CE2 1 
ATOM   2679 C CZ  . PHE A 1 334 ? 44.451  -36.934 82.540  1.00 56.34  ? 329 PHE A CZ  1 
ATOM   2680 N N   . GLU A 1 335 ? 46.162  -42.030 84.692  1.00 63.98  ? 330 GLU A N   1 
ATOM   2681 C CA  . GLU A 1 335 ? 44.989  -42.784 85.117  1.00 63.90  ? 330 GLU A CA  1 
ATOM   2682 C C   . GLU A 1 335 ? 44.238  -42.130 86.266  1.00 61.58  ? 330 GLU A C   1 
ATOM   2683 O O   . GLU A 1 335 ? 44.841  -41.529 87.153  1.00 61.53  ? 330 GLU A O   1 
ATOM   2684 C CB  . GLU A 1 335 ? 45.392  -44.205 85.522  1.00 67.91  ? 330 GLU A CB  1 
ATOM   2685 C CG  . GLU A 1 335 ? 44.212  -45.105 85.846  1.00 68.53  ? 330 GLU A CG  1 
ATOM   2686 C CD  . GLU A 1 335 ? 44.610  -46.552 86.134  1.00 75.01  ? 330 GLU A CD  1 
ATOM   2687 O OE1 . GLU A 1 335 ? 45.760  -46.954 85.829  1.00 77.38  ? 330 GLU A OE1 1 
ATOM   2688 O OE2 . GLU A 1 335 ? 43.756  -47.294 86.667  1.00 76.77  ? 330 GLU A OE2 1 
ATOM   2689 N N   . VAL A 1 336 ? 42.921  -42.283 86.256  1.00 60.36  ? 331 VAL A N   1 
ATOM   2690 C CA  . VAL A 1 336 ? 42.099  -41.787 87.345  1.00 59.32  ? 331 VAL A CA  1 
ATOM   2691 C C   . VAL A 1 336 ? 41.271  -42.918 87.960  1.00 61.09  ? 331 VAL A C   1 
ATOM   2692 O O   . VAL A 1 336 ? 40.431  -43.522 87.298  1.00 62.04  ? 331 VAL A O   1 
ATOM   2693 C CB  . VAL A 1 336 ? 41.187  -40.632 86.881  1.00 55.95  ? 331 VAL A CB  1 
ATOM   2694 C CG1 . VAL A 1 336 ? 40.171  -40.316 87.940  1.00 56.51  ? 331 VAL A CG1 1 
ATOM   2695 C CG2 . VAL A 1 336 ? 42.005  -39.389 86.572  1.00 55.29  ? 331 VAL A CG2 1 
ATOM   2696 N N   . VAL A 1 337 ? 41.504  -43.199 89.233  1.00 62.37  ? 332 VAL A N   1 
ATOM   2697 C CA  . VAL A 1 337 ? 40.783  -44.266 89.889  1.00 65.03  ? 332 VAL A CA  1 
ATOM   2698 C C   . VAL A 1 337 ? 39.912  -43.690 90.988  1.00 64.91  ? 332 VAL A C   1 
ATOM   2699 O O   . VAL A 1 337 ? 40.317  -42.786 91.700  1.00 64.14  ? 332 VAL A O   1 
ATOM   2700 C CB  . VAL A 1 337 ? 41.740  -45.335 90.468  1.00 68.82  ? 332 VAL A CB  1 
ATOM   2701 C CG1 . VAL A 1 337 ? 40.956  -46.538 91.004  1.00 71.31  ? 332 VAL A CG1 1 
ATOM   2702 C CG2 . VAL A 1 337 ? 42.730  -45.785 89.413  1.00 69.27  ? 332 VAL A CG2 1 
ATOM   2703 N N   . SER A 1 338 ? 38.703  -44.207 91.097  1.00 66.90  ? 333 SER A N   1 
ATOM   2704 C CA  . SER A 1 338 ? 37.813  -43.880 92.190  1.00 68.23  ? 333 SER A CA  1 
ATOM   2705 C C   . SER A 1 338 ? 37.308  -45.186 92.766  1.00 72.80  ? 333 SER A C   1 
ATOM   2706 O O   . SER A 1 338 ? 37.749  -46.263 92.354  1.00 75.38  ? 333 SER A O   1 
ATOM   2707 C CB  . SER A 1 338 ? 36.652  -43.012 91.700  1.00 66.37  ? 333 SER A CB  1 
ATOM   2708 O OG  . SER A 1 338 ? 36.101  -43.498 90.486  1.00 66.65  ? 333 SER A OG  1 
ATOM   2709 N N   . THR A 1 339 ? 36.399  -45.083 93.730  1.00 74.83  ? 334 THR A N   1 
ATOM   2710 C CA  . THR A 1 339 ? 35.801  -46.245 94.387  1.00 79.70  ? 334 THR A CA  1 
ATOM   2711 C C   . THR A 1 339 ? 35.175  -47.214 93.373  1.00 82.25  ? 334 THR A C   1 
ATOM   2712 O O   . THR A 1 339 ? 35.412  -48.417 93.434  1.00 86.00  ? 334 THR A O   1 
ATOM   2713 C CB  . THR A 1 339 ? 34.742  -45.801 95.420  1.00 80.52  ? 334 THR A CB  1 
ATOM   2714 O OG1 . THR A 1 339 ? 33.812  -44.907 94.791  1.00 79.65  ? 334 THR A OG1 1 
ATOM   2715 C CG2 . THR A 1 339 ? 35.398  -45.055 96.554  1.00 79.73  ? 334 THR A CG2 1 
ATOM   2716 N N   . SER A 1 340 ? 34.405  -46.671 92.430  1.00 80.98  ? 335 SER A N   1 
ATOM   2717 C CA  . SER A 1 340 ? 33.667  -47.471 91.448  1.00 84.20  ? 335 SER A CA  1 
ATOM   2718 C C   . SER A 1 340 ? 34.305  -47.447 90.051  1.00 82.91  ? 335 SER A C   1 
ATOM   2719 O O   . SER A 1 340 ? 34.330  -48.460 89.360  1.00 86.32  ? 335 SER A O   1 
ATOM   2720 C CB  . SER A 1 340 ? 32.219  -46.974 91.353  1.00 84.46  ? 335 SER A CB  1 
ATOM   2721 O OG  . SER A 1 340 ? 32.184  -45.608 90.944  1.00 80.53  ? 335 SER A OG  1 
ATOM   2722 N N   . LYS A 1 341 ? 34.806  -46.286 89.641  1.00 78.65  ? 336 LYS A N   1 
ATOM   2723 C CA  . LYS A 1 341 ? 35.358  -46.111 88.300  1.00 77.32  ? 336 LYS A CA  1 
ATOM   2724 C C   . LYS A 1 341 ? 36.885  -46.234 88.261  1.00 76.52  ? 336 LYS A C   1 
ATOM   2725 O O   . LYS A 1 341 ? 37.566  -46.035 89.254  1.00 76.11  ? 336 LYS A O   1 
ATOM   2726 C CB  . LYS A 1 341 ? 34.939  -44.742 87.733  1.00 73.99  ? 336 LYS A CB  1 
ATOM   2727 C CG  . LYS A 1 341 ? 33.485  -44.628 87.252  1.00 75.74  ? 336 LYS A CG  1 
ATOM   2728 C CD  . LYS A 1 341 ? 33.387  -44.858 85.739  1.00 78.23  ? 336 LYS A CD  1 
ATOM   2729 C CE  . LYS A 1 341 ? 31.975  -45.237 85.280  1.00 81.91  ? 336 LYS A CE  1 
ATOM   2730 N NZ  . LYS A 1 341 ? 31.087  -44.055 85.122  1.00 79.80  ? 336 LYS A NZ  1 
ATOM   2731 N N   . SER A 1 342 ? 37.403  -46.603 87.098  1.00 77.08  ? 337 SER A N   1 
ATOM   2732 C CA  . SER A 1 342 ? 38.801  -46.405 86.734  1.00 75.49  ? 337 SER A CA  1 
ATOM   2733 C C   . SER A 1 342 ? 38.758  -45.873 85.306  1.00 73.86  ? 337 SER A C   1 
ATOM   2734 O O   . SER A 1 342 ? 37.901  -46.288 84.517  1.00 75.92  ? 337 SER A O   1 
ATOM   2735 C CB  . SER A 1 342 ? 39.571  -47.718 86.781  1.00 79.77  ? 337 SER A CB  1 
ATOM   2736 O OG  . SER A 1 342 ? 40.796  -47.618 86.075  1.00 78.59  ? 337 SER A OG  1 
ATOM   2737 N N   . CYS A 1 343 ? 39.655  -44.954 84.966  1.00 70.57  ? 338 CYS A N   1 
ATOM   2738 C CA  . CYS A 1 343 ? 39.662  -44.390 83.617  1.00 69.04  ? 338 CYS A CA  1 
ATOM   2739 C C   . CYS A 1 343 ? 41.068  -44.048 83.141  1.00 67.71  ? 338 CYS A C   1 
ATOM   2740 O O   . CYS A 1 343 ? 41.756  -43.224 83.749  1.00 65.40  ? 338 CYS A O   1 
ATOM   2741 C CB  . CYS A 1 343 ? 38.767  -43.147 83.556  1.00 66.12  ? 338 CYS A CB  1 
ATOM   2742 S SG  . CYS A 1 343 ? 38.164  -42.753 81.891  1.00 69.76  ? 338 CYS A SG  1 
ATOM   2743 N N   . LEU A 1 344 ? 41.490  -44.687 82.054  1.00 69.23  ? 339 LEU A N   1 
ATOM   2744 C CA  . LEU A 1 344 ? 42.738  -44.318 81.391  1.00 68.61  ? 339 LEU A CA  1 
ATOM   2745 C C   . LEU A 1 344 ? 42.458  -43.117 80.489  1.00 64.98  ? 339 LEU A C   1 
ATOM   2746 O O   . LEU A 1 344 ? 41.460  -43.091 79.784  1.00 64.05  ? 339 LEU A O   1 
ATOM   2747 C CB  . LEU A 1 344 ? 43.293  -45.480 80.568  1.00 73.37  ? 339 LEU A CB  1 
ATOM   2748 C CG  . LEU A 1 344 ? 44.795  -45.770 80.707  1.00 76.28  ? 339 LEU A CG  1 
ATOM   2749 C CD1 . LEU A 1 344 ? 45.151  -47.219 80.225  1.00 81.85  ? 339 LEU A CD1 1 
ATOM   2750 C CD2 . LEU A 1 344 ? 45.693  -44.708 80.057  1.00 71.88  ? 339 LEU A CD2 1 
ATOM   2751 N N   . LEU A 1 345 ? 43.331  -42.120 80.557  1.00 62.80  ? 340 LEU A N   1 
ATOM   2752 C CA  . LEU A 1 345 ? 43.132  -40.847 79.873  1.00 59.65  ? 340 LEU A CA  1 
ATOM   2753 C C   . LEU A 1 345 ? 44.404  -40.509 79.136  1.00 61.13  ? 340 LEU A C   1 
ATOM   2754 O O   . LEU A 1 345 ? 45.500  -40.870 79.568  1.00 63.71  ? 340 LEU A O   1 
ATOM   2755 C CB  . LEU A 1 345 ? 42.815  -39.729 80.856  1.00 55.82  ? 340 LEU A CB  1 
ATOM   2756 C CG  . LEU A 1 345 ? 41.588  -39.824 81.761  1.00 54.67  ? 340 LEU A CG  1 
ATOM   2757 C CD1 . LEU A 1 345 ? 41.425  -38.532 82.563  1.00 51.33  ? 340 LEU A CD1 1 
ATOM   2758 C CD2 . LEU A 1 345 ? 40.349  -40.105 80.964  1.00 55.76  ? 340 LEU A CD2 1 
ATOM   2759 N N   . GLN A 1 346 ? 44.271  -39.826 78.013  1.00 60.17  ? 341 GLN A N   1 
ATOM   2760 C CA  . GLN A 1 346 ? 45.447  -39.521 77.239  1.00 61.76  ? 341 GLN A CA  1 
ATOM   2761 C C   . GLN A 1 346 ? 45.375  -38.101 76.739  1.00 59.79  ? 341 GLN A C   1 
ATOM   2762 O O   . GLN A 1 346 ? 44.398  -37.704 76.120  1.00 58.82  ? 341 GLN A O   1 
ATOM   2763 C CB  . GLN A 1 346 ? 45.588  -40.510 76.091  1.00 65.11  ? 341 GLN A CB  1 
ATOM   2764 C CG  . GLN A 1 346 ? 46.786  -40.256 75.242  1.00 66.67  ? 341 GLN A CG  1 
ATOM   2765 C CD  . GLN A 1 346 ? 46.723  -40.991 73.933  1.00 69.93  ? 341 GLN A CD  1 
ATOM   2766 O OE1 . GLN A 1 346 ? 47.737  -41.135 73.263  1.00 74.54  ? 341 GLN A OE1 1 
ATOM   2767 N NE2 . GLN A 1 346 ? 45.538  -41.483 73.567  1.00 67.89  ? 341 GLN A NE2 1 
ATOM   2768 N N   . ALA A 1 347 ? 46.414  -37.338 77.047  1.00 60.54  ? 342 ALA A N   1 
ATOM   2769 C CA  . ALA A 1 347 ? 46.532  -35.975 76.588  1.00 59.87  ? 342 ALA A CA  1 
ATOM   2770 C C   . ALA A 1 347 ? 47.210  -35.992 75.217  1.00 63.55  ? 342 ALA A C   1 
ATOM   2771 O O   . ALA A 1 347 ? 47.658  -37.050 74.752  1.00 66.01  ? 342 ALA A O   1 
ATOM   2772 C CB  . ALA A 1 347 ? 47.325  -35.150 77.588  1.00 59.52  ? 342 ALA A CB  1 
ATOM   2773 N N   . ASP A 1 348 ? 47.291  -34.827 74.578  1.00 63.44  ? 343 ASP A N   1 
ATOM   2774 C CA  . ASP A 1 348 ? 47.872  -34.734 73.237  1.00 67.43  ? 343 ASP A CA  1 
ATOM   2775 C C   . ASP A 1 348 ? 49.351  -34.396 73.206  1.00 70.65  ? 343 ASP A C   1 
ATOM   2776 O O   . ASP A 1 348 ? 49.999  -34.587 72.186  1.00 74.31  ? 343 ASP A O   1 
ATOM   2777 C CB  . ASP A 1 348 ? 47.097  -33.717 72.401  1.00 66.59  ? 343 ASP A CB  1 
ATOM   2778 C CG  . ASP A 1 348 ? 45.682  -34.143 72.168  1.00 65.54  ? 343 ASP A CG  1 
ATOM   2779 O OD1 . ASP A 1 348 ? 45.479  -35.192 71.529  1.00 67.81  ? 343 ASP A OD1 1 
ATOM   2780 O OD2 . ASP A 1 348 ? 44.766  -33.443 72.640  1.00 66.24  ? 343 ASP A OD2 1 
ATOM   2781 N N   . SER A 1 349 ? 49.872  -33.876 74.313  1.00 70.35  ? 344 SER A N   1 
ATOM   2782 C CA  . SER A 1 349 ? 51.252  -33.418 74.371  1.00 74.57  ? 344 SER A CA  1 
ATOM   2783 C C   . SER A 1 349 ? 51.793  -33.561 75.779  1.00 74.69  ? 344 SER A C   1 
ATOM   2784 O O   . SER A 1 349 ? 51.039  -33.819 76.711  1.00 71.54  ? 344 SER A O   1 
ATOM   2785 C CB  . SER A 1 349 ? 51.372  -31.963 73.906  1.00 75.15  ? 344 SER A CB  1 
ATOM   2786 O OG  . SER A 1 349 ? 51.035  -31.061 74.945  1.00 73.88  ? 344 SER A OG  1 
ATOM   2787 N N   . GLU A 1 350 ? 53.104  -33.390 75.919  1.00 79.31  ? 345 GLU A N   1 
ATOM   2788 C CA  . GLU A 1 350 ? 53.753  -33.492 77.214  1.00 81.13  ? 345 GLU A CA  1 
ATOM   2789 C C   . GLU A 1 350 ? 53.197  -32.464 78.171  1.00 78.07  ? 345 GLU A C   1 
ATOM   2790 O O   . GLU A 1 350 ? 52.827  -32.793 79.292  1.00 76.77  ? 345 GLU A O   1 
ATOM   2791 C CB  . GLU A 1 350 ? 55.272  -33.350 77.083  1.00 87.11  ? 345 GLU A CB  1 
ATOM   2792 C CG  . GLU A 1 350 ? 56.034  -34.634 77.393  1.00 91.72  ? 345 GLU A CG  1 
ATOM   2793 C CD  . GLU A 1 350 ? 55.926  -35.061 78.864  1.00 91.43  ? 345 GLU A CD  1 
ATOM   2794 O OE1 . GLU A 1 350 ? 55.783  -36.277 79.130  1.00 92.25  ? 345 GLU A OE1 1 
ATOM   2795 O OE2 . GLU A 1 350 ? 55.989  -34.184 79.755  1.00 90.47  ? 345 GLU A OE2 1 
ATOM   2796 N N   . ARG A 1 351 ? 53.120  -31.230 77.689  1.00 78.22  ? 346 ARG A N   1 
ATOM   2797 C CA  . ARG A 1 351 ? 52.641  -30.078 78.440  1.00 76.59  ? 346 ARG A CA  1 
ATOM   2798 C C   . ARG A 1 351 ? 51.190  -30.199 78.919  1.00 71.34  ? 346 ARG A C   1 
ATOM   2799 O O   . ARG A 1 351 ? 50.858  -29.723 79.998  1.00 70.43  ? 346 ARG A O   1 
ATOM   2800 C CB  . ARG A 1 351 ? 52.779  -28.839 77.558  1.00 78.64  ? 346 ARG A CB  1 
ATOM   2801 C CG  . ARG A 1 351 ? 52.929  -27.529 78.299  1.00 81.16  ? 346 ARG A CG  1 
ATOM   2802 C CD  . ARG A 1 351 ? 52.613  -26.365 77.364  1.00 83.58  ? 346 ARG A CD  1 
ATOM   2803 N NE  . ARG A 1 351 ? 52.902  -25.064 77.964  1.00 88.19  ? 346 ARG A NE  1 
ATOM   2804 C CZ  . ARG A 1 351 ? 52.214  -24.522 78.969  1.00 87.92  ? 346 ARG A CZ  1 
ATOM   2805 N NH1 . ARG A 1 351 ? 51.184  -25.168 79.514  1.00 83.19  ? 346 ARG A NH1 1 
ATOM   2806 N NH2 . ARG A 1 351 ? 52.564  -23.329 79.438  1.00 92.11  ? 346 ARG A NH2 1 
ATOM   2807 N N   . LEU A 1 352 ? 50.324  -30.799 78.103  1.00 68.64  ? 347 LEU A N   1 
ATOM   2808 C CA  . LEU A 1 352 ? 48.909  -30.965 78.466  1.00 64.48  ? 347 LEU A CA  1 
ATOM   2809 C C   . LEU A 1 352 ? 48.773  -32.042 79.516  1.00 63.04  ? 347 LEU A C   1 
ATOM   2810 O O   . LEU A 1 352 ? 47.964  -31.921 80.428  1.00 60.39  ? 347 LEU A O   1 
ATOM   2811 C CB  . LEU A 1 352 ? 48.044  -31.338 77.254  1.00 62.67  ? 347 LEU A CB  1 
ATOM   2812 C CG  . LEU A 1 352 ? 47.675  -30.256 76.244  1.00 63.92  ? 347 LEU A CG  1 
ATOM   2813 C CD1 . LEU A 1 352 ? 46.791  -30.859 75.153  1.00 62.73  ? 347 LEU A CD1 1 
ATOM   2814 C CD2 . LEU A 1 352 ? 46.981  -29.095 76.934  1.00 61.36  ? 347 LEU A CD2 1 
ATOM   2815 N N   . LEU A 1 353 ? 49.556  -33.106 79.342  1.00 64.99  ? 348 LEU A N   1 
ATOM   2816 C CA  . LEU A 1 353 ? 49.661  -34.174 80.325  1.00 65.52  ? 348 LEU A CA  1 
ATOM   2817 C C   . LEU A 1 353 ? 49.935  -33.566 81.691  1.00 65.74  ? 348 LEU A C   1 
ATOM   2818 O O   . LEU A 1 353 ? 49.156  -33.762 82.619  1.00 63.81  ? 348 LEU A O   1 
ATOM   2819 C CB  . LEU A 1 353 ? 50.759  -35.167 79.914  1.00 69.06  ? 348 LEU A CB  1 
ATOM   2820 C CG  . LEU A 1 353 ? 51.031  -36.448 80.711  1.00 70.03  ? 348 LEU A CG  1 
ATOM   2821 C CD1 . LEU A 1 353 ? 52.254  -36.263 81.601  1.00 73.10  ? 348 LEU A CD1 1 
ATOM   2822 C CD2 . LEU A 1 353 ? 49.821  -36.943 81.494  1.00 64.30  ? 348 LEU A CD2 1 
ATOM   2823 N N   . GLN A 1 354 ? 51.012  -32.788 81.785  1.00 68.93  ? 349 GLN A N   1 
ATOM   2824 C CA  . GLN A 1 354 ? 51.352  -32.073 83.014  1.00 70.36  ? 349 GLN A CA  1 
ATOM   2825 C C   . GLN A 1 354 ? 50.325  -31.033 83.449  1.00 67.79  ? 349 GLN A C   1 
ATOM   2826 O O   . GLN A 1 354 ? 50.292  -30.684 84.627  1.00 68.40  ? 349 GLN A O   1 
ATOM   2827 C CB  . GLN A 1 354 ? 52.705  -31.377 82.898  1.00 75.22  ? 349 GLN A CB  1 
ATOM   2828 C CG  . GLN A 1 354 ? 53.892  -32.289 82.752  1.00 79.42  ? 349 GLN A CG  1 
ATOM   2829 C CD  . GLN A 1 354 ? 55.055  -31.570 82.114  1.00 84.87  ? 349 GLN A CD  1 
ATOM   2830 O OE1 . GLN A 1 354 ? 54.895  -30.898 81.090  1.00 84.64  ? 349 GLN A OE1 1 
ATOM   2831 N NE2 . GLN A 1 354 ? 56.238  -31.699 82.714  1.00 91.11  ? 349 GLN A NE2 1 
ATOM   2832 N N   . LEU A 1 355 ? 49.514  -30.506 82.527  1.00 65.57  ? 350 LEU A N   1 
ATOM   2833 C CA  . LEU A 1 355 ? 48.484  -29.540 82.944  1.00 63.54  ? 350 LEU A CA  1 
ATOM   2834 C C   . LEU A 1 355 ? 47.329  -30.255 83.615  1.00 59.91  ? 350 LEU A C   1 
ATOM   2835 O O   . LEU A 1 355 ? 46.909  -29.864 84.686  1.00 60.08  ? 350 LEU A O   1 
ATOM   2836 C CB  . LEU A 1 355 ? 47.980  -28.631 81.802  1.00 63.25  ? 350 LEU A CB  1 
ATOM   2837 C CG  . LEU A 1 355 ? 47.580  -27.213 82.277  1.00 65.18  ? 350 LEU A CG  1 
ATOM   2838 C CD1 . LEU A 1 355 ? 48.820  -26.365 82.602  1.00 70.76  ? 350 LEU A CD1 1 
ATOM   2839 C CD2 . LEU A 1 355 ? 46.692  -26.448 81.294  1.00 66.78  ? 350 LEU A CD2 1 
ATOM   2840 N N   . TRP A 1 356 ? 46.849  -31.321 82.985  1.00 57.44  ? 351 TRP A N   1 
ATOM   2841 C CA  . TRP A 1 356 ? 45.700  -32.069 83.458  1.00 54.36  ? 351 TRP A CA  1 
ATOM   2842 C C   . TRP A 1 356 ? 45.925  -32.839 84.769  1.00 55.03  ? 351 TRP A C   1 
ATOM   2843 O O   . TRP A 1 356 ? 44.995  -32.989 85.570  1.00 53.51  ? 351 TRP A O   1 
ATOM   2844 C CB  . TRP A 1 356 ? 45.244  -33.030 82.370  1.00 52.96  ? 351 TRP A CB  1 
ATOM   2845 C CG  . TRP A 1 356 ? 44.242  -32.438 81.451  1.00 52.04  ? 351 TRP A CG  1 
ATOM   2846 C CD1 . TRP A 1 356 ? 44.479  -31.912 80.210  1.00 52.96  ? 351 TRP A CD1 1 
ATOM   2847 C CD2 . TRP A 1 356 ? 42.829  -32.312 81.678  1.00 49.72  ? 351 TRP A CD2 1 
ATOM   2848 N NE1 . TRP A 1 356 ? 43.303  -31.457 79.654  1.00 51.84  ? 351 TRP A NE1 1 
ATOM   2849 C CE2 . TRP A 1 356 ? 42.274  -31.690 80.526  1.00 50.62  ? 351 TRP A CE2 1 
ATOM   2850 C CE3 . TRP A 1 356 ? 41.979  -32.652 82.741  1.00 48.34  ? 351 TRP A CE3 1 
ATOM   2851 C CZ2 . TRP A 1 356 ? 40.907  -31.405 80.404  1.00 49.91  ? 351 TRP A CZ2 1 
ATOM   2852 C CZ3 . TRP A 1 356 ? 40.617  -32.379 82.623  1.00 48.93  ? 351 TRP A CZ3 1 
ATOM   2853 C CH2 . TRP A 1 356 ? 40.092  -31.761 81.453  1.00 49.89  ? 351 TRP A CH2 1 
ATOM   2854 N N   . VAL A 1 357 ? 47.139  -33.349 84.981  1.00 57.60  ? 352 VAL A N   1 
ATOM   2855 C CA  . VAL A 1 357 ? 47.435  -34.107 86.214  1.00 58.55  ? 352 VAL A CA  1 
ATOM   2856 C C   . VAL A 1 357 ? 47.539  -33.219 87.451  1.00 59.28  ? 352 VAL A C   1 
ATOM   2857 O O   . VAL A 1 357 ? 46.850  -33.466 88.440  1.00 58.32  ? 352 VAL A O   1 
ATOM   2858 C CB  . VAL A 1 357 ? 48.653  -35.070 86.100  1.00 61.73  ? 352 VAL A CB  1 
ATOM   2859 C CG1 . VAL A 1 357 ? 48.378  -36.168 85.072  1.00 61.96  ? 352 VAL A CG1 1 
ATOM   2860 C CG2 . VAL A 1 357 ? 49.927  -34.328 85.764  1.00 65.94  ? 352 VAL A CG2 1 
ATOM   2861 N N   . SER A 1 358 ? 48.361  -32.169 87.390  1.00 61.16  ? 353 SER A N   1 
ATOM   2862 C CA  . SER A 1 358 ? 48.431  -31.234 88.507  1.00 63.04  ? 353 SER A CA  1 
ATOM   2863 C C   . SER A 1 358 ? 47.070  -30.558 88.672  1.00 60.53  ? 353 SER A C   1 
ATOM   2864 O O   . SER A 1 358 ? 46.626  -30.338 89.793  1.00 61.34  ? 353 SER A O   1 
ATOM   2865 C CB  . SER A 1 358 ? 49.594  -30.238 88.380  1.00 66.69  ? 353 SER A CB  1 
ATOM   2866 O OG  . SER A 1 358 ? 49.433  -29.368 87.284  1.00 66.26  ? 353 SER A OG  1 
ATOM   2867 N N   . ALA A 1 359 ? 46.395  -30.285 87.555  1.00 57.91  ? 354 ALA A N   1 
ATOM   2868 C CA  . ALA A 1 359 ? 44.985  -29.844 87.585  1.00 55.91  ? 354 ALA A CA  1 
ATOM   2869 C C   . ALA A 1 359 ? 44.097  -30.753 88.434  1.00 53.90  ? 354 ALA A C   1 
ATOM   2870 O O   . ALA A 1 359 ? 43.342  -30.282 89.268  1.00 53.85  ? 354 ALA A O   1 
ATOM   2871 C CB  . ALA A 1 359 ? 44.408  -29.721 86.167  1.00 53.57  ? 354 ALA A CB  1 
ATOM   2872 N N   . VAL A 1 360 ? 44.173  -32.053 88.191  1.00 53.15  ? 355 VAL A N   1 
ATOM   2873 C CA  . VAL A 1 360 ? 43.436  -33.020 89.007  1.00 53.06  ? 355 VAL A CA  1 
ATOM   2874 C C   . VAL A 1 360 ? 43.913  -33.077 90.471  1.00 55.27  ? 355 VAL A C   1 
ATOM   2875 O O   . VAL A 1 360 ? 43.089  -33.062 91.387  1.00 55.37  ? 355 VAL A O   1 
ATOM   2876 C CB  . VAL A 1 360 ? 43.463  -34.433 88.400  1.00 52.36  ? 355 VAL A CB  1 
ATOM   2877 C CG1 . VAL A 1 360 ? 42.709  -35.405 89.307  1.00 51.25  ? 355 VAL A CG1 1 
ATOM   2878 C CG2 . VAL A 1 360 ? 42.838  -34.410 87.020  1.00 50.68  ? 355 VAL A CG2 1 
ATOM   2879 N N   . GLN A 1 361 ? 45.228  -33.122 90.685  1.00 58.07  ? 356 GLN A N   1 
ATOM   2880 C CA  . GLN A 1 361 ? 45.799  -33.144 92.051  1.00 61.67  ? 356 GLN A CA  1 
ATOM   2881 C C   . GLN A 1 361 ? 45.372  -31.899 92.829  1.00 63.93  ? 356 GLN A C   1 
ATOM   2882 O O   . GLN A 1 361 ? 44.969  -31.983 93.992  1.00 65.69  ? 356 GLN A O   1 
ATOM   2883 C CB  . GLN A 1 361 ? 47.321  -33.168 92.005  1.00 64.31  ? 356 GLN A CB  1 
ATOM   2884 C CG  . GLN A 1 361 ? 47.941  -34.422 91.468  1.00 64.26  ? 356 GLN A CG  1 
ATOM   2885 C CD  . GLN A 1 361 ? 49.409  -34.218 91.111  1.00 67.63  ? 356 GLN A CD  1 
ATOM   2886 O OE1 . GLN A 1 361 ? 49.881  -33.084 90.963  1.00 68.31  ? 356 GLN A OE1 1 
ATOM   2887 N NE2 . GLN A 1 361 ? 50.135  -35.319 90.967  1.00 68.69  ? 356 GLN A NE2 1 
ATOM   2888 N N   . SER A 1 362 ? 45.489  -30.745 92.170  1.00 64.80  ? 357 SER A N   1 
ATOM   2889 C CA  . SER A 1 362 ? 45.067  -29.465 92.718  1.00 67.24  ? 357 SER A CA  1 
ATOM   2890 C C   . SER A 1 362 ? 43.563  -29.454 92.981  1.00 65.79  ? 357 SER A C   1 
ATOM   2891 O O   . SER A 1 362 ? 43.113  -28.839 93.936  1.00 68.33  ? 357 SER A O   1 
ATOM   2892 C CB  . SER A 1 362 ? 45.455  -28.324 91.762  1.00 68.01  ? 357 SER A CB  1 
ATOM   2893 O OG  . SER A 1 362 ? 44.860  -27.088 92.139  1.00 70.46  ? 357 SER A OG  1 
ATOM   2894 N N   . SER A 1 363 ? 42.789  -30.117 92.126  1.00 62.73  ? 358 SER A N   1 
ATOM   2895 C CA  . SER A 1 363 ? 41.345  -30.242 92.336  1.00 61.92  ? 358 SER A CA  1 
ATOM   2896 C C   . SER A 1 363 ? 41.048  -31.143 93.528  1.00 63.00  ? 358 SER A C   1 
ATOM   2897 O O   . SER A 1 363 ? 40.123  -30.867 94.299  1.00 64.60  ? 358 SER A O   1 
ATOM   2898 C CB  . SER A 1 363 ? 40.650  -30.772 91.084  1.00 58.91  ? 358 SER A CB  1 
ATOM   2899 O OG  . SER A 1 363 ? 40.799  -29.868 90.008  1.00 58.93  ? 358 SER A OG  1 
ATOM   2900 N N   . ILE A 1 364 ? 41.853  -32.201 93.675  1.00 62.97  ? 359 ILE A N   1 
ATOM   2901 C CA  . ILE A 1 364 ? 41.781  -33.138 94.810  1.00 64.00  ? 359 ILE A CA  1 
ATOM   2902 C C   . ILE A 1 364 ? 42.099  -32.451 96.155  1.00 67.75  ? 359 ILE A C   1 
ATOM   2903 O O   . ILE A 1 364 ? 41.344  -32.590 97.129  1.00 68.87  ? 359 ILE A O   1 
ATOM   2904 C CB  . ILE A 1 364 ? 42.710  -34.364 94.580  1.00 63.73  ? 359 ILE A CB  1 
ATOM   2905 C CG1 . ILE A 1 364 ? 42.109  -35.291 93.519  1.00 61.39  ? 359 ILE A CG1 1 
ATOM   2906 C CG2 . ILE A 1 364 ? 42.975  -35.136 95.888  1.00 66.65  ? 359 ILE A CG2 1 
ATOM   2907 C CD1 . ILE A 1 364 ? 43.006  -36.452 93.142  1.00 62.78  ? 359 ILE A CD1 1 
ATOM   2908 N N   . ALA A 1 365 ? 43.217  -31.724 96.196  1.00 69.61  ? 360 ALA A N   1 
ATOM   2909 C CA  . ALA A 1 365 ? 43.665  -31.026 97.408  1.00 74.16  ? 360 ALA A CA  1 
ATOM   2910 C C   . ALA A 1 365 ? 42.673  -29.923 97.789  1.00 75.35  ? 360 ALA A C   1 
ATOM   2911 O O   . ALA A 1 365 ? 42.216  -29.845 98.919  1.00 77.97  ? 360 ALA A O   1 
ATOM   2912 C CB  . ALA A 1 365 ? 45.066  -30.453 97.197  1.00 76.50  ? 360 ALA A CB  1 
ATOM   2913 N N   . SER A 1 366 ? 42.333  -29.103 96.804  1.00 73.90  ? 361 SER A N   1 
ATOM   2914 C CA  . SER A 1 366 ? 41.338  -28.052 96.919  1.00 75.70  ? 361 SER A CA  1 
ATOM   2915 C C   . SER A 1 366 ? 40.027  -28.491 97.568  1.00 75.81  ? 361 SER A C   1 
ATOM   2916 O O   . SER A 1 366 ? 39.519  -27.821 98.464  1.00 79.95  ? 361 SER A O   1 
ATOM   2917 C CB  . SER A 1 366 ? 41.038  -27.509 95.527  1.00 72.76  ? 361 SER A CB  1 
ATOM   2918 O OG  . SER A 1 366 ? 40.280  -26.320 95.599  1.00 77.11  ? 361 SER A OG  1 
ATOM   2919 N N   . ALA A 1 367 ? 39.482  -29.615 97.111  1.00 72.55  ? 362 ALA A N   1 
ATOM   2920 C CA  . ALA A 1 367 ? 38.137  -30.032 97.497  1.00 72.56  ? 362 ALA A CA  1 
ATOM   2921 C C   . ALA A 1 367 ? 38.023  -30.596 98.919  1.00 75.69  ? 362 ALA A C   1 
ATOM   2922 O O   . ALA A 1 367 ? 36.930  -30.964 99.341  1.00 76.84  ? 362 ALA A O   1 
ATOM   2923 C CB  . ALA A 1 367 ? 37.586  -31.006 96.493  1.00 68.59  ? 362 ALA A CB  1 
ATOM   2924 N N   . PHE A 1 368 ? 39.138  -30.657 99.645  1.00 77.56  ? 363 PHE A N   1 
ATOM   2925 C CA  . PHE A 1 368 ? 39.116  -30.980 101.078 1.00 81.73  ? 363 PHE A CA  1 
ATOM   2926 C C   . PHE A 1 368 ? 38.828  -29.764 101.966 1.00 86.86  ? 363 PHE A C   1 
ATOM   2927 O O   . PHE A 1 368 ? 38.560  -29.919 103.164 1.00 90.86  ? 363 PHE A O   1 
ATOM   2928 C CB  . PHE A 1 368 ? 40.435  -31.631 101.517 1.00 82.56  ? 363 PHE A CB  1 
ATOM   2929 C CG  . PHE A 1 368 ? 40.534  -33.089 101.184 1.00 79.70  ? 363 PHE A CG  1 
ATOM   2930 C CD1 . PHE A 1 368 ? 39.821  -34.039 101.923 1.00 80.38  ? 363 PHE A CD1 1 
ATOM   2931 C CD2 . PHE A 1 368 ? 41.347  -33.521 100.139 1.00 76.48  ? 363 PHE A CD2 1 
ATOM   2932 C CE1 . PHE A 1 368 ? 39.907  -35.399 101.619 1.00 78.29  ? 363 PHE A CE1 1 
ATOM   2933 C CE2 . PHE A 1 368 ? 41.443  -34.887 99.822  1.00 74.76  ? 363 PHE A CE2 1 
ATOM   2934 C CZ  . PHE A 1 368 ? 40.725  -35.825 100.566 1.00 75.93  ? 363 PHE A CZ  1 
ATOM   2935 N N   . SER A 1 369 ? 38.873  -28.567 101.375 1.00 87.41  ? 364 SER A N   1 
ATOM   2936 C CA  . SER A 1 369 ? 38.757  -27.288 102.114 1.00 93.35  ? 364 SER A CA  1 
ATOM   2937 C C   . SER A 1 369 ? 37.622  -27.222 103.148 1.00 97.56  ? 364 SER A C   1 
ATOM   2938 O O   . SER A 1 369 ? 36.438  -27.200 102.802 1.00 96.82  ? 364 SER A O   1 
ATOM   2939 C CB  . SER A 1 369 ? 38.645  -26.114 101.140 1.00 92.89  ? 364 SER A CB  1 
ATOM   2940 O OG  . SER A 1 369 ? 37.596  -26.331 100.212 1.00 89.11  ? 364 SER A OG  1 
ATOM   2941 N N   . SER B 1 5   ? 16.711  -21.852 70.358  1.00 96.28  ? 0   SER B N   1 
ATOM   2942 C CA  . SER B 1 5   ? 17.005  -22.775 71.499  1.00 99.87  ? 0   SER B CA  1 
ATOM   2943 C C   . SER B 1 5   ? 18.411  -22.568 72.070  1.00 99.60  ? 0   SER B C   1 
ATOM   2944 O O   . SER B 1 5   ? 18.571  -22.347 73.275  1.00 102.01 ? 0   SER B O   1 
ATOM   2945 C CB  . SER B 1 5   ? 16.811  -24.240 71.078  1.00 101.23 ? 0   SER B CB  1 
ATOM   2946 O OG  . SER B 1 5   ? 17.237  -25.137 72.097  1.00 104.05 ? 0   SER B OG  1 
ATOM   2947 N N   . MET B 1 6   ? 19.416  -22.657 71.200  1.00 96.74  ? 1   MET B N   1 
ATOM   2948 C CA  . MET B 1 6   ? 20.809  -22.443 71.586  1.00 95.98  ? 1   MET B CA  1 
ATOM   2949 C C   . MET B 1 6   ? 21.273  -21.078 71.124  1.00 92.45  ? 1   MET B C   1 
ATOM   2950 O O   . MET B 1 6   ? 20.752  -20.526 70.156  1.00 90.30  ? 1   MET B O   1 
ATOM   2951 C CB  . MET B 1 6   ? 21.725  -23.523 70.990  1.00 95.63  ? 1   MET B CB  1 
ATOM   2952 C CG  . MET B 1 6   ? 21.786  -24.816 71.797  1.00 100.18 ? 1   MET B CG  1 
ATOM   2953 S SD  . MET B 1 6   ? 22.233  -26.266 70.806  1.00 102.30 ? 1   MET B SD  1 
ATOM   2954 C CE  . MET B 1 6   ? 21.577  -27.587 71.835  1.00 105.55 ? 1   MET B CE  1 
ATOM   2955 N N   . THR B 1 7   ? 22.250  -20.536 71.835  1.00 91.98  ? 2   THR B N   1 
ATOM   2956 C CA  . THR B 1 7   ? 22.931  -19.334 71.395  1.00 88.82  ? 2   THR B CA  1 
ATOM   2957 C C   . THR B 1 7   ? 24.187  -19.739 70.620  1.00 85.97  ? 2   THR B C   1 
ATOM   2958 O O   . THR B 1 7   ? 25.014  -20.527 71.118  1.00 87.05  ? 2   THR B O   1 
ATOM   2959 C CB  . THR B 1 7   ? 23.316  -18.417 72.590  1.00 90.68  ? 2   THR B CB  1 
ATOM   2960 O OG1 . THR B 1 7   ? 22.221  -18.342 73.512  1.00 93.23  ? 2   THR B OG1 1 
ATOM   2961 C CG2 . THR B 1 7   ? 23.675  -16.998 72.100  1.00 88.87  ? 2   THR B CG2 1 
ATOM   2962 N N   . VAL B 1 8   ? 24.309  -19.220 69.401  1.00 81.67  ? 3   VAL B N   1 
ATOM   2963 C CA  . VAL B 1 8   ? 25.550  -19.335 68.645  1.00 78.65  ? 3   VAL B CA  1 
ATOM   2964 C C   . VAL B 1 8   ? 26.666  -18.654 69.425  1.00 78.24  ? 3   VAL B C   1 
ATOM   2965 O O   . VAL B 1 8   ? 26.481  -17.551 69.946  1.00 78.50  ? 3   VAL B O   1 
ATOM   2966 C CB  . VAL B 1 8   ? 25.451  -18.739 67.201  1.00 75.65  ? 3   VAL B CB  1 
ATOM   2967 C CG1 . VAL B 1 8   ? 24.541  -19.584 66.350  1.00 75.26  ? 3   VAL B CG1 1 
ATOM   2968 C CG2 . VAL B 1 8   ? 24.979  -17.282 67.212  1.00 74.83  ? 3   VAL B CG2 1 
ATOM   2969 N N   . LYS B 1 9   ? 27.804  -19.332 69.535  1.00 77.43  ? 4   LYS B N   1 
ATOM   2970 C CA  . LYS B 1 9   ? 28.970  -18.767 70.186  1.00 77.00  ? 4   LYS B CA  1 
ATOM   2971 C C   . LYS B 1 9   ? 30.177  -18.920 69.300  1.00 74.58  ? 4   LYS B C   1 
ATOM   2972 O O   . LYS B 1 9   ? 30.829  -19.966 69.274  1.00 74.94  ? 4   LYS B O   1 
ATOM   2973 C CB  . LYS B 1 9   ? 29.206  -19.398 71.551  1.00 79.97  ? 4   LYS B CB  1 
ATOM   2974 C CG  . LYS B 1 9   ? 28.714  -18.522 72.685  1.00 82.78  ? 4   LYS B CG  1 
ATOM   2975 C CD  . LYS B 1 9   ? 29.801  -17.559 73.173  1.00 83.21  ? 4   LYS B CD  1 
ATOM   2976 C CE  . LYS B 1 9   ? 30.657  -18.184 74.258  1.00 83.77  ? 4   LYS B CE  1 
ATOM   2977 N NZ  . LYS B 1 9   ? 29.797  -18.818 75.285  1.00 86.57  ? 4   LYS B NZ  1 
ATOM   2978 N N   . LEU B 1 10  ? 30.468  -17.843 68.582  1.00 71.97  ? 5   LEU B N   1 
ATOM   2979 C CA  . LEU B 1 10  ? 31.422  -17.869 67.490  1.00 69.14  ? 5   LEU B CA  1 
ATOM   2980 C C   . LEU B 1 10  ? 32.485  -16.775 67.604  1.00 68.36  ? 5   LEU B C   1 
ATOM   2981 O O   . LEU B 1 10  ? 32.983  -16.270 66.594  1.00 66.45  ? 5   LEU B O   1 
ATOM   2982 C CB  . LEU B 1 10  ? 30.664  -17.778 66.170  1.00 67.03  ? 5   LEU B CB  1 
ATOM   2983 C CG  . LEU B 1 10  ? 30.627  -18.993 65.240  1.00 66.35  ? 5   LEU B CG  1 
ATOM   2984 C CD1 . LEU B 1 10  ? 30.813  -20.319 65.954  1.00 68.36  ? 5   LEU B CD1 1 
ATOM   2985 C CD2 . LEU B 1 10  ? 29.368  -19.001 64.400  1.00 63.55  ? 5   LEU B CD2 1 
ATOM   2986 N N   . ASP B 1 11  ? 32.831  -16.428 68.844  1.00 69.14  ? 6   ASP B N   1 
ATOM   2987 C CA  . ASP B 1 11  ? 33.890  -15.462 69.116  1.00 68.69  ? 6   ASP B CA  1 
ATOM   2988 C C   . ASP B 1 11  ? 35.249  -16.163 69.168  1.00 68.47  ? 6   ASP B C   1 
ATOM   2989 O O   . ASP B 1 11  ? 35.317  -17.366 69.428  1.00 69.15  ? 6   ASP B O   1 
ATOM   2990 C CB  . ASP B 1 11  ? 33.609  -14.715 70.423  1.00 70.76  ? 6   ASP B CB  1 
ATOM   2991 C CG  . ASP B 1 11  ? 33.363  -15.648 71.597  1.00 73.30  ? 6   ASP B CG  1 
ATOM   2992 O OD1 . ASP B 1 11  ? 34.260  -16.455 71.910  1.00 74.55  ? 6   ASP B OD1 1 
ATOM   2993 O OD2 . ASP B 1 11  ? 32.281  -15.562 72.226  1.00 74.60  ? 6   ASP B OD2 1 
ATOM   2994 N N   . PHE B 1 12  ? 36.327  -15.421 68.928  1.00 67.16  ? 7   PHE B N   1 
ATOM   2995 C CA  . PHE B 1 12  ? 37.663  -16.017 68.861  1.00 66.84  ? 7   PHE B CA  1 
ATOM   2996 C C   . PHE B 1 12  ? 38.003  -16.872 70.102  1.00 68.46  ? 7   PHE B C   1 
ATOM   2997 O O   . PHE B 1 12  ? 38.741  -17.838 69.996  1.00 68.84  ? 7   PHE B O   1 
ATOM   2998 C CB  . PHE B 1 12  ? 38.735  -14.944 68.628  1.00 66.40  ? 7   PHE B CB  1 
ATOM   2999 C CG  . PHE B 1 12  ? 39.085  -14.161 69.867  1.00 67.95  ? 7   PHE B CG  1 
ATOM   3000 C CD1 . PHE B 1 12  ? 40.177  -14.526 70.648  1.00 68.57  ? 7   PHE B CD1 1 
ATOM   3001 C CD2 . PHE B 1 12  ? 38.305  -13.075 70.263  1.00 67.81  ? 7   PHE B CD2 1 
ATOM   3002 C CE1 . PHE B 1 12  ? 40.492  -13.823 71.806  1.00 71.63  ? 7   PHE B CE1 1 
ATOM   3003 C CE2 . PHE B 1 12  ? 38.617  -12.361 71.413  1.00 70.77  ? 7   PHE B CE2 1 
ATOM   3004 C CZ  . PHE B 1 12  ? 39.713  -12.736 72.189  1.00 71.89  ? 7   PHE B CZ  1 
ATOM   3005 N N   . GLU B 1 13  ? 37.470  -16.521 71.269  1.00 69.72  ? 8   GLU B N   1 
ATOM   3006 C CA  . GLU B 1 13  ? 37.737  -17.303 72.485  1.00 71.98  ? 8   GLU B CA  1 
ATOM   3007 C C   . GLU B 1 13  ? 37.356  -18.769 72.235  1.00 71.52  ? 8   GLU B C   1 
ATOM   3008 O O   . GLU B 1 13  ? 38.216  -19.658 72.251  1.00 71.59  ? 8   GLU B O   1 
ATOM   3009 C CB  . GLU B 1 13  ? 36.982  -16.699 73.684  1.00 74.03  ? 8   GLU B CB  1 
ATOM   3010 C CG  . GLU B 1 13  ? 36.774  -17.589 74.924  1.00 77.61  ? 8   GLU B CG  1 
ATOM   3011 C CD  . GLU B 1 13  ? 35.511  -17.184 75.718  1.00 80.31  ? 8   GLU B CD  1 
ATOM   3012 O OE1 . GLU B 1 13  ? 35.227  -17.795 76.769  1.00 81.06  ? 8   GLU B OE1 1 
ATOM   3013 O OE2 . GLU B 1 13  ? 34.792  -16.250 75.281  1.00 80.43  ? 8   GLU B OE2 1 
ATOM   3014 N N   . GLU B 1 14  ? 36.072  -18.985 71.949  1.00 70.69  ? 9   GLU B N   1 
ATOM   3015 C CA  . GLU B 1 14  ? 35.498  -20.311 71.724  1.00 70.30  ? 9   GLU B CA  1 
ATOM   3016 C C   . GLU B 1 14  ? 36.101  -21.017 70.498  1.00 67.66  ? 9   GLU B C   1 
ATOM   3017 O O   . GLU B 1 14  ? 36.221  -22.244 70.497  1.00 68.77  ? 9   GLU B O   1 
ATOM   3018 C CB  . GLU B 1 14  ? 33.974  -20.216 71.623  1.00 70.30  ? 9   GLU B CB  1 
ATOM   3019 C CG  . GLU B 1 14  ? 33.224  -21.448 72.128  1.00 74.14  ? 9   GLU B CG  1 
ATOM   3020 C CD  . GLU B 1 14  ? 33.127  -21.557 73.657  1.00 78.19  ? 9   GLU B CD  1 
ATOM   3021 O OE1 . GLU B 1 14  ? 32.926  -20.528 74.333  1.00 80.79  ? 9   GLU B OE1 1 
ATOM   3022 O OE2 . GLU B 1 14  ? 33.216  -22.687 74.188  1.00 80.40  ? 9   GLU B OE2 1 
ATOM   3023 N N   . CYS B 1 15  ? 36.508  -20.243 69.488  1.00 64.23  ? 10  CYS B N   1 
ATOM   3024 C CA  . CYS B 1 15  ? 37.197  -20.769 68.300  1.00 62.05  ? 10  CYS B CA  1 
ATOM   3025 C C   . CYS B 1 15  ? 38.511  -21.450 68.657  1.00 60.83  ? 10  CYS B C   1 
ATOM   3026 O O   . CYS B 1 15  ? 38.770  -22.566 68.236  1.00 60.37  ? 10  CYS B O   1 
ATOM   3027 C CB  . CYS B 1 15  ? 37.479  -19.658 67.267  1.00 60.17  ? 10  CYS B CB  1 
ATOM   3028 S SG  . CYS B 1 15  ? 36.025  -19.032 66.330  1.00 65.38  ? 10  CYS B SG  1 
ATOM   3029 N N   . LEU B 1 16  ? 39.334  -20.753 69.427  1.00 59.91  ? 11  LEU B N   1 
ATOM   3030 C CA  . LEU B 1 16  ? 40.652  -21.220 69.792  1.00 60.03  ? 11  LEU B CA  1 
ATOM   3031 C C   . LEU B 1 16  ? 40.593  -22.405 70.769  1.00 61.30  ? 11  LEU B C   1 
ATOM   3032 O O   . LEU B 1 16  ? 41.480  -23.270 70.781  1.00 61.78  ? 11  LEU B O   1 
ATOM   3033 C CB  . LEU B 1 16  ? 41.454  -20.067 70.408  1.00 60.59  ? 11  LEU B CB  1 
ATOM   3034 C CG  . LEU B 1 16  ? 41.816  -18.806 69.611  1.00 59.21  ? 11  LEU B CG  1 
ATOM   3035 C CD1 . LEU B 1 16  ? 43.153  -18.321 70.090  1.00 61.27  ? 11  LEU B CD1 1 
ATOM   3036 C CD2 . LEU B 1 16  ? 41.894  -19.051 68.130  1.00 57.90  ? 11  LEU B CD2 1 
ATOM   3037 N N   . LYS B 1 17  ? 39.543  -22.421 71.587  1.00 60.90  ? 12  LYS B N   1 
ATOM   3038 C CA  . LYS B 1 17  ? 39.282  -23.478 72.550  1.00 61.91  ? 12  LYS B CA  1 
ATOM   3039 C C   . LYS B 1 17  ? 38.869  -24.763 71.831  1.00 61.11  ? 12  LYS B C   1 
ATOM   3040 O O   . LYS B 1 17  ? 39.142  -25.849 72.315  1.00 62.28  ? 12  LYS B O   1 
ATOM   3041 C CB  . LYS B 1 17  ? 38.140  -23.025 73.445  1.00 63.40  ? 12  LYS B CB  1 
ATOM   3042 C CG  . LYS B 1 17  ? 38.284  -23.279 74.902  1.00 65.84  ? 12  LYS B CG  1 
ATOM   3043 C CD  . LYS B 1 17  ? 37.792  -22.059 75.686  1.00 66.99  ? 12  LYS B CD  1 
ATOM   3044 C CE  . LYS B 1 17  ? 36.272  -21.880 75.682  1.00 65.73  ? 12  LYS B CE  1 
ATOM   3045 N NZ  . LYS B 1 17  ? 35.707  -22.352 76.968  1.00 71.39  ? 12  LYS B NZ  1 
ATOM   3046 N N   . ASP B 1 18  ? 38.183  -24.616 70.691  1.00 58.26  ? 13  ASP B N   1 
ATOM   3047 C CA  . ASP B 1 18  ? 37.689  -25.744 69.869  1.00 57.70  ? 13  ASP B CA  1 
ATOM   3048 C C   . ASP B 1 18  ? 36.696  -26.648 70.627  1.00 59.28  ? 13  ASP B C   1 
ATOM   3049 O O   . ASP B 1 18  ? 36.841  -27.873 70.654  1.00 60.09  ? 13  ASP B O   1 
ATOM   3050 C CB  . ASP B 1 18  ? 38.859  -26.572 69.314  1.00 58.27  ? 13  ASP B CB  1 
ATOM   3051 C CG  . ASP B 1 18  ? 38.432  -27.543 68.208  1.00 58.92  ? 13  ASP B CG  1 
ATOM   3052 O OD1 . ASP B 1 18  ? 37.447  -27.269 67.505  1.00 56.26  ? 13  ASP B OD1 1 
ATOM   3053 O OD2 . ASP B 1 18  ? 39.094  -28.587 68.040  1.00 62.69  ? 13  ASP B OD2 1 
ATOM   3054 N N   . SER B 1 19  ? 35.696  -26.023 71.240  1.00 58.25  ? 14  SER B N   1 
ATOM   3055 C CA  . SER B 1 19  ? 34.792  -26.712 72.137  1.00 60.32  ? 14  SER B CA  1 
ATOM   3056 C C   . SER B 1 19  ? 33.634  -27.346 71.355  1.00 59.75  ? 14  SER B C   1 
ATOM   3057 O O   . SER B 1 19  ? 33.370  -26.947 70.230  1.00 56.09  ? 14  SER B O   1 
ATOM   3058 C CB  . SER B 1 19  ? 34.255  -25.730 73.187  1.00 60.85  ? 14  SER B CB  1 
ATOM   3059 O OG  . SER B 1 19  ? 33.770  -24.559 72.550  1.00 59.57  ? 14  SER B OG  1 
ATOM   3060 N N   . PRO B 1 20  ? 32.949  -28.345 71.960  1.00 62.47  ? 15  PRO B N   1 
ATOM   3061 C CA  . PRO B 1 20  ? 31.724  -28.887 71.406  1.00 63.13  ? 15  PRO B CA  1 
ATOM   3062 C C   . PRO B 1 20  ? 30.718  -27.771 71.125  1.00 62.08  ? 15  PRO B C   1 
ATOM   3063 O O   . PRO B 1 20  ? 29.966  -27.856 70.153  1.00 60.41  ? 15  PRO B O   1 
ATOM   3064 C CB  . PRO B 1 20  ? 31.198  -29.777 72.525  1.00 66.54  ? 15  PRO B CB  1 
ATOM   3065 C CG  . PRO B 1 20  ? 32.421  -30.211 73.247  1.00 68.05  ? 15  PRO B CG  1 
ATOM   3066 C CD  . PRO B 1 20  ? 33.315  -29.018 73.217  1.00 65.39  ? 15  PRO B CD  1 
ATOM   3067 N N   . ARG B 1 21  ? 30.716  -26.740 71.972  1.00 62.72  ? 16  ARG B N   1 
ATOM   3068 C CA  . ARG B 1 21  ? 29.832  -25.581 71.799  1.00 62.18  ? 16  ARG B CA  1 
ATOM   3069 C C   . ARG B 1 21  ? 30.134  -24.814 70.523  1.00 58.38  ? 16  ARG B C   1 
ATOM   3070 O O   . ARG B 1 21  ? 29.220  -24.362 69.842  1.00 57.50  ? 16  ARG B O   1 
ATOM   3071 C CB  . ARG B 1 21  ? 29.901  -24.654 73.028  1.00 64.04  ? 16  ARG B CB  1 
ATOM   3072 C CG  . ARG B 1 21  ? 29.593  -23.166 72.758  1.00 64.56  ? 16  ARG B CG  1 
ATOM   3073 C CD  . ARG B 1 21  ? 28.129  -22.788 72.931  1.00 69.91  ? 16  ARG B CD  1 
ATOM   3074 N NE  . ARG B 1 21  ? 27.908  -22.088 74.195  1.00 75.73  ? 16  ARG B NE  1 
ATOM   3075 C CZ  . ARG B 1 21  ? 27.007  -21.122 74.389  1.00 77.72  ? 16  ARG B CZ  1 
ATOM   3076 N NH1 . ARG B 1 21  ? 26.902  -20.565 75.588  1.00 80.78  ? 16  ARG B NH1 1 
ATOM   3077 N NH2 . ARG B 1 21  ? 26.214  -20.704 73.403  1.00 75.73  ? 16  ARG B NH2 1 
ATOM   3078 N N   . PHE B 1 22  ? 31.413  -24.645 70.210  1.00 57.11  ? 17  PHE B N   1 
ATOM   3079 C CA  . PHE B 1 22  ? 31.808  -24.011 68.962  1.00 54.16  ? 17  PHE B CA  1 
ATOM   3080 C C   . PHE B 1 22  ? 31.330  -24.846 67.786  1.00 53.22  ? 17  PHE B C   1 
ATOM   3081 O O   . PHE B 1 22  ? 30.813  -24.307 66.818  1.00 51.71  ? 17  PHE B O   1 
ATOM   3082 C CB  . PHE B 1 22  ? 33.331  -23.822 68.891  1.00 53.77  ? 17  PHE B CB  1 
ATOM   3083 C CG  . PHE B 1 22  ? 33.838  -23.461 67.510  1.00 52.82  ? 17  PHE B CG  1 
ATOM   3084 C CD1 . PHE B 1 22  ? 33.691  -22.179 67.016  1.00 51.53  ? 17  PHE B CD1 1 
ATOM   3085 C CD2 . PHE B 1 22  ? 34.476  -24.410 66.718  1.00 54.11  ? 17  PHE B CD2 1 
ATOM   3086 C CE1 . PHE B 1 22  ? 34.163  -21.855 65.753  1.00 51.45  ? 17  PHE B CE1 1 
ATOM   3087 C CE2 . PHE B 1 22  ? 34.959  -24.090 65.468  1.00 51.39  ? 17  PHE B CE2 1 
ATOM   3088 C CZ  . PHE B 1 22  ? 34.802  -22.816 64.984  1.00 50.96  ? 17  PHE B CZ  1 
ATOM   3089 N N   . ARG B 1 23  ? 31.518  -26.156 67.887  1.00 55.27  ? 18  ARG B N   1 
ATOM   3090 C CA  . ARG B 1 23  ? 31.073  -27.122 66.895  1.00 55.87  ? 18  ARG B CA  1 
ATOM   3091 C C   . ARG B 1 23  ? 29.559  -27.058 66.697  1.00 55.82  ? 18  ARG B C   1 
ATOM   3092 O O   . ARG B 1 23  ? 29.089  -26.934 65.562  1.00 54.24  ? 18  ARG B O   1 
ATOM   3093 C CB  . ARG B 1 23  ? 31.534  -28.542 67.282  1.00 58.82  ? 18  ARG B CB  1 
ATOM   3094 C CG  . ARG B 1 23  ? 31.672  -29.523 66.101  1.00 60.98  ? 18  ARG B CG  1 
ATOM   3095 C CD  . ARG B 1 23  ? 32.509  -28.945 64.944  1.00 61.50  ? 18  ARG B CD  1 
ATOM   3096 N NE  . ARG B 1 23  ? 33.939  -28.825 65.256  1.00 62.68  ? 18  ARG B NE  1 
ATOM   3097 C CZ  . ARG B 1 23  ? 34.889  -29.580 64.712  1.00 62.82  ? 18  ARG B CZ  1 
ATOM   3098 N NH1 . ARG B 1 23  ? 34.571  -30.506 63.825  1.00 62.29  ? 18  ARG B NH1 1 
ATOM   3099 N NH2 . ARG B 1 23  ? 36.158  -29.415 65.058  1.00 64.29  ? 18  ARG B NH2 1 
ATOM   3100 N N   . ALA B 1 24  ? 28.806  -27.117 67.791  1.00 57.37  ? 19  ALA B N   1 
ATOM   3101 C CA  . ALA B 1 24  ? 27.344  -26.993 67.739  1.00 58.22  ? 19  ALA B CA  1 
ATOM   3102 C C   . ALA B 1 24  ? 26.908  -25.651 67.196  1.00 55.97  ? 19  ALA B C   1 
ATOM   3103 O O   . ALA B 1 24  ? 25.870  -25.548 66.523  1.00 55.05  ? 19  ALA B O   1 
ATOM   3104 C CB  . ALA B 1 24  ? 26.724  -27.224 69.099  1.00 60.55  ? 19  ALA B CB  1 
ATOM   3105 N N   . SER B 1 25  ? 27.698  -24.619 67.476  1.00 55.54  ? 20  SER B N   1 
ATOM   3106 C CA  . SER B 1 25  ? 27.419  -23.287 66.924  1.00 53.85  ? 20  SER B CA  1 
ATOM   3107 C C   . SER B 1 25  ? 27.574  -23.252 65.399  1.00 52.42  ? 20  SER B C   1 
ATOM   3108 O O   . SER B 1 25  ? 26.750  -22.658 64.700  1.00 51.79  ? 20  SER B O   1 
ATOM   3109 C CB  . SER B 1 25  ? 28.285  -22.224 67.601  1.00 53.20  ? 20  SER B CB  1 
ATOM   3110 O OG  . SER B 1 25  ? 27.905  -22.043 68.953  1.00 54.77  ? 20  SER B OG  1 
ATOM   3111 N N   . ILE B 1 26  ? 28.628  -23.887 64.890  1.00 53.04  ? 21  ILE B N   1 
ATOM   3112 C CA  . ILE B 1 26  ? 28.857  -24.001 63.458  1.00 52.18  ? 21  ILE B CA  1 
ATOM   3113 C C   . ILE B 1 26  ? 27.727  -24.791 62.813  1.00 53.44  ? 21  ILE B C   1 
ATOM   3114 O O   . ILE B 1 26  ? 27.213  -24.394 61.769  1.00 52.73  ? 21  ILE B O   1 
ATOM   3115 C CB  . ILE B 1 26  ? 30.250  -24.631 63.115  1.00 51.99  ? 21  ILE B CB  1 
ATOM   3116 C CG1 . ILE B 1 26  ? 31.402  -23.676 63.453  1.00 52.09  ? 21  ILE B CG1 1 
ATOM   3117 C CG2 . ILE B 1 26  ? 30.353  -24.978 61.654  1.00 49.87  ? 21  ILE B CG2 1 
ATOM   3118 C CD1 . ILE B 1 26  ? 31.289  -22.291 62.790  1.00 49.90  ? 21  ILE B CD1 1 
ATOM   3119 N N   . GLU B 1 27  ? 27.319  -25.894 63.425  1.00 56.66  ? 22  GLU B N   1 
ATOM   3120 C CA  . GLU B 1 27  ? 26.215  -26.675 62.856  1.00 59.00  ? 22  GLU B CA  1 
ATOM   3121 C C   . GLU B 1 27  ? 24.900  -25.877 62.758  1.00 57.90  ? 22  GLU B C   1 
ATOM   3122 O O   . GLU B 1 27  ? 24.172  -25.999 61.774  1.00 56.79  ? 22  GLU B O   1 
ATOM   3123 C CB  . GLU B 1 27  ? 26.026  -28.003 63.601  1.00 62.00  ? 22  GLU B CB  1 
ATOM   3124 C CG  . GLU B 1 27  ? 27.131  -29.021 63.272  1.00 66.80  ? 22  GLU B CG  1 
ATOM   3125 C CD  . GLU B 1 27  ? 27.502  -29.949 64.444  1.00 73.50  ? 22  GLU B CD  1 
ATOM   3126 O OE1 . GLU B 1 27  ? 28.581  -30.587 64.384  1.00 76.23  ? 22  GLU B OE1 1 
ATOM   3127 O OE2 . GLU B 1 27  ? 26.728  -30.054 65.426  1.00 77.10  ? 22  GLU B OE2 1 
ATOM   3128 N N   . LEU B 1 28  ? 24.625  -25.061 63.777  1.00 58.58  ? 23  LEU B N   1 
ATOM   3129 C CA  . LEU B 1 28  ? 23.423  -24.224 63.839  1.00 58.35  ? 23  LEU B CA  1 
ATOM   3130 C C   . LEU B 1 28  ? 23.443  -23.169 62.743  1.00 55.79  ? 23  LEU B C   1 
ATOM   3131 O O   . LEU B 1 28  ? 22.450  -22.969 62.050  1.00 55.63  ? 23  LEU B O   1 
ATOM   3132 C CB  . LEU B 1 28  ? 23.301  -23.531 65.200  1.00 59.26  ? 23  LEU B CB  1 
ATOM   3133 C CG  . LEU B 1 28  ? 21.888  -23.359 65.754  1.00 62.72  ? 23  LEU B CG  1 
ATOM   3134 C CD1 . LEU B 1 28  ? 21.514  -24.571 66.608  1.00 66.27  ? 23  LEU B CD1 1 
ATOM   3135 C CD2 . LEU B 1 28  ? 21.733  -22.067 66.572  1.00 64.03  ? 23  LEU B CD2 1 
ATOM   3136 N N   . VAL B 1 29  ? 24.577  -22.493 62.584  1.00 54.02  ? 24  VAL B N   1 
ATOM   3137 C CA  . VAL B 1 29  ? 24.701  -21.491 61.554  1.00 51.30  ? 24  VAL B CA  1 
ATOM   3138 C C   . VAL B 1 29  ? 24.511  -22.145 60.175  1.00 50.73  ? 24  VAL B C   1 
ATOM   3139 O O   . VAL B 1 29  ? 23.851  -21.591 59.291  1.00 48.50  ? 24  VAL B O   1 
ATOM   3140 C CB  . VAL B 1 29  ? 26.024  -20.695 61.682  1.00 50.41  ? 24  VAL B CB  1 
ATOM   3141 C CG1 . VAL B 1 29  ? 26.283  -19.861 60.444  1.00 46.81  ? 24  VAL B CG1 1 
ATOM   3142 C CG2 . VAL B 1 29  ? 25.958  -19.806 62.909  1.00 50.12  ? 24  VAL B CG2 1 
ATOM   3143 N N   . GLU B 1 30  ? 25.028  -23.356 60.030  1.00 51.36  ? 25  GLU B N   1 
ATOM   3144 C CA  . GLU B 1 30  ? 24.918  -24.039 58.758  1.00 50.61  ? 25  GLU B CA  1 
ATOM   3145 C C   . GLU B 1 30  ? 23.486  -24.422 58.463  1.00 51.78  ? 25  GLU B C   1 
ATOM   3146 O O   . GLU B 1 30  ? 23.058  -24.356 57.308  1.00 50.25  ? 25  GLU B O   1 
ATOM   3147 C CB  . GLU B 1 30  ? 25.859  -25.223 58.687  1.00 51.92  ? 25  GLU B CB  1 
ATOM   3148 C CG  . GLU B 1 30  ? 27.241  -24.789 58.343  1.00 47.79  ? 25  GLU B CG  1 
ATOM   3149 C CD  . GLU B 1 30  ? 28.212  -25.926 58.289  1.00 48.79  ? 25  GLU B CD  1 
ATOM   3150 O OE1 . GLU B 1 30  ? 29.406  -25.658 58.041  1.00 45.17  ? 25  GLU B OE1 1 
ATOM   3151 O OE2 . GLU B 1 30  ? 27.801  -27.094 58.502  1.00 52.19  ? 25  GLU B OE2 1 
ATOM   3152 N N   . ALA B 1 31  ? 22.755  -24.800 59.512  1.00 53.99  ? 26  ALA B N   1 
ATOM   3153 C CA  . ALA B 1 31  ? 21.315  -24.991 59.413  1.00 55.55  ? 26  ALA B CA  1 
ATOM   3154 C C   . ALA B 1 31  ? 20.593  -23.693 59.013  1.00 54.27  ? 26  ALA B C   1 
ATOM   3155 O O   . ALA B 1 31  ? 19.748  -23.734 58.130  1.00 54.23  ? 26  ALA B O   1 
ATOM   3156 C CB  . ALA B 1 31  ? 20.730  -25.547 60.690  1.00 56.77  ? 26  ALA B CB  1 
ATOM   3157 N N   . GLU B 1 32  ? 20.903  -22.559 59.642  1.00 54.19  ? 27  GLU B N   1 
ATOM   3158 C CA  . GLU B 1 32  ? 20.116  -21.351 59.352  1.00 53.91  ? 27  GLU B CA  1 
ATOM   3159 C C   . GLU B 1 32  ? 20.454  -20.644 58.029  1.00 51.69  ? 27  GLU B C   1 
ATOM   3160 O O   . GLU B 1 32  ? 19.644  -19.869 57.527  1.00 51.00  ? 27  GLU B O   1 
ATOM   3161 C CB  . GLU B 1 32  ? 19.995  -20.390 60.562  1.00 54.69  ? 27  GLU B CB  1 
ATOM   3162 C CG  . GLU B 1 32  ? 21.193  -19.514 60.917  1.00 57.45  ? 27  GLU B CG  1 
ATOM   3163 C CD  . GLU B 1 32  ? 21.257  -19.184 62.439  1.00 62.88  ? 27  GLU B CD  1 
ATOM   3164 O OE1 . GLU B 1 32  ? 21.904  -18.177 62.828  1.00 65.17  ? 27  GLU B OE1 1 
ATOM   3165 O OE2 . GLU B 1 32  ? 20.670  -19.926 63.254  1.00 65.73  ? 27  GLU B OE2 1 
ATOM   3166 N N   . VAL B 1 33  ? 21.631  -20.925 57.468  1.00 51.14  ? 28  VAL B N   1 
ATOM   3167 C CA  . VAL B 1 33  ? 22.015  -20.426 56.152  1.00 49.08  ? 28  VAL B CA  1 
ATOM   3168 C C   . VAL B 1 33  ? 21.344  -21.272 55.075  1.00 50.83  ? 28  VAL B C   1 
ATOM   3169 O O   . VAL B 1 33  ? 20.917  -20.758 54.045  1.00 49.23  ? 28  VAL B O   1 
ATOM   3170 C CB  . VAL B 1 33  ? 23.558  -20.461 55.938  1.00 48.40  ? 28  VAL B CB  1 
ATOM   3171 C CG1 . VAL B 1 33  ? 23.922  -20.139 54.492  1.00 44.44  ? 28  VAL B CG1 1 
ATOM   3172 C CG2 . VAL B 1 33  ? 24.243  -19.525 56.878  1.00 45.63  ? 28  VAL B CG2 1 
ATOM   3173 N N   . SER B 1 34  ? 21.257  -22.577 55.318  1.00 53.96  ? 29  SER B N   1 
ATOM   3174 C CA  . SER B 1 34  ? 20.608  -23.473 54.378  1.00 55.92  ? 29  SER B CA  1 
ATOM   3175 C C   . SER B 1 34  ? 19.131  -23.129 54.185  1.00 56.33  ? 29  SER B C   1 
ATOM   3176 O O   . SER B 1 34  ? 18.637  -23.123 53.050  1.00 56.54  ? 29  SER B O   1 
ATOM   3177 C CB  . SER B 1 34  ? 20.777  -24.918 54.802  1.00 58.36  ? 29  SER B CB  1 
ATOM   3178 O OG  . SER B 1 34  ? 20.735  -25.730 53.652  1.00 60.87  ? 29  SER B OG  1 
ATOM   3179 N N   . GLU B 1 35  ? 18.431  -22.830 55.274  1.00 56.98  ? 30  GLU B N   1 
ATOM   3180 C CA  . GLU B 1 35  ? 17.087  -22.299 55.155  1.00 57.29  ? 30  GLU B CA  1 
ATOM   3181 C C   . GLU B 1 35  ? 17.064  -20.896 54.550  1.00 54.85  ? 30  GLU B C   1 
ATOM   3182 O O   . GLU B 1 35  ? 16.079  -20.511 53.926  1.00 53.62  ? 30  GLU B O   1 
ATOM   3183 C CB  . GLU B 1 35  ? 16.353  -22.313 56.494  1.00 59.05  ? 30  GLU B CB  1 
ATOM   3184 C CG  . GLU B 1 35  ? 15.491  -23.560 56.697  1.00 64.17  ? 30  GLU B CG  1 
ATOM   3185 C CD  . GLU B 1 35  ? 14.529  -23.828 55.531  1.00 65.52  ? 30  GLU B CD  1 
ATOM   3186 O OE1 . GLU B 1 35  ? 14.780  -24.808 54.776  1.00 66.58  ? 30  GLU B OE1 1 
ATOM   3187 O OE2 . GLU B 1 35  ? 13.544  -23.057 55.374  1.00 62.71  ? 30  GLU B OE2 1 
ATOM   3188 N N   . LEU B 1 36  ? 18.140  -20.131 54.729  1.00 53.94  ? 31  LEU B N   1 
ATOM   3189 C CA  . LEU B 1 36  ? 18.192  -18.780 54.143  1.00 51.99  ? 31  LEU B CA  1 
ATOM   3190 C C   . LEU B 1 36  ? 18.203  -18.915 52.638  1.00 51.22  ? 31  LEU B C   1 
ATOM   3191 O O   . LEU B 1 36  ? 17.522  -18.160 51.965  1.00 50.77  ? 31  LEU B O   1 
ATOM   3192 C CB  . LEU B 1 36  ? 19.435  -18.006 54.577  1.00 50.92  ? 31  LEU B CB  1 
ATOM   3193 C CG  . LEU B 1 36  ? 19.512  -16.477 54.727  1.00 49.07  ? 31  LEU B CG  1 
ATOM   3194 C CD1 . LEU B 1 36  ? 20.922  -15.981 54.327  1.00 45.11  ? 31  LEU B CD1 1 
ATOM   3195 C CD2 . LEU B 1 36  ? 18.468  -15.714 53.969  1.00 43.44  ? 31  LEU B CD2 1 
ATOM   3196 N N   . GLU B 1 37  ? 18.970  -19.881 52.127  1.00 52.01  ? 32  GLU B N   1 
ATOM   3197 C CA  . GLU B 1 37  ? 19.104  -20.099 50.697  1.00 51.59  ? 32  GLU B CA  1 
ATOM   3198 C C   . GLU B 1 37  ? 17.788  -20.585 50.107  1.00 51.72  ? 32  GLU B C   1 
ATOM   3199 O O   . GLU B 1 37  ? 17.351  -20.080 49.074  1.00 50.03  ? 32  GLU B O   1 
ATOM   3200 C CB  . GLU B 1 37  ? 20.201  -21.104 50.391  1.00 52.49  ? 32  GLU B CB  1 
ATOM   3201 C CG  . GLU B 1 37  ? 21.583  -20.502 50.175  1.00 53.79  ? 32  GLU B CG  1 
ATOM   3202 C CD  . GLU B 1 37  ? 22.719  -21.513 50.466  1.00 59.87  ? 32  GLU B CD  1 
ATOM   3203 O OE1 . GLU B 1 37  ? 23.912  -21.137 50.321  1.00 61.36  ? 32  GLU B OE1 1 
ATOM   3204 O OE2 . GLU B 1 37  ? 22.427  -22.683 50.842  1.00 61.38  ? 32  GLU B OE2 1 
ATOM   3205 N N   . THR B 1 38  ? 17.170  -21.565 50.766  1.00 52.66  ? 33  THR B N   1 
ATOM   3206 C CA  . THR B 1 38  ? 15.875  -22.082 50.334  1.00 53.61  ? 33  THR B CA  1 
ATOM   3207 C C   . THR B 1 38  ? 14.794  -20.980 50.319  1.00 52.36  ? 33  THR B C   1 
ATOM   3208 O O   . THR B 1 38  ? 13.977  -20.924 49.392  1.00 52.01  ? 33  THR B O   1 
ATOM   3209 C CB  . THR B 1 38  ? 15.439  -23.324 51.174  1.00 55.96  ? 33  THR B CB  1 
ATOM   3210 O OG1 . THR B 1 38  ? 16.352  -24.401 50.923  1.00 58.27  ? 33  THR B OG1 1 
ATOM   3211 C CG2 . THR B 1 38  ? 14.045  -23.811 50.783  1.00 56.41  ? 33  THR B CG2 1 
ATOM   3212 N N   . ARG B 1 39  ? 14.824  -20.089 51.308  1.00 51.57  ? 34  ARG B N   1 
ATOM   3213 C CA  . ARG B 1 39  ? 13.782  -19.080 51.452  1.00 51.11  ? 34  ARG B CA  1 
ATOM   3214 C C   . ARG B 1 39  ? 14.003  -17.832 50.606  1.00 49.42  ? 34  ARG B C   1 
ATOM   3215 O O   . ARG B 1 39  ? 13.056  -17.106 50.314  1.00 48.56  ? 34  ARG B O   1 
ATOM   3216 C CB  . ARG B 1 39  ? 13.603  -18.698 52.903  1.00 51.98  ? 34  ARG B CB  1 
ATOM   3217 C CG  . ARG B 1 39  ? 12.917  -19.772 53.749  1.00 55.27  ? 34  ARG B CG  1 
ATOM   3218 C CD  . ARG B 1 39  ? 13.032  -19.354 55.190  1.00 58.93  ? 34  ARG B CD  1 
ATOM   3219 N NE  . ARG B 1 39  ? 12.664  -20.395 56.134  1.00 64.74  ? 34  ARG B NE  1 
ATOM   3220 C CZ  . ARG B 1 39  ? 11.599  -20.323 56.916  1.00 67.19  ? 34  ARG B CZ  1 
ATOM   3221 N NH1 . ARG B 1 39  ? 10.805  -19.259 56.842  1.00 67.22  ? 34  ARG B NH1 1 
ATOM   3222 N NH2 . ARG B 1 39  ? 11.326  -21.307 57.761  1.00 69.40  ? 34  ARG B NH2 1 
ATOM   3223 N N   . LEU B 1 40  ? 15.247  -17.591 50.208  1.00 48.39  ? 35  LEU B N   1 
ATOM   3224 C CA  . LEU B 1 40  ? 15.532  -16.583 49.208  1.00 46.68  ? 35  LEU B CA  1 
ATOM   3225 C C   . LEU B 1 40  ? 15.169  -17.028 47.792  1.00 46.58  ? 35  LEU B C   1 
ATOM   3226 O O   . LEU B 1 40  ? 14.666  -16.219 46.995  1.00 45.57  ? 35  LEU B O   1 
ATOM   3227 C CB  . LEU B 1 40  ? 16.997  -16.169 49.241  1.00 46.00  ? 35  LEU B CB  1 
ATOM   3228 C CG  . LEU B 1 40  ? 17.504  -15.317 50.407  1.00 46.68  ? 35  LEU B CG  1 
ATOM   3229 C CD1 . LEU B 1 40  ? 18.836  -14.746 50.009  1.00 47.22  ? 35  LEU B CD1 1 
ATOM   3230 C CD2 . LEU B 1 40  ? 16.554  -14.205 50.785  1.00 46.32  ? 35  LEU B CD2 1 
ATOM   3231 N N   . GLU B 1 41  ? 15.443  -18.291 47.475  1.00 47.66  ? 36  GLU B N   1 
ATOM   3232 C CA  . GLU B 1 41  ? 15.171  -18.820 46.137  1.00 48.26  ? 36  GLU B CA  1 
ATOM   3233 C C   . GLU B 1 41  ? 13.668  -18.906 45.882  1.00 47.37  ? 36  GLU B C   1 
ATOM   3234 O O   . GLU B 1 41  ? 13.223  -18.678 44.766  1.00 46.91  ? 36  GLU B O   1 
ATOM   3235 C CB  . GLU B 1 41  ? 15.840  -20.180 45.898  1.00 49.96  ? 36  GLU B CB  1 
ATOM   3236 C CG  . GLU B 1 41  ? 17.373  -20.193 46.074  1.00 54.15  ? 36  GLU B CG  1 
ATOM   3237 C CD  . GLU B 1 41  ? 18.168  -19.916 44.786  1.00 58.98  ? 36  GLU B CD  1 
ATOM   3238 O OE1 . GLU B 1 41  ? 17.922  -18.880 44.114  1.00 59.82  ? 36  GLU B OE1 1 
ATOM   3239 O OE2 . GLU B 1 41  ? 19.073  -20.724 44.464  1.00 61.34  ? 36  GLU B OE2 1 
ATOM   3240 N N   . LYS B 1 42  ? 12.900  -19.251 46.912  1.00 46.81  ? 37  LYS B N   1 
ATOM   3241 C CA  . LYS B 1 42  ? 11.456  -19.362 46.802  1.00 46.62  ? 37  LYS B CA  1 
ATOM   3242 C C   . LYS B 1 42  ? 10.833  -17.960 46.590  1.00 44.49  ? 37  LYS B C   1 
ATOM   3243 O O   . LYS B 1 42  ? 9.881   -17.808 45.809  1.00 43.07  ? 37  LYS B O   1 
ATOM   3244 C CB  . LYS B 1 42  ? 10.878  -20.094 48.029  1.00 47.87  ? 37  LYS B CB  1 
ATOM   3245 C CG  . LYS B 1 42  ? 9.402   -19.828 48.400  1.00 50.09  ? 37  LYS B CG  1 
ATOM   3246 C CD  . LYS B 1 42  ? 8.388   -20.527 47.477  1.00 55.23  ? 37  LYS B CD  1 
ATOM   3247 C CE  . LYS B 1 42  ? 6.950   -20.393 47.999  1.00 55.94  ? 37  LYS B CE  1 
ATOM   3248 N NZ  . LYS B 1 42  ? 6.707   -21.295 49.175  1.00 61.21  ? 37  LYS B NZ  1 
ATOM   3249 N N   . LEU B 1 43  ? 11.398  -16.961 47.278  1.00 42.56  ? 38  LEU B N   1 
ATOM   3250 C CA  . LEU B 1 43  ? 10.979  -15.572 47.144  1.00 40.96  ? 38  LEU B CA  1 
ATOM   3251 C C   . LEU B 1 43  ? 11.324  -15.030 45.752  1.00 39.71  ? 38  LEU B C   1 
ATOM   3252 O O   . LEU B 1 43  ? 10.605  -14.205 45.244  1.00 38.80  ? 38  LEU B O   1 
ATOM   3253 C CB  . LEU B 1 43  ? 11.622  -14.705 48.222  1.00 39.77  ? 38  LEU B CB  1 
ATOM   3254 C CG  . LEU B 1 43  ? 11.045  -13.335 48.668  1.00 40.88  ? 38  LEU B CG  1 
ATOM   3255 C CD1 . LEU B 1 43  ? 11.887  -12.181 48.247  1.00 37.50  ? 38  LEU B CD1 1 
ATOM   3256 C CD2 . LEU B 1 43  ? 9.559   -13.043 48.359  1.00 38.02  ? 38  LEU B CD2 1 
ATOM   3257 N N   . LEU B 1 44  ? 12.412  -15.519 45.146  1.00 39.71  ? 39  LEU B N   1 
ATOM   3258 C CA  . LEU B 1 44  ? 12.750  -15.148 43.789  1.00 39.20  ? 39  LEU B CA  1 
ATOM   3259 C C   . LEU B 1 44  ? 11.706  -15.750 42.845  1.00 39.57  ? 39  LEU B C   1 
ATOM   3260 O O   . LEU B 1 44  ? 11.204  -15.071 41.947  1.00 38.83  ? 39  LEU B O   1 
ATOM   3261 C CB  . LEU B 1 44  ? 14.154  -15.635 43.415  1.00 39.65  ? 39  LEU B CB  1 
ATOM   3262 C CG  . LEU B 1 44  ? 15.389  -14.909 43.974  1.00 39.78  ? 39  LEU B CG  1 
ATOM   3263 C CD1 . LEU B 1 44  ? 16.662  -15.773 43.781  1.00 39.30  ? 39  LEU B CD1 1 
ATOM   3264 C CD2 . LEU B 1 44  ? 15.550  -13.589 43.327  1.00 35.86  ? 39  LEU B CD2 1 
ATOM   3265 N N   . LYS B 1 45  ? 11.379  -17.017 43.073  1.00 40.35  ? 40  LYS B N   1 
ATOM   3266 C CA  . LYS B 1 45  ? 10.320  -17.724 42.361  1.00 41.10  ? 40  LYS B CA  1 
ATOM   3267 C C   . LYS B 1 45  ? 8.937   -16.975 42.427  1.00 40.11  ? 40  LYS B C   1 
ATOM   3268 O O   . LYS B 1 45  ? 8.274   -16.735 41.375  1.00 39.69  ? 40  LYS B O   1 
ATOM   3269 C CB  . LYS B 1 45  ? 10.263  -19.162 42.893  1.00 43.32  ? 40  LYS B CB  1 
ATOM   3270 C CG  . LYS B 1 45  ? 9.670   -20.150 41.939  1.00 49.04  ? 40  LYS B CG  1 
ATOM   3271 C CD  . LYS B 1 45  ? 9.199   -21.422 42.639  1.00 55.24  ? 40  LYS B CD  1 
ATOM   3272 C CE  . LYS B 1 45  ? 7.822   -21.819 42.124  1.00 58.44  ? 40  LYS B CE  1 
ATOM   3273 N NZ  . LYS B 1 45  ? 7.204   -22.849 43.012  1.00 62.22  ? 40  LYS B NZ  1 
ATOM   3274 N N   . LEU B 1 46  ? 8.528   -16.583 43.638  1.00 37.92  ? 41  LEU B N   1 
ATOM   3275 C CA  . LEU B 1 46  ? 7.343   -15.771 43.850  1.00 37.03  ? 41  LEU B CA  1 
ATOM   3276 C C   . LEU B 1 46  ? 7.470   -14.359 43.225  1.00 35.25  ? 41  LEU B C   1 
ATOM   3277 O O   . LEU B 1 46  ? 6.466   -13.707 42.923  1.00 33.65  ? 41  LEU B O   1 
ATOM   3278 C CB  . LEU B 1 46  ? 7.115   -15.601 45.349  1.00 37.23  ? 41  LEU B CB  1 
ATOM   3279 C CG  . LEU B 1 46  ? 6.075   -16.306 46.237  1.00 39.85  ? 41  LEU B CG  1 
ATOM   3280 C CD1 . LEU B 1 46  ? 5.380   -17.531 45.641  1.00 40.09  ? 41  LEU B CD1 1 
ATOM   3281 C CD2 . LEU B 1 46  ? 6.743   -16.653 47.570  1.00 39.78  ? 41  LEU B CD2 1 
ATOM   3282 N N   . GLY B 1 47  ? 8.702   -13.894 43.065  1.00 33.99  ? 42  GLY B N   1 
ATOM   3283 C CA  . GLY B 1 47  ? 8.963   -12.601 42.473  1.00 34.09  ? 42  GLY B CA  1 
ATOM   3284 C C   . GLY B 1 47  ? 8.751   -12.684 40.968  1.00 34.36  ? 42  GLY B C   1 
ATOM   3285 O O   . GLY B 1 47  ? 8.227   -11.760 40.364  1.00 33.16  ? 42  GLY B O   1 
ATOM   3286 N N   . THR B 1 48  ? 9.155   -13.807 40.378  1.00 35.59  ? 43  THR B N   1 
ATOM   3287 C CA  . THR B 1 48  ? 8.849   -14.093 38.981  1.00 36.76  ? 43  THR B CA  1 
ATOM   3288 C C   . THR B 1 48  ? 7.315   -14.175 38.782  1.00 36.36  ? 43  THR B C   1 
ATOM   3289 O O   . THR B 1 48  ? 6.778   -13.501 37.907  1.00 35.57  ? 43  THR B O   1 
ATOM   3290 C CB  . THR B 1 48  ? 9.561   -15.372 38.503  1.00 38.75  ? 43  THR B CB  1 
ATOM   3291 O OG1 . THR B 1 48  ? 10.981  -15.196 38.629  1.00 39.93  ? 43  THR B OG1 1 
ATOM   3292 C CG2 . THR B 1 48  ? 9.218   -15.654 37.061  1.00 40.04  ? 43  THR B CG2 1 
ATOM   3293 N N   . GLY B 1 49  ? 6.625   -14.988 39.600  1.00 36.48  ? 44  GLY B N   1 
ATOM   3294 C CA  . GLY B 1 49  ? 5.164   -15.027 39.627  1.00 35.64  ? 44  GLY B CA  1 
ATOM   3295 C C   . GLY B 1 49  ? 4.511   -13.638 39.630  1.00 34.28  ? 44  GLY B C   1 
ATOM   3296 O O   . GLY B 1 49  ? 3.618   -13.380 38.832  1.00 33.59  ? 44  GLY B O   1 
ATOM   3297 N N   . LEU B 1 50  ? 4.967   -12.742 40.514  1.00 32.27  ? 45  LEU B N   1 
ATOM   3298 C CA  . LEU B 1 50  ? 4.369   -11.426 40.679  1.00 31.05  ? 45  LEU B CA  1 
ATOM   3299 C C   . LEU B 1 50  ? 4.563   -10.583 39.395  1.00 31.26  ? 45  LEU B C   1 
ATOM   3300 O O   . LEU B 1 50  ? 3.634   -9.877  38.948  1.00 29.45  ? 45  LEU B O   1 
ATOM   3301 C CB  . LEU B 1 50  ? 4.948   -10.704 41.915  1.00 30.43  ? 45  LEU B CB  1 
ATOM   3302 C CG  . LEU B 1 50  ? 4.480   -9.264  42.245  1.00 29.72  ? 45  LEU B CG  1 
ATOM   3303 C CD1 . LEU B 1 50  ? 4.621   -8.893  43.736  1.00 30.49  ? 45  LEU B CD1 1 
ATOM   3304 C CD2 . LEU B 1 50  ? 5.221   -8.245  41.390  1.00 32.04  ? 45  LEU B CD2 1 
ATOM   3305 N N   . LEU B 1 51  ? 5.777   -10.669 38.823  1.00 31.17  ? 46  LEU B N   1 
ATOM   3306 C CA  . LEU B 1 51  ? 6.163   -9.843  37.720  1.00 31.06  ? 46  LEU B CA  1 
ATOM   3307 C C   . LEU B 1 51  ? 5.472   -10.336 36.480  1.00 30.97  ? 46  LEU B C   1 
ATOM   3308 O O   . LEU B 1 51  ? 4.963   -9.522  35.728  1.00 30.94  ? 46  LEU B O   1 
ATOM   3309 C CB  . LEU B 1 51  ? 7.685   -9.886  37.489  1.00 32.12  ? 46  LEU B CB  1 
ATOM   3310 C CG  . LEU B 1 51  ? 8.733   -8.999  38.156  1.00 32.94  ? 46  LEU B CG  1 
ATOM   3311 C CD1 . LEU B 1 51  ? 8.334   -8.506  39.452  1.00 34.81  ? 46  LEU B CD1 1 
ATOM   3312 C CD2 . LEU B 1 51  ? 10.099  -9.750  38.278  1.00 35.45  ? 46  LEU B CD2 1 
ATOM   3313 N N   . GLU B 1 52  ? 5.484   -11.649 36.232  1.00 30.80  ? 47  GLU B N   1 
ATOM   3314 C CA  . GLU B 1 52  ? 4.839   -12.186 35.023  1.00 31.92  ? 47  GLU B CA  1 
ATOM   3315 C C   . GLU B 1 52  ? 3.320   -11.923 35.059  1.00 31.36  ? 47  GLU B C   1 
ATOM   3316 O O   . GLU B 1 52  ? 2.700   -11.633 34.026  1.00 31.00  ? 47  GLU B O   1 
ATOM   3317 C CB  . GLU B 1 52  ? 5.107   -13.693 34.817  1.00 33.22  ? 47  GLU B CB  1 
ATOM   3318 C CG  . GLU B 1 52  ? 6.521   -14.004 34.236  1.00 39.91  ? 47  GLU B CG  1 
ATOM   3319 C CD  . GLU B 1 52  ? 6.897   -15.520 34.264  1.00 47.76  ? 47  GLU B CD  1 
ATOM   3320 O OE1 . GLU B 1 52  ? 6.115   -16.334 34.842  1.00 50.15  ? 47  GLU B OE1 1 
ATOM   3321 O OE2 . GLU B 1 52  ? 7.976   -15.888 33.714  1.00 48.82  ? 47  GLU B OE2 1 
ATOM   3322 N N   . SER B 1 53  ? 2.713   -12.031 36.229  1.00 29.27  ? 48  SER B N   1 
ATOM   3323 C CA  . SER B 1 53  ? 1.280   -11.793 36.261  1.00 30.54  ? 48  SER B CA  1 
ATOM   3324 C C   . SER B 1 53  ? 0.975   -10.301 36.268  1.00 28.57  ? 48  SER B C   1 
ATOM   3325 O O   . SER B 1 53  ? -0.036  -9.901  35.741  1.00 30.56  ? 48  SER B O   1 
ATOM   3326 C CB  . SER B 1 53  ? 0.596   -12.518 37.402  1.00 29.42  ? 48  SER B CB  1 
ATOM   3327 O OG  . SER B 1 53  ? 1.009   -11.953 38.614  1.00 33.14  ? 48  SER B OG  1 
ATOM   3328 N N   . GLY B 1 54  ? 1.850   -9.486  36.828  1.00 27.80  ? 49  GLY B N   1 
ATOM   3329 C CA  . GLY B 1 54  ? 1.724   -8.029  36.753  1.00 26.91  ? 49  GLY B CA  1 
ATOM   3330 C C   . GLY B 1 54  ? 1.705   -7.518  35.315  1.00 27.71  ? 49  GLY B C   1 
ATOM   3331 O O   . GLY B 1 54  ? 0.837   -6.744  34.962  1.00 27.68  ? 49  GLY B O   1 
ATOM   3332 N N   . ARG B 1 55  ? 2.674   -7.940  34.503  1.00 28.89  ? 50  ARG B N   1 
ATOM   3333 C CA  . ARG B 1 55  ? 2.796   -7.527  33.110  1.00 30.02  ? 50  ARG B CA  1 
ATOM   3334 C C   . ARG B 1 55  ? 1.578   -7.981  32.289  1.00 30.34  ? 50  ARG B C   1 
ATOM   3335 O O   . ARG B 1 55  ? 1.130   -7.269  31.396  1.00 29.15  ? 50  ARG B O   1 
ATOM   3336 C CB  . ARG B 1 55  ? 4.074   -8.098  32.438  1.00 30.91  ? 50  ARG B CB  1 
ATOM   3337 C CG  . ARG B 1 55  ? 5.393   -7.858  33.159  1.00 33.60  ? 50  ARG B CG  1 
ATOM   3338 C CD  . ARG B 1 55  ? 5.958   -6.431  32.977  1.00 33.82  ? 50  ARG B CD  1 
ATOM   3339 N NE  . ARG B 1 55  ? 7.158   -6.246  33.805  1.00 34.50  ? 50  ARG B NE  1 
ATOM   3340 C CZ  . ARG B 1 55  ? 7.650   -5.063  34.208  1.00 38.39  ? 50  ARG B CZ  1 
ATOM   3341 N NH1 . ARG B 1 55  ? 7.053   -3.909  33.859  1.00 30.67  ? 50  ARG B NH1 1 
ATOM   3342 N NH2 . ARG B 1 55  ? 8.771   -5.033  34.963  1.00 38.74  ? 50  ARG B NH2 1 
ATOM   3343 N N   . HIS B 1 56  ? 1.106   -9.203  32.534  1.00 31.20  ? 51  HIS B N   1 
ATOM   3344 C CA  . HIS B 1 56  ? -0.098  -9.669  31.872  1.00 32.51  ? 51  HIS B CA  1 
ATOM   3345 C C   . HIS B 1 56  ? -1.286  -8.769  32.237  1.00 31.71  ? 51  HIS B C   1 
ATOM   3346 O O   . HIS B 1 56  ? -2.079  -8.378  31.375  1.00 31.65  ? 51  HIS B O   1 
ATOM   3347 C CB  . HIS B 1 56  ? -0.384  -11.101 32.276  1.00 34.05  ? 51  HIS B CB  1 
ATOM   3348 C CG  . HIS B 1 56  ? -1.523  -11.694 31.541  1.00 38.76  ? 51  HIS B CG  1 
ATOM   3349 N ND1 . HIS B 1 56  ? -1.373  -12.323 30.325  1.00 45.38  ? 51  HIS B ND1 1 
ATOM   3350 C CD2 . HIS B 1 56  ? -2.845  -11.736 31.830  1.00 42.36  ? 51  HIS B CD2 1 
ATOM   3351 C CE1 . HIS B 1 56  ? -2.557  -12.731 29.897  1.00 47.07  ? 51  HIS B CE1 1 
ATOM   3352 N NE2 . HIS B 1 56  ? -3.466  -12.391 30.794  1.00 46.49  ? 51  HIS B NE2 1 
ATOM   3353 N N   . TYR B 1 57  ? -1.390  -8.438  33.520  1.00 30.20  ? 52  TYR B N   1 
ATOM   3354 C CA  . TYR B 1 57  ? -2.471  -7.622  34.001  1.00 30.59  ? 52  TYR B CA  1 
ATOM   3355 C C   . TYR B 1 57  ? -2.429  -6.270  33.295  1.00 30.00  ? 52  TYR B C   1 
ATOM   3356 O O   . TYR B 1 57  ? -3.440  -5.795  32.813  1.00 30.54  ? 52  TYR B O   1 
ATOM   3357 C CB  . TYR B 1 57  ? -2.338  -7.407  35.492  1.00 29.14  ? 52  TYR B CB  1 
ATOM   3358 C CG  . TYR B 1 57  ? -3.247  -6.341  36.069  1.00 29.94  ? 52  TYR B CG  1 
ATOM   3359 C CD1 . TYR B 1 57  ? -4.638  -6.356  35.828  1.00 30.72  ? 52  TYR B CD1 1 
ATOM   3360 C CD2 . TYR B 1 57  ? -2.729  -5.324  36.877  1.00 31.25  ? 52  TYR B CD2 1 
ATOM   3361 C CE1 . TYR B 1 57  ? -5.489  -5.378  36.383  1.00 30.06  ? 52  TYR B CE1 1 
ATOM   3362 C CE2 . TYR B 1 57  ? -3.567  -4.331  37.435  1.00 31.80  ? 52  TYR B CE2 1 
ATOM   3363 C CZ  . TYR B 1 57  ? -4.942  -4.394  37.201  1.00 31.49  ? 52  TYR B CZ  1 
ATOM   3364 O OH  . TYR B 1 57  ? -5.759  -3.477  37.767  1.00 31.62  ? 52  TYR B OH  1 
ATOM   3365 N N   . LEU B 1 58  ? -1.258  -5.647  33.257  1.00 29.90  ? 53  LEU B N   1 
ATOM   3366 C CA  . LEU B 1 58  ? -1.157  -4.322  32.695  1.00 28.42  ? 53  LEU B CA  1 
ATOM   3367 C C   . LEU B 1 58  ? -1.438  -4.395  31.191  1.00 28.50  ? 53  LEU B C   1 
ATOM   3368 O O   . LEU B 1 58  ? -1.956  -3.453  30.651  1.00 27.20  ? 53  LEU B O   1 
ATOM   3369 C CB  . LEU B 1 58  ? 0.201   -3.687  32.997  1.00 28.81  ? 53  LEU B CB  1 
ATOM   3370 C CG  . LEU B 1 58  ? 0.578   -3.399  34.471  1.00 28.28  ? 53  LEU B CG  1 
ATOM   3371 C CD1 . LEU B 1 58  ? 1.942   -2.723  34.554  1.00 26.24  ? 53  LEU B CD1 1 
ATOM   3372 C CD2 . LEU B 1 58  ? -0.462  -2.570  35.257  1.00 24.68  ? 53  LEU B CD2 1 
ATOM   3373 N N   . ALA B 1 59  ? -1.158  -5.533  30.534  1.00 28.12  ? 54  ALA B N   1 
ATOM   3374 C CA  . ALA B 1 59  ? -1.386  -5.630  29.088  1.00 29.08  ? 54  ALA B CA  1 
ATOM   3375 C C   . ALA B 1 59  ? -2.885  -5.658  28.837  1.00 29.28  ? 54  ALA B C   1 
ATOM   3376 O O   . ALA B 1 59  ? -3.404  -4.945  27.965  1.00 30.59  ? 54  ALA B O   1 
ATOM   3377 C CB  . ALA B 1 59  ? -0.675  -6.839  28.444  1.00 28.78  ? 54  ALA B CB  1 
ATOM   3378 N N   . ALA B 1 60  ? -3.581  -6.425  29.669  1.00 28.92  ? 55  ALA B N   1 
ATOM   3379 C CA  . ALA B 1 60  ? -5.031  -6.510  29.639  1.00 28.18  ? 55  ALA B CA  1 
ATOM   3380 C C   . ALA B 1 60  ? -5.691  -5.158  29.928  1.00 27.83  ? 55  ALA B C   1 
ATOM   3381 O O   . ALA B 1 60  ? -6.686  -4.849  29.317  1.00 27.99  ? 55  ALA B O   1 
ATOM   3382 C CB  . ALA B 1 60  ? -5.523  -7.582  30.645  1.00 28.33  ? 55  ALA B CB  1 
ATOM   3383 N N   . SER B 1 61  ? -5.160  -4.373  30.865  1.00 26.82  ? 56  SER B N   1 
ATOM   3384 C CA  . SER B 1 61  ? -5.741  -3.082  31.159  1.00 27.76  ? 56  SER B CA  1 
ATOM   3385 C C   . SER B 1 61  ? -5.578  -2.157  30.016  1.00 28.72  ? 56  SER B C   1 
ATOM   3386 O O   . SER B 1 61  ? -6.471  -1.360  29.763  1.00 30.34  ? 56  SER B O   1 
ATOM   3387 C CB  . SER B 1 61  ? -5.158  -2.428  32.426  1.00 26.84  ? 56  SER B CB  1 
ATOM   3388 O OG  . SER B 1 61  ? -5.235  -3.320  33.509  1.00 30.44  ? 56  SER B OG  1 
ATOM   3389 N N   . ARG B 1 62  ? -4.427  -2.266  29.347  1.00 29.02  ? 57  ARG B N   1 
ATOM   3390 C CA  . ARG B 1 62  ? -4.071  -1.468  28.209  1.00 30.42  ? 57  ARG B CA  1 
ATOM   3391 C C   . ARG B 1 62  ? -5.054  -1.774  27.075  1.00 29.73  ? 57  ARG B C   1 
ATOM   3392 O O   . ARG B 1 62  ? -5.601  -0.856  26.479  1.00 29.31  ? 57  ARG B O   1 
ATOM   3393 C CB  . ARG B 1 62  ? -2.631  -1.841  27.784  1.00 31.37  ? 57  ARG B CB  1 
ATOM   3394 C CG  . ARG B 1 62  ? -1.679  -0.679  27.483  1.00 38.94  ? 57  ARG B CG  1 
ATOM   3395 C CD  . ARG B 1 62  ? -0.211  -0.873  28.105  1.00 43.07  ? 57  ARG B CD  1 
ATOM   3396 N NE  . ARG B 1 62  ? 0.456   -2.172  27.817  1.00 47.67  ? 57  ARG B NE  1 
ATOM   3397 C CZ  . ARG B 1 62  ? 1.351   -2.792  28.614  1.00 42.25  ? 57  ARG B CZ  1 
ATOM   3398 N NH1 . ARG B 1 62  ? 1.728   -2.272  29.764  1.00 43.35  ? 57  ARG B NH1 1 
ATOM   3399 N NH2 . ARG B 1 62  ? 1.868   -3.951  28.258  1.00 42.43  ? 57  ARG B NH2 1 
ATOM   3400 N N   . ALA B 1 63  ? -5.266  -3.072  26.805  1.00 28.95  ? 58  ALA B N   1 
ATOM   3401 C CA  . ALA B 1 63  ? -6.208  -3.521  25.800  1.00 29.20  ? 58  ALA B CA  1 
ATOM   3402 C C   . ALA B 1 63  ? -7.653  -3.085  26.151  1.00 28.52  ? 58  ALA B C   1 
ATOM   3403 O O   . ALA B 1 63  ? -8.417  -2.773  25.258  1.00 29.69  ? 58  ALA B O   1 
ATOM   3404 C CB  . ALA B 1 63  ? -6.098  -5.064  25.566  1.00 27.95  ? 58  ALA B CB  1 
ATOM   3405 N N   . PHE B 1 64  ? -7.969  -2.972  27.440  1.00 28.28  ? 59  PHE B N   1 
ATOM   3406 C CA  . PHE B 1 64  ? -9.289  -2.476  27.930  1.00 28.06  ? 59  PHE B CA  1 
ATOM   3407 C C   . PHE B 1 64  ? -9.536  -0.991  27.619  1.00 29.37  ? 59  PHE B C   1 
ATOM   3408 O O   . PHE B 1 64  ? -10.611 -0.611  27.115  1.00 28.64  ? 59  PHE B O   1 
ATOM   3409 C CB  . PHE B 1 64  ? -9.387  -2.741  29.433  1.00 27.18  ? 59  PHE B CB  1 
ATOM   3410 C CG  . PHE B 1 64  ? -10.648 -2.244  30.103  1.00 27.61  ? 59  PHE B CG  1 
ATOM   3411 C CD1 . PHE B 1 64  ? -11.829 -2.955  30.013  1.00 25.57  ? 59  PHE B CD1 1 
ATOM   3412 C CD2 . PHE B 1 64  ? -10.607 -1.100  30.919  1.00 26.45  ? 59  PHE B CD2 1 
ATOM   3413 C CE1 . PHE B 1 64  ? -12.967 -2.516  30.658  1.00 29.36  ? 59  PHE B CE1 1 
ATOM   3414 C CE2 . PHE B 1 64  ? -11.723 -0.695  31.594  1.00 26.69  ? 59  PHE B CE2 1 
ATOM   3415 C CZ  . PHE B 1 64  ? -12.906 -1.380  31.472  1.00 26.89  ? 59  PHE B CZ  1 
ATOM   3416 N N   . VAL B 1 65  ? -8.547  -0.142  27.920  1.00 29.85  ? 60  VAL B N   1 
ATOM   3417 C CA  . VAL B 1 65  ? -8.678  1.264   27.565  1.00 30.59  ? 60  VAL B CA  1 
ATOM   3418 C C   . VAL B 1 65  ? -8.832  1.446   26.038  1.00 32.09  ? 60  VAL B C   1 
ATOM   3419 O O   . VAL B 1 65  ? -9.693  2.175   25.610  1.00 33.56  ? 60  VAL B O   1 
ATOM   3420 C CB  . VAL B 1 65  ? -7.542  2.128   28.155  1.00 30.65  ? 60  VAL B CB  1 
ATOM   3421 C CG1 . VAL B 1 65  ? -7.691  3.594   27.687  1.00 29.66  ? 60  VAL B CG1 1 
ATOM   3422 C CG2 . VAL B 1 65  ? -7.539  1.999   29.699  1.00 27.68  ? 60  VAL B CG2 1 
ATOM   3423 N N   . VAL B 1 66  ? -8.044  0.746   25.227  1.00 33.64  ? 61  VAL B N   1 
ATOM   3424 C CA  . VAL B 1 66  ? -8.251  0.760   23.760  1.00 34.35  ? 61  VAL B CA  1 
ATOM   3425 C C   . VAL B 1 66  ? -9.717  0.424   23.356  1.00 34.52  ? 61  VAL B C   1 
ATOM   3426 O O   . VAL B 1 66  ? -10.312 1.137   22.552  1.00 36.21  ? 61  VAL B O   1 
ATOM   3427 C CB  . VAL B 1 66  ? -7.181  -0.078  23.001  1.00 35.59  ? 61  VAL B CB  1 
ATOM   3428 C CG1 . VAL B 1 66  ? -7.592  -0.344  21.535  1.00 36.42  ? 61  VAL B CG1 1 
ATOM   3429 C CG2 . VAL B 1 66  ? -5.826  0.614   23.022  1.00 34.84  ? 61  VAL B CG2 1 
ATOM   3430 N N   . GLY B 1 67  ? -10.283 -0.634  23.934  1.00 34.22  ? 62  GLY B N   1 
ATOM   3431 C CA  . GLY B 1 67  ? -11.699 -1.030  23.744  1.00 33.19  ? 62  GLY B CA  1 
ATOM   3432 C C   . GLY B 1 67  ? -12.665 0.123   23.969  1.00 32.23  ? 62  GLY B C   1 
ATOM   3433 O O   . GLY B 1 67  ? -13.644 0.294   23.232  1.00 31.91  ? 62  GLY B O   1 
ATOM   3434 N N   . ILE B 1 68  ? -12.358 0.931   24.975  1.00 31.28  ? 63  ILE B N   1 
ATOM   3435 C CA  . ILE B 1 68  ? -13.144 2.095   25.319  1.00 30.57  ? 63  ILE B CA  1 
ATOM   3436 C C   . ILE B 1 68  ? -13.116 3.145   24.208  1.00 31.75  ? 63  ILE B C   1 
ATOM   3437 O O   . ILE B 1 68  ? -14.165 3.705   23.850  1.00 29.91  ? 63  ILE B O   1 
ATOM   3438 C CB  . ILE B 1 68  ? -12.663 2.736   26.625  1.00 30.55  ? 63  ILE B CB  1 
ATOM   3439 C CG1 . ILE B 1 68  ? -12.748 1.737   27.781  1.00 29.37  ? 63  ILE B CG1 1 
ATOM   3440 C CG2 . ILE B 1 68  ? -13.508 4.041   26.949  1.00 31.11  ? 63  ILE B CG2 1 
ATOM   3441 C CD1 . ILE B 1 68  ? -12.346 2.318   29.172  1.00 26.51  ? 63  ILE B CD1 1 
ATOM   3442 N N   . CYS B 1 69  ? -11.913 3.404   23.675  1.00 32.87  ? 64  CYS B N   1 
ATOM   3443 C CA  . CYS B 1 69  ? -11.761 4.342   22.585  1.00 36.17  ? 64  CYS B CA  1 
ATOM   3444 C C   . CYS B 1 69  ? -12.432 3.814   21.325  1.00 36.00  ? 64  CYS B C   1 
ATOM   3445 O O   . CYS B 1 69  ? -13.061 4.578   20.632  1.00 35.23  ? 64  CYS B O   1 
ATOM   3446 C CB  . CYS B 1 69  ? -10.276 4.674   22.316  1.00 37.58  ? 64  CYS B CB  1 
ATOM   3447 S SG  . CYS B 1 69  ? -9.569  5.505   23.756  1.00 47.56  ? 64  CYS B SG  1 
ATOM   3448 N N   . ASP B 1 70  ? -12.278 2.518   21.039  1.00 36.71  ? 65  ASP B N   1 
ATOM   3449 C CA  . ASP B 1 70  ? -12.985 1.877   19.912  1.00 39.05  ? 65  ASP B CA  1 
ATOM   3450 C C   . ASP B 1 70  ? -14.514 2.071   20.066  1.00 37.90  ? 65  ASP B C   1 
ATOM   3451 O O   . ASP B 1 70  ? -15.208 2.415   19.102  1.00 39.01  ? 65  ASP B O   1 
ATOM   3452 C CB  . ASP B 1 70  ? -12.646 0.371   19.747  1.00 38.62  ? 65  ASP B CB  1 
ATOM   3453 C CG  . ASP B 1 70  ? -11.167 0.099   19.359  1.00 45.86  ? 65  ASP B CG  1 
ATOM   3454 O OD1 . ASP B 1 70  ? -10.757 -1.096  19.512  1.00 48.11  ? 65  ASP B OD1 1 
ATOM   3455 O OD2 . ASP B 1 70  ? -10.400 1.028   18.903  1.00 46.86  ? 65  ASP B OD2 1 
ATOM   3456 N N   . LEU B 1 71  ? -15.023 1.878   21.277  1.00 36.41  ? 66  LEU B N   1 
ATOM   3457 C CA  . LEU B 1 71  ? -16.455 2.015   21.534  1.00 36.01  ? 66  LEU B CA  1 
ATOM   3458 C C   . LEU B 1 71  ? -16.884 3.435   21.228  1.00 37.71  ? 66  LEU B C   1 
ATOM   3459 O O   . LEU B 1 71  ? -17.756 3.661   20.367  1.00 38.92  ? 66  LEU B O   1 
ATOM   3460 C CB  . LEU B 1 71  ? -16.826 1.628   22.975  1.00 33.92  ? 66  LEU B CB  1 
ATOM   3461 C CG  . LEU B 1 71  ? -18.266 1.856   23.464  1.00 31.73  ? 66  LEU B CG  1 
ATOM   3462 C CD1 . LEU B 1 71  ? -19.286 1.082   22.604  1.00 31.01  ? 66  LEU B CD1 1 
ATOM   3463 C CD2 . LEU B 1 71  ? -18.450 1.464   24.949  1.00 27.92  ? 66  LEU B CD2 1 
ATOM   3464 N N   . ALA B 1 72  ? -16.252 4.399   21.889  1.00 37.68  ? 67  ALA B N   1 
ATOM   3465 C CA  . ALA B 1 72  ? -16.634 5.804   21.702  1.00 38.99  ? 67  ALA B CA  1 
ATOM   3466 C C   . ALA B 1 72  ? -16.398 6.312   20.271  1.00 40.97  ? 67  ALA B C   1 
ATOM   3467 O O   . ALA B 1 72  ? -16.974 7.308   19.869  1.00 41.57  ? 67  ALA B O   1 
ATOM   3468 C CB  . ALA B 1 72  ? -15.911 6.675   22.700  1.00 38.86  ? 67  ALA B CB  1 
ATOM   3469 N N   . ARG B 1 73  ? -15.571 5.619   19.499  1.00 41.73  ? 68  ARG B N   1 
ATOM   3470 C CA  . ARG B 1 73  ? -15.307 6.042   18.133  1.00 44.93  ? 68  ARG B CA  1 
ATOM   3471 C C   . ARG B 1 73  ? -16.579 6.010   17.254  1.00 46.58  ? 68  ARG B C   1 
ATOM   3472 O O   . ARG B 1 73  ? -16.646 6.673   16.218  1.00 47.55  ? 68  ARG B O   1 
ATOM   3473 C CB  . ARG B 1 73  ? -14.173 5.215   17.519  1.00 45.30  ? 68  ARG B CB  1 
ATOM   3474 C CG  . ARG B 1 73  ? -13.232 6.033   16.677  1.00 49.64  ? 68  ARG B CG  1 
ATOM   3475 C CD  . ARG B 1 73  ? -12.045 5.200   16.170  1.00 54.17  ? 68  ARG B CD  1 
ATOM   3476 N NE  . ARG B 1 73  ? -12.456 4.152   15.230  1.00 58.82  ? 68  ARG B NE  1 
ATOM   3477 C CZ  . ARG B 1 73  ? -12.397 2.842   15.467  1.00 60.63  ? 68  ARG B CZ  1 
ATOM   3478 N NH1 . ARG B 1 73  ? -11.928 2.392   16.625  1.00 60.67  ? 68  ARG B NH1 1 
ATOM   3479 N NH2 . ARG B 1 73  ? -12.802 1.973   14.539  1.00 61.41  ? 68  ARG B NH2 1 
ATOM   3480 N N   . LEU B 1 74  ? -17.593 5.260   17.690  1.00 47.21  ? 69  LEU B N   1 
ATOM   3481 C CA  . LEU B 1 74  ? -18.872 5.183   16.971  1.00 49.13  ? 69  LEU B CA  1 
ATOM   3482 C C   . LEU B 1 74  ? -19.698 6.466   17.010  1.00 49.99  ? 69  LEU B C   1 
ATOM   3483 O O   . LEU B 1 74  ? -19.727 7.176   18.013  1.00 49.83  ? 69  LEU B O   1 
ATOM   3484 C CB  . LEU B 1 74  ? -19.708 4.015   17.496  1.00 48.22  ? 69  LEU B CB  1 
ATOM   3485 C CG  . LEU B 1 74  ? -19.321 2.633   16.998  1.00 48.56  ? 69  LEU B CG  1 
ATOM   3486 C CD1 . LEU B 1 74  ? -20.202 1.648   17.714  1.00 48.76  ? 69  LEU B CD1 1 
ATOM   3487 C CD2 . LEU B 1 74  ? -19.486 2.503   15.487  1.00 49.40  ? 69  LEU B CD2 1 
ATOM   3488 N N   . GLY B 1 75  ? -20.376 6.755   15.910  1.00 52.61  ? 70  GLY B N   1 
ATOM   3489 C CA  . GLY B 1 75  ? -21.284 7.914   15.843  1.00 54.18  ? 70  GLY B CA  1 
ATOM   3490 C C   . GLY B 1 75  ? -20.531 9.124   15.329  1.00 56.41  ? 70  GLY B C   1 
ATOM   3491 O O   . GLY B 1 75  ? -19.404 8.982   14.832  1.00 57.36  ? 70  GLY B O   1 
ATOM   3492 N N   . PRO B 1 76  ? -21.133 10.326  15.444  1.00 57.36  ? 71  PRO B N   1 
ATOM   3493 C CA  . PRO B 1 76  ? -20.428 11.519  14.932  1.00 59.01  ? 71  PRO B CA  1 
ATOM   3494 C C   . PRO B 1 76  ? -19.397 12.027  15.954  1.00 59.02  ? 71  PRO B C   1 
ATOM   3495 O O   . PRO B 1 76  ? -19.384 11.565  17.108  1.00 57.88  ? 71  PRO B O   1 
ATOM   3496 C CB  . PRO B 1 76  ? -21.558 12.543  14.701  1.00 59.55  ? 71  PRO B CB  1 
ATOM   3497 C CG  . PRO B 1 76  ? -22.718 12.085  15.593  1.00 58.13  ? 71  PRO B CG  1 
ATOM   3498 C CD  . PRO B 1 76  ? -22.390 10.675  16.139  1.00 56.66  ? 71  PRO B CD  1 
ATOM   3499 N N   . PRO B 1 77  ? -18.495 12.929  15.532  1.00 60.65  ? 72  PRO B N   1 
ATOM   3500 C CA  . PRO B 1 77  ? -17.589 13.466  16.540  1.00 60.18  ? 72  PRO B CA  1 
ATOM   3501 C C   . PRO B 1 77  ? -18.376 14.380  17.461  1.00 59.33  ? 72  PRO B C   1 
ATOM   3502 O O   . PRO B 1 77  ? -19.165 15.214  16.992  1.00 60.89  ? 72  PRO B O   1 
ATOM   3503 C CB  . PRO B 1 77  ? -16.581 14.257  15.725  1.00 62.46  ? 72  PRO B CB  1 
ATOM   3504 C CG  . PRO B 1 77  ? -16.702 13.708  14.327  1.00 64.58  ? 72  PRO B CG  1 
ATOM   3505 C CD  . PRO B 1 77  ? -18.142 13.379  14.177  1.00 62.77  ? 72  PRO B CD  1 
ATOM   3506 N N   . GLU B 1 78  ? -18.191 14.172  18.756  1.00 56.53  ? 73  GLU B N   1 
ATOM   3507 C CA  . GLU B 1 78  ? -18.922 14.867  19.791  1.00 55.31  ? 73  GLU B CA  1 
ATOM   3508 C C   . GLU B 1 78  ? -17.849 15.463  20.693  1.00 53.84  ? 73  GLU B C   1 
ATOM   3509 O O   . GLU B 1 78  ? -17.145 14.728  21.372  1.00 52.67  ? 73  GLU B O   1 
ATOM   3510 C CB  . GLU B 1 78  ? -19.808 13.868  20.547  1.00 54.57  ? 73  GLU B CB  1 
ATOM   3511 C CG  . GLU B 1 78  ? -20.472 12.829  19.604  1.00 57.71  ? 73  GLU B CG  1 
ATOM   3512 C CD  . GLU B 1 78  ? -20.960 11.536  20.273  1.00 60.96  ? 73  GLU B CD  1 
ATOM   3513 O OE1 . GLU B 1 78  ? -21.486 10.658  19.538  1.00 62.10  ? 73  GLU B OE1 1 
ATOM   3514 O OE2 . GLU B 1 78  ? -20.823 11.383  21.513  1.00 62.71  ? 73  GLU B OE2 1 
ATOM   3515 N N   . PRO B 1 79  ? -17.708 16.802  20.692  1.00 53.86  ? 74  PRO B N   1 
ATOM   3516 C CA  . PRO B 1 79  ? -16.611 17.480  21.385  1.00 53.25  ? 74  PRO B CA  1 
ATOM   3517 C C   . PRO B 1 79  ? -16.487 17.154  22.880  1.00 50.35  ? 74  PRO B C   1 
ATOM   3518 O O   . PRO B 1 79  ? -15.375 17.062  23.400  1.00 49.43  ? 74  PRO B O   1 
ATOM   3519 C CB  . PRO B 1 79  ? -16.944 18.979  21.194  1.00 56.10  ? 74  PRO B CB  1 
ATOM   3520 C CG  . PRO B 1 79  ? -17.808 19.026  19.975  1.00 56.54  ? 74  PRO B CG  1 
ATOM   3521 C CD  . PRO B 1 79  ? -18.631 17.768  20.062  1.00 55.13  ? 74  PRO B CD  1 
ATOM   3522 N N   . MET B 1 80  ? -17.616 16.991  23.553  1.00 47.49  ? 75  MET B N   1 
ATOM   3523 C CA  . MET B 1 80  ? -17.633 16.741  24.974  1.00 46.09  ? 75  MET B CA  1 
ATOM   3524 C C   . MET B 1 80  ? -17.191 15.306  25.269  1.00 43.64  ? 75  MET B C   1 
ATOM   3525 O O   . MET B 1 80  ? -16.511 15.047  26.259  1.00 42.99  ? 75  MET B O   1 
ATOM   3526 C CB  . MET B 1 80  ? -19.040 16.994  25.542  1.00 46.35  ? 75  MET B CB  1 
ATOM   3527 C CG  . MET B 1 80  ? -19.205 16.508  26.962  1.00 47.03  ? 75  MET B CG  1 
ATOM   3528 S SD  . MET B 1 80  ? -20.794 16.867  27.709  1.00 53.84  ? 75  MET B SD  1 
ATOM   3529 C CE  . MET B 1 80  ? -21.807 15.699  26.807  1.00 51.25  ? 75  MET B CE  1 
ATOM   3530 N N   . MET B 1 81  ? -17.596 14.377  24.422  1.00 41.55  ? 76  MET B N   1 
ATOM   3531 C CA  . MET B 1 81  ? -17.213 12.980  24.590  1.00 40.73  ? 76  MET B CA  1 
ATOM   3532 C C   . MET B 1 81  ? -15.706 12.819  24.252  1.00 40.54  ? 76  MET B C   1 
ATOM   3533 O O   . MET B 1 81  ? -14.962 12.085  24.920  1.00 39.17  ? 76  MET B O   1 
ATOM   3534 C CB  . MET B 1 81  ? -18.123 12.122  23.698  1.00 40.23  ? 76  MET B CB  1 
ATOM   3535 C CG  . MET B 1 81  ? -17.622 10.770  23.316  1.00 44.17  ? 76  MET B CG  1 
ATOM   3536 S SD  . MET B 1 81  ? -17.599 9.703   24.737  1.00 52.63  ? 76  MET B SD  1 
ATOM   3537 C CE  . MET B 1 81  ? -19.311 9.134   24.745  1.00 48.93  ? 76  MET B CE  1 
ATOM   3538 N N   . ALA B 1 82  ? -15.266 13.555  23.245  1.00 40.74  ? 77  ALA B N   1 
ATOM   3539 C CA  . ALA B 1 82  ? -13.890 13.518  22.828  1.00 41.30  ? 77  ALA B CA  1 
ATOM   3540 C C   . ALA B 1 82  ? -12.945 14.154  23.868  1.00 41.66  ? 77  ALA B C   1 
ATOM   3541 O O   . ALA B 1 82  ? -11.864 13.636  24.077  1.00 40.08  ? 77  ALA B O   1 
ATOM   3542 C CB  . ALA B 1 82  ? -13.742 14.179  21.462  1.00 42.20  ? 77  ALA B CB  1 
ATOM   3543 N N   . GLU B 1 83  ? -13.341 15.288  24.473  1.00 42.83  ? 78  GLU B N   1 
ATOM   3544 C CA  . GLU B 1 83  ? -12.577 15.905  25.576  1.00 43.11  ? 78  GLU B CA  1 
ATOM   3545 C C   . GLU B 1 83  ? -12.542 14.970  26.793  1.00 41.65  ? 78  GLU B C   1 
ATOM   3546 O O   . GLU B 1 83  ? -11.541 14.922  27.517  1.00 42.04  ? 78  GLU B O   1 
ATOM   3547 C CB  . GLU B 1 83  ? -13.186 17.228  26.001  1.00 44.46  ? 78  GLU B CB  1 
ATOM   3548 C CG  . GLU B 1 83  ? -12.542 17.815  27.250  1.00 48.24  ? 78  GLU B CG  1 
ATOM   3549 C CD  . GLU B 1 83  ? -13.058 19.204  27.623  1.00 52.77  ? 78  GLU B CD  1 
ATOM   3550 O OE1 . GLU B 1 83  ? -14.285 19.430  27.610  1.00 54.08  ? 78  GLU B OE1 1 
ATOM   3551 O OE2 . GLU B 1 83  ? -12.228 20.067  27.960  1.00 57.22  ? 78  GLU B OE2 1 
ATOM   3552 N N   . CYS B 1 84  ? -13.629 14.230  27.003  1.00 39.14  ? 79  CYS B N   1 
ATOM   3553 C CA  . CYS B 1 84  ? -13.696 13.302  28.099  1.00 39.38  ? 79  CYS B CA  1 
ATOM   3554 C C   . CYS B 1 84  ? -12.715 12.115  27.919  1.00 38.53  ? 79  CYS B C   1 
ATOM   3555 O O   . CYS B 1 84  ? -12.007 11.754  28.871  1.00 37.73  ? 79  CYS B O   1 
ATOM   3556 C CB  . CYS B 1 84  ? -15.144 12.859  28.372  1.00 38.08  ? 79  CYS B CB  1 
ATOM   3557 S SG  . CYS B 1 84  ? -15.279 11.329  29.320  1.00 41.11  ? 79  CYS B SG  1 
ATOM   3558 N N   . LEU B 1 85  ? -12.674 11.524  26.722  1.00 38.58  ? 80  LEU B N   1 
ATOM   3559 C CA  . LEU B 1 85  ? -11.699 10.482  26.418  1.00 39.23  ? 80  LEU B CA  1 
ATOM   3560 C C   . LEU B 1 85  ? -10.304 11.059  26.370  1.00 40.31  ? 80  LEU B C   1 
ATOM   3561 O O   . LEU B 1 85  ? -9.336  10.452  26.836  1.00 39.85  ? 80  LEU B O   1 
ATOM   3562 C CB  . LEU B 1 85  ? -11.966 9.821   25.062  1.00 40.39  ? 80  LEU B CB  1 
ATOM   3563 C CG  . LEU B 1 85  ? -13.008 8.714   24.858  1.00 40.73  ? 80  LEU B CG  1 
ATOM   3564 C CD1 . LEU B 1 85  ? -13.067 7.767   26.033  1.00 41.10  ? 80  LEU B CD1 1 
ATOM   3565 C CD2 . LEU B 1 85  ? -14.353 9.306   24.629  1.00 44.97  ? 80  LEU B CD2 1 
ATOM   3566 N N   . GLU B 1 86  ? -10.182 12.234  25.791  1.00 40.78  ? 81  GLU B N   1 
ATOM   3567 C CA  . GLU B 1 86  ? -8.879  12.822  25.736  1.00 42.43  ? 81  GLU B CA  1 
ATOM   3568 C C   . GLU B 1 86  ? -8.235  12.910  27.142  1.00 42.19  ? 81  GLU B C   1 
ATOM   3569 O O   . GLU B 1 86  ? -7.062  12.562  27.311  1.00 43.33  ? 81  GLU B O   1 
ATOM   3570 C CB  . GLU B 1 86  ? -8.921  14.193  25.064  1.00 44.43  ? 81  GLU B CB  1 
ATOM   3571 C CG  . GLU B 1 86  ? -7.854  15.043  25.595  1.00 46.17  ? 81  GLU B CG  1 
ATOM   3572 C CD  . GLU B 1 86  ? -7.927  16.441  25.146  1.00 48.09  ? 81  GLU B CD  1 
ATOM   3573 O OE1 . GLU B 1 86  ? -6.842  16.934  24.766  1.00 48.99  ? 81  GLU B OE1 1 
ATOM   3574 O OE2 . GLU B 1 86  ? -9.044  17.039  25.154  1.00 49.46  ? 81  GLU B OE2 1 
ATOM   3575 N N   . LYS B 1 87  ? -8.990  13.366  28.143  1.00 41.34  ? 82  LYS B N   1 
ATOM   3576 C CA  . LYS B 1 87  ? -8.412  13.569  29.482  1.00 40.31  ? 82  LYS B CA  1 
ATOM   3577 C C   . LYS B 1 87  ? -8.303  12.267  30.275  1.00 37.19  ? 82  LYS B C   1 
ATOM   3578 O O   . LYS B 1 87  ? -7.289  12.011  30.926  1.00 35.77  ? 82  LYS B O   1 
ATOM   3579 C CB  . LYS B 1 87  ? -9.179  14.617  30.295  1.00 41.29  ? 82  LYS B CB  1 
ATOM   3580 C CG  . LYS B 1 87  ? -9.156  16.066  29.714  1.00 44.87  ? 82  LYS B CG  1 
ATOM   3581 C CD  . LYS B 1 87  ? -9.725  17.045  30.726  1.00 46.33  ? 82  LYS B CD  1 
ATOM   3582 C CE  . LYS B 1 87  ? -9.999  18.435  30.143  1.00 51.68  ? 82  LYS B CE  1 
ATOM   3583 N NZ  . LYS B 1 87  ? -8.822  19.360  30.244  1.00 53.82  ? 82  LYS B NZ  1 
ATOM   3584 N N   . PHE B 1 88  ? -9.344  11.455  30.221  1.00 34.42  ? 83  PHE B N   1 
ATOM   3585 C CA  . PHE B 1 88  ? -9.401  10.315  31.101  1.00 33.52  ? 83  PHE B CA  1 
ATOM   3586 C C   . PHE B 1 88  ? -8.617  9.171   30.570  1.00 33.07  ? 83  PHE B C   1 
ATOM   3587 O O   . PHE B 1 88  ? -8.042  8.411   31.322  1.00 33.89  ? 83  PHE B O   1 
ATOM   3588 C CB  . PHE B 1 88  ? -10.837 9.889   31.394  1.00 31.52  ? 83  PHE B CB  1 
ATOM   3589 C CG  . PHE B 1 88  ? -11.593 10.881  32.261  1.00 33.52  ? 83  PHE B CG  1 
ATOM   3590 C CD1 . PHE B 1 88  ? -12.985 10.869  32.305  1.00 35.42  ? 83  PHE B CD1 1 
ATOM   3591 C CD2 . PHE B 1 88  ? -10.893 11.855  33.009  1.00 34.74  ? 83  PHE B CD2 1 
ATOM   3592 C CE1 . PHE B 1 88  ? -13.697 11.787  33.108  1.00 38.78  ? 83  PHE B CE1 1 
ATOM   3593 C CE2 . PHE B 1 88  ? -11.552 12.774  33.797  1.00 37.88  ? 83  PHE B CE2 1 
ATOM   3594 C CZ  . PHE B 1 88  ? -12.983 12.749  33.861  1.00 40.00  ? 83  PHE B CZ  1 
ATOM   3595 N N   . THR B 1 89  ? -8.625  9.004   29.265  1.00 33.17  ? 84  THR B N   1 
ATOM   3596 C CA  . THR B 1 89  ? -7.964  7.859   28.725  1.00 33.29  ? 84  THR B CA  1 
ATOM   3597 C C   . THR B 1 89  ? -6.420  8.057   28.835  1.00 32.85  ? 84  THR B C   1 
ATOM   3598 O O   . THR B 1 89  ? -5.694  7.121   29.115  1.00 31.05  ? 84  THR B O   1 
ATOM   3599 C CB  . THR B 1 89  ? -8.451  7.598   27.285  1.00 33.60  ? 84  THR B CB  1 
ATOM   3600 O OG1 . THR B 1 89  ? -8.369  6.211   27.039  1.00 37.79  ? 84  THR B OG1 1 
ATOM   3601 C CG2 . THR B 1 89  ? -7.605  8.250   26.315  1.00 33.49  ? 84  THR B CG2 1 
ATOM   3602 N N   . VAL B 1 90  ? -5.935  9.288   28.705  1.00 33.81  ? 85  VAL B N   1 
ATOM   3603 C CA  . VAL B 1 90  ? -4.485  9.513   28.873  1.00 34.83  ? 85  VAL B CA  1 
ATOM   3604 C C   . VAL B 1 90  ? -4.163  9.269   30.353  1.00 35.13  ? 85  VAL B C   1 
ATOM   3605 O O   . VAL B 1 90  ? -3.124  8.652   30.715  1.00 33.25  ? 85  VAL B O   1 
ATOM   3606 C CB  . VAL B 1 90  ? -4.088  10.848  28.342  1.00 37.55  ? 85  VAL B CB  1 
ATOM   3607 C CG1 . VAL B 1 90  ? -2.581  11.194  28.644  1.00 38.44  ? 85  VAL B CG1 1 
ATOM   3608 C CG2 . VAL B 1 90  ? -4.357  10.854  26.815  1.00 38.14  ? 85  VAL B CG2 1 
ATOM   3609 N N   . SER B 1 91  ? -5.137  9.620   31.198  1.00 34.58  ? 86  SER B N   1 
ATOM   3610 C CA  . SER B 1 91  ? -4.988  9.432   32.628  1.00 35.27  ? 86  SER B CA  1 
ATOM   3611 C C   . SER B 1 91  ? -4.969  7.964   33.060  1.00 32.98  ? 86  SER B C   1 
ATOM   3612 O O   . SER B 1 91  ? -4.153  7.595   33.885  1.00 33.38  ? 86  SER B O   1 
ATOM   3613 C CB  . SER B 1 91  ? -6.075  10.196  33.392  1.00 36.58  ? 86  SER B CB  1 
ATOM   3614 O OG  . SER B 1 91  ? -5.948  9.933   34.783  1.00 38.20  ? 86  SER B OG  1 
ATOM   3615 N N   . LEU B 1 92  ? -5.872  7.140   32.537  1.00 31.49  ? 87  LEU B N   1 
ATOM   3616 C CA  . LEU B 1 92  ? -5.828  5.706   32.796  1.00 30.48  ? 87  LEU B CA  1 
ATOM   3617 C C   . LEU B 1 92  ? -4.535  5.069   32.287  1.00 30.19  ? 87  LEU B C   1 
ATOM   3618 O O   . LEU B 1 92  ? -3.969  4.267   32.997  1.00 30.41  ? 87  LEU B O   1 
ATOM   3619 C CB  . LEU B 1 92  ? -7.044  4.957   32.215  1.00 29.37  ? 87  LEU B CB  1 
ATOM   3620 C CG  . LEU B 1 92  ? -8.435  5.226   32.817  1.00 31.35  ? 87  LEU B CG  1 
ATOM   3621 C CD1 . LEU B 1 92  ? -9.515  4.759   31.800  1.00 29.11  ? 87  LEU B CD1 1 
ATOM   3622 C CD2 . LEU B 1 92  ? -8.653  4.600   34.184  1.00 27.63  ? 87  LEU B CD2 1 
ATOM   3623 N N   . ASN B 1 93  ? -4.095  5.403   31.073  1.00 30.57  ? 88  ASN B N   1 
ATOM   3624 C CA  . ASN B 1 93  ? -2.761  4.961   30.558  1.00 31.55  ? 88  ASN B CA  1 
ATOM   3625 C C   . ASN B 1 93  ? -1.541  5.355   31.405  1.00 31.78  ? 88  ASN B C   1 
ATOM   3626 O O   . ASN B 1 93  ? -0.633  4.574   31.570  1.00 32.39  ? 88  ASN B O   1 
ATOM   3627 C CB  . ASN B 1 93  ? -2.528  5.389   29.121  1.00 30.96  ? 88  ASN B CB  1 
ATOM   3628 C CG  . ASN B 1 93  ? -3.441  4.662   28.148  1.00 34.17  ? 88  ASN B CG  1 
ATOM   3629 O OD1 . ASN B 1 93  ? -3.813  5.213   27.100  1.00 37.42  ? 88  ASN B OD1 1 
ATOM   3630 N ND2 . ASN B 1 93  ? -3.863  3.454   28.509  1.00 27.31  ? 88  ASN B ND2 1 
ATOM   3631 N N   . HIS B 1 94  ? -1.547  6.562   31.935  1.00 32.85  ? 89  HIS B N   1 
ATOM   3632 C CA  . HIS B 1 94  ? -0.519  7.032   32.829  1.00 33.90  ? 89  HIS B CA  1 
ATOM   3633 C C   . HIS B 1 94  ? -0.381  6.179   34.119  1.00 33.06  ? 89  HIS B C   1 
ATOM   3634 O O   . HIS B 1 94  ? 0.736   5.880   34.537  1.00 33.59  ? 89  HIS B O   1 
ATOM   3635 C CB  . HIS B 1 94  ? -0.769  8.496   33.171  1.00 35.65  ? 89  HIS B CB  1 
ATOM   3636 C CG  . HIS B 1 94  ? 0.015   8.962   34.357  1.00 39.23  ? 89  HIS B CG  1 
ATOM   3637 N ND1 . HIS B 1 94  ? 1.316   9.415   34.258  1.00 41.27  ? 89  HIS B ND1 1 
ATOM   3638 C CD2 . HIS B 1 94  ? -0.294  8.982   35.675  1.00 38.85  ? 89  HIS B CD2 1 
ATOM   3639 C CE1 . HIS B 1 94  ? 1.761   9.726   35.463  1.00 41.20  ? 89  HIS B CE1 1 
ATOM   3640 N NE2 . HIS B 1 94  ? 0.805   9.469   36.340  1.00 39.71  ? 89  HIS B NE2 1 
ATOM   3641 N N   . LYS B 1 95  ? -1.504  5.763   34.711  1.00 31.45  ? 90  LYS B N   1 
ATOM   3642 C CA  . LYS B 1 95  ? -1.473  4.897   35.868  1.00 29.98  ? 90  LYS B CA  1 
ATOM   3643 C C   . LYS B 1 95  ? -0.866  3.525   35.514  1.00 29.35  ? 90  LYS B C   1 
ATOM   3644 O O   . LYS B 1 95  ? -0.187  2.926   36.340  1.00 28.93  ? 90  LYS B O   1 
ATOM   3645 C CB  . LYS B 1 95  ? -2.882  4.688   36.471  1.00 28.83  ? 90  LYS B CB  1 
ATOM   3646 C CG  . LYS B 1 95  ? -3.714  5.934   36.744  1.00 30.52  ? 90  LYS B CG  1 
ATOM   3647 C CD  . LYS B 1 95  ? -2.938  6.960   37.546  1.00 32.45  ? 90  LYS B CD  1 
ATOM   3648 C CE  . LYS B 1 95  ? -3.611  8.275   37.468  1.00 29.94  ? 90  LYS B CE  1 
ATOM   3649 N NZ  . LYS B 1 95  ? -3.361  8.993   36.214  1.00 32.09  ? 90  LYS B NZ  1 
ATOM   3650 N N   . LEU B 1 96  ? -1.176  3.022   34.314  1.00 28.44  ? 91  LEU B N   1 
ATOM   3651 C CA  . LEU B 1 96  ? -0.623  1.776   33.777  1.00 27.86  ? 91  LEU B CA  1 
ATOM   3652 C C   . LEU B 1 96  ? 0.875   1.900   33.498  1.00 28.75  ? 91  LEU B C   1 
ATOM   3653 O O   . LEU B 1 96  ? 1.622   0.999   33.836  1.00 29.35  ? 91  LEU B O   1 
ATOM   3654 C CB  . LEU B 1 96  ? -1.352  1.410   32.480  1.00 27.30  ? 91  LEU B CB  1 
ATOM   3655 C CG  . LEU B 1 96  ? -2.594  0.506   32.527  1.00 29.06  ? 91  LEU B CG  1 
ATOM   3656 C CD1 . LEU B 1 96  ? -3.255  0.304   33.870  1.00 23.56  ? 91  LEU B CD1 1 
ATOM   3657 C CD2 . LEU B 1 96  ? -3.594  0.799   31.404  1.00 27.62  ? 91  LEU B CD2 1 
ATOM   3658 N N   . ASP B 1 97  ? 1.320   3.003   32.886  1.00 29.28  ? 92  ASP B N   1 
ATOM   3659 C CA  . ASP B 1 97  ? 2.762   3.227   32.736  1.00 31.50  ? 92  ASP B CA  1 
ATOM   3660 C C   . ASP B 1 97  ? 3.463   3.355   34.114  1.00 31.22  ? 92  ASP B C   1 
ATOM   3661 O O   . ASP B 1 97  ? 4.542   2.815   34.325  1.00 30.27  ? 92  ASP B O   1 
ATOM   3662 C CB  . ASP B 1 97  ? 3.072   4.427   31.830  1.00 33.23  ? 92  ASP B CB  1 
ATOM   3663 C CG  . ASP B 1 97  ? 2.580   4.235   30.385  1.00 38.30  ? 92  ASP B CG  1 
ATOM   3664 O OD1 . ASP B 1 97  ? 2.271   3.082   29.958  1.00 42.37  ? 92  ASP B OD1 1 
ATOM   3665 O OD2 . ASP B 1 97  ? 2.467   5.253   29.674  1.00 42.75  ? 92  ASP B OD2 1 
ATOM   3666 N N   . SER B 1 98  ? 2.820   4.019   35.062  1.00 30.98  ? 93  SER B N   1 
ATOM   3667 C CA  . SER B 1 98  ? 3.420   4.186   36.379  1.00 31.91  ? 93  SER B CA  1 
ATOM   3668 C C   . SER B 1 98  ? 3.423   2.847   37.125  1.00 30.08  ? 93  SER B C   1 
ATOM   3669 O O   . SER B 1 98  ? 4.417   2.470   37.773  1.00 29.35  ? 93  SER B O   1 
ATOM   3670 C CB  . SER B 1 98  ? 2.704   5.269   37.172  1.00 32.94  ? 93  SER B CB  1 
ATOM   3671 O OG  . SER B 1 98  ? 3.287   5.401   38.450  1.00 38.24  ? 93  SER B OG  1 
ATOM   3672 N N   . HIS B 1 99  ? 2.343   2.089   36.983  1.00 28.60  ? 94  HIS B N   1 
ATOM   3673 C CA  . HIS B 1 99  ? 2.385   0.728   37.475  1.00 27.87  ? 94  HIS B CA  1 
ATOM   3674 C C   . HIS B 1 99  ? 3.541   -0.099  36.858  1.00 27.74  ? 94  HIS B C   1 
ATOM   3675 O O   . HIS B 1 99  ? 4.199   -0.802  37.590  1.00 28.38  ? 94  HIS B O   1 
ATOM   3676 C CB  . HIS B 1 99  ? 1.050   0.025   37.346  1.00 27.50  ? 94  HIS B CB  1 
ATOM   3677 C CG  . HIS B 1 99  ? 0.886   -1.117  38.303  1.00 28.66  ? 94  HIS B CG  1 
ATOM   3678 N ND1 . HIS B 1 99  ? -0.072  -1.130  39.280  1.00 32.59  ? 94  HIS B ND1 1 
ATOM   3679 C CD2 . HIS B 1 99  ? 1.583   -2.268  38.449  1.00 28.84  ? 94  HIS B CD2 1 
ATOM   3680 C CE1 . HIS B 1 99  ? 0.017   -2.254  39.972  1.00 34.78  ? 94  HIS B CE1 1 
ATOM   3681 N NE2 . HIS B 1 99  ? 1.030   -2.952  39.497  1.00 31.36  ? 94  HIS B NE2 1 
ATOM   3682 N N   . ALA B 1 100 ? 3.814   0.050   35.565  1.00 27.98  ? 95  ALA B N   1 
ATOM   3683 C CA  . ALA B 1 100 ? 4.904   -0.701  34.937  1.00 28.81  ? 95  ALA B CA  1 
ATOM   3684 C C   . ALA B 1 100 ? 6.268   -0.359  35.547  1.00 28.55  ? 95  ALA B C   1 
ATOM   3685 O O   . ALA B 1 100 ? 7.090   -1.243  35.787  1.00 28.40  ? 95  ALA B O   1 
ATOM   3686 C CB  . ALA B 1 100 ? 4.917   -0.459  33.435  1.00 26.36  ? 95  ALA B CB  1 
ATOM   3687 N N   . GLU B 1 101 ? 6.493   0.926   35.803  1.00 29.40  ? 96  GLU B N   1 
ATOM   3688 C CA  . GLU B 1 101 ? 7.675   1.402   36.509  1.00 30.23  ? 96  GLU B CA  1 
ATOM   3689 C C   . GLU B 1 101 ? 7.786   0.786   37.887  1.00 29.21  ? 96  GLU B C   1 
ATOM   3690 O O   . GLU B 1 101 ? 8.880   0.492   38.335  1.00 28.29  ? 96  GLU B O   1 
ATOM   3691 C CB  . GLU B 1 101 ? 7.687   2.915   36.698  1.00 31.75  ? 96  GLU B CB  1 
ATOM   3692 C CG  . GLU B 1 101 ? 7.686   3.818   35.474  1.00 38.62  ? 96  GLU B CG  1 
ATOM   3693 C CD  . GLU B 1 101 ? 7.431   5.316   35.891  1.00 47.90  ? 96  GLU B CD  1 
ATOM   3694 O OE1 . GLU B 1 101 ? 7.806   5.693   37.057  1.00 49.80  ? 96  GLU B OE1 1 
ATOM   3695 O OE2 . GLU B 1 101 ? 6.837   6.091   35.082  1.00 49.15  ? 96  GLU B OE2 1 
ATOM   3696 N N   . LEU B 1 102 ? 6.643   0.630   38.569  1.00 28.89  ? 97  LEU B N   1 
ATOM   3697 C CA  . LEU B 1 102 ? 6.600   0.002   39.864  1.00 29.19  ? 97  LEU B CA  1 
ATOM   3698 C C   . LEU B 1 102 ? 7.102   -1.431  39.774  1.00 28.69  ? 97  LEU B C   1 
ATOM   3699 O O   . LEU B 1 102 ? 7.827   -1.886  40.675  1.00 30.03  ? 97  LEU B O   1 
ATOM   3700 C CB  . LEU B 1 102 ? 5.184   0.037   40.493  1.00 29.42  ? 97  LEU B CB  1 
ATOM   3701 C CG  . LEU B 1 102 ? 4.849   -0.813  41.745  1.00 29.82  ? 97  LEU B CG  1 
ATOM   3702 C CD1 . LEU B 1 102 ? 5.718   -0.411  42.930  1.00 32.36  ? 97  LEU B CD1 1 
ATOM   3703 C CD2 . LEU B 1 102 ? 3.400   -0.589  42.169  1.00 29.91  ? 97  LEU B CD2 1 
ATOM   3704 N N   . LEU B 1 103 ? 6.693   -2.146  38.741  1.00 28.06  ? 98  LEU B N   1 
ATOM   3705 C CA  . LEU B 1 103 ? 7.124   -3.565  38.564  1.00 28.33  ? 98  LEU B CA  1 
ATOM   3706 C C   . LEU B 1 103 ? 8.623   -3.637  38.211  1.00 28.41  ? 98  LEU B C   1 
ATOM   3707 O O   . LEU B 1 103 ? 9.332   -4.519  38.671  1.00 28.49  ? 98  LEU B O   1 
ATOM   3708 C CB  . LEU B 1 103 ? 6.312   -4.265  37.480  1.00 27.18  ? 98  LEU B CB  1 
ATOM   3709 C CG  . LEU B 1 103 ? 4.810   -4.483  37.778  1.00 29.01  ? 98  LEU B CG  1 
ATOM   3710 C CD1 . LEU B 1 103 ? 4.125   -5.076  36.538  1.00 25.79  ? 98  LEU B CD1 1 
ATOM   3711 C CD2 . LEU B 1 103 ? 4.613   -5.380  38.937  1.00 29.01  ? 98  LEU B CD2 1 
ATOM   3712 N N   . ASP B 1 104 ? 9.096   -2.698  37.405  1.00 28.68  ? 99  ASP B N   1 
ATOM   3713 C CA  . ASP B 1 104 ? 10.534  -2.581  37.120  1.00 30.65  ? 99  ASP B CA  1 
ATOM   3714 C C   . ASP B 1 104 ? 11.350  -2.395  38.418  1.00 30.33  ? 99  ASP B C   1 
ATOM   3715 O O   . ASP B 1 104 ? 12.348  -3.079  38.609  1.00 29.27  ? 99  ASP B O   1 
ATOM   3716 C CB  . ASP B 1 104 ? 10.805  -1.372  36.266  1.00 31.81  ? 99  ASP B CB  1 
ATOM   3717 C CG  . ASP B 1 104 ? 10.345  -1.531  34.847  1.00 36.31  ? 99  ASP B CG  1 
ATOM   3718 O OD1 . ASP B 1 104 ? 10.097  -2.666  34.381  1.00 36.89  ? 99  ASP B OD1 1 
ATOM   3719 O OD2 . ASP B 1 104 ? 10.238  -0.464  34.186  1.00 43.40  ? 99  ASP B OD2 1 
ATOM   3720 N N   . ALA B 1 105 ? 10.923  -1.445  39.269  1.00 30.70  ? 100 ALA B N   1 
ATOM   3721 C CA  . ALA B 1 105 ? 11.595  -1.160  40.558  1.00 31.34  ? 100 ALA B CA  1 
ATOM   3722 C C   . ALA B 1 105 ? 11.573  -2.383  41.473  1.00 31.12  ? 100 ALA B C   1 
ATOM   3723 O O   . ALA B 1 105 ? 12.568  -2.689  42.126  1.00 32.56  ? 100 ALA B O   1 
ATOM   3724 C CB  . ALA B 1 105 ? 10.989  0.025   41.246  1.00 30.21  ? 100 ALA B CB  1 
ATOM   3725 N N   . THR B 1 106 ? 10.447  -3.090  41.475  1.00 29.93  ? 101 THR B N   1 
ATOM   3726 C CA  . THR B 1 106 ? 10.301  -4.335  42.188  1.00 28.95  ? 101 THR B CA  1 
ATOM   3727 C C   . THR B 1 106 ? 11.280  -5.379  41.674  1.00 29.94  ? 101 THR B C   1 
ATOM   3728 O O   . THR B 1 106 ? 11.944  -6.073  42.476  1.00 29.73  ? 101 THR B O   1 
ATOM   3729 C CB  . THR B 1 106 ? 8.829   -4.859  42.124  1.00 28.65  ? 101 THR B CB  1 
ATOM   3730 O OG1 . THR B 1 106 ? 7.961   -3.879  42.679  1.00 27.74  ? 101 THR B OG1 1 
ATOM   3731 C CG2 . THR B 1 106 ? 8.653   -6.106  42.890  1.00 28.23  ? 101 THR B CG2 1 
ATOM   3732 N N   . GLN B 1 107 ? 11.371  -5.511  40.358  1.00 29.63  ? 102 GLN B N   1 
ATOM   3733 C CA  . GLN B 1 107 ? 12.337  -6.437  39.784  1.00 30.71  ? 102 GLN B CA  1 
ATOM   3734 C C   . GLN B 1 107 ? 13.787  -6.084  40.177  1.00 30.98  ? 102 GLN B C   1 
ATOM   3735 O O   . GLN B 1 107 ? 14.586  -6.982  40.513  1.00 30.40  ? 102 GLN B O   1 
ATOM   3736 C CB  . GLN B 1 107 ? 12.262  -6.469  38.254  1.00 31.46  ? 102 GLN B CB  1 
ATOM   3737 C CG  . GLN B 1 107 ? 13.003  -7.675  37.707  1.00 33.92  ? 102 GLN B CG  1 
ATOM   3738 C CD  . GLN B 1 107 ? 12.845  -7.851  36.234  1.00 41.00  ? 102 GLN B CD  1 
ATOM   3739 O OE1 . GLN B 1 107 ? 12.283  -6.996  35.527  1.00 44.52  ? 102 GLN B OE1 1 
ATOM   3740 N NE2 . GLN B 1 107 ? 13.331  -8.982  35.742  1.00 41.56  ? 102 GLN B NE2 1 
ATOM   3741 N N   . HIS B 1 108 ? 14.102  -4.785  40.112  1.00 29.30  ? 103 HIS B N   1 
ATOM   3742 C CA  . HIS B 1 108 ? 15.430  -4.262  40.462  1.00 30.32  ? 103 HIS B CA  1 
ATOM   3743 C C   . HIS B 1 108 ? 15.904  -4.561  41.904  1.00 30.56  ? 103 HIS B C   1 
ATOM   3744 O O   . HIS B 1 108 ? 17.071  -4.911  42.066  1.00 29.74  ? 103 HIS B O   1 
ATOM   3745 C CB  . HIS B 1 108 ? 15.539  -2.753  40.183  1.00 29.35  ? 103 HIS B CB  1 
ATOM   3746 C CG  . HIS B 1 108 ? 15.301  -2.392  38.752  1.00 30.93  ? 103 HIS B CG  1 
ATOM   3747 N ND1 . HIS B 1 108 ? 14.877  -1.134  38.365  1.00 31.53  ? 103 HIS B ND1 1 
ATOM   3748 C CD2 . HIS B 1 108 ? 15.432  -3.118  37.605  1.00 30.89  ? 103 HIS B CD2 1 
ATOM   3749 C CE1 . HIS B 1 108 ? 14.773  -1.092  37.046  1.00 31.54  ? 103 HIS B CE1 1 
ATOM   3750 N NE2 . HIS B 1 108 ? 15.087  -2.283  36.561  1.00 34.92  ? 103 HIS B NE2 1 
ATOM   3751 N N   . THR B 1 109 ? 15.043  -4.414  42.921  1.00 30.98  ? 104 THR B N   1 
ATOM   3752 C CA  . THR B 1 109 ? 15.445  -4.824  44.276  1.00 32.94  ? 104 THR B CA  1 
ATOM   3753 C C   . THR B 1 109 ? 15.564  -6.310  44.408  1.00 32.49  ? 104 THR B C   1 
ATOM   3754 O O   . THR B 1 109 ? 16.392  -6.783  45.169  1.00 34.23  ? 104 THR B O   1 
ATOM   3755 C CB  . THR B 1 109 ? 14.497  -4.541  45.398  1.00 32.90  ? 104 THR B CB  1 
ATOM   3756 O OG1 . THR B 1 109 ? 13.398  -3.724  44.999  1.00 39.90  ? 104 THR B OG1 1 
ATOM   3757 C CG2 . THR B 1 109 ? 15.224  -4.017  46.564  1.00 30.61  ? 104 THR B CG2 1 
ATOM   3758 N N   . LEU B 1 110 ? 14.703  -7.060  43.741  1.00 32.34  ? 105 LEU B N   1 
ATOM   3759 C CA  . LEU B 1 110 ? 14.842  -8.507  43.754  1.00 33.07  ? 105 LEU B CA  1 
ATOM   3760 C C   . LEU B 1 110 ? 16.230  -8.887  43.243  1.00 34.03  ? 105 LEU B C   1 
ATOM   3761 O O   . LEU B 1 110 ? 16.891  -9.711  43.856  1.00 35.96  ? 105 LEU B O   1 
ATOM   3762 C CB  . LEU B 1 110 ? 13.757  -9.199  42.944  1.00 32.51  ? 105 LEU B CB  1 
ATOM   3763 C CG  . LEU B 1 110 ? 12.467  -9.652  43.657  1.00 35.79  ? 105 LEU B CG  1 
ATOM   3764 C CD1 . LEU B 1 110 ? 12.642  -10.682 44.819  1.00 31.96  ? 105 LEU B CD1 1 
ATOM   3765 C CD2 . LEU B 1 110 ? 11.719  -8.465  44.179  1.00 38.34  ? 105 LEU B CD2 1 
ATOM   3766 N N   . GLN B 1 111 ? 16.688  -8.279  42.154  1.00 33.77  ? 106 GLN B N   1 
ATOM   3767 C CA  . GLN B 1 111 ? 18.013  -8.604  41.617  1.00 35.31  ? 106 GLN B CA  1 
ATOM   3768 C C   . GLN B 1 111 ? 19.104  -8.065  42.515  1.00 36.13  ? 106 GLN B C   1 
ATOM   3769 O O   . GLN B 1 111 ? 20.076  -8.745  42.817  1.00 36.81  ? 106 GLN B O   1 
ATOM   3770 C CB  . GLN B 1 111 ? 18.212  -8.019  40.219  1.00 35.22  ? 106 GLN B CB  1 
ATOM   3771 C CG  . GLN B 1 111 ? 17.056  -8.206  39.294  1.00 35.74  ? 106 GLN B CG  1 
ATOM   3772 C CD  . GLN B 1 111 ? 17.243  -7.507  37.985  1.00 37.79  ? 106 GLN B CD  1 
ATOM   3773 O OE1 . GLN B 1 111 ? 17.625  -8.137  37.017  1.00 41.62  ? 106 GLN B OE1 1 
ATOM   3774 N NE2 . GLN B 1 111 ? 17.031  -6.180  37.952  1.00 38.52  ? 106 GLN B NE2 1 
ATOM   3775 N N   . GLN B 1 112 ? 18.941  -6.827  42.941  1.00 36.75  ? 107 GLN B N   1 
ATOM   3776 C CA  . GLN B 1 112 ? 20.017  -6.133  43.617  1.00 38.31  ? 107 GLN B CA  1 
ATOM   3777 C C   . GLN B 1 112 ? 20.206  -6.608  45.083  1.00 38.64  ? 107 GLN B C   1 
ATOM   3778 O O   . GLN B 1 112 ? 21.344  -6.753  45.524  1.00 40.47  ? 107 GLN B O   1 
ATOM   3779 C CB  . GLN B 1 112 ? 19.836  -4.614  43.457  1.00 38.48  ? 107 GLN B CB  1 
ATOM   3780 C CG  . GLN B 1 112 ? 20.693  -3.774  44.320  1.00 41.68  ? 107 GLN B CG  1 
ATOM   3781 C CD  . GLN B 1 112 ? 20.661  -2.290  43.966  1.00 47.86  ? 107 GLN B CD  1 
ATOM   3782 O OE1 . GLN B 1 112 ? 20.304  -1.881  42.830  1.00 49.82  ? 107 GLN B OE1 1 
ATOM   3783 N NE2 . GLN B 1 112 ? 21.055  -1.467  44.939  1.00 48.99  ? 107 GLN B NE2 1 
ATOM   3784 N N   . GLN B 1 113 ? 19.122  -6.948  45.783  1.00 37.77  ? 108 GLN B N   1 
ATOM   3785 C CA  . GLN B 1 113 ? 19.189  -7.387  47.175  1.00 38.41  ? 108 GLN B CA  1 
ATOM   3786 C C   . GLN B 1 113 ? 19.157  -8.903  47.316  1.00 38.77  ? 108 GLN B C   1 
ATOM   3787 O O   . GLN B 1 113 ? 20.031  -9.503  47.933  1.00 39.83  ? 108 GLN B O   1 
ATOM   3788 C CB  . GLN B 1 113 ? 18.037  -6.805  48.009  1.00 38.30  ? 108 GLN B CB  1 
ATOM   3789 C CG  . GLN B 1 113 ? 17.985  -5.268  48.059  1.00 41.40  ? 108 GLN B CG  1 
ATOM   3790 C CD  . GLN B 1 113 ? 19.290  -4.646  48.361  1.00 45.75  ? 108 GLN B CD  1 
ATOM   3791 O OE1 . GLN B 1 113 ? 19.796  -4.775  49.481  1.00 54.37  ? 108 GLN B OE1 1 
ATOM   3792 N NE2 . GLN B 1 113 ? 19.867  -3.959  47.392  1.00 42.42  ? 108 GLN B NE2 1 
ATOM   3793 N N   . ILE B 1 114 ? 18.137  -9.528  46.747  1.00 37.97  ? 109 ILE B N   1 
ATOM   3794 C CA  . ILE B 1 114 ? 17.845  -10.888 47.060  1.00 37.24  ? 109 ILE B CA  1 
ATOM   3795 C C   . ILE B 1 114 ? 18.669  -11.800 46.199  1.00 38.62  ? 109 ILE B C   1 
ATOM   3796 O O   . ILE B 1 114 ? 19.293  -12.734 46.701  1.00 38.63  ? 109 ILE B O   1 
ATOM   3797 C CB  . ILE B 1 114 ? 16.355  -11.202 46.877  1.00 36.95  ? 109 ILE B CB  1 
ATOM   3798 C CG1 . ILE B 1 114 ? 15.506  -10.208 47.679  1.00 37.08  ? 109 ILE B CG1 1 
ATOM   3799 C CG2 . ILE B 1 114 ? 16.063  -12.671 47.201  1.00 35.69  ? 109 ILE B CG2 1 
ATOM   3800 C CD1 . ILE B 1 114 ? 15.924  -9.993  49.187  1.00 40.04  ? 109 ILE B CD1 1 
ATOM   3801 N N   . GLN B 1 115 ? 18.689  -11.531 44.902  1.00 38.47  ? 110 GLN B N   1 
ATOM   3802 C CA  . GLN B 1 115 ? 19.344  -12.451 44.030  1.00 40.11  ? 110 GLN B CA  1 
ATOM   3803 C C   . GLN B 1 115 ? 20.867  -12.444 44.207  1.00 40.33  ? 110 GLN B C   1 
ATOM   3804 O O   . GLN B 1 115 ? 21.475  -13.507 44.141  1.00 40.35  ? 110 GLN B O   1 
ATOM   3805 C CB  . GLN B 1 115 ? 18.976  -12.238 42.567  1.00 40.93  ? 110 GLN B CB  1 
ATOM   3806 C CG  . GLN B 1 115 ? 19.725  -13.201 41.641  1.00 42.86  ? 110 GLN B CG  1 
ATOM   3807 C CD  . GLN B 1 115 ? 19.376  -12.970 40.194  1.00 49.42  ? 110 GLN B CD  1 
ATOM   3808 O OE1 . GLN B 1 115 ? 18.971  -13.899 39.497  1.00 53.24  ? 110 GLN B OE1 1 
ATOM   3809 N NE2 . GLN B 1 115 ? 19.500  -11.720 39.733  1.00 48.48  ? 110 GLN B NE2 1 
ATOM   3810 N N   . THR B 1 116 ? 21.476  -11.281 44.425  1.00 39.62  ? 111 THR B N   1 
ATOM   3811 C CA  . THR B 1 116 ? 22.942  -11.265 44.614  1.00 41.13  ? 111 THR B CA  1 
ATOM   3812 C C   . THR B 1 116 ? 23.358  -11.919 45.944  1.00 41.32  ? 111 THR B C   1 
ATOM   3813 O O   . THR B 1 116 ? 24.461  -12.468 46.028  1.00 41.83  ? 111 THR B O   1 
ATOM   3814 C CB  . THR B 1 116 ? 23.604  -9.866  44.459  1.00 41.07  ? 111 THR B CB  1 
ATOM   3815 O OG1 . THR B 1 116 ? 23.294  -9.068  45.597  1.00 44.66  ? 111 THR B OG1 1 
ATOM   3816 C CG2 . THR B 1 116 ? 23.118  -9.163  43.230  1.00 39.11  ? 111 THR B CG2 1 
ATOM   3817 N N   . LEU B 1 117 ? 22.451  -11.914 46.936  1.00 41.18  ? 112 LEU B N   1 
ATOM   3818 C CA  . LEU B 1 117 ? 22.703  -12.494 48.249  1.00 41.64  ? 112 LEU B CA  1 
ATOM   3819 C C   . LEU B 1 117 ? 22.881  -14.000 48.137  1.00 42.99  ? 112 LEU B C   1 
ATOM   3820 O O   . LEU B 1 117 ? 23.825  -14.538 48.716  1.00 42.34  ? 112 LEU B O   1 
ATOM   3821 C CB  . LEU B 1 117 ? 21.569  -12.193 49.240  1.00 42.21  ? 112 LEU B CB  1 
ATOM   3822 C CG  . LEU B 1 117 ? 21.806  -11.994 50.763  1.00 43.93  ? 112 LEU B CG  1 
ATOM   3823 C CD1 . LEU B 1 117 ? 20.567  -12.311 51.569  1.00 43.69  ? 112 LEU B CD1 1 
ATOM   3824 C CD2 . LEU B 1 117 ? 23.001  -12.714 51.377  1.00 43.67  ? 112 LEU B CD2 1 
ATOM   3825 N N   . VAL B 1 118 ? 21.980  -14.673 47.404  1.00 43.43  ? 113 VAL B N   1 
ATOM   3826 C CA  . VAL B 1 118 ? 22.055  -16.138 47.233  1.00 45.27  ? 113 VAL B CA  1 
ATOM   3827 C C   . VAL B 1 118 ? 23.189  -16.559 46.319  1.00 46.68  ? 113 VAL B C   1 
ATOM   3828 O O   . VAL B 1 118 ? 23.527  -17.749 46.260  1.00 47.50  ? 113 VAL B O   1 
ATOM   3829 C CB  . VAL B 1 118 ? 20.750  -16.777 46.671  1.00 45.97  ? 113 VAL B CB  1 
ATOM   3830 C CG1 . VAL B 1 118 ? 19.623  -16.580 47.614  1.00 46.63  ? 113 VAL B CG1 1 
ATOM   3831 C CG2 . VAL B 1 118 ? 20.389  -16.236 45.305  1.00 43.88  ? 113 VAL B CG2 1 
ATOM   3832 N N   . LYS B 1 119 ? 23.738  -15.588 45.587  1.00 46.95  ? 114 LYS B N   1 
ATOM   3833 C CA  . LYS B 1 119 ? 24.779  -15.839 44.597  1.00 49.07  ? 114 LYS B CA  1 
ATOM   3834 C C   . LYS B 1 119 ? 26.101  -15.338 45.169  1.00 49.27  ? 114 LYS B C   1 
ATOM   3835 O O   . LYS B 1 119 ? 26.725  -16.010 45.999  1.00 49.58  ? 114 LYS B O   1 
ATOM   3836 C CB  . LYS B 1 119 ? 24.473  -15.099 43.273  1.00 49.58  ? 114 LYS B CB  1 
ATOM   3837 C CG  . LYS B 1 119 ? 23.317  -15.636 42.421  1.00 51.26  ? 114 LYS B CG  1 
ATOM   3838 C CD  . LYS B 1 119 ? 23.559  -17.095 42.026  1.00 56.06  ? 114 LYS B CD  1 
ATOM   3839 C CE  . LYS B 1 119 ? 23.331  -17.343 40.515  1.00 58.72  ? 114 LYS B CE  1 
ATOM   3840 N NZ  . LYS B 1 119 ? 21.886  -17.483 40.146  1.00 59.14  ? 114 LYS B NZ  1 
ATOM   3841 N N   . GLU B 1 120 ? 26.499  -14.138 44.748  1.00 48.49  ? 115 GLU B N   1 
ATOM   3842 C CA  . GLU B 1 120 ? 27.792  -13.574 45.117  1.00 49.00  ? 115 GLU B CA  1 
ATOM   3843 C C   . GLU B 1 120 ? 27.896  -13.300 46.629  1.00 46.61  ? 115 GLU B C   1 
ATOM   3844 O O   . GLU B 1 120 ? 28.972  -13.420 47.204  1.00 46.66  ? 115 GLU B O   1 
ATOM   3845 C CB  . GLU B 1 120 ? 28.101  -12.317 44.270  1.00 49.68  ? 115 GLU B CB  1 
ATOM   3846 C CG  . GLU B 1 120 ? 29.267  -11.411 44.787  1.00 54.07  ? 115 GLU B CG  1 
ATOM   3847 C CD  . GLU B 1 120 ? 30.658  -12.100 44.804  1.00 58.55  ? 115 GLU B CD  1 
ATOM   3848 O OE1 . GLU B 1 120 ? 31.385  -11.940 45.810  1.00 58.22  ? 115 GLU B OE1 1 
ATOM   3849 O OE2 . GLU B 1 120 ? 31.021  -12.798 43.824  1.00 61.82  ? 115 GLU B OE2 1 
ATOM   3850 N N   . GLY B 1 121 ? 26.762  -12.975 47.254  1.00 44.45  ? 116 GLY B N   1 
ATOM   3851 C CA  . GLY B 1 121 ? 26.711  -12.534 48.649  1.00 41.59  ? 116 GLY B CA  1 
ATOM   3852 C C   . GLY B 1 121 ? 27.064  -13.619 49.657  1.00 41.35  ? 116 GLY B C   1 
ATOM   3853 O O   . GLY B 1 121 ? 27.483  -13.316 50.747  1.00 40.09  ? 116 GLY B O   1 
ATOM   3854 N N   . LEU B 1 122 ? 26.883  -14.877 49.258  1.00 41.60  ? 117 LEU B N   1 
ATOM   3855 C CA  . LEU B 1 122 ? 27.118  -16.039 50.080  1.00 42.98  ? 117 LEU B CA  1 
ATOM   3856 C C   . LEU B 1 122 ? 28.380  -16.802 49.693  1.00 44.68  ? 117 LEU B C   1 
ATOM   3857 O O   . LEU B 1 122 ? 28.669  -17.878 50.252  1.00 46.03  ? 117 LEU B O   1 
ATOM   3858 C CB  . LEU B 1 122 ? 25.920  -16.976 50.001  1.00 42.41  ? 117 LEU B CB  1 
ATOM   3859 C CG  . LEU B 1 122 ? 24.826  -16.768 51.038  1.00 41.63  ? 117 LEU B CG  1 
ATOM   3860 C CD1 . LEU B 1 122 ? 23.703  -17.754 50.785  1.00 40.50  ? 117 LEU B CD1 1 
ATOM   3861 C CD2 . LEU B 1 122 ? 25.372  -16.923 52.468  1.00 43.82  ? 117 LEU B CD2 1 
ATOM   3862 N N   . ARG B 1 123 ? 29.140  -16.249 48.753  1.00 44.63  ? 118 ARG B N   1 
ATOM   3863 C CA  . ARG B 1 123 ? 30.320  -16.945 48.242  1.00 46.01  ? 118 ARG B CA  1 
ATOM   3864 C C   . ARG B 1 123 ? 31.424  -17.140 49.293  1.00 45.63  ? 118 ARG B C   1 
ATOM   3865 O O   . ARG B 1 123 ? 31.960  -18.241 49.436  1.00 47.66  ? 118 ARG B O   1 
ATOM   3866 C CB  . ARG B 1 123 ? 30.874  -16.237 46.997  1.00 46.43  ? 118 ARG B CB  1 
ATOM   3867 C CG  . ARG B 1 123 ? 32.151  -16.892 46.456  1.00 50.39  ? 118 ARG B CG  1 
ATOM   3868 C CD  . ARG B 1 123 ? 32.655  -16.219 45.192  1.00 56.71  ? 118 ARG B CD  1 
ATOM   3869 N NE  . ARG B 1 123 ? 31.749  -16.393 44.042  1.00 61.86  ? 118 ARG B NE  1 
ATOM   3870 C CZ  . ARG B 1 123 ? 31.741  -17.457 43.234  1.00 64.80  ? 118 ARG B CZ  1 
ATOM   3871 N NH1 . ARG B 1 123 ? 32.581  -18.466 43.459  1.00 67.25  ? 118 ARG B NH1 1 
ATOM   3872 N NH2 . ARG B 1 123 ? 30.888  -17.519 42.207  1.00 64.42  ? 118 ARG B NH2 1 
ATOM   3873 N N   . GLY B 1 124 ? 31.774  -16.078 50.013  1.00 44.40  ? 119 GLY B N   1 
ATOM   3874 C CA  . GLY B 1 124 ? 32.772  -16.158 51.084  1.00 43.42  ? 119 GLY B CA  1 
ATOM   3875 C C   . GLY B 1 124 ? 32.416  -17.240 52.108  1.00 43.21  ? 119 GLY B C   1 
ATOM   3876 O O   . GLY B 1 124 ? 33.258  -18.050 52.484  1.00 43.65  ? 119 GLY B O   1 
ATOM   3877 N N   . PHE B 1 125 ? 31.155  -17.247 52.529  1.00 41.58  ? 120 PHE B N   1 
ATOM   3878 C CA  . PHE B 1 125 ? 30.632  -18.233 53.424  1.00 42.16  ? 120 PHE B CA  1 
ATOM   3879 C C   . PHE B 1 125 ? 30.846  -19.665 52.926  1.00 43.93  ? 120 PHE B C   1 
ATOM   3880 O O   . PHE B 1 125 ? 31.328  -20.521 53.690  1.00 45.33  ? 120 PHE B O   1 
ATOM   3881 C CB  . PHE B 1 125 ? 29.144  -17.970 53.680  1.00 41.76  ? 120 PHE B CB  1 
ATOM   3882 C CG  . PHE B 1 125 ? 28.531  -18.932 54.631  1.00 43.20  ? 120 PHE B CG  1 
ATOM   3883 C CD1 . PHE B 1 125 ? 28.502  -18.660 55.985  1.00 43.95  ? 120 PHE B CD1 1 
ATOM   3884 C CD2 . PHE B 1 125 ? 28.010  -20.141 54.176  1.00 45.37  ? 120 PHE B CD2 1 
ATOM   3885 C CE1 . PHE B 1 125 ? 27.948  -19.590 56.874  1.00 45.48  ? 120 PHE B CE1 1 
ATOM   3886 C CE2 . PHE B 1 125 ? 27.461  -21.053 55.053  1.00 47.27  ? 120 PHE B CE2 1 
ATOM   3887 C CZ  . PHE B 1 125 ? 27.429  -20.776 56.400  1.00 46.09  ? 120 PHE B CZ  1 
ATOM   3888 N N   . ARG B 1 126 ? 30.484  -19.924 51.665  1.00 43.79  ? 121 ARG B N   1 
ATOM   3889 C CA  . ARG B 1 126 ? 30.575  -21.258 51.068  1.00 45.27  ? 121 ARG B CA  1 
ATOM   3890 C C   . ARG B 1 126 ? 32.012  -21.733 50.955  1.00 45.88  ? 121 ARG B C   1 
ATOM   3891 O O   . ARG B 1 126 ? 32.284  -22.923 51.067  1.00 47.16  ? 121 ARG B O   1 
ATOM   3892 C CB  . ARG B 1 126 ? 29.929  -21.273 49.676  1.00 45.38  ? 121 ARG B CB  1 
ATOM   3893 C CG  . ARG B 1 126 ? 28.418  -21.144 49.696  1.00 46.85  ? 121 ARG B CG  1 
ATOM   3894 C CD  . ARG B 1 126 ? 27.787  -21.133 48.292  1.00 48.12  ? 121 ARG B CD  1 
ATOM   3895 N NE  . ARG B 1 126 ? 26.361  -20.826 48.420  1.00 48.80  ? 121 ARG B NE  1 
ATOM   3896 C CZ  . ARG B 1 126 ? 25.742  -19.747 47.927  1.00 48.25  ? 121 ARG B CZ  1 
ATOM   3897 N NH1 . ARG B 1 126 ? 26.399  -18.836 47.210  1.00 44.74  ? 121 ARG B NH1 1 
ATOM   3898 N NH2 . ARG B 1 126 ? 24.433  -19.589 48.151  1.00 47.47  ? 121 ARG B NH2 1 
ATOM   3899 N N   . GLU B 1 127 ? 32.913  -20.786 50.696  1.00 45.20  ? 122 GLU B N   1 
ATOM   3900 C CA  . GLU B 1 127 ? 34.356  -21.024 50.580  1.00 46.30  ? 122 GLU B CA  1 
ATOM   3901 C C   . GLU B 1 127 ? 34.956  -21.352 51.944  1.00 46.13  ? 122 GLU B C   1 
ATOM   3902 O O   . GLU B 1 127 ? 35.688  -22.322 52.112  1.00 47.07  ? 122 GLU B O   1 
ATOM   3903 C CB  . GLU B 1 127 ? 35.009  -19.728 50.122  1.00 45.84  ? 122 GLU B CB  1 
ATOM   3904 C CG  . GLU B 1 127 ? 35.975  -19.803 48.965  1.00 51.64  ? 122 GLU B CG  1 
ATOM   3905 C CD  . GLU B 1 127 ? 35.892  -18.521 48.121  1.00 57.19  ? 122 GLU B CD  1 
ATOM   3906 O OE1 . GLU B 1 127 ? 36.152  -17.409 48.657  1.00 58.12  ? 122 GLU B OE1 1 
ATOM   3907 O OE2 . GLU B 1 127 ? 35.515  -18.617 46.933  1.00 59.88  ? 122 GLU B OE2 1 
ATOM   3908 N N   . ALA B 1 128 ? 34.674  -20.494 52.915  1.00 44.66  ? 123 ALA B N   1 
ATOM   3909 C CA  . ALA B 1 128 ? 35.222  -20.662 54.231  1.00 45.50  ? 123 ALA B CA  1 
ATOM   3910 C C   . ALA B 1 128 ? 34.655  -21.943 54.856  1.00 46.95  ? 123 ALA B C   1 
ATOM   3911 O O   . ALA B 1 128 ? 35.410  -22.723 55.412  1.00 47.93  ? 123 ALA B O   1 
ATOM   3912 C CB  . ALA B 1 128 ? 34.962  -19.436 55.069  1.00 44.55  ? 123 ALA B CB  1 
ATOM   3913 N N   . ARG B 1 129 ? 33.345  -22.177 54.696  1.00 47.48  ? 124 ARG B N   1 
ATOM   3914 C CA  . ARG B 1 129 ? 32.718  -23.434 55.092  1.00 49.62  ? 124 ARG B CA  1 
ATOM   3915 C C   . ARG B 1 129 ? 33.503  -24.615 54.574  1.00 51.41  ? 124 ARG B C   1 
ATOM   3916 O O   . ARG B 1 129 ? 33.942  -25.493 55.356  1.00 52.98  ? 124 ARG B O   1 
ATOM   3917 C CB  . ARG B 1 129 ? 31.286  -23.511 54.569  1.00 49.92  ? 124 ARG B CB  1 
ATOM   3918 C CG  . ARG B 1 129 ? 30.523  -24.748 55.020  1.00 52.13  ? 124 ARG B CG  1 
ATOM   3919 C CD  . ARG B 1 129 ? 29.632  -25.233 53.903  1.00 57.34  ? 124 ARG B CD  1 
ATOM   3920 N NE  . ARG B 1 129 ? 28.329  -25.700 54.359  1.00 59.10  ? 124 ARG B NE  1 
ATOM   3921 C CZ  . ARG B 1 129 ? 28.047  -26.958 54.687  1.00 63.23  ? 124 ARG B CZ  1 
ATOM   3922 N NH1 . ARG B 1 129 ? 28.992  -27.895 54.637  1.00 64.39  ? 124 ARG B NH1 1 
ATOM   3923 N NH2 . ARG B 1 129 ? 26.815  -27.278 55.074  1.00 64.00  ? 124 ARG B NH2 1 
ATOM   3924 N N   . ARG B 1 130 ? 33.698  -24.620 53.253  1.00 51.17  ? 125 ARG B N   1 
ATOM   3925 C CA  . ARG B 1 130 ? 34.500  -25.642 52.577  1.00 52.61  ? 125 ARG B CA  1 
ATOM   3926 C C   . ARG B 1 130 ? 35.893  -25.854 53.199  1.00 52.55  ? 125 ARG B C   1 
ATOM   3927 O O   . ARG B 1 130 ? 36.256  -26.976 53.531  1.00 53.78  ? 125 ARG B O   1 
ATOM   3928 C CB  . ARG B 1 130 ? 34.622  -25.342 51.073  1.00 52.45  ? 125 ARG B CB  1 
ATOM   3929 C CG  . ARG B 1 130 ? 35.023  -26.568 50.257  1.00 58.45  ? 125 ARG B CG  1 
ATOM   3930 C CD  . ARG B 1 130 ? 35.783  -26.249 48.961  1.00 65.39  ? 125 ARG B CD  1 
ATOM   3931 N NE  . ARG B 1 130 ? 36.890  -25.299 49.137  1.00 68.88  ? 125 ARG B NE  1 
ATOM   3932 C CZ  . ARG B 1 130 ? 36.914  -24.070 48.611  1.00 68.87  ? 125 ARG B CZ  1 
ATOM   3933 N NH1 . ARG B 1 130 ? 35.897  -23.639 47.862  1.00 67.42  ? 125 ARG B NH1 1 
ATOM   3934 N NH2 . ARG B 1 130 ? 37.963  -23.276 48.811  1.00 68.01  ? 125 ARG B NH2 1 
ATOM   3935 N N   . ASP B 1 131 ? 36.677  -24.783 53.301  1.00 50.99  ? 126 ASP B N   1 
ATOM   3936 C CA  . ASP B 1 131 ? 38.039  -24.856 53.812  1.00 51.40  ? 126 ASP B CA  1 
ATOM   3937 C C   . ASP B 1 131 ? 38.092  -25.246 55.312  1.00 51.34  ? 126 ASP B C   1 
ATOM   3938 O O   . ASP B 1 131 ? 39.051  -25.849 55.774  1.00 51.65  ? 126 ASP B O   1 
ATOM   3939 C CB  . ASP B 1 131 ? 38.762  -23.532 53.567  1.00 50.28  ? 126 ASP B CB  1 
ATOM   3940 C CG  . ASP B 1 131 ? 38.998  -23.246 52.071  1.00 53.96  ? 126 ASP B CG  1 
ATOM   3941 O OD1 . ASP B 1 131 ? 39.141  -24.205 51.263  1.00 57.48  ? 126 ASP B OD1 1 
ATOM   3942 O OD2 . ASP B 1 131 ? 39.046  -22.044 51.699  1.00 55.20  ? 126 ASP B OD2 1 
ATOM   3943 N N   . PHE B 1 132 ? 37.044  -24.922 56.057  1.00 50.29  ? 127 PHE B N   1 
ATOM   3944 C CA  . PHE B 1 132 ? 36.990  -25.265 57.470  1.00 50.64  ? 127 PHE B CA  1 
ATOM   3945 C C   . PHE B 1 132 ? 36.818  -26.780 57.660  1.00 53.08  ? 127 PHE B C   1 
ATOM   3946 O O   . PHE B 1 132 ? 37.584  -27.416 58.419  1.00 54.19  ? 127 PHE B O   1 
ATOM   3947 C CB  . PHE B 1 132 ? 35.870  -24.480 58.164  1.00 49.06  ? 127 PHE B CB  1 
ATOM   3948 C CG  . PHE B 1 132 ? 35.439  -25.058 59.490  1.00 49.01  ? 127 PHE B CG  1 
ATOM   3949 C CD1 . PHE B 1 132 ? 36.120  -24.738 60.663  1.00 48.66  ? 127 PHE B CD1 1 
ATOM   3950 C CD2 . PHE B 1 132 ? 34.333  -25.891 59.566  1.00 48.08  ? 127 PHE B CD2 1 
ATOM   3951 C CE1 . PHE B 1 132 ? 35.704  -25.262 61.893  1.00 50.96  ? 127 PHE B CE1 1 
ATOM   3952 C CE2 . PHE B 1 132 ? 33.915  -26.417 60.793  1.00 51.15  ? 127 PHE B CE2 1 
ATOM   3953 C CZ  . PHE B 1 132 ? 34.593  -26.103 61.952  1.00 48.88  ? 127 PHE B CZ  1 
ATOM   3954 N N   . TRP B 1 133 ? 35.834  -27.355 56.962  1.00 53.55  ? 128 TRP B N   1 
ATOM   3955 C CA  . TRP B 1 133 ? 35.548  -28.782 57.110  1.00 56.44  ? 128 TRP B CA  1 
ATOM   3956 C C   . TRP B 1 133 ? 36.703  -29.615 56.590  1.00 58.39  ? 128 TRP B C   1 
ATOM   3957 O O   . TRP B 1 133 ? 36.995  -30.684 57.105  1.00 60.54  ? 128 TRP B O   1 
ATOM   3958 C CB  . TRP B 1 133 ? 34.224  -29.152 56.453  1.00 56.28  ? 128 TRP B CB  1 
ATOM   3959 C CG  . TRP B 1 133 ? 33.054  -28.686 57.267  1.00 55.72  ? 128 TRP B CG  1 
ATOM   3960 C CD1 . TRP B 1 133 ? 32.135  -27.741 56.916  1.00 54.06  ? 128 TRP B CD1 1 
ATOM   3961 C CD2 . TRP B 1 133 ? 32.691  -29.131 58.583  1.00 57.17  ? 128 TRP B CD2 1 
ATOM   3962 N NE1 . TRP B 1 133 ? 31.214  -27.582 57.921  1.00 54.80  ? 128 TRP B NE1 1 
ATOM   3963 C CE2 . TRP B 1 133 ? 31.533  -28.417 58.959  1.00 55.84  ? 128 TRP B CE2 1 
ATOM   3964 C CE3 . TRP B 1 133 ? 33.229  -30.079 59.478  1.00 59.05  ? 128 TRP B CE3 1 
ATOM   3965 C CZ2 . TRP B 1 133 ? 30.890  -28.616 60.200  1.00 57.85  ? 128 TRP B CZ2 1 
ATOM   3966 C CZ3 . TRP B 1 133 ? 32.593  -30.276 60.719  1.00 60.52  ? 128 TRP B CZ3 1 
ATOM   3967 C CH2 . TRP B 1 133 ? 31.434  -29.553 61.061  1.00 60.28  ? 128 TRP B CH2 1 
ATOM   3968 N N   . ARG B 1 134 ? 37.386  -29.081 55.586  1.00 58.22  ? 129 ARG B N   1 
ATOM   3969 C CA  . ARG B 1 134 ? 38.599  -29.690 55.070  1.00 59.86  ? 129 ARG B CA  1 
ATOM   3970 C C   . ARG B 1 134 ? 39.647  -29.724 56.181  1.00 59.83  ? 129 ARG B C   1 
ATOM   3971 O O   . ARG B 1 134 ? 40.320  -30.742 56.373  1.00 61.46  ? 129 ARG B O   1 
ATOM   3972 C CB  . ARG B 1 134 ? 39.089  -28.897 53.852  1.00 59.40  ? 129 ARG B CB  1 
ATOM   3973 C CG  . ARG B 1 134 ? 40.177  -29.557 53.004  1.00 64.01  ? 129 ARG B CG  1 
ATOM   3974 C CD  . ARG B 1 134 ? 40.241  -28.892 51.619  1.00 66.42  ? 129 ARG B CD  1 
ATOM   3975 N NE  . ARG B 1 134 ? 38.976  -28.989 50.892  1.00 67.02  ? 129 ARG B NE  1 
ATOM   3976 C CZ  . ARG B 1 134 ? 38.876  -29.004 49.562  1.00 70.60  ? 129 ARG B CZ  1 
ATOM   3977 N NH1 . ARG B 1 134 ? 39.974  -28.942 48.803  1.00 73.38  ? 129 ARG B NH1 1 
ATOM   3978 N NH2 . ARG B 1 134 ? 37.684  -29.110 48.979  1.00 69.87  ? 129 ARG B NH2 1 
ATOM   3979 N N   . GLY B 1 135 ? 39.763  -28.619 56.920  1.00 57.54  ? 130 GLY B N   1 
ATOM   3980 C CA  . GLY B 1 135 ? 40.711  -28.518 58.039  1.00 57.26  ? 130 GLY B CA  1 
ATOM   3981 C C   . GLY B 1 135 ? 40.353  -29.359 59.262  1.00 58.23  ? 130 GLY B C   1 
ATOM   3982 O O   . GLY B 1 135 ? 41.233  -29.905 59.902  1.00 59.21  ? 130 GLY B O   1 
ATOM   3983 N N   . ALA B 1 136 ? 39.059  -29.451 59.577  1.00 57.90  ? 131 ALA B N   1 
ATOM   3984 C CA  . ALA B 1 136 ? 38.560  -30.291 60.659  1.00 59.45  ? 131 ALA B CA  1 
ATOM   3985 C C   . ALA B 1 136 ? 38.829  -31.783 60.410  1.00 62.37  ? 131 ALA B C   1 
ATOM   3986 O O   . ALA B 1 136 ? 39.072  -32.543 61.341  1.00 64.00  ? 131 ALA B O   1 
ATOM   3987 C CB  . ALA B 1 136 ? 37.089  -30.052 60.871  1.00 58.33  ? 131 ALA B CB  1 
ATOM   3988 N N   . GLU B 1 137 ? 38.791  -32.180 59.146  1.00 63.13  ? 132 GLU B N   1 
ATOM   3989 C CA  . GLU B 1 137 ? 39.000  -33.555 58.749  1.00 65.87  ? 132 GLU B CA  1 
ATOM   3990 C C   . GLU B 1 137 ? 40.460  -33.872 58.953  1.00 66.43  ? 132 GLU B C   1 
ATOM   3991 O O   . GLU B 1 137 ? 40.809  -34.894 59.572  1.00 68.76  ? 132 GLU B O   1 
ATOM   3992 C CB  . GLU B 1 137 ? 38.612  -33.725 57.275  1.00 66.88  ? 132 GLU B CB  1 
ATOM   3993 C CG  . GLU B 1 137 ? 38.143  -35.138 56.863  1.00 71.58  ? 132 GLU B CG  1 
ATOM   3994 C CD  . GLU B 1 137 ? 37.256  -35.133 55.595  1.00 73.75  ? 132 GLU B CD  1 
ATOM   3995 O OE1 . GLU B 1 137 ? 36.659  -34.068 55.257  1.00 70.50  ? 132 GLU B OE1 1 
ATOM   3996 O OE2 . GLU B 1 137 ? 37.158  -36.203 54.946  1.00 76.54  ? 132 GLU B OE2 1 
ATOM   3997 N N   . SER B 1 138 ? 41.328  -32.986 58.473  1.00 63.98  ? 133 SER B N   1 
ATOM   3998 C CA  . SER B 1 138 ? 42.757  -33.257 58.567  1.00 64.50  ? 133 SER B CA  1 
ATOM   3999 C C   . SER B 1 138 ? 43.317  -33.076 59.982  1.00 63.75  ? 133 SER B C   1 
ATOM   4000 O O   . SER B 1 138 ? 44.314  -33.692 60.328  1.00 65.77  ? 133 SER B O   1 
ATOM   4001 C CB  . SER B 1 138 ? 43.537  -32.452 57.528  1.00 63.49  ? 133 SER B CB  1 
ATOM   4002 O OG  . SER B 1 138 ? 44.089  -31.276 58.076  1.00 63.10  ? 133 SER B OG  1 
ATOM   4003 N N   . LEU B 1 139 ? 42.685  -32.232 60.797  1.00 61.45  ? 134 LEU B N   1 
ATOM   4004 C CA  . LEU B 1 139 ? 43.075  -32.108 62.198  1.00 60.80  ? 134 LEU B CA  1 
ATOM   4005 C C   . LEU B 1 139 ? 42.680  -33.362 62.979  1.00 63.14  ? 134 LEU B C   1 
ATOM   4006 O O   . LEU B 1 139 ? 43.474  -33.848 63.761  1.00 64.10  ? 134 LEU B O   1 
ATOM   4007 C CB  . LEU B 1 139 ? 42.518  -30.836 62.870  1.00 58.25  ? 134 LEU B CB  1 
ATOM   4008 C CG  . LEU B 1 139 ? 42.772  -30.622 64.384  1.00 56.91  ? 134 LEU B CG  1 
ATOM   4009 C CD1 . LEU B 1 139 ? 44.257  -30.562 64.737  1.00 54.87  ? 134 LEU B CD1 1 
ATOM   4010 C CD2 . LEU B 1 139 ? 42.034  -29.407 64.956  1.00 50.94  ? 134 LEU B CD2 1 
ATOM   4011 N N   . GLU B 1 140 ? 41.472  -33.876 62.745  1.00 63.95  ? 135 GLU B N   1 
ATOM   4012 C CA  . GLU B 1 140 ? 40.989  -35.079 63.421  1.00 67.09  ? 135 GLU B CA  1 
ATOM   4013 C C   . GLU B 1 140 ? 41.833  -36.300 63.065  1.00 69.75  ? 135 GLU B C   1 
ATOM   4014 O O   . GLU B 1 140 ? 41.906  -37.261 63.844  1.00 72.35  ? 135 GLU B O   1 
ATOM   4015 C CB  . GLU B 1 140 ? 39.507  -35.325 63.126  1.00 67.68  ? 135 GLU B CB  1 
ATOM   4016 C CG  . GLU B 1 140 ? 38.787  -36.157 64.188  1.00 71.18  ? 135 GLU B CG  1 
ATOM   4017 C CD  . GLU B 1 140 ? 38.411  -37.556 63.705  1.00 75.60  ? 135 GLU B CD  1 
ATOM   4018 O OE1 . GLU B 1 140 ? 38.987  -38.574 64.203  1.00 79.27  ? 135 GLU B OE1 1 
ATOM   4019 O OE2 . GLU B 1 140 ? 37.533  -37.630 62.822  1.00 74.31  ? 135 GLU B OE2 1 
ATOM   4020 N N   . ALA B 1 141 ? 42.489  -36.250 61.904  1.00 69.01  ? 136 ALA B N   1 
ATOM   4021 C CA  . ALA B 1 141 ? 43.449  -37.276 61.511  1.00 71.19  ? 136 ALA B CA  1 
ATOM   4022 C C   . ALA B 1 141 ? 44.757  -37.116 62.279  1.00 71.23  ? 136 ALA B C   1 
ATOM   4023 O O   . ALA B 1 141 ? 45.368  -38.106 62.715  1.00 73.98  ? 136 ALA B O   1 
ATOM   4024 C CB  . ALA B 1 141 ? 43.708  -37.220 60.011  1.00 70.87  ? 136 ALA B CB  1 
ATOM   4025 N N   . ALA B 1 142 ? 45.186  -35.868 62.435  1.00 68.49  ? 137 ALA B N   1 
ATOM   4026 C CA  . ALA B 1 142 ? 46.469  -35.563 63.050  1.00 68.43  ? 137 ALA B CA  1 
ATOM   4027 C C   . ALA B 1 142 ? 46.469  -35.850 64.559  1.00 69.74  ? 137 ALA B C   1 
ATOM   4028 O O   . ALA B 1 142 ? 47.442  -36.349 65.084  1.00 70.99  ? 137 ALA B O   1 
ATOM   4029 C CB  . ALA B 1 142 ? 46.853  -34.131 62.772  1.00 65.89  ? 137 ALA B CB  1 
ATOM   4030 N N   . LEU B 1 143 ? 45.358  -35.542 65.227  1.00 69.33  ? 138 LEU B N   1 
ATOM   4031 C CA  . LEU B 1 143 ? 45.155  -35.847 66.641  1.00 70.78  ? 138 LEU B CA  1 
ATOM   4032 C C   . LEU B 1 143 ? 45.218  -37.341 66.969  1.00 74.30  ? 138 LEU B C   1 
ATOM   4033 O O   . LEU B 1 143 ? 45.869  -37.713 67.923  1.00 75.38  ? 138 LEU B O   1 
ATOM   4034 C CB  . LEU B 1 143 ? 43.811  -35.270 67.120  1.00 69.74  ? 138 LEU B CB  1 
ATOM   4035 C CG  . LEU B 1 143 ? 43.738  -33.756 67.336  1.00 66.45  ? 138 LEU B CG  1 
ATOM   4036 C CD1 . LEU B 1 143 ? 42.282  -33.274 67.399  1.00 65.91  ? 138 LEU B CD1 1 
ATOM   4037 C CD2 . LEU B 1 143 ? 44.532  -33.333 68.574  1.00 66.51  ? 138 LEU B CD2 1 
ATOM   4038 N N   . THR B 1 144 ? 44.523  -38.178 66.194  1.00 76.37  ? 139 THR B N   1 
ATOM   4039 C CA  . THR B 1 144 ? 44.475  -39.640 66.426  1.00 81.01  ? 139 THR B CA  1 
ATOM   4040 C C   . THR B 1 144 ? 45.804  -40.309 66.105  1.00 82.78  ? 139 THR B C   1 
ATOM   4041 O O   . THR B 1 144 ? 46.269  -41.178 66.850  1.00 85.97  ? 139 THR B O   1 
ATOM   4042 C CB  . THR B 1 144 ? 43.402  -40.331 65.564  1.00 82.13  ? 139 THR B CB  1 
ATOM   4043 O OG1 . THR B 1 144 ? 43.558  -39.916 64.201  1.00 81.18  ? 139 THR B OG1 1 
ATOM   4044 C CG2 . THR B 1 144 ? 42.003  -39.962 66.029  1.00 81.82  ? 139 THR B CG2 1 
ATOM   4045 N N   . HIS B 1 145 ? 46.402  -39.906 64.986  1.00 81.93  ? 140 HIS B N   1 
ATOM   4046 C CA  . HIS B 1 145 ? 47.713  -40.386 64.599  1.00 83.63  ? 140 HIS B CA  1 
ATOM   4047 C C   . HIS B 1 145 ? 48.743  -40.097 65.699  1.00 84.05  ? 140 HIS B C   1 
ATOM   4048 O O   . HIS B 1 145 ? 49.484  -40.990 66.116  1.00 86.62  ? 140 HIS B O   1 
ATOM   4049 C CB  . HIS B 1 145 ? 48.156  -39.794 63.251  1.00 81.87  ? 140 HIS B CB  1 
ATOM   4050 C CG  . HIS B 1 145 ? 49.567  -40.144 62.885  1.00 84.01  ? 140 HIS B CG  1 
ATOM   4051 N ND1 . HIS B 1 145 ? 49.998  -41.449 62.760  1.00 88.72  ? 140 HIS B ND1 1 
ATOM   4052 C CD2 . HIS B 1 145 ? 50.654  -39.366 62.665  1.00 82.77  ? 140 HIS B CD2 1 
ATOM   4053 C CE1 . HIS B 1 145 ? 51.288  -41.460 62.475  1.00 89.17  ? 140 HIS B CE1 1 
ATOM   4054 N NE2 . HIS B 1 145 ? 51.710  -40.208 62.410  1.00 86.78  ? 140 HIS B NE2 1 
ATOM   4055 N N   . ASN B 1 146 ? 48.766  -38.853 66.172  1.00 81.91  ? 141 ASN B N   1 
ATOM   4056 C CA  . ASN B 1 146 ? 49.657  -38.422 67.248  1.00 82.05  ? 141 ASN B CA  1 
ATOM   4057 C C   . ASN B 1 146 ? 49.349  -39.126 68.570  1.00 85.08  ? 141 ASN B C   1 
ATOM   4058 O O   . ASN B 1 146 ? 50.237  -39.286 69.406  1.00 86.79  ? 141 ASN B O   1 
ATOM   4059 C CB  . ASN B 1 146 ? 49.586  -36.898 67.379  1.00 78.73  ? 141 ASN B CB  1 
ATOM   4060 C CG  . ASN B 1 146 ? 50.346  -36.373 68.561  1.00 78.01  ? 141 ASN B CG  1 
ATOM   4061 O OD1 . ASN B 1 146 ? 49.863  -36.420 69.688  1.00 78.44  ? 141 ASN B OD1 1 
ATOM   4062 N ND2 . ASN B 1 146 ? 51.527  -35.831 68.310  1.00 76.24  ? 141 ASN B ND2 1 
ATOM   4063 N N   . ALA B 1 147 ? 48.108  -39.582 68.734  1.00 86.97  ? 142 ALA B N   1 
ATOM   4064 C CA  . ALA B 1 147 ? 47.691  -40.348 69.910  1.00 90.86  ? 142 ALA B CA  1 
ATOM   4065 C C   . ALA B 1 147 ? 48.090  -41.819 69.840  1.00 95.41  ? 142 ALA B C   1 
ATOM   4066 O O   . ALA B 1 147 ? 48.537  -42.393 70.832  1.00 97.47  ? 142 ALA B O   1 
ATOM   4067 C CB  . ALA B 1 147 ? 46.194  -40.234 70.119  1.00 90.69  ? 142 ALA B CB  1 
ATOM   4068 N N   . GLU B 1 148 ? 47.908  -42.431 68.672  1.00 97.47  ? 143 GLU B N   1 
ATOM   4069 C CA  . GLU B 1 148 ? 48.085  -43.879 68.523  1.00 102.35 ? 143 GLU B CA  1 
ATOM   4070 C C   . GLU B 1 148 ? 49.529  -44.316 68.290  1.00 104.13 ? 143 GLU B C   1 
ATOM   4071 O O   . GLU B 1 148 ? 49.821  -45.517 68.293  1.00 107.68 ? 143 GLU B O   1 
ATOM   4072 C CB  . GLU B 1 148 ? 47.166  -44.428 67.430  1.00 103.34 ? 143 GLU B CB  1 
ATOM   4073 C CG  . GLU B 1 148 ? 45.751  -44.701 67.919  1.00 105.26 ? 143 GLU B CG  1 
ATOM   4074 C CD  . GLU B 1 148 ? 44.791  -45.079 66.807  1.00 106.61 ? 143 GLU B CD  1 
ATOM   4075 O OE1 . GLU B 1 148 ? 44.869  -44.486 65.708  1.00 102.68 ? 143 GLU B OE1 1 
ATOM   4076 O OE2 . GLU B 1 148 ? 43.947  -45.971 67.044  1.00 110.78 ? 143 GLU B OE2 1 
ATOM   4077 N N   . VAL B 1 149 ? 50.426  -43.346 68.107  1.00 102.36 ? 144 VAL B N   1 
ATOM   4078 C CA  . VAL B 1 149 ? 51.857  -43.627 67.958  1.00 103.81 ? 144 VAL B CA  1 
ATOM   4079 C C   . VAL B 1 149 ? 52.432  -44.097 69.285  1.00 106.87 ? 144 VAL B C   1 
ATOM   4080 O O   . VAL B 1 149 ? 52.403  -43.338 70.261  1.00 105.83 ? 144 VAL B O   1 
ATOM   4081 C CB  . VAL B 1 149 ? 52.641  -42.382 67.468  1.00 100.45 ? 144 VAL B CB  1 
ATOM   4082 C CG1 . VAL B 1 149 ? 54.137  -42.600 67.578  1.00 100.85 ? 144 VAL B CG1 1 
ATOM   4083 C CG2 . VAL B 1 149 ? 52.270  -42.042 66.026  1.00 98.97  ? 144 VAL B CG2 1 
ATOM   4084 N N   . PRO B 1 150 ? 52.956  -45.351 69.332  1.00 110.95 ? 145 PRO B N   1 
ATOM   4085 C CA  . PRO B 1 150 ? 53.598  -45.845 70.541  1.00 113.58 ? 145 PRO B CA  1 
ATOM   4086 C C   . PRO B 1 150 ? 54.925  -45.141 70.787  1.00 112.60 ? 145 PRO B C   1 
ATOM   4087 O O   . PRO B 1 150 ? 55.498  -44.563 69.864  1.00 110.46 ? 145 PRO B O   1 
ATOM   4088 C CB  . PRO B 1 150 ? 53.831  -47.334 70.240  1.00 117.56 ? 145 PRO B CB  1 
ATOM   4089 C CG  . PRO B 1 150 ? 52.963  -47.651 69.094  1.00 117.45 ? 145 PRO B CG  1 
ATOM   4090 C CD  . PRO B 1 150 ? 52.917  -46.395 68.293  1.00 113.22 ? 145 PRO B CD  1 
ATOM   4091 N N   . ARG B 1 151 ? 55.400  -45.180 72.027  1.00 114.43 ? 146 ARG B N   1 
ATOM   4092 C CA  . ARG B 1 151 ? 56.662  -44.549 72.370  1.00 114.10 ? 146 ARG B CA  1 
ATOM   4093 C C   . ARG B 1 151 ? 57.819  -45.522 72.209  1.00 117.07 ? 146 ARG B C   1 
ATOM   4094 O O   . ARG B 1 151 ? 58.911  -45.110 71.820  1.00 116.00 ? 146 ARG B O   1 
ATOM   4095 C CB  . ARG B 1 151 ? 56.640  -44.020 73.806  1.00 113.97 ? 146 ARG B CB  1 
ATOM   4096 C CG  . ARG B 1 151 ? 57.231  -42.616 73.991  1.00 111.22 ? 146 ARG B CG  1 
ATOM   4097 C CD  . ARG B 1 151 ? 58.339  -42.274 72.993  1.00 109.94 ? 146 ARG B CD  1 
ATOM   4098 N NE  . ARG B 1 151 ? 59.030  -41.038 73.349  1.00 107.99 ? 146 ARG B NE  1 
ATOM   4099 C CZ  . ARG B 1 151 ? 60.271  -40.977 73.829  1.00 108.18 ? 146 ARG B CZ  1 
ATOM   4100 N NH1 . ARG B 1 151 ? 60.983  -42.084 73.995  1.00 110.56 ? 146 ARG B NH1 1 
ATOM   4101 N NH2 . ARG B 1 151 ? 60.809  -39.803 74.126  1.00 106.14 ? 146 ARG B NH2 1 
ATOM   4102 N N   . ARG B 1 152 ? 57.557  -46.806 72.479  1.00 121.46 ? 147 ARG B N   1 
ATOM   4103 C CA  . ARG B 1 152 ? 58.596  -47.848 72.647  1.00 125.35 ? 147 ARG B CA  1 
ATOM   4104 C C   . ARG B 1 152 ? 59.708  -47.883 71.579  1.00 125.25 ? 147 ARG B C   1 
ATOM   4105 O O   . ARG B 1 152 ? 60.798  -48.424 71.822  1.00 127.28 ? 147 ARG B O   1 
ATOM   4106 C CB  . ARG B 1 152 ? 57.963  -49.243 72.840  1.00 129.65 ? 147 ARG B CB  1 
ATOM   4107 C CG  . ARG B 1 152 ? 57.733  -50.040 71.559  1.00 131.68 ? 147 ARG B CG  1 
ATOM   4108 C CD  . ARG B 1 152 ? 56.330  -49.863 70.996  1.00 131.75 ? 147 ARG B CD  1 
ATOM   4109 N NE  . ARG B 1 152 ? 56.290  -50.065 69.546  1.00 132.30 ? 147 ARG B NE  1 
ATOM   4110 C CZ  . ARG B 1 152 ? 56.382  -51.246 68.933  1.00 136.02 ? 147 ARG B CZ  1 
ATOM   4111 N NH1 . ARG B 1 152 ? 56.339  -51.303 67.610  1.00 135.86 ? 147 ARG B NH1 1 
ATOM   4112 N NH2 . ARG B 1 152 ? 56.526  -52.369 69.629  1.00 140.27 ? 147 ARG B NH2 1 
ATOM   4113 N N   . ARG B 1 153 ? 59.402  -47.338 70.403  1.00 123.41 ? 148 ARG B N   1 
ATOM   4114 C CA  . ARG B 1 153 ? 60.392  -46.987 69.381  1.00 122.57 ? 148 ARG B CA  1 
ATOM   4115 C C   . ARG B 1 153 ? 59.766  -45.908 68.510  1.00 119.34 ? 148 ARG B C   1 
ATOM   4116 O O   . ARG B 1 153 ? 58.810  -46.175 67.775  1.00 119.90 ? 148 ARG B O   1 
ATOM   4117 C CB  . ARG B 1 153 ? 60.841  -48.207 68.548  1.00 125.92 ? 148 ARG B CB  1 
ATOM   4118 C CG  . ARG B 1 153 ? 59.725  -49.136 68.033  1.00 127.99 ? 148 ARG B CG  1 
ATOM   4119 C CD  . ARG B 1 153 ? 60.279  -50.259 67.154  1.00 130.81 ? 148 ARG B CD  1 
ATOM   4120 N NE  . ARG B 1 153 ? 61.244  -51.108 67.859  1.00 132.17 ? 148 ARG B NE  1 
ATOM   4121 C CZ  . ARG B 1 153 ? 61.983  -52.057 67.284  1.00 135.42 ? 148 ARG B CZ  1 
ATOM   4122 N NH1 . ARG B 1 153 ? 61.879  -52.290 65.982  1.00 135.62 ? 148 ARG B NH1 1 
ATOM   4123 N NH2 . ARG B 1 153 ? 62.838  -52.774 68.011  1.00 137.23 ? 148 ARG B NH2 1 
ATOM   4124 N N   . ALA B 1 154 ? 60.268  -44.679 68.609  1.00 116.45 ? 149 ALA B N   1 
ATOM   4125 C CA  . ALA B 1 154 ? 59.592  -43.570 67.937  1.00 113.43 ? 149 ALA B CA  1 
ATOM   4126 C C   . ALA B 1 154 ? 60.448  -42.369 67.534  1.00 110.92 ? 149 ALA B C   1 
ATOM   4127 O O   . ALA B 1 154 ? 61.190  -41.810 68.344  1.00 110.08 ? 149 ALA B O   1 
ATOM   4128 C CB  . ALA B 1 154 ? 58.393  -43.109 68.769  1.00 112.22 ? 149 ALA B CB  1 
ATOM   4129 N N   . GLN B 1 155 ? 60.329  -42.003 66.258  1.00 109.95 ? 150 GLN B N   1 
ATOM   4130 C CA  . GLN B 1 155 ? 60.672  -40.672 65.758  1.00 107.14 ? 150 GLN B CA  1 
ATOM   4131 C C   . GLN B 1 155 ? 59.537  -40.240 64.847  1.00 105.51 ? 150 GLN B C   1 
ATOM   4132 O O   . GLN B 1 155 ? 59.328  -39.047 64.614  1.00 102.99 ? 150 GLN B O   1 
ATOM   4133 C CB  . GLN B 1 155 ? 61.998  -40.651 64.996  1.00 107.97 ? 150 GLN B CB  1 
ATOM   4134 C CG  . GLN B 1 155 ? 62.316  -39.283 64.379  1.00 105.45 ? 150 GLN B CG  1 
ATOM   4135 C CD  . GLN B 1 155 ? 63.759  -39.128 63.945  1.00 106.69 ? 150 GLN B CD  1 
ATOM   4136 O OE1 . GLN B 1 155 ? 64.687  -39.561 64.636  1.00 108.24 ? 150 GLN B OE1 1 
ATOM   4137 N NE2 . GLN B 1 155 ? 63.958  -38.487 62.800  1.00 105.49 ? 150 GLN B NE2 1 
ATOM   4138 N N   . GLU B 1 156 ? 58.798  -41.221 64.331  1.00 107.07 ? 151 GLU B N   1 
ATOM   4139 C CA  . GLU B 1 156 ? 57.573  -40.930 63.603  1.00 105.62 ? 151 GLU B CA  1 
ATOM   4140 C C   . GLU B 1 156 ? 56.616  -40.187 64.542  1.00 103.59 ? 151 GLU B C   1 
ATOM   4141 O O   . GLU B 1 156 ? 55.703  -39.503 64.087  1.00 101.84 ? 151 GLU B O   1 
ATOM   4142 C CB  . GLU B 1 156 ? 56.942  -42.201 63.013  1.00 108.17 ? 151 GLU B CB  1 
ATOM   4143 C CG  . GLU B 1 156 ? 56.444  -43.226 64.024  1.00 110.17 ? 151 GLU B CG  1 
ATOM   4144 C CD  . GLU B 1 156 ? 55.653  -44.355 63.379  1.00 112.50 ? 151 GLU B CD  1 
ATOM   4145 O OE1 . GLU B 1 156 ? 54.559  -44.097 62.839  1.00 110.61 ? 151 GLU B OE1 1 
ATOM   4146 O OE2 . GLU B 1 156 ? 56.125  -45.512 63.426  1.00 116.59 ? 151 GLU B OE2 1 
ATOM   4147 N N   . ALA B 1 157 ? 56.861  -40.326 65.849  1.00 104.09 ? 152 ALA B N   1 
ATOM   4148 C CA  . ALA B 1 157 ? 56.186  -39.551 66.888  1.00 102.33 ? 152 ALA B CA  1 
ATOM   4149 C C   . ALA B 1 157 ? 56.582  -38.078 66.808  1.00 99.35  ? 152 ALA B C   1 
ATOM   4150 O O   . ALA B 1 157 ? 55.721  -37.197 66.776  1.00 97.14  ? 152 ALA B O   1 
ATOM   4151 C CB  . ALA B 1 157 ? 56.512  -40.111 68.270  1.00 103.91 ? 152 ALA B CB  1 
ATOM   4152 N N   . GLU B 1 158 ? 57.890  -37.826 66.785  1.00 99.26  ? 153 GLU B N   1 
ATOM   4153 C CA  . GLU B 1 158 ? 58.432  -36.487 66.573  1.00 96.91  ? 153 GLU B CA  1 
ATOM   4154 C C   . GLU B 1 158 ? 57.770  -35.841 65.358  1.00 94.73  ? 153 GLU B C   1 
ATOM   4155 O O   . GLU B 1 158 ? 57.319  -34.693 65.418  1.00 92.72  ? 153 GLU B O   1 
ATOM   4156 C CB  . GLU B 1 158 ? 59.944  -36.580 66.369  1.00 98.27  ? 153 GLU B CB  1 
ATOM   4157 C CG  . GLU B 1 158 ? 60.727  -35.305 66.620  1.00 97.73  ? 153 GLU B CG  1 
ATOM   4158 C CD  . GLU B 1 158 ? 62.178  -35.592 66.983  1.00 100.93 ? 153 GLU B CD  1 
ATOM   4159 O OE1 . GLU B 1 158 ? 62.908  -36.189 66.152  1.00 102.52 ? 153 GLU B OE1 1 
ATOM   4160 O OE2 . GLU B 1 158 ? 62.585  -35.227 68.110  1.00 101.67 ? 153 GLU B OE2 1 
ATOM   4161 N N   . GLU B 1 159 ? 57.682  -36.600 64.267  1.00 95.27  ? 154 GLU B N   1 
ATOM   4162 C CA  . GLU B 1 159 ? 57.083  -36.114 63.019  1.00 92.98  ? 154 GLU B CA  1 
ATOM   4163 C C   . GLU B 1 159 ? 55.550  -36.097 63.039  1.00 91.50  ? 154 GLU B C   1 
ATOM   4164 O O   . GLU B 1 159 ? 54.920  -35.460 62.179  1.00 89.82  ? 154 GLU B O   1 
ATOM   4165 C CB  . GLU B 1 159 ? 57.611  -36.902 61.817  1.00 94.81  ? 154 GLU B CB  1 
ATOM   4166 C CG  . GLU B 1 159 ? 59.106  -36.717 61.591  1.00 95.81  ? 154 GLU B CG  1 
ATOM   4167 C CD  . GLU B 1 159 ? 59.626  -37.496 60.403  1.00 98.16  ? 154 GLU B CD  1 
ATOM   4168 O OE1 . GLU B 1 159 ? 60.204  -38.579 60.620  1.00 100.47 ? 154 GLU B OE1 1 
ATOM   4169 O OE2 . GLU B 1 159 ? 59.454  -37.029 59.255  1.00 97.75  ? 154 GLU B OE2 1 
ATOM   4170 N N   . ALA B 1 160 ? 54.956  -36.795 64.009  1.00 91.71  ? 155 ALA B N   1 
ATOM   4171 C CA  . ALA B 1 160 ? 53.507  -36.726 64.235  1.00 90.27  ? 155 ALA B CA  1 
ATOM   4172 C C   . ALA B 1 160 ? 53.143  -35.433 64.952  1.00 87.36  ? 155 ALA B C   1 
ATOM   4173 O O   . ALA B 1 160 ? 52.130  -34.811 64.644  1.00 85.85  ? 155 ALA B O   1 
ATOM   4174 C CB  . ALA B 1 160 ? 53.014  -37.927 65.022  1.00 92.32  ? 155 ALA B CB  1 
ATOM   4175 N N   . GLY B 1 161 ? 53.982  -35.039 65.904  1.00 86.93  ? 156 GLY B N   1 
ATOM   4176 C CA  . GLY B 1 161 ? 53.797  -33.809 66.666  1.00 84.41  ? 156 GLY B CA  1 
ATOM   4177 C C   . GLY B 1 161 ? 53.911  -32.580 65.797  1.00 81.66  ? 156 GLY B C   1 
ATOM   4178 O O   . GLY B 1 161 ? 53.086  -31.666 65.891  1.00 79.95  ? 156 GLY B O   1 
ATOM   4179 N N   . ALA B 1 162 ? 54.933  -32.559 64.944  1.00 81.38  ? 157 ALA B N   1 
ATOM   4180 C CA  . ALA B 1 162 ? 55.093  -31.479 63.973  1.00 79.26  ? 157 ALA B CA  1 
ATOM   4181 C C   . ALA B 1 162 ? 53.940  -31.454 62.963  1.00 77.95  ? 157 ALA B C   1 
ATOM   4182 O O   . ALA B 1 162 ? 53.499  -30.382 62.559  1.00 76.04  ? 157 ALA B O   1 
ATOM   4183 C CB  . ALA B 1 162 ? 56.427  -31.582 63.266  1.00 80.20  ? 157 ALA B CB  1 
ATOM   4184 N N   . ALA B 1 163 ? 53.446  -32.633 62.577  1.00 78.67  ? 158 ALA B N   1 
ATOM   4185 C CA  . ALA B 1 163 ? 52.297  -32.726 61.683  1.00 77.47  ? 158 ALA B CA  1 
ATOM   4186 C C   . ALA B 1 163 ? 51.015  -32.222 62.356  1.00 75.96  ? 158 ALA B C   1 
ATOM   4187 O O   . ALA B 1 163 ? 50.199  -31.539 61.713  1.00 74.37  ? 158 ALA B O   1 
ATOM   4188 C CB  . ALA B 1 163 ? 52.118  -34.149 61.178  1.00 79.55  ? 158 ALA B CB  1 
ATOM   4189 N N   . LEU B 1 164 ? 50.849  -32.567 63.637  1.00 76.24  ? 159 LEU B N   1 
ATOM   4190 C CA  . LEU B 1 164 ? 49.728  -32.114 64.454  1.00 75.07  ? 159 LEU B CA  1 
ATOM   4191 C C   . LEU B 1 164 ? 49.792  -30.607 64.573  1.00 72.72  ? 159 LEU B C   1 
ATOM   4192 O O   . LEU B 1 164 ? 48.775  -29.937 64.501  1.00 71.54  ? 159 LEU B O   1 
ATOM   4193 C CB  . LEU B 1 164 ? 49.786  -32.750 65.845  1.00 77.21  ? 159 LEU B CB  1 
ATOM   4194 C CG  . LEU B 1 164 ? 48.928  -32.229 67.019  1.00 77.76  ? 159 LEU B CG  1 
ATOM   4195 C CD1 . LEU B 1 164 ? 48.720  -33.320 68.062  1.00 79.88  ? 159 LEU B CD1 1 
ATOM   4196 C CD2 . LEU B 1 164 ? 49.499  -30.976 67.691  1.00 77.72  ? 159 LEU B CD2 1 
ATOM   4197 N N   . ARG B 1 165 ? 51.001  -30.087 64.757  1.00 72.50  ? 160 ARG B N   1 
ATOM   4198 C CA  . ARG B 1 165 ? 51.247  -28.649 64.827  1.00 70.76  ? 160 ARG B CA  1 
ATOM   4199 C C   . ARG B 1 165 ? 50.711  -27.906 63.588  1.00 68.84  ? 160 ARG B C   1 
ATOM   4200 O O   . ARG B 1 165 ? 50.016  -26.903 63.718  1.00 67.33  ? 160 ARG B O   1 
ATOM   4201 C CB  . ARG B 1 165 ? 52.745  -28.397 64.996  1.00 71.70  ? 160 ARG B CB  1 
ATOM   4202 C CG  . ARG B 1 165 ? 53.121  -27.090 65.668  1.00 71.68  ? 160 ARG B CG  1 
ATOM   4203 C CD  . ARG B 1 165 ? 53.493  -27.302 67.142  1.00 74.47  ? 160 ARG B CD  1 
ATOM   4204 N NE  . ARG B 1 165 ? 54.908  -27.601 67.447  1.00 77.00  ? 160 ARG B NE  1 
ATOM   4205 C CZ  . ARG B 1 165 ? 55.936  -27.614 66.593  1.00 78.13  ? 160 ARG B CZ  1 
ATOM   4206 N NH1 . ARG B 1 165 ? 57.150  -27.902 67.043  1.00 79.11  ? 160 ARG B NH1 1 
ATOM   4207 N NH2 . ARG B 1 165 ? 55.779  -27.339 65.304  1.00 77.92  ? 160 ARG B NH2 1 
ATOM   4208 N N   . THR B 1 166 ? 51.007  -28.407 62.390  1.00 68.73  ? 161 THR B N   1 
ATOM   4209 C CA  . THR B 1 166 ? 50.561  -27.725 61.183  1.00 67.08  ? 161 THR B CA  1 
ATOM   4210 C C   . THR B 1 166 ? 49.053  -27.881 60.959  1.00 65.34  ? 161 THR B C   1 
ATOM   4211 O O   . THR B 1 166 ? 48.405  -26.965 60.454  1.00 63.54  ? 161 THR B O   1 
ATOM   4212 C CB  . THR B 1 166 ? 51.373  -28.137 59.926  1.00 68.42  ? 161 THR B CB  1 
ATOM   4213 O OG1 . THR B 1 166 ? 50.928  -29.415 59.445  1.00 70.82  ? 161 THR B OG1 1 
ATOM   4214 C CG2 . THR B 1 166 ? 52.876  -28.179 60.244  1.00 68.85  ? 161 THR B CG2 1 
ATOM   4215 N N   . ALA B 1 167 ? 48.494  -29.023 61.356  1.00 65.40  ? 162 ALA B N   1 
ATOM   4216 C CA  . ALA B 1 167 ? 47.044  -29.217 61.241  1.00 63.92  ? 162 ALA B CA  1 
ATOM   4217 C C   . ALA B 1 167 ? 46.288  -28.336 62.234  1.00 62.09  ? 162 ALA B C   1 
ATOM   4218 O O   . ALA B 1 167 ? 45.226  -27.837 61.916  1.00 60.93  ? 162 ALA B O   1 
ATOM   4219 C CB  . ALA B 1 167 ? 46.654  -30.673 61.407  1.00 66.06  ? 162 ALA B CB  1 
ATOM   4220 N N   . ARG B 1 168 ? 46.854  -28.125 63.420  1.00 61.79  ? 163 ARG B N   1 
ATOM   4221 C CA  . ARG B 1 168 ? 46.247  -27.217 64.399  1.00 60.44  ? 163 ARG B CA  1 
ATOM   4222 C C   . ARG B 1 168 ? 46.318  -25.747 63.954  1.00 58.13  ? 163 ARG B C   1 
ATOM   4223 O O   . ARG B 1 168 ? 45.332  -25.018 64.017  1.00 56.53  ? 163 ARG B O   1 
ATOM   4224 C CB  . ARG B 1 168 ? 46.869  -27.405 65.797  1.00 61.41  ? 163 ARG B CB  1 
ATOM   4225 C CG  . ARG B 1 168 ? 46.489  -26.328 66.821  1.00 60.42  ? 163 ARG B CG  1 
ATOM   4226 C CD  . ARG B 1 168 ? 45.004  -26.382 67.174  1.00 58.83  ? 163 ARG B CD  1 
ATOM   4227 N NE  . ARG B 1 168 ? 44.679  -27.677 67.775  1.00 60.66  ? 163 ARG B NE  1 
ATOM   4228 C CZ  . ARG B 1 168 ? 43.451  -28.084 68.075  1.00 60.20  ? 163 ARG B CZ  1 
ATOM   4229 N NH1 . ARG B 1 168 ? 42.408  -27.295 67.832  1.00 58.54  ? 163 ARG B NH1 1 
ATOM   4230 N NH2 . ARG B 1 168 ? 43.274  -29.278 68.620  1.00 61.20  ? 163 ARG B NH2 1 
ATOM   4231 N N   . ALA B 1 169 ? 47.495  -25.324 63.517  1.00 57.99  ? 164 ALA B N   1 
ATOM   4232 C CA  . ALA B 1 169 ? 47.698  -23.969 63.031  1.00 56.40  ? 164 ALA B CA  1 
ATOM   4233 C C   . ALA B 1 169 ? 46.741  -23.689 61.867  1.00 54.92  ? 164 ALA B C   1 
ATOM   4234 O O   . ALA B 1 169 ? 46.153  -22.607 61.780  1.00 53.69  ? 164 ALA B O   1 
ATOM   4235 C CB  . ALA B 1 169 ? 49.164  -23.779 62.613  1.00 56.51  ? 164 ALA B CB  1 
ATOM   4236 N N   . GLY B 1 170 ? 46.557  -24.695 61.006  1.00 55.02  ? 165 GLY B N   1 
ATOM   4237 C CA  . GLY B 1 170 ? 45.750  -24.569 59.802  1.00 52.76  ? 165 GLY B CA  1 
ATOM   4238 C C   . GLY B 1 170 ? 44.275  -24.506 60.145  1.00 51.98  ? 165 GLY B C   1 
ATOM   4239 O O   . GLY B 1 170 ? 43.534  -23.660 59.616  1.00 49.59  ? 165 GLY B O   1 
ATOM   4240 N N   . TYR B 1 171 ? 43.859  -25.414 61.031  1.00 52.53  ? 166 TYR B N   1 
ATOM   4241 C CA  . TYR B 1 171 ? 42.475  -25.509 61.475  1.00 51.69  ? 166 TYR B CA  1 
ATOM   4242 C C   . TYR B 1 171 ? 42.088  -24.254 62.213  1.00 50.42  ? 166 TYR B C   1 
ATOM   4243 O O   . TYR B 1 171 ? 40.968  -23.777 62.081  1.00 50.23  ? 166 TYR B O   1 
ATOM   4244 C CB  . TYR B 1 171 ? 42.277  -26.716 62.392  1.00 53.57  ? 166 TYR B CB  1 
ATOM   4245 C CG  . TYR B 1 171 ? 40.913  -26.752 63.049  1.00 53.90  ? 166 TYR B CG  1 
ATOM   4246 C CD1 . TYR B 1 171 ? 39.834  -27.363 62.418  1.00 51.71  ? 166 TYR B CD1 1 
ATOM   4247 C CD2 . TYR B 1 171 ? 40.706  -26.161 64.303  1.00 53.51  ? 166 TYR B CD2 1 
ATOM   4248 C CE1 . TYR B 1 171 ? 38.591  -27.398 63.008  1.00 54.11  ? 166 TYR B CE1 1 
ATOM   4249 C CE2 . TYR B 1 171 ? 39.457  -26.185 64.899  1.00 55.04  ? 166 TYR B CE2 1 
ATOM   4250 C CZ  . TYR B 1 171 ? 38.403  -26.812 64.251  1.00 53.58  ? 166 TYR B CZ  1 
ATOM   4251 O OH  . TYR B 1 171 ? 37.165  -26.840 64.840  1.00 51.36  ? 166 TYR B OH  1 
ATOM   4252 N N   . ARG B 1 172 ? 43.016  -23.711 62.988  1.00 50.72  ? 167 ARG B N   1 
ATOM   4253 C CA  . ARG B 1 172 ? 42.733  -22.498 63.741  1.00 50.71  ? 167 ARG B CA  1 
ATOM   4254 C C   . ARG B 1 172 ? 42.457  -21.321 62.820  1.00 48.50  ? 167 ARG B C   1 
ATOM   4255 O O   . ARG B 1 172 ? 41.520  -20.567 63.065  1.00 47.69  ? 167 ARG B O   1 
ATOM   4256 C CB  . ARG B 1 172 ? 43.872  -22.182 64.712  1.00 52.47  ? 167 ARG B CB  1 
ATOM   4257 C CG  . ARG B 1 172 ? 43.456  -21.360 65.910  1.00 55.34  ? 167 ARG B CG  1 
ATOM   4258 C CD  . ARG B 1 172 ? 44.682  -20.938 66.751  1.00 62.25  ? 167 ARG B CD  1 
ATOM   4259 N NE  . ARG B 1 172 ? 45.473  -22.072 67.252  1.00 66.66  ? 167 ARG B NE  1 
ATOM   4260 C CZ  . ARG B 1 172 ? 45.333  -22.644 68.452  1.00 69.97  ? 167 ARG B CZ  1 
ATOM   4261 N NH1 . ARG B 1 172 ? 44.418  -22.223 69.322  1.00 71.76  ? 167 ARG B NH1 1 
ATOM   4262 N NH2 . ARG B 1 172 ? 46.114  -23.656 68.785  1.00 70.92  ? 167 ARG B NH2 1 
ATOM   4263 N N   . GLY B 1 173 ? 43.260  -21.180 61.762  1.00 47.54  ? 168 GLY B N   1 
ATOM   4264 C CA  . GLY B 1 173 ? 43.047  -20.153 60.743  1.00 46.29  ? 168 GLY B CA  1 
ATOM   4265 C C   . GLY B 1 173 ? 41.709  -20.283 60.025  1.00 45.04  ? 168 GLY B C   1 
ATOM   4266 O O   . GLY B 1 173 ? 40.967  -19.320 59.898  1.00 43.79  ? 168 GLY B O   1 
ATOM   4267 N N   . ARG B 1 174 ? 41.397  -21.490 59.580  1.00 45.53  ? 169 ARG B N   1 
ATOM   4268 C CA  . ARG B 1 174 ? 40.106  -21.787 58.972  1.00 45.16  ? 169 ARG B CA  1 
ATOM   4269 C C   . ARG B 1 174 ? 38.924  -21.589 59.922  1.00 44.24  ? 169 ARG B C   1 
ATOM   4270 O O   . ARG B 1 174 ? 37.839  -21.266 59.485  1.00 43.29  ? 169 ARG B O   1 
ATOM   4271 C CB  . ARG B 1 174 ? 40.042  -23.240 58.475  1.00 47.12  ? 169 ARG B CB  1 
ATOM   4272 C CG  . ARG B 1 174 ? 41.310  -23.833 57.867  1.00 51.33  ? 169 ARG B CG  1 
ATOM   4273 C CD  . ARG B 1 174 ? 41.608  -23.346 56.447  1.00 55.43  ? 169 ARG B CD  1 
ATOM   4274 N NE  . ARG B 1 174 ? 42.768  -24.073 55.910  1.00 59.69  ? 169 ARG B NE  1 
ATOM   4275 C CZ  . ARG B 1 174 ? 42.699  -25.207 55.211  1.00 63.62  ? 169 ARG B CZ  1 
ATOM   4276 N NH1 . ARG B 1 174 ? 41.523  -25.767 54.937  1.00 64.85  ? 169 ARG B NH1 1 
ATOM   4277 N NH2 . ARG B 1 174 ? 43.811  -25.782 54.771  1.00 65.48  ? 169 ARG B NH2 1 
ATOM   4278 N N   . ALA B 1 175 ? 39.101  -21.819 61.216  1.00 44.51  ? 170 ALA B N   1 
ATOM   4279 C CA  . ALA B 1 175 ? 37.959  -21.656 62.097  1.00 44.74  ? 170 ALA B CA  1 
ATOM   4280 C C   . ALA B 1 175 ? 37.685  -20.166 62.269  1.00 43.69  ? 170 ALA B C   1 
ATOM   4281 O O   . ALA B 1 175 ? 36.542  -19.723 62.216  1.00 42.93  ? 170 ALA B O   1 
ATOM   4282 C CB  . ALA B 1 175 ? 38.175  -22.375 63.436  1.00 45.47  ? 170 ALA B CB  1 
ATOM   4283 N N   . LEU B 1 176 ? 38.756  -19.397 62.394  1.00 44.34  ? 171 LEU B N   1 
ATOM   4284 C CA  . LEU B 1 176 ? 38.673  -17.940 62.443  1.00 44.71  ? 171 LEU B CA  1 
ATOM   4285 C C   . LEU B 1 176 ? 38.095  -17.309 61.180  1.00 43.45  ? 171 LEU B C   1 
ATOM   4286 O O   . LEU B 1 176 ? 37.212  -16.452 61.268  1.00 43.84  ? 171 LEU B O   1 
ATOM   4287 C CB  . LEU B 1 176 ? 40.044  -17.350 62.783  1.00 44.99  ? 171 LEU B CB  1 
ATOM   4288 C CG  . LEU B 1 176 ? 40.444  -17.708 64.212  1.00 47.22  ? 171 LEU B CG  1 
ATOM   4289 C CD1 . LEU B 1 176 ? 41.921  -17.451 64.452  1.00 49.00  ? 171 LEU B CD1 1 
ATOM   4290 C CD2 . LEU B 1 176 ? 39.565  -16.977 65.246  1.00 47.38  ? 171 LEU B CD2 1 
ATOM   4291 N N   . ASP B 1 177 ? 38.564  -17.741 60.011  1.00 43.79  ? 172 ASP B N   1 
ATOM   4292 C CA  . ASP B 1 177 ? 38.075  -17.214 58.717  1.00 42.48  ? 172 ASP B CA  1 
ATOM   4293 C C   . ASP B 1 177 ? 36.591  -17.499 58.573  1.00 41.87  ? 172 ASP B C   1 
ATOM   4294 O O   . ASP B 1 177 ? 35.796  -16.617 58.219  1.00 40.31  ? 172 ASP B O   1 
ATOM   4295 C CB  . ASP B 1 177 ? 38.832  -17.830 57.521  1.00 42.74  ? 172 ASP B CB  1 
ATOM   4296 C CG  . ASP B 1 177 ? 40.306  -17.401 57.452  1.00 45.32  ? 172 ASP B CG  1 
ATOM   4297 O OD1 . ASP B 1 177 ? 40.666  -16.364 58.066  1.00 46.26  ? 172 ASP B OD1 1 
ATOM   4298 O OD2 . ASP B 1 177 ? 41.119  -18.117 56.798  1.00 47.96  ? 172 ASP B OD2 1 
ATOM   4299 N N   . TYR B 1 178 ? 36.222  -18.738 58.885  1.00 42.28  ? 173 TYR B N   1 
ATOM   4300 C CA  . TYR B 1 178 ? 34.837  -19.157 58.819  1.00 41.74  ? 173 TYR B CA  1 
ATOM   4301 C C   . TYR B 1 178 ? 33.975  -18.376 59.804  1.00 41.90  ? 173 TYR B C   1 
ATOM   4302 O O   . TYR B 1 178 ? 32.883  -17.952 59.464  1.00 41.52  ? 173 TYR B O   1 
ATOM   4303 C CB  . TYR B 1 178 ? 34.742  -20.675 59.064  1.00 42.85  ? 173 TYR B CB  1 
ATOM   4304 C CG  . TYR B 1 178 ? 33.422  -21.276 58.712  1.00 41.50  ? 173 TYR B CG  1 
ATOM   4305 C CD1 . TYR B 1 178 ? 32.998  -22.434 59.331  1.00 43.09  ? 173 TYR B CD1 1 
ATOM   4306 C CD2 . TYR B 1 178 ? 32.571  -20.671 57.767  1.00 40.35  ? 173 TYR B CD2 1 
ATOM   4307 C CE1 . TYR B 1 178 ? 31.782  -22.998 59.031  1.00 42.20  ? 173 TYR B CE1 1 
ATOM   4308 C CE2 . TYR B 1 178 ? 31.337  -21.230 57.452  1.00 38.43  ? 173 TYR B CE2 1 
ATOM   4309 C CZ  . TYR B 1 178 ? 30.961  -22.404 58.095  1.00 42.00  ? 173 TYR B CZ  1 
ATOM   4310 O OH  . TYR B 1 178 ? 29.763  -22.999 57.822  1.00 41.24  ? 173 TYR B OH  1 
ATOM   4311 N N   . ALA B 1 179 ? 34.463  -18.192 61.032  1.00 43.35  ? 174 ALA B N   1 
ATOM   4312 C CA  . ALA B 1 179 ? 33.749  -17.357 62.004  1.00 43.58  ? 174 ALA B CA  1 
ATOM   4313 C C   . ALA B 1 179 ? 33.568  -15.931 61.491  1.00 42.27  ? 174 ALA B C   1 
ATOM   4314 O O   . ALA B 1 179 ? 32.479  -15.382 61.571  1.00 41.89  ? 174 ALA B O   1 
ATOM   4315 C CB  . ALA B 1 179 ? 34.447  -17.358 63.358  1.00 44.99  ? 174 ALA B CB  1 
ATOM   4316 N N   . LEU B 1 180 ? 34.630  -15.344 60.961  1.00 41.79  ? 175 LEU B N   1 
ATOM   4317 C CA  . LEU B 1 180 ? 34.542  -14.016 60.364  1.00 41.98  ? 175 LEU B CA  1 
ATOM   4318 C C   . LEU B 1 180 ? 33.496  -13.961 59.216  1.00 41.01  ? 175 LEU B C   1 
ATOM   4319 O O   . LEU B 1 180 ? 32.682  -13.054 59.173  1.00 40.81  ? 175 LEU B O   1 
ATOM   4320 C CB  . LEU B 1 180 ? 35.928  -13.554 59.885  1.00 42.05  ? 175 LEU B CB  1 
ATOM   4321 C CG  . LEU B 1 180 ? 36.195  -12.084 59.505  1.00 43.66  ? 175 LEU B CG  1 
ATOM   4322 C CD1 . LEU B 1 180 ? 36.177  -11.865 58.017  1.00 44.62  ? 175 LEU B CD1 1 
ATOM   4323 C CD2 . LEU B 1 180 ? 35.242  -11.104 60.187  1.00 45.48  ? 175 LEU B CD2 1 
ATOM   4324 N N   . GLN B 1 181 ? 33.500  -14.945 58.315  1.00 40.29  ? 176 GLN B N   1 
ATOM   4325 C CA  . GLN B 1 181 ? 32.495  -14.999 57.241  1.00 39.01  ? 176 GLN B CA  1 
ATOM   4326 C C   . GLN B 1 181 ? 31.054  -15.102 57.791  1.00 38.84  ? 176 GLN B C   1 
ATOM   4327 O O   . GLN B 1 181 ? 30.137  -14.468 57.264  1.00 36.33  ? 176 GLN B O   1 
ATOM   4328 C CB  . GLN B 1 181 ? 32.816  -16.106 56.224  1.00 38.84  ? 176 GLN B CB  1 
ATOM   4329 C CG  . GLN B 1 181 ? 34.082  -15.819 55.361  1.00 38.97  ? 176 GLN B CG  1 
ATOM   4330 C CD  . GLN B 1 181 ? 33.997  -14.462 54.643  1.00 42.11  ? 176 GLN B CD  1 
ATOM   4331 O OE1 . GLN B 1 181 ? 34.959  -13.709 54.608  1.00 44.52  ? 176 GLN B OE1 1 
ATOM   4332 N NE2 . GLN B 1 181 ? 32.833  -14.148 54.092  1.00 39.87  ? 176 GLN B NE2 1 
ATOM   4333 N N   . ILE B 1 182 ? 30.890  -15.859 58.875  1.00 40.31  ? 177 ILE B N   1 
ATOM   4334 C CA  . ILE B 1 182 ? 29.598  -16.008 59.535  1.00 42.04  ? 177 ILE B CA  1 
ATOM   4335 C C   . ILE B 1 182 ? 29.091  -14.673 60.128  1.00 43.61  ? 177 ILE B C   1 
ATOM   4336 O O   . ILE B 1 182 ? 27.934  -14.301 59.919  1.00 42.60  ? 177 ILE B O   1 
ATOM   4337 C CB  . ILE B 1 182 ? 29.635  -17.125 60.600  1.00 43.51  ? 177 ILE B CB  1 
ATOM   4338 C CG1 . ILE B 1 182 ? 29.752  -18.497 59.915  1.00 43.47  ? 177 ILE B CG1 1 
ATOM   4339 C CG2 . ILE B 1 182 ? 28.387  -17.066 61.522  1.00 43.15  ? 177 ILE B CG2 1 
ATOM   4340 C CD1 . ILE B 1 182 ? 30.473  -19.530 60.741  1.00 44.37  ? 177 ILE B CD1 1 
ATOM   4341 N N   . ASN B 1 183 ? 29.944  -13.952 60.857  1.00 46.21  ? 178 ASN B N   1 
ATOM   4342 C CA  . ASN B 1 183 ? 29.556  -12.623 61.311  1.00 48.61  ? 178 ASN B CA  1 
ATOM   4343 C C   . ASN B 1 183 ? 29.139  -11.710 60.128  1.00 47.67  ? 178 ASN B C   1 
ATOM   4344 O O   . ASN B 1 183 ? 28.111  -11.070 60.196  1.00 47.29  ? 178 ASN B O   1 
ATOM   4345 C CB  . ASN B 1 183 ? 30.626  -11.974 62.189  1.00 50.34  ? 178 ASN B CB  1 
ATOM   4346 C CG  . ASN B 1 183 ? 30.120  -10.695 62.890  1.00 55.73  ? 178 ASN B CG  1 
ATOM   4347 O OD1 . ASN B 1 183 ? 29.800  -10.704 64.093  1.00 61.61  ? 178 ASN B OD1 1 
ATOM   4348 N ND2 . ASN B 1 183 ? 30.040  -9.592  62.137  1.00 57.14  ? 178 ASN B ND2 1 
ATOM   4349 N N   . VAL B 1 184 ? 29.923  -11.689 59.052  1.00 47.36  ? 179 VAL B N   1 
ATOM   4350 C CA  . VAL B 1 184 ? 29.619  -10.891 57.863  1.00 47.29  ? 179 VAL B CA  1 
ATOM   4351 C C   . VAL B 1 184 ? 28.253  -11.186 57.214  1.00 47.43  ? 179 VAL B C   1 
ATOM   4352 O O   . VAL B 1 184 ? 27.497  -10.256 56.903  1.00 47.32  ? 179 VAL B O   1 
ATOM   4353 C CB  . VAL B 1 184 ? 30.735  -11.021 56.774  1.00 47.24  ? 179 VAL B CB  1 
ATOM   4354 C CG1 . VAL B 1 184 ? 30.322  -10.304 55.478  1.00 45.45  ? 179 VAL B CG1 1 
ATOM   4355 C CG2 . VAL B 1 184 ? 32.061  -10.506 57.293  1.00 46.65  ? 179 VAL B CG2 1 
ATOM   4356 N N   . ILE B 1 185 ? 27.930  -12.457 56.986  1.00 48.21  ? 180 ILE B N   1 
ATOM   4357 C CA  . ILE B 1 185 ? 26.618  -12.765 56.393  1.00 49.10  ? 180 ILE B CA  1 
ATOM   4358 C C   . ILE B 1 185 ? 25.461  -12.562 57.371  1.00 49.93  ? 180 ILE B C   1 
ATOM   4359 O O   . ILE B 1 185 ? 24.353  -12.296 56.947  1.00 50.02  ? 180 ILE B O   1 
ATOM   4360 C CB  . ILE B 1 185 ? 26.539  -14.141 55.673  1.00 48.99  ? 180 ILE B CB  1 
ATOM   4361 C CG1 . ILE B 1 185 ? 26.870  -15.286 56.612  1.00 50.71  ? 180 ILE B CG1 1 
ATOM   4362 C CG2 . ILE B 1 185 ? 27.443  -14.160 54.439  1.00 50.09  ? 180 ILE B CG2 1 
ATOM   4363 C CD1 . ILE B 1 185 ? 25.644  -16.002 57.082  1.00 55.20  ? 180 ILE B CD1 1 
ATOM   4364 N N   . GLU B 1 186 ? 25.732  -12.666 58.663  1.00 51.64  ? 181 GLU B N   1 
ATOM   4365 C CA  . GLU B 1 186 ? 24.767  -12.299 59.685  1.00 54.40  ? 181 GLU B CA  1 
ATOM   4366 C C   . GLU B 1 186 ? 24.320  -10.846 59.448  1.00 54.18  ? 181 GLU B C   1 
ATOM   4367 O O   . GLU B 1 186 ? 23.126  -10.556 59.428  1.00 53.88  ? 181 GLU B O   1 
ATOM   4368 C CB  . GLU B 1 186 ? 25.364  -12.480 61.096  1.00 56.05  ? 181 GLU B CB  1 
ATOM   4369 C CG  . GLU B 1 186 ? 24.364  -12.605 62.251  1.00 61.76  ? 181 GLU B CG  1 
ATOM   4370 C CD  . GLU B 1 186 ? 24.327  -11.381 63.206  1.00 69.00  ? 181 GLU B CD  1 
ATOM   4371 O OE1 . GLU B 1 186 ? 23.974  -11.564 64.410  1.00 70.74  ? 181 GLU B OE1 1 
ATOM   4372 O OE2 . GLU B 1 186 ? 24.638  -10.243 62.755  1.00 70.15  ? 181 GLU B OE2 1 
ATOM   4373 N N   . ASP B 1 187 ? 25.281  -9.955  59.234  1.00 54.29  ? 182 ASP B N   1 
ATOM   4374 C CA  . ASP B 1 187 ? 24.984  -8.542  59.049  1.00 54.89  ? 182 ASP B CA  1 
ATOM   4375 C C   . ASP B 1 187 ? 24.375  -8.266  57.681  1.00 53.18  ? 182 ASP B C   1 
ATOM   4376 O O   . ASP B 1 187 ? 23.434  -7.499  57.573  1.00 52.40  ? 182 ASP B O   1 
ATOM   4377 C CB  . ASP B 1 187 ? 26.237  -7.695  59.259  1.00 55.74  ? 182 ASP B CB  1 
ATOM   4378 C CG  . ASP B 1 187 ? 26.562  -7.490  60.735  1.00 59.91  ? 182 ASP B CG  1 
ATOM   4379 O OD1 . ASP B 1 187 ? 25.656  -7.663  61.586  1.00 63.09  ? 182 ASP B OD1 1 
ATOM   4380 O OD2 . ASP B 1 187 ? 27.727  -7.153  61.050  1.00 62.15  ? 182 ASP B OD2 1 
ATOM   4381 N N   . LYS B 1 188 ? 24.910  -8.919  56.654  1.00 52.83  ? 183 LYS B N   1 
ATOM   4382 C CA  . LYS B 1 188 ? 24.436  -8.766  55.278  1.00 52.43  ? 183 LYS B CA  1 
ATOM   4383 C C   . LYS B 1 188 ? 22.969  -9.242  55.137  1.00 52.07  ? 183 LYS B C   1 
ATOM   4384 O O   . LYS B 1 188 ? 22.130  -8.527  54.592  1.00 50.84  ? 183 LYS B O   1 
ATOM   4385 C CB  . LYS B 1 188 ? 25.380  -9.500  54.325  1.00 51.97  ? 183 LYS B CB  1 
ATOM   4386 C CG  . LYS B 1 188 ? 25.352  -9.038  52.889  1.00 53.04  ? 183 LYS B CG  1 
ATOM   4387 C CD  . LYS B 1 188 ? 26.527  -9.660  52.115  1.00 55.03  ? 183 LYS B CD  1 
ATOM   4388 C CE  . LYS B 1 188 ? 26.596  -9.115  50.691  1.00 57.51  ? 183 LYS B CE  1 
ATOM   4389 N NZ  . LYS B 1 188 ? 27.860  -9.538  49.961  1.00 60.10  ? 183 LYS B NZ  1 
ATOM   4390 N N   . ARG B 1 189 ? 22.662  -10.426 55.666  1.00 52.59  ? 184 ARG B N   1 
ATOM   4391 C CA  . ARG B 1 189 ? 21.281  -10.888 55.714  1.00 53.17  ? 184 ARG B CA  1 
ATOM   4392 C C   . ARG B 1 189 ? 20.360  -9.783  56.233  1.00 53.02  ? 184 ARG B C   1 
ATOM   4393 O O   . ARG B 1 189 ? 19.418  -9.396  55.545  1.00 52.41  ? 184 ARG B O   1 
ATOM   4394 C CB  . ARG B 1 189 ? 21.142  -12.148 56.561  1.00 54.62  ? 184 ARG B CB  1 
ATOM   4395 C CG  . ARG B 1 189 ? 19.704  -12.545 56.826  1.00 58.32  ? 184 ARG B CG  1 
ATOM   4396 C CD  . ARG B 1 189 ? 19.581  -13.799 57.683  1.00 65.06  ? 184 ARG B CD  1 
ATOM   4397 N NE  . ARG B 1 189 ? 20.169  -13.681 59.022  1.00 70.14  ? 184 ARG B NE  1 
ATOM   4398 C CZ  . ARG B 1 189 ? 19.594  -13.092 60.074  1.00 73.75  ? 184 ARG B CZ  1 
ATOM   4399 N NH1 . ARG B 1 189 ? 20.232  -13.064 61.240  1.00 77.06  ? 184 ARG B NH1 1 
ATOM   4400 N NH2 . ARG B 1 189 ? 18.400  -12.516 59.973  1.00 74.13  ? 184 ARG B NH2 1 
ATOM   4401 N N   . LYS B 1 190 ? 20.665  -9.255  57.417  1.00 53.24  ? 185 LYS B N   1 
ATOM   4402 C CA  . LYS B 1 190 ? 19.850  -8.220  58.039  1.00 53.50  ? 185 LYS B CA  1 
ATOM   4403 C C   . LYS B 1 190 ? 19.621  -6.985  57.165  1.00 51.80  ? 185 LYS B C   1 
ATOM   4404 O O   . LYS B 1 190 ? 18.476  -6.629  56.908  1.00 51.16  ? 185 LYS B O   1 
ATOM   4405 C CB  . LYS B 1 190 ? 20.432  -7.801  59.397  1.00 55.30  ? 185 LYS B CB  1 
ATOM   4406 C CG  . LYS B 1 190 ? 20.148  -8.787  60.513  1.00 59.04  ? 185 LYS B CG  1 
ATOM   4407 C CD  . LYS B 1 190 ? 20.692  -8.273  61.846  1.00 63.83  ? 185 LYS B CD  1 
ATOM   4408 C CE  . LYS B 1 190 ? 21.161  -9.413  62.735  1.00 66.29  ? 185 LYS B CE  1 
ATOM   4409 N NZ  . LYS B 1 190 ? 21.607  -8.924  64.091  1.00 69.76  ? 185 LYS B NZ  1 
ATOM   4410 N N   . PHE B 1 191 ? 20.696  -6.331  56.729  1.00 50.87  ? 186 PHE B N   1 
ATOM   4411 C CA  . PHE B 1 191 ? 20.592  -5.087  55.949  1.00 50.48  ? 186 PHE B CA  1 
ATOM   4412 C C   . PHE B 1 191 ? 20.043  -5.290  54.536  1.00 48.05  ? 186 PHE B C   1 
ATOM   4413 O O   . PHE B 1 191 ? 19.428  -4.394  53.995  1.00 47.75  ? 186 PHE B O   1 
ATOM   4414 C CB  . PHE B 1 191 ? 21.942  -4.325  55.878  1.00 51.54  ? 186 PHE B CB  1 
ATOM   4415 C CG  . PHE B 1 191 ? 22.090  -3.451  54.632  1.00 53.36  ? 186 PHE B CG  1 
ATOM   4416 C CD1 . PHE B 1 191 ? 21.604  -2.133  54.612  1.00 55.79  ? 186 PHE B CD1 1 
ATOM   4417 C CD2 . PHE B 1 191 ? 22.680  -3.964  53.460  1.00 53.59  ? 186 PHE B CD2 1 
ATOM   4418 C CE1 . PHE B 1 191 ? 21.726  -1.340  53.449  1.00 55.96  ? 186 PHE B CE1 1 
ATOM   4419 C CE2 . PHE B 1 191 ? 22.807  -3.179  52.300  1.00 52.75  ? 186 PHE B CE2 1 
ATOM   4420 C CZ  . PHE B 1 191 ? 22.333  -1.876  52.293  1.00 54.61  ? 186 PHE B CZ  1 
ATOM   4421 N N   . ASP B 1 192 ? 20.308  -6.440  53.924  1.00 47.04  ? 187 ASP B N   1 
ATOM   4422 C CA  . ASP B 1 192 ? 19.846  -6.689  52.564  1.00 45.76  ? 187 ASP B CA  1 
ATOM   4423 C C   . ASP B 1 192 ? 18.351  -6.943  52.527  1.00 44.68  ? 187 ASP B C   1 
ATOM   4424 O O   . ASP B 1 192 ? 17.697  -6.595  51.536  1.00 44.25  ? 187 ASP B O   1 
ATOM   4425 C CB  . ASP B 1 192 ? 20.584  -7.863  51.899  1.00 46.44  ? 187 ASP B CB  1 
ATOM   4426 C CG  . ASP B 1 192 ? 22.008  -7.494  51.440  1.00 48.86  ? 187 ASP B CG  1 
ATOM   4427 O OD1 . ASP B 1 192 ? 22.498  -6.387  51.779  1.00 49.91  ? 187 ASP B OD1 1 
ATOM   4428 O OD2 . ASP B 1 192 ? 22.630  -8.330  50.737  1.00 52.22  ? 187 ASP B OD2 1 
ATOM   4429 N N   . ILE B 1 193 ? 17.817  -7.559  53.582  1.00 43.42  ? 188 ILE B N   1 
ATOM   4430 C CA  . ILE B 1 193 ? 16.372  -7.826  53.667  1.00 42.33  ? 188 ILE B CA  1 
ATOM   4431 C C   . ILE B 1 193 ? 15.639  -6.535  53.974  1.00 41.58  ? 188 ILE B C   1 
ATOM   4432 O O   . ILE B 1 193 ? 14.666  -6.198  53.332  1.00 40.57  ? 188 ILE B O   1 
ATOM   4433 C CB  . ILE B 1 193 ? 16.057  -8.900  54.724  1.00 43.09  ? 188 ILE B CB  1 
ATOM   4434 C CG1 . ILE B 1 193 ? 16.491  -10.268 54.203  1.00 42.67  ? 188 ILE B CG1 1 
ATOM   4435 C CG2 . ILE B 1 193 ? 14.580  -8.902  55.104  1.00 43.81  ? 188 ILE B CG2 1 
ATOM   4436 C CD1 . ILE B 1 193 ? 16.604  -11.283 55.320  1.00 44.19  ? 188 ILE B CD1 1 
ATOM   4437 N N   . MET B 1 194 ? 16.134  -5.797  54.956  1.00 42.17  ? 189 MET B N   1 
ATOM   4438 C CA  . MET B 1 194 ? 15.524  -4.534  55.311  1.00 42.17  ? 189 MET B CA  1 
ATOM   4439 C C   . MET B 1 194 ? 15.598  -3.479  54.187  1.00 40.66  ? 189 MET B C   1 
ATOM   4440 O O   . MET B 1 194 ? 14.624  -2.781  53.958  1.00 40.10  ? 189 MET B O   1 
ATOM   4441 C CB  . MET B 1 194 ? 16.087  -4.020  56.632  1.00 44.02  ? 189 MET B CB  1 
ATOM   4442 C CG  . MET B 1 194 ? 15.528  -4.791  57.823  1.00 46.95  ? 189 MET B CG  1 
ATOM   4443 S SD  . MET B 1 194 ? 16.099  -4.171  59.415  1.00 52.85  ? 189 MET B SD  1 
ATOM   4444 C CE  . MET B 1 194 ? 17.834  -4.605  59.395  1.00 49.45  ? 189 MET B CE  1 
ATOM   4445 N N   . GLU B 1 195 ? 16.728  -3.387  53.484  1.00 38.73  ? 190 GLU B N   1 
ATOM   4446 C CA  . GLU B 1 195 ? 16.820  -2.496  52.333  1.00 38.83  ? 190 GLU B CA  1 
ATOM   4447 C C   . GLU B 1 195 ? 15.883  -2.992  51.202  1.00 35.84  ? 190 GLU B C   1 
ATOM   4448 O O   . GLU B 1 195 ? 15.245  -2.188  50.555  1.00 35.34  ? 190 GLU B O   1 
ATOM   4449 C CB  . GLU B 1 195 ? 18.282  -2.351  51.822  1.00 39.08  ? 190 GLU B CB  1 
ATOM   4450 C CG  . GLU B 1 195 ? 18.639  -0.925  51.410  1.00 46.46  ? 190 GLU B CG  1 
ATOM   4451 C CD  . GLU B 1 195 ? 18.928  -0.732  49.925  1.00 54.16  ? 190 GLU B CD  1 
ATOM   4452 O OE1 . GLU B 1 195 ? 19.254  -1.729  49.214  1.00 55.42  ? 190 GLU B OE1 1 
ATOM   4453 O OE2 . GLU B 1 195 ? 18.845  0.442   49.464  1.00 55.77  ? 190 GLU B OE2 1 
ATOM   4454 N N   . PHE B 1 196 ? 15.815  -4.310  50.996  1.00 33.93  ? 191 PHE B N   1 
ATOM   4455 C CA  . PHE B 1 196 ? 14.886  -4.903  50.039  1.00 33.15  ? 191 PHE B CA  1 
ATOM   4456 C C   . PHE B 1 196 ? 13.442  -4.444  50.333  1.00 33.76  ? 191 PHE B C   1 
ATOM   4457 O O   . PHE B 1 196 ? 12.788  -3.815  49.500  1.00 33.41  ? 191 PHE B O   1 
ATOM   4458 C CB  . PHE B 1 196 ? 15.005  -6.436  50.037  1.00 32.82  ? 191 PHE B CB  1 
ATOM   4459 C CG  . PHE B 1 196 ? 13.850  -7.141  49.349  1.00 33.53  ? 191 PHE B CG  1 
ATOM   4460 C CD1 . PHE B 1 196 ? 13.659  -7.025  47.968  1.00 33.15  ? 191 PHE B CD1 1 
ATOM   4461 C CD2 . PHE B 1 196 ? 12.965  -7.904  50.078  1.00 34.72  ? 191 PHE B CD2 1 
ATOM   4462 C CE1 . PHE B 1 196 ? 12.618  -7.655  47.343  1.00 34.56  ? 191 PHE B CE1 1 
ATOM   4463 C CE2 . PHE B 1 196 ? 11.913  -8.545  49.450  1.00 34.83  ? 191 PHE B CE2 1 
ATOM   4464 C CZ  . PHE B 1 196 ? 11.741  -8.414  48.088  1.00 33.19  ? 191 PHE B CZ  1 
ATOM   4465 N N   . VAL B 1 197 ? 12.967  -4.695  51.540  1.00 34.54  ? 192 VAL B N   1 
ATOM   4466 C CA  . VAL B 1 197 ? 11.607  -4.264  51.879  1.00 35.34  ? 192 VAL B CA  1 
ATOM   4467 C C   . VAL B 1 197 ? 11.478  -2.715  51.826  1.00 35.70  ? 192 VAL B C   1 
ATOM   4468 O O   . VAL B 1 197 ? 10.434  -2.180  51.458  1.00 35.85  ? 192 VAL B O   1 
ATOM   4469 C CB  . VAL B 1 197 ? 11.116  -4.850  53.244  1.00 35.30  ? 192 VAL B CB  1 
ATOM   4470 C CG1 . VAL B 1 197 ? 9.626   -4.630  53.379  1.00 37.78  ? 192 VAL B CG1 1 
ATOM   4471 C CG2 . VAL B 1 197 ? 11.372  -6.345  53.317  1.00 33.10  ? 192 VAL B CG2 1 
ATOM   4472 N N   . LEU B 1 198 ? 12.530  -1.985  52.174  1.00 36.29  ? 193 LEU B N   1 
ATOM   4473 C CA  . LEU B 1 198 ? 12.421  -0.511  52.114  1.00 36.19  ? 193 LEU B CA  1 
ATOM   4474 C C   . LEU B 1 198 ? 12.297  0.019   50.654  1.00 35.22  ? 193 LEU B C   1 
ATOM   4475 O O   . LEU B 1 198 ? 11.575  0.993   50.402  1.00 35.80  ? 193 LEU B O   1 
ATOM   4476 C CB  . LEU B 1 198 ? 13.590  0.162   52.859  1.00 37.04  ? 193 LEU B CB  1 
ATOM   4477 C CG  . LEU B 1 198 ? 13.643  1.699   52.745  1.00 38.44  ? 193 LEU B CG  1 
ATOM   4478 C CD1 . LEU B 1 198 ? 12.383  2.416   53.317  1.00 38.44  ? 193 LEU B CD1 1 
ATOM   4479 C CD2 . LEU B 1 198 ? 14.925  2.265   53.373  1.00 39.39  ? 193 LEU B CD2 1 
ATOM   4480 N N   . ARG B 1 199 ? 13.029  -0.599  49.720  1.00 32.93  ? 194 ARG B N   1 
ATOM   4481 C CA  . ARG B 1 199 ? 12.918  -0.273  48.300  1.00 32.32  ? 194 ARG B CA  1 
ATOM   4482 C C   . ARG B 1 199 ? 11.544  -0.609  47.690  1.00 31.13  ? 194 ARG B C   1 
ATOM   4483 O O   . ARG B 1 199 ? 11.024  0.149   46.876  1.00 31.85  ? 194 ARG B O   1 
ATOM   4484 C CB  . ARG B 1 199 ? 14.075  -0.902  47.476  1.00 31.63  ? 194 ARG B CB  1 
ATOM   4485 C CG  . ARG B 1 199 ? 15.457  -0.252  47.741  1.00 33.79  ? 194 ARG B CG  1 
ATOM   4486 C CD  . ARG B 1 199 ? 16.556  -0.885  46.893  1.00 39.68  ? 194 ARG B CD  1 
ATOM   4487 N NE  . ARG B 1 199 ? 16.546  -0.430  45.490  1.00 40.39  ? 194 ARG B NE  1 
ATOM   4488 C CZ  . ARG B 1 199 ? 17.151  -1.069  44.479  1.00 42.33  ? 194 ARG B CZ  1 
ATOM   4489 N NH1 . ARG B 1 199 ? 17.820  -2.211  44.701  1.00 39.25  ? 194 ARG B NH1 1 
ATOM   4490 N NH2 . ARG B 1 199 ? 17.084  -0.565  43.238  1.00 38.94  ? 194 ARG B NH2 1 
ATOM   4491 N N   . LEU B 1 200 ? 10.976  -1.748  48.047  1.00 30.30  ? 195 LEU B N   1 
ATOM   4492 C CA  . LEU B 1 200 ? 9.588   -2.042  47.644  1.00 31.16  ? 195 LEU B CA  1 
ATOM   4493 C C   . LEU B 1 200 ? 8.644   -0.952  48.141  1.00 31.28  ? 195 LEU B C   1 
ATOM   4494 O O   . LEU B 1 200 ? 7.812   -0.474  47.391  1.00 31.42  ? 195 LEU B O   1 
ATOM   4495 C CB  . LEU B 1 200 ? 9.085   -3.382  48.161  1.00 30.68  ? 195 LEU B CB  1 
ATOM   4496 C CG  . LEU B 1 200 ? 9.853   -4.643  47.722  1.00 32.20  ? 195 LEU B CG  1 
ATOM   4497 C CD1 . LEU B 1 200 ? 9.337   -5.798  48.574  1.00 34.71  ? 195 LEU B CD1 1 
ATOM   4498 C CD2 . LEU B 1 200 ? 9.585   -4.942  46.257  1.00 32.09  ? 195 LEU B CD2 1 
ATOM   4499 N N   . VAL B 1 201 ? 8.790   -0.556  49.389  1.00 32.10  ? 196 VAL B N   1 
ATOM   4500 C CA  . VAL B 1 201 ? 7.946   0.496   49.926  1.00 34.04  ? 196 VAL B CA  1 
ATOM   4501 C C   . VAL B 1 201 ? 8.167   1.839   49.237  1.00 34.21  ? 196 VAL B C   1 
ATOM   4502 O O   . VAL B 1 201 ? 7.207   2.506   48.887  1.00 34.82  ? 196 VAL B O   1 
ATOM   4503 C CB  . VAL B 1 201 ? 8.011   0.558   51.491  1.00 35.77  ? 196 VAL B CB  1 
ATOM   4504 C CG1 . VAL B 1 201 ? 7.462   1.864   52.039  1.00 35.60  ? 196 VAL B CG1 1 
ATOM   4505 C CG2 . VAL B 1 201 ? 7.193   -0.640  52.066  1.00 35.66  ? 196 VAL B CG2 1 
ATOM   4506 N N   . GLU B 1 202 ? 9.419   2.221   49.019  1.00 34.66  ? 197 GLU B N   1 
ATOM   4507 C CA  . GLU B 1 202 ? 9.722   3.501   48.330  1.00 35.48  ? 197 GLU B CA  1 
ATOM   4508 C C   . GLU B 1 202 ? 9.194   3.526   46.875  1.00 33.24  ? 197 GLU B C   1 
ATOM   4509 O O   . GLU B 1 202 ? 8.842   4.580   46.365  1.00 33.06  ? 197 GLU B O   1 
ATOM   4510 C CB  . GLU B 1 202 ? 11.244  3.780   48.343  1.00 36.75  ? 197 GLU B CB  1 
ATOM   4511 C CG  . GLU B 1 202 ? 11.779  4.210   49.703  1.00 41.19  ? 197 GLU B CG  1 
ATOM   4512 C CD  . GLU B 1 202 ? 11.202  5.536   50.179  1.00 46.72  ? 197 GLU B CD  1 
ATOM   4513 O OE1 . GLU B 1 202 ? 10.863  5.659   51.376  1.00 48.26  ? 197 GLU B OE1 1 
ATOM   4514 O OE2 . GLU B 1 202 ? 11.056  6.455   49.346  1.00 50.11  ? 197 GLU B OE2 1 
ATOM   4515 N N   . ALA B 1 203 ? 9.125   2.365   46.224  1.00 30.68  ? 198 ALA B N   1 
ATOM   4516 C CA  . ALA B 1 203 ? 8.629   2.283   44.860  1.00 30.18  ? 198 ALA B CA  1 
ATOM   4517 C C   . ALA B 1 203 ? 7.093   2.368   44.847  1.00 30.70  ? 198 ALA B C   1 
ATOM   4518 O O   . ALA B 1 203 ? 6.511   2.968   43.951  1.00 30.08  ? 198 ALA B O   1 
ATOM   4519 C CB  . ALA B 1 203 ? 9.090   0.980   44.172  1.00 29.40  ? 198 ALA B CB  1 
ATOM   4520 N N   . GLN B 1 204 ? 6.438   1.718   45.810  1.00 31.72  ? 199 GLN B N   1 
ATOM   4521 C CA  . GLN B 1 204 ? 5.006   1.968   46.005  1.00 32.74  ? 199 GLN B CA  1 
ATOM   4522 C C   . GLN B 1 204 ? 4.752   3.455   46.175  1.00 33.34  ? 199 GLN B C   1 
ATOM   4523 O O   . GLN B 1 204 ? 3.812   3.994   45.581  1.00 34.90  ? 199 GLN B O   1 
ATOM   4524 C CB  . GLN B 1 204 ? 4.456   1.203   47.201  1.00 32.97  ? 199 GLN B CB  1 
ATOM   4525 C CG  . GLN B 1 204 ? 4.589   -0.302  47.058  1.00 35.65  ? 199 GLN B CG  1 
ATOM   4526 C CD  . GLN B 1 204 ? 3.604   -0.913  46.102  1.00 35.97  ? 199 GLN B CD  1 
ATOM   4527 O OE1 . GLN B 1 204 ? 2.534   -0.380  45.894  1.00 40.84  ? 199 GLN B OE1 1 
ATOM   4528 N NE2 . GLN B 1 204 ? 3.938   -2.063  45.558  1.00 37.85  ? 199 GLN B NE2 1 
ATOM   4529 N N   . ALA B 1 205 ? 5.586   4.138   46.945  1.00 33.67  ? 200 ALA B N   1 
ATOM   4530 C CA  . ALA B 1 205 ? 5.270   5.560   47.280  1.00 34.81  ? 200 ALA B CA  1 
ATOM   4531 C C   . ALA B 1 205 ? 5.430   6.487   46.101  1.00 34.89  ? 200 ALA B C   1 
ATOM   4532 O O   . ALA B 1 205 ? 4.612   7.358   45.906  1.00 36.33  ? 200 ALA B O   1 
ATOM   4533 C CB  . ALA B 1 205 ? 6.083   6.077   48.474  1.00 34.64  ? 200 ALA B CB  1 
ATOM   4534 N N   . THR B 1 206 ? 6.504   6.330   45.333  1.00 34.89  ? 201 THR B N   1 
ATOM   4535 C CA  . THR B 1 206 ? 6.621   7.023   44.056  1.00 35.34  ? 201 THR B CA  1 
ATOM   4536 C C   . THR B 1 206 ? 5.383   6.784   43.152  1.00 33.83  ? 201 THR B C   1 
ATOM   4537 O O   . THR B 1 206 ? 4.839   7.733   42.595  1.00 33.55  ? 201 THR B O   1 
ATOM   4538 C CB  . THR B 1 206 ? 7.904   6.581   43.315  1.00 35.88  ? 201 THR B CB  1 
ATOM   4539 O OG1 . THR B 1 206 ? 9.029   6.829   44.157  1.00 38.13  ? 201 THR B OG1 1 
ATOM   4540 C CG2 . THR B 1 206 ? 8.102   7.350   41.997  1.00 35.20  ? 201 THR B CG2 1 
ATOM   4541 N N   . HIS B 1 207 ? 4.957   5.521   43.016  1.00 31.86  ? 202 HIS B N   1 
ATOM   4542 C CA  . HIS B 1 207 ? 3.787   5.154   42.221  1.00 31.32  ? 202 HIS B CA  1 
ATOM   4543 C C   . HIS B 1 207 ? 2.490   5.831   42.723  1.00 32.70  ? 202 HIS B C   1 
ATOM   4544 O O   . HIS B 1 207 ? 1.752   6.474   41.962  1.00 33.66  ? 202 HIS B O   1 
ATOM   4545 C CB  . HIS B 1 207 ? 3.608   3.621   42.265  1.00 30.01  ? 202 HIS B CB  1 
ATOM   4546 C CG  . HIS B 1 207 ? 2.353   3.133   41.606  1.00 29.81  ? 202 HIS B CG  1 
ATOM   4547 N ND1 . HIS B 1 207 ? 2.099   3.300   40.252  1.00 29.84  ? 202 HIS B ND1 1 
ATOM   4548 C CD2 . HIS B 1 207 ? 1.272   2.488   42.117  1.00 29.57  ? 202 HIS B CD2 1 
ATOM   4549 C CE1 . HIS B 1 207 ? 0.923   2.766   39.964  1.00 25.50  ? 202 HIS B CE1 1 
ATOM   4550 N NE2 . HIS B 1 207 ? 0.398   2.277   41.077  1.00 27.15  ? 202 HIS B NE2 1 
ATOM   4551 N N   . PHE B 1 208 ? 2.198   5.699   44.007  1.00 33.58  ? 203 PHE B N   1 
ATOM   4552 C CA  . PHE B 1 208 ? 0.945   6.265   44.528  1.00 34.98  ? 203 PHE B CA  1 
ATOM   4553 C C   . PHE B 1 208 ? 0.938   7.788   44.538  1.00 37.13  ? 203 PHE B C   1 
ATOM   4554 O O   . PHE B 1 208 ? -0.125  8.426   44.455  1.00 37.26  ? 203 PHE B O   1 
ATOM   4555 C CB  . PHE B 1 208 ? 0.606   5.686   45.906  1.00 34.87  ? 203 PHE B CB  1 
ATOM   4556 C CG  . PHE B 1 208 ? -0.013  4.349   45.815  1.00 35.06  ? 203 PHE B CG  1 
ATOM   4557 C CD1 . PHE B 1 208 ? -1.399  4.230   45.598  1.00 31.99  ? 203 PHE B CD1 1 
ATOM   4558 C CD2 . PHE B 1 208 ? 0.780   3.204   45.854  1.00 30.68  ? 203 PHE B CD2 1 
ATOM   4559 C CE1 . PHE B 1 208 ? -1.980  3.006   45.457  1.00 32.59  ? 203 PHE B CE1 1 
ATOM   4560 C CE2 . PHE B 1 208 ? 0.199   1.945   45.709  1.00 30.17  ? 203 PHE B CE2 1 
ATOM   4561 C CZ  . PHE B 1 208 ? -1.184  1.833   45.505  1.00 29.21  ? 203 PHE B CZ  1 
ATOM   4562 N N   . GLN B 1 209 ? 2.121   8.371   44.604  1.00 38.15  ? 204 GLN B N   1 
ATOM   4563 C CA  . GLN B 1 209 ? 2.214   9.828   44.566  1.00 41.66  ? 204 GLN B CA  1 
ATOM   4564 C C   . GLN B 1 209 ? 2.017   10.418  43.155  1.00 41.14  ? 204 GLN B C   1 
ATOM   4565 O O   . GLN B 1 209 ? 1.325   11.419  43.007  1.00 42.92  ? 204 GLN B O   1 
ATOM   4566 C CB  . GLN B 1 209 ? 3.533   10.287  45.188  1.00 42.66  ? 204 GLN B CB  1 
ATOM   4567 C CG  . GLN B 1 209 ? 3.644   11.778  45.403  1.00 49.75  ? 204 GLN B CG  1 
ATOM   4568 C CD  . GLN B 1 209 ? 4.638   12.389  44.473  1.00 56.49  ? 204 GLN B CD  1 
ATOM   4569 O OE1 . GLN B 1 209 ? 4.602   12.160  43.261  1.00 59.73  ? 204 GLN B OE1 1 
ATOM   4570 N NE2 . GLN B 1 209 ? 5.556   13.162  45.029  1.00 59.23  ? 204 GLN B NE2 1 
ATOM   4571 N N   . GLN B 1 210 ? 2.668   9.833   42.146  1.00 40.03  ? 205 GLN B N   1 
ATOM   4572 C CA  . GLN B 1 210 ? 2.475   10.236  40.743  1.00 39.53  ? 205 GLN B CA  1 
ATOM   4573 C C   . GLN B 1 210 ? 1.002   10.106  40.407  1.00 38.11  ? 205 GLN B C   1 
ATOM   4574 O O   . GLN B 1 210 ? 0.418   11.026  39.858  1.00 38.94  ? 205 GLN B O   1 
ATOM   4575 C CB  . GLN B 1 210 ? 3.253   9.314   39.761  1.00 38.42  ? 205 GLN B CB  1 
ATOM   4576 C CG  . GLN B 1 210 ? 4.777   9.517   39.714  1.00 37.95  ? 205 GLN B CG  1 
ATOM   4577 C CD  . GLN B 1 210 ? 5.560   8.336   39.091  1.00 38.21  ? 205 GLN B CD  1 
ATOM   4578 O OE1 . GLN B 1 210 ? 6.699   8.513   38.690  1.00 43.05  ? 205 GLN B OE1 1 
ATOM   4579 N NE2 . GLN B 1 210 ? 4.952   7.136   39.012  1.00 36.90  ? 205 GLN B NE2 1 
ATOM   4580 N N   . GLY B 1 211 ? 0.426   8.945   40.699  1.00 35.43  ? 206 GLY B N   1 
ATOM   4581 C CA  . GLY B 1 211 ? -0.980  8.696   40.382  1.00 35.60  ? 206 GLY B CA  1 
ATOM   4582 C C   . GLY B 1 211 ? -1.910  9.706   41.057  1.00 36.84  ? 206 GLY B C   1 
ATOM   4583 O O   . GLY B 1 211 ? -2.755  10.353  40.405  1.00 35.75  ? 206 GLY B O   1 
ATOM   4584 N N   . HIS B 1 212 ? -1.724  9.854   42.367  1.00 37.47  ? 207 HIS B N   1 
ATOM   4585 C CA  . HIS B 1 212 ? -2.580  10.725  43.150  1.00 39.20  ? 207 HIS B CA  1 
ATOM   4586 C C   . HIS B 1 212 ? -2.448  12.177  42.685  1.00 41.31  ? 207 HIS B C   1 
ATOM   4587 O O   . HIS B 1 212 ? -3.437  12.904  42.671  1.00 41.74  ? 207 HIS B O   1 
ATOM   4588 C CB  . HIS B 1 212 ? -2.325  10.574  44.653  1.00 39.45  ? 207 HIS B CB  1 
ATOM   4589 C CG  . HIS B 1 212 ? -3.101  11.541  45.476  1.00 41.88  ? 207 HIS B CG  1 
ATOM   4590 N ND1 . HIS B 1 212 ? -4.463  11.420  45.679  1.00 42.50  ? 207 HIS B ND1 1 
ATOM   4591 C CD2 . HIS B 1 212 ? -2.728  12.699  46.067  1.00 39.24  ? 207 HIS B CD2 1 
ATOM   4592 C CE1 . HIS B 1 212 ? -4.886  12.449  46.389  1.00 42.32  ? 207 HIS B CE1 1 
ATOM   4593 N NE2 . HIS B 1 212 ? -3.854  13.234  46.639  1.00 43.84  ? 207 HIS B NE2 1 
ATOM   4594 N N   . GLU B 1 213 ? -1.264  12.598  42.244  1.00 42.25  ? 208 GLU B N   1 
ATOM   4595 C CA  . GLU B 1 213 ? -1.169  14.004  41.839  1.00 45.37  ? 208 GLU B CA  1 
ATOM   4596 C C   . GLU B 1 213 ? -1.759  14.276  40.437  1.00 44.53  ? 208 GLU B C   1 
ATOM   4597 O O   . GLU B 1 213 ? -2.292  15.367  40.187  1.00 45.85  ? 208 GLU B O   1 
ATOM   4598 C CB  . GLU B 1 213 ? 0.224   14.607  42.036  1.00 47.35  ? 208 GLU B CB  1 
ATOM   4599 C CG  . GLU B 1 213 ? 1.283   14.208  41.004  1.00 49.76  ? 208 GLU B CG  1 
ATOM   4600 C CD  . GLU B 1 213 ? 2.582   15.053  41.146  1.00 56.56  ? 208 GLU B CD  1 
ATOM   4601 O OE1 . GLU B 1 213 ? 2.639   16.189  40.606  1.00 58.69  ? 208 GLU B OE1 1 
ATOM   4602 O OE2 . GLU B 1 213 ? 3.540   14.575  41.802  1.00 57.72  ? 208 GLU B OE2 1 
ATOM   4603 N N   . GLU B 1 214 ? -1.708  13.288  39.552  1.00 41.27  ? 209 GLU B N   1 
ATOM   4604 C CA  . GLU B 1 214 ? -2.326  13.446  38.235  1.00 41.34  ? 209 GLU B CA  1 
ATOM   4605 C C   . GLU B 1 214 ? -3.862  13.438  38.370  1.00 40.25  ? 209 GLU B C   1 
ATOM   4606 O O   . GLU B 1 214 ? -4.549  14.256  37.773  1.00 41.76  ? 209 GLU B O   1 
ATOM   4607 C CB  . GLU B 1 214 ? -1.804  12.394  37.237  1.00 39.30  ? 209 GLU B CB  1 
ATOM   4608 C CG  . GLU B 1 214 ? -2.229  12.599  35.768  1.00 43.49  ? 209 GLU B CG  1 
ATOM   4609 C CD  . GLU B 1 214 ? -3.695  12.185  35.438  1.00 47.19  ? 209 GLU B CD  1 
ATOM   4610 O OE1 . GLU B 1 214 ? -4.215  12.591  34.366  1.00 50.49  ? 209 GLU B OE1 1 
ATOM   4611 O OE2 . GLU B 1 214 ? -4.338  11.455  36.223  1.00 46.61  ? 209 GLU B OE2 1 
ATOM   4612 N N   . LEU B 1 215 ? -4.390  12.539  39.184  1.00 39.07  ? 210 LEU B N   1 
ATOM   4613 C CA  . LEU B 1 215 ? -5.831  12.496  39.437  1.00 40.05  ? 210 LEU B CA  1 
ATOM   4614 C C   . LEU B 1 215 ? -6.330  13.740  40.164  1.00 42.83  ? 210 LEU B C   1 
ATOM   4615 O O   . LEU B 1 215 ? -7.442  14.169  39.909  1.00 43.25  ? 210 LEU B O   1 
ATOM   4616 C CB  . LEU B 1 215 ? -6.243  11.221  40.167  1.00 37.16  ? 210 LEU B CB  1 
ATOM   4617 C CG  . LEU B 1 215 ? -6.248  10.005  39.240  1.00 36.45  ? 210 LEU B CG  1 
ATOM   4618 C CD1 . LEU B 1 215 ? -6.043  8.730   40.021  1.00 34.03  ? 210 LEU B CD1 1 
ATOM   4619 C CD2 . LEU B 1 215 ? -7.567  9.902   38.401  1.00 35.07  ? 210 LEU B CD2 1 
ATOM   4620 N N   . SER B 1 216 ? -5.490  14.321  41.034  1.00 45.83  ? 211 SER B N   1 
ATOM   4621 C CA  . SER B 1 216 ? -5.837  15.530  41.763  1.00 49.29  ? 211 SER B CA  1 
ATOM   4622 C C   . SER B 1 216 ? -5.889  16.740  40.845  1.00 51.04  ? 211 SER B C   1 
ATOM   4623 O O   . SER B 1 216 ? -6.674  17.686  41.079  1.00 52.95  ? 211 SER B O   1 
ATOM   4624 C CB  . SER B 1 216 ? -4.848  15.802  42.908  1.00 51.36  ? 211 SER B CB  1 
ATOM   4625 O OG  . SER B 1 216 ? -5.011  14.851  43.943  1.00 52.83  ? 211 SER B OG  1 
ATOM   4626 N N   . ARG B 1 217 ? -5.056  16.730  39.810  1.00 50.11  ? 212 ARG B N   1 
ATOM   4627 C CA  . ARG B 1 217 ? -5.101  17.826  38.853  1.00 52.39  ? 212 ARG B CA  1 
ATOM   4628 C C   . ARG B 1 217 ? -6.376  17.777  37.993  1.00 50.34  ? 212 ARG B C   1 
ATOM   4629 O O   . ARG B 1 217 ? -6.755  18.753  37.375  1.00 51.92  ? 212 ARG B O   1 
ATOM   4630 C CB  . ARG B 1 217 ? -3.828  17.867  38.003  1.00 52.48  ? 212 ARG B CB  1 
ATOM   4631 C CG  . ARG B 1 217 ? -2.596  18.253  38.799  1.00 57.40  ? 212 ARG B CG  1 
ATOM   4632 C CD  . ARG B 1 217 ? -1.403  18.472  37.901  1.00 62.98  ? 212 ARG B CD  1 
ATOM   4633 N NE  . ARG B 1 217 ? -0.255  19.022  38.625  1.00 70.02  ? 212 ARG B NE  1 
ATOM   4634 C CZ  . ARG B 1 217 ? 0.773   18.290  39.043  1.00 71.98  ? 212 ARG B CZ  1 
ATOM   4635 N NH1 . ARG B 1 217 ? 0.786   16.969  38.815  1.00 69.36  ? 212 ARG B NH1 1 
ATOM   4636 N NH2 . ARG B 1 217 ? 1.785   18.872  39.690  1.00 74.44  ? 212 ARG B NH2 1 
ATOM   4637 N N   . LEU B 1 218 ? -7.027  16.624  37.964  1.00 48.19  ? 213 LEU B N   1 
ATOM   4638 C CA  . LEU B 1 218 ? -8.276  16.485  37.233  1.00 46.96  ? 213 LEU B CA  1 
ATOM   4639 C C   . LEU B 1 218 ? -9.476  16.734  38.125  1.00 47.20  ? 213 LEU B C   1 
ATOM   4640 O O   . LEU B 1 218 ? -10.579 16.727  37.635  1.00 47.68  ? 213 LEU B O   1 
ATOM   4641 C CB  . LEU B 1 218 ? -8.426  15.086  36.625  1.00 44.18  ? 213 LEU B CB  1 
ATOM   4642 C CG  . LEU B 1 218 ? -7.552  14.633  35.462  1.00 44.19  ? 213 LEU B CG  1 
ATOM   4643 C CD1 . LEU B 1 218 ? -7.819  13.164  35.162  1.00 39.27  ? 213 LEU B CD1 1 
ATOM   4644 C CD2 . LEU B 1 218 ? -7.811  15.517  34.246  1.00 46.26  ? 213 LEU B CD2 1 
ATOM   4645 N N   . SER B 1 219 ? -9.272  16.915  39.424  1.00 47.97  ? 214 SER B N   1 
ATOM   4646 C CA  . SER B 1 219 ? -10.393 17.015  40.357  1.00 48.83  ? 214 SER B CA  1 
ATOM   4647 C C   . SER B 1 219 ? -11.493 17.946  39.846  1.00 49.83  ? 214 SER B C   1 
ATOM   4648 O O   . SER B 1 219 ? -12.659 17.572  39.871  1.00 48.05  ? 214 SER B O   1 
ATOM   4649 C CB  . SER B 1 219 ? -9.921  17.450  41.757  1.00 51.27  ? 214 SER B CB  1 
ATOM   4650 O OG  . SER B 1 219 ? -10.905 17.119  42.730  1.00 51.39  ? 214 SER B OG  1 
ATOM   4651 N N   . GLN B 1 220 ? -11.098 19.143  39.379  1.00 52.07  ? 215 GLN B N   1 
ATOM   4652 C CA  . GLN B 1 220 ? -12.015 20.158  38.843  1.00 53.99  ? 215 GLN B CA  1 
ATOM   4653 C C   . GLN B 1 220 ? -12.804 19.688  37.603  1.00 52.22  ? 215 GLN B C   1 
ATOM   4654 O O   . GLN B 1 220 ? -14.039 19.751  37.560  1.00 51.80  ? 215 GLN B O   1 
ATOM   4655 C CB  . GLN B 1 220 ? -11.226 21.427  38.501  1.00 57.04  ? 215 GLN B CB  1 
ATOM   4656 C CG  . GLN B 1 220 ? -12.045 22.698  38.420  1.00 61.24  ? 215 GLN B CG  1 
ATOM   4657 C CD  . GLN B 1 220 ? -12.569 23.147  39.769  1.00 67.49  ? 215 GLN B CD  1 
ATOM   4658 O OE1 . GLN B 1 220 ? -13.642 22.717  40.213  1.00 69.00  ? 215 GLN B OE1 1 
ATOM   4659 N NE2 . GLN B 1 220 ? -11.834 24.046  40.417  1.00 71.32  ? 215 GLN B NE2 1 
ATOM   4660 N N   . TYR B 1 221 ? -12.082 19.212  36.599  1.00 50.60  ? 216 TYR B N   1 
ATOM   4661 C CA  . TYR B 1 221 ? -12.713 18.704  35.404  1.00 48.73  ? 216 TYR B CA  1 
ATOM   4662 C C   . TYR B 1 221 ? -13.715 17.571  35.717  1.00 46.49  ? 216 TYR B C   1 
ATOM   4663 O O   . TYR B 1 221 ? -14.790 17.502  35.108  1.00 46.06  ? 216 TYR B O   1 
ATOM   4664 C CB  . TYR B 1 221 ? -11.670 18.253  34.374  1.00 47.29  ? 216 TYR B CB  1 
ATOM   4665 C CG  . TYR B 1 221 ? -12.321 17.548  33.224  1.00 45.90  ? 216 TYR B CG  1 
ATOM   4666 C CD1 . TYR B 1 221 ? -12.929 18.270  32.198  1.00 46.76  ? 216 TYR B CD1 1 
ATOM   4667 C CD2 . TYR B 1 221 ? -12.380 16.139  33.182  1.00 44.37  ? 216 TYR B CD2 1 
ATOM   4668 C CE1 . TYR B 1 221 ? -13.554 17.623  31.156  1.00 45.52  ? 216 TYR B CE1 1 
ATOM   4669 C CE2 . TYR B 1 221 ? -13.008 15.479  32.138  1.00 40.76  ? 216 TYR B CE2 1 
ATOM   4670 C CZ  . TYR B 1 221 ? -13.581 16.223  31.140  1.00 42.65  ? 216 TYR B CZ  1 
ATOM   4671 O OH  . TYR B 1 221 ? -14.193 15.582  30.125  1.00 44.00  ? 216 TYR B OH  1 
ATOM   4672 N N   . ARG B 1 222 ? -13.374 16.733  36.692  1.00 44.92  ? 217 ARG B N   1 
ATOM   4673 C CA  . ARG B 1 222 ? -14.219 15.605  37.110  1.00 43.34  ? 217 ARG B CA  1 
ATOM   4674 C C   . ARG B 1 222 ? -15.585 15.984  37.688  1.00 44.83  ? 217 ARG B C   1 
ATOM   4675 O O   . ARG B 1 222 ? -16.574 15.304  37.417  1.00 42.70  ? 217 ARG B O   1 
ATOM   4676 C CB  . ARG B 1 222 ? -13.494 14.775  38.164  1.00 42.62  ? 217 ARG B CB  1 
ATOM   4677 C CG  . ARG B 1 222 ? -12.666 13.647  37.641  1.00 41.09  ? 217 ARG B CG  1 
ATOM   4678 C CD  . ARG B 1 222 ? -12.515 12.652  38.763  1.00 42.80  ? 217 ARG B CD  1 
ATOM   4679 N NE  . ARG B 1 222 ? -11.272 12.845  39.482  1.00 40.77  ? 217 ARG B NE  1 
ATOM   4680 C CZ  . ARG B 1 222 ? -11.106 12.720  40.793  1.00 40.82  ? 217 ARG B CZ  1 
ATOM   4681 N NH1 . ARG B 1 222 ? -12.124 12.432  41.591  1.00 37.32  ? 217 ARG B NH1 1 
ATOM   4682 N NH2 . ARG B 1 222 ? -9.889  12.933  41.301  1.00 42.20  ? 217 ARG B NH2 1 
ATOM   4683 N N   . LYS B 1 223 ? -15.606 17.019  38.529  1.00 47.75  ? 218 LYS B N   1 
ATOM   4684 C CA  . LYS B 1 223 ? -16.840 17.556  39.126  1.00 51.16  ? 218 LYS B CA  1 
ATOM   4685 C C   . LYS B 1 223 ? -17.703 18.273  38.094  1.00 51.28  ? 218 LYS B C   1 
ATOM   4686 O O   . LYS B 1 223 ? -18.903 18.068  38.065  1.00 51.91  ? 218 LYS B O   1 
ATOM   4687 C CB  . LYS B 1 223 ? -16.544 18.553  40.275  1.00 53.69  ? 218 LYS B CB  1 
ATOM   4688 C CG  . LYS B 1 223 ? -15.741 17.981  41.448  1.00 56.58  ? 218 LYS B CG  1 
ATOM   4689 C CD  . LYS B 1 223 ? -15.510 19.062  42.526  1.00 61.54  ? 218 LYS B CD  1 
ATOM   4690 C CE  . LYS B 1 223 ? -14.743 18.498  43.711  1.00 62.87  ? 218 LYS B CE  1 
ATOM   4691 N NZ  . LYS B 1 223 ? -15.094 19.320  44.899  1.00 67.31  ? 218 LYS B NZ  1 
ATOM   4692 N N   . GLU B 1 224 ? -17.090 19.142  37.292  1.00 52.30  ? 219 GLU B N   1 
ATOM   4693 C CA  . GLU B 1 224 ? -17.772 19.825  36.199  1.00 53.15  ? 219 GLU B CA  1 
ATOM   4694 C C   . GLU B 1 224 ? -18.421 18.830  35.201  1.00 50.75  ? 219 GLU B C   1 
ATOM   4695 O O   . GLU B 1 224 ? -19.528 19.069  34.725  1.00 50.82  ? 219 GLU B O   1 
ATOM   4696 C CB  . GLU B 1 224 ? -16.812 20.754  35.459  1.00 54.38  ? 219 GLU B CB  1 
ATOM   4697 C CG  . GLU B 1 224 ? -16.583 22.125  36.109  1.00 60.50  ? 219 GLU B CG  1 
ATOM   4698 C CD  . GLU B 1 224 ? -15.473 22.933  35.412  1.00 64.42  ? 219 GLU B CD  1 
ATOM   4699 O OE1 . GLU B 1 224 ? -15.615 24.167  35.282  1.00 67.55  ? 219 GLU B OE1 1 
ATOM   4700 O OE2 . GLU B 1 224 ? -14.460 22.334  34.975  1.00 64.27  ? 219 GLU B OE2 1 
ATOM   4701 N N   . LEU B 1 225 ? -17.729 17.730  34.892  1.00 48.49  ? 220 LEU B N   1 
ATOM   4702 C CA  . LEU B 1 225 ? -18.261 16.726  33.969  1.00 46.34  ? 220 LEU B CA  1 
ATOM   4703 C C   . LEU B 1 225 ? -19.463 16.026  34.600  1.00 45.95  ? 220 LEU B C   1 
ATOM   4704 O O   . LEU B 1 225 ? -20.500 15.882  33.966  1.00 45.33  ? 220 LEU B O   1 
ATOM   4705 C CB  . LEU B 1 225 ? -17.196 15.698  33.554  1.00 44.23  ? 220 LEU B CB  1 
ATOM   4706 C CG  . LEU B 1 225 ? -17.679 14.512  32.683  1.00 41.36  ? 220 LEU B CG  1 
ATOM   4707 C CD1 . LEU B 1 225 ? -18.496 15.002  31.471  1.00 41.15  ? 220 LEU B CD1 1 
ATOM   4708 C CD2 . LEU B 1 225 ? -16.508 13.748  32.187  1.00 39.19  ? 220 LEU B CD2 1 
ATOM   4709 N N   . GLY B 1 226 ? -19.307 15.590  35.850  1.00 46.54  ? 221 GLY B N   1 
ATOM   4710 C CA  . GLY B 1 226 ? -20.408 15.024  36.616  1.00 46.37  ? 221 GLY B CA  1 
ATOM   4711 C C   . GLY B 1 226 ? -21.620 15.951  36.676  1.00 47.76  ? 221 GLY B C   1 
ATOM   4712 O O   . GLY B 1 226 ? -22.741 15.508  36.507  1.00 47.34  ? 221 GLY B O   1 
ATOM   4713 N N   . ALA B 1 227 ? -21.394 17.238  36.913  1.00 49.69  ? 222 ALA B N   1 
ATOM   4714 C CA  . ALA B 1 227 ? -22.491 18.197  36.981  1.00 51.84  ? 222 ALA B CA  1 
ATOM   4715 C C   . ALA B 1 227 ? -23.137 18.302  35.602  1.00 51.43  ? 222 ALA B C   1 
ATOM   4716 O O   . ALA B 1 227 ? -24.363 18.243  35.480  1.00 52.04  ? 222 ALA B O   1 
ATOM   4717 C CB  . ALA B 1 227 ? -21.998 19.555  37.466  1.00 53.74  ? 222 ALA B CB  1 
ATOM   4718 N N   . GLN B 1 228 ? -22.303 18.413  34.569  1.00 50.98  ? 223 GLN B N   1 
ATOM   4719 C CA  . GLN B 1 228 ? -22.759 18.419  33.185  1.00 50.89  ? 223 GLN B CA  1 
ATOM   4720 C C   . GLN B 1 228 ? -23.581 17.179  32.829  1.00 48.68  ? 223 GLN B C   1 
ATOM   4721 O O   . GLN B 1 228 ? -24.713 17.320  32.381  1.00 48.88  ? 223 GLN B O   1 
ATOM   4722 C CB  . GLN B 1 228 ? -21.592 18.596  32.209  1.00 51.28  ? 223 GLN B CB  1 
ATOM   4723 C CG  . GLN B 1 228 ? -22.014 18.616  30.714  1.00 53.58  ? 223 GLN B CG  1 
ATOM   4724 C CD  . GLN B 1 228 ? -21.552 19.872  29.956  1.00 59.64  ? 223 GLN B CD  1 
ATOM   4725 O OE1 . GLN B 1 228 ? -20.546 19.849  29.222  1.00 60.46  ? 223 GLN B OE1 1 
ATOM   4726 N NE2 . GLN B 1 228 ? -22.282 20.972  30.142  1.00 61.40  ? 223 GLN B NE2 1 
ATOM   4727 N N   . LEU B 1 229 ? -23.030 15.986  33.046  1.00 46.08  ? 224 LEU B N   1 
ATOM   4728 C CA  . LEU B 1 229 ? -23.725 14.737  32.699  1.00 44.88  ? 224 LEU B CA  1 
ATOM   4729 C C   . LEU B 1 229 ? -25.095 14.611  33.318  1.00 44.80  ? 224 LEU B C   1 
ATOM   4730 O O   . LEU B 1 229 ? -26.011 14.159  32.668  1.00 43.33  ? 224 LEU B O   1 
ATOM   4731 C CB  . LEU B 1 229 ? -22.916 13.495  33.105  1.00 42.60  ? 224 LEU B CB  1 
ATOM   4732 C CG  . LEU B 1 229 ? -21.840 13.111  32.115  1.00 44.26  ? 224 LEU B CG  1 
ATOM   4733 C CD1 . LEU B 1 229 ? -21.193 11.746  32.492  1.00 41.18  ? 224 LEU B CD1 1 
ATOM   4734 C CD2 . LEU B 1 229 ? -22.492 13.054  30.731  1.00 44.41  ? 224 LEU B CD2 1 
ATOM   4735 N N   . HIS B 1 230 ? -25.188 14.933  34.601  1.00 46.76  ? 225 HIS B N   1 
ATOM   4736 C CA  . HIS B 1 230 ? -26.421 14.811  35.346  1.00 48.89  ? 225 HIS B CA  1 
ATOM   4737 C C   . HIS B 1 230 ? -27.498 15.768  34.810  1.00 49.91  ? 225 HIS B C   1 
ATOM   4738 O O   . HIS B 1 230 ? -28.667 15.421  34.774  1.00 50.58  ? 225 HIS B O   1 
ATOM   4739 C CB  . HIS B 1 230 ? -26.161 15.055  36.837  1.00 51.44  ? 225 HIS B CB  1 
ATOM   4740 C CG  . HIS B 1 230 ? -27.399 15.348  37.619  1.00 55.01  ? 225 HIS B CG  1 
ATOM   4741 N ND1 . HIS B 1 230 ? -27.671 16.597  38.143  1.00 59.70  ? 225 HIS B ND1 1 
ATOM   4742 C CD2 . HIS B 1 230 ? -28.465 14.570  37.923  1.00 58.13  ? 225 HIS B CD2 1 
ATOM   4743 C CE1 . HIS B 1 230 ? -28.843 16.570  38.754  1.00 60.72  ? 225 HIS B CE1 1 
ATOM   4744 N NE2 . HIS B 1 230 ? -29.346 15.352  38.637  1.00 60.72  ? 225 HIS B NE2 1 
ATOM   4745 N N   . GLN B 1 231 ? -27.080 16.963  34.401  1.00 50.36  ? 226 GLN B N   1 
ATOM   4746 C CA  . GLN B 1 231 ? -27.953 17.959  33.818  1.00 51.05  ? 226 GLN B CA  1 
ATOM   4747 C C   . GLN B 1 231 ? -28.410 17.532  32.413  1.00 49.23  ? 226 GLN B C   1 
ATOM   4748 O O   . GLN B 1 231 ? -29.603 17.664  32.072  1.00 48.54  ? 226 GLN B O   1 
ATOM   4749 C CB  . GLN B 1 231 ? -27.236 19.306  33.771  1.00 52.56  ? 226 GLN B CB  1 
ATOM   4750 C CG  . GLN B 1 231 ? -28.095 20.447  33.314  1.00 56.71  ? 226 GLN B CG  1 
ATOM   4751 C CD  . GLN B 1 231 ? -29.418 20.543  34.082  1.00 61.95  ? 226 GLN B CD  1 
ATOM   4752 O OE1 . GLN B 1 231 ? -30.501 20.470  33.479  1.00 64.96  ? 226 GLN B OE1 1 
ATOM   4753 N NE2 . GLN B 1 231 ? -29.340 20.683  35.412  1.00 61.52  ? 226 GLN B NE2 1 
ATOM   4754 N N   . LEU B 1 232 ? -27.476 16.989  31.628  1.00 46.67  ? 227 LEU B N   1 
ATOM   4755 C CA  . LEU B 1 232 ? -27.768 16.479  30.281  1.00 45.14  ? 227 LEU B CA  1 
ATOM   4756 C C   . LEU B 1 232 ? -28.750 15.316  30.310  1.00 43.75  ? 227 LEU B C   1 
ATOM   4757 O O   . LEU B 1 232 ? -29.598 15.203  29.421  1.00 43.18  ? 227 LEU B O   1 
ATOM   4758 C CB  . LEU B 1 232 ? -26.484 16.083  29.516  1.00 43.65  ? 227 LEU B CB  1 
ATOM   4759 C CG  . LEU B 1 232 ? -25.501 17.225  29.154  1.00 46.24  ? 227 LEU B CG  1 
ATOM   4760 C CD1 . LEU B 1 232 ? -24.424 16.724  28.212  1.00 46.34  ? 227 LEU B CD1 1 
ATOM   4761 C CD2 . LEU B 1 232 ? -26.189 18.430  28.535  1.00 46.87  ? 227 LEU B CD2 1 
ATOM   4762 N N   . VAL B 1 233 ? -28.634 14.471  31.334  1.00 43.01  ? 228 VAL B N   1 
ATOM   4763 C CA  . VAL B 1 233 ? -29.478 13.290  31.482  1.00 42.94  ? 228 VAL B CA  1 
ATOM   4764 C C   . VAL B 1 233 ? -30.919 13.738  31.814  1.00 44.90  ? 228 VAL B C   1 
ATOM   4765 O O   . VAL B 1 233 ? -31.903 13.163  31.309  1.00 44.22  ? 228 VAL B O   1 
ATOM   4766 C CB  . VAL B 1 233 ? -28.930 12.361  32.572  1.00 43.04  ? 228 VAL B CB  1 
ATOM   4767 C CG1 . VAL B 1 233 ? -29.937 11.285  32.949  1.00 42.57  ? 228 VAL B CG1 1 
ATOM   4768 C CG2 . VAL B 1 233 ? -27.569 11.719  32.110  1.00 42.28  ? 228 VAL B CG2 1 
ATOM   4769 N N   . LEU B 1 234 ? -31.014 14.778  32.644  1.00 46.13  ? 229 LEU B N   1 
ATOM   4770 C CA  . LEU B 1 234 ? -32.271 15.418  32.955  1.00 48.38  ? 229 LEU B CA  1 
ATOM   4771 C C   . LEU B 1 234 ? -32.887 16.112  31.737  1.00 48.10  ? 229 LEU B C   1 
ATOM   4772 O O   . LEU B 1 234 ? -34.073 15.977  31.520  1.00 48.64  ? 229 LEU B O   1 
ATOM   4773 C CB  . LEU B 1 234 ? -32.082 16.417  34.095  1.00 50.57  ? 229 LEU B CB  1 
ATOM   4774 C CG  . LEU B 1 234 ? -32.739 16.185  35.455  1.00 54.46  ? 229 LEU B CG  1 
ATOM   4775 C CD1 . LEU B 1 234 ? -32.318 14.874  36.081  1.00 53.95  ? 229 LEU B CD1 1 
ATOM   4776 C CD2 . LEU B 1 234 ? -32.401 17.362  36.385  1.00 58.24  ? 229 LEU B CD2 1 
ATOM   4777 N N   . ASN B 1 235 ? -32.097 16.867  30.963  1.00 48.01  ? 230 ASN B N   1 
ATOM   4778 C CA  . ASN B 1 235 ? -32.615 17.541  29.756  1.00 48.12  ? 230 ASN B CA  1 
ATOM   4779 C C   . ASN B 1 235 ? -33.128 16.495  28.752  1.00 45.92  ? 230 ASN B C   1 
ATOM   4780 O O   . ASN B 1 235 ? -34.162 16.672  28.115  1.00 45.80  ? 230 ASN B O   1 
ATOM   4781 C CB  . ASN B 1 235 ? -31.565 18.438  29.072  1.00 48.35  ? 230 ASN B CB  1 
ATOM   4782 C CG  . ASN B 1 235 ? -31.200 19.701  29.882  1.00 51.73  ? 230 ASN B CG  1 
ATOM   4783 O OD1 . ASN B 1 235 ? -31.814 20.025  30.894  1.00 53.90  ? 230 ASN B OD1 1 
ATOM   4784 N ND2 . ASN B 1 235 ? -30.168 20.407  29.422  1.00 52.62  ? 230 ASN B ND2 1 
ATOM   4785 N N   . SER B 1 236 ? -32.390 15.405  28.627  1.00 44.04  ? 231 SER B N   1 
ATOM   4786 C CA  . SER B 1 236 ? -32.761 14.322  27.736  1.00 42.38  ? 231 SER B CA  1 
ATOM   4787 C C   . SER B 1 236 ? -34.105 13.678  28.131  1.00 42.92  ? 231 SER B C   1 
ATOM   4788 O O   . SER B 1 236 ? -34.957 13.420  27.282  1.00 41.98  ? 231 SER B O   1 
ATOM   4789 C CB  . SER B 1 236 ? -31.659 13.275  27.755  1.00 41.10  ? 231 SER B CB  1 
ATOM   4790 O OG  . SER B 1 236 ? -31.837 12.367  26.702  1.00 40.64  ? 231 SER B OG  1 
ATOM   4791 N N   . ALA B 1 237 ? -34.274 13.409  29.420  1.00 43.89  ? 232 ALA B N   1 
ATOM   4792 C CA  . ALA B 1 237 ? -35.504 12.820  29.935  1.00 45.08  ? 232 ALA B CA  1 
ATOM   4793 C C   . ALA B 1 237 ? -36.698 13.713  29.647  1.00 46.26  ? 232 ALA B C   1 
ATOM   4794 O O   . ALA B 1 237 ? -37.719 13.220  29.211  1.00 46.30  ? 232 ALA B O   1 
ATOM   4795 C CB  . ALA B 1 237 ? -35.394 12.521  31.435  1.00 46.17  ? 232 ALA B CB  1 
ATOM   4796 N N   . ARG B 1 238 ? -36.552 15.020  29.881  1.00 47.37  ? 233 ARG B N   1 
ATOM   4797 C CA  . ARG B 1 238 ? -37.560 16.017  29.530  1.00 49.02  ? 233 ARG B CA  1 
ATOM   4798 C C   . ARG B 1 238 ? -37.862 16.048  28.022  1.00 47.45  ? 233 ARG B C   1 
ATOM   4799 O O   . ARG B 1 238 ? -39.014 15.980  27.629  1.00 46.25  ? 233 ARG B O   1 
ATOM   4800 C CB  . ARG B 1 238 ? -37.127 17.389  30.080  1.00 51.94  ? 233 ARG B CB  1 
ATOM   4801 C CG  . ARG B 1 238 ? -37.510 18.657  29.286  1.00 57.78  ? 233 ARG B CG  1 
ATOM   4802 C CD  . ARG B 1 238 ? -36.210 19.485  29.005  1.00 64.83  ? 233 ARG B CD  1 
ATOM   4803 N NE  . ARG B 1 238 ? -36.417 20.943  28.953  1.00 70.41  ? 233 ARG B NE  1 
ATOM   4804 C CZ  . ARG B 1 238 ? -35.441 21.851  28.828  1.00 72.31  ? 233 ARG B CZ  1 
ATOM   4805 N NH1 . ARG B 1 238 ? -35.742 23.152  28.787  1.00 74.81  ? 233 ARG B NH1 1 
ATOM   4806 N NH2 . ARG B 1 238 ? -34.168 21.470  28.739  1.00 71.37  ? 233 ARG B NH2 1 
ATOM   4807 N N   . GLU B 1 239 ? -36.818 16.113  27.193  1.00 45.72  ? 234 GLU B N   1 
ATOM   4808 C CA  . GLU B 1 239 ? -36.962 16.095  25.741  1.00 45.13  ? 234 GLU B CA  1 
ATOM   4809 C C   . GLU B 1 239 ? -37.683 14.828  25.235  1.00 43.09  ? 234 GLU B C   1 
ATOM   4810 O O   . GLU B 1 239 ? -38.460 14.896  24.290  1.00 43.72  ? 234 GLU B O   1 
ATOM   4811 C CB  . GLU B 1 239 ? -35.597 16.265  25.048  1.00 44.31  ? 234 GLU B CB  1 
ATOM   4812 C CG  . GLU B 1 239 ? -35.610 16.009  23.527  1.00 49.15  ? 234 GLU B CG  1 
ATOM   4813 C CD  . GLU B 1 239 ? -34.202 15.957  22.878  1.00 54.51  ? 234 GLU B CD  1 
ATOM   4814 O OE1 . GLU B 1 239 ? -33.778 14.845  22.460  1.00 55.73  ? 234 GLU B OE1 1 
ATOM   4815 O OE2 . GLU B 1 239 ? -33.525 17.024  22.785  1.00 56.81  ? 234 GLU B OE2 1 
ATOM   4816 N N   . LYS B 1 240 ? -37.412 13.692  25.860  1.00 40.76  ? 235 LYS B N   1 
ATOM   4817 C CA  . LYS B 1 240 ? -38.100 12.452  25.560  1.00 39.83  ? 235 LYS B CA  1 
ATOM   4818 C C   . LYS B 1 240 ? -39.569 12.532  25.950  1.00 39.32  ? 235 LYS B C   1 
ATOM   4819 O O   . LYS B 1 240 ? -40.406 11.999  25.252  1.00 38.90  ? 235 LYS B O   1 
ATOM   4820 C CB  . LYS B 1 240 ? -37.421 11.272  26.281  1.00 39.84  ? 235 LYS B CB  1 
ATOM   4821 C CG  . LYS B 1 240 ? -38.057 9.882   26.046  1.00 43.09  ? 235 LYS B CG  1 
ATOM   4822 C CD  . LYS B 1 240 ? -37.920 8.993   27.298  1.00 48.55  ? 235 LYS B CD  1 
ATOM   4823 C CE  . LYS B 1 240 ? -38.821 7.750   27.256  1.00 51.45  ? 235 LYS B CE  1 
ATOM   4824 N NZ  . LYS B 1 240 ? -38.339 6.747   26.250  1.00 51.79  ? 235 LYS B NZ  1 
ATOM   4825 N N   . ARG B 1 241 ? -39.873 13.173  27.067  1.00 39.44  ? 236 ARG B N   1 
ATOM   4826 C CA  . ARG B 1 241 ? -41.264 13.352  27.485  1.00 41.46  ? 236 ARG B CA  1 
ATOM   4827 C C   . ARG B 1 241 ? -42.047 14.200  26.467  1.00 40.89  ? 236 ARG B C   1 
ATOM   4828 O O   . ARG B 1 241 ? -43.169 13.849  26.117  1.00 40.58  ? 236 ARG B O   1 
ATOM   4829 C CB  . ARG B 1 241 ? -41.352 13.964  28.892  1.00 43.53  ? 236 ARG B CB  1 
ATOM   4830 C CG  . ARG B 1 241 ? -42.771 14.028  29.490  1.00 47.30  ? 236 ARG B CG  1 
ATOM   4831 C CD  . ARG B 1 241 ? -42.834 14.884  30.771  1.00 55.88  ? 236 ARG B CD  1 
ATOM   4832 N NE  . ARG B 1 241 ? -43.249 16.252  30.443  1.00 61.17  ? 236 ARG B NE  1 
ATOM   4833 C CZ  . ARG B 1 241 ? -44.254 16.918  31.006  1.00 65.04  ? 236 ARG B CZ  1 
ATOM   4834 N NH1 . ARG B 1 241 ? -44.967 16.378  31.985  1.00 66.71  ? 236 ARG B NH1 1 
ATOM   4835 N NH2 . ARG B 1 241 ? -44.536 18.149  30.593  1.00 67.60  ? 236 ARG B NH2 1 
ATOM   4836 N N   . ASP B 1 242 ? -41.444 15.302  26.009  1.00 40.27  ? 237 ASP B N   1 
ATOM   4837 C CA  . ASP B 1 242 ? -42.037 16.160  24.985  1.00 41.37  ? 237 ASP B CA  1 
ATOM   4838 C C   . ASP B 1 242 ? -42.349 15.401  23.699  1.00 39.65  ? 237 ASP B C   1 
ATOM   4839 O O   . ASP B 1 242 ? -43.441 15.496  23.174  1.00 39.53  ? 237 ASP B O   1 
ATOM   4840 C CB  . ASP B 1 242 ? -41.120 17.351  24.659  1.00 42.31  ? 237 ASP B CB  1 
ATOM   4841 C CG  . ASP B 1 242 ? -40.878 18.251  25.860  1.00 48.74  ? 237 ASP B CG  1 
ATOM   4842 O OD1 . ASP B 1 242 ? -41.778 18.376  26.739  1.00 54.14  ? 237 ASP B OD1 1 
ATOM   4843 O OD2 . ASP B 1 242 ? -39.779 18.854  25.916  1.00 54.56  ? 237 ASP B OD2 1 
ATOM   4844 N N   . MET B 1 243 ? -41.366 14.671  23.196  1.00 37.63  ? 238 MET B N   1 
ATOM   4845 C CA  . MET B 1 243 ? -41.525 13.909  21.994  1.00 37.70  ? 238 MET B CA  1 
ATOM   4846 C C   . MET B 1 243 ? -42.659 12.924  22.121  1.00 37.83  ? 238 MET B C   1 
ATOM   4847 O O   . MET B 1 243 ? -43.520 12.844  21.232  1.00 38.74  ? 238 MET B O   1 
ATOM   4848 C CB  . MET B 1 243 ? -40.237 13.165  21.640  1.00 36.05  ? 238 MET B CB  1 
ATOM   4849 C CG  . MET B 1 243 ? -39.289 13.985  20.782  1.00 38.72  ? 238 MET B CG  1 
ATOM   4850 S SD  . MET B 1 243 ? -37.822 13.061  20.266  1.00 44.82  ? 238 MET B SD  1 
ATOM   4851 C CE  . MET B 1 243 ? -37.154 12.397  21.800  1.00 44.28  ? 238 MET B CE  1 
ATOM   4852 N N   . GLU B 1 244 ? -42.649 12.157  23.210  1.00 37.58  ? 239 GLU B N   1 
ATOM   4853 C CA  . GLU B 1 244 ? -43.689 11.174  23.416  1.00 37.94  ? 239 GLU B CA  1 
ATOM   4854 C C   . GLU B 1 244 ? -45.059 11.852  23.438  1.00 37.76  ? 239 GLU B C   1 
ATOM   4855 O O   . GLU B 1 244 ? -45.986 11.340  22.821  1.00 37.72  ? 239 GLU B O   1 
ATOM   4856 C CB  . GLU B 1 244 ? -43.442 10.321  24.661  1.00 38.28  ? 239 GLU B CB  1 
ATOM   4857 C CG  . GLU B 1 244 ? -44.162 8.950   24.582  1.00 42.29  ? 239 GLU B CG  1 
ATOM   4858 C CD  . GLU B 1 244 ? -44.216 8.215   25.934  1.00 46.58  ? 239 GLU B CD  1 
ATOM   4859 O OE1 . GLU B 1 244 ? -45.260 7.590   26.233  1.00 45.83  ? 239 GLU B OE1 1 
ATOM   4860 O OE2 . GLU B 1 244 ? -43.228 8.299   26.708  1.00 48.24  ? 239 GLU B OE2 1 
ATOM   4861 N N   . GLN B 1 245 ? -45.183 12.994  24.122  1.00 37.74  ? 240 GLN B N   1 
ATOM   4862 C CA  . GLN B 1 245 ? -46.455 13.769  24.086  1.00 39.48  ? 240 GLN B CA  1 
ATOM   4863 C C   . GLN B 1 245 ? -46.868 14.167  22.657  1.00 38.57  ? 240 GLN B C   1 
ATOM   4864 O O   . GLN B 1 245 ? -48.027 13.944  22.266  1.00 38.37  ? 240 GLN B O   1 
ATOM   4865 C CB  . GLN B 1 245 ? -46.450 14.974  25.050  1.00 39.97  ? 240 GLN B CB  1 
ATOM   4866 C CG  . GLN B 1 245 ? -46.334 14.520  26.493  1.00 43.71  ? 240 GLN B CG  1 
ATOM   4867 C CD  . GLN B 1 245 ? -46.523 15.596  27.539  1.00 46.75  ? 240 GLN B CD  1 
ATOM   4868 O OE1 . GLN B 1 245 ? -47.381 15.464  28.393  1.00 53.03  ? 240 GLN B OE1 1 
ATOM   4869 N NE2 . GLN B 1 245 ? -45.716 16.633  27.502  1.00 47.85  ? 240 GLN B NE2 1 
ATOM   4870 N N   . ARG B 1 246 ? -45.918 14.701  21.880  1.00 37.74  ? 241 ARG B N   1 
ATOM   4871 C CA  . ARG B 1 246 ? -46.172 15.076  20.478  1.00 39.35  ? 241 ARG B CA  1 
ATOM   4872 C C   . ARG B 1 246 ? -46.667 13.883  19.665  1.00 37.88  ? 241 ARG B C   1 
ATOM   4873 O O   . ARG B 1 246 ? -47.624 13.999  18.904  1.00 39.12  ? 241 ARG B O   1 
ATOM   4874 C CB  . ARG B 1 246 ? -44.903 15.622  19.791  1.00 38.88  ? 241 ARG B CB  1 
ATOM   4875 C CG  . ARG B 1 246 ? -44.134 16.629  20.624  1.00 45.49  ? 241 ARG B CG  1 
ATOM   4876 C CD  . ARG B 1 246 ? -44.706 18.069  20.643  1.00 55.42  ? 241 ARG B CD  1 
ATOM   4877 N NE  . ARG B 1 246 ? -43.763 18.972  21.340  1.00 62.29  ? 241 ARG B NE  1 
ATOM   4878 C CZ  . ARG B 1 246 ? -43.758 20.304  21.251  1.00 65.24  ? 241 ARG B CZ  1 
ATOM   4879 N NH1 . ARG B 1 246 ? -44.640 20.933  20.477  1.00 67.57  ? 241 ARG B NH1 1 
ATOM   4880 N NH2 . ARG B 1 246 ? -42.859 21.009  21.937  1.00 66.88  ? 241 ARG B NH2 1 
ATOM   4881 N N   . HIS B 1 247 ? -46.007 12.744  19.844  1.00 35.69  ? 242 HIS B N   1 
ATOM   4882 C CA  . HIS B 1 247 ? -46.351 11.508  19.140  1.00 34.71  ? 242 HIS B CA  1 
ATOM   4883 C C   . HIS B 1 247 ? -47.782 11.056  19.460  1.00 35.83  ? 242 HIS B C   1 
ATOM   4884 O O   . HIS B 1 247 ? -48.501 10.630  18.564  1.00 36.49  ? 242 HIS B O   1 
ATOM   4885 C CB  . HIS B 1 247 ? -45.383 10.419  19.549  1.00 32.75  ? 242 HIS B CB  1 
ATOM   4886 C CG  . HIS B 1 247 ? -44.025 10.569  18.959  1.00 33.01  ? 242 HIS B CG  1 
ATOM   4887 N ND1 . HIS B 1 247 ? -43.122 9.530   18.920  1.00 33.03  ? 242 HIS B ND1 1 
ATOM   4888 C CD2 . HIS B 1 247 ? -43.421 11.619  18.350  1.00 33.76  ? 242 HIS B CD2 1 
ATOM   4889 C CE1 . HIS B 1 247 ? -42.007 9.942   18.342  1.00 34.05  ? 242 HIS B CE1 1 
ATOM   4890 N NE2 . HIS B 1 247 ? -42.160 11.207  17.988  1.00 32.47  ? 242 HIS B NE2 1 
ATOM   4891 N N   . VAL B 1 248 ? -48.198 11.164  20.717  1.00 36.27  ? 243 VAL B N   1 
ATOM   4892 C CA  . VAL B 1 248 ? -49.603 10.878  21.067  1.00 39.53  ? 243 VAL B CA  1 
ATOM   4893 C C   . VAL B 1 248 ? -50.566 11.809  20.308  1.00 40.78  ? 243 VAL B C   1 
ATOM   4894 O O   . VAL B 1 248 ? -51.574 11.361  19.755  1.00 40.62  ? 243 VAL B O   1 
ATOM   4895 C CB  . VAL B 1 248 ? -49.879 10.901  22.603  1.00 39.74  ? 243 VAL B CB  1 
ATOM   4896 C CG1 . VAL B 1 248 ? -51.323 10.521  22.896  1.00 41.92  ? 243 VAL B CG1 1 
ATOM   4897 C CG2 . VAL B 1 248 ? -48.997 9.920   23.285  1.00 40.51  ? 243 VAL B CG2 1 
ATOM   4898 N N   . LEU B 1 249 ? -50.252 13.104  20.259  1.00 42.45  ? 244 LEU B N   1 
ATOM   4899 C CA  . LEU B 1 249 ? -51.146 14.025  19.524  1.00 43.76  ? 244 LEU B CA  1 
ATOM   4900 C C   . LEU B 1 249 ? -51.113 13.672  18.046  1.00 43.07  ? 244 LEU B C   1 
ATOM   4901 O O   . LEU B 1 249 ? -52.153 13.584  17.424  1.00 43.45  ? 244 LEU B O   1 
ATOM   4902 C CB  . LEU B 1 249 ? -50.799 15.497  19.748  1.00 44.08  ? 244 LEU B CB  1 
ATOM   4903 C CG  . LEU B 1 249 ? -50.872 16.049  21.161  1.00 45.80  ? 244 LEU B CG  1 
ATOM   4904 C CD1 . LEU B 1 249 ? -50.131 17.355  21.187  1.00 45.95  ? 244 LEU B CD1 1 
ATOM   4905 C CD2 . LEU B 1 249 ? -52.329 16.227  21.663  1.00 46.83  ? 244 LEU B CD2 1 
ATOM   4906 N N   . LEU B 1 250 ? -49.926 13.396  17.506  1.00 43.26  ? 245 LEU B N   1 
ATOM   4907 C CA  . LEU B 1 250 ? -49.818 12.956  16.105  1.00 44.02  ? 245 LEU B CA  1 
ATOM   4908 C C   . LEU B 1 250 ? -50.728 11.757  15.787  1.00 45.33  ? 245 LEU B C   1 
ATOM   4909 O O   . LEU B 1 250 ? -51.582 11.853  14.922  1.00 46.76  ? 245 LEU B O   1 
ATOM   4910 C CB  . LEU B 1 250 ? -48.370 12.683  15.688  1.00 43.17  ? 245 LEU B CB  1 
ATOM   4911 C CG  . LEU B 1 250 ? -47.497 13.856  15.212  1.00 43.06  ? 245 LEU B CG  1 
ATOM   4912 C CD1 . LEU B 1 250 ? -46.098 13.395  14.967  1.00 38.07  ? 245 LEU B CD1 1 
ATOM   4913 C CD2 . LEU B 1 250 ? -48.058 14.511  13.931  1.00 45.00  ? 245 LEU B CD2 1 
ATOM   4914 N N   . LYS B 1 251 ? -50.600 10.664  16.531  1.00 45.80  ? 246 LYS B N   1 
ATOM   4915 C CA  . LYS B 1 251 ? -51.397 9.455   16.278  1.00 47.16  ? 246 LYS B CA  1 
ATOM   4916 C C   . LYS B 1 251 ? -52.896 9.594   16.535  1.00 49.26  ? 246 LYS B C   1 
ATOM   4917 O O   . LYS B 1 251 ? -53.687 8.867   15.948  1.00 50.85  ? 246 LYS B O   1 
ATOM   4918 C CB  . LYS B 1 251 ? -50.888 8.277   17.109  1.00 46.55  ? 246 LYS B CB  1 
ATOM   4919 C CG  . LYS B 1 251 ? -49.437 7.915   16.928  1.00 44.33  ? 246 LYS B CG  1 
ATOM   4920 C CD  . LYS B 1 251 ? -49.126 6.822   17.921  1.00 44.69  ? 246 LYS B CD  1 
ATOM   4921 C CE  . LYS B 1 251 ? -47.660 6.611   18.082  1.00 42.51  ? 246 LYS B CE  1 
ATOM   4922 N NZ  . LYS B 1 251 ? -47.418 5.850   19.340  1.00 43.48  ? 246 LYS B NZ  1 
ATOM   4923 N N   . GLN B 1 252 ? -53.295 10.479  17.431  1.00 50.63  ? 247 GLN B N   1 
ATOM   4924 C CA  . GLN B 1 252 ? -54.727 10.609  17.754  1.00 53.81  ? 247 GLN B CA  1 
ATOM   4925 C C   . GLN B 1 252 ? -55.502 11.592  16.867  1.00 55.84  ? 247 GLN B C   1 
ATOM   4926 O O   . GLN B 1 252 ? -56.723 11.523  16.783  1.00 56.93  ? 247 GLN B O   1 
ATOM   4927 C CB  . GLN B 1 252 ? -54.918 10.952  19.233  1.00 53.98  ? 247 GLN B CB  1 
ATOM   4928 C CG  . GLN B 1 252 ? -54.503 9.800   20.179  1.00 53.23  ? 247 GLN B CG  1 
ATOM   4929 C CD  . GLN B 1 252 ? -55.505 8.630   20.162  1.00 53.60  ? 247 GLN B CD  1 
ATOM   4930 O OE1 . GLN B 1 252 ? -56.710 8.835   19.990  1.00 52.07  ? 247 GLN B OE1 1 
ATOM   4931 N NE2 . GLN B 1 252 ? -54.999 7.399   20.350  1.00 52.83  ? 247 GLN B NE2 1 
ATOM   4932 N N   . LYS B 1 253 ? -54.784 12.485  16.187  1.00 57.22  ? 248 LYS B N   1 
ATOM   4933 C CA  . LYS B 1 253 ? -55.405 13.680  15.581  1.00 59.76  ? 248 LYS B CA  1 
ATOM   4934 C C   . LYS B 1 253 ? -55.039 13.909  14.129  1.00 59.69  ? 248 LYS B C   1 
ATOM   4935 O O   . LYS B 1 253 ? -55.892 14.339  13.336  1.00 61.29  ? 248 LYS B O   1 
ATOM   4936 C CB  . LYS B 1 253 ? -55.050 14.940  16.383  1.00 59.78  ? 248 LYS B CB  1 
ATOM   4937 C CG  . LYS B 1 253 ? -55.735 15.005  17.738  1.00 62.87  ? 248 LYS B CG  1 
ATOM   4938 C CD  . LYS B 1 253 ? -55.184 16.148  18.577  1.00 65.23  ? 248 LYS B CD  1 
ATOM   4939 C CE  . LYS B 1 253 ? -56.031 17.379  18.417  1.00 67.19  ? 248 LYS B CE  1 
ATOM   4940 N NZ  . LYS B 1 253 ? -55.356 18.487  19.103  1.00 70.05  ? 248 LYS B NZ  1 
ATOM   4941 N N   . GLU B 1 254 ? -53.795 13.582  13.797  1.00 59.15  ? 249 GLU B N   1 
ATOM   4942 C CA  . GLU B 1 254 ? -53.118 14.082  12.608  1.00 59.73  ? 249 GLU B CA  1 
ATOM   4943 C C   . GLU B 1 254 ? -52.619 13.015  11.624  1.00 59.61  ? 249 GLU B C   1 
ATOM   4944 O O   . GLU B 1 254 ? -52.343 13.345  10.463  1.00 60.69  ? 249 GLU B O   1 
ATOM   4945 C CB  . GLU B 1 254 ? -51.913 14.955  13.011  1.00 59.35  ? 249 GLU B CB  1 
ATOM   4946 C CG  . GLU B 1 254 ? -52.171 16.029  14.068  1.00 62.37  ? 249 GLU B CG  1 
ATOM   4947 C CD  . GLU B 1 254 ? -53.013 17.199  13.561  1.00 67.61  ? 249 GLU B CD  1 
ATOM   4948 O OE1 . GLU B 1 254 ? -53.016 17.458  12.334  1.00 71.39  ? 249 GLU B OE1 1 
ATOM   4949 O OE2 . GLU B 1 254 ? -53.657 17.876  14.390  1.00 67.61  ? 249 GLU B OE2 1 
ATOM   4950 N N   . LEU B 1 255 ? -52.471 11.762  12.057  1.00 58.87  ? 250 LEU B N   1 
ATOM   4951 C CA  . LEU B 1 255 ? -51.889 10.742  11.166  1.00 58.19  ? 250 LEU B CA  1 
ATOM   4952 C C   . LEU B 1 255 ? -52.885 10.084  10.228  1.00 58.99  ? 250 LEU B C   1 
ATOM   4953 O O   . LEU B 1 255 ? -52.846 10.319  9.020   1.00 60.27  ? 250 LEU B O   1 
ATOM   4954 C CB  . LEU B 1 255 ? -51.104 9.676   11.926  1.00 57.55  ? 250 LEU B CB  1 
ATOM   4955 C CG  . LEU B 1 255 ? -49.584 9.885   12.026  1.00 56.08  ? 250 LEU B CG  1 
ATOM   4956 C CD1 . LEU B 1 255 ? -48.970 8.739   12.819  1.00 54.63  ? 250 LEU B CD1 1 
ATOM   4957 C CD2 . LEU B 1 255 ? -48.911 10.022  10.677  1.00 54.27  ? 250 LEU B CD2 1 
ATOM   4958 N N   . GLY B 1 256 ? -53.753 9.244   10.785  1.00 80.62  ? 251 GLY B N   1 
ATOM   4959 C CA  . GLY B 1 256 ? -54.697 8.479   9.987   1.00 78.93  ? 251 GLY B CA  1 
ATOM   4960 C C   . GLY B 1 256 ? -54.055 7.412   9.104   1.00 73.68  ? 251 GLY B C   1 
ATOM   4961 O O   . GLY B 1 256 ? -52.823 7.307   8.996   1.00 69.68  ? 251 GLY B O   1 
ATOM   4962 N N   . GLY B 1 257 ? -54.915 6.631   8.460   1.00 73.19  ? 252 GLY B N   1 
ATOM   4963 C CA  . GLY B 1 257 ? -54.493 5.499   7.670   1.00 69.41  ? 252 GLY B CA  1 
ATOM   4964 C C   . GLY B 1 257 ? -54.792 5.632   6.192   1.00 67.88  ? 252 GLY B C   1 
ATOM   4965 O O   . GLY B 1 257 ? -55.112 4.647   5.542   1.00 67.03  ? 252 GLY B O   1 
ATOM   4966 N N   . GLU B 1 258 ? -54.679 6.844   5.657   1.00 68.42  ? 253 GLU B N   1 
ATOM   4967 C CA  . GLU B 1 258 ? -54.830 7.058   4.226   1.00 67.71  ? 253 GLU B CA  1 
ATOM   4968 C C   . GLU B 1 258 ? -53.568 6.637   3.473   1.00 63.30  ? 253 GLU B C   1 
ATOM   4969 O O   . GLU B 1 258 ? -52.445 6.927   3.910   1.00 61.43  ? 253 GLU B O   1 
ATOM   4970 C CB  . GLU B 1 258 ? -55.163 8.510   3.918   1.00 70.74  ? 253 GLU B CB  1 
ATOM   4971 C CG  . GLU B 1 258 ? -54.097 9.558   4.357   1.00 73.62  ? 253 GLU B CG  1 
ATOM   4972 C CD  . GLU B 1 258 ? -54.040 9.810   5.876   1.00 77.84  ? 253 GLU B CD  1 
ATOM   4973 O OE1 . GLU B 1 258 ? -53.386 9.022   6.587   1.00 78.69  ? 253 GLU B OE1 1 
ATOM   4974 O OE2 . GLU B 1 258 ? -54.624 10.799  6.356   1.00 81.64  ? 253 GLU B OE2 1 
ATOM   4975 N N   . GLU B 1 259 ? -53.773 5.952   2.347   1.00 61.15  ? 254 GLU B N   1 
ATOM   4976 C CA  . GLU B 1 259 ? -52.714 5.637   1.413   1.00 57.64  ? 254 GLU B CA  1 
ATOM   4977 C C   . GLU B 1 259 ? -51.981 6.903   0.974   1.00 57.24  ? 254 GLU B C   1 
ATOM   4978 O O   . GLU B 1 259 ? -52.626 7.891   0.662   1.00 58.77  ? 254 GLU B O   1 
ATOM   4979 C CB  . GLU B 1 259 ? -53.284 4.914   0.192   1.00 57.09  ? 254 GLU B CB  1 
ATOM   4980 C CG  . GLU B 1 259 ? -53.681 3.464   0.472   1.00 57.64  ? 254 GLU B CG  1 
ATOM   4981 C CD  . GLU B 1 259 ? -52.686 2.744   1.382   1.00 56.35  ? 254 GLU B CD  1 
ATOM   4982 O OE1 . GLU B 1 259 ? -51.598 2.350   0.898   1.00 53.92  ? 254 GLU B OE1 1 
ATOM   4983 O OE2 . GLU B 1 259 ? -52.996 2.582   2.585   1.00 57.69  ? 254 GLU B OE2 1 
ATOM   4984 N N   . PRO B 1 260 ? -50.618 6.856   0.927   1.00 54.88  ? 255 PRO B N   1 
ATOM   4985 C CA  . PRO B 1 260 ? -49.833 7.999   0.442   1.00 54.50  ? 255 PRO B CA  1 
ATOM   4986 C C   . PRO B 1 260 ? -50.166 8.291   -1.015  1.00 55.34  ? 255 PRO B C   1 
ATOM   4987 O O   . PRO B 1 260 ? -50.527 7.382   -1.776  1.00 55.12  ? 255 PRO B O   1 
ATOM   4988 C CB  . PRO B 1 260 ? -48.389 7.532   0.571   1.00 51.62  ? 255 PRO B CB  1 
ATOM   4989 C CG  . PRO B 1 260 ? -48.460 6.029   0.521   1.00 50.67  ? 255 PRO B CG  1 
ATOM   4990 C CD  . PRO B 1 260 ? -49.773 5.676   1.191   1.00 52.07  ? 255 PRO B CD  1 
ATOM   4991 N N   . GLU B 1 261 ? -50.058 9.558   -1.383  1.00 57.21  ? 256 GLU B N   1 
ATOM   4992 C CA  . GLU B 1 261 ? -50.405 10.017  -2.711  1.00 58.64  ? 256 GLU B CA  1 
ATOM   4993 C C   . GLU B 1 261 ? -49.172 10.640  -3.343  1.00 58.34  ? 256 GLU B C   1 
ATOM   4994 O O   . GLU B 1 261 ? -48.782 11.774  -2.976  1.00 59.72  ? 256 GLU B O   1 
ATOM   4995 C CB  . GLU B 1 261 ? -51.569 11.025  -2.651  1.00 62.25  ? 256 GLU B CB  1 
ATOM   4996 C CG  . GLU B 1 261 ? -52.926 10.369  -2.550  1.00 63.81  ? 256 GLU B CG  1 
ATOM   4997 C CD  . GLU B 1 261 ? -54.094 11.329  -2.519  1.00 70.49  ? 256 GLU B CD  1 
ATOM   4998 O OE1 . GLU B 1 261 ? -55.193 10.847  -2.163  1.00 73.43  ? 256 GLU B OE1 1 
ATOM   4999 O OE2 . GLU B 1 261 ? -53.944 12.543  -2.841  1.00 72.08  ? 256 GLU B OE2 1 
ATOM   5000 N N   . PRO B 1 262 ? -48.552 9.910   -4.294  1.00 56.64  ? 257 PRO B N   1 
ATOM   5001 C CA  . PRO B 1 262 ? -47.362 10.379  -5.000  1.00 56.82  ? 257 PRO B CA  1 
ATOM   5002 C C   . PRO B 1 262 ? -47.693 11.700  -5.669  1.00 60.92  ? 257 PRO B C   1 
ATOM   5003 O O   . PRO B 1 262 ? -48.780 11.837  -6.234  1.00 63.40  ? 257 PRO B O   1 
ATOM   5004 C CB  . PRO B 1 262 ? -47.137 9.304   -6.065  1.00 55.73  ? 257 PRO B CB  1 
ATOM   5005 C CG  . PRO B 1 262 ? -47.933 8.112   -5.635  1.00 53.40  ? 257 PRO B CG  1 
ATOM   5006 C CD  . PRO B 1 262 ? -49.094 8.668   -4.879  1.00 55.81  ? 257 PRO B CD  1 
ATOM   5007 N N   . SER B 1 263 ? -46.821 12.693  -5.578  1.00 62.41  ? 258 SER B N   1 
ATOM   5008 C CA  . SER B 1 263 ? -47.121 13.941  -6.289  1.00 67.39  ? 258 SER B CA  1 
ATOM   5009 C C   . SER B 1 263 ? -46.464 13.988  -7.669  1.00 68.87  ? 258 SER B C   1 
ATOM   5010 O O   . SER B 1 263 ? -45.322 13.543  -7.844  1.00 67.23  ? 258 SER B O   1 
ATOM   5011 C CB  . SER B 1 263 ? -46.837 15.207  -5.446  1.00 69.02  ? 258 SER B CB  1 
ATOM   5012 O OG  . SER B 1 263 ? -45.596 15.139  -4.751  1.00 67.63  ? 258 SER B OG  1 
ATOM   5013 N N   . LEU B 1 264 ? -47.225 14.476  -8.647  1.00 72.73  ? 259 LEU B N   1 
ATOM   5014 C CA  . LEU B 1 264 ? -46.686 14.791  -9.954  1.00 76.00  ? 259 LEU B CA  1 
ATOM   5015 C C   . LEU B 1 264 ? -45.786 15.995  -9.757  1.00 78.45  ? 259 LEU B C   1 
ATOM   5016 O O   . LEU B 1 264 ? -46.243 17.079  -9.353  1.00 80.91  ? 259 LEU B O   1 
ATOM   5017 C CB  . LEU B 1 264 ? -47.791 15.170  -10.943 1.00 80.09  ? 259 LEU B CB  1 
ATOM   5018 C CG  . LEU B 1 264 ? -48.576 14.179  -11.790 1.00 80.58  ? 259 LEU B CG  1 
ATOM   5019 C CD1 . LEU B 1 264 ? -49.417 13.268  -10.920 1.00 78.46  ? 259 LEU B CD1 1 
ATOM   5020 C CD2 . LEU B 1 264 ? -49.457 14.974  -12.753 1.00 85.00  ? 259 LEU B CD2 1 
ATOM   5021 N N   . ARG B 1 265 ? -44.505 15.792  -10.029 1.00 78.18  ? 260 ARG B N   1 
ATOM   5022 C CA  . ARG B 1 265 ? -43.553 16.880  -9.990  1.00 81.38  ? 260 ARG B CA  1 
ATOM   5023 C C   . ARG B 1 265 ? -42.901 17.082  -11.354 1.00 84.24  ? 260 ARG B C   1 
ATOM   5024 O O   . ARG B 1 265 ? -42.648 16.120  -12.089 1.00 83.15  ? 260 ARG B O   1 
ATOM   5025 C CB  . ARG B 1 265 ? -42.503 16.620  -8.918  1.00 78.82  ? 260 ARG B CB  1 
ATOM   5026 C CG  . ARG B 1 265 ? -43.085 16.319  -7.539  1.00 78.66  ? 260 ARG B CG  1 
ATOM   5027 C CD  . ARG B 1 265 ? -42.240 15.273  -6.809  1.00 79.09  ? 260 ARG B CD  1 
ATOM   5028 N NE  . ARG B 1 265 ? -40.933 15.814  -6.437  1.00 84.05  ? 260 ARG B NE  1 
ATOM   5029 C CZ  . ARG B 1 265 ? -39.796 15.599  -7.100  1.00 86.42  ? 260 ARG B CZ  1 
ATOM   5030 N NH1 . ARG B 1 265 ? -39.775 14.830  -8.189  1.00 86.19  ? 260 ARG B NH1 1 
ATOM   5031 N NH2 . ARG B 1 265 ? -38.670 16.157  -6.661  1.00 88.70  ? 260 ARG B NH2 1 
ATOM   5032 N N   . GLU B 1 266 ? -42.666 18.347  -11.688 1.00 88.16  ? 261 GLU B N   1 
ATOM   5033 C CA  . GLU B 1 266 ? -41.865 18.718  -12.842 1.00 92.03  ? 261 GLU B CA  1 
ATOM   5034 C C   . GLU B 1 266 ? -40.412 18.632  -12.388 1.00 91.11  ? 261 GLU B C   1 
ATOM   5035 O O   . GLU B 1 266 ? -39.915 19.527  -11.694 1.00 92.09  ? 261 GLU B O   1 
ATOM   5036 C CB  . GLU B 1 266 ? -42.180 20.162  -13.296 1.00 97.61  ? 261 GLU B CB  1 
ATOM   5037 C CG  . GLU B 1 266 ? -43.641 20.468  -13.697 1.00 99.47  ? 261 GLU B CG  1 
ATOM   5038 C CD  . GLU B 1 266 ? -44.010 20.030  -15.116 1.00 101.28 ? 261 GLU B CD  1 
ATOM   5039 O OE1 . GLU B 1 266 ? -43.146 19.495  -15.847 1.00 101.11 ? 261 GLU B OE1 1 
ATOM   5040 O OE2 . GLU B 1 266 ? -45.183 20.221  -15.500 1.00 102.97 ? 261 GLU B OE2 1 
ATOM   5041 N N   . GLY B 1 267 ? -39.738 17.541  -12.747 1.00 89.37  ? 262 GLY B N   1 
ATOM   5042 C CA  . GLY B 1 267 ? -38.327 17.373  -12.400 1.00 89.26  ? 262 GLY B CA  1 
ATOM   5043 C C   . GLY B 1 267 ? -37.437 18.122  -13.379 1.00 94.56  ? 262 GLY B C   1 
ATOM   5044 O O   . GLY B 1 267 ? -37.943 18.778  -14.300 1.00 98.53  ? 262 GLY B O   1 
ATOM   5045 N N   . PRO B 1 268 ? -36.102 18.064  -13.179 1.00 95.29  ? 263 PRO B N   1 
ATOM   5046 C CA  . PRO B 1 268 ? -35.247 18.486  -14.295 1.00 100.13 ? 263 PRO B CA  1 
ATOM   5047 C C   . PRO B 1 268 ? -35.117 17.312  -15.284 1.00 99.39  ? 263 PRO B C   1 
ATOM   5048 O O   . PRO B 1 268 ? -34.609 16.244  -14.922 1.00 96.49  ? 263 PRO B O   1 
ATOM   5049 C CB  . PRO B 1 268 ? -33.915 18.830  -13.614 1.00 101.38 ? 263 PRO B CB  1 
ATOM   5050 C CG  . PRO B 1 268 ? -33.894 17.988  -12.356 1.00 96.18  ? 263 PRO B CG  1 
ATOM   5051 C CD  . PRO B 1 268 ? -35.329 17.716  -11.966 1.00 92.48  ? 263 PRO B CD  1 
ATOM   5052 N N   . GLY B 1 269 ? -35.621 17.498  -16.502 1.00 102.00 ? 264 GLY B N   1 
ATOM   5053 C CA  . GLY B 1 269 ? -35.647 16.429  -17.503 1.00 101.20 ? 264 GLY B CA  1 
ATOM   5054 C C   . GLY B 1 269 ? -37.018 15.813  -17.734 1.00 97.89  ? 264 GLY B C   1 
ATOM   5055 O O   . GLY B 1 269 ? -37.124 14.717  -18.291 1.00 96.82  ? 264 GLY B O   1 
ATOM   5056 N N   . GLY B 1 270 ? -38.066 16.519  -17.312 1.00 96.62  ? 265 GLY B N   1 
ATOM   5057 C CA  . GLY B 1 270 ? -39.443 16.060  -17.499 1.00 94.23  ? 265 GLY B CA  1 
ATOM   5058 C C   . GLY B 1 270 ? -40.226 15.797  -16.219 1.00 88.61  ? 265 GLY B C   1 
ATOM   5059 O O   . GLY B 1 270 ? -39.742 16.045  -15.106 1.00 86.38  ? 265 GLY B O   1 
ATOM   5060 N N   . LEU B 1 271 ? -41.444 15.289  -16.377 1.00 86.58  ? 266 LEU B N   1 
ATOM   5061 C CA  . LEU B 1 271 ? -42.303 15.031  -15.237 1.00 81.84  ? 266 LEU B CA  1 
ATOM   5062 C C   . LEU B 1 271 ? -41.839 13.785  -14.495 1.00 76.31  ? 266 LEU B C   1 
ATOM   5063 O O   . LEU B 1 271 ? -41.537 12.762  -15.106 1.00 75.66  ? 266 LEU B O   1 
ATOM   5064 C CB  . LEU B 1 271 ? -43.786 14.973  -15.647 1.00 83.09  ? 266 LEU B CB  1 
ATOM   5065 C CG  . LEU B 1 271 ? -44.412 16.368  -15.873 1.00 87.62  ? 266 LEU B CG  1 
ATOM   5066 C CD1 . LEU B 1 271 ? -44.412 16.796  -17.347 1.00 94.97  ? 266 LEU B CD1 1 
ATOM   5067 C CD2 . LEU B 1 271 ? -45.817 16.491  -15.301 1.00 87.04  ? 266 LEU B CD2 1 
ATOM   5068 N N   . VAL B 1 272 ? -41.731 13.900  -13.172 1.00 72.59  ? 267 VAL B N   1 
ATOM   5069 C CA  . VAL B 1 272 ? -41.322 12.787  -12.319 1.00 66.98  ? 267 VAL B CA  1 
ATOM   5070 C C   . VAL B 1 272 ? -42.441 12.434  -11.331 1.00 63.92  ? 267 VAL B C   1 
ATOM   5071 O O   . VAL B 1 272 ? -43.172 13.314  -10.840 1.00 64.44  ? 267 VAL B O   1 
ATOM   5072 C CB  . VAL B 1 272 ? -40.002 13.076  -11.524 1.00 66.67  ? 267 VAL B CB  1 
ATOM   5073 C CG1 . VAL B 1 272 ? -39.455 11.794  -10.876 1.00 61.72  ? 267 VAL B CG1 1 
ATOM   5074 C CG2 . VAL B 1 272 ? -38.932 13.737  -12.409 1.00 69.56  ? 267 VAL B CG2 1 
ATOM   5075 N N   . MET B 1 273 ? -42.589 11.135  -11.076 1.00 59.78  ? 268 MET B N   1 
ATOM   5076 C CA  . MET B 1 273 ? -43.401 10.665  -9.974  1.00 56.75  ? 268 MET B CA  1 
ATOM   5077 C C   . MET B 1 273 ? -42.830 9.337   -9.541  1.00 53.30  ? 268 MET B C   1 
ATOM   5078 O O   . MET B 1 273 ? -42.354 8.573   -10.383 1.00 53.80  ? 268 MET B O   1 
ATOM   5079 C CB  . MET B 1 273 ? -44.864 10.494  -10.393 1.00 57.66  ? 268 MET B CB  1 
ATOM   5080 C CG  . MET B 1 273 ? -45.814 10.414  -9.192  1.00 56.52  ? 268 MET B CG  1 
ATOM   5081 S SD  . MET B 1 273 ? -47.579 10.432  -9.616  1.00 60.18  ? 268 MET B SD  1 
ATOM   5082 C CE  . MET B 1 273 ? -47.780 8.808   -10.312 1.00 56.56  ? 268 MET B CE  1 
ATOM   5083 N N   . GLU B 1 274 ? -42.878 9.056   -8.244  1.00 49.99  ? 269 GLU B N   1 
ATOM   5084 C CA  . GLU B 1 274 ? -42.515 7.737   -7.732  1.00 46.81  ? 269 GLU B CA  1 
ATOM   5085 C C   . GLU B 1 274 ? -43.596 7.277   -6.752  1.00 44.17  ? 269 GLU B C   1 
ATOM   5086 O O   . GLU B 1 274 ? -44.290 8.100   -6.168  1.00 45.07  ? 269 GLU B O   1 
ATOM   5087 C CB  . GLU B 1 274 ? -41.135 7.804   -7.084  1.00 47.10  ? 269 GLU B CB  1 
ATOM   5088 C CG  . GLU B 1 274 ? -40.932 9.114   -6.269  1.00 51.34  ? 269 GLU B CG  1 
ATOM   5089 C CD  . GLU B 1 274 ? -39.843 9.034   -5.208  1.00 55.44  ? 269 GLU B CD  1 
ATOM   5090 O OE1 . GLU B 1 274 ? -39.993 9.703   -4.145  1.00 56.97  ? 269 GLU B OE1 1 
ATOM   5091 O OE2 . GLU B 1 274 ? -38.844 8.307   -5.437  1.00 56.15  ? 269 GLU B OE2 1 
ATOM   5092 N N   . GLY B 1 275 ? -43.771 5.975   -6.591  1.00 40.91  ? 270 GLY B N   1 
ATOM   5093 C CA  . GLY B 1 275 ? -44.811 5.444   -5.700  1.00 38.63  ? 270 GLY B CA  1 
ATOM   5094 C C   . GLY B 1 275 ? -44.921 3.928   -5.882  1.00 36.75  ? 270 GLY B C   1 
ATOM   5095 O O   . GLY B 1 275 ? -44.384 3.400   -6.839  1.00 34.93  ? 270 GLY B O   1 
ATOM   5096 N N   . HIS B 1 276 ? -45.599 3.243   -4.965  1.00 36.54  ? 271 HIS B N   1 
ATOM   5097 C CA  . HIS B 1 276 ? -45.781 1.781   -5.074  1.00 37.89  ? 271 HIS B CA  1 
ATOM   5098 C C   . HIS B 1 276 ? -46.957 1.433   -6.008  1.00 39.78  ? 271 HIS B C   1 
ATOM   5099 O O   . HIS B 1 276 ? -47.982 2.145   -6.033  1.00 41.74  ? 271 HIS B O   1 
ATOM   5100 C CB  . HIS B 1 276 ? -46.053 1.160   -3.721  1.00 37.27  ? 271 HIS B CB  1 
ATOM   5101 C CG  . HIS B 1 276 ? -44.896 1.209   -2.773  1.00 38.36  ? 271 HIS B CG  1 
ATOM   5102 N ND1 . HIS B 1 276 ? -43.793 0.379   -2.895  1.00 42.16  ? 271 HIS B ND1 1 
ATOM   5103 C CD2 . HIS B 1 276 ? -44.692 1.948   -1.659  1.00 38.35  ? 271 HIS B CD2 1 
ATOM   5104 C CE1 . HIS B 1 276 ? -42.953 0.620   -1.901  1.00 42.31  ? 271 HIS B CE1 1 
ATOM   5105 N NE2 . HIS B 1 276 ? -43.481 1.562   -1.134  1.00 43.91  ? 271 HIS B NE2 1 
ATOM   5106 N N   . LEU B 1 277 ? -46.774 0.399   -6.822  1.00 39.81  ? 272 LEU B N   1 
ATOM   5107 C CA  . LEU B 1 277 ? -47.874 -0.208  -7.586  1.00 41.52  ? 272 LEU B CA  1 
ATOM   5108 C C   . LEU B 1 277 ? -47.686 -1.685  -7.548  1.00 40.79  ? 272 LEU B C   1 
ATOM   5109 O O   . LEU B 1 277 ? -46.590 -2.139  -7.340  1.00 40.60  ? 272 LEU B O   1 
ATOM   5110 C CB  . LEU B 1 277 ? -47.890 0.246   -9.047  1.00 43.37  ? 272 LEU B CB  1 
ATOM   5111 C CG  . LEU B 1 277 ? -48.255 1.722   -9.230  1.00 45.09  ? 272 LEU B CG  1 
ATOM   5112 C CD1 . LEU B 1 277 ? -47.941 2.163   -10.638 1.00 48.60  ? 272 LEU B CD1 1 
ATOM   5113 C CD2 . LEU B 1 277 ? -49.728 1.982   -8.853  1.00 46.88  ? 272 LEU B CD2 1 
ATOM   5114 N N   . PHE B 1 278 ? -48.771 -2.432  -7.697  1.00 41.95  ? 273 PHE B N   1 
ATOM   5115 C CA  . PHE B 1 278 ? -48.683 -3.834  -7.973  1.00 40.95  ? 273 PHE B CA  1 
ATOM   5116 C C   . PHE B 1 278 ? -48.410 -3.976  -9.468  1.00 41.73  ? 273 PHE B C   1 
ATOM   5117 O O   . PHE B 1 278 ? -48.773 -3.112  -10.261 1.00 44.06  ? 273 PHE B O   1 
ATOM   5118 C CB  . PHE B 1 278 ? -49.972 -4.536  -7.552  1.00 42.09  ? 273 PHE B CB  1 
ATOM   5119 C CG  . PHE B 1 278 ? -50.041 -4.849  -6.082  1.00 42.04  ? 273 PHE B CG  1 
ATOM   5120 C CD1 . PHE B 1 278 ? -49.573 -6.079  -5.597  1.00 44.04  ? 273 PHE B CD1 1 
ATOM   5121 C CD2 . PHE B 1 278 ? -50.555 -3.917  -5.175  1.00 43.07  ? 273 PHE B CD2 1 
ATOM   5122 C CE1 . PHE B 1 278 ? -49.621 -6.389  -4.219  1.00 43.67  ? 273 PHE B CE1 1 
ATOM   5123 C CE2 . PHE B 1 278 ? -50.602 -4.199  -3.801  1.00 44.55  ? 273 PHE B CE2 1 
ATOM   5124 C CZ  . PHE B 1 278 ? -50.137 -5.454  -3.318  1.00 45.34  ? 273 PHE B CZ  1 
ATOM   5125 N N   . LYS B 1 279 ? -47.724 -5.041  -9.845  1.00 40.60  ? 274 LYS B N   1 
ATOM   5126 C CA  . LYS B 1 279 ? -47.347 -5.244  -11.227 1.00 41.98  ? 274 LYS B CA  1 
ATOM   5127 C C   . LYS B 1 279 ? -47.524 -6.730  -11.488 1.00 40.99  ? 274 LYS B C   1 
ATOM   5128 O O   . LYS B 1 279 ? -47.347 -7.546  -10.571 1.00 39.58  ? 274 LYS B O   1 
ATOM   5129 C CB  . LYS B 1 279 ? -45.884 -4.838  -11.439 1.00 42.21  ? 274 LYS B CB  1 
ATOM   5130 C CG  . LYS B 1 279 ? -44.841 -5.966  -11.238 1.00 44.09  ? 274 LYS B CG  1 
ATOM   5131 C CD  . LYS B 1 279 ? -44.255 -6.377  -12.575 1.00 50.87  ? 274 LYS B CD  1 
ATOM   5132 C CE  . LYS B 1 279 ? -43.822 -5.132  -13.390 1.00 53.57  ? 274 LYS B CE  1 
ATOM   5133 N NZ  . LYS B 1 279 ? -44.006 -5.303  -14.865 1.00 59.72  ? 274 LYS B NZ  1 
ATOM   5134 N N   . ARG B 1 280 ? -47.887 -7.075  -12.718 1.00 41.27  ? 275 ARG B N   1 
ATOM   5135 C CA  . ARG B 1 280 ? -47.979 -8.480  -13.086 1.00 39.85  ? 275 ARG B CA  1 
ATOM   5136 C C   . ARG B 1 280 ? -46.696 -8.940  -13.816 1.00 39.16  ? 275 ARG B C   1 
ATOM   5137 O O   . ARG B 1 280 ? -46.222 -8.287  -14.753 1.00 39.84  ? 275 ARG B O   1 
ATOM   5138 C CB  . ARG B 1 280 ? -49.238 -8.723  -13.916 1.00 41.67  ? 275 ARG B CB  1 
ATOM   5139 C CG  . ARG B 1 280 ? -49.746 -10.136 -13.795 1.00 42.59  ? 275 ARG B CG  1 
ATOM   5140 C CD  . ARG B 1 280 ? -50.142 -10.619 -15.122 1.00 46.68  ? 275 ARG B CD  1 
ATOM   5141 N NE  . ARG B 1 280 ? -51.574 -10.726 -15.240 1.00 49.58  ? 275 ARG B NE  1 
ATOM   5142 C CZ  . ARG B 1 280 ? -52.214 -10.890 -16.390 1.00 51.56  ? 275 ARG B CZ  1 
ATOM   5143 N NH1 . ARG B 1 280 ? -51.544 -10.949 -17.531 1.00 53.00  ? 275 ARG B NH1 1 
ATOM   5144 N NH2 . ARG B 1 280 ? -53.534 -10.978 -16.389 1.00 53.74  ? 275 ARG B NH2 1 
ATOM   5145 N N   . ALA B 1 281 ? -46.133 -10.064 -13.380 1.00 37.78  ? 276 ALA B N   1 
ATOM   5146 C CA  . ALA B 1 281 ? -44.942 -10.662 -14.034 1.00 38.16  ? 276 ALA B CA  1 
ATOM   5147 C C   . ALA B 1 281 ? -45.239 -11.037 -15.472 1.00 41.21  ? 276 ALA B C   1 
ATOM   5148 O O   . ALA B 1 281 ? -46.400 -11.271 -15.819 1.00 43.23  ? 276 ALA B O   1 
ATOM   5149 C CB  . ALA B 1 281 ? -44.468 -11.878 -13.255 1.00 36.44  ? 276 ALA B CB  1 
ATOM   5150 N N   . SER B 1 282 ? -44.198 -11.088 -16.314 1.00 43.12  ? 277 SER B N   1 
ATOM   5151 C CA  . SER B 1 282 ? -44.315 -11.516 -17.691 1.00 45.36  ? 277 SER B CA  1 
ATOM   5152 C C   . SER B 1 282 ? -44.114 -13.038 -17.889 1.00 45.54  ? 277 SER B C   1 
ATOM   5153 O O   . SER B 1 282 ? -44.385 -13.581 -18.973 1.00 47.01  ? 277 SER B O   1 
ATOM   5154 C CB  . SER B 1 282 ? -43.318 -10.743 -18.577 1.00 48.65  ? 277 SER B CB  1 
ATOM   5155 O OG  . SER B 1 282 ? -43.695 -9.374  -18.723 1.00 52.79  ? 277 SER B OG  1 
ATOM   5156 N N   . ASN B 1 283 ? -43.616 -13.728 -16.874 1.00 42.75  ? 278 ASN B N   1 
ATOM   5157 C CA  . ASN B 1 283 ? -43.533 -15.182 -16.967 1.00 43.08  ? 278 ASN B CA  1 
ATOM   5158 C C   . ASN B 1 283 ? -44.939 -15.803 -16.724 1.00 41.82  ? 278 ASN B C   1 
ATOM   5159 O O   . ASN B 1 283 ? -45.865 -15.095 -16.298 1.00 40.53  ? 278 ASN B O   1 
ATOM   5160 C CB  . ASN B 1 283 ? -42.504 -15.714 -15.978 1.00 41.98  ? 278 ASN B CB  1 
ATOM   5161 C CG  . ASN B 1 283 ? -42.853 -15.406 -14.572 1.00 40.03  ? 278 ASN B CG  1 
ATOM   5162 O OD1 . ASN B 1 283 ? -43.789 -15.976 -13.999 1.00 41.18  ? 278 ASN B OD1 1 
ATOM   5163 N ND2 . ASN B 1 283 ? -42.105 -14.496 -13.977 1.00 39.67  ? 278 ASN B ND2 1 
ATOM   5164 N N   . ALA B 1 284 ? -45.060 -17.111 -16.940 1.00 41.73  ? 279 ALA B N   1 
ATOM   5165 C CA  . ALA B 1 284 ? -46.335 -17.812 -16.995 1.00 41.90  ? 279 ALA B CA  1 
ATOM   5166 C C   . ALA B 1 284 ? -47.073 -17.910 -15.667 1.00 40.71  ? 279 ALA B C   1 
ATOM   5167 O O   . ALA B 1 284 ? -48.278 -18.112 -15.642 1.00 40.67  ? 279 ALA B O   1 
ATOM   5168 C CB  . ALA B 1 284 ? -46.146 -19.218 -17.654 1.00 44.14  ? 279 ALA B CB  1 
ATOM   5169 N N   . PHE B 1 285 ? -46.366 -17.716 -14.560 1.00 39.60  ? 280 PHE B N   1 
ATOM   5170 C CA  . PHE B 1 285 ? -47.001 -17.659 -13.279 1.00 39.38  ? 280 PHE B CA  1 
ATOM   5171 C C   . PHE B 1 285 ? -47.845 -16.419 -13.131 1.00 39.22  ? 280 PHE B C   1 
ATOM   5172 O O   . PHE B 1 285 ? -48.778 -16.417 -12.350 1.00 38.10  ? 280 PHE B O   1 
ATOM   5173 C CB  . PHE B 1 285 ? -45.986 -17.733 -12.128 1.00 39.00  ? 280 PHE B CB  1 
ATOM   5174 C CG  . PHE B 1 285 ? -45.488 -19.101 -11.868 1.00 40.88  ? 280 PHE B CG  1 
ATOM   5175 C CD1 . PHE B 1 285 ? -44.448 -19.623 -12.615 1.00 42.63  ? 280 PHE B CD1 1 
ATOM   5176 C CD2 . PHE B 1 285 ? -46.063 -19.876 -10.870 1.00 40.48  ? 280 PHE B CD2 1 
ATOM   5177 C CE1 . PHE B 1 285 ? -43.986 -20.894 -12.370 1.00 45.88  ? 280 PHE B CE1 1 
ATOM   5178 C CE2 . PHE B 1 285 ? -45.612 -21.146 -10.637 1.00 41.34  ? 280 PHE B CE2 1 
ATOM   5179 C CZ  . PHE B 1 285 ? -44.583 -21.655 -11.367 1.00 43.40  ? 280 PHE B CZ  1 
ATOM   5180 N N   . LYS B 1 286 ? -47.533 -15.375 -13.893 1.00 40.68  ? 281 LYS B N   1 
ATOM   5181 C CA  . LYS B 1 286 ? -48.324 -14.131 -13.863 1.00 41.49  ? 281 LYS B CA  1 
ATOM   5182 C C   . LYS B 1 286 ? -48.570 -13.646 -12.442 1.00 40.52  ? 281 LYS B C   1 
ATOM   5183 O O   . LYS B 1 286 ? -49.663 -13.135 -12.118 1.00 40.33  ? 281 LYS B O   1 
ATOM   5184 C CB  . LYS B 1 286 ? -49.686 -14.289 -14.578 1.00 43.53  ? 281 LYS B CB  1 
ATOM   5185 C CG  . LYS B 1 286 ? -49.659 -14.967 -15.940 1.00 46.64  ? 281 LYS B CG  1 
ATOM   5186 C CD  . LYS B 1 286 ? -49.334 -14.007 -17.030 1.00 51.81  ? 281 LYS B CD  1 
ATOM   5187 C CE  . LYS B 1 286 ? -49.549 -14.663 -18.403 1.00 58.35  ? 281 LYS B CE  1 
ATOM   5188 N NZ  . LYS B 1 286 ? -48.777 -14.037 -19.526 1.00 61.43  ? 281 LYS B NZ  1 
ATOM   5189 N N   . THR B 1 287 ? -47.550 -13.773 -11.596 1.00 39.73  ? 282 THR B N   1 
ATOM   5190 C CA  . THR B 1 287 ? -47.688 -13.330 -10.211 1.00 38.40  ? 282 THR B CA  1 
ATOM   5191 C C   . THR B 1 287 ? -47.725 -11.796 -10.130 1.00 38.42  ? 282 THR B C   1 
ATOM   5192 O O   . THR B 1 287 ? -46.931 -11.100 -10.792 1.00 37.85  ? 282 THR B O   1 
ATOM   5193 C CB  . THR B 1 287 ? -46.537 -13.855 -9.312  1.00 38.47  ? 282 THR B CB  1 
ATOM   5194 O OG1 . THR B 1 287 ? -46.354 -15.265 -9.507  1.00 38.49  ? 282 THR B OG1 1 
ATOM   5195 C CG2 . THR B 1 287 ? -46.845 -13.601 -7.863  1.00 35.43  ? 282 THR B CG2 1 
ATOM   5196 N N   . TRP B 1 288 ? -48.666 -11.293 -9.332  1.00 38.18  ? 283 TRP B N   1 
ATOM   5197 C CA  . TRP B 1 288 ? -48.780 -9.884  -9.023  1.00 38.76  ? 283 TRP B CA  1 
ATOM   5198 C C   . TRP B 1 288 ? -47.859 -9.614  -7.860  1.00 38.06  ? 283 TRP B C   1 
ATOM   5199 O O   . TRP B 1 288 ? -47.858 -10.381 -6.911  1.00 38.44  ? 283 TRP B O   1 
ATOM   5200 C CB  . TRP B 1 288 ? -50.225 -9.533  -8.615  1.00 39.86  ? 283 TRP B CB  1 
ATOM   5201 C CG  . TRP B 1 288 ? -51.160 -9.361  -9.795  1.00 39.78  ? 283 TRP B CG  1 
ATOM   5202 C CD1 . TRP B 1 288 ? -52.002 -10.299 -10.325 1.00 40.79  ? 283 TRP B CD1 1 
ATOM   5203 C CD2 . TRP B 1 288 ? -51.315 -8.188  -10.595 1.00 39.57  ? 283 TRP B CD2 1 
ATOM   5204 N NE1 . TRP B 1 288 ? -52.676 -9.779  -11.402 1.00 39.92  ? 283 TRP B NE1 1 
ATOM   5205 C CE2 . TRP B 1 288 ? -52.266 -8.483  -11.591 1.00 41.65  ? 283 TRP B CE2 1 
ATOM   5206 C CE3 . TRP B 1 288 ? -50.733 -6.913  -10.570 1.00 39.97  ? 283 TRP B CE3 1 
ATOM   5207 C CZ2 . TRP B 1 288 ? -52.674 -7.539  -12.539 1.00 44.56  ? 283 TRP B CZ2 1 
ATOM   5208 C CZ3 . TRP B 1 288 ? -51.119 -5.985  -11.514 1.00 41.39  ? 283 TRP B CZ3 1 
ATOM   5209 C CH2 . TRP B 1 288 ? -52.092 -6.303  -12.493 1.00 45.04  ? 283 TRP B CH2 1 
ATOM   5210 N N   . SER B 1 289 ? -47.044 -8.568  -7.939  1.00 37.42  ? 284 SER B N   1 
ATOM   5211 C CA  . SER B 1 289 ? -46.217 -8.202  -6.788  1.00 38.08  ? 284 SER B CA  1 
ATOM   5212 C C   . SER B 1 289 ? -46.050 -6.697  -6.723  1.00 38.26  ? 284 SER B C   1 
ATOM   5213 O O   . SER B 1 289 ? -46.135 -6.014  -7.745  1.00 39.20  ? 284 SER B O   1 
ATOM   5214 C CB  . SER B 1 289 ? -44.855 -8.915  -6.793  1.00 37.86  ? 284 SER B CB  1 
ATOM   5215 O OG  . SER B 1 289 ? -44.036 -8.473  -7.861  1.00 38.84  ? 284 SER B OG  1 
ATOM   5216 N N   . ARG B 1 290 ? -45.805 -6.198  -5.520  1.00 37.82  ? 285 ARG B N   1 
ATOM   5217 C CA  . ARG B 1 290 ? -45.721 -4.756  -5.271  1.00 38.72  ? 285 ARG B CA  1 
ATOM   5218 C C   . ARG B 1 290 ? -44.277 -4.272  -5.472  1.00 38.39  ? 285 ARG B C   1 
ATOM   5219 O O   . ARG B 1 290 ? -43.327 -4.907  -4.985  1.00 39.03  ? 285 ARG B O   1 
ATOM   5220 C CB  . ARG B 1 290 ? -46.201 -4.471  -3.854  1.00 38.93  ? 285 ARG B CB  1 
ATOM   5221 C CG  . ARG B 1 290 ? -46.413 -3.027  -3.508  1.00 40.72  ? 285 ARG B CG  1 
ATOM   5222 C CD  . ARG B 1 290 ? -47.044 -2.949  -2.146  1.00 41.10  ? 285 ARG B CD  1 
ATOM   5223 N NE  . ARG B 1 290 ? -47.210 -1.567  -1.708  1.00 44.21  ? 285 ARG B NE  1 
ATOM   5224 C CZ  . ARG B 1 290 ? -48.194 -0.774  -2.108  1.00 44.96  ? 285 ARG B CZ  1 
ATOM   5225 N NH1 . ARG B 1 290 ? -49.086 -1.240  -2.976  1.00 47.82  ? 285 ARG B NH1 1 
ATOM   5226 N NH2 . ARG B 1 290 ? -48.277 0.475   -1.652  1.00 43.97  ? 285 ARG B NH2 1 
ATOM   5227 N N   . ARG B 1 291 ? -44.122 -3.188  -6.226  1.00 37.24  ? 286 ARG B N   1 
ATOM   5228 C CA  . ARG B 1 291 ? -42.820 -2.637  -6.530  1.00 36.90  ? 286 ARG B CA  1 
ATOM   5229 C C   . ARG B 1 291 ? -42.889 -1.127  -6.398  1.00 37.20  ? 286 ARG B C   1 
ATOM   5230 O O   . ARG B 1 291 ? -43.988 -0.554  -6.427  1.00 37.38  ? 286 ARG B O   1 
ATOM   5231 C CB  . ARG B 1 291 ? -42.390 -3.020  -7.967  1.00 38.27  ? 286 ARG B CB  1 
ATOM   5232 C CG  . ARG B 1 291 ? -42.031 -4.499  -8.179  1.00 37.99  ? 286 ARG B CG  1 
ATOM   5233 C CD  . ARG B 1 291 ? -41.058 -4.998  -7.098  1.00 42.79  ? 286 ARG B CD  1 
ATOM   5234 N NE  . ARG B 1 291 ? -40.650 -6.418  -7.234  1.00 46.51  ? 286 ARG B NE  1 
ATOM   5235 C CZ  . ARG B 1 291 ? -41.034 -7.397  -6.407  1.00 47.88  ? 286 ARG B CZ  1 
ATOM   5236 N NH1 . ARG B 1 291 ? -41.863 -7.148  -5.395  1.00 47.80  ? 286 ARG B NH1 1 
ATOM   5237 N NH2 . ARG B 1 291 ? -40.590 -8.630  -6.588  1.00 49.19  ? 286 ARG B NH2 1 
ATOM   5238 N N   . TRP B 1 292 ? -41.721 -0.490  -6.257  1.00 36.85  ? 287 TRP B N   1 
ATOM   5239 C CA  . TRP B 1 292 ? -41.615 0.965   -6.245  1.00 37.36  ? 287 TRP B CA  1 
ATOM   5240 C C   . TRP B 1 292 ? -41.358 1.408   -7.660  1.00 39.65  ? 287 TRP B C   1 
ATOM   5241 O O   . TRP B 1 292 ? -40.311 1.121   -8.237  1.00 41.33  ? 287 TRP B O   1 
ATOM   5242 C CB  . TRP B 1 292 ? -40.485 1.421   -5.314  1.00 36.46  ? 287 TRP B CB  1 
ATOM   5243 C CG  . TRP B 1 292 ? -40.317 2.929   -5.130  1.00 37.38  ? 287 TRP B CG  1 
ATOM   5244 C CD1 . TRP B 1 292 ? -39.315 3.726   -5.651  1.00 36.06  ? 287 TRP B CD1 1 
ATOM   5245 C CD2 . TRP B 1 292 ? -41.146 3.801   -4.339  1.00 34.39  ? 287 TRP B CD2 1 
ATOM   5246 N NE1 . TRP B 1 292 ? -39.498 5.036   -5.247  1.00 35.74  ? 287 TRP B NE1 1 
ATOM   5247 C CE2 . TRP B 1 292 ? -40.601 5.102   -4.434  1.00 34.50  ? 287 TRP B CE2 1 
ATOM   5248 C CE3 . TRP B 1 292 ? -42.280 3.596   -3.540  1.00 34.17  ? 287 TRP B CE3 1 
ATOM   5249 C CZ2 . TRP B 1 292 ? -41.168 6.216   -3.774  1.00 35.42  ? 287 TRP B CZ2 1 
ATOM   5250 C CZ3 . TRP B 1 292 ? -42.859 4.700   -2.906  1.00 37.90  ? 287 TRP B CZ3 1 
ATOM   5251 C CH2 . TRP B 1 292 ? -42.298 6.007   -3.030  1.00 32.67  ? 287 TRP B CH2 1 
ATOM   5252 N N   . PHE B 1 293 ? -42.329 2.110   -8.225  1.00 42.03  ? 288 PHE B N   1 
ATOM   5253 C CA  . PHE B 1 293 ? -42.256 2.595   -9.603  1.00 44.40  ? 288 PHE B CA  1 
ATOM   5254 C C   . PHE B 1 293 ? -41.829 4.029   -9.680  1.00 46.49  ? 288 PHE B C   1 
ATOM   5255 O O   . PHE B 1 293 ? -42.134 4.819   -8.794  1.00 47.28  ? 288 PHE B O   1 
ATOM   5256 C CB  . PHE B 1 293 ? -43.614 2.437   -10.274 1.00 44.83  ? 288 PHE B CB  1 
ATOM   5257 C CG  . PHE B 1 293 ? -43.853 1.067   -10.769 1.00 44.62  ? 288 PHE B CG  1 
ATOM   5258 C CD1 . PHE B 1 293 ? -44.243 0.054   -9.882  1.00 41.69  ? 288 PHE B CD1 1 
ATOM   5259 C CD2 . PHE B 1 293 ? -43.645 0.762   -12.114 1.00 45.45  ? 288 PHE B CD2 1 
ATOM   5260 C CE1 . PHE B 1 293 ? -44.459 -1.234  -10.324 1.00 40.22  ? 288 PHE B CE1 1 
ATOM   5261 C CE2 . PHE B 1 293 ? -43.840 -0.544  -12.571 1.00 46.65  ? 288 PHE B CE2 1 
ATOM   5262 C CZ  . PHE B 1 293 ? -44.248 -1.550  -11.655 1.00 43.05  ? 288 PHE B CZ  1 
ATOM   5263 N N   . THR B 1 294 ? -41.120 4.357   -10.749 1.00 48.73  ? 289 THR B N   1 
ATOM   5264 C CA  . THR B 1 294 ? -40.677 5.710   -11.002 1.00 50.95  ? 289 THR B CA  1 
ATOM   5265 C C   . THR B 1 294 ? -40.925 6.051   -12.471 1.00 53.65  ? 289 THR B C   1 
ATOM   5266 O O   . THR B 1 294 ? -40.472 5.337   -13.375 1.00 54.55  ? 289 THR B O   1 
ATOM   5267 C CB  . THR B 1 294 ? -39.185 5.885   -10.656 1.00 51.75  ? 289 THR B CB  1 
ATOM   5268 O OG1 . THR B 1 294 ? -38.992 5.603   -9.270  1.00 50.99  ? 289 THR B OG1 1 
ATOM   5269 C CG2 . THR B 1 294 ? -38.694 7.308   -10.952 1.00 54.29  ? 289 THR B CG2 1 
ATOM   5270 N N   . ILE B 1 295 ? -41.683 7.122   -12.683 1.00 55.32  ? 290 ILE B N   1 
ATOM   5271 C CA  . ILE B 1 295 ? -41.777 7.789   -13.982 1.00 59.57  ? 290 ILE B CA  1 
ATOM   5272 C C   . ILE B 1 295 ? -40.686 8.857   -13.980 1.00 61.62  ? 290 ILE B C   1 
ATOM   5273 O O   . ILE B 1 295 ? -40.702 9.757   -13.141 1.00 61.11  ? 290 ILE B O   1 
ATOM   5274 C CB  . ILE B 1 295 ? -43.134 8.519   -14.179 1.00 61.05  ? 290 ILE B CB  1 
ATOM   5275 C CG1 . ILE B 1 295 ? -44.321 7.560   -14.061 1.00 59.97  ? 290 ILE B CG1 1 
ATOM   5276 C CG2 . ILE B 1 295 ? -43.163 9.235   -15.526 1.00 65.66  ? 290 ILE B CG2 1 
ATOM   5277 C CD1 . ILE B 1 295 ? -45.691 8.276   -14.044 1.00 62.92  ? 290 ILE B CD1 1 
ATOM   5278 N N   . GLN B 1 296 ? -39.730 8.722   -14.894 1.00 64.12  ? 291 GLN B N   1 
ATOM   5279 C CA  . GLN B 1 296 ? -38.631 9.676   -15.039 1.00 67.17  ? 291 GLN B CA  1 
ATOM   5280 C C   . GLN B 1 296 ? -38.019 9.541   -16.421 1.00 71.06  ? 291 GLN B C   1 
ATOM   5281 O O   . GLN B 1 296 ? -37.833 8.421   -16.919 1.00 70.18  ? 291 GLN B O   1 
ATOM   5282 C CB  . GLN B 1 296 ? -37.561 9.497   -13.951 1.00 65.40  ? 291 GLN B CB  1 
ATOM   5283 C CG  . GLN B 1 296 ? -36.405 10.510  -14.018 1.00 70.35  ? 291 GLN B CG  1 
ATOM   5284 C CD  . GLN B 1 296 ? -35.955 11.059  -12.648 1.00 70.96  ? 291 GLN B CD  1 
ATOM   5285 O OE1 . GLN B 1 296 ? -35.513 12.216  -12.544 1.00 74.39  ? 291 GLN B OE1 1 
ATOM   5286 N NE2 . GLN B 1 296 ? -36.059 10.240  -11.609 1.00 65.55  ? 291 GLN B NE2 1 
ATOM   5287 N N   . SER B 1 297 ? -37.723 10.701  -17.021 1.00 75.39  ? 292 SER B N   1 
ATOM   5288 C CA  . SER B 1 297 ? -37.114 10.827  -18.348 1.00 80.44  ? 292 SER B CA  1 
ATOM   5289 C C   . SER B 1 297 ? -37.733 9.882   -19.378 1.00 81.27  ? 292 SER B C   1 
ATOM   5290 O O   . SER B 1 297 ? -37.038 9.068   -19.999 1.00 82.49  ? 292 SER B O   1 
ATOM   5291 C CB  . SER B 1 297 ? -35.594 10.661  -18.265 1.00 81.84  ? 292 SER B CB  1 
ATOM   5292 O OG  . SER B 1 297 ? -35.248 9.406   -17.722 1.00 77.95  ? 292 SER B OG  1 
ATOM   5293 N N   . ASN B 1 298 ? -39.056 9.993   -19.520 1.00 80.92  ? 293 ASN B N   1 
ATOM   5294 C CA  . ASN B 1 298 ? -39.868 9.168   -20.433 1.00 81.69  ? 293 ASN B CA  1 
ATOM   5295 C C   . ASN B 1 298 ? -39.623 7.660   -20.345 1.00 78.49  ? 293 ASN B C   1 
ATOM   5296 O O   . ASN B 1 298 ? -39.660 6.952   -21.348 1.00 80.50  ? 293 ASN B O   1 
ATOM   5297 C CB  . ASN B 1 298 ? -39.763 9.672   -21.885 1.00 88.01  ? 293 ASN B CB  1 
ATOM   5298 C CG  . ASN B 1 298 ? -40.013 11.170  -22.007 1.00 91.51  ? 293 ASN B CG  1 
ATOM   5299 O OD1 . ASN B 1 298 ? -39.343 11.853  -22.777 1.00 96.77  ? 293 ASN B OD1 1 
ATOM   5300 N ND2 . ASN B 1 298 ? -40.975 11.683  -21.244 1.00 88.72  ? 293 ASN B ND2 1 
ATOM   5301 N N   . GLN B 1 299 ? -39.371 7.186   -19.128 1.00 73.98  ? 294 GLN B N   1 
ATOM   5302 C CA  . GLN B 1 299 ? -39.273 5.757   -18.837 1.00 70.62  ? 294 GLN B CA  1 
ATOM   5303 C C   . GLN B 1 299 ? -40.107 5.456   -17.611 1.00 65.87  ? 294 GLN B C   1 
ATOM   5304 O O   . GLN B 1 299 ? -40.192 6.279   -16.680 1.00 64.87  ? 294 GLN B O   1 
ATOM   5305 C CB  . GLN B 1 299 ? -37.823 5.320   -18.600 1.00 70.57  ? 294 GLN B CB  1 
ATOM   5306 C CG  . GLN B 1 299 ? -36.977 5.219   -19.874 1.00 76.42  ? 294 GLN B CG  1 
ATOM   5307 C CD  . GLN B 1 299 ? -35.553 4.737   -19.627 1.00 78.05  ? 294 GLN B CD  1 
ATOM   5308 O OE1 . GLN B 1 299 ? -34.816 4.449   -20.568 1.00 82.97  ? 294 GLN B OE1 1 
ATOM   5309 N NE2 . GLN B 1 299 ? -35.160 4.653   -18.361 1.00 76.30  ? 294 GLN B NE2 1 
ATOM   5310 N N   . LEU B 1 300 ? -40.754 4.296   -17.640 1.00 63.22  ? 295 LEU B N   1 
ATOM   5311 C CA  . LEU B 1 300 ? -41.398 3.741   -16.472 1.00 58.88  ? 295 LEU B CA  1 
ATOM   5312 C C   . LEU B 1 300 ? -40.498 2.624   -15.962 1.00 56.42  ? 295 LEU B C   1 
ATOM   5313 O O   . LEU B 1 300 ? -40.227 1.659   -16.683 1.00 56.07  ? 295 LEU B O   1 
ATOM   5314 C CB  . LEU B 1 300 ? -42.811 3.217   -16.783 1.00 58.64  ? 295 LEU B CB  1 
ATOM   5315 C CG  . LEU B 1 300 ? -43.614 2.780   -15.546 1.00 55.68  ? 295 LEU B CG  1 
ATOM   5316 C CD1 . LEU B 1 300 ? -43.696 3.900   -14.493 1.00 54.20  ? 295 LEU B CD1 1 
ATOM   5317 C CD2 . LEU B 1 300 ? -45.004 2.267   -15.899 1.00 56.66  ? 295 LEU B CD2 1 
ATOM   5318 N N   . VAL B 1 301 ? -39.994 2.810   -14.737 1.00 54.33  ? 296 VAL B N   1 
ATOM   5319 C CA  . VAL B 1 301 ? -39.121 1.838   -14.069 1.00 52.57  ? 296 VAL B CA  1 
ATOM   5320 C C   . VAL B 1 301 ? -39.632 1.428   -12.686 1.00 49.83  ? 296 VAL B C   1 
ATOM   5321 O O   . VAL B 1 301 ? -40.450 2.129   -12.064 1.00 48.85  ? 296 VAL B O   1 
ATOM   5322 C CB  . VAL B 1 301 ? -37.659 2.321   -13.927 1.00 54.15  ? 296 VAL B CB  1 
ATOM   5323 C CG1 . VAL B 1 301 ? -37.082 2.764   -15.268 1.00 57.84  ? 296 VAL B CG1 1 
ATOM   5324 C CG2 . VAL B 1 301 ? -37.548 3.406   -12.898 1.00 52.66  ? 296 VAL B CG2 1 
ATOM   5325 N N   . TYR B 1 302 ? -39.147 0.283   -12.210 1.00 48.93  ? 297 TYR B N   1 
ATOM   5326 C CA  . TYR B 1 302 ? -39.384 -0.111  -10.831 1.00 46.79  ? 297 TYR B CA  1 
ATOM   5327 C C   . TYR B 1 302 ? -38.137 -0.697  -10.162 1.00 47.29  ? 297 TYR B C   1 
ATOM   5328 O O   . TYR B 1 302 ? -37.176 -1.094  -10.849 1.00 48.49  ? 297 TYR B O   1 
ATOM   5329 C CB  . TYR B 1 302 ? -40.590 -1.045  -10.733 1.00 45.49  ? 297 TYR B CB  1 
ATOM   5330 C CG  . TYR B 1 302 ? -40.347 -2.453  -11.217 1.00 47.01  ? 297 TYR B CG  1 
ATOM   5331 C CD1 . TYR B 1 302 ? -39.719 -3.396  -10.399 1.00 47.54  ? 297 TYR B CD1 1 
ATOM   5332 C CD2 . TYR B 1 302 ? -40.740 -2.847  -12.489 1.00 49.88  ? 297 TYR B CD2 1 
ATOM   5333 C CE1 . TYR B 1 302 ? -39.496 -4.689  -10.844 1.00 48.79  ? 297 TYR B CE1 1 
ATOM   5334 C CE2 . TYR B 1 302 ? -40.526 -4.136  -12.935 1.00 50.43  ? 297 TYR B CE2 1 
ATOM   5335 C CZ  . TYR B 1 302 ? -39.904 -5.048  -12.107 1.00 50.55  ? 297 TYR B CZ  1 
ATOM   5336 O OH  . TYR B 1 302 ? -39.689 -6.332  -12.555 1.00 54.29  ? 297 TYR B OH  1 
ATOM   5337 N N   . GLN B 1 303 ? -38.162 -0.693  -8.824  1.00 46.24  ? 298 GLN B N   1 
ATOM   5338 C CA  . GLN B 1 303 ? -37.164 -1.346  -7.960  1.00 46.90  ? 298 GLN B CA  1 
ATOM   5339 C C   . GLN B 1 303 ? -37.911 -2.056  -6.833  1.00 46.11  ? 298 GLN B C   1 
ATOM   5340 O O   . GLN B 1 303 ? -39.064 -1.679  -6.525  1.00 44.63  ? 298 GLN B O   1 
ATOM   5341 C CB  . GLN B 1 303 ? -36.233 -0.325  -7.316  1.00 47.80  ? 298 GLN B CB  1 
ATOM   5342 C CG  . GLN B 1 303 ? -35.332 0.454   -8.241  1.00 50.59  ? 298 GLN B CG  1 
ATOM   5343 C CD  . GLN B 1 303 ? -34.896 1.817   -7.648  1.00 52.63  ? 298 GLN B CD  1 
ATOM   5344 O OE1 . GLN B 1 303 ? -35.708 2.757   -7.474  1.00 47.98  ? 298 GLN B OE1 1 
ATOM   5345 N NE2 . GLN B 1 303 ? -33.612 1.925   -7.359  1.00 53.94  ? 298 GLN B NE2 1 
ATOM   5346 N N   . LYS B 1 304 ? -37.283 -3.077  -6.230  1.00 47.59  ? 299 LYS B N   1 
ATOM   5347 C CA  . LYS B 1 304 ? -37.747 -3.602  -4.915  1.00 47.59  ? 299 LYS B CA  1 
ATOM   5348 C C   . LYS B 1 304 ? -37.230 -2.680  -3.796  1.00 48.05  ? 299 LYS B C   1 
ATOM   5349 O O   . LYS B 1 304 ? -38.012 -1.990  -3.147  1.00 46.66  ? 299 LYS B O   1 
ATOM   5350 C CB  . LYS B 1 304 ? -37.319 -5.054  -4.633  1.00 48.48  ? 299 LYS B CB  1 
ATOM   5351 C CG  . LYS B 1 304 ? -37.122 -5.960  -5.858  1.00 51.14  ? 299 LYS B CG  1 
ATOM   5352 C CD  . LYS B 1 304 ? -36.347 -7.281  -5.520  1.00 55.56  ? 299 LYS B CD  1 
ATOM   5353 C CE  . LYS B 1 304 ? -37.206 -8.550  -5.749  1.00 54.89  ? 299 LYS B CE  1 
ATOM   5354 N NZ  . LYS B 1 304 ? -36.852 -9.696  -4.855  1.00 56.02  ? 299 LYS B NZ  1 
ATOM   5355 N N   . LYS B 1 305 ? -35.912 -2.646  -3.613  1.00 50.15  ? 300 LYS B N   1 
ATOM   5356 C CA  . LYS B 1 305 ? -35.285 -1.903  -2.528  1.00 51.90  ? 300 LYS B CA  1 
ATOM   5357 C C   . LYS B 1 305 ? -34.479 -0.716  -3.053  1.00 53.12  ? 300 LYS B C   1 
ATOM   5358 O O   . LYS B 1 305 ? -34.036 -0.715  -4.195  1.00 53.39  ? 300 LYS B O   1 
ATOM   5359 C CB  . LYS B 1 305 ? -34.343 -2.820  -1.715  1.00 54.54  ? 300 LYS B CB  1 
ATOM   5360 C CG  . LYS B 1 305 ? -34.820 -4.278  -1.552  1.00 56.26  ? 300 LYS B CG  1 
ATOM   5361 C CD  . LYS B 1 305 ? -36.013 -4.393  -0.579  1.00 56.53  ? 300 LYS B CD  1 
ATOM   5362 C CE  . LYS B 1 305 ? -35.592 -5.029  0.755   1.00 59.47  ? 300 LYS B CE  1 
ATOM   5363 N NZ  . LYS B 1 305 ? -34.215 -4.604  1.160   1.00 64.04  ? 300 LYS B NZ  1 
ATOM   5364 N N   . TYR B 1 306 ? -34.284 0.283   -2.195  1.00 53.67  ? 301 TYR B N   1 
ATOM   5365 C CA  . TYR B 1 306 ? -33.374 1.396   -2.449  1.00 55.97  ? 301 TYR B CA  1 
ATOM   5366 C C   . TYR B 1 306 ? -32.093 0.857   -3.090  1.00 59.02  ? 301 TYR B C   1 
ATOM   5367 O O   . TYR B 1 306 ? -31.701 -0.284  -2.838  1.00 59.67  ? 301 TYR B O   1 
ATOM   5368 C CB  . TYR B 1 306 ? -33.048 2.092   -1.125  1.00 56.46  ? 301 TYR B CB  1 
ATOM   5369 C CG  . TYR B 1 306 ? -32.487 3.498   -1.240  1.00 56.94  ? 301 TYR B CG  1 
ATOM   5370 C CD1 . TYR B 1 306 ? -31.249 3.827   -0.672  1.00 58.07  ? 301 TYR B CD1 1 
ATOM   5371 C CD2 . TYR B 1 306 ? -33.199 4.500   -1.885  1.00 54.39  ? 301 TYR B CD2 1 
ATOM   5372 C CE1 . TYR B 1 306 ? -30.738 5.101   -0.758  1.00 59.66  ? 301 TYR B CE1 1 
ATOM   5373 C CE2 . TYR B 1 306 ? -32.688 5.785   -1.992  1.00 55.86  ? 301 TYR B CE2 1 
ATOM   5374 C CZ  . TYR B 1 306 ? -31.462 6.079   -1.426  1.00 58.97  ? 301 TYR B CZ  1 
ATOM   5375 O OH  . TYR B 1 306 ? -30.965 7.362   -1.526  1.00 62.05  ? 301 TYR B OH  1 
ATOM   5376 N N   . LYS B 1 307 ? -31.472 1.660   -3.945  1.00 61.75  ? 302 LYS B N   1 
ATOM   5377 C CA  . LYS B 1 307 ? -30.205 1.293   -4.618  1.00 66.10  ? 302 LYS B CA  1 
ATOM   5378 C C   . LYS B 1 307 ? -30.222 -0.051  -5.357  1.00 66.10  ? 302 LYS B C   1 
ATOM   5379 O O   . LYS B 1 307 ? -29.180 -0.677  -5.551  1.00 69.23  ? 302 LYS B O   1 
ATOM   5380 C CB  . LYS B 1 307 ? -29.022 1.355   -3.641  1.00 69.42  ? 302 LYS B CB  1 
ATOM   5381 C CG  . LYS B 1 307 ? -28.780 2.728   -3.021  1.00 72.03  ? 302 LYS B CG  1 
ATOM   5382 C CD  . LYS B 1 307 ? -28.972 3.841   -4.044  1.00 73.20  ? 302 LYS B CD  1 
ATOM   5383 C CE  . LYS B 1 307 ? -28.437 5.178   -3.561  1.00 74.65  ? 302 LYS B CE  1 
ATOM   5384 N NZ  . LYS B 1 307 ? -29.264 6.255   -4.179  1.00 72.72  ? 302 LYS B NZ  1 
ATOM   5385 N N   . ASP B 1 308 ? -31.408 -0.509  -5.745  1.00 63.48  ? 303 ASP B N   1 
ATOM   5386 C CA  . ASP B 1 308 ? -31.509 -1.639  -6.669  1.00 63.92  ? 303 ASP B CA  1 
ATOM   5387 C C   . ASP B 1 308 ? -31.356 -1.138  -8.106  1.00 65.71  ? 303 ASP B C   1 
ATOM   5388 O O   . ASP B 1 308 ? -31.896 -0.065  -8.453  1.00 65.25  ? 303 ASP B O   1 
ATOM   5389 C CB  . ASP B 1 308 ? -32.853 -2.354  -6.540  1.00 60.36  ? 303 ASP B CB  1 
ATOM   5390 C CG  . ASP B 1 308 ? -32.895 -3.321  -5.387  1.00 61.31  ? 303 ASP B CG  1 
ATOM   5391 O OD1 . ASP B 1 308 ? -31.825 -3.687  -4.858  1.00 65.28  ? 303 ASP B OD1 1 
ATOM   5392 O OD2 . ASP B 1 308 ? -34.012 -3.723  -5.004  1.00 62.19  ? 303 ASP B OD2 1 
ATOM   5393 N N   . PRO B 1 309 ? -30.634 -1.908  -8.954  1.00 67.73  ? 304 PRO B N   1 
ATOM   5394 C CA  . PRO B 1 309 ? -30.700 -1.612  -10.386 1.00 68.77  ? 304 PRO B CA  1 
ATOM   5395 C C   . PRO B 1 309 ? -32.172 -1.533  -10.833 1.00 64.86  ? 304 PRO B C   1 
ATOM   5396 O O   . PRO B 1 309 ? -32.972 -2.401  -10.486 1.00 61.97  ? 304 PRO B O   1 
ATOM   5397 C CB  . PRO B 1 309 ? -30.002 -2.821  -11.029 1.00 71.19  ? 304 PRO B CB  1 
ATOM   5398 C CG  . PRO B 1 309 ? -30.035 -3.909  -9.977  1.00 69.91  ? 304 PRO B CG  1 
ATOM   5399 C CD  . PRO B 1 309 ? -29.913 -3.168  -8.684  1.00 69.39  ? 304 PRO B CD  1 
ATOM   5400 N N   . VAL B 1 310 ? -32.527 -0.476  -11.554 1.00 64.78  ? 305 VAL B N   1 
ATOM   5401 C CA  . VAL B 1 310 ? -33.880 -0.350  -12.080 1.00 62.22  ? 305 VAL B CA  1 
ATOM   5402 C C   . VAL B 1 310 ? -34.188 -1.389  -13.168 1.00 62.11  ? 305 VAL B C   1 
ATOM   5403 O O   . VAL B 1 310 ? -33.361 -1.679  -14.023 1.00 64.68  ? 305 VAL B O   1 
ATOM   5404 C CB  . VAL B 1 310 ? -34.174 1.078   -12.610 1.00 63.43  ? 305 VAL B CB  1 
ATOM   5405 C CG1 . VAL B 1 310 ? -33.679 2.117   -11.618 1.00 64.72  ? 305 VAL B CG1 1 
ATOM   5406 C CG2 . VAL B 1 310 ? -33.529 1.313   -13.973 1.00 67.09  ? 305 VAL B CG2 1 
ATOM   5407 N N   . THR B 1 311 ? -35.382 -1.959  -13.098 1.00 59.07  ? 306 THR B N   1 
ATOM   5408 C CA  . THR B 1 311 ? -35.950 -2.671  -14.224 1.00 59.94  ? 306 THR B CA  1 
ATOM   5409 C C   . THR B 1 311 ? -36.780 -1.670  -15.017 1.00 60.89  ? 306 THR B C   1 
ATOM   5410 O O   . THR B 1 311 ? -37.690 -1.048  -14.483 1.00 58.84  ? 306 THR B O   1 
ATOM   5411 C CB  . THR B 1 311 ? -36.839 -3.850  -13.777 1.00 57.09  ? 306 THR B CB  1 
ATOM   5412 O OG1 . THR B 1 311 ? -36.100 -4.685  -12.883 1.00 56.85  ? 306 THR B OG1 1 
ATOM   5413 C CG2 . THR B 1 311 ? -37.326 -4.671  -14.981 1.00 57.32  ? 306 THR B CG2 1 
ATOM   5414 N N   . VAL B 1 312 ? -36.446 -1.506  -16.289 1.00 65.01  ? 307 VAL B N   1 
ATOM   5415 C CA  . VAL B 1 312 ? -37.191 -0.609  -17.170 1.00 67.06  ? 307 VAL B CA  1 
ATOM   5416 C C   . VAL B 1 312 ? -38.343 -1.363  -17.860 1.00 66.90  ? 307 VAL B C   1 
ATOM   5417 O O   . VAL B 1 312 ? -38.131 -2.232  -18.700 1.00 68.82  ? 307 VAL B O   1 
ATOM   5418 C CB  . VAL B 1 312 ? -36.238 0.193   -18.136 1.00 71.70  ? 307 VAL B CB  1 
ATOM   5419 C CG1 . VAL B 1 312 ? -34.961 -0.586  -18.421 1.00 73.93  ? 307 VAL B CG1 1 
ATOM   5420 C CG2 . VAL B 1 312 ? -36.954 0.649   -19.414 1.00 74.33  ? 307 VAL B CG2 1 
ATOM   5421 N N   . VAL B 1 313 ? -39.562 -1.036  -17.446 1.00 65.37  ? 308 VAL B N   1 
ATOM   5422 C CA  . VAL B 1 313 ? -40.771 -1.673  -17.964 1.00 65.81  ? 308 VAL B CA  1 
ATOM   5423 C C   . VAL B 1 313 ? -41.283 -1.012  -19.268 1.00 69.93  ? 308 VAL B C   1 
ATOM   5424 O O   . VAL B 1 313 ? -41.886 -1.689  -20.120 1.00 71.62  ? 308 VAL B O   1 
ATOM   5425 C CB  . VAL B 1 313 ? -41.878 -1.839  -16.845 1.00 62.46  ? 308 VAL B CB  1 
ATOM   5426 C CG1 . VAL B 1 313 ? -41.856 -0.702  -15.845 1.00 61.63  ? 308 VAL B CG1 1 
ATOM   5427 C CG2 . VAL B 1 313 ? -43.260 -1.982  -17.435 1.00 64.01  ? 308 VAL B CG2 1 
ATOM   5428 N N   . VAL B 1 314 ? -41.009 0.286   -19.435 1.00 71.76  ? 309 VAL B N   1 
ATOM   5429 C CA  . VAL B 1 314 ? -41.301 0.993   -20.689 1.00 76.03  ? 309 VAL B CA  1 
ATOM   5430 C C   . VAL B 1 314 ? -40.075 1.778   -21.190 1.00 79.84  ? 309 VAL B C   1 
ATOM   5431 O O   . VAL B 1 314 ? -39.545 2.629   -20.461 1.00 79.24  ? 309 VAL B O   1 
ATOM   5432 C CB  . VAL B 1 314 ? -42.508 1.943   -20.538 1.00 76.19  ? 309 VAL B CB  1 
ATOM   5433 C CG1 . VAL B 1 314 ? -42.764 2.680   -21.837 1.00 81.36  ? 309 VAL B CG1 1 
ATOM   5434 C CG2 . VAL B 1 314 ? -43.763 1.183   -20.104 1.00 73.07  ? 309 VAL B CG2 1 
ATOM   5435 N N   . ASP B 1 315 ? -39.649 1.493   -22.430 1.00 84.19  ? 310 ASP B N   1 
ATOM   5436 C CA  . ASP B 1 315 ? -38.440 2.078   -23.053 1.00 88.66  ? 310 ASP B CA  1 
ATOM   5437 C C   . ASP B 1 315 ? -38.557 3.578   -23.297 1.00 92.06  ? 310 ASP B C   1 
ATOM   5438 O O   . ASP B 1 315 ? -37.613 4.333   -23.065 1.00 93.64  ? 310 ASP B O   1 
ATOM   5439 C CB  . ASP B 1 315 ? -38.134 1.439   -24.420 1.00 93.10  ? 310 ASP B CB  1 
ATOM   5440 C CG  . ASP B 1 315 ? -38.072 -0.086  -24.388 1.00 90.96  ? 310 ASP B CG  1 
ATOM   5441 O OD1 . ASP B 1 315 ? -37.756 -0.672  -25.451 1.00 95.16  ? 310 ASP B OD1 1 
ATOM   5442 O OD2 . ASP B 1 315 ? -38.341 -0.703  -23.340 1.00 84.56  ? 310 ASP B OD2 1 
ATOM   5443 N N   . ASP B 1 316 ? -39.712 3.988   -23.817 1.00 93.98  ? 311 ASP B N   1 
ATOM   5444 C CA  . ASP B 1 316 ? -39.965 5.367   -24.225 1.00 97.96  ? 311 ASP B CA  1 
ATOM   5445 C C   . ASP B 1 316 ? -41.466 5.610   -24.116 1.00 97.18  ? 311 ASP B C   1 
ATOM   5446 O O   . ASP B 1 316 ? -42.255 5.026   -24.858 1.00 98.49  ? 311 ASP B O   1 
ATOM   5447 C CB  . ASP B 1 316 ? -39.467 5.606   -25.657 1.00 104.89 ? 311 ASP B CB  1 
ATOM   5448 C CG  . ASP B 1 316 ? -39.433 7.080   -26.033 1.00 109.72 ? 311 ASP B CG  1 
ATOM   5449 O OD1 . ASP B 1 316 ? -39.325 7.383   -27.242 1.00 116.46 ? 311 ASP B OD1 1 
ATOM   5450 O OD2 . ASP B 1 316 ? -39.506 7.936   -25.124 1.00 108.42 ? 311 ASP B OD2 1 
ATOM   5451 N N   . LEU B 1 317 ? -41.857 6.468   -23.180 1.00 95.41  ? 312 LEU B N   1 
ATOM   5452 C CA  . LEU B 1 317 ? -43.265 6.591   -22.788 1.00 94.24  ? 312 LEU B CA  1 
ATOM   5453 C C   . LEU B 1 317 ? -44.104 7.427   -23.768 1.00 100.10 ? 312 LEU B C   1 
ATOM   5454 O O   . LEU B 1 317 ? -45.325 7.541   -23.610 1.00 99.94  ? 312 LEU B O   1 
ATOM   5455 C CB  . LEU B 1 317 ? -43.377 7.130   -21.353 1.00 90.18  ? 312 LEU B CB  1 
ATOM   5456 C CG  . LEU B 1 317 ? -44.519 6.601   -20.476 1.00 85.95  ? 312 LEU B CG  1 
ATOM   5457 C CD1 . LEU B 1 317 ? -44.133 5.303   -19.825 1.00 81.11  ? 312 LEU B CD1 1 
ATOM   5458 C CD2 . LEU B 1 317 ? -44.890 7.609   -19.411 1.00 85.32  ? 312 LEU B CD2 1 
ATOM   5459 N N   . ARG B 1 318 ? -43.440 7.992   -24.777 1.00 105.63 ? 313 ARG B N   1 
ATOM   5460 C CA  . ARG B 1 318 ? -44.109 8.728   -25.859 1.00 112.40 ? 313 ARG B CA  1 
ATOM   5461 C C   . ARG B 1 318 ? -44.404 7.840   -27.086 1.00 115.99 ? 313 ARG B C   1 
ATOM   5462 O O   . ARG B 1 318 ? -44.736 8.337   -28.160 1.00 122.54 ? 313 ARG B O   1 
ATOM   5463 C CB  . ARG B 1 318 ? -43.312 9.992   -26.235 1.00 117.03 ? 313 ARG B CB  1 
ATOM   5464 C CG  . ARG B 1 318 ? -41.800 9.802   -26.327 1.00 117.20 ? 313 ARG B CG  1 
ATOM   5465 C CD  . ARG B 1 318 ? -41.049 10.911  -25.595 1.00 117.12 ? 313 ARG B CD  1 
ATOM   5466 N NE  . ARG B 1 318 ? -40.901 12.117  -26.410 1.00 124.57 ? 313 ARG B NE  1 
ATOM   5467 C CZ  . ARG B 1 318 ? -40.437 13.283  -25.961 1.00 126.02 ? 313 ARG B CZ  1 
ATOM   5468 N NH1 . ARG B 1 318 ? -40.074 13.419  -24.690 1.00 120.99 ? 313 ARG B NH1 1 
ATOM   5469 N NH2 . ARG B 1 318 ? -40.339 14.320  -26.784 1.00 133.00 ? 313 ARG B NH2 1 
ATOM   5470 N N   . LEU B 1 319 ? -44.281 6.527   -26.903 1.00 112.38 ? 314 LEU B N   1 
ATOM   5471 C CA  . LEU B 1 319 ? -44.663 5.533   -27.903 1.00 114.89 ? 314 LEU B CA  1 
ATOM   5472 C C   . LEU B 1 319 ? -45.752 4.597   -27.348 1.00 110.83 ? 314 LEU B C   1 
ATOM   5473 O O   . LEU B 1 319 ? -45.963 3.496   -27.869 1.00 111.41 ? 314 LEU B O   1 
ATOM   5474 C CB  . LEU B 1 319 ? -43.442 4.706   -28.343 1.00 115.06 ? 314 LEU B CB  1 
ATOM   5475 C CG  . LEU B 1 319 ? -42.221 5.353   -29.011 1.00 119.79 ? 314 LEU B CG  1 
ATOM   5476 C CD1 . LEU B 1 319 ? -41.044 4.390   -28.949 1.00 117.78 ? 314 LEU B CD1 1 
ATOM   5477 C CD2 . LEU B 1 319 ? -42.500 5.766   -30.460 1.00 127.93 ? 314 LEU B CD2 1 
ATOM   5478 N N   . CYS B 1 320 ? -46.445 5.046   -26.302 1.00 107.32 ? 315 CYS B N   1 
ATOM   5479 C CA  . CYS B 1 320 ? -47.422 4.222   -25.596 1.00 103.23 ? 315 CYS B CA  1 
ATOM   5480 C C   . CYS B 1 320 ? -48.780 4.901   -25.409 1.00 104.98 ? 315 CYS B C   1 
ATOM   5481 O O   . CYS B 1 320 ? -48.909 6.114   -25.574 1.00 108.65 ? 315 CYS B O   1 
ATOM   5482 C CB  . CYS B 1 320 ? -46.862 3.821   -24.230 1.00 96.76  ? 315 CYS B CB  1 
ATOM   5483 S SG  . CYS B 1 320 ? -45.273 2.943   -24.286 1.00 95.14  ? 315 CYS B SG  1 
ATOM   5484 N N   . THR B 1 321 ? -49.795 4.100   -25.093 1.00 102.96 ? 316 THR B N   1 
ATOM   5485 C CA  . THR B 1 321 ? -51.090 4.611   -24.639 1.00 104.04 ? 316 THR B CA  1 
ATOM   5486 C C   . THR B 1 321 ? -51.473 3.917   -23.327 1.00 98.07  ? 316 THR B C   1 
ATOM   5487 O O   . THR B 1 321 ? -50.909 2.879   -22.990 1.00 93.97  ? 316 THR B O   1 
ATOM   5488 C CB  . THR B 1 321 ? -52.220 4.441   -25.700 1.00 109.85 ? 316 THR B CB  1 
ATOM   5489 O OG1 . THR B 1 321 ? -52.285 3.077   -26.129 1.00 109.30 ? 316 THR B OG1 1 
ATOM   5490 C CG2 . THR B 1 321 ? -51.996 5.348   -26.913 1.00 116.40 ? 316 THR B CG2 1 
ATOM   5491 N N   . VAL B 1 322 ? -52.417 4.499   -22.587 1.00 98.32  ? 317 VAL B N   1 
ATOM   5492 C CA  . VAL B 1 322 ? -52.862 3.954   -21.297 1.00 94.22  ? 317 VAL B CA  1 
ATOM   5493 C C   . VAL B 1 322 ? -54.359 3.648   -21.302 1.00 97.21  ? 317 VAL B C   1 
ATOM   5494 O O   . VAL B 1 322 ? -55.151 4.467   -21.749 1.00 102.40 ? 317 VAL B O   1 
ATOM   5495 C CB  . VAL B 1 322 ? -52.584 4.934   -20.112 1.00 91.81  ? 317 VAL B CB  1 
ATOM   5496 C CG1 . VAL B 1 322 ? -52.410 4.165   -18.803 1.00 85.06  ? 317 VAL B CG1 1 
ATOM   5497 C CG2 . VAL B 1 322 ? -51.365 5.798   -20.377 1.00 92.32  ? 317 VAL B CG2 1 
ATOM   5498 N N   . LYS B 1 323 ? -54.750 2.479   -20.794 1.00 94.87  ? 318 LYS B N   1 
ATOM   5499 C CA  . LYS B 1 323 ? -56.177 2.142   -20.682 1.00 97.95  ? 318 LYS B CA  1 
ATOM   5500 C C   . LYS B 1 323 ? -56.515 1.452   -19.367 1.00 94.00  ? 318 LYS B C   1 
ATOM   5501 O O   . LYS B 1 323 ? -55.683 0.745   -18.791 1.00 89.50  ? 318 LYS B O   1 
ATOM   5502 C CB  . LYS B 1 323 ? -56.663 1.261   -21.850 1.00 101.42 ? 318 LYS B CB  1 
ATOM   5503 C CG  . LYS B 1 323 ? -55.709 1.106   -23.030 1.00 102.71 ? 318 LYS B CG  1 
ATOM   5504 C CD  . LYS B 1 323 ? -54.736 -0.062  -22.815 1.00 97.54  ? 318 LYS B CD  1 
ATOM   5505 C CE  . LYS B 1 323 ? -55.388 -1.415  -23.105 1.00 98.17  ? 318 LYS B CE  1 
ATOM   5506 N NZ  . LYS B 1 323 ? -55.748 -1.609  -24.545 1.00 103.27 ? 318 LYS B NZ  1 
ATOM   5507 N N   . LEU B 1 324 ? -57.743 1.665   -18.903 1.00 96.84  ? 319 LEU B N   1 
ATOM   5508 C CA  . LEU B 1 324 ? -58.327 0.863   -17.834 1.00 94.86  ? 319 LEU B CA  1 
ATOM   5509 C C   . LEU B 1 324 ? -58.459 -0.586  -18.314 1.00 94.77  ? 319 LEU B C   1 
ATOM   5510 O O   . LEU B 1 324 ? -58.418 -0.848  -19.517 1.00 97.51  ? 319 LEU B O   1 
ATOM   5511 C CB  . LEU B 1 324 ? -59.719 1.396   -17.455 1.00 99.16  ? 319 LEU B CB  1 
ATOM   5512 C CG  . LEU B 1 324 ? -59.972 2.748   -16.762 1.00 100.47 ? 319 LEU B CG  1 
ATOM   5513 C CD1 . LEU B 1 324 ? -59.050 2.962   -15.538 1.00 94.94  ? 319 LEU B CD1 1 
ATOM   5514 C CD2 . LEU B 1 324 ? -59.888 3.917   -17.740 1.00 104.49 ? 319 LEU B CD2 1 
ATOM   5515 N N   . CYS B 1 325 ? -58.607 -1.519  -17.378 1.00 92.17  ? 320 CYS B N   1 
ATOM   5516 C CA  . CYS B 1 325 ? -58.923 -2.907  -17.720 1.00 92.77  ? 320 CYS B CA  1 
ATOM   5517 C C   . CYS B 1 325 ? -60.265 -3.304  -17.096 1.00 95.43  ? 320 CYS B C   1 
ATOM   5518 O O   . CYS B 1 325 ? -60.292 -3.852  -15.986 1.00 92.84  ? 320 CYS B O   1 
ATOM   5519 C CB  . CYS B 1 325 ? -57.824 -3.868  -17.253 1.00 87.30  ? 320 CYS B CB  1 
ATOM   5520 S SG  . CYS B 1 325 ? -56.124 -3.422  -17.706 1.00 85.34  ? 320 CYS B SG  1 
ATOM   5521 N N   . PRO B 1 326 ? -61.384 -3.017  -17.796 1.00 101.34 ? 321 PRO B N   1 
ATOM   5522 C CA  . PRO B 1 326 ? -62.705 -3.426  -17.311 1.00 104.58 ? 321 PRO B CA  1 
ATOM   5523 C C   . PRO B 1 326 ? -62.904 -4.937  -17.463 1.00 103.82 ? 321 PRO B C   1 
ATOM   5524 O O   . PRO B 1 326 ? -63.926 -5.480  -17.027 1.00 106.08 ? 321 PRO B O   1 
ATOM   5525 C CB  . PRO B 1 326 ? -63.665 -2.671  -18.236 1.00 111.71 ? 321 PRO B CB  1 
ATOM   5526 C CG  . PRO B 1 326 ? -62.908 -2.517  -19.513 1.00 112.19 ? 321 PRO B CG  1 
ATOM   5527 C CD  . PRO B 1 326 ? -61.472 -2.307  -19.088 1.00 105.99 ? 321 PRO B CD  1 
ATOM   5528 N N   . ASP B 1 327 ? -61.924 -5.589  -18.091 1.00 100.70 ? 322 ASP B N   1 
ATOM   5529 C CA  . ASP B 1 327 ? -61.941 -7.030  -18.309 1.00 99.68  ? 322 ASP B CA  1 
ATOM   5530 C C   . ASP B 1 327 ? -60.752 -7.702  -17.604 1.00 93.25  ? 322 ASP B C   1 
ATOM   5531 O O   . ASP B 1 327 ? -60.164 -8.651  -18.133 1.00 91.91  ? 322 ASP B O   1 
ATOM   5532 C CB  . ASP B 1 327 ? -61.944 -7.343  -19.812 1.00 103.10 ? 322 ASP B CB  1 
ATOM   5533 C CG  . ASP B 1 327 ? -62.786 -8.577  -20.164 1.00 106.85 ? 322 ASP B CG  1 
ATOM   5534 O OD1 . ASP B 1 327 ? -63.929 -8.408  -20.656 1.00 111.75 ? 322 ASP B OD1 1 
ATOM   5535 O OD2 . ASP B 1 327 ? -62.302 -9.714  -19.954 1.00 104.89 ? 322 ASP B OD2 1 
ATOM   5536 N N   . SER B 1 328 ? -60.382 -7.184  -16.429 1.00 89.28  ? 323 SER B N   1 
ATOM   5537 C CA  . SER B 1 328 ? -59.555 -7.949  -15.488 1.00 83.47  ? 323 SER B CA  1 
ATOM   5538 C C   . SER B 1 328 ? -60.271 -8.179  -14.148 1.00 82.40  ? 323 SER B C   1 
ATOM   5539 O O   . SER B 1 328 ? -61.204 -7.455  -13.784 1.00 84.91  ? 323 SER B O   1 
ATOM   5540 C CB  . SER B 1 328 ? -58.136 -7.367  -15.314 1.00 79.75  ? 323 SER B CB  1 
ATOM   5541 O OG  . SER B 1 328 ? -58.123 -6.237  -14.464 1.00 79.37  ? 323 SER B OG  1 
ATOM   5542 N N   . GLU B 1 329 ? -59.823 -9.211  -13.440 1.00 78.68  ? 324 GLU B N   1 
ATOM   5543 C CA  . GLU B 1 329 ? -60.460 -9.695  -12.214 1.00 78.28  ? 324 GLU B CA  1 
ATOM   5544 C C   . GLU B 1 329 ? -60.340 -8.741  -11.021 1.00 75.66  ? 324 GLU B C   1 
ATOM   5545 O O   . GLU B 1 329 ? -61.316 -8.490  -10.299 1.00 78.52  ? 324 GLU B O   1 
ATOM   5546 C CB  . GLU B 1 329 ? -59.897 -11.076 -11.847 1.00 76.20  ? 324 GLU B CB  1 
ATOM   5547 C CG  . GLU B 1 329 ? -58.362 -11.164 -11.857 1.00 72.88  ? 324 GLU B CG  1 
ATOM   5548 C CD  . GLU B 1 329 ? -57.853 -12.579 -11.999 1.00 74.35  ? 324 GLU B CD  1 
ATOM   5549 O OE1 . GLU B 1 329 ? -58.681 -13.483 -12.259 1.00 78.07  ? 324 GLU B OE1 1 
ATOM   5550 O OE2 . GLU B 1 329 ? -56.621 -12.789 -11.858 1.00 73.39  ? 324 GLU B OE2 1 
ATOM   5551 N N   . ARG B 1 330 ? -59.144 -8.210  -10.822 1.00 70.45  ? 325 ARG B N   1 
ATOM   5552 C CA  . ARG B 1 330 ? -58.867 -7.371  -9.668  1.00 67.30  ? 325 ARG B CA  1 
ATOM   5553 C C   . ARG B 1 330 ? -59.126 -5.907  -9.974  1.00 68.42  ? 325 ARG B C   1 
ATOM   5554 O O   . ARG B 1 330 ? -59.082 -5.492  -11.140 1.00 69.42  ? 325 ARG B O   1 
ATOM   5555 C CB  . ARG B 1 330 ? -57.451 -7.604  -9.166  1.00 62.78  ? 325 ARG B CB  1 
ATOM   5556 C CG  . ARG B 1 330 ? -56.439 -7.827  -10.245 1.00 59.83  ? 325 ARG B CG  1 
ATOM   5557 C CD  . ARG B 1 330 ? -55.419 -8.810  -9.765  1.00 54.47  ? 325 ARG B CD  1 
ATOM   5558 N NE  . ARG B 1 330 ? -54.445 -8.210  -8.860  1.00 51.39  ? 325 ARG B NE  1 
ATOM   5559 C CZ  . ARG B 1 330 ? -53.866 -8.851  -7.849  1.00 47.76  ? 325 ARG B CZ  1 
ATOM   5560 N NH1 . ARG B 1 330 ? -54.169 -10.109 -7.596  1.00 46.10  ? 325 ARG B NH1 1 
ATOM   5561 N NH2 . ARG B 1 330 ? -52.980 -8.230  -7.091  1.00 46.69  ? 325 ARG B NH2 1 
ATOM   5562 N N   . ARG B 1 331 ? -59.423 -5.144  -8.921  1.00 67.64  ? 326 ARG B N   1 
ATOM   5563 C CA  . ARG B 1 331 ? -59.804 -3.746  -9.056  1.00 69.38  ? 326 ARG B CA  1 
ATOM   5564 C C   . ARG B 1 331 ? -58.595 -2.860  -9.254  1.00 65.72  ? 326 ARG B C   1 
ATOM   5565 O O   . ARG B 1 331 ? -57.496 -3.202  -8.829  1.00 61.33  ? 326 ARG B O   1 
ATOM   5566 C CB  . ARG B 1 331 ? -60.556 -3.250  -7.816  1.00 71.62  ? 326 ARG B CB  1 
ATOM   5567 C CG  . ARG B 1 331 ? -61.888 -3.934  -7.510  1.00 76.39  ? 326 ARG B CG  1 
ATOM   5568 C CD  . ARG B 1 331 ? -62.337 -3.519  -6.111  1.00 78.64  ? 326 ARG B CD  1 
ATOM   5569 N NE  . ARG B 1 331 ? -61.281 -3.819  -5.149  1.00 74.11  ? 326 ARG B NE  1 
ATOM   5570 C CZ  . ARG B 1 331 ? -61.072 -3.178  -4.006  1.00 74.22  ? 326 ARG B CZ  1 
ATOM   5571 N NH1 . ARG B 1 331 ? -61.856 -2.169  -3.639  1.00 75.67  ? 326 ARG B NH1 1 
ATOM   5572 N NH2 . ARG B 1 331 ? -60.055 -3.551  -3.231  1.00 70.88  ? 326 ARG B NH2 1 
ATOM   5573 N N   . PHE B 1 332 ? -58.838 -1.716  -9.888  1.00 67.47  ? 327 PHE B N   1 
ATOM   5574 C CA  . PHE B 1 332 ? -57.883 -0.608  -10.020 1.00 65.78  ? 327 PHE B CA  1 
ATOM   5575 C C   . PHE B 1 332 ? -56.751 -0.926  -10.981 1.00 63.06  ? 327 PHE B C   1 
ATOM   5576 O O   . PHE B 1 332 ? -55.651 -0.394  -10.857 1.00 60.36  ? 327 PHE B O   1 
ATOM   5577 C CB  . PHE B 1 332 ? -57.365 -0.127  -8.645  1.00 63.46  ? 327 PHE B CB  1 
ATOM   5578 C CG  . PHE B 1 332 ? -58.454 0.051   -7.614  1.00 66.32  ? 327 PHE B CG  1 
ATOM   5579 C CD1 . PHE B 1 332 ? -59.538 0.893   -7.856  1.00 71.45  ? 327 PHE B CD1 1 
ATOM   5580 C CD2 . PHE B 1 332 ? -58.405 -0.640  -6.408  1.00 64.61  ? 327 PHE B CD2 1 
ATOM   5581 C CE1 . PHE B 1 332 ? -60.567 1.046   -6.907  1.00 74.20  ? 327 PHE B CE1 1 
ATOM   5582 C CE2 . PHE B 1 332 ? -59.424 -0.495  -5.455  1.00 67.75  ? 327 PHE B CE2 1 
ATOM   5583 C CZ  . PHE B 1 332 ? -60.507 0.351   -5.707  1.00 72.11  ? 327 PHE B CZ  1 
ATOM   5584 N N   . CYS B 1 333 ? -57.041 -1.790  -11.948 1.00 64.17  ? 328 CYS B N   1 
ATOM   5585 C CA  . CYS B 1 333 ? -56.062 -2.181  -12.955 1.00 63.07  ? 328 CYS B CA  1 
ATOM   5586 C C   . CYS B 1 333 ? -55.948 -1.225  -14.139 1.00 65.59  ? 328 CYS B C   1 
ATOM   5587 O O   . CYS B 1 333 ? -56.932 -0.642  -14.594 1.00 69.77  ? 328 CYS B O   1 
ATOM   5588 C CB  . CYS B 1 333 ? -56.366 -3.584  -13.467 1.00 63.12  ? 328 CYS B CB  1 
ATOM   5589 S SG  . CYS B 1 333 ? -55.761 -4.799  -12.338 1.00 61.11  ? 328 CYS B SG  1 
ATOM   5590 N N   . PHE B 1 334 ? -54.728 -1.096  -14.642 1.00 63.63  ? 329 PHE B N   1 
ATOM   5591 C CA  . PHE B 1 334 ? -54.484 -0.363  -15.865 1.00 66.29  ? 329 PHE B CA  1 
ATOM   5592 C C   . PHE B 1 334 ? -53.302 -0.933  -16.615 1.00 64.87  ? 329 PHE B C   1 
ATOM   5593 O O   . PHE B 1 334 ? -52.468 -1.640  -16.054 1.00 61.39  ? 329 PHE B O   1 
ATOM   5594 C CB  . PHE B 1 334 ? -54.339 1.149   -15.629 1.00 67.29  ? 329 PHE B CB  1 
ATOM   5595 C CG  . PHE B 1 334 ? -53.211 1.546   -14.712 1.00 63.67  ? 329 PHE B CG  1 
ATOM   5596 C CD1 . PHE B 1 334 ? -52.098 2.217   -15.218 1.00 63.80  ? 329 PHE B CD1 1 
ATOM   5597 C CD2 . PHE B 1 334 ? -53.280 1.306   -13.337 1.00 60.44  ? 329 PHE B CD2 1 
ATOM   5598 C CE1 . PHE B 1 334 ? -51.060 2.618   -14.377 1.00 60.79  ? 329 PHE B CE1 1 
ATOM   5599 C CE2 . PHE B 1 334 ? -52.249 1.703   -12.485 1.00 57.24  ? 329 PHE B CE2 1 
ATOM   5600 C CZ  . PHE B 1 334 ? -51.133 2.354   -13.004 1.00 57.78  ? 329 PHE B CZ  1 
ATOM   5601 N N   . GLU B 1 335 ? -53.248 -0.612  -17.898 1.00 68.64  ? 330 GLU B N   1 
ATOM   5602 C CA  . GLU B 1 335 ? -52.237 -1.137  -18.774 1.00 68.79  ? 330 GLU B CA  1 
ATOM   5603 C C   . GLU B 1 335 ? -51.508 -0.008  -19.484 1.00 71.14  ? 330 GLU B C   1 
ATOM   5604 O O   . GLU B 1 335 ? -52.119 0.961   -19.932 1.00 74.51  ? 330 GLU B O   1 
ATOM   5605 C CB  . GLU B 1 335 ? -52.890 -2.066  -19.791 1.00 71.68  ? 330 GLU B CB  1 
ATOM   5606 C CG  . GLU B 1 335 ? -51.913 -2.769  -20.706 1.00 74.03  ? 330 GLU B CG  1 
ATOM   5607 C CD  . GLU B 1 335 ? -52.510 -3.999  -21.367 1.00 78.03  ? 330 GLU B CD  1 
ATOM   5608 O OE1 . GLU B 1 335 ? -51.988 -5.113  -21.107 1.00 77.31  ? 330 GLU B OE1 1 
ATOM   5609 O OE2 . GLU B 1 335 ? -53.499 -3.855  -22.123 1.00 81.31  ? 330 GLU B OE2 1 
ATOM   5610 N N   . VAL B 1 336 ? -50.192 -0.147  -19.558 1.00 69.85  ? 331 VAL B N   1 
ATOM   5611 C CA  . VAL B 1 336 ? -49.350 0.697   -20.385 1.00 73.37  ? 331 VAL B CA  1 
ATOM   5612 C C   . VAL B 1 336 ? -48.923 -0.137  -21.594 1.00 76.34  ? 331 VAL B C   1 
ATOM   5613 O O   . VAL B 1 336 ? -48.274 -1.185  -21.447 1.00 74.01  ? 331 VAL B O   1 
ATOM   5614 C CB  . VAL B 1 336 ? -48.123 1.222   -19.591 1.00 70.52  ? 331 VAL B CB  1 
ATOM   5615 C CG1 . VAL B 1 336 ? -47.271 2.136   -20.457 1.00 74.35  ? 331 VAL B CG1 1 
ATOM   5616 C CG2 . VAL B 1 336 ? -48.574 1.972   -18.337 1.00 67.70  ? 331 VAL B CG2 1 
ATOM   5617 N N   . VAL B 1 337 ? -49.311 0.307   -22.788 1.00 82.52  ? 332 VAL B N   1 
ATOM   5618 C CA  . VAL B 1 337 ? -49.091 -0.488  -23.998 1.00 86.49  ? 332 VAL B CA  1 
ATOM   5619 C C   . VAL B 1 337 ? -48.078 0.159   -24.939 1.00 90.79  ? 332 VAL B C   1 
ATOM   5620 O O   . VAL B 1 337 ? -48.310 1.248   -25.472 1.00 94.83  ? 332 VAL B O   1 
ATOM   5621 C CB  . VAL B 1 337 ? -50.420 -0.806  -24.742 1.00 90.52  ? 332 VAL B CB  1 
ATOM   5622 C CG1 . VAL B 1 337 ? -50.169 -1.671  -25.990 1.00 93.70  ? 332 VAL B CG1 1 
ATOM   5623 C CG2 . VAL B 1 337 ? -51.385 -1.513  -23.813 1.00 87.54  ? 332 VAL B CG2 1 
ATOM   5624 N N   . SER B 1 338 ? -46.956 -0.532  -25.124 1.00 90.50  ? 333 SER B N   1 
ATOM   5625 C CA  . SER B 1 338 ? -45.884 -0.081  -26.001 1.00 94.82  ? 333 SER B CA  1 
ATOM   5626 C C   . SER B 1 338 ? -46.049 -0.751  -27.346 1.00 99.94  ? 333 SER B C   1 
ATOM   5627 O O   . SER B 1 338 ? -47.036 -1.461  -27.565 1.00 100.64 ? 333 SER B O   1 
ATOM   5628 C CB  . SER B 1 338 ? -44.520 -0.415  -25.396 1.00 91.66  ? 333 SER B CB  1 
ATOM   5629 O OG  . SER B 1 338 ? -44.344 0.246   -24.153 1.00 87.66  ? 333 SER B OG  1 
ATOM   5630 N N   . THR B 1 339 ? -45.092 -0.522  -28.244 1.00 104.33 ? 334 THR B N   1 
ATOM   5631 C CA  . THR B 1 339 ? -45.146 -1.093  -29.595 1.00 109.76 ? 334 THR B CA  1 
ATOM   5632 C C   . THR B 1 339 ? -45.287 -2.624  -29.570 1.00 107.62 ? 334 THR B C   1 
ATOM   5633 O O   . THR B 1 339 ? -46.339 -3.150  -29.941 1.00 108.79 ? 334 THR B O   1 
ATOM   5634 C CB  . THR B 1 339 ? -43.972 -0.596  -30.501 1.00 114.63 ? 334 THR B CB  1 
ATOM   5635 O OG1 . THR B 1 339 ? -43.628 -1.607  -31.455 1.00 117.60 ? 334 THR B OG1 1 
ATOM   5636 C CG2 . THR B 1 339 ? -42.736 -0.229  -29.670 1.00 111.34 ? 334 THR B CG2 1 
ATOM   5637 N N   . SER B 1 340 ? -44.252 -3.331  -29.114 1.00 104.80 ? 335 SER B N   1 
ATOM   5638 C CA  . SER B 1 340 ? -44.321 -4.790  -29.013 1.00 103.06 ? 335 SER B CA  1 
ATOM   5639 C C   . SER B 1 340 ? -44.661 -5.235  -27.602 1.00 96.90  ? 335 SER B C   1 
ATOM   5640 O O   . SER B 1 340 ? -45.416 -6.194  -27.412 1.00 95.32  ? 335 SER B O   1 
ATOM   5641 C CB  . SER B 1 340 ? -43.013 -5.446  -29.461 1.00 104.60 ? 335 SER B CB  1 
ATOM   5642 O OG  . SER B 1 340 ? -43.091 -5.879  -30.809 1.00 110.56 ? 335 SER B OG  1 
ATOM   5643 N N   . LYS B 1 341 ? -44.094 -4.531  -26.621 1.00 93.81  ? 336 LYS B N   1 
ATOM   5644 C CA  . LYS B 1 341 ? -44.255 -4.872  -25.215 1.00 88.33  ? 336 LYS B CA  1 
ATOM   5645 C C   . LYS B 1 341 ? -45.577 -4.353  -24.636 1.00 86.64  ? 336 LYS B C   1 
ATOM   5646 O O   . LYS B 1 341 ? -46.191 -3.426  -25.179 1.00 90.25  ? 336 LYS B O   1 
ATOM   5647 C CB  . LYS B 1 341 ? -43.065 -4.337  -24.397 1.00 86.49  ? 336 LYS B CB  1 
ATOM   5648 C CG  . LYS B 1 341 ? -41.986 -5.377  -24.032 1.00 85.05  ? 336 LYS B CG  1 
ATOM   5649 C CD  . LYS B 1 341 ? -40.912 -4.794  -23.098 1.00 83.18  ? 336 LYS B CD  1 
ATOM   5650 C CE  . LYS B 1 341 ? -41.265 -4.936  -21.613 1.00 78.86  ? 336 LYS B CE  1 
ATOM   5651 N NZ  . LYS B 1 341 ? -42.400 -4.080  -21.154 1.00 77.53  ? 336 LYS B NZ  1 
ATOM   5652 N N   . SER B 1 342 ? -46.005 -4.964  -23.534 1.00 81.43  ? 337 SER B N   1 
ATOM   5653 C CA  . SER B 1 342 ? -47.157 -4.490  -22.778 1.00 79.32  ? 337 SER B CA  1 
ATOM   5654 C C   . SER B 1 342 ? -46.935 -4.767  -21.286 1.00 73.81  ? 337 SER B C   1 
ATOM   5655 O O   . SER B 1 342 ? -46.238 -5.734  -20.915 1.00 71.74  ? 337 SER B O   1 
ATOM   5656 C CB  . SER B 1 342 ? -48.449 -5.137  -23.290 1.00 81.31  ? 337 SER B CB  1 
ATOM   5657 O OG  . SER B 1 342 ? -49.517 -4.941  -22.381 1.00 79.55  ? 337 SER B OG  1 
ATOM   5658 N N   . CYS B 1 343 ? -47.499 -3.917  -20.428 1.00 71.41  ? 338 CYS B N   1 
ATOM   5659 C CA  . CYS B 1 343 ? -47.313 -4.087  -18.985 1.00 66.26  ? 338 CYS B CA  1 
ATOM   5660 C C   . CYS B 1 343 ? -48.560 -3.763  -18.165 1.00 63.61  ? 338 CYS B C   1 
ATOM   5661 O O   . CYS B 1 343 ? -49.168 -2.704  -18.323 1.00 65.44  ? 338 CYS B O   1 
ATOM   5662 C CB  . CYS B 1 343 ? -46.134 -3.257  -18.509 1.00 65.45  ? 338 CYS B CB  1 
ATOM   5663 S SG  . CYS B 1 343 ? -46.604 -1.742  -17.643 1.00 70.61  ? 338 CYS B SG  1 
ATOM   5664 N N   . LEU B 1 344 ? -48.929 -4.693  -17.294 1.00 59.24  ? 339 LEU B N   1 
ATOM   5665 C CA  . LEU B 1 344 ? -50.110 -4.573  -16.443 1.00 57.55  ? 339 LEU B CA  1 
ATOM   5666 C C   . LEU B 1 344 ? -49.787 -4.077  -15.025 1.00 53.00  ? 339 LEU B C   1 
ATOM   5667 O O   . LEU B 1 344 ? -48.909 -4.608  -14.368 1.00 50.49  ? 339 LEU B O   1 
ATOM   5668 C CB  . LEU B 1 344 ? -50.808 -5.927  -16.347 1.00 57.28  ? 339 LEU B CB  1 
ATOM   5669 C CG  . LEU B 1 344 ? -51.808 -6.327  -17.414 1.00 62.96  ? 339 LEU B CG  1 
ATOM   5670 C CD1 . LEU B 1 344 ? -51.145 -7.024  -18.634 1.00 65.93  ? 339 LEU B CD1 1 
ATOM   5671 C CD2 . LEU B 1 344 ? -52.824 -7.241  -16.750 1.00 64.83  ? 339 LEU B CD2 1 
ATOM   5672 N N   . LEU B 1 345 ? -50.528 -3.079  -14.555 1.00 52.65  ? 340 LEU B N   1 
ATOM   5673 C CA  . LEU B 1 345 ? -50.279 -2.440  -13.249 1.00 48.68  ? 340 LEU B CA  1 
ATOM   5674 C C   . LEU B 1 345 ? -51.572 -2.274  -12.479 1.00 48.44  ? 340 LEU B C   1 
ATOM   5675 O O   . LEU B 1 345 ? -52.656 -2.308  -13.052 1.00 50.94  ? 340 LEU B O   1 
ATOM   5676 C CB  . LEU B 1 345 ? -49.625 -1.068  -13.429 1.00 49.10  ? 340 LEU B CB  1 
ATOM   5677 C CG  . LEU B 1 345 ? -48.417 -0.945  -14.359 1.00 48.38  ? 340 LEU B CG  1 
ATOM   5678 C CD1 . LEU B 1 345 ? -48.147 0.512   -14.685 1.00 48.41  ? 340 LEU B CD1 1 
ATOM   5679 C CD2 . LEU B 1 345 ? -47.200 -1.608  -13.736 1.00 44.08  ? 340 LEU B CD2 1 
ATOM   5680 N N   . GLN B 1 346 ? -51.450 -2.086  -11.176 1.00 45.52  ? 341 GLN B N   1 
ATOM   5681 C CA  . GLN B 1 346 ? -52.605 -1.963  -10.318 1.00 45.76  ? 341 GLN B CA  1 
ATOM   5682 C C   . GLN B 1 346 ? -52.325 -0.985  -9.181  1.00 45.70  ? 341 GLN B C   1 
ATOM   5683 O O   . GLN B 1 346 ? -51.252 -1.016  -8.585  1.00 43.80  ? 341 GLN B O   1 
ATOM   5684 C CB  . GLN B 1 346 ? -52.975 -3.317  -9.746  1.00 44.32  ? 341 GLN B CB  1 
ATOM   5685 C CG  . GLN B 1 346 ? -54.204 -3.248  -8.866  1.00 44.72  ? 341 GLN B CG  1 
ATOM   5686 C CD  . GLN B 1 346 ? -54.529 -4.544  -8.179  1.00 41.49  ? 341 GLN B CD  1 
ATOM   5687 O OE1 . GLN B 1 346 ? -55.618 -4.691  -7.636  1.00 44.38  ? 341 GLN B OE1 1 
ATOM   5688 N NE2 . GLN B 1 346 ? -53.598 -5.492  -8.194  1.00 38.23  ? 341 GLN B NE2 1 
ATOM   5689 N N   . ALA B 1 347 ? -53.292 -0.116  -8.896  1.00 48.31  ? 342 ALA B N   1 
ATOM   5690 C CA  . ALA B 1 347 ? -53.175 0.825   -7.803  1.00 48.25  ? 342 ALA B CA  1 
ATOM   5691 C C   . ALA B 1 347 ? -53.976 0.345   -6.579  1.00 48.93  ? 342 ALA B C   1 
ATOM   5692 O O   . ALA B 1 347 ? -54.745 -0.603  -6.671  1.00 50.29  ? 342 ALA B O   1 
ATOM   5693 C CB  . ALA B 1 347 ? -53.580 2.210   -8.252  1.00 50.43  ? 342 ALA B CB  1 
ATOM   5694 N N   . ASP B 1 348 ? -53.764 0.965   -5.429  1.00 48.79  ? 343 ASP B N   1 
ATOM   5695 C CA  . ASP B 1 348 ? -54.366 0.481   -4.186  1.00 49.98  ? 343 ASP B CA  1 
ATOM   5696 C C   . ASP B 1 348 ? -55.768 1.020   -3.934  1.00 53.74  ? 343 ASP B C   1 
ATOM   5697 O O   . ASP B 1 348 ? -56.534 0.413   -3.186  1.00 54.92  ? 343 ASP B O   1 
ATOM   5698 C CB  . ASP B 1 348 ? -53.423 0.754   -3.004  1.00 48.01  ? 343 ASP B CB  1 
ATOM   5699 C CG  . ASP B 1 348 ? -52.064 0.112   -3.204  1.00 45.91  ? 343 ASP B CG  1 
ATOM   5700 O OD1 . ASP B 1 348 ? -51.997 -1.150  -3.304  1.00 43.19  ? 343 ASP B OD1 1 
ATOM   5701 O OD2 . ASP B 1 348 ? -51.061 0.868   -3.295  1.00 46.05  ? 343 ASP B OD2 1 
ATOM   5702 N N   . SER B 1 349 ? -56.087 2.147   -4.579  1.00 56.35  ? 344 SER B N   1 
ATOM   5703 C CA  . SER B 1 349 ? -57.395 2.782   -4.479  1.00 61.76  ? 344 SER B CA  1 
ATOM   5704 C C   . SER B 1 349 ? -57.889 3.303   -5.842  1.00 65.10  ? 344 SER B C   1 
ATOM   5705 O O   . SER B 1 349 ? -57.117 3.376   -6.808  1.00 63.92  ? 344 SER B O   1 
ATOM   5706 C CB  . SER B 1 349 ? -57.348 3.950   -3.483  1.00 62.80  ? 344 SER B CB  1 
ATOM   5707 O OG  . SER B 1 349 ? -56.740 5.097   -4.062  1.00 61.60  ? 344 SER B OG  1 
ATOM   5708 N N   . GLU B 1 350 ? -59.169 3.680   -5.904  1.00 70.06  ? 345 GLU B N   1 
ATOM   5709 C CA  . GLU B 1 350 ? -59.717 4.347   -7.091  1.00 73.98  ? 345 GLU B CA  1 
ATOM   5710 C C   . GLU B 1 350 ? -59.054 5.702   -7.287  1.00 73.57  ? 345 GLU B C   1 
ATOM   5711 O O   . GLU B 1 350 ? -58.630 6.031   -8.393  1.00 74.19  ? 345 GLU B O   1 
ATOM   5712 C CB  . GLU B 1 350 ? -61.239 4.481   -7.033  1.00 80.02  ? 345 GLU B CB  1 
ATOM   5713 C CG  . GLU B 1 350 ? -61.797 4.927   -5.687  1.00 84.43  ? 345 GLU B CG  1 
ATOM   5714 C CD  . GLU B 1 350 ? -62.343 3.767   -4.857  1.00 86.12  ? 345 GLU B CD  1 
ATOM   5715 O OE1 . GLU B 1 350 ? -61.531 3.057   -4.207  1.00 78.99  ? 345 GLU B OE1 1 
ATOM   5716 O OE2 . GLU B 1 350 ? -63.597 3.602   -4.847  1.00 91.15  ? 345 GLU B OE2 1 
ATOM   5717 N N   . ARG B 1 351 ? -58.941 6.465   -6.203  1.00 72.69  ? 346 ARG B N   1 
ATOM   5718 C CA  . ARG B 1 351 ? -58.124 7.674   -6.182  1.00 71.53  ? 346 ARG B CA  1 
ATOM   5719 C C   . ARG B 1 351 ? -56.685 7.464   -6.728  1.00 66.94  ? 346 ARG B C   1 
ATOM   5720 O O   . ARG B 1 351 ? -56.224 8.218   -7.596  1.00 67.78  ? 346 ARG B O   1 
ATOM   5721 C CB  . ARG B 1 351 ? -58.073 8.212   -4.753  1.00 71.62  ? 346 ARG B CB  1 
ATOM   5722 C CG  . ARG B 1 351 ? -57.967 9.703   -4.668  1.00 73.89  ? 346 ARG B CG  1 
ATOM   5723 C CD  . ARG B 1 351 ? -58.198 10.184  -3.257  1.00 75.96  ? 346 ARG B CD  1 
ATOM   5724 N NE  . ARG B 1 351 ? -58.813 11.516  -3.194  1.00 83.23  ? 346 ARG B NE  1 
ATOM   5725 C CZ  . ARG B 1 351 ? -58.378 12.603  -3.839  1.00 84.87  ? 346 ARG B CZ  1 
ATOM   5726 N NH1 . ARG B 1 351 ? -57.320 12.544  -4.648  1.00 82.39  ? 346 ARG B NH1 1 
ATOM   5727 N NH2 . ARG B 1 351 ? -59.014 13.757  -3.685  1.00 89.24  ? 346 ARG B NH2 1 
ATOM   5728 N N   . LEU B 1 352 ? -55.985 6.447   -6.228  1.00 62.02  ? 347 LEU B N   1 
ATOM   5729 C CA  . LEU B 1 352 ? -54.615 6.188   -6.676  1.00 58.15  ? 347 LEU B CA  1 
ATOM   5730 C C   . LEU B 1 352 ? -54.570 5.827   -8.159  1.00 58.43  ? 347 LEU B C   1 
ATOM   5731 O O   . LEU B 1 352 ? -53.712 6.312   -8.899  1.00 58.39  ? 347 LEU B O   1 
ATOM   5732 C CB  . LEU B 1 352 ? -53.930 5.126   -5.813  1.00 54.02  ? 347 LEU B CB  1 
ATOM   5733 C CG  . LEU B 1 352 ? -53.260 5.678   -4.545  1.00 53.35  ? 347 LEU B CG  1 
ATOM   5734 C CD1 . LEU B 1 352 ? -52.735 4.549   -3.665  1.00 50.45  ? 347 LEU B CD1 1 
ATOM   5735 C CD2 . LEU B 1 352 ? -52.134 6.643   -4.880  1.00 51.76  ? 347 LEU B CD2 1 
ATOM   5736 N N   . LEU B 1 353 ? -55.527 5.020   -8.592  1.00 59.18  ? 348 LEU B N   1 
ATOM   5737 C CA  . LEU B 1 353 ? -55.695 4.727   -10.008 1.00 60.88  ? 348 LEU B CA  1 
ATOM   5738 C C   . LEU B 1 353 ? -55.692 5.993   -10.895 1.00 63.91  ? 348 LEU B C   1 
ATOM   5739 O O   . LEU B 1 353 ? -54.903 6.090   -11.844 1.00 63.47  ? 348 LEU B O   1 
ATOM   5740 C CB  . LEU B 1 353 ? -56.982 3.901   -10.223 1.00 63.33  ? 348 LEU B CB  1 
ATOM   5741 C CG  . LEU B 1 353 ? -57.459 3.556   -11.629 1.00 65.92  ? 348 LEU B CG  1 
ATOM   5742 C CD1 . LEU B 1 353 ? -56.449 2.679   -12.382 1.00 62.29  ? 348 LEU B CD1 1 
ATOM   5743 C CD2 . LEU B 1 353 ? -58.825 2.884   -11.547 1.00 70.23  ? 348 LEU B CD2 1 
ATOM   5744 N N   . GLN B 1 354 ? -56.562 6.949   -10.586 1.00 66.97  ? 349 GLN B N   1 
ATOM   5745 C CA  . GLN B 1 354 ? -56.760 8.105   -11.468 1.00 71.48  ? 349 GLN B CA  1 
ATOM   5746 C C   . GLN B 1 354 ? -55.518 8.990   -11.491 1.00 69.52  ? 349 GLN B C   1 
ATOM   5747 O O   . GLN B 1 354 ? -55.129 9.517   -12.542 1.00 71.25  ? 349 GLN B O   1 
ATOM   5748 C CB  . GLN B 1 354 ? -58.007 8.931   -11.083 1.00 76.47  ? 349 GLN B CB  1 
ATOM   5749 C CG  . GLN B 1 354 ? -59.322 8.146   -10.830 1.00 80.48  ? 349 GLN B CG  1 
ATOM   5750 C CD  . GLN B 1 354 ? -59.764 7.237   -11.986 1.00 85.78  ? 349 GLN B CD  1 
ATOM   5751 O OE1 . GLN B 1 354 ? -60.026 6.045   -11.779 1.00 87.24  ? 349 GLN B OE1 1 
ATOM   5752 N NE2 . GLN B 1 354 ? -59.855 7.793   -13.199 1.00 89.06  ? 349 GLN B NE2 1 
ATOM   5753 N N   . LEU B 1 355 ? -54.918 9.136   -10.313 1.00 66.22  ? 350 LEU B N   1 
ATOM   5754 C CA  . LEU B 1 355 ? -53.692 9.901   -10.098 1.00 64.95  ? 350 LEU B CA  1 
ATOM   5755 C C   . LEU B 1 355 ? -52.534 9.395   -10.979 1.00 62.62  ? 350 LEU B C   1 
ATOM   5756 O O   . LEU B 1 355 ? -51.901 10.186  -11.691 1.00 63.98  ? 350 LEU B O   1 
ATOM   5757 C CB  . LEU B 1 355 ? -53.308 9.804   -8.614  1.00 62.44  ? 350 LEU B CB  1 
ATOM   5758 C CG  . LEU B 1 355 ? -52.654 10.926  -7.804  1.00 63.01  ? 350 LEU B CG  1 
ATOM   5759 C CD1 . LEU B 1 355 ? -53.214 12.333  -8.105  1.00 67.74  ? 350 LEU B CD1 1 
ATOM   5760 C CD2 . LEU B 1 355 ? -52.802 10.599  -6.311  1.00 62.13  ? 350 LEU B CD2 1 
ATOM   5761 N N   . TRP B 1 356 ? -52.268 8.087   -10.898 1.00 58.62  ? 351 TRP B N   1 
ATOM   5762 C CA  . TRP B 1 356 ? -51.329 7.389   -11.776 1.00 57.17  ? 351 TRP B CA  1 
ATOM   5763 C C   . TRP B 1 356 ? -51.653 7.467   -13.284 1.00 60.68  ? 351 TRP B C   1 
ATOM   5764 O O   . TRP B 1 356 ? -50.766 7.713   -14.110 1.00 60.97  ? 351 TRP B O   1 
ATOM   5765 C CB  . TRP B 1 356 ? -51.204 5.904   -11.350 1.00 53.80  ? 351 TRP B CB  1 
ATOM   5766 C CG  . TRP B 1 356 ? -50.218 5.693   -10.258 1.00 50.30  ? 351 TRP B CG  1 
ATOM   5767 C CD1 . TRP B 1 356 ? -50.483 5.460   -8.932  1.00 49.49  ? 351 TRP B CD1 1 
ATOM   5768 C CD2 . TRP B 1 356 ? -48.796 5.711   -10.387 1.00 50.66  ? 351 TRP B CD2 1 
ATOM   5769 N NE1 . TRP B 1 356 ? -49.306 5.317   -8.227  1.00 46.64  ? 351 TRP B NE1 1 
ATOM   5770 C CE2 . TRP B 1 356 ? -48.255 5.482   -9.096  1.00 48.72  ? 351 TRP B CE2 1 
ATOM   5771 C CE3 . TRP B 1 356 ? -47.919 5.898   -11.470 1.00 51.98  ? 351 TRP B CE3 1 
ATOM   5772 C CZ2 . TRP B 1 356 ? -46.876 5.449   -8.861  1.00 46.88  ? 351 TRP B CZ2 1 
ATOM   5773 C CZ3 . TRP B 1 356 ? -46.550 5.862   -11.238 1.00 50.82  ? 351 TRP B CZ3 1 
ATOM   5774 C CH2 . TRP B 1 356 ? -46.042 5.644   -9.941  1.00 48.22  ? 351 TRP B CH2 1 
ATOM   5775 N N   . VAL B 1 357 ? -52.904 7.241   -13.661 1.00 63.58  ? 352 VAL B N   1 
ATOM   5776 C CA  . VAL B 1 357 ? -53.181 7.229   -15.086 1.00 68.01  ? 352 VAL B CA  1 
ATOM   5777 C C   . VAL B 1 357 ? -53.010 8.593   -15.762 1.00 72.62  ? 352 VAL B C   1 
ATOM   5778 O O   . VAL B 1 357 ? -52.470 8.646   -16.874 1.00 74.66  ? 352 VAL B O   1 
ATOM   5779 C CB  . VAL B 1 357 ? -54.497 6.484   -15.505 1.00 70.71  ? 352 VAL B CB  1 
ATOM   5780 C CG1 . VAL B 1 357 ? -54.507 5.027   -14.986 1.00 65.61  ? 352 VAL B CG1 1 
ATOM   5781 C CG2 . VAL B 1 357 ? -55.770 7.264   -15.130 1.00 75.01  ? 352 VAL B CG2 1 
ATOM   5782 N N   . SER B 1 358 ? -53.425 9.683   -15.104 1.00 74.40  ? 353 SER B N   1 
ATOM   5783 C CA  . SER B 1 358 ? -53.225 11.013  -15.702 1.00 79.48  ? 353 SER B CA  1 
ATOM   5784 C C   . SER B 1 358 ? -51.777 11.472  -15.568 1.00 77.61  ? 353 SER B C   1 
ATOM   5785 O O   . SER B 1 358 ? -51.339 12.372  -16.277 1.00 80.84  ? 353 SER B O   1 
ATOM   5786 C CB  . SER B 1 358 ? -54.227 12.069  -15.196 1.00 82.85  ? 353 SER B CB  1 
ATOM   5787 O OG  . SER B 1 358 ? -54.184 12.217  -13.797 1.00 80.91  ? 353 SER B OG  1 
ATOM   5788 N N   . ALA B 1 359 ? -51.035 10.830  -14.668 1.00 73.16  ? 354 ALA B N   1 
ATOM   5789 C CA  . ALA B 1 359 ? -49.593 11.033  -14.575 1.00 71.85  ? 354 ALA B CA  1 
ATOM   5790 C C   . ALA B 1 359 ? -48.900 10.410  -15.787 1.00 73.18  ? 354 ALA B C   1 
ATOM   5791 O O   . ALA B 1 359 ? -48.063 11.050  -16.418 1.00 75.85  ? 354 ALA B O   1 
ATOM   5792 C CB  . ALA B 1 359 ? -49.044 10.460  -13.276 1.00 66.36  ? 354 ALA B CB  1 
ATOM   5793 N N   . VAL B 1 360 ? -49.259 9.171   -16.117 1.00 72.35  ? 355 VAL B N   1 
ATOM   5794 C CA  . VAL B 1 360 ? -48.775 8.551   -17.341 1.00 74.69  ? 355 VAL B CA  1 
ATOM   5795 C C   . VAL B 1 360 ? -49.290 9.304   -18.577 1.00 81.05  ? 355 VAL B C   1 
ATOM   5796 O O   . VAL B 1 360 ? -48.511 9.596   -19.489 1.00 84.02  ? 355 VAL B O   1 
ATOM   5797 C CB  . VAL B 1 360 ? -49.176 7.069   -17.447 1.00 72.68  ? 355 VAL B CB  1 
ATOM   5798 C CG1 . VAL B 1 360 ? -48.493 6.431   -18.654 1.00 74.48  ? 355 VAL B CG1 1 
ATOM   5799 C CG2 . VAL B 1 360 ? -48.814 6.307   -16.171 1.00 67.65  ? 355 VAL B CG2 1 
ATOM   5800 N N   . GLN B 1 361 ? -50.587 9.626   -18.605 1.00 83.91  ? 356 GLN B N   1 
ATOM   5801 C CA  . GLN B 1 361 ? -51.162 10.409  -19.711 1.00 90.63  ? 356 GLN B CA  1 
ATOM   5802 C C   . GLN B 1 361 ? -50.316 11.651  -19.988 1.00 93.39  ? 356 GLN B C   1 
ATOM   5803 O O   . GLN B 1 361 ? -50.081 12.005  -21.142 1.00 97.52  ? 356 GLN B O   1 
ATOM   5804 C CB  . GLN B 1 361 ? -52.613 10.840  -19.425 1.00 93.47  ? 356 GLN B CB  1 
ATOM   5805 C CG  . GLN B 1 361 ? -53.682 9.774   -19.658 1.00 93.93  ? 356 GLN B CG  1 
ATOM   5806 C CD  . GLN B 1 361 ? -55.091 10.341  -19.607 1.00 98.38  ? 356 GLN B CD  1 
ATOM   5807 O OE1 . GLN B 1 361 ? -55.571 10.939  -20.574 1.00 106.54 ? 356 GLN B OE1 1 
ATOM   5808 N NE2 . GLN B 1 361 ? -55.763 10.152  -18.483 1.00 95.45  ? 356 GLN B NE2 1 
ATOM   5809 N N   . SER B 1 362 ? -49.847 12.287  -18.912 1.00 91.10  ? 357 SER B N   1 
ATOM   5810 C CA  . SER B 1 362 ? -49.090 13.538  -19.010 1.00 93.58  ? 357 SER B CA  1 
ATOM   5811 C C   . SER B 1 362 ? -47.668 13.293  -19.502 1.00 92.76  ? 357 SER B C   1 
ATOM   5812 O O   . SER B 1 362 ? -47.148 14.075  -20.305 1.00 96.92  ? 357 SER B O   1 
ATOM   5813 C CB  . SER B 1 362 ? -49.071 14.271  -17.666 1.00 91.30  ? 357 SER B CB  1 
ATOM   5814 O OG  . SER B 1 362 ? -50.382 14.635  -17.274 1.00 93.05  ? 357 SER B OG  1 
ATOM   5815 N N   . SER B 1 363 ? -47.049 12.204  -19.033 1.00 87.34  ? 358 SER B N   1 
ATOM   5816 C CA  . SER B 1 363 ? -45.688 11.873  -19.456 1.00 86.85  ? 358 SER B CA  1 
ATOM   5817 C C   . SER B 1 363 ? -45.659 11.337  -20.888 1.00 90.54  ? 358 SER B C   1 
ATOM   5818 O O   . SER B 1 363 ? -44.592 10.993  -21.400 1.00 91.49  ? 358 SER B O   1 
ATOM   5819 C CB  . SER B 1 363 ? -45.024 10.870  -18.510 1.00 80.73  ? 358 SER B CB  1 
ATOM   5820 O OG  . SER B 1 363 ? -45.731 10.762  -17.299 1.00 77.19  ? 358 SER B OG  1 
ATOM   5821 N N   . ILE B 1 364 ? -46.831 11.251  -21.519 1.00 93.32  ? 359 ILE B N   1 
ATOM   5822 C CA  . ILE B 1 364 ? -46.926 10.916  -22.937 1.00 97.60  ? 359 ILE B CA  1 
ATOM   5823 C C   . ILE B 1 364 ? -46.828 12.200  -23.759 1.00 104.06 ? 359 ILE B C   1 
ATOM   5824 O O   . ILE B 1 364 ? -46.441 12.175  -24.929 1.00 108.56 ? 359 ILE B O   1 
ATOM   5825 C CB  . ILE B 1 364 ? -48.226 10.125  -23.266 1.00 98.17  ? 359 ILE B CB  1 
ATOM   5826 C CG1 . ILE B 1 364 ? -48.312 8.867   -22.389 1.00 92.18  ? 359 ILE B CG1 1 
ATOM   5827 C CG2 . ILE B 1 364 ? -48.270 9.725   -24.739 1.00 102.80 ? 359 ILE B CG2 1 
ATOM   5828 C CD1 . ILE B 1 364 ? -49.549 8.019   -22.611 1.00 93.24  ? 359 ILE B CD1 1 
ATOM   5829 N N   . ALA B 1 365 ? -47.162 13.325  -23.131 1.00 104.81 ? 360 ALA B N   1 
ATOM   5830 C CA  . ALA B 1 365 ? -47.107 14.634  -23.798 1.00 110.78 ? 360 ALA B CA  1 
ATOM   5831 C C   . ALA B 1 365 ? -45.657 15.054  -24.042 1.00 111.74 ? 360 ALA B C   1 
ATOM   5832 O O   . ALA B 1 365 ? -44.795 14.907  -23.155 1.00 106.79 ? 360 ALA B O   1 
ATOM   5833 C CB  . ALA B 1 365 ? -47.855 15.686  -22.996 1.00 111.20 ? 360 ALA B CB  1 
ATOM   5834 N N   . SER B 1 366 ? -45.402 15.544  -25.257 1.00 118.15 ? 361 SER B N   1 
ATOM   5835 C CA  . SER B 1 366 ? -44.062 15.931  -25.704 1.00 120.63 ? 361 SER B CA  1 
ATOM   5836 C C   . SER B 1 366 ? -43.955 17.440  -25.954 1.00 126.42 ? 361 SER B C   1 
ATOM   5837 O O   . SER B 1 366 ? -44.423 17.948  -26.975 1.00 133.14 ? 361 SER B O   1 
ATOM   5838 C CB  . SER B 1 366 ? -43.674 15.145  -26.967 1.00 123.99 ? 361 SER B CB  1 
ATOM   5839 O OG  . SER B 1 366 ? -42.530 15.703  -27.599 1.00 128.13 ? 361 SER B OG  1 
HETATM 5840 O O   . HOH C 2 .   ? -1.927  0.543   41.644  1.00 16.71  ? 401 HOH A O   1 
HETATM 5841 O O   . HOH C 2 .   ? 3.574   -17.473 49.553  1.00 16.50  ? 402 HOH A O   1 
HETATM 5842 O O   . HOH C 2 .   ? 4.875   8.903   50.307  1.00 10.11  ? 403 HOH A O   1 
HETATM 5843 O O   . HOH C 2 .   ? -57.006 -5.339  3.611   1.00 18.07  ? 404 HOH A O   1 
HETATM 5844 O O   . HOH C 2 .   ? -39.830 -5.329  30.199  1.00 7.02   ? 405 HOH A O   1 
HETATM 5845 O O   . HOH C 2 .   ? -35.670 -2.541  30.324  1.00 19.62  ? 406 HOH A O   1 
HETATM 5846 O O   . HOH C 2 .   ? -38.258 8.468   -2.022  1.00 13.34  ? 407 HOH A O   1 
HETATM 5847 O O   . HOH C 2 .   ? -34.882 0.179   27.186  1.00 10.22  ? 408 HOH A O   1 
HETATM 5848 O O   . HOH C 2 .   ? -2.003  -15.822 46.932  1.00 20.07  ? 409 HOH A O   1 
HETATM 5849 O O   . HOH C 2 .   ? -19.127 -9.963  25.700  1.00 17.42  ? 410 HOH A O   1 
HETATM 5850 O O   . HOH C 2 .   ? -8.601  -6.814  28.653  1.00 6.29   ? 411 HOH A O   1 
HETATM 5851 O O   . HOH C 2 .   ? -11.377 2.201   44.021  1.00 9.26   ? 412 HOH A O   1 
HETATM 5852 O O   . HOH C 2 .   ? -35.395 -0.319  0.613   1.00 10.96  ? 413 HOH A O   1 
HETATM 5853 O O   . HOH C 2 .   ? -25.002 -7.341  17.402  1.00 29.31  ? 414 HOH A O   1 
HETATM 5854 O O   . HOH C 2 .   ? 33.733  -41.022 68.709  1.00 19.82  ? 415 HOH A O   1 
HETATM 5855 O O   . HOH C 2 .   ? -31.477 -4.394  9.353   1.00 18.69  ? 416 HOH A O   1 
HETATM 5856 O O   . HOH C 2 .   ? -19.269 -7.639  33.066  1.00 30.85  ? 417 HOH A O   1 
HETATM 5857 O O   . HOH C 2 .   ? -23.272 -3.586  39.793  1.00 17.36  ? 418 HOH A O   1 
HETATM 5858 O O   . HOH C 2 .   ? -46.919 -3.471  15.421  1.00 18.31  ? 419 HOH A O   1 
HETATM 5859 O O   . HOH C 2 .   ? -33.500 0.611   23.982  1.00 16.72  ? 420 HOH A O   1 
HETATM 5860 O O   . HOH C 2 .   ? 53.271  -50.369 77.977  1.00 25.94  ? 421 HOH A O   1 
HETATM 5861 O O   . HOH C 2 .   ? -41.636 4.473   21.692  1.00 23.51  ? 422 HOH A O   1 
HETATM 5862 O O   . HOH C 2 .   ? -18.324 0.147   43.374  1.00 20.97  ? 423 HOH A O   1 
HETATM 5863 O O   . HOH C 2 .   ? -25.628 -5.577  34.685  1.00 20.55  ? 424 HOH A O   1 
HETATM 5864 O O   . HOH C 2 .   ? -4.701  1.113   38.055  1.00 24.12  ? 425 HOH A O   1 
HETATM 5865 O O   . HOH C 2 .   ? -17.157 -7.126  32.198  1.00 30.53  ? 426 HOH A O   1 
HETATM 5866 O O   . HOH C 2 .   ? -9.581  1.366   46.031  1.00 12.14  ? 427 HOH A O   1 
HETATM 5867 O O   . HOH C 2 .   ? 40.220  -14.307 59.746  1.00 18.51  ? 428 HOH A O   1 
HETATM 5868 O O   . HOH C 2 .   ? -37.312 5.570   -2.010  1.00 18.76  ? 429 HOH A O   1 
HETATM 5869 O O   . HOH C 2 .   ? -54.002 -2.734  -2.181  1.00 9.64   ? 430 HOH A O   1 
HETATM 5870 O O   . HOH C 2 .   ? -16.404 4.579   40.722  1.00 16.54  ? 431 HOH A O   1 
HETATM 5871 O O   . HOH C 2 .   ? -49.508 -2.204  10.170  1.00 17.30  ? 432 HOH A O   1 
HETATM 5872 O O   . HOH C 2 .   ? -3.079  -4.391  55.256  1.00 28.97  ? 433 HOH A O   1 
HETATM 5873 O O   . HOH C 2 .   ? -15.014 -2.145  22.440  1.00 8.81   ? 434 HOH A O   1 
HETATM 5874 O O   . HOH C 2 .   ? -33.602 -6.506  17.015  1.00 24.64  ? 435 HOH A O   1 
HETATM 5875 O O   . HOH C 2 .   ? -34.379 2.693   23.018  1.00 16.68  ? 436 HOH A O   1 
HETATM 5876 O O   . HOH C 2 .   ? -36.066 -6.529  17.830  1.00 10.24  ? 437 HOH A O   1 
HETATM 5877 O O   . HOH C 2 .   ? -29.372 -3.269  8.857   1.00 14.89  ? 438 HOH A O   1 
HETATM 5878 O O   . HOH C 2 .   ? -42.307 0.532   17.041  1.00 8.52   ? 439 HOH A O   1 
HETATM 5879 O O   . HOH C 2 .   ? -25.120 5.382   33.747  1.00 31.67  ? 440 HOH A O   1 
HETATM 5880 O O   . HOH C 2 .   ? 40.560  -48.029 82.869  1.00 18.51  ? 441 HOH A O   1 
HETATM 5881 O O   . HOH C 2 .   ? -1.471  -1.574  43.559  1.00 44.14  ? 442 HOH A O   1 
HETATM 5882 O O   . HOH C 2 .   ? -28.948 1.441   29.971  1.00 21.58  ? 443 HOH A O   1 
HETATM 5883 O O   . HOH C 2 .   ? -23.730 -3.487  11.752  1.00 17.64  ? 444 HOH A O   1 
HETATM 5884 O O   . HOH C 2 .   ? -7.740  1.316   52.079  1.00 38.33  ? 445 HOH A O   1 
HETATM 5885 O O   . HOH C 2 .   ? -10.598 -9.943  24.219  1.00 34.28  ? 446 HOH A O   1 
HETATM 5886 O O   . HOH C 2 .   ? 41.195  0.570   57.992  1.00 25.97  ? 447 HOH A O   1 
HETATM 5887 O O   . HOH C 2 .   ? 32.162  -32.274 80.027  1.00 22.53  ? 448 HOH A O   1 
HETATM 5888 O O   . HOH C 2 .   ? -4.321  -8.835  50.378  1.00 24.78  ? 449 HOH A O   1 
HETATM 5889 O O   . HOH C 2 .   ? -17.522 2.311   40.133  1.00 19.83  ? 450 HOH A O   1 
HETATM 5890 O O   . HOH C 2 .   ? 1.745   -4.129  47.822  1.00 18.51  ? 451 HOH A O   1 
HETATM 5891 O O   . HOH C 2 .   ? -33.752 -7.047  25.580  1.00 26.54  ? 452 HOH A O   1 
HETATM 5892 O O   . HOH C 2 .   ? -22.918 15.417  24.155  1.00 43.58  ? 453 HOH A O   1 
HETATM 5893 O O   . HOH C 2 .   ? -43.065 -3.471  -1.661  1.00 33.13  ? 454 HOH A O   1 
HETATM 5894 O O   . HOH C 2 .   ? -59.557 -3.102  -13.113 1.00 27.94  ? 455 HOH A O   1 
HETATM 5895 O O   . HOH C 2 .   ? 41.649  -29.317 74.445  1.00 9.15   ? 456 HOH A O   1 
HETATM 5896 O O   . HOH C 2 .   ? -42.752 -5.504  4.022   1.00 41.04  ? 457 HOH A O   1 
HETATM 5897 O O   . HOH C 2 .   ? -69.037 -9.978  -5.304  1.00 33.55  ? 458 HOH A O   1 
HETATM 5898 O O   . HOH C 2 .   ? 5.027   -13.841 59.035  1.00 45.37  ? 459 HOH A O   1 
HETATM 5899 O O   . HOH C 2 .   ? -8.852  -1.202  53.121  1.00 26.68  ? 460 HOH A O   1 
HETATM 5900 O O   . HOH C 2 .   ? -22.245 -10.376 35.302  1.00 34.00  ? 461 HOH A O   1 
HETATM 5901 O O   . HOH C 2 .   ? -29.128 7.503   29.940  1.00 35.40  ? 462 HOH A O   1 
HETATM 5902 O O   . HOH C 2 .   ? 28.704  -21.923 80.946  1.00 25.79  ? 463 HOH A O   1 
HETATM 5903 O O   . HOH C 2 .   ? 43.201  -31.040 76.667  1.00 14.88  ? 464 HOH A O   1 
HETATM 5904 O O   . HOH C 2 .   ? -25.504 8.337   32.429  1.00 29.55  ? 465 HOH A O   1 
HETATM 5905 O O   . HOH C 2 .   ? 54.003  -34.103 70.370  1.00 24.17  ? 466 HOH A O   1 
HETATM 5906 O O   . HOH C 2 .   ? -8.097  -15.096 38.121  1.00 28.83  ? 467 HOH A O   1 
HETATM 5907 O O   . HOH C 2 .   ? -13.205 -11.062 39.305  1.00 35.93  ? 468 HOH A O   1 
HETATM 5908 O O   . HOH C 2 .   ? -17.998 -8.683  34.786  1.00 31.37  ? 469 HOH A O   1 
HETATM 5909 O O   . HOH C 2 .   ? 43.229  -49.912 71.044  1.00 2.15   ? 470 HOH A O   1 
HETATM 5910 O O   . HOH C 2 .   ? -14.933 -3.265  47.621  1.00 37.14  ? 471 HOH A O   1 
HETATM 5911 O O   . HOH C 2 .   ? -66.463 -12.267 -9.131  1.00 34.19  ? 472 HOH A O   1 
HETATM 5912 O O   . HOH C 2 .   ? -26.646 -8.568  13.148  1.00 41.58  ? 473 HOH A O   1 
HETATM 5913 O O   . HOH C 2 .   ? -50.554 -13.083 -3.191  1.00 23.94  ? 474 HOH A O   1 
HETATM 5914 O O   . HOH C 2 .   ? -68.563 -16.225 -5.120  1.00 25.34  ? 475 HOH A O   1 
HETATM 5915 O O   . HOH C 2 .   ? -38.374 -3.529  31.555  1.00 8.29   ? 476 HOH A O   1 
HETATM 5916 O O   . HOH C 2 .   ? -31.780 8.236   26.350  1.00 22.07  ? 477 HOH A O   1 
HETATM 5917 O O   . HOH C 2 .   ? -46.208 3.831   22.386  1.00 25.88  ? 478 HOH A O   1 
HETATM 5918 O O   . HOH C 2 .   ? -28.243 -10.860 32.869  1.00 38.33  ? 479 HOH A O   1 
HETATM 5919 O O   . HOH D 2 .   ? -2.186  -11.580 35.762  1.00 4.21   ? 401 HOH B O   1 
HETATM 5920 O O   . HOH D 2 .   ? -8.286  12.826  43.098  1.00 8.80   ? 402 HOH B O   1 
HETATM 5921 O O   . HOH D 2 .   ? -38.199 3.005   -9.202  1.00 12.20  ? 403 HOH B O   1 
HETATM 5922 O O   . HOH D 2 .   ? 7.649   2.732   41.270  1.00 3.62   ? 404 HOH B O   1 
HETATM 5923 O O   . HOH D 2 .   ? 9.549   -7.486  35.017  1.00 19.05  ? 405 HOH B O   1 
HETATM 5924 O O   . HOH D 2 .   ? -2.470  -4.567  25.421  1.00 16.36  ? 406 HOH B O   1 
HETATM 5925 O O   . HOH D 2 .   ? 5.867   4.107   39.634  1.00 6.57   ? 407 HOH B O   1 
HETATM 5926 O O   . HOH D 2 .   ? 20.578  0.587   42.428  1.00 21.27  ? 408 HOH B O   1 
HETATM 5927 O O   . HOH D 2 .   ? -15.034 3.009   13.367  1.00 36.54  ? 409 HOH B O   1 
HETATM 5928 O O   . HOH D 2 .   ? -9.132  12.679  45.113  1.00 27.62  ? 410 HOH B O   1 
HETATM 5929 O O   . HOH D 2 .   ? -44.807 -14.949 -11.763 1.00 9.98   ? 411 HOH B O   1 
HETATM 5930 O O   . HOH D 2 .   ? -48.460 -9.913  -17.353 1.00 13.23  ? 412 HOH B O   1 
HETATM 5931 O O   . HOH D 2 .   ? 29.835  -14.751 67.690  1.00 29.52  ? 413 HOH B O   1 
HETATM 5932 O O   . HOH D 2 .   ? -39.361 4.435   26.297  1.00 22.92  ? 414 HOH B O   1 
HETATM 5933 O O   . HOH D 2 .   ? 1.592   0.463   30.312  1.00 29.50  ? 415 HOH B O   1 
HETATM 5934 O O   . HOH D 2 .   ? 12.504  1.338   45.153  1.00 17.55  ? 416 HOH B O   1 
HETATM 5935 O O   . HOH D 2 .   ? -13.470 17.784  21.977  1.00 25.03  ? 417 HOH B O   1 
HETATM 5936 O O   . HOH D 2 .   ? -42.417 -13.197 -10.821 1.00 4.93   ? 418 HOH B O   1 
HETATM 5937 O O   . HOH D 2 .   ? -45.687 -7.772  -3.406  1.00 32.55  ? 419 HOH B O   1 
HETATM 5938 O O   . HOH D 2 .   ? 19.036  -16.077 41.031  1.00 39.06  ? 420 HOH B O   1 
HETATM 5939 O O   . HOH D 2 .   ? 29.727  -13.674 64.311  1.00 31.17  ? 421 HOH B O   1 
HETATM 5940 O O   . HOH D 2 .   ? 30.116  -14.723 42.639  1.00 33.23  ? 422 HOH B O   1 
HETATM 5941 O O   . HOH D 2 .   ? 31.798  -26.365 75.330  1.00 8.80   ? 423 HOH B O   1 
HETATM 5942 O O   . HOH D 2 .   ? -7.960  -1.083  15.452  1.00 37.51  ? 424 HOH B O   1 
HETATM 5943 O O   . HOH D 2 .   ? -41.277 -2.918  -30.669 1.00 30.35  ? 425 HOH B O   1 
HETATM 5944 O O   . HOH D 2 .   ? -9.192  19.547  36.605  1.00 20.07  ? 426 HOH B O   1 
HETATM 5945 O O   . HOH D 2 .   ? -41.007 -2.144  -2.659  1.00 22.83  ? 427 HOH B O   1 
HETATM 5946 O O   . HOH D 2 .   ? -20.488 16.735  22.210  1.00 24.83  ? 428 HOH B O   1 
HETATM 5947 O O   . HOH D 2 .   ? 3.155   -0.891  27.123  1.00 20.51  ? 429 HOH B O   1 
HETATM 5948 O O   . HOH D 2 .   ? 46.746  -33.026 65.998  1.00 18.80  ? 430 HOH B O   1 
HETATM 5949 O O   . HOH D 2 .   ? 4.171   -14.434 43.561  1.00 11.86  ? 431 HOH B O   1 
HETATM 5950 O O   . HOH D 2 .   ? 29.551  -14.960 51.993  1.00 25.22  ? 432 HOH B O   1 
HETATM 5951 O O   . HOH D 2 .   ? -5.716  2.484   34.559  1.00 17.27  ? 433 HOH B O   1 
HETATM 5952 O O   . HOH D 2 .   ? 0.642   -1.889  44.692  1.00 29.09  ? 434 HOH B O   1 
HETATM 5953 O O   . HOH D 2 .   ? 23.144  -16.816 64.780  1.00 33.58  ? 435 HOH B O   1 
HETATM 5954 O O   . HOH D 2 .   ? -0.053  1.880   28.589  1.00 25.06  ? 436 HOH B O   1 
HETATM 5955 O O   . HOH D 2 .   ? 54.026  -40.971 62.380  1.00 22.88  ? 437 HOH B O   1 
HETATM 5956 O O   . HOH D 2 .   ? -32.541 10.738  30.066  1.00 29.96  ? 438 HOH B O   1 
HETATM 5957 O O   . HOH D 2 .   ? -21.662 8.503   21.113  1.00 28.26  ? 439 HOH B O   1 
HETATM 5958 O O   . HOH D 2 .   ? -9.570  -0.117  34.945  1.00 25.76  ? 440 HOH B O   1 
HETATM 5959 O O   . HOH D 2 .   ? -2.218  0.988   38.832  1.00 34.91  ? 441 HOH B O   1 
HETATM 5960 O O   . HOH D 2 .   ? -7.627  -0.035  33.556  1.00 31.32  ? 442 HOH B O   1 
HETATM 5961 O O   . HOH D 2 .   ? 34.552  -15.403 42.672  1.00 25.69  ? 443 HOH B O   1 
HETATM 5962 O O   . HOH D 2 .   ? -4.400  1.745   26.469  1.00 20.90  ? 444 HOH B O   1 
HETATM 5963 O O   . HOH D 2 .   ? 12.609  -17.087 39.053  1.00 27.52  ? 445 HOH B O   1 
HETATM 5964 O O   . HOH D 2 .   ? -30.489 1.307   -11.970 1.00 33.44  ? 446 HOH B O   1 
HETATM 5965 O O   . HOH D 2 .   ? -18.174 9.062   17.601  1.00 38.22  ? 447 HOH B O   1 
HETATM 5966 O O   . HOH D 2 .   ? 25.559  -22.829 50.006  1.00 34.44  ? 448 HOH B O   1 
HETATM 5967 O O   . HOH D 2 .   ? 33.847  -19.280 45.114  1.00 17.95  ? 449 HOH B O   1 
HETATM 5968 O O   . HOH D 2 .   ? -36.619 -5.329  -8.567  1.00 29.37  ? 450 HOH B O   1 
HETATM 5969 O O   . HOH D 2 .   ? -15.816 16.871  28.143  1.00 16.27  ? 451 HOH B O   1 
HETATM 5970 O O   . HOH D 2 .   ? -8.321  -3.561  22.755  1.00 15.84  ? 452 HOH B O   1 
HETATM 5971 O O   . HOH D 2 .   ? 30.535  -13.665 54.659  1.00 18.04  ? 453 HOH B O   1 
HETATM 5972 O O   . HOH D 2 .   ? 40.065  -19.782 55.205  1.00 16.10  ? 454 HOH B O   1 
HETATM 5973 O O   . HOH D 2 .   ? 13.753  1.158   39.717  1.00 31.15  ? 455 HOH B O   1 
HETATM 5974 O O   . HOH D 2 .   ? -10.113 4.809   18.368  1.00 31.73  ? 456 HOH B O   1 
HETATM 5975 O O   . HOH D 2 .   ? -10.777 -3.360  20.656  1.00 20.38  ? 457 HOH B O   1 
HETATM 5976 O O   . HOH D 2 .   ? -20.659 4.221   20.623  1.00 24.88  ? 458 HOH B O   1 
HETATM 5977 O O   . HOH D 2 .   ? -8.659  4.535   16.217  1.00 16.17  ? 459 HOH B O   1 
HETATM 5978 O O   . HOH D 2 .   ? -16.231 20.800  31.143  1.00 25.64  ? 460 HOH B O   1 
HETATM 5979 O O   . HOH D 2 .   ? 11.504  1.751   34.795  1.00 18.23  ? 461 HOH B O   1 
HETATM 5980 O O   . HOH D 2 .   ? 5.233   8.128   34.406  1.00 44.52  ? 462 HOH B O   1 
HETATM 5981 O O   . HOH D 2 .   ? 21.125  -25.306 50.781  1.00 37.31  ? 463 HOH B O   1 
HETATM 5982 O O   . HOH D 2 .   ? 2.959   1.862   27.014  1.00 24.51  ? 464 HOH B O   1 
HETATM 5983 O O   . HOH D 2 .   ? 57.930  -33.260 67.180  1.00 16.93  ? 465 HOH B O   1 
HETATM 5984 O O   . HOH D 2 .   ? -8.148  0.401   17.811  1.00 48.90  ? 466 HOH B O   1 
HETATM 5985 O O   . HOH D 2 .   ? -44.149 7.390   19.966  1.00 10.62  ? 467 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 2   ? 1.1982 0.7589 1.7073 0.0597  -0.4051 0.0437  -3  PRO A N   
2    C CA  . PRO A 2   ? 1.1445 0.7614 1.5827 0.0509  -0.3363 0.0573  -3  PRO A CA  
3    C C   . PRO A 2   ? 1.1364 0.7779 1.5704 0.0153  -0.3232 0.1323  -3  PRO A C   
4    O O   . PRO A 2   ? 1.1764 0.7951 1.6619 -0.0040 -0.3665 0.1782  -3  PRO A O   
5    C CB  . PRO A 2   ? 1.1310 0.7636 1.5421 0.0778  -0.3199 0.0149  -3  PRO A CB  
6    C CG  . PRO A 2   ? 1.1826 0.7690 1.6519 0.1019  -0.3822 -0.0203 -3  PRO A CG  
7    C CD  . PRO A 2   ? 1.2218 0.7602 1.7562 0.0819  -0.4375 0.0167  -3  PRO A CD  
8    N N   . LEU A 3   ? 1.0886 0.7808 1.4654 0.0073  -0.2675 0.1448  -2  LEU A N   
9    C CA  . LEU A 3   ? 1.0764 0.8118 1.4402 -0.0189 -0.2494 0.2064  -2  LEU A CA  
10   C C   . LEU A 3   ? 1.0306 0.8148 1.3303 -0.0101 -0.1942 0.1921  -2  LEU A C   
11   O O   . LEU A 3   ? 1.0032 0.7950 1.2666 0.0043  -0.1632 0.1518  -2  LEU A O   
12   C CB  . LEU A 3   ? 1.0804 0.8362 1.4556 -0.0457 -0.2493 0.2529  -2  LEU A CB  
13   C CG  . LEU A 3   ? 1.1195 0.8367 1.5543 -0.0612 -0.2968 0.2742  -2  LEU A CG  
14   C CD1 . LEU A 3   ? 1.1167 0.8075 1.5431 -0.0430 -0.2919 0.2200  -2  LEU A CD1 
15   C CD2 . LEU A 3   ? 1.1196 0.8845 1.5661 -0.0965 -0.2946 0.3479  -2  LEU A CD2 
16   N N   . GLY A 4   ? 1.0209 0.8403 1.3103 -0.0193 -0.1854 0.2265  -1  GLY A N   
17   C CA  . GLY A 4   ? 0.9763 0.8470 1.2108 -0.0131 -0.1385 0.2189  -1  GLY A CA  
18   C C   . GLY A 4   ? 0.9492 0.8684 1.1612 -0.0265 -0.1125 0.2442  -1  GLY A C   
19   O O   . GLY A 4   ? 0.9645 0.8901 1.2055 -0.0466 -0.1312 0.2844  -1  GLY A O   
20   N N   . SER A 5   ? 0.9046 0.8589 1.0694 -0.0151 -0.0736 0.2212  0   SER A N   
21   C CA  . SER A 5   ? 0.8772 0.8820 1.0175 -0.0212 -0.0486 0.2351  0   SER A CA  
22   C C   . SER A 5   ? 0.8418 0.8819 0.9364 -0.0045 -0.0142 0.2054  0   SER A C   
23   O O   . SER A 5   ? 0.8330 0.9352 0.9101 -0.0052 -0.0002 0.2233  0   SER A O   
24   C CB  . SER A 5   ? 0.8765 0.8542 1.0255 -0.0255 -0.0507 0.2245  0   SER A CB  
25   O OG  . SER A 5   ? 0.8579 0.8596 0.9702 -0.0165 -0.0192 0.2008  0   SER A OG  
26   N N   . MET A 6   ? 0.8118 0.8167 0.8908 0.0109  -0.0037 0.1598  1   MET A N   
27   C CA  . MET A 6   ? 0.7782 0.8019 0.8268 0.0259  0.0168  0.1328  1   MET A CA  
28   C C   . MET A 6   ? 0.7734 0.7827 0.8304 0.0315  0.0056  0.1288  1   MET A C   
29   O O   . MET A 6   ? 0.7658 0.7962 0.8048 0.0414  0.0158  0.1170  1   MET A O   
30   C CB  . MET A 6   ? 0.7618 0.7599 0.7951 0.0352  0.0309  0.0935  1   MET A CB  
31   C CG  . MET A 6   ? 0.7580 0.7677 0.7804 0.0326  0.0432  0.0909  1   MET A CG  
32   S SD  . MET A 6   ? 0.7510 0.7412 0.7563 0.0425  0.0577  0.0510  1   MET A SD  
33   C CE  . MET A 6   ? 0.6806 0.6475 0.6940 0.0355  0.0568  0.0479  1   MET A CE  
34   N N   . THR A 7   ? 0.7765 0.7484 0.8638 0.0265  -0.0190 0.1363  2   THR A N   
35   C CA  . THR A 7   ? 0.7763 0.7302 0.8775 0.0328  -0.0350 0.1318  2   THR A CA  
36   C C   . THR A 7   ? 0.7828 0.7562 0.9064 0.0199  -0.0557 0.1785  2   THR A C   
37   O O   . THR A 7   ? 0.7928 0.7541 0.9296 0.0241  -0.0713 0.1801  2   THR A O   
38   C CB  . THR A 7   ? 0.7922 0.6943 0.9207 0.0400  -0.0583 0.1069  2   THR A CB  
39   O OG1 . THR A 7   ? 0.7907 0.6758 0.9219 0.0393  -0.0567 0.0919  2   THR A OG1 
40   C CG2 . THR A 7   ? 0.7866 0.6823 0.9036 0.0576  -0.0517 0.0694  2   THR A CG2 
41   N N   . VAL A 8   ? 0.7646 0.7718 0.8953 0.0034  -0.0577 0.2193  3   VAL A N   
42   C CA  . VAL A 8   ? 0.7733 0.8061 0.9335 -0.0145 -0.0822 0.2752  3   VAL A CA  
43   C C   . VAL A 8   ? 0.7507 0.8370 0.8912 -0.0091 -0.0717 0.2876  3   VAL A C   
44   O O   . VAL A 8   ? 0.7720 0.8673 0.9369 -0.0185 -0.0944 0.3232  3   VAL A O   
45   C CB  . VAL A 8   ? 0.7787 0.8485 0.9549 -0.0366 -0.0879 0.3228  3   VAL A CB  
46   C CG1 . VAL A 8   ? 0.7614 0.9046 0.8967 -0.0313 -0.0527 0.3211  3   VAL A CG1 
47   C CG2 . VAL A 8   ? 0.8117 0.9034 1.0308 -0.0605 -0.1217 0.3888  3   VAL A CG2 
48   N N   . LYS A 9   ? 0.7082 0.8281 0.8074 0.0071  -0.0403 0.2564  4   LYS A N   
49   C CA  . LYS A 9   ? 0.6906 0.8718 0.7669 0.0163  -0.0282 0.2610  4   LYS A CA  
50   C C   . LYS A 9   ? 0.6669 0.8145 0.7340 0.0328  -0.0266 0.2240  4   LYS A C   
51   O O   . LYS A 9   ? 0.6696 0.8526 0.7318 0.0372  -0.0288 0.2355  4   LYS A O   
52   C CB  . LYS A 9   ? 0.6832 0.9220 0.7254 0.0275  -0.0015 0.2442  4   LYS A CB  
53   C CG  . LYS A 9   ? 0.6942 0.8991 0.7341 0.0254  0.0070  0.2245  4   LYS A CG  
54   C CD  . LYS A 9   ? 0.7127 0.9295 0.7210 0.0445  0.0293  0.1802  4   LYS A CD  
55   C CE  . LYS A 9   ? 0.7247 0.9114 0.7334 0.0402  0.0356  0.1676  4   LYS A CE  
56   N NZ  . LYS A 9   ? 0.7192 0.9328 0.7025 0.0567  0.0522  0.1352  4   LYS A NZ  
57   N N   . LEU A 10  ? 0.6189 0.7062 0.6848 0.0414  -0.0233 0.1821  5   LEU A N   
58   C CA  . LEU A 10  ? 0.5888 0.6509 0.6480 0.0558  -0.0215 0.1482  5   LEU A CA  
59   C C   . LEU A 10  ? 0.5893 0.6369 0.6749 0.0524  -0.0471 0.1694  5   LEU A C   
60   O O   . LEU A 10  ? 0.6093 0.6241 0.7285 0.0422  -0.0730 0.1893  5   LEU A O   
61   C CB  . LEU A 10  ? 0.5768 0.5910 0.6348 0.0631  -0.0159 0.1073  5   LEU A CB  
62   C CG  . LEU A 10  ? 0.5736 0.5947 0.6061 0.0698  0.0076  0.0776  5   LEU A CG  
63   C CD1 . LEU A 10  ? 0.5908 0.5845 0.6228 0.0792  0.0104  0.0424  5   LEU A CD1 
64   C CD2 . LEU A 10  ? 0.5724 0.6406 0.5813 0.0767  0.0218  0.0756  5   LEU A CD2 
65   N N   . ASP A 11  ? 0.5537 0.6261 0.6275 0.0614  -0.0434 0.1655  6   ASP A N   
66   C CA  . ASP A 11  ? 0.5528 0.6201 0.6502 0.0582  -0.0676 0.1896  6   ASP A CA  
67   C C   . ASP A 11  ? 0.5260 0.5737 0.6139 0.0755  -0.0631 0.1501  6   ASP A C   
68   O O   . ASP A 11  ? 0.5051 0.5834 0.5651 0.0859  -0.0429 0.1304  6   ASP A O   
69   C CB  . ASP A 11  ? 0.5584 0.6963 0.6517 0.0494  -0.0689 0.2368  6   ASP A CB  
70   C CG  . ASP A 11  ? 0.5827 0.7170 0.7074 0.0407  -0.0992 0.2741  6   ASP A CG  
71   O OD1 . ASP A 11  ? 0.6475 0.8247 0.7901 0.0224  -0.1136 0.3306  6   ASP A OD1 
72   O OD2 . ASP A 11  ? 0.6121 0.7061 0.7462 0.0514  -0.1105 0.2507  6   ASP A OD2 
73   N N   . PHE A 12  ? 0.5205 0.5189 0.6338 0.0802  -0.0839 0.1350  7   PHE A N   
74   C CA  . PHE A 12  ? 0.5170 0.5018 0.6247 0.0968  -0.0810 0.0977  7   PHE A CA  
75   C C   . PHE A 12  ? 0.5160 0.5333 0.6155 0.1008  -0.0814 0.1103  7   PHE A C   
76   O O   . PHE A 12  ? 0.5047 0.5346 0.5843 0.1124  -0.0658 0.0821  7   PHE A O   
77   C CB  . PHE A 12  ? 0.5334 0.4701 0.6728 0.1053  -0.1072 0.0767  7   PHE A CB  
78   C CG  . PHE A 12  ? 0.5353 0.4696 0.6668 0.1234  -0.1002 0.0340  7   PHE A CG  
79   C CD1 . PHE A 12  ? 0.5590 0.5131 0.6622 0.1278  -0.0706 0.0069  7   PHE A CD1 
80   C CD2 . PHE A 12  ? 0.6117 0.5274 0.7679 0.1354  -0.1259 0.0232  7   PHE A CD2 
81   C CE1 . PHE A 12  ? 0.5857 0.5473 0.6851 0.1413  -0.0650 -0.0261 7   PHE A CE1 
82   C CE2 . PHE A 12  ? 0.6186 0.5430 0.7680 0.1525  -0.1186 -0.0154 7   PHE A CE2 
83   C CZ  . PHE A 12  ? 0.5699 0.5201 0.6911 0.1542  -0.0874 -0.0380 7   PHE A CZ  
84   N N   . GLU A 13  ? 0.5369 0.5725 0.6530 0.0898  -0.1002 0.1554  8   GLU A N   
85   C CA  . GLU A 13  ? 0.5461 0.6230 0.6527 0.0936  -0.1000 0.1706  8   GLU A CA  
86   C C   . GLU A 13  ? 0.5148 0.6494 0.5822 0.1007  -0.0702 0.1592  8   GLU A C   
87   O O   . GLU A 13  ? 0.4992 0.6502 0.5512 0.1137  -0.0623 0.1372  8   GLU A O   
88   C CB  . GLU A 13  ? 0.5785 0.6749 0.7129 0.0773  -0.1273 0.2296  8   GLU A CB  
89   C CG  . GLU A 13  ? 0.6657 0.7144 0.8386 0.0789  -0.1630 0.2343  8   GLU A CG  
90   C CD  . GLU A 13  ? 0.7170 0.7634 0.8767 0.0982  -0.1569 0.1987  8   GLU A CD  
91   O OE1 . GLU A 13  ? 0.7275 0.8255 0.8660 0.1009  -0.1451 0.2103  8   GLU A OE1 
92   O OE2 . GLU A 13  ? 0.7421 0.7411 0.9134 0.1118  -0.1650 0.1583  8   GLU A OE2 
93   N N   . GLU A 14  ? 0.4993 0.6637 0.5539 0.0941  -0.0570 0.1708  9   GLU A N   
94   C CA  . GLU A 14  ? 0.4921 0.7094 0.5141 0.1051  -0.0341 0.1525  9   GLU A CA  
95   C C   . GLU A 14  ? 0.4692 0.6543 0.4766 0.1189  -0.0198 0.0991  9   GLU A C   
96   O O   . GLU A 14  ? 0.4574 0.6720 0.4472 0.1322  -0.0112 0.0765  9   GLU A O   
97   C CB  . GLU A 14  ? 0.4902 0.7453 0.5050 0.0968  -0.0255 0.1733  9   GLU A CB  
98   C CG  . GLU A 14  ? 0.5322 0.8415 0.5623 0.0803  -0.0394 0.2350  9   GLU A CG  
99   C CD  . GLU A 14  ? 0.5829 0.9650 0.6044 0.0867  -0.0427 0.2563  9   GLU A CD  
100  O OE1 . GLU A 14  ? 0.5861 1.0126 0.5795 0.1072  -0.0277 0.2242  9   GLU A OE1 
101  O OE2 . GLU A 14  ? 0.6226 1.0200 0.6687 0.0712  -0.0637 0.3067  9   GLU A OE2 
102  N N   . CYS A 15  ? 0.4740 0.6028 0.4927 0.1154  -0.0204 0.0804  10  CYS A N   
103  C CA  . CYS A 15  ? 0.4694 0.5747 0.4802 0.1240  -0.0095 0.0388  10  CYS A CA  
104  C C   . CYS A 15  ? 0.4719 0.5764 0.4847 0.1337  -0.0143 0.0226  10  CYS A C   
105  O O   . CYS A 15  ? 0.4648 0.5801 0.4669 0.1417  -0.0065 -0.0024 10  CYS A O   
106  C CB  . CYS A 15  ? 0.4646 0.5251 0.4874 0.1183  -0.0093 0.0262  10  CYS A CB  
107  S SG  . CYS A 15  ? 0.4777 0.5184 0.5014 0.1252  -0.0023 -0.0136 10  CYS A SG  
108  N N   . LEU A 16  ? 0.4846 0.5752 0.5149 0.1329  -0.0306 0.0372  11  LEU A N   
109  C CA  . LEU A 16  ? 0.4890 0.5816 0.5227 0.1425  -0.0371 0.0251  11  LEU A CA  
110  C C   . LEU A 16  ? 0.4893 0.6304 0.5065 0.1494  -0.0339 0.0315  11  LEU A C   
111  O O   . LEU A 16  ? 0.4815 0.6289 0.4942 0.1591  -0.0323 0.0093  11  LEU A O   
112  C CB  . LEU A 16  ? 0.5087 0.5750 0.5690 0.1419  -0.0607 0.0398  11  LEU A CB  
113  C CG  . LEU A 16  ? 0.5468 0.5693 0.6283 0.1440  -0.0713 0.0211  11  LEU A CG  
114  C CD1 . LEU A 16  ? 0.5398 0.5376 0.6528 0.1480  -0.1030 0.0324  11  LEU A CD1 
115  C CD2 . LEU A 16  ? 0.5483 0.5693 0.6222 0.1529  -0.0568 -0.0196 11  LEU A CD2 
116  N N   . LYS A 17  ? 0.5019 0.6841 0.5119 0.1453  -0.0344 0.0619  12  LYS A N   
117  C CA  . LYS A 17  ? 0.5241 0.7682 0.5153 0.1561  -0.0302 0.0625  12  LYS A CA  
118  C C   . LYS A 17  ? 0.5146 0.7754 0.4872 0.1676  -0.0167 0.0265  12  LYS A C   
119  O O   . LYS A 17  ? 0.5243 0.8331 0.4833 0.1827  -0.0163 0.0123  12  LYS A O   
120  C CB  . LYS A 17  ? 0.5413 0.8428 0.5311 0.1487  -0.0350 0.1088  12  LYS A CB  
121  C CG  . LYS A 17  ? 0.5708 0.8650 0.5852 0.1355  -0.0558 0.1538  12  LYS A CG  
122  C CD  . LYS A 17  ? 0.6034 0.9343 0.6262 0.1183  -0.0609 0.2038  12  LYS A CD  
123  C CE  . LYS A 17  ? 0.6381 1.0373 0.6686 0.1106  -0.0750 0.2574  12  LYS A CE  
124  N NZ  . LYS A 17  ? 0.6472 1.1361 0.6629 0.1067  -0.0646 0.2866  12  LYS A NZ  
125  N N   . ASP A 18  ? 0.5068 0.7288 0.4821 0.1616  -0.0094 0.0109  13  ASP A N   
126  C CA  . ASP A 18  ? 0.5116 0.7413 0.4764 0.1693  -0.0019 -0.0178 13  ASP A CA  
127  C C   . ASP A 18  ? 0.5084 0.8084 0.4566 0.1808  -0.0005 -0.0112 13  ASP A C   
128  O O   . ASP A 18  ? 0.5195 0.8536 0.4588 0.1992  -0.0036 -0.0396 13  ASP A O   
129  C CB  . ASP A 18  ? 0.5133 0.7238 0.4829 0.1776  -0.0054 -0.0536 13  ASP A CB  
130  C CG  . ASP A 18  ? 0.5724 0.7752 0.5422 0.1819  -0.0052 -0.0815 13  ASP A CG  
131  O OD1 . ASP A 18  ? 0.6076 0.8013 0.5752 0.1752  0.0011  -0.0756 13  ASP A OD1 
132  O OD2 . ASP A 18  ? 0.6411 0.8464 0.6163 0.1923  -0.0148 -0.1090 13  ASP A OD2 
133  N N   . SER A 19  ? 0.4977 0.8256 0.4449 0.1708  0.0013  0.0265  14  SER A N   
134  C CA  . SER A 19  ? 0.4966 0.9109 0.4292 0.1808  0.0026  0.0413  14  SER A CA  
135  C C   . SER A 19  ? 0.4892 0.9225 0.4120 0.1885  0.0098  0.0215  14  SER A C   
136  O O   . SER A 19  ? 0.4656 0.8412 0.3954 0.1787  0.0140  0.0121  14  SER A O   
137  C CB  . SER A 19  ? 0.5057 0.9506 0.4472 0.1629  -0.0019 0.0991  14  SER A CB  
138  O OG  . SER A 19  ? 0.5084 0.9228 0.4599 0.1454  0.0008  0.1189  14  SER A OG  
139  N N   . PRO A 20  ? 0.4988 1.0201 0.4059 0.2083  0.0099  0.0139  15  PRO A N   
140  C CA  . PRO A 20  ? 0.4968 1.0492 0.3952 0.2201  0.0139  -0.0066 15  PRO A CA  
141  C C   . PRO A 20  ? 0.4983 1.0416 0.4018 0.1979  0.0223  0.0307  15  PRO A C   
142  O O   . PRO A 20  ? 0.5006 1.0225 0.4035 0.1997  0.0261  0.0115  15  PRO A O   
143  C CB  . PRO A 20  ? 0.5066 1.1789 0.3880 0.2460  0.0111  -0.0115 15  PRO A CB  
144  C CG  . PRO A 20  ? 0.5052 1.1898 0.3857 0.2533  0.0039  -0.0135 15  PRO A CG  
145  C CD  . PRO A 20  ? 0.5001 1.1024 0.3967 0.2248  0.0045  0.0182  15  PRO A CD  
146  N N   . ARG A 21  ? 0.5041 1.0642 0.4158 0.1771  0.0217  0.0846  16  ARG A N   
147  C CA  . ARG A 21  ? 0.5013 1.0472 0.4249 0.1529  0.0242  0.1249  16  ARG A CA  
148  C C   . ARG A 21  ? 0.4824 0.9172 0.4200 0.1390  0.0247  0.1095  16  ARG A C   
149  O O   . ARG A 21  ? 0.4726 0.8860 0.4136 0.1301  0.0296  0.1121  16  ARG A O   
150  C CB  . ARG A 21  ? 0.5188 1.0995 0.4575 0.1327  0.0148  0.1870  16  ARG A CB  
151  C CG  . ARG A 21  ? 0.5511 1.1109 0.5119 0.1045  0.0092  0.2348  16  ARG A CG  
152  C CD  . ARG A 21  ? 0.6216 1.1762 0.6092 0.0830  -0.0102 0.2893  16  ARG A CD  
153  N NE  . ARG A 21  ? 0.6787 1.3473 0.6626 0.0824  -0.0140 0.3332  16  ARG A NE  
154  C CZ  . ARG A 21  ? 0.7139 1.4740 0.7012 0.0705  -0.0135 0.3808  16  ARG A CZ  
155  N NH1 . ARG A 21  ? 0.7111 1.4540 0.7052 0.0590  -0.0093 0.3872  16  ARG A NH1 
156  N NH2 . ARG A 21  ? 0.7347 1.6112 0.7189 0.0699  -0.0172 0.4237  16  ARG A NH2 
157  N N   . PHE A 22  ? 0.4736 0.8467 0.4193 0.1384  0.0196  0.0931  17  PHE A N   
158  C CA  . PHE A 22  ? 0.4534 0.7406 0.4093 0.1309  0.0210  0.0711  17  PHE A CA  
159  C C   . PHE A 22  ? 0.4501 0.7275 0.3958 0.1419  0.0288  0.0321  17  PHE A C   
160  O O   . PHE A 22  ? 0.4453 0.6885 0.3954 0.1326  0.0333  0.0309  17  PHE A O   
161  C CB  . PHE A 22  ? 0.4534 0.6946 0.4182 0.1322  0.0146  0.0563  17  PHE A CB  
162  C CG  . PHE A 22  ? 0.4439 0.6177 0.4173 0.1275  0.0173  0.0311  17  PHE A CG  
163  C CD1 . PHE A 22  ? 0.4269 0.5618 0.4134 0.1138  0.0160  0.0438  17  PHE A CD1 
164  C CD2 . PHE A 22  ? 0.4251 0.5818 0.3962 0.1365  0.0191  -0.0035 17  PHE A CD2 
165  C CE1 . PHE A 22  ? 0.4234 0.5122 0.4164 0.1114  0.0191  0.0207  17  PHE A CE1 
166  C CE2 . PHE A 22  ? 0.4330 0.5437 0.4135 0.1301  0.0216  -0.0200 17  PHE A CE2 
167  C CZ  . PHE A 22  ? 0.4293 0.5103 0.4188 0.1186  0.0229  -0.0085 17  PHE A CZ  
168  N N   . ARG A 23  ? 0.4528 0.7593 0.3882 0.1622  0.0267  0.0000  18  ARG A N   
169  C CA  . ARG A 23  ? 0.4519 0.7487 0.3846 0.1738  0.0262  -0.0368 18  ARG A CA  
170  C C   . ARG A 23  ? 0.4455 0.7716 0.3719 0.1733  0.0324  -0.0281 18  ARG A C   
171  O O   . ARG A 23  ? 0.4256 0.7106 0.3571 0.1675  0.0344  -0.0396 18  ARG A O   
172  C CB  . ARG A 23  ? 0.4683 0.8003 0.3961 0.1995  0.0154  -0.0736 18  ARG A CB  
173  C CG  . ARG A 23  ? 0.4859 0.7799 0.4236 0.1992  0.0077  -0.0876 18  ARG A CG  
174  C CD  . ARG A 23  ? 0.5365 0.7564 0.4912 0.1851  0.0059  -0.0997 18  ARG A CD  
175  N NE  . ARG A 23  ? 0.5623 0.7593 0.5280 0.1853  -0.0022 -0.1119 18  ARG A NE  
176  C CZ  . ARG A 23  ? 0.5678 0.7750 0.5404 0.2014  -0.0180 -0.1423 18  ARG A CZ  
177  N NH1 . ARG A 23  ? 0.6160 0.8546 0.5864 0.2218  -0.0295 -0.1686 18  ARG A NH1 
178  N NH2 . ARG A 23  ? 0.5621 0.7496 0.5466 0.1986  -0.0250 -0.1488 18  ARG A NH2 
179  N N   . ALA A 24  ? 0.4567 0.8610 0.3729 0.1785  0.0349  -0.0050 19  ALA A N   
180  C CA  . ALA A 24  ? 0.4564 0.9053 0.3673 0.1767  0.0411  0.0108  19  ALA A CA  
181  C C   . ALA A 24  ? 0.4552 0.8457 0.3782 0.1502  0.0466  0.0382  19  ALA A C   
182  O O   . ALA A 24  ? 0.4630 0.8478 0.3850 0.1490  0.0509  0.0318  19  ALA A O   
183  C CB  . ALA A 24  ? 0.4684 1.0196 0.3707 0.1804  0.0424  0.0448  19  ALA A CB  
184  N N   . SER A 25  ? 0.4690 0.8159 0.4054 0.1309  0.0436  0.0657  20  SER A N   
185  C CA  . SER A 25  ? 0.4620 0.7592 0.4128 0.1095  0.0440  0.0876  20  SER A CA  
186  C C   . SER A 25  ? 0.4534 0.6812 0.4062 0.1096  0.0478  0.0536  20  SER A C   
187  O O   . SER A 25  ? 0.4557 0.6596 0.4133 0.0995  0.0512  0.0589  20  SER A O   
188  C CB  . SER A 25  ? 0.4744 0.7451 0.4440 0.0934  0.0330  0.1205  20  SER A CB  
189  O OG  . SER A 25  ? 0.5026 0.7195 0.4761 0.0980  0.0298  0.0945  20  SER A OG  
190  N N   . ILE A 26  ? 0.4387 0.6399 0.3898 0.1195  0.0461  0.0219  21  ILE A N   
191  C CA  . ILE A 26  ? 0.4301 0.5813 0.3854 0.1184  0.0477  -0.0052 21  ILE A CA  
192  C C   . ILE A 26  ? 0.4303 0.5995 0.3789 0.1281  0.0489  -0.0240 21  ILE A C   
193  O O   . ILE A 26  ? 0.4322 0.5710 0.3852 0.1201  0.0520  -0.0272 21  ILE A O   
194  C CB  . ILE A 26  ? 0.4180 0.5451 0.3784 0.1239  0.0422  -0.0283 21  ILE A CB  
195  C CG1 . ILE A 26  ? 0.4449 0.5462 0.4146 0.1149  0.0404  -0.0153 21  ILE A CG1 
196  C CG2 . ILE A 26  ? 0.4031 0.4962 0.3712 0.1218  0.0404  -0.0506 21  ILE A CG2 
197  C CD1 . ILE A 26  ? 0.4233 0.4818 0.4041 0.1020  0.0428  -0.0121 21  ILE A CD1 
198  N N   . GLU A 27  ? 0.4406 0.6627 0.3799 0.1475  0.0444  -0.0387 22  GLU A N   
199  C CA  . GLU A 27  ? 0.4644 0.7133 0.3992 0.1618  0.0416  -0.0596 22  GLU A CA  
200  C C   . GLU A 27  ? 0.4514 0.7218 0.3819 0.1520  0.0514  -0.0346 22  GLU A C   
201  O O   . GLU A 27  ? 0.4419 0.7047 0.3735 0.1560  0.0506  -0.0497 22  GLU A O   
202  C CB  . GLU A 27  ? 0.4729 0.7881 0.3995 0.1910  0.0314  -0.0865 22  GLU A CB  
203  C CG  . GLU A 27  ? 0.5268 0.8078 0.4650 0.2030  0.0147  -0.1230 22  GLU A CG  
204  C CD  . GLU A 27  ? 0.5966 0.9409 0.5290 0.2336  0.0012  -0.1523 22  GLU A CD  
205  O OE1 . GLU A 27  ? 0.6344 1.0502 0.5568 0.2569  -0.0021 -0.1677 22  GLU A OE1 
206  O OE2 . GLU A 27  ? 0.6194 0.9472 0.5580 0.2363  -0.0070 -0.1624 22  GLU A OE2 
207  N N   . LEU A 28  ? 0.4522 0.7467 0.3821 0.1379  0.0577  0.0050  23  LEU A N   
208  C CA  . LEU A 28  ? 0.4596 0.7746 0.3903 0.1265  0.0639  0.0311  23  LEU A CA  
209  C C   . LEU A 28  ? 0.4450 0.6858 0.3865 0.1086  0.0664  0.0334  23  LEU A C   
210  O O   . LEU A 28  ? 0.4391 0.6808 0.3800 0.1065  0.0702  0.0323  23  LEU A O   
211  C CB  . LEU A 28  ? 0.4671 0.8408 0.4005 0.1147  0.0646  0.0789  23  LEU A CB  
212  C CG  . LEU A 28  ? 0.5126 0.9720 0.4379 0.1214  0.0694  0.0908  23  LEU A CG  
213  C CD1 . LEU A 28  ? 0.5660 1.1316 0.4828 0.1321  0.0684  0.1106  23  LEU A CD1 
214  C CD2 . LEU A 28  ? 0.5389 0.9922 0.4761 0.0989  0.0723  0.1258  23  LEU A CD2 
215  N N   . VAL A 29  ? 0.4269 0.6107 0.3779 0.0986  0.0638  0.0334  24  VAL A N   
216  C CA  . VAL A 29  ? 0.4157 0.5402 0.3763 0.0857  0.0653  0.0307  24  VAL A CA  
217  C C   . VAL A 29  ? 0.4058 0.5116 0.3632 0.0922  0.0670  0.0021  24  VAL A C   
218  O O   . VAL A 29  ? 0.4044 0.4905 0.3647 0.0844  0.0704  0.0040  24  VAL A O   
219  C CB  . VAL A 29  ? 0.4141 0.4950 0.3858 0.0790  0.0605  0.0303  24  VAL A CB  
220  C CG1 . VAL A 29  ? 0.4168 0.4526 0.3966 0.0707  0.0620  0.0212  24  VAL A CG1 
221  C CG2 . VAL A 29  ? 0.4127 0.5019 0.3953 0.0707  0.0525  0.0608  24  VAL A CG2 
222  N N   . GLU A 30  ? 0.3971 0.5091 0.3520 0.1062  0.0613  -0.0229 25  GLU A N   
223  C CA  . GLU A 30  ? 0.3870 0.4795 0.3469 0.1122  0.0548  -0.0486 25  GLU A CA  
224  C C   . GLU A 30  ? 0.3853 0.5061 0.3401 0.1221  0.0539  -0.0563 25  GLU A C   
225  O O   . GLU A 30  ? 0.3806 0.4747 0.3420 0.1181  0.0513  -0.0639 25  GLU A O   
226  C CB  . GLU A 30  ? 0.3857 0.4767 0.3517 0.1250  0.0415  -0.0731 25  GLU A CB  
227  C CG  . GLU A 30  ? 0.4211 0.4808 0.3954 0.1137  0.0417  -0.0677 25  GLU A CG  
228  C CD  . GLU A 30  ? 0.4356 0.4960 0.4188 0.1246  0.0270  -0.0888 25  GLU A CD  
229  O OE1 . GLU A 30  ? 0.4692 0.5108 0.4605 0.1160  0.0264  -0.0850 25  GLU A OE1 
230  O OE2 . GLU A 30  ? 0.4593 0.5417 0.4435 0.1431  0.0139  -0.1113 25  GLU A OE2 
231  N N   . ALA A 31  ? 0.3771 0.5588 0.3210 0.1355  0.0554  -0.0535 26  ALA A N   
232  C CA  . ALA A 31  ? 0.3870 0.6082 0.3253 0.1438  0.0574  -0.0554 26  ALA A CA  
233  C C   . ALA A 31  ? 0.3865 0.5844 0.3271 0.1222  0.0682  -0.0281 26  ALA A C   
234  O O   . ALA A 31  ? 0.3812 0.5751 0.3230 0.1242  0.0678  -0.0367 26  ALA A O   
235  C CB  . ALA A 31  ? 0.3873 0.6980 0.3132 0.1606  0.0589  -0.0503 26  ALA A CB  
236  N N   . GLU A 32  ? 0.3970 0.5783 0.3414 0.1033  0.0743  0.0022  27  GLU A N   
237  C CA  . GLU A 32  ? 0.4232 0.5817 0.3739 0.0852  0.0795  0.0238  27  GLU A CA  
238  C C   . GLU A 32  ? 0.4166 0.5167 0.3732 0.0787  0.0796  0.0082  27  GLU A C   
239  O O   . GLU A 32  ? 0.4268 0.5218 0.3840 0.0749  0.0823  0.0088  27  GLU A O   
240  C CB  . GLU A 32  ? 0.4335 0.5823 0.3944 0.0686  0.0779  0.0561  27  GLU A CB  
241  C CG  . GLU A 32  ? 0.5124 0.7258 0.4740 0.0658  0.0766  0.0887  27  GLU A CG  
242  C CD  . GLU A 32  ? 0.6280 0.8218 0.6106 0.0441  0.0675  0.1272  27  GLU A CD  
243  O OE1 . GLU A 32  ? 0.6566 0.8977 0.6462 0.0377  0.0616  0.1613  27  GLU A OE1 
244  O OE2 . GLU A 32  ? 0.6527 0.7878 0.6478 0.0343  0.0632  0.1234  27  GLU A OE2 
245  N N   . VAL A 33  ? 0.4081 0.4720 0.3693 0.0769  0.0765  -0.0035 28  VAL A N   
246  C CA  . VAL A 33  ? 0.4072 0.4316 0.3752 0.0700  0.0758  -0.0138 28  VAL A CA  
247  C C   . VAL A 33  ? 0.4121 0.4362 0.3818 0.0778  0.0695  -0.0316 28  VAL A C   
248  O O   . VAL A 33  ? 0.4020 0.4064 0.3764 0.0702  0.0700  -0.0312 28  VAL A O   
249  C CB  . VAL A 33  ? 0.4090 0.4128 0.3833 0.0678  0.0724  -0.0208 28  VAL A CB  
250  C CG1 . VAL A 33  ? 0.4052 0.3850 0.3887 0.0598  0.0700  -0.0272 28  VAL A CG1 
251  C CG2 . VAL A 33  ? 0.4050 0.4027 0.3819 0.0617  0.0746  -0.0073 28  VAL A CG2 
252  N N   . SER A 34  ? 0.4199 0.4670 0.3882 0.0946  0.0604  -0.0491 29  SER A N   
253  C CA  . SER A 34  ? 0.4509 0.4966 0.4264 0.1061  0.0472  -0.0707 29  SER A CA  
254  C C   . SER A 34  ? 0.4504 0.5202 0.4189 0.1098  0.0527  -0.0675 29  SER A C   
255  O O   . SER A 34  ? 0.4490 0.5005 0.4255 0.1096  0.0456  -0.0758 29  SER A O   
256  C CB  . SER A 34  ? 0.4562 0.5230 0.4357 0.1285  0.0303  -0.0978 29  SER A CB  
257  O OG  . SER A 34  ? 0.5123 0.5904 0.4991 0.1464  0.0142  -0.1227 29  SER A OG  
258  N N   . GLU A 35  ? 0.4529 0.5656 0.4092 0.1109  0.0642  -0.0515 30  GLU A N   
259  C CA  . GLU A 35  ? 0.4532 0.5908 0.4052 0.1094  0.0709  -0.0416 30  GLU A CA  
260  C C   . GLU A 35  ? 0.4417 0.5350 0.3988 0.0873  0.0784  -0.0234 30  GLU A C   
261  O O   . GLU A 35  ? 0.4301 0.5225 0.3881 0.0859  0.0795  -0.0240 30  GLU A O   
262  C CB  . GLU A 35  ? 0.4584 0.6615 0.4012 0.1119  0.0788  -0.0209 30  GLU A CB  
263  C CG  . GLU A 35  ? 0.4991 0.7397 0.4398 0.1086  0.0851  -0.0056 30  GLU A CG  
264  C CD  . GLU A 35  ? 0.5645 0.8469 0.5015 0.1338  0.0779  -0.0361 30  GLU A CD  
265  O OE1 . GLU A 35  ? 0.6274 0.9264 0.5635 0.1576  0.0657  -0.0686 30  GLU A OE1 
266  O OE2 . GLU A 35  ? 0.5863 0.8868 0.5234 0.1317  0.0818  -0.0299 30  GLU A OE2 
267  N N   . LEU A 36  ? 0.4400 0.5007 0.4010 0.0728  0.0821  -0.0106 31  LEU A N   
268  C CA  . LEU A 36  ? 0.4396 0.4651 0.4062 0.0570  0.0862  -0.0010 31  LEU A CA  
269  C C   . LEU A 36  ? 0.4384 0.4385 0.4104 0.0565  0.0812  -0.0151 31  LEU A C   
270  O O   . LEU A 36  ? 0.4391 0.4294 0.4128 0.0496  0.0838  -0.0110 31  LEU A O   
271  C CB  . LEU A 36  ? 0.4326 0.4362 0.4043 0.0479  0.0871  0.0073  31  LEU A CB  
272  C CG  . LEU A 36  ? 0.4451 0.4245 0.4247 0.0366  0.0879  0.0146  31  LEU A CG  
273  C CD1 . LEU A 36  ? 0.4155 0.3769 0.3993 0.0353  0.0866  0.0042  31  LEU A CD1 
274  C CD2 . LEU A 36  ? 0.4367 0.4118 0.4180 0.0308  0.0901  0.0188  31  LEU A CD2 
275  N N   . GLU A 37  ? 0.4285 0.4194 0.4063 0.0624  0.0714  -0.0291 32  GLU A N   
276  C CA  . GLU A 37  ? 0.4385 0.4067 0.4291 0.0590  0.0603  -0.0362 32  GLU A CA  
277  C C   . GLU A 37  ? 0.4300 0.4051 0.4226 0.0683  0.0529  -0.0463 32  GLU A C   
278  O O   . GLU A 37  ? 0.4408 0.3991 0.4409 0.0600  0.0495  -0.0418 32  GLU A O   
279  C CB  . GLU A 37  ? 0.4403 0.3981 0.4444 0.0632  0.0442  -0.0475 32  GLU A CB  
280  C CG  . GLU A 37  ? 0.4979 0.4479 0.5054 0.0523  0.0481  -0.0380 32  GLU A CG  
281  C CD  . GLU A 37  ? 0.6060 0.5499 0.6283 0.0577  0.0304  -0.0491 32  GLU A CD  
282  O OE1 . GLU A 37  ? 0.6537 0.6010 0.6817 0.0743  0.0143  -0.0691 32  GLU A OE1 
283  O OE2 . GLU A 37  ? 0.6247 0.5648 0.6545 0.0471  0.0307  -0.0402 32  GLU A OE2 
284  N N   . THR A 38  ? 0.4357 0.4419 0.4222 0.0872  0.0490  -0.0609 33  THR A N   
285  C CA  . THR A 38  ? 0.4367 0.4619 0.4248 0.1025  0.0402  -0.0769 33  THR A CA  
286  C C   . THR A 38  ? 0.4183 0.4473 0.3993 0.0912  0.0543  -0.0598 33  THR A C   
287  O O   . THR A 38  ? 0.4079 0.4238 0.3965 0.0916  0.0467  -0.0651 33  THR A O   
288  C CB  . THR A 38  ? 0.4429 0.5219 0.4225 0.1272  0.0368  -0.0952 33  THR A CB  
289  O OG1 . THR A 38  ? 0.5118 0.5819 0.5021 0.1401  0.0183  -0.1171 33  THR A OG1 
290  C CG2 . THR A 38  ? 0.4149 0.5319 0.3944 0.1484  0.0285  -0.1156 33  THR A CG2 
291  N N   . ARG A 39  ? 0.3936 0.4372 0.3639 0.0804  0.0714  -0.0383 34  ARG A N   
292  C CA  . ARG A 39  ? 0.3812 0.4295 0.3487 0.0703  0.0810  -0.0229 34  ARG A CA  
293  C C   . ARG A 39  ? 0.3800 0.3862 0.3537 0.0542  0.0824  -0.0158 34  ARG A C   
294  O O   . ARG A 39  ? 0.3667 0.3704 0.3411 0.0494  0.0849  -0.0114 34  ARG A O   
295  C CB  . ARG A 39  ? 0.3717 0.4488 0.3341 0.0629  0.0914  0.0001  34  ARG A CB  
296  C CG  . ARG A 39  ? 0.3722 0.5142 0.3279 0.0787  0.0912  -0.0017 34  ARG A CG  
297  C CD  . ARG A 39  ? 0.3762 0.5571 0.3326 0.0666  0.0985  0.0317  34  ARG A CD  
298  N NE  . ARG A 39  ? 0.4026 0.6564 0.3518 0.0818  0.0984  0.0324  34  ARG A NE  
299  C CZ  . ARG A 39  ? 0.4502 0.7659 0.4014 0.0744  0.1024  0.0644  34  ARG A CZ  
300  N NH1 . ARG A 39  ? 0.4604 0.7639 0.4244 0.0507  0.1036  0.0983  34  ARG A NH1 
301  N NH2 . ARG A 39  ? 0.4640 0.8603 0.4071 0.0909  0.1026  0.0634  34  ARG A NH2 
302  N N   . LEU A 40  ? 0.3754 0.3569 0.3536 0.0469  0.0807  -0.0148 35  LEU A N   
303  C CA  . LEU A 40  ? 0.3907 0.3502 0.3743 0.0336  0.0821  -0.0078 35  LEU A CA  
304  C C   . LEU A 40  ? 0.3999 0.3481 0.3937 0.0342  0.0698  -0.0133 35  LEU A C   
305  O O   . LEU A 40  ? 0.3883 0.3307 0.3845 0.0256  0.0714  -0.0059 35  LEU A O   
306  C CB  . LEU A 40  ? 0.3833 0.3340 0.3703 0.0273  0.0826  -0.0052 35  LEU A CB  
307  C CG  . LEU A 40  ? 0.4016 0.3554 0.3841 0.0247  0.0906  0.0004  35  LEU A CG  
308  C CD1 . LEU A 40  ? 0.4160 0.3680 0.4015 0.0247  0.0888  -0.0024 35  LEU A CD1 
309  C CD2 . LEU A 40  ? 0.3664 0.3172 0.3505 0.0178  0.0946  0.0045  35  LEU A CD2 
310  N N   . GLU A 41  ? 0.4260 0.3714 0.4287 0.0450  0.0545  -0.0268 36  GLU A N   
311  C CA  . GLU A 41  ? 0.4564 0.3849 0.4779 0.0469  0.0332  -0.0333 36  GLU A CA  
312  C C   . GLU A 41  ? 0.4465 0.3842 0.4651 0.0562  0.0318  -0.0413 36  GLU A C   
313  O O   . GLU A 41  ? 0.4442 0.3663 0.4757 0.0509  0.0204  -0.0374 36  GLU A O   
314  C CB  . GLU A 41  ? 0.4969 0.4232 0.5306 0.0632  0.0126  -0.0541 36  GLU A CB  
315  C CG  . GLU A 41  ? 0.5880 0.4856 0.6516 0.0561  -0.0148 -0.0520 36  GLU A CG  
316  C CD  . GLU A 41  ? 0.6628 0.5564 0.7303 0.0410  -0.0105 -0.0362 36  GLU A CD  
317  O OE1 . GLU A 41  ? 0.7190 0.6165 0.7861 0.0515  -0.0149 -0.0497 36  GLU A OE1 
318  O OE2 . GLU A 41  ? 0.6797 0.5730 0.7509 0.0201  -0.0035 -0.0114 36  GLU A OE2 
319  N N   . LYS A 42  ? 0.4313 0.4003 0.4347 0.0697  0.0422  -0.0500 37  LYS A N   
320  C CA  . LYS A 42  ? 0.4224 0.4120 0.4229 0.0803  0.0415  -0.0580 37  LYS A CA  
321  C C   . LYS A 42  ? 0.4003 0.3802 0.3960 0.0622  0.0554  -0.0377 37  LYS A C   
322  O O   . LYS A 42  ? 0.3864 0.3633 0.3871 0.0638  0.0497  -0.0404 37  LYS A O   
323  C CB  . LYS A 42  ? 0.4320 0.4738 0.4193 0.0975  0.0491  -0.0670 37  LYS A CB  
324  C CG  . LYS A 42  ? 0.4484 0.5274 0.4293 0.1034  0.0560  -0.0658 37  LYS A CG  
325  C CD  . LYS A 42  ? 0.5454 0.6558 0.5328 0.1328  0.0373  -0.0985 37  LYS A CD  
326  C CE  . LYS A 42  ? 0.6013 0.6684 0.6071 0.1344  0.0166  -0.1109 37  LYS A CE  
327  N NZ  . LYS A 42  ? 0.6871 0.7673 0.7094 0.1672  -0.0144 -0.1520 37  LYS A NZ  
328  N N   . LEU A 43  ? 0.3895 0.3639 0.3778 0.0470  0.0704  -0.0204 38  LEU A N   
329  C CA  . LEU A 43  ? 0.3969 0.3631 0.3831 0.0327  0.0798  -0.0063 38  LEU A CA  
330  C C   . LEU A 43  ? 0.4097 0.3561 0.4054 0.0228  0.0726  -0.0010 38  LEU A C   
331  O O   . LEU A 43  ? 0.3982 0.3454 0.3932 0.0179  0.0754  0.0042  38  LEU A O   
332  C CB  . LEU A 43  ? 0.3816 0.3470 0.3629 0.0235  0.0906  0.0041  38  LEU A CB  
333  C CG  . LEU A 43  ? 0.3873 0.3483 0.3686 0.0135  0.0965  0.0122  38  LEU A CG  
334  C CD1 . LEU A 43  ? 0.3843 0.3587 0.3647 0.0146  0.0987  0.0160  38  LEU A CD1 
335  C CD2 . LEU A 43  ? 0.4209 0.3785 0.4035 0.0092  0.0996  0.0161  38  LEU A CD2 
336  N N   . LEU A 44  ? 0.4185 0.3526 0.4245 0.0182  0.0628  0.0014  39  LEU A N   
337  C CA  . LEU A 44  ? 0.4293 0.3538 0.4504 0.0064  0.0511  0.0137  39  LEU A CA  
338  C C   . LEU A 44  ? 0.4411 0.3544 0.4750 0.0120  0.0338  0.0087  39  LEU A C   
339  O O   . LEU A 44  ? 0.4495 0.3615 0.4902 0.0020  0.0300  0.0219  39  LEU A O   
340  C CB  . LEU A 44  ? 0.4322 0.3495 0.4685 0.0005  0.0382  0.0197  39  LEU A CB  
341  C CG  . LEU A 44  ? 0.4423 0.3757 0.4684 -0.0066 0.0540  0.0266  39  LEU A CG  
342  C CD1 . LEU A 44  ? 0.4039 0.3366 0.4449 -0.0127 0.0429  0.0333  39  LEU A CD1 
343  C CD2 . LEU A 44  ? 0.4137 0.3688 0.4343 -0.0173 0.0652  0.0395  39  LEU A CD2 
344  N N   . LYS A 45  ? 0.4489 0.3580 0.4883 0.0299  0.0203  -0.0119 40  LYS A N   
345  C CA  . LYS A 45  ? 0.4646 0.3637 0.5204 0.0417  -0.0024 -0.0251 40  LYS A CA  
346  C C   . LYS A 45  ? 0.4437 0.3595 0.4856 0.0458  0.0109  -0.0271 40  LYS A C   
347  O O   . LYS A 45  ? 0.4299 0.3359 0.4836 0.0448  -0.0017 -0.0251 40  LYS A O   
348  C CB  . LYS A 45  ? 0.4806 0.3833 0.5441 0.0666  -0.0206 -0.0552 40  LYS A CB  
349  C CG  . LYS A 45  ? 0.5678 0.4702 0.6467 0.0878  -0.0452 -0.0796 40  LYS A CG  
350  C CD  . LYS A 45  ? 0.6663 0.5272 0.7837 0.0816  -0.0837 -0.0750 40  LYS A CD  
351  C CE  . LYS A 45  ? 0.7155 0.5711 0.8468 0.0936  -0.1029 -0.0875 40  LYS A CE  
352  N NZ  . LYS A 45  ? 0.7044 0.5624 0.8234 0.0717  -0.0819 -0.0578 40  LYS A NZ  
353  N N   . LEU A 46  ? 0.4141 0.3556 0.4341 0.0486  0.0344  -0.0280 41  LEU A N   
354  C CA  . LEU A 46  ? 0.4032 0.3626 0.4122 0.0475  0.0481  -0.0239 41  LEU A CA  
355  C C   . LEU A 46  ? 0.3870 0.3327 0.3964 0.0284  0.0544  -0.0045 41  LEU A C   
356  O O   . LEU A 46  ? 0.3660 0.3160 0.3749 0.0275  0.0556  -0.0026 41  LEU A O   
357  C CB  . LEU A 46  ? 0.3769 0.3644 0.3700 0.0480  0.0675  -0.0197 41  LEU A CB  
358  C CG  . LEU A 46  ? 0.4008 0.4328 0.3876 0.0648  0.0701  -0.0299 41  LEU A CG  
359  C CD1 . LEU A 46  ? 0.3626 0.4152 0.3562 0.0883  0.0538  -0.0549 41  LEU A CD1 
360  C CD2 . LEU A 46  ? 0.3800 0.4329 0.3597 0.0670  0.0773  -0.0266 41  LEU A CD2 
361  N N   . GLY A 47  ? 0.3782 0.3155 0.3881 0.0151  0.0584  0.0081  42  GLY A N   
362  C CA  . GLY A 47  ? 0.3869 0.3262 0.3971 0.0000  0.0631  0.0242  42  GLY A CA  
363  C C   . GLY A 47  ? 0.4067 0.3365 0.4343 -0.0060 0.0448  0.0344  42  GLY A C   
364  O O   . GLY A 47  ? 0.4114 0.3485 0.4382 -0.0120 0.0469  0.0429  42  GLY A O   
365  N N   . THR A 48  ? 0.4216 0.3345 0.4686 -0.0045 0.0234  0.0343  43  THR A N   
366  C CA  . THR A 48  ? 0.4433 0.3406 0.5160 -0.0103 -0.0031 0.0456  43  THR A CA  
367  C C   . THR A 48  ? 0.4510 0.3442 0.5234 0.0022  -0.0083 0.0318  43  THR A C   
368  O O   . THR A 48  ? 0.4540 0.3469 0.5350 -0.0070 -0.0153 0.0468  43  THR A O   
369  C CB  . THR A 48  ? 0.4583 0.3318 0.5585 -0.0074 -0.0324 0.0423  43  THR A CB  
370  O OG1 . THR A 48  ? 0.4758 0.3595 0.5763 -0.0219 -0.0256 0.0595  43  THR A OG1 
371  C CG2 . THR A 48  ? 0.4912 0.3413 0.6296 -0.0156 -0.0701 0.0578  43  THR A CG2 
372  N N   . GLY A 49  ? 0.4499 0.3479 0.5126 0.0231  -0.0047 0.0047  44  GLY A N   
373  C CA  . GLY A 49  ? 0.4549 0.3603 0.5163 0.0375  -0.0084 -0.0106 44  GLY A CA  
374  C C   . GLY A 49  ? 0.4349 0.3552 0.4804 0.0260  0.0128  0.0036  44  GLY A C   
375  O O   . GLY A 49  ? 0.4454 0.3624 0.4988 0.0263  0.0035  0.0056  44  GLY A O   
376  N N   . LEU A 50  ? 0.4163 0.3513 0.4428 0.0170  0.0375  0.0116  45  LEU A N   
377  C CA  . LEU A 50  ? 0.4032 0.3511 0.4178 0.0071  0.0542  0.0216  45  LEU A CA  
378  C C   . LEU A 50  ? 0.4141 0.3608 0.4367 -0.0074 0.0478  0.0408  45  LEU A C   
379  O O   . LEU A 50  ? 0.4181 0.3707 0.4404 -0.0094 0.0478  0.0446  45  LEU A O   
380  C CB  . LEU A 50  ? 0.3869 0.3450 0.3880 0.0024  0.0727  0.0232  45  LEU A CB  
381  C CG  . LEU A 50  ? 0.3693 0.3387 0.3630 -0.0043 0.0843  0.0273  45  LEU A CG  
382  C CD1 . LEU A 50  ? 0.3763 0.3498 0.3647 -0.0057 0.0940  0.0251  45  LEU A CD1 
383  C CD2 . LEU A 50  ? 0.3991 0.3753 0.3950 -0.0141 0.0820  0.0381  45  LEU A CD2 
384  N N   . LEU A 51  ? 0.4079 0.3537 0.4387 -0.0180 0.0416  0.0551  46  LEU A N   
385  C CA  . LEU A 51  ? 0.4143 0.3759 0.4537 -0.0339 0.0358  0.0798  46  LEU A CA  
386  C C   . LEU A 51  ? 0.4262 0.3725 0.4881 -0.0371 0.0111  0.0915  46  LEU A C   
387  O O   . LEU A 51  ? 0.4164 0.3785 0.4798 -0.0453 0.0101  0.1065  46  LEU A O   
388  C CB  . LEU A 51  ? 0.4055 0.3816 0.4511 -0.0455 0.0344  0.0963  46  LEU A CB  
389  C CG  . LEU A 51  ? 0.4168 0.4123 0.4422 -0.0417 0.0564  0.0846  46  LEU A CG  
390  C CD1 . LEU A 51  ? 0.4507 0.4563 0.4843 -0.0493 0.0524  0.0961  46  LEU A CD1 
391  C CD2 . LEU A 51  ? 0.4121 0.4442 0.4244 -0.0434 0.0700  0.0850  46  LEU A CD2 
392  N N   . GLU A 52  ? 0.4425 0.3588 0.5244 -0.0292 -0.0122 0.0830  47  GLU A N   
393  C CA  . GLU A 52  ? 0.4660 0.3609 0.5775 -0.0302 -0.0445 0.0915  47  GLU A CA  
394  C C   . GLU A 52  ? 0.4680 0.3627 0.5715 -0.0172 -0.0416 0.0750  47  GLU A C   
395  O O   . GLU A 52  ? 0.4737 0.3639 0.5937 -0.0236 -0.0589 0.0901  47  GLU A O   
396  C CB  . GLU A 52  ? 0.5014 0.3629 0.6397 -0.0190 -0.0753 0.0769  47  GLU A CB  
397  C CG  . GLU A 52  ? 0.5644 0.4218 0.7254 -0.0386 -0.0908 0.1047  47  GLU A CG  
398  C CD  . GLU A 52  ? 0.6752 0.4966 0.8660 -0.0262 -0.1248 0.0866  47  GLU A CD  
399  O OE1 . GLU A 52  ? 0.6898 0.5030 0.9070 -0.0429 -0.1447 0.1105  47  GLU A OE1 
400  O OE2 . GLU A 52  ? 0.7236 0.5307 0.9126 0.0016  -0.1332 0.0473  47  GLU A OE2 
401  N N   . SER A 53  ? 0.4417 0.3455 0.5222 -0.0003 -0.0211 0.0475  48  SER A N   
402  C CA  . SER A 53  ? 0.4343 0.3485 0.5047 0.0118  -0.0136 0.0322  48  SER A CA  
403  C C   . SER A 53  ? 0.4000 0.3337 0.4563 -0.0020 0.0047  0.0489  48  SER A C   
404  O O   . SER A 53  ? 0.4144 0.3499 0.4748 -0.0002 -0.0012 0.0498  48  SER A O   
405  C CB  . SER A 53  ? 0.4165 0.3488 0.4678 0.0282  0.0049  0.0078  48  SER A CB  
406  O OG  . SER A 53  ? 0.4922 0.4218 0.5567 0.0511  -0.0157 -0.0177 48  SER A OG  
407  N N   . GLY A 54  ? 0.3926 0.3425 0.4337 -0.0130 0.0246  0.0584  49  GLY A N   
408  C CA  . GLY A 54  ? 0.3956 0.3702 0.4243 -0.0230 0.0396  0.0692  49  GLY A CA  
409  C C   . GLY A 54  ? 0.4091 0.3947 0.4509 -0.0362 0.0257  0.0949  49  GLY A C   
410  O O   . GLY A 54  ? 0.4040 0.4049 0.4418 -0.0382 0.0285  0.0991  49  GLY A O   
411  N N   . ARG A 55  ? 0.4280 0.4091 0.4882 -0.0468 0.0089  0.1154  50  ARG A N   
412  C CA  . ARG A 55  ? 0.4536 0.4521 0.5323 -0.0638 -0.0082 0.1496  50  ARG A CA  
413  C C   . ARG A 55  ? 0.4613 0.4353 0.5582 -0.0597 -0.0306 0.1504  50  ARG A C   
414  O O   . ARG A 55  ? 0.4797 0.4754 0.5807 -0.0695 -0.0350 0.1714  50  ARG A O   
415  C CB  . ARG A 55  ? 0.4609 0.4582 0.5642 -0.0790 -0.0279 0.1770  50  ARG A CB  
416  C CG  . ARG A 55  ? 0.5059 0.5310 0.5947 -0.0830 -0.0090 0.1778  50  ARG A CG  
417  C CD  . ARG A 55  ? 0.5565 0.6396 0.6228 -0.0865 0.0140  0.1828  50  ARG A CD  
418  N NE  . ARG A 55  ? 0.6052 0.7282 0.6667 -0.0930 0.0237  0.1922  50  ARG A NE  
419  C CZ  . ARG A 55  ? 0.6070 0.7909 0.6505 -0.0915 0.0416  0.1905  50  ARG A CZ  
420  N NH1 . ARG A 55  ? 0.6315 0.8551 0.6728 -0.0950 0.0481  0.1967  50  ARG A NH1 
421  N NH2 . ARG A 55  ? 0.5650 0.7726 0.5938 -0.0840 0.0512  0.1789  50  ARG A NH2 
422  N N   . HIS A 56  ? 0.4638 0.3979 0.5735 -0.0437 -0.0474 0.1271  51  HIS A N   
423  C CA  . HIS A 56  ? 0.4816 0.3922 0.6120 -0.0346 -0.0731 0.1210  51  HIS A CA  
424  C C   . HIS A 56  ? 0.4626 0.3932 0.5683 -0.0263 -0.0503 0.1063  51  HIS A C   
425  O O   . HIS A 56  ? 0.4790 0.4089 0.5955 -0.0275 -0.0636 0.1148  51  HIS A O   
426  C CB  . HIS A 56  ? 0.4995 0.3738 0.6486 -0.0133 -0.0973 0.0909  51  HIS A CB  
427  C CG  . HIS A 56  ? 0.5670 0.4194 0.7389 0.0037  -0.1271 0.0738  51  HIS A CG  
428  N ND1 . HIS A 56  ? 0.6438 0.4649 0.8596 -0.0020 -0.1729 0.0909  51  HIS A ND1 
429  C CD2 . HIS A 56  ? 0.6012 0.4611 0.7618 0.0277  -0.1213 0.0402  51  HIS A CD2 
430  C CE1 . HIS A 56  ? 0.6619 0.4684 0.8917 0.0200  -0.1946 0.0646  51  HIS A CE1 
431  N NE2 . HIS A 56  ? 0.6599 0.4940 0.8548 0.0388  -0.1619 0.0332  51  HIS A NE2 
432  N N   . TYR A 57  ? 0.4285 0.3774 0.5047 -0.0203 -0.0186 0.0884  52  TYR A N   
433  C CA  . TYR A 57  ? 0.4143 0.3812 0.4725 -0.0145 -0.0004 0.0764  52  TYR A CA  
434  C C   . TYR A 57  ? 0.4015 0.3972 0.4517 -0.0289 0.0086  0.0971  52  TYR A C   
435  O O   . TYR A 57  ? 0.4132 0.4167 0.4629 -0.0273 0.0072  0.0972  52  TYR A O   
436  C CB  . TYR A 57  ? 0.3847 0.3608 0.4226 -0.0057 0.0235  0.0550  52  TYR A CB  
437  C CG  . TYR A 57  ? 0.3738 0.3706 0.3971 -0.0065 0.0414  0.0501  52  TYR A CG  
438  C CD1 . TYR A 57  ? 0.3919 0.3936 0.4179 0.0006  0.0378  0.0431  52  TYR A CD1 
439  C CD2 . TYR A 57  ? 0.3579 0.3687 0.3681 -0.0129 0.0585  0.0500  52  TYR A CD2 
440  C CE1 . TYR A 57  ? 0.3745 0.3944 0.3910 -0.0013 0.0518  0.0393  52  TYR A CE1 
441  C CE2 . TYR A 57  ? 0.3814 0.4064 0.3849 -0.0130 0.0688  0.0433  52  TYR A CE2 
442  C CZ  . TYR A 57  ? 0.4023 0.4314 0.4093 -0.0086 0.0656  0.0396  52  TYR A CZ  
443  O OH  . TYR A 57  ? 0.4373 0.4794 0.4417 -0.0104 0.0726  0.0348  52  TYR A OH  
444  N N   . LEU A 58  ? 0.3850 0.4032 0.4293 -0.0410 0.0169  0.1129  53  LEU A N   
445  C CA  . LEU A 58  ? 0.3737 0.4343 0.4123 -0.0524 0.0220  0.1328  53  LEU A CA  
446  C C   . LEU A 58  ? 0.3839 0.4477 0.4442 -0.0635 -0.0018 0.1627  53  LEU A C   
447  O O   . LEU A 58  ? 0.3895 0.4787 0.4456 -0.0659 -0.0002 0.1703  53  LEU A O   
448  C CB  . LEU A 58  ? 0.3725 0.4673 0.4040 -0.0606 0.0319  0.1433  53  LEU A CB  
449  C CG  . LEU A 58  ? 0.3949 0.4849 0.4077 -0.0487 0.0519  0.1125  53  LEU A CG  
450  C CD1 . LEU A 58  ? 0.4077 0.5371 0.4121 -0.0516 0.0615  0.1149  53  LEU A CD1 
451  C CD2 . LEU A 58  ? 0.4054 0.4964 0.4070 -0.0390 0.0616  0.0907  53  LEU A CD2 
452  N N   . ALA A 59  ? 0.3862 0.4217 0.4736 -0.0699 -0.0276 0.1796  54  ALA A N   
453  C CA  . ALA A 59  ? 0.3942 0.4280 0.5113 -0.0831 -0.0579 0.2136  54  ALA A CA  
454  C C   . ALA A 59  ? 0.3991 0.4093 0.5203 -0.0701 -0.0676 0.1968  54  ALA A C   
455  O O   . ALA A 59  ? 0.4070 0.4395 0.5346 -0.0794 -0.0757 0.2200  54  ALA A O   
456  C CB  . ALA A 59  ? 0.4096 0.4102 0.5627 -0.0920 -0.0908 0.2328  54  ALA A CB  
457  N N   . ALA A 60  ? 0.3898 0.3647 0.5070 -0.0484 -0.0661 0.1580  55  ALA A N   
458  C CA  . ALA A 60  ? 0.4011 0.3639 0.5196 -0.0329 -0.0720 0.1374  55  ALA A CA  
459  C C   . ALA A 60  ? 0.3797 0.3786 0.4720 -0.0347 -0.0454 0.1352  55  ALA A C   
460  O O   . ALA A 60  ? 0.3909 0.3926 0.4888 -0.0325 -0.0541 0.1378  55  ALA A O   
461  C CB  . ALA A 60  ? 0.3876 0.3266 0.5044 -0.0076 -0.0726 0.0961  55  ALA A CB  
462  N N   . SER A 61  ? 0.3810 0.4054 0.4479 -0.0373 -0.0168 0.1285  56  SER A N   
463  C CA  . SER A 61  ? 0.3902 0.4483 0.4365 -0.0377 0.0037  0.1229  56  SER A CA  
464  C C   . SER A 61  ? 0.4101 0.5078 0.4587 -0.0514 -0.0017 0.1527  56  SER A C   
465  O O   . SER A 61  ? 0.3931 0.5081 0.4357 -0.0487 0.0013  0.1495  56  SER A O   
466  C CB  . SER A 61  ? 0.3628 0.4360 0.3889 -0.0356 0.0275  0.1067  56  SER A CB  
467  O OG  . SER A 61  ? 0.4220 0.4680 0.4463 -0.0250 0.0330  0.0845  56  SER A OG  
468  N N   . ARG A 62  ? 0.4274 0.5466 0.4850 -0.0664 -0.0095 0.1830  57  ARG A N   
469  C CA  . ARG A 62  ? 0.4584 0.6314 0.5203 -0.0815 -0.0159 0.2189  57  ARG A CA  
470  C C   . ARG A 62  ? 0.4742 0.6290 0.5583 -0.0857 -0.0410 0.2377  57  ARG A C   
471  O O   . ARG A 62  ? 0.4985 0.6930 0.5783 -0.0899 -0.0406 0.2519  57  ARG A O   
472  C CB  . ARG A 62  ? 0.4747 0.6803 0.5501 -0.1003 -0.0250 0.2573  57  ARG A CB  
473  C CG  . ARG A 62  ? 0.5018 0.7402 0.5564 -0.0967 -0.0019 0.2428  57  ARG A CG  
474  C CD  . ARG A 62  ? 0.5394 0.8273 0.6074 -0.1165 -0.0097 0.2847  57  ARG A CD  
475  N NE  . ARG A 62  ? 0.6095 0.9056 0.6593 -0.1072 0.0104  0.2588  57  ARG A NE  
476  C CZ  . ARG A 62  ? 0.6361 0.8885 0.6947 -0.1080 0.0066  0.2536  57  ARG A CZ  
477  N NH1 . ARG A 62  ? 0.6089 0.8090 0.6968 -0.1174 -0.0193 0.2724  57  ARG A NH1 
478  N NH2 . ARG A 62  ? 0.6473 0.9105 0.6878 -0.0981 0.0255  0.2284  57  ARG A NH2 
479  N N   . ALA A 63  ? 0.4781 0.5752 0.5881 -0.0826 -0.0661 0.2361  58  ALA A N   
480  C CA  . ALA A 63  ? 0.4754 0.5481 0.6137 -0.0842 -0.0976 0.2514  58  ALA A CA  
481  C C   . ALA A 63  ? 0.4614 0.5287 0.5835 -0.0664 -0.0859 0.2194  58  ALA A C   
482  O O   . ALA A 63  ? 0.4683 0.5423 0.6020 -0.0694 -0.1012 0.2347  58  ALA A O   
483  C CB  . ALA A 63  ? 0.4983 0.5112 0.6713 -0.0796 -0.1318 0.2482  58  ALA A CB  
484  N N   . PHE A 64  ? 0.4250 0.4833 0.5232 -0.0495 -0.0605 0.1787  59  PHE A N   
485  C CA  . PHE A 64  ? 0.4155 0.4789 0.4983 -0.0358 -0.0466 0.1518  59  PHE A CA  
486  C C   . PHE A 64  ? 0.4112 0.5241 0.4785 -0.0445 -0.0336 0.1657  59  PHE A C   
487  O O   . PHE A 64  ? 0.4090 0.5293 0.4789 -0.0417 -0.0396 0.1666  59  PHE A O   
488  C CB  . PHE A 64  ? 0.3785 0.4349 0.4421 -0.0229 -0.0224 0.1169  59  PHE A CB  
489  C CG  . PHE A 64  ? 0.3595 0.4251 0.4116 -0.0120 -0.0090 0.0933  59  PHE A CG  
490  C CD1 . PHE A 64  ? 0.3283 0.3807 0.3923 0.0006  -0.0222 0.0810  59  PHE A CD1 
491  C CD2 . PHE A 64  ? 0.3514 0.4397 0.3844 -0.0134 0.0143  0.0816  59  PHE A CD2 
492  C CE1 . PHE A 64  ? 0.3659 0.4339 0.4210 0.0089  -0.0092 0.0622  59  PHE A CE1 
493  C CE2 . PHE A 64  ? 0.2847 0.3803 0.3132 -0.0063 0.0235  0.0632  59  PHE A CE2 
494  C CZ  . PHE A 64  ? 0.3134 0.4020 0.3519 0.0035  0.0133  0.0559  59  PHE A CZ  
495  N N   . VAL A 65  ? 0.4151 0.5665 0.4669 -0.0526 -0.0172 0.1735  60  VAL A N   
496  C CA  . VAL A 65  ? 0.4245 0.6353 0.4616 -0.0568 -0.0070 0.1820  60  VAL A CA  
497  C C   . VAL A 65  ? 0.4364 0.6782 0.4899 -0.0714 -0.0275 0.2249  60  VAL A C   
498  O O   . VAL A 65  ? 0.4493 0.7203 0.4979 -0.0699 -0.0278 0.2277  60  VAL A O   
499  C CB  . VAL A 65  ? 0.4207 0.6729 0.4394 -0.0566 0.0121  0.1738  60  VAL A CB  
500  C CG1 . VAL A 65  ? 0.4246 0.7495 0.4286 -0.0546 0.0198  0.1744  60  VAL A CG1 
501  C CG2 . VAL A 65  ? 0.3815 0.5975 0.3898 -0.0436 0.0273  0.1346  60  VAL A CG2 
502  N N   . VAL A 66  ? 0.4550 0.6872 0.5323 -0.0865 -0.0488 0.2605  61  VAL A N   
503  C CA  . VAL A 66  ? 0.4745 0.7285 0.5773 -0.1038 -0.0764 0.3089  61  VAL A CA  
504  C C   . VAL A 66  ? 0.4962 0.7094 0.6114 -0.0939 -0.0929 0.2972  61  VAL A C   
505  O O   . VAL A 66  ? 0.5008 0.7484 0.6197 -0.1003 -0.1011 0.3197  61  VAL A O   
506  C CB  . VAL A 66  ? 0.4900 0.7328 0.6272 -0.1246 -0.1050 0.3538  61  VAL A CB  
507  C CG1 . VAL A 66  ? 0.5040 0.7663 0.6753 -0.1455 -0.1397 0.4097  61  VAL A CG1 
508  C CG2 . VAL A 66  ? 0.4601 0.7615 0.5830 -0.1348 -0.0866 0.3686  61  VAL A CG2 
509  N N   . GLY A 67  ? 0.5028 0.6522 0.6222 -0.0763 -0.0959 0.2595  62  GLY A N   
510  C CA  . GLY A 67  ? 0.5163 0.6320 0.6478 -0.0627 -0.1115 0.2424  62  GLY A CA  
511  C C   . GLY A 67  ? 0.5051 0.6532 0.6115 -0.0543 -0.0894 0.2233  62  GLY A C   
512  O O   . GLY A 67  ? 0.5206 0.6664 0.6377 -0.0513 -0.1043 0.2280  62  GLY A O   
513  N N   . ILE A 68  ? 0.4889 0.6652 0.5655 -0.0501 -0.0574 0.2011  63  ILE A N   
514  C CA  . ILE A 68  ? 0.4866 0.6924 0.5428 -0.0421 -0.0392 0.1800  63  ILE A CA  
515  C C   . ILE A 68  ? 0.5153 0.7776 0.5706 -0.0525 -0.0457 0.2107  63  ILE A C   
516  O O   . ILE A 68  ? 0.5297 0.7984 0.5857 -0.0475 -0.0501 0.2065  63  ILE A O   
517  C CB  . ILE A 68  ? 0.4562 0.6776 0.4886 -0.0357 -0.0114 0.1504  63  ILE A CB  
518  C CG1 . ILE A 68  ? 0.4333 0.6074 0.4666 -0.0256 -0.0043 0.1219  63  ILE A CG1 
519  C CG2 . ILE A 68  ? 0.4533 0.7079 0.4716 -0.0287 -0.0002 0.1314  63  ILE A CG2 
520  C CD1 . ILE A 68  ? 0.3435 0.5251 0.3612 -0.0231 0.0161  0.1009  63  ILE A CD1 
521  N N   . CYS A 69  ? 0.5427 0.8532 0.5967 -0.0667 -0.0464 0.2427  64  CYS A N   
522  C CA  . CYS A 69  ? 0.5846 0.9653 0.6397 -0.0786 -0.0541 0.2801  64  CYS A CA  
523  C C   . CYS A 69  ? 0.6113 0.9716 0.6955 -0.0885 -0.0853 0.3149  64  CYS A C   
524  O O   . CYS A 69  ? 0.6099 0.9965 0.6912 -0.0860 -0.0885 0.3186  64  CYS A O   
525  C CB  . CYS A 69  ? 0.5799 1.0207 0.6340 -0.0936 -0.0521 0.3138  64  CYS A CB  
526  S SG  . CYS A 69  ? 0.6455 1.1060 0.6697 -0.0785 -0.0210 0.2688  64  CYS A SG  
527  N N   . ASP A 70  ? 0.6391 0.9516 0.7542 -0.0990 -0.1114 0.3395  65  ASP A N   
528  C CA  . ASP A 70  ? 0.6801 0.9442 0.8313 -0.1020 -0.1487 0.3583  65  ASP A CA  
529  C C   . ASP A 70  ? 0.6853 0.9311 0.8284 -0.0834 -0.1453 0.3250  65  ASP A C   
530  O O   . ASP A 70  ? 0.6944 0.9596 0.8495 -0.0889 -0.1625 0.3491  65  ASP A O   
531  C CB  . ASP A 70  ? 0.6871 0.8736 0.8636 -0.0960 -0.1690 0.3439  65  ASP A CB  
532  C CG  . ASP A 70  ? 0.7319 0.9072 0.9506 -0.1184 -0.2079 0.3963  65  ASP A CG  
533  O OD1 . ASP A 70  ? 0.7152 0.9225 0.9315 -0.1346 -0.2003 0.4218  65  ASP A OD1 
534  O OD2 . ASP A 70  ? 0.7840 0.9192 1.0416 -0.1197 -0.2491 0.4124  65  ASP A OD2 
535  N N   . LEU A 71  ? 0.6799 0.8914 0.8051 -0.0626 -0.1245 0.2724  66  LEU A N   
536  C CA  . LEU A 71  ? 0.6909 0.8867 0.8111 -0.0449 -0.1214 0.2399  66  LEU A CA  
537  C C   . LEU A 71  ? 0.6932 0.9481 0.7929 -0.0474 -0.1063 0.2448  66  LEU A C   
538  O O   . LEU A 71  ? 0.7105 0.9675 0.8193 -0.0442 -0.1200 0.2496  66  LEU A O   
539  C CB  . LEU A 71  ? 0.6622 0.8292 0.7667 -0.0264 -0.0992 0.1904  66  LEU A CB  
540  C CG  . LEU A 71  ? 0.6664 0.8271 0.7668 -0.0094 -0.0940 0.1583  66  LEU A CG  
541  C CD1 . LEU A 71  ? 0.6310 0.8385 0.7076 -0.0116 -0.0716 0.1523  66  LEU A CD1 
542  C CD2 . LEU A 71  ? 0.6735 0.8102 0.8023 -0.0029 -0.1277 0.1666  66  LEU A CD2 
543  N N   . ALA A 72  ? 0.6901 0.9954 0.7640 -0.0510 -0.0810 0.2412  67  ALA A N   
544  C CA  . ALA A 72  ? 0.6964 1.0594 0.7489 -0.0464 -0.0656 0.2309  67  ALA A CA  
545  C C   . ALA A 72  ? 0.7195 1.1477 0.7764 -0.0595 -0.0789 0.2749  67  ALA A C   
546  O O   . ALA A 72  ? 0.7200 1.1906 0.7643 -0.0531 -0.0731 0.2660  67  ALA A O   
547  C CB  . ALA A 72  ? 0.6744 1.0665 0.7015 -0.0393 -0.0387 0.2005  67  ALA A CB  
548  N N   . ARG A 73  ? 0.7568 1.1964 0.8342 -0.0788 -0.0990 0.3248  68  ARG A N   
549  C CA  . ARG A 73  ? 0.7878 1.2994 0.8747 -0.0961 -0.1152 0.3790  68  ARG A CA  
550  C C   . ARG A 73  ? 0.8199 1.3053 0.9290 -0.0969 -0.1413 0.3943  68  ARG A C   
551  O O   . ARG A 73  ? 0.8349 1.3843 0.9445 -0.1053 -0.1491 0.4266  68  ARG A O   
552  C CB  . ARG A 73  ? 0.8033 1.3427 0.9115 -0.1210 -0.1320 0.4360  68  ARG A CB  
553  C CG  . ARG A 73  ? 0.8429 1.3223 0.9991 -0.1382 -0.1751 0.4798  68  ARG A CG  
554  C CD  . ARG A 73  ? 0.8894 1.4184 1.0704 -0.1685 -0.1945 0.5483  68  ARG A CD  
555  N NE  . ARG A 73  ? 0.9123 1.4641 1.0726 -0.1676 -0.1687 0.5335  68  ARG A NE  
556  C CZ  . ARG A 73  ? 0.9259 1.4114 1.1018 -0.1692 -0.1760 0.5248  68  ARG A CZ  
557  N NH1 . ARG A 73  ? 0.8994 1.4136 1.0540 -0.1677 -0.1508 0.5113  68  ARG A NH1 
558  N NH2 . ARG A 73  ? 0.9601 1.3534 1.1741 -0.1700 -0.2107 0.5270  68  ARG A NH2 
559  N N   . LEU A 74  ? 0.8368 1.2343 0.9643 -0.0862 -0.1555 0.3696  69  LEU A N   
560  C CA  . LEU A 74  ? 0.8667 1.2334 1.0137 -0.0799 -0.1789 0.3700  69  LEU A CA  
561  C C   . LEU A 74  ? 0.8635 1.2787 0.9848 -0.0694 -0.1601 0.3499  69  LEU A C   
562  O O   . LEU A 74  ? 0.8447 1.3022 0.9334 -0.0613 -0.1286 0.3212  69  LEU A O   
563  C CB  . LEU A 74  ? 0.8658 1.1465 1.0260 -0.0603 -0.1869 0.3263  69  LEU A CB  
564  C CG  . LEU A 74  ? 0.9065 1.1220 1.1133 -0.0601 -0.2333 0.3419  69  LEU A CG  
565  C CD1 . LEU A 74  ? 0.8994 1.0640 1.1048 -0.0317 -0.2295 0.2838  69  LEU A CD1 
566  C CD2 . LEU A 74  ? 0.9248 1.1515 1.1627 -0.0723 -0.2710 0.3876  69  LEU A CD2 
567  N N   . GLY A 75  ? 0.8900 1.2958 1.0298 -0.0682 -0.1836 0.3632  70  GLY A N   
568  C CA  . GLY A 75  ? 0.8854 1.3220 1.0062 -0.0555 -0.1704 0.3389  70  GLY A CA  
569  C C   . GLY A 75  ? 0.8925 1.4276 0.9937 -0.0649 -0.1602 0.3659  70  GLY A C   
570  O O   . GLY A 75  ? 0.9021 1.4911 1.0052 -0.0828 -0.1637 0.4092  70  GLY A O   
571  N N   . PRO A 76  ? 0.8891 1.4567 0.9727 -0.0521 -0.1490 0.3411  71  PRO A N   
572  C CA  . PRO A 76  ? 0.8894 1.5616 0.9511 -0.0550 -0.1380 0.3565  71  PRO A CA  
573  C C   . PRO A 76  ? 0.8661 1.5784 0.8995 -0.0471 -0.1091 0.3255  71  PRO A C   
574  O O   . PRO A 76  ? 0.8505 1.5133 0.8738 -0.0323 -0.0921 0.2737  71  PRO A O   
575  C CB  . PRO A 76  ? 0.8858 1.5650 0.9388 -0.0393 -0.1351 0.3260  71  PRO A CB  
576  C CG  . PRO A 76  ? 0.8760 1.4626 0.9354 -0.0250 -0.1304 0.2788  71  PRO A CG  
577  C CD  . PRO A 76  ? 0.8815 1.4000 0.9662 -0.0339 -0.1475 0.2982  71  PRO A CD  
578  N N   . PRO A 77  ? 0.8666 1.6722 0.8902 -0.0568 -0.1058 0.3582  72  PRO A N   
579  C CA  . PRO A 77  ? 0.8457 1.6886 0.8464 -0.0475 -0.0826 0.3281  72  PRO A CA  
580  C C   . PRO A 77  ? 0.8282 1.7001 0.8043 -0.0212 -0.0650 0.2655  72  PRO A C   
581  O O   . PRO A 77  ? 0.8315 1.7481 0.8020 -0.0133 -0.0692 0.2607  72  PRO A O   
582  C CB  . PRO A 77  ? 0.8589 1.8145 0.8576 -0.0631 -0.0870 0.3830  72  PRO A CB  
583  C CG  . PRO A 77  ? 0.8834 1.8905 0.8926 -0.0734 -0.1058 0.4275  72  PRO A CG  
584  C CD  . PRO A 77  ? 0.8886 1.7859 0.9194 -0.0733 -0.1222 0.4195  72  PRO A CD  
585  N N   . GLU A 78  ? 0.8006 1.6442 0.7661 -0.0081 -0.0492 0.2184  73  GLU A N   
586  C CA  . GLU A 78  ? 0.7826 1.6490 0.7329 0.0165  -0.0396 0.1581  73  GLU A CA  
587  C C   . GLU A 78  ? 0.7611 1.6658 0.6983 0.0288  -0.0286 0.1279  73  GLU A C   
588  O O   . GLU A 78  ? 0.7521 1.6013 0.6942 0.0225  -0.0225 0.1266  73  GLU A O   
589  C CB  . GLU A 78  ? 0.7764 1.5459 0.7373 0.0230  -0.0390 0.1203  73  GLU A CB  
590  C CG  . GLU A 78  ? 0.7864 1.5683 0.7413 0.0449  -0.0357 0.0612  73  GLU A CG  
591  C CD  . GLU A 78  ? 0.7923 1.4903 0.7624 0.0463  -0.0373 0.0348  73  GLU A CD  
592  O OE1 . GLU A 78  ? 0.7966 1.4860 0.7729 0.0445  -0.0441 0.0437  73  GLU A OE1 
593  O OE2 . GLU A 78  ? 0.7928 1.4392 0.7699 0.0487  -0.0325 0.0076  73  GLU A OE2 
594  N N   . PRO A 79  ? 0.7538 1.7561 0.6755 0.0495  -0.0279 0.0993  74  PRO A N   
595  C CA  . PRO A 79  ? 0.7381 1.7953 0.6483 0.0661  -0.0215 0.0681  74  PRO A CA  
596  C C   . PRO A 79  ? 0.7114 1.6784 0.6298 0.0760  -0.0187 0.0179  74  PRO A C   
597  O O   . PRO A 79  ? 0.7063 1.6806 0.6214 0.0794  -0.0131 0.0084  74  PRO A O   
598  C CB  . PRO A 79  ? 0.7529 1.9256 0.6491 0.0928  -0.0271 0.0354  74  PRO A CB  
599  C CG  . PRO A 79  ? 0.7667 1.9686 0.6635 0.0816  -0.0335 0.0743  74  PRO A CG  
600  C CD  . PRO A 79  ? 0.7605 1.8310 0.6756 0.0620  -0.0354 0.0902  74  PRO A CD  
601  N N   . MET A 80  ? 0.6915 1.5794 0.6227 0.0791  -0.0237 -0.0104 75  MET A N   
602  C CA  . MET A 80  ? 0.6685 1.4701 0.6133 0.0829  -0.0237 -0.0473 75  MET A CA  
603  C C   . MET A 80  ? 0.6422 1.3717 0.5921 0.0622  -0.0137 -0.0163 75  MET A C   
604  O O   . MET A 80  ? 0.6239 1.3266 0.5765 0.0656  -0.0103 -0.0352 75  MET A O   
605  C CB  . MET A 80  ? 0.6720 1.4136 0.6334 0.0855  -0.0324 -0.0729 75  MET A CB  
606  C CG  . MET A 80  ? 0.6809 1.3388 0.6616 0.0841  -0.0348 -0.1001 75  MET A CG  
607  S SD  . MET A 80  ? 0.7170 1.3163 0.7223 0.0821  -0.0464 -0.1195 75  MET A SD  
608  C CE  . MET A 80  ? 0.6879 1.1989 0.7147 0.0698  -0.0444 -0.1237 75  MET A CE  
609  N N   . MET A 81  ? 0.6291 1.3283 0.5827 0.0430  -0.0122 0.0285  76  MET A N   
610  C CA  . MET A 81  ? 0.6177 1.2570 0.5781 0.0255  -0.0073 0.0591  76  MET A CA  
611  C C   . MET A 81  ? 0.6081 1.2957 0.5598 0.0199  -0.0025 0.0824  76  MET A C   
612  O O   . MET A 81  ? 0.5944 1.2389 0.5491 0.0151  0.0033  0.0810  76  MET A O   
613  C CB  . MET A 81  ? 0.6226 1.2310 0.5933 0.0106  -0.0149 0.0986  76  MET A CB  
614  C CG  . MET A 81  ? 0.6552 1.1909 0.6388 0.0122  -0.0169 0.0808  76  MET A CG  
615  S SD  . MET A 81  ? 0.7336 1.1869 0.7332 0.0004  -0.0201 0.1029  76  MET A SD  
616  C CE  . MET A 81  ? 0.6728 1.1332 0.6663 -0.0067 -0.0130 0.1157  76  MET A CE  
617  N N   . ALA A 82  ? 0.6039 1.3873 0.5458 0.0195  -0.0054 0.1070  77  ALA A N   
618  C CA  . ALA A 82  ? 0.6011 1.4492 0.5363 0.0129  -0.0014 0.1343  77  ALA A CA  
619  C C   . ALA A 82  ? 0.5898 1.4553 0.5156 0.0325  0.0064  0.0865  77  ALA A C   
620  O O   . ALA A 82  ? 0.5854 1.4370 0.5122 0.0254  0.0121  0.0968  77  ALA A O   
621  C CB  . ALA A 82  ? 0.6123 1.5791 0.5397 0.0094  -0.0064 0.1712  77  ALA A CB  
622  N N   . GLU A 83  ? 0.5852 1.4755 0.5058 0.0577  0.0032  0.0328  78  GLU A N   
623  C CA  . GLU A 83  ? 0.5824 1.4831 0.5008 0.0802  0.0029  -0.0196 78  GLU A CA  
624  C C   . GLU A 83  ? 0.5667 1.3535 0.4984 0.0715  0.0063  -0.0304 78  GLU A C   
625  O O   . GLU A 83  ? 0.5644 1.3478 0.4955 0.0765  0.0096  -0.0445 78  GLU A O   
626  C CB  . GLU A 83  ? 0.5898 1.5227 0.5095 0.1093  -0.0099 -0.0783 78  GLU A CB  
627  C CG  . GLU A 83  ? 0.6086 1.5236 0.5371 0.1327  -0.0190 -0.1374 78  GLU A CG  
628  C CD  . GLU A 83  ? 0.6528 1.6186 0.5869 0.1666  -0.0394 -0.1998 78  GLU A CD  
629  O OE1 . GLU A 83  ? 0.6948 1.7366 0.6243 0.1945  -0.0478 -0.2391 78  GLU A OE1 
630  O OE2 . GLU A 83  ? 0.6800 1.6125 0.6252 0.1677  -0.0496 -0.2128 78  GLU A OE2 
631  N N   . CYS A 84  ? 0.5530 1.2546 0.4970 0.0593  0.0052  -0.0229 79  CYS A N   
632  C CA  . CYS A 84  ? 0.5403 1.1462 0.4970 0.0505  0.0084  -0.0284 79  CYS A CA  
633  C C   . CYS A 84  ? 0.5261 1.1144 0.4799 0.0341  0.0175  0.0083  79  CYS A C   
634  O O   . CYS A 84  ? 0.5200 1.0827 0.4754 0.0359  0.0215  -0.0048 79  CYS A O   
635  C CB  . CYS A 84  ? 0.5356 1.0775 0.5048 0.0415  0.0057  -0.0227 79  CYS A CB  
636  S SG  . CYS A 84  ? 0.5483 0.9915 0.5327 0.0303  0.0107  -0.0232 79  CYS A SG  
637  N N   . LEU A 85  ? 0.5203 1.1215 0.4731 0.0182  0.0172  0.0544  80  LEU A N   
638  C CA  . LEU A 85  ? 0.5222 1.1014 0.4791 0.0010  0.0196  0.0920  80  LEU A CA  
639  C C   . LEU A 85  ? 0.5211 1.1669 0.4682 0.0031  0.0247  0.0973  80  LEU A C   
640  O O   . LEU A 85  ? 0.5189 1.1332 0.4693 -0.0041 0.0289  0.1054  80  LEU A O   
641  C CB  . LEU A 85  ? 0.5350 1.1104 0.5017 -0.0166 0.0094  0.1408  80  LEU A CB  
642  C CG  . LEU A 85  ? 0.5469 1.0350 0.5289 -0.0214 0.0030  0.1420  80  LEU A CG  
643  C CD1 . LEU A 85  ? 0.5614 0.9867 0.5524 -0.0279 0.0041  0.1462  80  LEU A CD1 
644  C CD2 . LEU A 85  ? 0.5397 0.9967 0.5206 -0.0078 0.0072  0.1003  80  LEU A CD2 
645  N N   . GLU A 86  ? 0.5324 1.2769 0.4675 0.0153  0.0241  0.0898  81  GLU A N   
646  C CA  . GLU A 86  ? 0.5369 1.3671 0.4615 0.0223  0.0290  0.0896  81  GLU A CA  
647  C C   . GLU A 86  ? 0.5221 1.3193 0.4458 0.0395  0.0329  0.0405  81  GLU A C   
648  O O   . GLU A 86  ? 0.5265 1.3236 0.4500 0.0332  0.0384  0.0524  81  GLU A O   
649  C CB  . GLU A 86  ? 0.5459 1.5038 0.4574 0.0366  0.0262  0.0869  81  GLU A CB  
650  C CG  . GLU A 86  ? 0.5839 1.6316 0.4829 0.0648  0.0280  0.0430  81  GLU A CG  
651  C CD  . GLU A 86  ? 0.6301 1.8057 0.5164 0.0850  0.0231  0.0300  81  GLU A CD  
652  O OE1 . GLU A 86  ? 0.6830 1.9772 0.5604 0.0802  0.0265  0.0667  81  GLU A OE1 
653  O OE2 . GLU A 86  ? 0.6335 1.7992 0.5200 0.1049  0.0146  -0.0136 81  GLU A OE2 
654  N N   . LYS A 87  ? 0.5105 1.2780 0.4376 0.0596  0.0269  -0.0120 82  LYS A N   
655  C CA  . LYS A 87  ? 0.5006 1.2361 0.4332 0.0758  0.0240  -0.0577 82  LYS A CA  
656  C C   . LYS A 87  ? 0.4803 1.1148 0.4230 0.0583  0.0301  -0.0435 82  LYS A C   
657  O O   . LYS A 87  ? 0.4834 1.1084 0.4267 0.0614  0.0328  -0.0533 82  LYS A O   
658  C CB  . LYS A 87  ? 0.5090 1.2287 0.4524 0.0983  0.0086  -0.1126 82  LYS A CB  
659  C CG  . LYS A 87  ? 0.5352 1.3512 0.4734 0.1311  -0.0033 -0.1595 82  LYS A CG  
660  C CD  . LYS A 87  ? 0.5584 1.3870 0.5057 0.1510  -0.0214 -0.2004 82  LYS A CD  
661  C CE  . LYS A 87  ? 0.6002 1.4997 0.5521 0.1906  -0.0421 -0.2653 82  LYS A CE  
662  N NZ  . LYS A 87  ? 0.6170 1.6515 0.5459 0.2068  -0.0342 -0.2629 82  LYS A NZ  
663  N N   . PHE A 88  ? 0.4605 1.0259 0.4110 0.0418  0.0315  -0.0217 83  PHE A N   
664  C CA  . PHE A 88  ? 0.4332 0.9126 0.3935 0.0303  0.0356  -0.0159 83  PHE A CA  
665  C C   . PHE A 88  ? 0.4261 0.8947 0.3839 0.0135  0.0428  0.0233  83  PHE A C   
666  O O   . PHE A 88  ? 0.4286 0.8562 0.3898 0.0111  0.0469  0.0188  83  PHE A O   
667  C CB  . PHE A 88  ? 0.4174 0.8357 0.3892 0.0243  0.0325  -0.0166 83  PHE A CB  
668  C CG  . PHE A 88  ? 0.4215 0.8285 0.4049 0.0373  0.0221  -0.0561 83  PHE A CG  
669  C CD1 . PHE A 88  ? 0.4114 0.8439 0.3986 0.0548  0.0127  -0.0933 83  PHE A CD1 
670  C CD2 . PHE A 88  ? 0.4345 0.8049 0.4297 0.0326  0.0178  -0.0569 83  PHE A CD2 
671  C CE1 . PHE A 88  ? 0.4211 0.8363 0.4275 0.0663  -0.0048 -0.1299 83  PHE A CE1 
672  C CE2 . PHE A 88  ? 0.4388 0.7969 0.4516 0.0414  0.0037  -0.0892 83  PHE A CE2 
673  C CZ  . PHE A 88  ? 0.4532 0.8300 0.4736 0.0577  -0.0096 -0.1254 83  PHE A CZ  
674  N N   . THR A 89  ? 0.4194 0.9219 0.3750 0.0011  0.0413  0.0631  84  THR A N   
675  C CA  . THR A 89  ? 0.4218 0.9087 0.3828 -0.0161 0.0416  0.1013  84  THR A CA  
676  C C   . THR A 89  ? 0.4133 0.9516 0.3669 -0.0132 0.0474  0.1005  84  THR A C   
677  O O   . THR A 89  ? 0.4037 0.9102 0.3627 -0.0230 0.0491  0.1157  84  THR A O   
678  C CB  . THR A 89  ? 0.4289 0.9382 0.3984 -0.0335 0.0312  0.1511  84  THR A CB  
679  O OG1 . THR A 89  ? 0.4671 1.0780 0.4277 -0.0327 0.0306  0.1672  84  THR A OG1 
680  C CG2 . THR A 89  ? 0.4419 0.9034 0.4199 -0.0344 0.0234  0.1509  84  THR A CG2 
681  N N   . VAL A 90  ? 0.4145 1.0366 0.3565 0.0024  0.0489  0.0804  85  VAL A N   
682  C CA  . VAL A 90  ? 0.4177 1.1008 0.3525 0.0102  0.0538  0.0729  85  VAL A CA  
683  C C   . VAL A 90  ? 0.4039 1.0209 0.3419 0.0214  0.0562  0.0329  85  VAL A C   
684  O O   . VAL A 90  ? 0.4080 1.0183 0.3466 0.0169  0.0606  0.0402  85  VAL A O   
685  C CB  . VAL A 90  ? 0.4298 1.2371 0.3516 0.0294  0.0526  0.0568  85  VAL A CB  
686  C CG1 . VAL A 90  ? 0.4357 1.3085 0.3505 0.0454  0.0563  0.0346  85  VAL A CG1 
687  C CG2 . VAL A 90  ? 0.4573 1.3425 0.3782 0.0115  0.0508  0.1125  85  VAL A CG2 
688  N N   . SER A 91  ? 0.4008 0.9661 0.3443 0.0330  0.0511  -0.0038 86  SER A N   
689  C CA  . SER A 91  ? 0.3844 0.8906 0.3365 0.0425  0.0483  -0.0391 86  SER A CA  
690  C C   . SER A 91  ? 0.3746 0.7972 0.3339 0.0248  0.0545  -0.0176 86  SER A C   
691  O O   . SER A 91  ? 0.3536 0.7499 0.3161 0.0271  0.0560  -0.0290 86  SER A O   
692  C CB  . SER A 91  ? 0.3881 0.8730 0.3506 0.0567  0.0360  -0.0773 86  SER A CB  
693  O OG  . SER A 91  ? 0.4026 0.8080 0.3815 0.0543  0.0308  -0.0927 86  SER A OG  
694  N N   . LEU A 92  ? 0.3744 0.7611 0.3368 0.0095  0.0562  0.0112  87  LEU A N   
695  C CA  . LEU A 92  ? 0.3807 0.7025 0.3495 -0.0035 0.0597  0.0298  87  LEU A CA  
696  C C   . LEU A 92  ? 0.3797 0.7212 0.3460 -0.0127 0.0626  0.0560  87  LEU A C   
697  O O   . LEU A 92  ? 0.3731 0.6762 0.3425 -0.0154 0.0658  0.0547  87  LEU A O   
698  C CB  . LEU A 92  ? 0.3819 0.6688 0.3574 -0.0122 0.0561  0.0482  87  LEU A CB  
699  C CG  . LEU A 92  ? 0.4055 0.6625 0.3875 -0.0070 0.0537  0.0285  87  LEU A CG  
700  C CD1 . LEU A 92  ? 0.4006 0.6496 0.3866 -0.0124 0.0487  0.0470  87  LEU A CD1 
701  C CD2 . LEU A 92  ? 0.3900 0.5956 0.3807 -0.0069 0.0562  0.0149  87  LEU A CD2 
702  N N   . ASN A 93  ? 0.3901 0.7952 0.3528 -0.0191 0.0603  0.0830  88  ASN A N   
703  C CA  . ASN A 93  ? 0.4060 0.8420 0.3705 -0.0302 0.0607  0.1124  88  ASN A CA  
704  C C   . ASN A 93  ? 0.4040 0.8666 0.3608 -0.0183 0.0678  0.0872  88  ASN A C   
705  O O   . ASN A 93  ? 0.4158 0.8679 0.3762 -0.0262 0.0697  0.1013  88  ASN A O   
706  C CB  . ASN A 93  ? 0.4202 0.9368 0.3857 -0.0414 0.0551  0.1519  88  ASN A CB  
707  C CG  . ASN A 93  ? 0.4550 0.9348 0.4380 -0.0609 0.0414  0.1931  88  ASN A CG  
708  O OD1 . ASN A 93  ? 0.4648 0.8675 0.4601 -0.0666 0.0356  0.1956  88  ASN A OD1 
709  N ND2 . ASN A 93  ? 0.4677 1.0037 0.4542 -0.0694 0.0332  0.2237  88  ASN A ND2 
710  N N   . HIS A 94  ? 0.4013 0.8982 0.3504 0.0023  0.0684  0.0477  89  HIS A N   
711  C CA  . HIS A 94  ? 0.3868 0.9073 0.3322 0.0188  0.0700  0.0154  89  HIS A CA  
712  C C   . HIS A 94  ? 0.3722 0.8075 0.3252 0.0161  0.0717  0.0042  89  HIS A C   
713  O O   . HIS A 94  ? 0.3625 0.8052 0.3146 0.0163  0.0751  0.0051  89  HIS A O   
714  C CB  . HIS A 94  ? 0.3970 0.9577 0.3399 0.0447  0.0622  -0.0317 89  HIS A CB  
715  C CG  . HIS A 94  ? 0.4219 0.9985 0.3670 0.0661  0.0569  -0.0729 89  HIS A CG  
716  N ND1 . HIS A 94  ? 0.4009 0.9061 0.3601 0.0757  0.0466  -0.1076 89  HIS A ND1 
717  C CD2 . HIS A 94  ? 0.4051 1.0632 0.3431 0.0797  0.0581  -0.0830 89  HIS A CD2 
718  C CE1 . HIS A 94  ? 0.4287 0.9630 0.3906 0.0952  0.0394  -0.1398 89  HIS A CE1 
719  N NE2 . HIS A 94  ? 0.4237 1.0530 0.3712 0.0997  0.0473  -0.1283 89  HIS A NE2 
720  N N   . LYS A 95  ? 0.3615 0.7239 0.3224 0.0129  0.0693  -0.0031 90  LYS A N   
721  C CA  . LYS A 95  ? 0.3577 0.6485 0.3267 0.0101  0.0702  -0.0112 90  LYS A CA  
722  C C   . LYS A 95  ? 0.3484 0.6164 0.3168 -0.0042 0.0763  0.0184  90  LYS A C   
723  O O   . LYS A 95  ? 0.3556 0.5970 0.3262 -0.0033 0.0786  0.0117  90  LYS A O   
724  C CB  . LYS A 95  ? 0.3570 0.5925 0.3354 0.0068  0.0669  -0.0158 90  LYS A CB  
725  C CG  . LYS A 95  ? 0.3559 0.6001 0.3422 0.0191  0.0562  -0.0457 90  LYS A CG  
726  C CD  . LYS A 95  ? 0.3347 0.6054 0.3258 0.0370  0.0460  -0.0801 90  LYS A CD  
727  C CE  . LYS A 95  ? 0.3441 0.6467 0.3424 0.0539  0.0305  -0.1123 90  LYS A CE  
728  N NZ  . LYS A 95  ? 0.3440 0.7214 0.3259 0.0596  0.0351  -0.1069 90  LYS A NZ  
729  N N   . LEU A 96  ? 0.3535 0.6322 0.3224 -0.0169 0.0753  0.0509  91  LEU A N   
730  C CA  . LEU A 96  ? 0.3600 0.6208 0.3349 -0.0307 0.0738  0.0806  91  LEU A CA  
731  C C   . LEU A 96  ? 0.3692 0.6800 0.3411 -0.0329 0.0764  0.0905  91  LEU A C   
732  O O   . LEU A 96  ? 0.3895 0.6741 0.3667 -0.0393 0.0763  0.1001  91  LEU A O   
733  C CB  . LEU A 96  ? 0.3552 0.6146 0.3396 -0.0438 0.0637  0.1136  91  LEU A CB  
734  C CG  . LEU A 96  ? 0.3773 0.5959 0.3644 -0.0393 0.0607  0.1021  91  LEU A CG  
735  C CD1 . LEU A 96  ? 0.3892 0.6083 0.3882 -0.0497 0.0469  0.1318  91  LEU A CD1 
736  C CD2 . LEU A 96  ? 0.3547 0.5113 0.3450 -0.0334 0.0636  0.0823  91  LEU A CD2 
737  N N   . ASP A 97  ? 0.3802 0.7698 0.3443 -0.0265 0.0781  0.0876  92  ASP A N   
738  C CA  . ASP A 97  ? 0.3929 0.8496 0.3536 -0.0258 0.0815  0.0950  92  ASP A CA  
739  C C   . ASP A 97  ? 0.3853 0.8200 0.3423 -0.0101 0.0857  0.0576  92  ASP A C   
740  O O   . ASP A 97  ? 0.3794 0.8161 0.3384 -0.0147 0.0882  0.0665  92  ASP A O   
741  C CB  . ASP A 97  ? 0.3990 0.9633 0.3513 -0.0186 0.0818  0.0978  92  ASP A CB  
742  C CG  . ASP A 97  ? 0.4394 1.0410 0.3992 -0.0396 0.0756  0.1486  92  ASP A CG  
743  O OD1 . ASP A 97  ? 0.4832 1.0226 0.4580 -0.0591 0.0678  0.1796  92  ASP A OD1 
744  O OD2 . ASP A 97  ? 0.4865 1.1815 0.4397 -0.0357 0.0756  0.1569  92  ASP A OD2 
745  N N   . SER A 98  ? 0.3954 0.8042 0.3509 0.0071  0.0834  0.0178  93  SER A N   
746  C CA  . SER A 98  ? 0.3980 0.7815 0.3562 0.0219  0.0812  -0.0171 93  SER A CA  
747  C C   . SER A 98  ? 0.4007 0.7057 0.3649 0.0094  0.0844  -0.0042 93  SER A C   
748  O O   . SER A 98  ? 0.4046 0.6962 0.3707 0.0137  0.0850  -0.0149 93  SER A O   
749  C CB  . SER A 98  ? 0.4020 0.7704 0.3659 0.0390  0.0708  -0.0556 93  SER A CB  
750  O OG  . SER A 98  ? 0.4292 0.7507 0.4045 0.0484  0.0626  -0.0831 93  SER A OG  
751  N N   . HIS A 99  ? 0.4008 0.6611 0.3682 -0.0045 0.0854  0.0180  94  HIS A N   
752  C CA  . HIS A 99  ? 0.3926 0.5901 0.3653 -0.0120 0.0870  0.0257  94  HIS A CA  
753  C C   . HIS A 99  ? 0.3931 0.5993 0.3670 -0.0223 0.0883  0.0498  94  HIS A C   
754  O O   . HIS A 99  ? 0.3947 0.5703 0.3706 -0.0222 0.0901  0.0458  94  HIS A O   
755  C CB  . HIS A 99  ? 0.3852 0.5416 0.3624 -0.0182 0.0850  0.0350  94  HIS A CB  
756  C CG  . HIS A 99  ? 0.4029 0.5072 0.3848 -0.0194 0.0862  0.0328  94  HIS A CG  
757  N ND1 . HIS A 99  ? 0.4421 0.5188 0.4285 -0.0174 0.0857  0.0248  94  HIS A ND1 
758  C CD2 . HIS A 99  ? 0.4256 0.5096 0.4090 -0.0219 0.0876  0.0383  94  HIS A CD2 
759  C CE1 . HIS A 99  ? 0.4437 0.4926 0.4329 -0.0179 0.0875  0.0261  94  HIS A CE1 
760  N NE2 . HIS A 99  ? 0.3989 0.4487 0.3857 -0.0197 0.0884  0.0323  94  HIS A NE2 
761  N N   . ALA A 100 ? 0.4003 0.6492 0.3762 -0.0328 0.0850  0.0780  95  ALA A N   
762  C CA  . ALA A 100 ? 0.4060 0.6755 0.3895 -0.0464 0.0815  0.1084  95  ALA A CA  
763  C C   . ALA A 100 ? 0.4078 0.7173 0.3852 -0.0388 0.0881  0.0957  95  ALA A C   
764  O O   . ALA A 100 ? 0.4162 0.7140 0.3997 -0.0460 0.0872  0.1076  95  ALA A O   
765  C CB  . ALA A 100 ? 0.3990 0.7211 0.3902 -0.0610 0.0736  0.1460  95  ALA A CB  
766  N N   . GLU A 101 ? 0.4075 0.7667 0.3749 -0.0224 0.0922  0.0688  96  GLU A N   
767  C CA  . GLU A 101 ? 0.4031 0.8008 0.3659 -0.0080 0.0954  0.0452  96  GLU A CA  
768  C C   . GLU A 101 ? 0.3880 0.7107 0.3537 -0.0020 0.0956  0.0227  96  GLU A C   
769  O O   . GLU A 101 ? 0.3696 0.6959 0.3363 -0.0004 0.0974  0.0202  96  GLU A O   
770  C CB  . GLU A 101 ? 0.4167 0.8790 0.3721 0.0141  0.0934  0.0121  96  GLU A CB  
771  C CG  . GLU A 101 ? 0.4641 0.9520 0.4185 0.0371  0.0904  -0.0277 96  GLU A CG  
772  C CD  . GLU A 101 ? 0.5376 1.0949 0.4888 0.0647  0.0823  -0.0683 96  GLU A CD  
773  O OE1 . GLU A 101 ? 0.5502 1.1394 0.4975 0.0658  0.0809  -0.0656 96  GLU A OE1 
774  O OE2 . GLU A 101 ? 0.5774 1.1574 0.5317 0.0876  0.0747  -0.1063 96  GLU A OE2 
775  N N   . LEU A 102 ? 0.3738 0.6335 0.3422 -0.0005 0.0933  0.0107  97  LEU A N   
776  C CA  . LEU A 102 ? 0.3691 0.5672 0.3424 0.0027  0.0922  -0.0038 97  LEU A CA  
777  C C   . LEU A 102 ? 0.3586 0.5230 0.3339 -0.0101 0.0957  0.0190  97  LEU A C   
778  O O   . LEU A 102 ? 0.3405 0.4855 0.3173 -0.0069 0.0965  0.0111  97  LEU A O   
779  C CB  . LEU A 102 ? 0.3666 0.5195 0.3455 0.0047  0.0877  -0.0154 97  LEU A CB  
780  C CG  . LEU A 102 ? 0.3517 0.4463 0.3377 0.0011  0.0871  -0.0153 97  LEU A CG  
781  C CD1 . LEU A 102 ? 0.3603 0.4465 0.3527 0.0096  0.0818  -0.0328 97  LEU A CD1 
782  C CD2 . LEU A 102 ? 0.3113 0.3766 0.3050 -0.0013 0.0832  -0.0164 97  LEU A CD2 
783  N N   . LEU A 103 ? 0.3711 0.5268 0.3493 -0.0229 0.0942  0.0451  98  LEU A N   
784  C CA  . LEU A 103 ? 0.3764 0.5026 0.3615 -0.0323 0.0911  0.0629  98  LEU A CA  
785  C C   . LEU A 103 ? 0.3842 0.5490 0.3715 -0.0372 0.0915  0.0748  98  LEU A C   
786  O O   . LEU A 103 ? 0.3787 0.5204 0.3692 -0.0382 0.0910  0.0747  98  LEU A O   
787  C CB  . LEU A 103 ? 0.3842 0.4952 0.3790 -0.0427 0.0815  0.0855  98  LEU A CB  
788  C CG  . LEU A 103 ? 0.3942 0.4699 0.3888 -0.0376 0.0798  0.0754  98  LEU A CG  
789  C CD1 . LEU A 103 ? 0.3937 0.4576 0.4020 -0.0457 0.0652  0.0963  98  LEU A CD1 
790  C CD2 . LEU A 103 ? 0.3719 0.4086 0.3646 -0.0294 0.0832  0.0582  98  LEU A CD2 
791  N N   . ASP A 104 ? 0.3947 0.6265 0.3802 -0.0396 0.0923  0.0855  99  ASP A N   
792  C CA  . ASP A 104 ? 0.4073 0.6956 0.3948 -0.0431 0.0938  0.0972  99  ASP A CA  
793  C C   . ASP A 104 ? 0.3992 0.6806 0.3801 -0.0277 0.0994  0.0664  99  ASP A C   
794  O O   . ASP A 104 ? 0.4009 0.6793 0.3866 -0.0327 0.0992  0.0750  99  ASP A O   
795  C CB  . ASP A 104 ? 0.4069 0.7889 0.3903 -0.0423 0.0957  0.1066  99  ASP A CB  
796  C CG  . ASP A 104 ? 0.4580 0.8639 0.4529 -0.0628 0.0873  0.1497  99  ASP A CG  
797  O OD1 . ASP A 104 ? 0.4873 0.8446 0.4988 -0.0796 0.0761  0.1763  99  ASP A OD1 
798  O OD2 . ASP A 104 ? 0.5349 1.0134 0.5249 -0.0615 0.0888  0.1573  99  ASP A OD2 
799  N N   . ALA A 105 ? 0.3953 0.6733 0.3690 -0.0093 0.1009  0.0313  100 ALA A N   
800  C CA  . ALA A 105 ? 0.3931 0.6635 0.3661 0.0070  0.1001  0.0004  100 ALA A CA  
801  C C   . ALA A 105 ? 0.3934 0.5914 0.3703 0.0016  0.1002  0.0028  100 ALA A C   
802  O O   . ALA A 105 ? 0.4105 0.6066 0.3888 0.0055  0.1004  -0.0037 100 ALA A O   
803  C CB  . ALA A 105 ? 0.3913 0.6630 0.3646 0.0260  0.0932  -0.0354 100 ALA A CB  
804  N N   . THR A 106 ? 0.3927 0.5397 0.3712 -0.0062 0.0997  0.0121  101 THR A N   
805  C CA  . THR A 106 ? 0.3787 0.4714 0.3599 -0.0090 0.0998  0.0139  101 THR A CA  
806  C C   . THR A 106 ? 0.3959 0.4887 0.3802 -0.0179 0.0997  0.0321  101 THR A C   
807  O O   . THR A 106 ? 0.3970 0.4707 0.3820 -0.0151 0.1003  0.0265  101 THR A O   
808  C CB  . THR A 106 ? 0.3658 0.4231 0.3482 -0.0131 0.0988  0.0195  101 THR A CB  
809  O OG1 . THR A 106 ? 0.3366 0.3928 0.3200 -0.0065 0.0968  0.0042  101 THR A OG1 
810  C CG2 . THR A 106 ? 0.3639 0.3821 0.3481 -0.0131 0.0990  0.0205  101 THR A CG2 
811  N N   . GLN A 107 ? 0.3878 0.5011 0.3773 -0.0297 0.0959  0.0558  102 GLN A N   
812  C CA  . GLN A 107 ? 0.4025 0.5212 0.4020 -0.0402 0.0905  0.0758  102 GLN A CA  
813  C C   . GLN A 107 ? 0.3951 0.5591 0.3920 -0.0368 0.0955  0.0716  102 GLN A C   
814  O O   . GLN A 107 ? 0.3800 0.5306 0.3816 -0.0387 0.0939  0.0737  102 GLN A O   
815  C CB  . GLN A 107 ? 0.4095 0.5468 0.4228 -0.0566 0.0796  0.1080  102 GLN A CB  
816  C CG  . GLN A 107 ? 0.4292 0.5773 0.4601 -0.0708 0.0687  0.1339  102 GLN A CG  
817  C CD  . GLN A 107 ? 0.4743 0.6163 0.5290 -0.0885 0.0485  0.1674  102 GLN A CD  
818  O OE1 . GLN A 107 ? 0.4537 0.6329 0.5114 -0.0970 0.0463  0.1869  102 GLN A OE1 
819  N NE2 . GLN A 107 ? 0.5285 0.6244 0.6037 -0.0935 0.0298  0.1740  102 GLN A NE2 
820  N N   . HIS A 108 ? 0.3929 0.6147 0.3831 -0.0291 0.1004  0.0620  103 HIS A N   
821  C CA  . HIS A 108 ? 0.4029 0.6761 0.3912 -0.0209 0.1037  0.0521  103 HIS A CA  
822  C C   . HIS A 108 ? 0.3883 0.6188 0.3740 -0.0077 0.1044  0.0250  103 HIS A C   
823  O O   . HIS A 108 ? 0.3672 0.6111 0.3558 -0.0081 0.1049  0.0272  103 HIS A O   
824  C CB  . HIS A 108 ? 0.4085 0.7639 0.3905 -0.0091 0.1061  0.0400  103 HIS A CB  
825  C CG  . HIS A 108 ? 0.4583 0.8672 0.4440 -0.0249 0.1051  0.0742  103 HIS A CG  
826  N ND1 . HIS A 108 ? 0.5021 0.9826 0.4809 -0.0153 0.1068  0.0664  103 HIS A ND1 
827  C CD2 . HIS A 108 ? 0.4729 0.8728 0.4722 -0.0496 0.0987  0.1174  103 HIS A CD2 
828  C CE1 . HIS A 108 ? 0.5294 1.0474 0.5155 -0.0356 0.1041  0.1080  103 HIS A CE1 
829  N NE2 . HIS A 108 ? 0.5029 0.9683 0.5037 -0.0573 0.0973  0.1399  103 HIS A NE2 
830  N N   . THR A 109 ? 0.3917 0.5725 0.3748 0.0016  0.1028  0.0041  104 THR A N   
831  C CA  . THR A 109 ? 0.3931 0.5358 0.3780 0.0111  0.1002  -0.0146 104 THR A CA  
832  C C   . THR A 109 ? 0.3862 0.4832 0.3728 0.0010  0.1016  0.0010  104 THR A C   
833  O O   . THR A 109 ? 0.3831 0.4669 0.3711 0.0057  0.1007  -0.0065 104 THR A O   
834  C CB  . THR A 109 ? 0.4034 0.5186 0.3923 0.0235  0.0926  -0.0393 104 THR A CB  
835  O OG1 . THR A 109 ? 0.4269 0.5184 0.4229 0.0325  0.0855  -0.0546 104 THR A OG1 
836  C CG2 . THR A 109 ? 0.3921 0.4617 0.3815 0.0145  0.0932  -0.0278 104 THR A CG2 
837  N N   . LEU A 110 ? 0.3785 0.4539 0.3662 -0.0103 0.1013  0.0197  105 LEU A N   
838  C CA  . LEU A 110 ? 0.3799 0.4220 0.3716 -0.0156 0.0985  0.0293  105 LEU A CA  
839  C C   . LEU A 110 ? 0.3862 0.4512 0.3844 -0.0216 0.0961  0.0402  105 LEU A C   
840  O O   . LEU A 110 ? 0.3890 0.4335 0.3888 -0.0193 0.0946  0.0366  105 LEU A O   
841  C CB  . LEU A 110 ? 0.3772 0.3980 0.3741 -0.0226 0.0923  0.0423  105 LEU A CB  
842  C CG  . LEU A 110 ? 0.3963 0.3881 0.3884 -0.0160 0.0937  0.0325  105 LEU A CG  
843  C CD1 . LEU A 110 ? 0.4244 0.4069 0.4227 -0.0200 0.0858  0.0415  105 LEU A CD1 
844  C CD2 . LEU A 110 ? 0.3604 0.3304 0.3502 -0.0086 0.0944  0.0239  105 LEU A CD2 
845  N N   . GLN A 111 ? 0.3790 0.4912 0.3823 -0.0305 0.0948  0.0568  106 GLN A N   
846  C CA  . GLN A 111 ? 0.3899 0.5382 0.4039 -0.0406 0.0911  0.0755  106 GLN A CA  
847  C C   . GLN A 111 ? 0.3849 0.5575 0.3922 -0.0283 0.0978  0.0563  106 GLN A C   
848  O O   . GLN A 111 ? 0.3911 0.5512 0.4038 -0.0302 0.0952  0.0584  106 GLN A O   
849  C CB  . GLN A 111 ? 0.3875 0.5964 0.4104 -0.0548 0.0877  0.1040  106 GLN A CB  
850  C CG  . GLN A 111 ? 0.4415 0.6198 0.4807 -0.0709 0.0732  0.1302  106 GLN A CG  
851  C CD  . GLN A 111 ? 0.4854 0.7219 0.5365 -0.0880 0.0669  0.1652  106 GLN A CD  
852  O OE1 . GLN A 111 ? 0.4709 0.7786 0.5125 -0.0849 0.0770  0.1663  106 GLN A OE1 
853  N NE2 . GLN A 111 ? 0.5281 0.7370 0.6028 -0.1048 0.0470  0.1935  106 GLN A NE2 
854  N N   . GLN A 112 ? 0.3822 0.5865 0.3802 -0.0135 0.1031  0.0338  107 GLN A N   
855  C CA  . GLN A 112 ? 0.3735 0.6136 0.3692 0.0018  0.1048  0.0117  107 GLN A CA  
856  C C   . GLN A 112 ? 0.3736 0.5551 0.3680 0.0122  0.1024  -0.0086 107 GLN A C   
857  O O   . GLN A 112 ? 0.3554 0.5493 0.3518 0.0197  0.1014  -0.0189 107 GLN A O   
858  C CB  . GLN A 112 ? 0.3620 0.6575 0.3527 0.0188  0.1048  -0.0117 107 GLN A CB  
859  C CG  . GLN A 112 ? 0.4093 0.7864 0.4008 0.0089  0.1081  0.0121  107 GLN A CG  
860  C CD  . GLN A 112 ? 0.4745 0.9178 0.4598 0.0291  0.1074  -0.0143 107 GLN A CD  
861  O OE1 . GLN A 112 ? 0.4995 0.9483 0.4838 0.0543  0.1015  -0.0549 107 GLN A OE1 
862  N NE2 . GLN A 112 ? 0.5060 1.0040 0.4900 0.0193  0.1099  0.0080  107 GLN A NE2 
863  N N   . GLN A 113 ? 0.3794 0.5036 0.3718 0.0121  0.1008  -0.0121 108 GLN A N   
864  C CA  . GLN A 113 ? 0.3990 0.4794 0.3928 0.0199  0.0970  -0.0254 108 GLN A CA  
865  C C   . GLN A 113 ? 0.4124 0.4553 0.4056 0.0110  0.0984  -0.0104 108 GLN A C   
866  O O   . GLN A 113 ? 0.4458 0.4769 0.4405 0.0150  0.0968  -0.0148 108 GLN A O   
867  C CB  . GLN A 113 ? 0.4135 0.4680 0.4105 0.0278  0.0904  -0.0400 108 GLN A CB  
868  C CG  . GLN A 113 ? 0.4473 0.5239 0.4527 0.0462  0.0789  -0.0695 108 GLN A CG  
869  C CD  . GLN A 113 ? 0.4781 0.6171 0.4798 0.0536  0.0807  -0.0800 108 GLN A CD  
870  O OE1 . GLN A 113 ? 0.5189 0.6679 0.5159 0.0469  0.0851  -0.0706 108 GLN A OE1 
871  N NE2 . GLN A 113 ? 0.4523 0.6416 0.4563 0.0687  0.0769  -0.0997 108 GLN A NE2 
872  N N   . ILE A 114 ? 0.4011 0.4283 0.3935 0.0016  0.0992  0.0041  109 ILE A N   
873  C CA  . ILE A 114 ? 0.3725 0.3673 0.3650 0.0000  0.0972  0.0093  109 ILE A CA  
874  C C   . ILE A 114 ? 0.3797 0.3792 0.3800 -0.0073 0.0918  0.0206  109 ILE A C   
875  O O   . ILE A 114 ? 0.3824 0.3709 0.3843 -0.0043 0.0892  0.0176  109 ILE A O   
876  C CB  . ILE A 114 ? 0.3769 0.3527 0.3669 -0.0008 0.0969  0.0120  109 ILE A CB  
877  C CG1 . ILE A 114 ? 0.3389 0.3113 0.3267 0.0034  0.0989  0.0047  109 ILE A CG1 
878  C CG2 . ILE A 114 ? 0.3468 0.3043 0.3371 0.0025  0.0929  0.0124  109 ILE A CG2 
879  C CD1 . ILE A 114 ? 0.3762 0.3341 0.3661 0.0083  0.0967  0.0014  109 ILE A CD1 
880  N N   . GLN A 115 ? 0.3836 0.4001 0.3921 -0.0181 0.0872  0.0359  110 GLN A N   
881  C CA  . GLN A 115 ? 0.3969 0.4184 0.4220 -0.0292 0.0756  0.0529  110 GLN A CA  
882  C C   . GLN A 115 ? 0.3946 0.4474 0.4229 -0.0314 0.0781  0.0560  110 GLN A C   
883  O O   . GLN A 115 ? 0.3816 0.4230 0.4207 -0.0347 0.0693  0.0603  110 GLN A O   
884  C CB  . GLN A 115 ? 0.3991 0.4386 0.4379 -0.0440 0.0667  0.0764  110 GLN A CB  
885  C CG  . GLN A 115 ? 0.4436 0.4773 0.5083 -0.0578 0.0466  0.0975  110 GLN A CG  
886  C CD  . GLN A 115 ? 0.5228 0.5671 0.6083 -0.0747 0.0311  0.1259  110 GLN A CD  
887  O OE1 . GLN A 115 ? 0.5575 0.6520 0.6423 -0.0850 0.0376  0.1451  110 GLN A OE1 
888  N NE2 . GLN A 115 ? 0.5972 0.5986 0.7045 -0.0768 0.0071  0.1285  110 GLN A NE2 
889  N N   . THR A 116 ? 0.3924 0.4884 0.4131 -0.0276 0.0878  0.0511  111 THR A N   
890  C CA  . THR A 116 ? 0.4179 0.5504 0.4400 -0.0242 0.0908  0.0473  111 THR A CA  
891  C C   . THR A 116 ? 0.4152 0.5111 0.4312 -0.0117 0.0919  0.0274  111 THR A C   
892  O O   . THR A 116 ? 0.4149 0.5183 0.4379 -0.0145 0.0887  0.0317  111 THR A O   
893  C CB  . THR A 116 ? 0.4139 0.6117 0.4302 -0.0168 0.0979  0.0394  111 THR A CB  
894  O OG1 . THR A 116 ? 0.4468 0.6942 0.4725 -0.0330 0.0956  0.0681  111 THR A OG1 
895  C CG2 . THR A 116 ? 0.4186 0.6574 0.4355 -0.0072 0.1001  0.0273  111 THR A CG2 
896  N N   . LEU A 117 ? 0.4113 0.4705 0.4173 -0.0008 0.0945  0.0107  112 LEU A N   
897  C CA  . LEU A 117 ? 0.4196 0.4471 0.4224 0.0076  0.0934  0.0003  112 LEU A CA  
898  C C   . LEU A 117 ? 0.4297 0.4381 0.4382 0.0024  0.0872  0.0087  112 LEU A C   
899  O O   . LEU A 117 ? 0.4378 0.4480 0.4489 0.0050  0.0853  0.0057  112 LEU A O   
900  C CB  . LEU A 117 ? 0.4169 0.4135 0.4133 0.0138  0.0941  -0.0066 112 LEU A CB  
901  C CG  . LEU A 117 ? 0.4458 0.4286 0.4424 0.0234  0.0912  -0.0171 112 LEU A CG  
902  C CD1 . LEU A 117 ? 0.3888 0.3475 0.3833 0.0232  0.0901  -0.0107 112 LEU A CD1 
903  C CD2 . LEU A 117 ? 0.4474 0.4343 0.4466 0.0285  0.0888  -0.0221 112 LEU A CD2 
904  N N   . VAL A 118 ? 0.4228 0.4143 0.4357 -0.0029 0.0812  0.0162  113 VAL A N   
905  C CA  . VAL A 118 ? 0.4380 0.4079 0.4590 -0.0016 0.0697  0.0153  113 VAL A CA  
906  C C   . VAL A 118 ? 0.4530 0.4332 0.4939 -0.0131 0.0571  0.0286  113 VAL A C   
907  O O   . VAL A 118 ? 0.4589 0.4256 0.5082 -0.0097 0.0465  0.0234  113 VAL A O   
908  C CB  . VAL A 118 ? 0.4424 0.3918 0.4634 0.0027  0.0631  0.0113  113 VAL A CB  
909  C CG1 . VAL A 118 ? 0.4526 0.4020 0.4897 -0.0093 0.0516  0.0258  113 VAL A CG1 
910  C CG2 . VAL A 118 ? 0.4611 0.3962 0.4844 0.0152  0.0526  -0.0026 113 VAL A CG2 
911  N N   . LYS A 119 ? 0.4535 0.4644 0.5040 -0.0272 0.0568  0.0475  114 LYS A N   
912  C CA  . LYS A 119 ? 0.4735 0.5058 0.5464 -0.0418 0.0446  0.0676  114 LYS A CA  
913  C C   . LYS A 119 ? 0.4648 0.5338 0.5310 -0.0387 0.0560  0.0639  114 LYS A C   
914  O O   . LYS A 119 ? 0.4732 0.5258 0.5353 -0.0292 0.0563  0.0496  114 LYS A O   
915  C CB  . LYS A 119 ? 0.4901 0.5472 0.5823 -0.0615 0.0346  0.0976  114 LYS A CB  
916  C CG  . LYS A 119 ? 0.5321 0.5441 0.6399 -0.0636 0.0142  0.0996  114 LYS A CG  
917  C CD  . LYS A 119 ? 0.5927 0.6274 0.7145 -0.0809 0.0072  0.1282  114 LYS A CD  
918  C CE  . LYS A 119 ? 0.6303 0.6203 0.7757 -0.0837 -0.0199 0.1318  114 LYS A CE  
919  N NZ  . LYS A 119 ? 0.7108 0.7248 0.8939 -0.1120 -0.0436 0.1769  114 LYS A NZ  
920  N N   . GLU A 120 ? 0.4463 0.5692 0.5102 -0.0434 0.0652  0.0734  115 GLU A N   
921  C CA  . GLU A 120 ? 0.4354 0.6055 0.4948 -0.0371 0.0740  0.0664  115 GLU A CA  
922  C C   . GLU A 120 ? 0.4119 0.5628 0.4518 -0.0144 0.0837  0.0332  115 GLU A C   
923  O O   . GLU A 120 ? 0.4087 0.5773 0.4493 -0.0077 0.0849  0.0246  115 GLU A O   
924  C CB  . GLU A 120 ? 0.4285 0.6753 0.4906 -0.0440 0.0795  0.0817  115 GLU A CB  
925  C CG  . GLU A 120 ? 0.4654 0.7435 0.5544 -0.0715 0.0659  0.1251  115 GLU A CG  
926  C CD  . GLU A 120 ? 0.5100 0.7939 0.6223 -0.0849 0.0531  0.1437  115 GLU A CD  
927  O OE1 . GLU A 120 ? 0.5108 0.7918 0.6535 -0.1088 0.0328  0.1790  115 GLU A OE1 
928  O OE2 . GLU A 120 ? 0.5126 0.8021 0.6162 -0.0718 0.0600  0.1235  115 GLU A OE2 
929  N N   . GLY A 121 ? 0.3863 0.5022 0.4129 -0.0041 0.0878  0.0177  116 GLY A N   
930  C CA  . GLY A 121 ? 0.3734 0.4706 0.3897 0.0135  0.0909  -0.0066 116 GLY A CA  
931  C C   . GLY A 121 ? 0.3680 0.4316 0.3843 0.0170  0.0873  -0.0102 116 GLY A C   
932  O O   . GLY A 121 ? 0.3623 0.4224 0.3761 0.0288  0.0866  -0.0245 116 GLY A O   
933  N N   . LEU A 122 ? 0.3448 0.3861 0.3663 0.0084  0.0817  0.0012  117 LEU A N   
934  C CA  . LEU A 122 ? 0.3472 0.3642 0.3684 0.0137  0.0770  -0.0042 117 LEU A CA  
935  C C   . LEU A 122 ? 0.3428 0.3781 0.3779 0.0070  0.0702  0.0030  117 LEU A C   
936  O O   . LEU A 122 ? 0.3374 0.3566 0.3741 0.0116  0.0647  -0.0026 117 LEU A O   
937  C CB  . LEU A 122 ? 0.3544 0.3410 0.3744 0.0147  0.0712  -0.0042 117 LEU A CB  
938  C CG  . LEU A 122 ? 0.3774 0.3485 0.3837 0.0232  0.0772  -0.0104 117 LEU A CG  
939  C CD1 . LEU A 122 ? 0.4245 0.3815 0.4319 0.0259  0.0698  -0.0124 117 LEU A CD1 
940  C CD2 . LEU A 122 ? 0.4014 0.3692 0.4008 0.0325  0.0794  -0.0164 117 LEU A CD2 
941  N N   . ARG A 123 ? 0.3415 0.4176 0.3877 -0.0043 0.0700  0.0169  118 ARG A N   
942  C CA  . ARG A 123 ? 0.3617 0.4615 0.4263 -0.0150 0.0614  0.0305  118 ARG A CA  
943  C C   . ARG A 123 ? 0.3580 0.4633 0.4170 -0.0028 0.0649  0.0150  118 ARG A C   
944  O O   . ARG A 123 ? 0.3636 0.4552 0.4325 -0.0051 0.0555  0.0167  118 ARG A O   
945  C CB  . ARG A 123 ? 0.3549 0.5165 0.4336 -0.0309 0.0614  0.0544  118 ARG A CB  
946  C CG  . ARG A 123 ? 0.3806 0.5770 0.4814 -0.0439 0.0521  0.0729  118 ARG A CG  
947  C CD  . ARG A 123 ? 0.4248 0.7002 0.5389 -0.0596 0.0536  0.1006  118 ARG A CD  
948  N NE  . ARG A 123 ? 0.4714 0.7417 0.5998 -0.0781 0.0437  0.1275  118 ARG A NE  
949  C CZ  . ARG A 123 ? 0.4885 0.7708 0.6513 -0.1048 0.0231  0.1663  118 ARG A CZ  
950  N NH1 . ARG A 123 ? 0.4881 0.7912 0.6756 -0.1178 0.0104  0.1845  118 ARG A NH1 
951  N NH2 . ARG A 123 ? 0.5150 0.7876 0.6910 -0.1194 0.0121  0.1888  118 ARG A NH2 
952  N N   . GLY A 124 ? 0.3545 0.4789 0.4007 0.0113  0.0748  -0.0016 119 GLY A N   
953  C CA  . GLY A 124 ? 0.3424 0.4706 0.3859 0.0243  0.0750  -0.0172 119 GLY A CA  
954  C C   . GLY A 124 ? 0.3382 0.4163 0.3764 0.0299  0.0706  -0.0233 119 GLY A C   
955  O O   . GLY A 124 ? 0.3315 0.4098 0.3741 0.0322  0.0663  -0.0257 119 GLY A O   
956  N N   . PHE A 125 ? 0.3403 0.3833 0.3691 0.0322  0.0714  -0.0247 120 PHE A N   
957  C CA  . PHE A 125 ? 0.3536 0.3654 0.3755 0.0393  0.0679  -0.0292 120 PHE A CA  
958  C C   . PHE A 125 ? 0.3685 0.3745 0.4007 0.0345  0.0578  -0.0261 120 PHE A C   
959  O O   . PHE A 125 ? 0.3800 0.3798 0.4109 0.0422  0.0532  -0.0333 120 PHE A O   
960  C CB  . PHE A 125 ? 0.3573 0.3483 0.3688 0.0420  0.0710  -0.0285 120 PHE A CB  
961  C CG  . PHE A 125 ? 0.3880 0.3662 0.3923 0.0497  0.0677  -0.0306 120 PHE A CG  
962  C CD1 . PHE A 125 ? 0.4326 0.4095 0.4304 0.0572  0.0686  -0.0295 120 PHE A CD1 
963  C CD2 . PHE A 125 ? 0.3931 0.3668 0.4002 0.0506  0.0607  -0.0336 120 PHE A CD2 
964  C CE1 . PHE A 125 ? 0.4193 0.4019 0.4098 0.0644  0.0664  -0.0281 120 PHE A CE1 
965  C CE2 . PHE A 125 ? 0.4310 0.4083 0.4306 0.0623  0.0570  -0.0402 120 PHE A CE2 
966  C CZ  . PHE A 125 ? 0.4345 0.4219 0.4239 0.0687  0.0620  -0.0358 120 PHE A CZ  
967  N N   . ARG A 126 ? 0.3796 0.3869 0.4251 0.0223  0.0507  -0.0156 121 ARG A N   
968  C CA  . ARG A 126 ? 0.3974 0.3922 0.4620 0.0174  0.0321  -0.0135 121 ARG A CA  
969  C C   . ARG A 126 ? 0.4030 0.4155 0.4854 0.0099  0.0237  -0.0070 121 ARG A C   
970  O O   . ARG A 126 ? 0.4082 0.4058 0.5043 0.0127  0.0069  -0.0135 121 ARG A O   
971  C CB  . ARG A 126 ? 0.4114 0.3976 0.4918 0.0051  0.0208  -0.0012 121 ARG A CB  
972  C CG  . ARG A 126 ? 0.4400 0.4044 0.5052 0.0167  0.0239  -0.0133 121 ARG A CG  
973  C CD  . ARG A 126 ? 0.5065 0.4542 0.5900 0.0101  0.0062  -0.0081 121 ARG A CD  
974  N NE  . ARG A 126 ? 0.5360 0.5002 0.6249 -0.0071 0.0122  0.0139  121 ARG A NE  
975  C CZ  . ARG A 126 ? 0.5337 0.4986 0.6104 -0.0074 0.0228  0.0165  121 ARG A CZ  
976  N NH1 . ARG A 126 ? 0.4860 0.4344 0.5458 0.0069  0.0283  0.0004  121 ARG A NH1 
977  N NH2 . ARG A 126 ? 0.4839 0.4747 0.5671 -0.0230 0.0271  0.0374  121 ARG A NH2 
978  N N   . GLU A 127 ? 0.3889 0.4387 0.4728 0.0022  0.0336  0.0038  122 GLU A N   
979  C CA  . GLU A 127 ? 0.4131 0.4928 0.5123 -0.0045 0.0289  0.0115  122 GLU A CA  
980  C C   . GLU A 127 ? 0.4009 0.4722 0.4862 0.0128  0.0338  -0.0086 122 GLU A C   
981  O O   . GLU A 127 ? 0.4056 0.4748 0.5034 0.0119  0.0227  -0.0097 122 GLU A O   
982  C CB  . GLU A 127 ? 0.3999 0.5394 0.5038 -0.0144 0.0385  0.0270  122 GLU A CB  
983  C CG  . GLU A 127 ? 0.4752 0.6386 0.6015 -0.0377 0.0292  0.0577  122 GLU A CG  
984  C CD  . GLU A 127 ? 0.5470 0.7883 0.6745 -0.0449 0.0408  0.0732  122 GLU A CD  
985  O OE1 . GLU A 127 ? 0.5665 0.8325 0.6722 -0.0263 0.0569  0.0512  122 GLU A OE1 
986  O OE2 . GLU A 127 ? 0.5745 0.8581 0.7281 -0.0686 0.0306  0.1080  122 GLU A OE2 
987  N N   . ALA A 128 ? 0.3906 0.4562 0.4538 0.0274  0.0470  -0.0225 123 ALA A N   
988  C CA  . ALA A 128 ? 0.3911 0.4481 0.4440 0.0424  0.0487  -0.0368 123 ALA A CA  
989  C C   . ALA A 128 ? 0.4018 0.4296 0.4510 0.0491  0.0404  -0.0433 123 ALA A C   
990  O O   . ALA A 128 ? 0.4022 0.4309 0.4525 0.0558  0.0355  -0.0500 123 ALA A O   
991  C CB  . ALA A 128 ? 0.3904 0.4437 0.4290 0.0542  0.0572  -0.0460 123 ALA A CB  
992  N N   . ARG A 129 ? 0.4123 0.4212 0.4577 0.0492  0.0377  -0.0435 124 ARG A N   
993  C CA  . ARG A 129 ? 0.4323 0.4272 0.4764 0.0594  0.0268  -0.0546 124 ARG A CA  
994  C C   . ARG A 129 ? 0.4503 0.4434 0.5176 0.0558  0.0074  -0.0583 124 ARG A C   
995  O O   . ARG A 129 ? 0.4632 0.4569 0.5296 0.0677  -0.0005 -0.0715 124 ARG A O   
996  C CB  . ARG A 129 ? 0.4407 0.4236 0.4809 0.0614  0.0246  -0.0567 124 ARG A CB  
997  C CG  . ARG A 129 ? 0.4543 0.4355 0.4924 0.0780  0.0119  -0.0747 124 ARG A CG  
998  C CD  . ARG A 129 ? 0.4768 0.4550 0.5080 0.0824  0.0128  -0.0776 124 ARG A CD  
999  N NE  . ARG A 129 ? 0.5984 0.5856 0.6310 0.1024  -0.0031 -0.1006 124 ARG A NE  
1000 C CZ  . ARG A 129 ? 0.6582 0.6556 0.6841 0.1141  -0.0054 -0.1108 124 ARG A CZ  
1001 N NH1 . ARG A 129 ? 0.6776 0.6713 0.6950 0.1049  0.0082  -0.0967 124 ARG A NH1 
1002 N NH2 . ARG A 129 ? 0.6397 0.6566 0.6678 0.1376  -0.0224 -0.1381 124 ARG A NH2 
1003 N N   . ARG A 130 ? 0.4550 0.4483 0.5460 0.0385  -0.0030 -0.0445 125 ARG A N   
1004 C CA  . ARG A 130 ? 0.4780 0.4669 0.6000 0.0309  -0.0277 -0.0428 125 ARG A CA  
1005 C C   . ARG A 130 ? 0.4627 0.4712 0.5844 0.0324  -0.0233 -0.0435 125 ARG A C   
1006 O O   . ARG A 130 ? 0.4647 0.4657 0.5956 0.0407  -0.0384 -0.0567 125 ARG A O   
1007 C CB  . ARG A 130 ? 0.4856 0.4762 0.6391 0.0070  -0.0427 -0.0179 125 ARG A CB  
1008 C CG  . ARG A 130 ? 0.5433 0.5489 0.7340 -0.0126 -0.0628 0.0021  125 ARG A CG  
1009 C CD  . ARG A 130 ? 0.6046 0.6626 0.7918 -0.0276 -0.0423 0.0262  125 ARG A CD  
1010 N NE  . ARG A 130 ? 0.6476 0.7324 0.8501 -0.0497 -0.0427 0.0571  125 ARG A NE  
1011 C CZ  . ARG A 130 ? 0.6357 0.7786 0.8321 -0.0589 -0.0242 0.0752  125 ARG A CZ  
1012 N NH1 . ARG A 130 ? 0.6443 0.8208 0.8210 -0.0467 -0.0050 0.0626  125 ARG A NH1 
1013 N NH2 . ARG A 130 ? 0.6399 0.8125 0.8512 -0.0787 -0.0268 0.1047  125 ARG A NH2 
1014 N N   . ASP A 131 ? 0.4437 0.4796 0.5547 0.0277  -0.0040 -0.0336 126 ASP A N   
1015 C CA  . ASP A 131 ? 0.4430 0.5018 0.5564 0.0297  -0.0013 -0.0350 126 ASP A CA  
1016 C C   . ASP A 131 ? 0.4436 0.4892 0.5374 0.0504  0.0019  -0.0553 126 ASP A C   
1017 O O   . ASP A 131 ? 0.4546 0.5072 0.5562 0.0538  -0.0056 -0.0607 126 ASP A O   
1018 C CB  . ASP A 131 ? 0.4338 0.5329 0.5426 0.0248  0.0150  -0.0255 126 ASP A CB  
1019 C CG  . ASP A 131 ? 0.4620 0.5920 0.5917 0.0030  0.0115  -0.0006 126 ASP A CG  
1020 O OD1 . ASP A 131 ? 0.4777 0.5964 0.6347 -0.0128 -0.0088 0.0146  126 ASP A OD1 
1021 O OD2 . ASP A 131 ? 0.4930 0.6607 0.6149 0.0023  0.0256  0.0041  126 ASP A OD2 
1022 N N   . PHE A 132 ? 0.4316 0.4625 0.5023 0.0626  0.0114  -0.0631 127 PHE A N   
1023 C CA  . PHE A 132 ? 0.4274 0.4550 0.4807 0.0799  0.0134  -0.0749 127 PHE A CA  
1024 C C   . PHE A 132 ? 0.4326 0.4552 0.4928 0.0894  -0.0038 -0.0894 127 PHE A C   
1025 O O   . PHE A 132 ? 0.4309 0.4624 0.4888 0.0992  -0.0080 -0.0979 127 PHE A O   
1026 C CB  . PHE A 132 ? 0.4199 0.4420 0.4522 0.0868  0.0250  -0.0723 127 PHE A CB  
1027 C CG  . PHE A 132 ? 0.4010 0.4308 0.4185 0.1016  0.0245  -0.0767 127 PHE A CG  
1028 C CD1 . PHE A 132 ? 0.4308 0.4675 0.4435 0.1065  0.0273  -0.0724 127 PHE A CD1 
1029 C CD2 . PHE A 132 ? 0.3919 0.4296 0.4019 0.1118  0.0195  -0.0844 127 PHE A CD2 
1030 C CE1 . PHE A 132 ? 0.4352 0.4874 0.4362 0.1178  0.0255  -0.0697 127 PHE A CE1 
1031 C CE2 . PHE A 132 ? 0.4126 0.4750 0.4086 0.1257  0.0194  -0.0852 127 PHE A CE2 
1032 C CZ  . PHE A 132 ? 0.3960 0.4661 0.3877 0.1268  0.0228  -0.0745 127 PHE A CZ  
1033 N N   . TRP A 133 ? 0.4366 0.4466 0.5063 0.0891  -0.0162 -0.0952 128 TRP A N   
1034 C CA  . TRP A 133 ? 0.4589 0.4652 0.5407 0.1030  -0.0398 -0.1171 128 TRP A CA  
1035 C C   . TRP A 133 ? 0.4605 0.4601 0.5745 0.0940  -0.0618 -0.1180 128 TRP A C   
1036 O O   . TRP A 133 ? 0.4672 0.4693 0.5887 0.1084  -0.0793 -0.1382 128 TRP A O   
1037 C CB  . TRP A 133 ? 0.4705 0.4665 0.5557 0.1106  -0.0515 -0.1291 128 TRP A CB  
1038 C CG  . TRP A 133 ? 0.4930 0.5072 0.5464 0.1229  -0.0319 -0.1297 128 TRP A CG  
1039 C CD1 . TRP A 133 ? 0.4902 0.4997 0.5325 0.1142  -0.0163 -0.1151 128 TRP A CD1 
1040 C CD2 . TRP A 133 ? 0.5033 0.5502 0.5347 0.1436  -0.0266 -0.1405 128 TRP A CD2 
1041 N NE1 . TRP A 133 ? 0.4793 0.5139 0.4968 0.1268  -0.0033 -0.1149 128 TRP A NE1 
1042 C CE2 . TRP A 133 ? 0.4964 0.5582 0.5067 0.1441  -0.0088 -0.1279 128 TRP A CE2 
1043 C CE3 . TRP A 133 ? 0.5198 0.5907 0.5485 0.1612  -0.0361 -0.1575 128 TRP A CE3 
1044 C CZ2 . TRP A 133 ? 0.5022 0.6070 0.4913 0.1591  -0.0011 -0.1268 128 TRP A CZ2 
1045 C CZ3 . TRP A 133 ? 0.5294 0.6455 0.5336 0.1785  -0.0270 -0.1592 128 TRP A CZ3 
1046 C CH2 . TRP A 133 ? 0.5382 0.6732 0.5239 0.1761  -0.0098 -0.1413 128 TRP A CH2 
1047 N N   . ARG A 134 ? 0.4550 0.4532 0.5897 0.0702  -0.0623 -0.0950 129 ARG A N   
1048 C CA  . ARG A 134 ? 0.4802 0.4836 0.6460 0.0580  -0.0801 -0.0878 129 ARG A CA  
1049 C C   . ARG A 134 ? 0.4579 0.4813 0.6059 0.0682  -0.0664 -0.0942 129 ARG A C   
1050 O O   . ARG A 134 ? 0.4874 0.5112 0.6494 0.0741  -0.0832 -0.1058 129 ARG A O   
1051 C CB  . ARG A 134 ? 0.4788 0.4953 0.6712 0.0283  -0.0822 -0.0548 129 ARG A CB  
1052 C CG  . ARG A 134 ? 0.5494 0.5759 0.7839 0.0108  -0.1075 -0.0405 129 ARG A CG  
1053 C CD  . ARG A 134 ? 0.6016 0.6655 0.8615 -0.0207 -0.1058 0.0003  129 ARG A CD  
1054 N NE  . ARG A 134 ? 0.6504 0.7168 0.9076 -0.0322 -0.0980 0.0181  129 ARG A NE  
1055 C CZ  . ARG A 134 ? 0.6672 0.7677 0.8980 -0.0335 -0.0678 0.0274  129 ARG A CZ  
1056 N NH1 . ARG A 134 ? 0.6831 0.8166 0.8902 -0.0229 -0.0445 0.0192  129 ARG A NH1 
1057 N NH2 . ARG A 134 ? 0.6661 0.7678 0.8963 -0.0432 -0.0638 0.0421  129 ARG A NH2 
1058 N N   . GLY A 135 ? 0.4317 0.4695 0.5513 0.0719  -0.0394 -0.0887 130 GLY A N   
1059 C CA  . GLY A 135 ? 0.4082 0.4607 0.5123 0.0838  -0.0298 -0.0955 130 GLY A CA  
1060 C C   . GLY A 135 ? 0.4104 0.4600 0.5022 0.1052  -0.0379 -0.1161 130 GLY A C   
1061 O O   . GLY A 135 ? 0.4165 0.4754 0.5134 0.1120  -0.0459 -0.1246 130 GLY A O   
1062 N N   . ALA A 136 ? 0.4107 0.4562 0.4858 0.1168  -0.0356 -0.1240 131 ALA A N   
1063 C CA  . ALA A 136 ? 0.4319 0.4918 0.4951 0.1396  -0.0444 -0.1445 131 ALA A CA  
1064 C C   . ALA A 136 ? 0.4554 0.5115 0.5442 0.1473  -0.0735 -0.1671 131 ALA A C   
1065 O O   . ALA A 136 ? 0.4624 0.5360 0.5474 0.1617  -0.0799 -0.1806 131 ALA A O   
1066 C CB  . ALA A 136 ? 0.4231 0.4907 0.4690 0.1503  -0.0398 -0.1493 131 ALA A CB  
1067 N N   . GLU A 137 ? 0.4623 0.4949 0.5806 0.1374  -0.0942 -0.1700 132 GLU A N   
1068 C CA  . GLU A 137 ? 0.4938 0.5150 0.6469 0.1431  -0.1305 -0.1912 132 GLU A CA  
1069 C C   . GLU A 137 ? 0.4928 0.5178 0.6635 0.1327  -0.1364 -0.1834 132 GLU A C   
1070 O O   . GLU A 137 ? 0.5033 0.5313 0.6885 0.1472  -0.1600 -0.2068 132 GLU A O   
1071 C CB  . GLU A 137 ? 0.5076 0.4976 0.6981 0.1283  -0.1566 -0.1869 132 GLU A CB  
1072 C CG  . GLU A 137 ? 0.5984 0.5712 0.8266 0.1437  -0.2034 -0.2193 132 GLU A CG  
1073 C CD  . GLU A 137 ? 0.6878 0.6689 0.9023 0.1759  -0.2141 -0.2563 132 GLU A CD  
1074 O OE1 . GLU A 137 ? 0.7210 0.7173 0.9012 0.1794  -0.1852 -0.2486 132 GLU A OE1 
1075 O OE2 . GLU A 137 ? 0.7623 0.7382 1.0030 0.1990  -0.2537 -0.2944 132 GLU A OE2 
1076 N N   . SER A 138 ? 0.4747 0.5050 0.6455 0.1097  -0.1168 -0.1532 133 SER A N   
1077 C CA  . SER A 138 ? 0.4747 0.5178 0.6626 0.0989  -0.1203 -0.1436 133 SER A CA  
1078 C C   . SER A 138 ? 0.4707 0.5327 0.6315 0.1195  -0.1085 -0.1583 133 SER A C   
1079 O O   . SER A 138 ? 0.4751 0.5435 0.6515 0.1228  -0.1235 -0.1672 133 SER A O   
1080 C CB  . SER A 138 ? 0.4560 0.5164 0.6478 0.0743  -0.1009 -0.1114 133 SER A CB  
1081 O OG  . SER A 138 ? 0.4847 0.5365 0.7014 0.0530  -0.1108 -0.0917 133 SER A OG  
1082 N N   . LEU A 139 ? 0.4666 0.5385 0.5901 0.1311  -0.0834 -0.1570 134 LEU A N   
1083 C CA  . LEU A 139 ? 0.4644 0.5569 0.5631 0.1497  -0.0744 -0.1653 134 LEU A CA  
1084 C C   . LEU A 139 ? 0.4910 0.5924 0.5944 0.1707  -0.0971 -0.1938 134 LEU A C   
1085 O O   . LEU A 139 ? 0.5157 0.6302 0.6234 0.1798  -0.1065 -0.2048 134 LEU A O   
1086 C CB  . LEU A 139 ? 0.4491 0.5503 0.5154 0.1579  -0.0539 -0.1571 134 LEU A CB  
1087 C CG  . LEU A 139 ? 0.4617 0.5778 0.5080 0.1626  -0.0384 -0.1443 134 LEU A CG  
1088 C CD1 . LEU A 139 ? 0.4577 0.5904 0.4793 0.1728  -0.0293 -0.1366 134 LEU A CD1 
1089 C CD2 . LEU A 139 ? 0.4160 0.5472 0.4659 0.1712  -0.0460 -0.1519 134 LEU A CD2 
1090 N N   . GLU A 140 ? 0.4909 0.5888 0.5938 0.1810  -0.1073 -0.2088 135 GLU A N   
1091 C CA  . GLU A 140 ? 0.5244 0.6423 0.6278 0.2088  -0.1295 -0.2434 135 GLU A CA  
1092 C C   . GLU A 140 ? 0.5304 0.6348 0.6712 0.2105  -0.1632 -0.2636 135 GLU A C   
1093 O O   . GLU A 140 ? 0.5436 0.6735 0.6799 0.2313  -0.1736 -0.2855 135 GLU A O   
1094 C CB  . GLU A 140 ? 0.5236 0.6422 0.6246 0.2207  -0.1375 -0.2590 135 GLU A CB  
1095 C CG  . GLU A 140 ? 0.6117 0.7799 0.6947 0.2573  -0.1475 -0.2930 135 GLU A CG  
1096 C CD  . GLU A 140 ? 0.6710 0.8937 0.7116 0.2670  -0.1179 -0.2757 135 GLU A CD  
1097 O OE1 . GLU A 140 ? 0.7178 0.9986 0.7416 0.2962  -0.1234 -0.2983 135 GLU A OE1 
1098 O OE2 . GLU A 140 ? 0.6551 0.8686 0.6823 0.2467  -0.0927 -0.2400 135 GLU A OE2 
1099 N N   . ALA A 141 ? 0.5254 0.5938 0.7049 0.1871  -0.1810 -0.2525 136 ALA A N   
1100 C CA  . ALA A 141 ? 0.5409 0.5943 0.7639 0.1803  -0.2146 -0.2608 136 ALA A CA  
1101 C C   . ALA A 141 ? 0.5217 0.5936 0.7380 0.1737  -0.2004 -0.2477 136 ALA A C   
1102 O O   . ALA A 141 ? 0.5362 0.6121 0.7723 0.1827  -0.2241 -0.2662 136 ALA A O   
1103 C CB  . ALA A 141 ? 0.5441 0.5624 0.8140 0.1501  -0.2369 -0.2391 136 ALA A CB  
1104 N N   . ALA A 142 ? 0.4920 0.5760 0.6819 0.1608  -0.1645 -0.2194 137 ALA A N   
1105 C CA  . ALA A 142 ? 0.4793 0.5825 0.6636 0.1581  -0.1530 -0.2105 137 ALA A CA  
1106 C C   . ALA A 142 ? 0.4890 0.6173 0.6458 0.1871  -0.1508 -0.2330 137 ALA A C   
1107 O O   . ALA A 142 ? 0.4796 0.6206 0.6432 0.1916  -0.1578 -0.2392 137 ALA A O   
1108 C CB  . ALA A 142 ? 0.4506 0.5620 0.6175 0.1424  -0.1213 -0.1816 137 ALA A CB  
1109 N N   . LEU A 143 ? 0.4931 0.6353 0.6207 0.2062  -0.1422 -0.2435 138 LEU A N   
1110 C CA  . LEU A 143 ? 0.5052 0.6872 0.6052 0.2333  -0.1392 -0.2592 138 LEU A CA  
1111 C C   . LEU A 143 ? 0.5303 0.7263 0.6485 0.2572  -0.1733 -0.2994 138 LEU A C   
1112 O O   . LEU A 143 ? 0.5229 0.7467 0.6346 0.2723  -0.1782 -0.3113 138 LEU A O   
1113 C CB  . LEU A 143 ? 0.4954 0.7018 0.5619 0.2444  -0.1208 -0.2529 138 LEU A CB  
1114 C CG  . LEU A 143 ? 0.4943 0.6973 0.5394 0.2283  -0.0905 -0.2157 138 LEU A CG  
1115 C CD1 . LEU A 143 ? 0.4803 0.6945 0.5048 0.2305  -0.0772 -0.2053 138 LEU A CD1 
1116 C CD2 . LEU A 143 ? 0.4721 0.7015 0.5016 0.2347  -0.0822 -0.2037 138 LEU A CD2 
1117 N N   . THR A 144 ? 0.5558 0.7328 0.6984 0.2625  -0.1995 -0.3222 139 THR A N   
1118 C CA  . THR A 144 ? 0.6098 0.7942 0.7781 0.2878  -0.2403 -0.3670 139 THR A CA  
1119 C C   . THR A 144 ? 0.6243 0.7840 0.8307 0.2726  -0.2620 -0.3652 139 THR A C   
1120 O O   . THR A 144 ? 0.6470 0.8292 0.8575 0.2928  -0.2793 -0.3910 139 THR A O   
1121 C CB  . THR A 144 ? 0.6279 0.7886 0.8221 0.2951  -0.2692 -0.3910 139 THR A CB  
1122 O OG1 . THR A 144 ? 0.6471 0.7542 0.8758 0.2588  -0.2750 -0.3616 139 THR A OG1 
1123 C CG2 . THR A 144 ? 0.6126 0.8031 0.7691 0.3087  -0.2458 -0.3905 139 THR A CG2 
1124 N N   . HIS A 145 ? 0.6199 0.7424 0.8529 0.2367  -0.2591 -0.3317 140 HIS A N   
1125 C CA  . HIS A 145 ? 0.6241 0.7326 0.8952 0.2172  -0.2771 -0.3211 140 HIS A CA  
1126 C C   . HIS A 145 ? 0.6115 0.7522 0.8566 0.2256  -0.2570 -0.3185 140 HIS A C   
1127 O O   . HIS A 145 ? 0.6300 0.7759 0.8973 0.2329  -0.2811 -0.3361 140 HIS A O   
1128 C CB  . HIS A 145 ? 0.6109 0.6967 0.9072 0.1764  -0.2688 -0.2774 140 HIS A CB  
1129 C CG  . HIS A 145 ? 0.6360 0.7194 0.9759 0.1543  -0.2891 -0.2622 140 HIS A CG  
1130 N ND1 . HIS A 145 ? 0.6681 0.7272 1.0651 0.1496  -0.3399 -0.2757 140 HIS A ND1 
1131 C CD2 . HIS A 145 ? 0.6102 0.7165 0.9476 0.1370  -0.2687 -0.2357 140 HIS A CD2 
1132 C CE1 . HIS A 145 ? 0.6768 0.7455 1.1049 0.1269  -0.3482 -0.2532 140 HIS A CE1 
1133 N NE2 . HIS A 145 ? 0.6546 0.7553 1.0453 0.1202  -0.3039 -0.2301 140 HIS A NE2 
1134 N N   . ASN A 146 ? 0.5843 0.7444 0.7859 0.2244  -0.2163 -0.2963 141 ASN A N   
1135 C CA  . ASN A 146 ? 0.5686 0.7586 0.7438 0.2340  -0.1978 -0.2917 141 ASN A CA  
1136 C C   . ASN A 146 ? 0.5977 0.8219 0.7591 0.2681  -0.2131 -0.3263 141 ASN A C   
1137 O O   . ASN A 146 ? 0.6041 0.8420 0.7745 0.2756  -0.2252 -0.3377 141 ASN A O   
1138 C CB  . ASN A 146 ? 0.5407 0.7404 0.6777 0.2290  -0.1600 -0.2637 141 ASN A CB  
1139 C CG  . ASN A 146 ? 0.5273 0.7511 0.6449 0.2354  -0.1455 -0.2540 141 ASN A CG  
1140 O OD1 . ASN A 146 ? 0.5007 0.7496 0.5866 0.2498  -0.1319 -0.2487 141 ASN A OD1 
1141 N ND2 . ASN A 146 ? 0.4690 0.6890 0.6084 0.2235  -0.1503 -0.2488 141 ASN A ND2 
1142 N N   . ALA A 147 ? 0.6144 0.8601 0.7544 0.2899  -0.2133 -0.3439 142 ALA A N   
1143 C CA  . ALA A 147 ? 0.6438 0.9412 0.7666 0.3264  -0.2261 -0.3778 142 ALA A CA  
1144 C C   . ALA A 147 ? 0.6863 0.9780 0.8473 0.3428  -0.2703 -0.4207 142 ALA A C   
1145 O O   . ALA A 147 ? 0.7022 1.0390 0.8532 0.3711  -0.2820 -0.4482 142 ALA A O   
1146 C CB  . ALA A 147 ? 0.6459 0.9751 0.7445 0.3460  -0.2208 -0.3896 142 ALA A CB  
1147 N N   . GLU A 148 ? 0.7133 0.9521 0.9211 0.3247  -0.2978 -0.4250 143 GLU A N   
1148 C CA  . GLU A 148 ? 0.7620 0.9832 1.0189 0.3364  -0.3492 -0.4638 143 GLU A CA  
1149 C C   . GLU A 148 ? 0.7726 0.9770 1.0607 0.3168  -0.3611 -0.4512 143 GLU A C   
1150 O O   . GLU A 148 ? 0.7957 0.9920 1.1232 0.3292  -0.4047 -0.4842 143 GLU A O   
1151 C CB  . GLU A 148 ? 0.7786 0.9504 1.0803 0.3255  -0.3822 -0.4721 143 GLU A CB  
1152 C CG  . GLU A 148 ? 0.8196 1.0119 1.1139 0.3629  -0.4025 -0.5178 143 GLU A CG  
1153 C CD  . GLU A 148 ? 0.8736 1.0148 1.2036 0.3477  -0.4248 -0.5146 143 GLU A CD  
1154 O OE1 . GLU A 148 ? 0.8874 0.9836 1.2426 0.3053  -0.4188 -0.4700 143 GLU A OE1 
1155 O OE2 . GLU A 148 ? 0.9133 1.0652 1.2469 0.3787  -0.4491 -0.5562 143 GLU A OE2 
1156 N N   . VAL A 149 ? 0.7635 0.9643 1.0383 0.2877  -0.3263 -0.4062 144 VAL A N   
1157 C CA  . VAL A 149 ? 0.7853 0.9778 1.0924 0.2693  -0.3386 -0.3943 144 VAL A CA  
1158 C C   . VAL A 149 ? 0.8100 1.0393 1.1038 0.2974  -0.3464 -0.4223 144 VAL A C   
1159 O O   . VAL A 149 ? 0.7997 1.0693 1.0447 0.3175  -0.3186 -0.4235 144 VAL A O   
1160 C CB  . VAL A 149 ? 0.7585 0.9423 1.0670 0.2310  -0.3078 -0.3433 144 VAL A CB  
1161 C CG1 . VAL A 149 ? 0.7640 0.9129 1.1123 0.1999  -0.3216 -0.3202 144 VAL A CG1 
1162 C CG2 . VAL A 149 ? 0.7301 0.9357 0.9833 0.2337  -0.2592 -0.3213 144 VAL A CG2 
1163 N N   . PRO A 150 ? 0.8494 1.0662 1.1906 0.2983  -0.3885 -0.4440 145 PRO A N   
1164 C CA  . PRO A 150 ? 0.8795 1.1276 1.2196 0.3276  -0.4083 -0.4799 145 PRO A CA  
1165 C C   . PRO A 150 ? 0.8734 1.1572 1.1766 0.3285  -0.3740 -0.4603 145 PRO A C   
1166 O O   . PRO A 150 ? 0.8449 1.1212 1.1396 0.3005  -0.3429 -0.4182 145 PRO A O   
1167 C CB  . PRO A 150 ? 0.9049 1.1169 1.3158 0.3123  -0.4595 -0.4900 145 PRO A CB  
1168 C CG  . PRO A 150 ? 0.9177 1.0848 1.3649 0.2940  -0.4812 -0.4824 145 PRO A CG  
1169 C CD  . PRO A 150 ? 0.8678 1.0376 1.2747 0.2710  -0.4278 -0.4362 145 PRO A CD  
1170 N N   . ARG A 151 ? 0.9086 1.2351 1.1930 0.3636  -0.3840 -0.4948 146 ARG A N   
1171 C CA  . ARG A 151 ? 0.9152 1.2838 1.1641 0.3735  -0.3592 -0.4844 146 ARG A CA  
1172 C C   . ARG A 151 ? 0.9038 1.2534 1.1675 0.3417  -0.3441 -0.4476 146 ARG A C   
1173 O O   . ARG A 151 ? 0.8840 1.2344 1.1205 0.3258  -0.3067 -0.4106 146 ARG A O   
1174 C CB  . ARG A 151 ? 0.9472 1.3575 1.1990 0.4118  -0.3908 -0.5335 146 ARG A CB  
1175 C CG  . ARG A 151 ? 0.9605 1.4248 1.1736 0.4278  -0.3693 -0.5262 146 ARG A CG  
1176 C CD  . ARG A 151 ? 0.9872 1.5137 1.1468 0.4541  -0.3461 -0.5258 146 ARG A CD  
1177 N NE  . ARG A 151 ? 0.9714 1.4891 1.0998 0.4304  -0.3032 -0.4736 146 ARG A NE  
1178 C CZ  . ARG A 151 ? 0.9709 1.5341 1.0584 0.4421  -0.2805 -0.4581 146 ARG A CZ  
1179 N NH1 . ARG A 151 ? 0.9869 1.6184 1.0561 0.4781  -0.2931 -0.4905 146 ARG A NH1 
1180 N NH2 . ARG A 151 ? 0.9462 1.4924 1.0140 0.4185  -0.2477 -0.4107 146 ARG A NH2 
1181 N N   . ARG A 152 ? 0.9272 1.2631 1.2367 0.3334  -0.3756 -0.4589 147 ARG A N   
1182 C CA  . ARG A 152 ? 0.9199 1.2533 1.2440 0.3068  -0.3628 -0.4271 147 ARG A CA  
1183 C C   . ARG A 152 ? 0.9096 1.2096 1.2804 0.2660  -0.3701 -0.3959 147 ARG A C   
1184 O O   . ARG A 152 ? 0.9117 1.2133 1.3203 0.2460  -0.3839 -0.3829 147 ARG A O   
1185 C CB  . ARG A 152 ? 0.9394 1.2960 1.2774 0.3224  -0.3851 -0.4504 147 ARG A CB  
1186 C CG  . ARG A 152 ? 0.9676 1.3713 1.2598 0.3627  -0.3783 -0.4775 147 ARG A CG  
1187 C CD  . ARG A 152 ? 0.9780 1.4069 1.2175 0.3633  -0.3325 -0.4447 147 ARG A CD  
1188 N NE  . ARG A 152 ? 0.9876 1.4123 1.1966 0.3624  -0.3089 -0.4294 147 ARG A NE  
1189 C CZ  . ARG A 152 ? 0.9711 1.4101 1.1404 0.3609  -0.2746 -0.3991 147 ARG A CZ  
1190 N NH1 . ARG A 152 ? 0.9574 1.3910 1.1055 0.3589  -0.2581 -0.3869 147 ARG A NH1 
1191 N NH2 . ARG A 152 ? 0.9437 1.4009 1.0980 0.3615  -0.2602 -0.3810 147 ARG A NH2 
1192 N N   . ARG A 153 ? 0.9004 1.1775 1.2686 0.2533  -0.3608 -0.3815 148 ARG A N   
1193 C CA  . ARG A 153 ? 0.8862 1.1447 1.2883 0.2136  -0.3582 -0.3429 148 ARG A CA  
1194 C C   . ARG A 153 ? 0.8474 1.1234 1.2109 0.2022  -0.3095 -0.3091 148 ARG A C   
1195 O O   . ARG A 153 ? 0.8332 1.0963 1.1851 0.1911  -0.2922 -0.2918 148 ARG A O   
1196 C CB  . ARG A 153 ? 0.9037 1.1257 1.3346 0.2053  -0.3838 -0.3474 148 ARG A CB  
1197 C CG  . ARG A 153 ? 0.9419 1.1378 1.4459 0.1907  -0.4409 -0.3555 148 ARG A CG  
1198 C CD  . ARG A 153 ? 0.9833 1.1420 1.5097 0.2019  -0.4764 -0.3823 148 ARG A CD  
1199 N NE  . ARG A 153 ? 1.0385 1.1694 1.6324 0.2047  -0.5421 -0.4101 148 ARG A NE  
1200 C CZ  . ARG A 153 ? 1.0771 1.2173 1.6768 0.2378  -0.5715 -0.4578 148 ARG A CZ  
1201 N NH1 . ARG A 153 ? 1.1129 1.2218 1.7821 0.2390  -0.6374 -0.4835 148 ARG A NH1 
1202 N NH2 . ARG A 153 ? 1.0684 1.2505 1.6088 0.2692  -0.5390 -0.4789 148 ARG A NH2 
1203 N N   . ALA A 154 ? 0.8307 1.1357 1.1772 0.2067  -0.2909 -0.3025 149 ALA A N   
1204 C CA  . ALA A 154 ? 0.8031 1.1254 1.1141 0.2040  -0.2507 -0.2794 149 ALA A CA  
1205 C C   . ALA A 154 ? 0.7806 1.1057 1.1078 0.1743  -0.2365 -0.2471 149 ALA A C   
1206 O O   . ALA A 154 ? 0.7606 1.0882 1.0575 0.1757  -0.2077 -0.2350 149 ALA A O   
1207 C CB  . ALA A 154 ? 0.7989 1.1510 1.1021 0.2130  -0.2429 -0.2803 149 ALA A CB  
1208 N N   . GLN A 155 ? 0.7832 1.1117 1.1612 0.1475  -0.2600 -0.2323 150 GLN A N   
1209 C CA  . GLN A 155 ? 0.7680 1.1092 1.1700 0.1161  -0.2535 -0.1980 150 GLN A CA  
1210 C C   . GLN A 155 ? 0.7644 1.0701 1.1578 0.1129  -0.2525 -0.1961 150 GLN A C   
1211 O O   . GLN A 155 ? 0.7469 1.0612 1.1195 0.1063  -0.2256 -0.1790 150 GLN A O   
1212 C CB  . GLN A 155 ? 0.7803 1.1413 1.2461 0.0852  -0.2850 -0.1760 150 GLN A CB  
1213 C CG  . GLN A 155 ? 0.7839 1.1511 1.2899 0.0483  -0.2952 -0.1376 150 GLN A CG  
1214 C CD  . GLN A 155 ? 0.7633 1.1794 1.2492 0.0365  -0.2577 -0.1092 150 GLN A CD  
1215 O OE1 . GLN A 155 ? 0.7520 1.1988 1.2017 0.0546  -0.2279 -0.1183 150 GLN A OE1 
1216 N NE2 . GLN A 155 ? 0.7617 1.1869 1.2737 0.0079  -0.2623 -0.0763 150 GLN A NE2 
1217 N N   . GLU A 156 ? 0.7794 1.0474 1.1905 0.1196  -0.2839 -0.2168 151 GLU A N   
1218 C CA  . GLU A 156 ? 0.7774 1.0127 1.1807 0.1201  -0.2851 -0.2193 151 GLU A CA  
1219 C C   . GLU A 156 ? 0.7530 0.9858 1.0947 0.1455  -0.2502 -0.2319 151 GLU A C   
1220 O O   . GLU A 156 ? 0.7423 0.9628 1.0692 0.1397  -0.2349 -0.2207 151 GLU A O   
1221 C CB  . GLU A 156 ? 0.8110 1.0099 1.2507 0.1271  -0.3319 -0.2454 151 GLU A CB  
1222 C CG  . GLU A 156 ? 0.8379 1.0202 1.3416 0.0911  -0.3657 -0.2171 151 GLU A CG  
1223 C CD  . GLU A 156 ? 0.8896 1.0247 1.4229 0.1007  -0.4088 -0.2435 151 GLU A CD  
1224 O OE1 . GLU A 156 ? 0.9334 1.0484 1.5277 0.0914  -0.4601 -0.2495 151 GLU A OE1 
1225 O OE2 . GLU A 156 ? 0.8905 1.0094 1.3894 0.1184  -0.3946 -0.2593 151 GLU A OE2 
1226 N N   . ALA A 157 ? 0.7441 0.9908 1.0535 0.1714  -0.2399 -0.2515 152 ALA A N   
1227 C CA  . ALA A 157 ? 0.7222 0.9746 0.9791 0.1910  -0.2089 -0.2538 152 ALA A CA  
1228 C C   . ALA A 157 ? 0.6973 0.9606 0.9418 0.1760  -0.1787 -0.2258 152 ALA A C   
1229 O O   . ALA A 157 ? 0.6918 0.9446 0.9101 0.1786  -0.1596 -0.2189 152 ALA A O   
1230 C CB  . ALA A 157 ? 0.7263 0.9995 0.9606 0.2161  -0.2077 -0.2712 152 ALA A CB  
1231 N N   . GLU A 158 ? 0.6794 0.9690 0.9444 0.1624  -0.1765 -0.2121 153 GLU A N   
1232 C CA  . GLU A 158 ? 0.6535 0.9662 0.9147 0.1499  -0.1533 -0.1906 153 GLU A CA  
1233 C C   . GLU A 158 ? 0.6318 0.9334 0.8997 0.1314  -0.1481 -0.1736 153 GLU A C   
1234 O O   . GLU A 158 ? 0.6164 0.9146 0.8584 0.1360  -0.1267 -0.1689 153 GLU A O   
1235 C CB  . GLU A 158 ? 0.6528 1.0100 0.9448 0.1356  -0.1576 -0.1785 153 GLU A CB  
1236 C CG  . GLU A 158 ? 0.6730 1.0571 0.9470 0.1537  -0.1444 -0.1871 153 GLU A CG  
1237 C CD  . GLU A 158 ? 0.6919 1.0973 0.9480 0.1583  -0.1209 -0.1810 153 GLU A CD  
1238 O OE1 . GLU A 158 ? 0.7067 1.1459 0.9620 0.1693  -0.1155 -0.1868 153 GLU A OE1 
1239 O OE2 . GLU A 158 ? 0.6958 1.0856 0.9404 0.1534  -0.1102 -0.1736 153 GLU A OE2 
1240 N N   . GLU A 159 ? 0.6276 0.9222 0.9342 0.1103  -0.1713 -0.1637 154 GLU A N   
1241 C CA  . GLU A 159 ? 0.6158 0.9025 0.9357 0.0896  -0.1708 -0.1434 154 GLU A CA  
1242 C C   . GLU A 159 ? 0.6050 0.8499 0.8972 0.1028  -0.1660 -0.1567 154 GLU A C   
1243 O O   . GLU A 159 ? 0.5910 0.8352 0.8695 0.0960  -0.1481 -0.1435 154 GLU A O   
1244 C CB  . GLU A 159 ? 0.6341 0.9229 1.0111 0.0608  -0.2040 -0.1241 154 GLU A CB  
1245 C CG  . GLU A 159 ? 0.6656 1.0155 1.0732 0.0363  -0.2018 -0.0932 154 GLU A CG  
1246 C CD  . GLU A 159 ? 0.7256 1.0827 1.1972 0.0010  -0.2378 -0.0624 154 GLU A CD  
1247 O OE1 . GLU A 159 ? 0.7567 1.0874 1.2607 0.0007  -0.2726 -0.0740 154 GLU A OE1 
1248 O OE2 . GLU A 159 ? 0.7277 1.1206 1.2203 -0.0268 -0.2338 -0.0250 154 GLU A OE2 
1249 N N   . ALA A 160 ? 0.6052 0.8227 0.8903 0.1227  -0.1828 -0.1837 155 ALA A N   
1250 C CA  . ALA A 160 ? 0.5913 0.7824 0.8485 0.1382  -0.1774 -0.1974 155 ALA A CA  
1251 C C   . ALA A 160 ? 0.5625 0.7623 0.7747 0.1492  -0.1426 -0.1913 155 ALA A C   
1252 O O   . ALA A 160 ? 0.5513 0.7384 0.7479 0.1466  -0.1295 -0.1839 155 ALA A O   
1253 C CB  . ALA A 160 ? 0.6014 0.7818 0.8548 0.1634  -0.1995 -0.2308 155 ALA A CB  
1254 N N   . GLY A 161 ? 0.5485 0.7681 0.7449 0.1605  -0.1317 -0.1935 156 GLY A N   
1255 C CA  . GLY A 161 ? 0.5330 0.7566 0.6957 0.1712  -0.1074 -0.1873 156 GLY A CA  
1256 C C   . GLY A 161 ? 0.5175 0.7463 0.6816 0.1567  -0.0905 -0.1696 156 GLY A C   
1257 O O   . GLY A 161 ? 0.5142 0.7314 0.6563 0.1614  -0.0762 -0.1648 156 GLY A O   
1258 N N   . ALA A 162 ? 0.5030 0.7563 0.6953 0.1390  -0.0938 -0.1590 157 ALA A N   
1259 C CA  . ALA A 162 ? 0.4791 0.7559 0.6732 0.1288  -0.0783 -0.1450 157 ALA A CA  
1260 C C   . ALA A 162 ? 0.4704 0.7297 0.6678 0.1141  -0.0768 -0.1333 157 ALA A C   
1261 O O   . ALA A 162 ? 0.4504 0.7107 0.6328 0.1148  -0.0613 -0.1285 157 ALA A O   
1262 C CB  . ALA A 162 ? 0.4754 0.8043 0.6980 0.1159  -0.0811 -0.1349 157 ALA A CB  
1263 N N   . ALA A 163 ? 0.4765 0.7172 0.6958 0.1024  -0.0965 -0.1310 158 ALA A N   
1264 C CA  . ALA A 163 ? 0.4676 0.6850 0.6917 0.0910  -0.0998 -0.1226 158 ALA A CA  
1265 C C   . ALA A 163 ? 0.4626 0.6498 0.6494 0.1097  -0.0870 -0.1355 158 ALA A C   
1266 O O   . ALA A 163 ? 0.4415 0.6197 0.6197 0.1035  -0.0765 -0.1266 158 ALA A O   
1267 C CB  . ALA A 163 ? 0.4841 0.6813 0.7441 0.0798  -0.1318 -0.1235 158 ALA A CB  
1268 N N   . LEU A 164 ? 0.4678 0.6464 0.6344 0.1312  -0.0885 -0.1534 159 LEU A N   
1269 C CA  . LEU A 164 ? 0.4764 0.6404 0.6101 0.1472  -0.0772 -0.1592 159 LEU A CA  
1270 C C   . LEU A 164 ? 0.4663 0.6345 0.5823 0.1475  -0.0563 -0.1474 159 LEU A C   
1271 O O   . LEU A 164 ? 0.4615 0.6160 0.5634 0.1467  -0.0467 -0.1414 159 LEU A O   
1272 C CB  . LEU A 164 ? 0.4843 0.6542 0.6013 0.1693  -0.0838 -0.1752 159 LEU A CB  
1273 C CG  . LEU A 164 ? 0.4897 0.6608 0.5743 0.1842  -0.0726 -0.1732 159 LEU A CG  
1274 C CD1 . LEU A 164 ? 0.4706 0.6299 0.5497 0.1829  -0.0725 -0.1751 159 LEU A CD1 
1275 C CD2 . LEU A 164 ? 0.4762 0.6702 0.5464 0.2046  -0.0798 -0.1840 159 LEU A CD2 
1276 N N   . ARG A 165 ? 0.4733 0.6604 0.5923 0.1507  -0.0525 -0.1469 160 ARG A N   
1277 C CA  . ARG A 165 ? 0.4820 0.6736 0.5911 0.1556  -0.0402 -0.1426 160 ARG A CA  
1278 C C   . ARG A 165 ? 0.4666 0.6624 0.5808 0.1429  -0.0311 -0.1342 160 ARG A C   
1279 O O   . ARG A 165 ? 0.4618 0.6440 0.5627 0.1476  -0.0233 -0.1321 160 ARG A O   
1280 C CB  . ARG A 165 ? 0.4907 0.7090 0.6095 0.1629  -0.0422 -0.1489 160 ARG A CB  
1281 C CG  . ARG A 165 ? 0.5570 0.7693 0.6663 0.1790  -0.0497 -0.1552 160 ARG A CG  
1282 C CD  . ARG A 165 ? 0.6381 0.8691 0.7541 0.1910  -0.0524 -0.1625 160 ARG A CD  
1283 N NE  . ARG A 165 ? 0.7400 0.9568 0.8446 0.2057  -0.0603 -0.1617 160 ARG A NE  
1284 C CZ  . ARG A 165 ? 0.7800 0.9767 0.8770 0.2143  -0.0637 -0.1543 160 ARG A CZ  
1285 N NH1 . ARG A 165 ? 0.8078 0.9990 0.8984 0.2239  -0.0734 -0.1466 160 ARG A NH1 
1286 N NH2 . ARG A 165 ? 0.7731 0.9572 0.8719 0.2128  -0.0606 -0.1526 160 ARG A NH2 
1287 N N   . THR A 166 ? 0.4536 0.6706 0.5897 0.1255  -0.0343 -0.1268 161 THR A N   
1288 C CA  . THR A 166 ? 0.4439 0.6759 0.5858 0.1123  -0.0258 -0.1153 161 THR A CA  
1289 C C   . THR A 166 ? 0.4478 0.6440 0.5811 0.1063  -0.0254 -0.1101 161 THR A C   
1290 O O   . THR A 166 ? 0.4417 0.6365 0.5674 0.1030  -0.0154 -0.1047 161 THR A O   
1291 C CB  . THR A 166 ? 0.4448 0.7272 0.6159 0.0934  -0.0294 -0.1009 161 THR A CB  
1292 O OG1 . THR A 166 ? 0.4485 0.7182 0.6427 0.0741  -0.0450 -0.0876 161 THR A OG1 
1293 C CG2 . THR A 166 ? 0.4281 0.7474 0.6084 0.1011  -0.0321 -0.1082 161 THR A CG2 
1294 N N   . ALA A 167 ? 0.4504 0.6212 0.5850 0.1078  -0.0378 -0.1154 162 ALA A N   
1295 C CA  . ALA A 167 ? 0.4576 0.5990 0.5837 0.1075  -0.0399 -0.1162 162 ALA A CA  
1296 C C   . ALA A 167 ? 0.4534 0.5804 0.5493 0.1216  -0.0263 -0.1187 162 ALA A C   
1297 O O   . ALA A 167 ? 0.4563 0.5701 0.5442 0.1176  -0.0199 -0.1132 162 ALA A O   
1298 C CB  . ALA A 167 ? 0.4615 0.5883 0.5977 0.1130  -0.0605 -0.1293 162 ALA A CB  
1299 N N   . ARG A 168 ? 0.4493 0.5798 0.5322 0.1362  -0.0247 -0.1238 163 ARG A N   
1300 C CA  . ARG A 168 ? 0.4471 0.5674 0.5093 0.1462  -0.0174 -0.1188 163 ARG A CA  
1301 C C   . ARG A 168 ? 0.4463 0.5627 0.5088 0.1426  -0.0086 -0.1126 163 ARG A C   
1302 O O   . ARG A 168 ? 0.4513 0.5521 0.5036 0.1421  -0.0038 -0.1050 163 ARG A O   
1303 C CB  . ARG A 168 ? 0.4538 0.5824 0.5097 0.1599  -0.0229 -0.1208 163 ARG A CB  
1304 C CG  . ARG A 168 ? 0.4595 0.5810 0.5021 0.1671  -0.0216 -0.1075 163 ARG A CG  
1305 C CD  . ARG A 168 ? 0.4864 0.6103 0.5134 0.1682  -0.0193 -0.0986 163 ARG A CD  
1306 N NE  . ARG A 168 ? 0.5175 0.6635 0.5379 0.1776  -0.0254 -0.1091 163 ARG A NE  
1307 C CZ  . ARG A 168 ? 0.5403 0.7059 0.5465 0.1845  -0.0254 -0.1075 163 ARG A CZ  
1308 N NH1 . ARG A 168 ? 0.5341 0.7267 0.5362 0.1983  -0.0343 -0.1248 163 ARG A NH1 
1309 N NH2 . ARG A 168 ? 0.5142 0.6785 0.5117 0.1796  -0.0181 -0.0906 163 ARG A NH2 
1310 N N   . ALA A 169 ? 0.4306 0.5668 0.5061 0.1421  -0.0082 -0.1179 164 ALA A N   
1311 C CA  . ALA A 169 ? 0.4265 0.5693 0.5049 0.1451  -0.0040 -0.1207 164 ALA A CA  
1312 C C   . ALA A 169 ? 0.4137 0.5581 0.4925 0.1322  0.0043  -0.1141 164 ALA A C   
1313 O O   . ALA A 169 ? 0.4079 0.5419 0.4817 0.1352  0.0074  -0.1144 164 ALA A O   
1314 C CB  . ALA A 169 ? 0.4117 0.5928 0.5047 0.1516  -0.0066 -0.1325 164 ALA A CB  
1315 N N   . GLY A 170 ? 0.3940 0.5493 0.4822 0.1174  0.0042  -0.1072 165 GLY A N   
1316 C CA  . GLY A 170 ? 0.3761 0.5320 0.4681 0.1027  0.0087  -0.0969 165 GLY A CA  
1317 C C   . GLY A 170 ? 0.3913 0.5100 0.4668 0.1051  0.0111  -0.0948 165 GLY A C   
1318 O O   . GLY A 170 ? 0.3948 0.5082 0.4646 0.1027  0.0180  -0.0913 165 GLY A O   
1319 N N   . TYR A 171 ? 0.3991 0.4995 0.4672 0.1111  0.0047  -0.0979 166 TYR A N   
1320 C CA  . TYR A 171 ? 0.4019 0.4820 0.4536 0.1162  0.0069  -0.0957 166 TYR A CA  
1321 C C   . TYR A 171 ? 0.4078 0.4790 0.4490 0.1208  0.0135  -0.0894 166 TYR A C   
1322 O O   . TYR A 171 ? 0.4139 0.4736 0.4484 0.1169  0.0184  -0.0831 166 TYR A O   
1323 C CB  . TYR A 171 ? 0.4158 0.4975 0.4595 0.1279  -0.0009 -0.1020 166 TYR A CB  
1324 C CG  . TYR A 171 ? 0.3991 0.4783 0.4260 0.1343  0.0013  -0.0985 166 TYR A CG  
1325 C CD1 . TYR A 171 ? 0.4376 0.5113 0.4653 0.1319  -0.0012 -0.1035 166 TYR A CD1 
1326 C CD2 . TYR A 171 ? 0.4243 0.5126 0.4378 0.1425  0.0034  -0.0881 166 TYR A CD2 
1327 C CE1 . TYR A 171 ? 0.4447 0.5276 0.4568 0.1400  0.0012  -0.1017 166 TYR A CE1 
1328 C CE2 . TYR A 171 ? 0.4368 0.5379 0.4365 0.1469  0.0056  -0.0801 166 TYR A CE2 
1329 C CZ  . TYR A 171 ? 0.4460 0.5472 0.4436 0.1469  0.0059  -0.0888 166 TYR A CZ  
1330 O OH  . TYR A 171 ? 0.4875 0.6119 0.4712 0.1531  0.0087  -0.0817 166 TYR A OH  
1331 N N   . ARG A 172 ? 0.4044 0.4791 0.4480 0.1294  0.0100  -0.0915 167 ARG A N   
1332 C CA  . ARG A 172 ? 0.4124 0.4730 0.4551 0.1341  0.0076  -0.0860 167 ARG A CA  
1333 C C   . ARG A 172 ? 0.4076 0.4698 0.4573 0.1314  0.0114  -0.0923 167 ARG A C   
1334 O O   . ARG A 172 ? 0.4045 0.4494 0.4528 0.1308  0.0102  -0.0867 167 ARG A O   
1335 C CB  . ARG A 172 ? 0.4153 0.4756 0.4651 0.1455  -0.0039 -0.0881 167 ARG A CB  
1336 C CG  . ARG A 172 ? 0.4275 0.4889 0.4683 0.1483  -0.0086 -0.0748 167 ARG A CG  
1337 C CD  . ARG A 172 ? 0.4283 0.4974 0.4760 0.1580  -0.0188 -0.0790 167 ARG A CD  
1338 N NE  . ARG A 172 ? 0.4369 0.5142 0.4763 0.1606  -0.0244 -0.0611 167 ARG A NE  
1339 C CZ  . ARG A 172 ? 0.4351 0.5205 0.4786 0.1683  -0.0348 -0.0578 167 ARG A CZ  
1340 N NH1 . ARG A 172 ? 0.4314 0.5142 0.4877 0.1754  -0.0410 -0.0740 167 ARG A NH1 
1341 N NH2 . ARG A 172 ? 0.4431 0.5473 0.4781 0.1696  -0.0390 -0.0377 167 ARG A NH2 
1342 N N   . GLY A 173 ? 0.3925 0.4825 0.4511 0.1302  0.0144  -0.1030 168 GLY A N   
1343 C CA  . GLY A 173 ? 0.3873 0.4978 0.4515 0.1282  0.0193  -0.1091 168 GLY A CA  
1344 C C   . GLY A 173 ? 0.3857 0.4831 0.4427 0.1153  0.0274  -0.0976 168 GLY A C   
1345 O O   . GLY A 173 ? 0.3898 0.4816 0.4457 0.1174  0.0284  -0.1000 168 GLY A O   
1346 N N   . ARG A 174 ? 0.3699 0.4614 0.4245 0.1040  0.0297  -0.0877 169 ARG A N   
1347 C CA  . ARG A 174 ? 0.3727 0.4510 0.4229 0.0935  0.0341  -0.0788 169 ARG A CA  
1348 C C   . ARG A 174 ? 0.3722 0.4221 0.4092 0.0982  0.0352  -0.0747 169 ARG A C   
1349 O O   . ARG A 174 ? 0.3692 0.4116 0.4028 0.0928  0.0398  -0.0702 169 ARG A O   
1350 C CB  . ARG A 174 ? 0.3559 0.4313 0.4128 0.0838  0.0287  -0.0738 169 ARG A CB  
1351 C CG  . ARG A 174 ? 0.3872 0.4921 0.4649 0.0713  0.0241  -0.0679 169 ARG A CG  
1352 C CD  . ARG A 174 ? 0.4423 0.5769 0.5284 0.0588  0.0303  -0.0565 169 ARG A CD  
1353 N NE  . ARG A 174 ? 0.4910 0.6625 0.6016 0.0418  0.0232  -0.0411 169 ARG A NE  
1354 C CZ  . ARG A 174 ? 0.4973 0.7151 0.6209 0.0276  0.0263  -0.0241 169 ARG A CZ  
1355 N NH1 . ARG A 174 ? 0.5039 0.7366 0.6159 0.0312  0.0374  -0.0260 169 ARG A NH1 
1356 N NH2 . ARG A 174 ? 0.4616 0.7173 0.6125 0.0087  0.0164  -0.0028 169 ARG A NH2 
1357 N N   . ALA A 175 ? 0.3784 0.4181 0.4093 0.1065  0.0303  -0.0727 170 ALA A N   
1358 C CA  . ALA A 175 ? 0.3763 0.4003 0.3991 0.1081  0.0294  -0.0612 170 ALA A CA  
1359 C C   . ALA A 175 ? 0.3779 0.3902 0.4085 0.1091  0.0260  -0.0613 170 ALA A C   
1360 O O   . ALA A 175 ? 0.3613 0.3618 0.3894 0.1045  0.0273  -0.0524 170 ALA A O   
1361 C CB  . ALA A 175 ? 0.3833 0.4107 0.4023 0.1152  0.0224  -0.0530 170 ALA A CB  
1362 N N   . LEU A 176 ? 0.3763 0.3944 0.4183 0.1173  0.0190  -0.0742 171 LEU A N   
1363 C CA  . LEU A 176 ? 0.4053 0.4157 0.4592 0.1239  0.0101  -0.0836 171 LEU A CA  
1364 C C   . LEU A 176 ? 0.4042 0.4276 0.4551 0.1184  0.0205  -0.0896 171 LEU A C   
1365 O O   . LEU A 176 ? 0.4140 0.4227 0.4685 0.1186  0.0161  -0.0893 171 LEU A O   
1366 C CB  . LEU A 176 ? 0.3966 0.4213 0.4645 0.1390  -0.0015 -0.1041 171 LEU A CB  
1367 C CG  . LEU A 176 ? 0.4351 0.4411 0.5146 0.1482  -0.0202 -0.1012 171 LEU A CG  
1368 C CD1 . LEU A 176 ? 0.4147 0.4434 0.5071 0.1654  -0.0298 -0.1277 171 LEU A CD1 
1369 C CD2 . LEU A 176 ? 0.4267 0.3973 0.5220 0.1488  -0.0407 -0.0902 171 LEU A CD2 
1370 N N   . ASP A 177 ? 0.3947 0.4476 0.4422 0.1121  0.0317  -0.0922 172 ASP A N   
1371 C CA  . ASP A 177 ? 0.3951 0.4681 0.4416 0.1045  0.0406  -0.0922 172 ASP A CA  
1372 C C   . ASP A 177 ? 0.3724 0.4173 0.4097 0.0944  0.0454  -0.0781 172 ASP A C   
1373 O O   . ASP A 177 ? 0.3660 0.4103 0.4029 0.0929  0.0474  -0.0793 172 ASP A O   
1374 C CB  . ASP A 177 ? 0.3884 0.4985 0.4388 0.0937  0.0476  -0.0864 172 ASP A CB  
1375 C CG  . ASP A 177 ? 0.4254 0.5779 0.4857 0.1028  0.0445  -0.0988 172 ASP A CG  
1376 O OD1 . ASP A 177 ? 0.4416 0.6044 0.5062 0.1209  0.0373  -0.1189 172 ASP A OD1 
1377 O OD2 . ASP A 177 ? 0.4684 0.6435 0.5351 0.0925  0.0461  -0.0890 172 ASP A OD2 
1378 N N   . TYR A 178 ? 0.3664 0.3943 0.3966 0.0896  0.0462  -0.0673 173 TYR A N   
1379 C CA  . TYR A 178 ? 0.3772 0.3863 0.3984 0.0839  0.0494  -0.0563 173 TYR A CA  
1380 C C   . TYR A 178 ? 0.3675 0.3582 0.3892 0.0870  0.0443  -0.0501 173 TYR A C   
1381 O O   . TYR A 178 ? 0.3815 0.3648 0.4014 0.0822  0.0473  -0.0458 173 TYR A O   
1382 C CB  . TYR A 178 ? 0.3685 0.3757 0.3831 0.0851  0.0479  -0.0521 173 TYR A CB  
1383 C CG  . TYR A 178 ? 0.3950 0.3981 0.4023 0.0815  0.0505  -0.0478 173 TYR A CG  
1384 C CD1 . TYR A 178 ? 0.3900 0.4002 0.3922 0.0878  0.0461  -0.0513 173 TYR A CD1 
1385 C CD2 . TYR A 178 ? 0.3925 0.3891 0.3991 0.0747  0.0552  -0.0442 173 TYR A CD2 
1386 C CE1 . TYR A 178 ? 0.3836 0.3961 0.3810 0.0898  0.0450  -0.0539 173 TYR A CE1 
1387 C CE2 . TYR A 178 ? 0.3809 0.3752 0.3823 0.0737  0.0555  -0.0430 173 TYR A CE2 
1388 C CZ  . TYR A 178 ? 0.4008 0.4038 0.3982 0.0824  0.0497  -0.0492 173 TYR A CZ  
1389 O OH  . TYR A 178 ? 0.3844 0.3909 0.3790 0.0865  0.0463  -0.0549 173 TYR A OH  
1390 N N   . ALA A 179 ? 0.3777 0.3607 0.4053 0.0935  0.0339  -0.0468 174 ALA A N   
1391 C CA  . ALA A 179 ? 0.3755 0.3393 0.4137 0.0939  0.0213  -0.0363 174 ALA A CA  
1392 C C   . ALA A 179 ? 0.3561 0.3135 0.4040 0.0967  0.0172  -0.0503 174 ALA A C   
1393 O O   . ALA A 179 ? 0.3576 0.3011 0.4093 0.0912  0.0137  -0.0407 174 ALA A O   
1394 C CB  . ALA A 179 ? 0.3889 0.3446 0.4408 0.1009  0.0040  -0.0321 174 ALA A CB  
1395 N N   . LEU A 180 ? 0.3374 0.3130 0.3897 0.1058  0.0174  -0.0731 175 LEU A N   
1396 C CA  . LEU A 180 ? 0.3575 0.3426 0.4174 0.1125  0.0137  -0.0914 175 LEU A CA  
1397 C C   . LEU A 180 ? 0.3515 0.3392 0.4004 0.1010  0.0273  -0.0828 175 LEU A C   
1398 O O   . LEU A 180 ? 0.3547 0.3304 0.4105 0.1024  0.0202  -0.0863 175 LEU A O   
1399 C CB  . LEU A 180 ? 0.3575 0.3841 0.4202 0.1242  0.0157  -0.1148 175 LEU A CB  
1400 C CG  . LEU A 180 ? 0.4133 0.4687 0.4844 0.1377  0.0099  -0.1401 175 LEU A CG  
1401 C CD1 . LEU A 180 ? 0.4727 0.4983 0.5660 0.1546  -0.0184 -0.1582 175 LEU A CD1 
1402 C CD2 . LEU A 180 ? 0.4415 0.5607 0.5136 0.1487  0.0150  -0.1594 175 LEU A CD2 
1403 N N   . GLN A 181 ? 0.3279 0.3287 0.3632 0.0900  0.0432  -0.0724 176 GLN A N   
1404 C CA  . GLN A 181 ? 0.3334 0.3386 0.3611 0.0797  0.0537  -0.0652 176 GLN A CA  
1405 C C   . GLN A 181 ? 0.3559 0.3329 0.3791 0.0737  0.0531  -0.0504 176 GLN A C   
1406 O O   . GLN A 181 ? 0.3587 0.3329 0.3802 0.0693  0.0564  -0.0484 176 GLN A O   
1407 C CB  . GLN A 181 ? 0.3217 0.3431 0.3442 0.0696  0.0629  -0.0572 176 GLN A CB  
1408 C CG  . GLN A 181 ? 0.3188 0.3823 0.3486 0.0694  0.0649  -0.0634 176 GLN A CG  
1409 C CD  . GLN A 181 ? 0.3706 0.4659 0.4033 0.0737  0.0666  -0.0729 176 GLN A CD  
1410 O OE1 . GLN A 181 ? 0.3809 0.5140 0.4200 0.0858  0.0632  -0.0891 176 GLN A OE1 
1411 N NE2 . GLN A 181 ? 0.3579 0.4450 0.3862 0.0663  0.0708  -0.0655 176 GLN A NE2 
1412 N N   . ILE A 182 ? 0.3798 0.3445 0.4012 0.0735  0.0493  -0.0385 177 ILE A N   
1413 C CA  . ILE A 182 ? 0.3896 0.3422 0.4100 0.0682  0.0466  -0.0199 177 ILE A CA  
1414 C C   . ILE A 182 ? 0.4100 0.3441 0.4475 0.0685  0.0321  -0.0182 177 ILE A C   
1415 O O   . ILE A 182 ? 0.4083 0.3365 0.4464 0.0616  0.0328  -0.0079 177 ILE A O   
1416 C CB  . ILE A 182 ? 0.3969 0.3566 0.4139 0.0690  0.0434  -0.0049 177 ILE A CB  
1417 C CG1 . ILE A 182 ? 0.4102 0.3874 0.4126 0.0710  0.0537  -0.0107 177 ILE A CG1 
1418 C CG2 . ILE A 182 ? 0.3934 0.3550 0.4148 0.0621  0.0374  0.0211  177 ILE A CG2 
1419 C CD1 . ILE A 182 ? 0.3884 0.3810 0.3869 0.0769  0.0503  -0.0059 177 ILE A CD1 
1420 N N   . ASN A 183 ? 0.4236 0.3482 0.4782 0.0777  0.0156  -0.0301 178 ASN A N   
1421 C CA  . ASN A 183 ? 0.4579 0.3616 0.5350 0.0811  -0.0049 -0.0354 178 ASN A CA  
1422 C C   . ASN A 183 ? 0.4546 0.3676 0.5275 0.0839  0.0021  -0.0537 178 ASN A C   
1423 O O   . ASN A 183 ? 0.4725 0.3700 0.5565 0.0806  -0.0076 -0.0497 178 ASN A O   
1424 C CB  . ASN A 183 ? 0.4789 0.3710 0.5801 0.0961  -0.0299 -0.0546 178 ASN A CB  
1425 C CG  . ASN A 183 ? 0.5277 0.4016 0.6449 0.0918  -0.0479 -0.0315 178 ASN A CG  
1426 O OD1 . ASN A 183 ? 0.5362 0.4239 0.6390 0.0886  -0.0362 -0.0194 178 ASN A OD1 
1427 N ND2 . ASN A 183 ? 0.5970 0.4408 0.7478 0.0920  -0.0803 -0.0248 178 ASN A ND2 
1428 N N   . VAL A 184 ? 0.4467 0.3894 0.5059 0.0890  0.0172  -0.0710 179 VAL A N   
1429 C CA  . VAL A 184 ? 0.4459 0.4097 0.5027 0.0930  0.0222  -0.0874 179 VAL A CA  
1430 C C   . VAL A 184 ? 0.4580 0.4117 0.5044 0.0785  0.0335  -0.0687 179 VAL A C   
1431 O O   . VAL A 184 ? 0.4705 0.4199 0.5230 0.0797  0.0280  -0.0746 179 VAL A O   
1432 C CB  . VAL A 184 ? 0.4429 0.4531 0.4891 0.0961  0.0365  -0.0986 179 VAL A CB  
1433 C CG1 . VAL A 184 ? 0.4232 0.4648 0.4627 0.0930  0.0467  -0.1022 179 VAL A CG1 
1434 C CG2 . VAL A 184 ? 0.3833 0.4164 0.4411 0.1146  0.0245  -0.1233 179 VAL A CG2 
1435 N N   . ILE A 185 ? 0.4552 0.4072 0.4875 0.0675  0.0469  -0.0495 180 ILE A N   
1436 C CA  . ILE A 185 ? 0.4750 0.4236 0.4968 0.0568  0.0574  -0.0352 180 ILE A CA  
1437 C C   . ILE A 185 ? 0.4901 0.4182 0.5204 0.0521  0.0482  -0.0204 180 ILE A C   
1438 O O   . ILE A 185 ? 0.4787 0.4051 0.5066 0.0464  0.0521  -0.0153 180 ILE A O   
1439 C CB  . ILE A 185 ? 0.4772 0.4323 0.4866 0.0519  0.0675  -0.0257 180 ILE A CB  
1440 C CG1 . ILE A 185 ? 0.5121 0.4859 0.5180 0.0486  0.0750  -0.0316 180 ILE A CG1 
1441 C CG2 . ILE A 185 ? 0.5094 0.4601 0.5115 0.0464  0.0714  -0.0110 180 ILE A CG2 
1442 C CD1 . ILE A 185 ? 0.5620 0.5503 0.5696 0.0462  0.0779  -0.0363 180 ILE A CD1 
1443 N N   . GLU A 186 ? 0.5073 0.4228 0.5509 0.0530  0.0339  -0.0105 181 GLU A N   
1444 C CA  . GLU A 186 ? 0.5451 0.4452 0.6058 0.0452  0.0191  0.0100  181 GLU A CA  
1445 C C   . GLU A 186 ? 0.5493 0.4331 0.6273 0.0486  0.0049  -0.0047 181 GLU A C   
1446 O O   . GLU A 186 ? 0.5377 0.4157 0.6217 0.0395  0.0021  0.0095  181 GLU A O   
1447 C CB  . GLU A 186 ? 0.5683 0.4592 0.6470 0.0441  0.0006  0.0265  181 GLU A CB  
1448 C CG  . GLU A 186 ? 0.6549 0.5369 0.7571 0.0307  -0.0181 0.0595  181 GLU A CG  
1449 C CD  . GLU A 186 ? 0.7439 0.6603 0.8334 0.0194  -0.0061 0.0939  181 GLU A CD  
1450 O OE1 . GLU A 186 ? 0.7676 0.6947 0.8649 0.0166  -0.0152 0.1144  181 GLU A OE1 
1451 O OE2 . GLU A 186 ? 0.7462 0.6847 0.8189 0.0150  0.0108  0.0996  181 GLU A OE2 
1452 N N   . ASP A 187 ? 0.5521 0.4361 0.6378 0.0637  -0.0041 -0.0353 182 ASP A N   
1453 C CA  . ASP A 187 ? 0.5637 0.4412 0.6665 0.0735  -0.0206 -0.0587 182 ASP A CA  
1454 C C   . ASP A 187 ? 0.5436 0.4431 0.6272 0.0716  -0.0010 -0.0664 182 ASP A C   
1455 O O   . ASP A 187 ? 0.5361 0.4265 0.6305 0.0712  -0.0107 -0.0704 182 ASP A O   
1456 C CB  . ASP A 187 ? 0.5756 0.4590 0.6945 0.0959  -0.0400 -0.0946 182 ASP A CB  
1457 C CG  . ASP A 187 ? 0.6388 0.4869 0.7918 0.0997  -0.0745 -0.0907 182 ASP A CG  
1458 O OD1 . ASP A 187 ? 0.6830 0.5081 0.8456 0.0817  -0.0807 -0.0536 182 ASP A OD1 
1459 O OD2 . ASP A 187 ? 0.6662 0.5140 0.8388 0.1211  -0.0978 -0.1233 182 ASP A OD2 
1460 N N   . LYS A 188 ? 0.5209 0.4489 0.5802 0.0697  0.0230  -0.0671 183 LYS A N   
1461 C CA  . LYS A 188 ? 0.5134 0.4634 0.5576 0.0649  0.0395  -0.0679 183 LYS A CA  
1462 C C   . LYS A 188 ? 0.5112 0.4419 0.5516 0.0511  0.0444  -0.0454 183 LYS A C   
1463 O O   . LYS A 188 ? 0.5242 0.4560 0.5652 0.0492  0.0447  -0.0476 183 LYS A O   
1464 C CB  . LYS A 188 ? 0.4880 0.4662 0.5146 0.0602  0.0583  -0.0632 183 LYS A CB  
1465 C CG  . LYS A 188 ? 0.5175 0.5335 0.5461 0.0717  0.0574  -0.0823 183 LYS A CG  
1466 C CD  . LYS A 188 ? 0.5524 0.6035 0.5699 0.0614  0.0732  -0.0704 183 LYS A CD  
1467 C CE  . LYS A 188 ? 0.6165 0.7260 0.6351 0.0693  0.0745  -0.0843 183 LYS A CE  
1468 N NZ  . LYS A 188 ? 0.6258 0.7349 0.6420 0.0671  0.0754  -0.0842 183 LYS A NZ  
1469 N N   . ARG A 189 ? 0.5107 0.4308 0.5470 0.0430  0.0482  -0.0244 184 ARG A N   
1470 C CA  . ARG A 189 ? 0.5266 0.4428 0.5586 0.0323  0.0535  -0.0040 184 ARG A CA  
1471 C C   . ARG A 189 ? 0.5386 0.4392 0.5896 0.0291  0.0382  -0.0003 184 ARG A C   
1472 O O   . ARG A 189 ? 0.5584 0.4625 0.6047 0.0243  0.0443  0.0025  184 ARG A O   
1473 C CB  . ARG A 189 ? 0.5259 0.4463 0.5546 0.0278  0.0553  0.0163  184 ARG A CB  
1474 C CG  . ARG A 189 ? 0.5985 0.5277 0.6275 0.0188  0.0569  0.0387  184 ARG A CG  
1475 C CD  . ARG A 189 ? 0.6720 0.6120 0.7101 0.0138  0.0486  0.0634  184 ARG A CD  
1476 N NE  . ARG A 189 ? 0.7092 0.6796 0.7278 0.0179  0.0621  0.0668  184 ARG A NE  
1477 C CZ  . ARG A 189 ? 0.7591 0.7543 0.7787 0.0170  0.0592  0.0855  184 ARG A CZ  
1478 N NH1 . ARG A 189 ? 0.7717 0.7600 0.8132 0.0088  0.0423  0.1079  184 ARG A NH1 
1479 N NH2 . ARG A 189 ? 0.8007 0.8295 0.8022 0.0255  0.0699  0.0811  184 ARG A NH2 
1480 N N   . LYS A 190 ? 0.5444 0.4258 0.6208 0.0317  0.0146  -0.0006 185 LYS A N   
1481 C CA  . LYS A 190 ? 0.5386 0.4018 0.6394 0.0263  -0.0052 0.0063  185 LYS A CA  
1482 C C   . LYS A 190 ? 0.5280 0.3913 0.6326 0.0383  -0.0110 -0.0253 185 LYS A C   
1483 O O   . LYS A 190 ? 0.5092 0.3695 0.6182 0.0328  -0.0128 -0.0214 185 LYS A O   
1484 C CB  . LYS A 190 ? 0.5573 0.3966 0.6930 0.0207  -0.0357 0.0248  185 LYS A CB  
1485 C CG  . LYS A 190 ? 0.6080 0.4368 0.7546 0.0323  -0.0501 0.0106  185 LYS A CG  
1486 C CD  . LYS A 190 ? 0.6689 0.4799 0.8475 0.0196  -0.0768 0.0451  185 LYS A CD  
1487 C CE  . LYS A 190 ? 0.7418 0.5243 0.9526 0.0332  -0.1109 0.0251  185 LYS A CE  
1488 N NZ  . LYS A 190 ? 0.7756 0.5232 1.0313 0.0365  -0.1524 0.0142  185 LYS A NZ  
1489 N N   . PHE A 191 ? 0.5178 0.3942 0.6190 0.0555  -0.0124 -0.0564 186 PHE A N   
1490 C CA  . PHE A 191 ? 0.5174 0.4086 0.6240 0.0713  -0.0212 -0.0900 186 PHE A CA  
1491 C C   . PHE A 191 ? 0.4922 0.4141 0.5730 0.0675  0.0039  -0.0902 186 PHE A C   
1492 O O   . PHE A 191 ? 0.4804 0.4095 0.5664 0.0727  -0.0025 -0.1041 186 PHE A O   
1493 C CB  . PHE A 191 ? 0.5284 0.4393 0.6415 0.0938  -0.0326 -0.1244 186 PHE A CB  
1494 C CG  . PHE A 191 ? 0.5716 0.4476 0.7173 0.1007  -0.0655 -0.1293 186 PHE A CG  
1495 C CD1 . PHE A 191 ? 0.5938 0.4803 0.7420 0.1147  -0.0710 -0.1460 186 PHE A CD1 
1496 C CD2 . PHE A 191 ? 0.6102 0.4431 0.7880 0.0908  -0.0933 -0.1124 186 PHE A CD2 
1497 C CE1 . PHE A 191 ? 0.6376 0.4878 0.8201 0.1210  -0.1057 -0.1491 186 PHE A CE1 
1498 C CE2 . PHE A 191 ? 0.6419 0.4393 0.8571 0.0938  -0.1295 -0.1102 186 PHE A CE2 
1499 C CZ  . PHE A 191 ? 0.6584 0.4625 0.8758 0.1099  -0.1363 -0.1299 186 PHE A CZ  
1500 N N   . ASP A 192 ? 0.4706 0.4098 0.5269 0.0587  0.0289  -0.0748 187 ASP A N   
1501 C CA  . ASP A 192 ? 0.4816 0.4468 0.5186 0.0528  0.0484  -0.0699 187 ASP A CA  
1502 C C   . ASP A 192 ? 0.4736 0.4204 0.5081 0.0398  0.0530  -0.0507 187 ASP A C   
1503 O O   . ASP A 192 ? 0.4759 0.4377 0.5049 0.0392  0.0580  -0.0545 187 ASP A O   
1504 C CB  . ASP A 192 ? 0.4737 0.4580 0.4942 0.0470  0.0656  -0.0590 187 ASP A CB  
1505 C CG  . ASP A 192 ? 0.5342 0.5547 0.5558 0.0590  0.0641  -0.0773 187 ASP A CG  
1506 O OD1 . ASP A 192 ? 0.5779 0.6103 0.6121 0.0763  0.0488  -0.1037 187 ASP A OD1 
1507 O OD2 . ASP A 192 ? 0.5487 0.5891 0.5613 0.0523  0.0756  -0.0661 187 ASP A OD2 
1508 N N   . ILE A 193 ? 0.4716 0.3946 0.5105 0.0302  0.0512  -0.0296 188 ILE A N   
1509 C CA  . ILE A 193 ? 0.4575 0.3731 0.4962 0.0193  0.0542  -0.0111 188 ILE A CA  
1510 C C   . ILE A 193 ? 0.4638 0.3657 0.5246 0.0205  0.0349  -0.0182 188 ILE A C   
1511 O O   . ILE A 193 ? 0.4725 0.3782 0.5310 0.0166  0.0384  -0.0164 188 ILE A O   
1512 C CB  . ILE A 193 ? 0.4634 0.3752 0.5030 0.0101  0.0558  0.0148  188 ILE A CB  
1513 C CG1 . ILE A 193 ? 0.4767 0.4035 0.4957 0.0111  0.0724  0.0185  188 ILE A CG1 
1514 C CG2 . ILE A 193 ? 0.4519 0.3675 0.4964 -0.0002 0.0557  0.0345  188 ILE A CG2 
1515 C CD1 . ILE A 193 ? 0.5224 0.4554 0.5314 0.0177  0.0789  0.0021  188 ILE A CD1 
1516 N N   . MET A 194 ? 0.4525 0.3367 0.5379 0.0269  0.0110  -0.0281 189 MET A N   
1517 C CA  . MET A 194 ? 0.4675 0.3350 0.5807 0.0304  -0.0146 -0.0395 189 MET A CA  
1518 C C   . MET A 194 ? 0.4639 0.3540 0.5692 0.0458  -0.0129 -0.0728 189 MET A C   
1519 O O   . MET A 194 ? 0.4538 0.3432 0.5649 0.0441  -0.0177 -0.0758 189 MET A O   
1520 C CB  . MET A 194 ? 0.4812 0.3206 0.6300 0.0362  -0.0488 -0.0459 189 MET A CB  
1521 C CG  . MET A 194 ? 0.5072 0.3257 0.6782 0.0163  -0.0619 -0.0053 189 MET A CG  
1522 S SD  . MET A 194 ? 0.5806 0.3567 0.8086 0.0207  -0.1155 -0.0098 189 MET A SD  
1523 C CE  . MET A 194 ? 0.5706 0.3527 0.7851 0.0305  -0.1077 -0.0166 189 MET A CE  
1524 N N   . GLU A 195 ? 0.4499 0.3677 0.5426 0.0607  -0.0062 -0.0960 190 GLU A N   
1525 C CA  . GLU A 195 ? 0.4525 0.4128 0.5332 0.0743  0.0002  -0.1217 190 GLU A CA  
1526 C C   . GLU A 195 ? 0.4083 0.3844 0.4658 0.0601  0.0249  -0.1012 190 GLU A C   
1527 O O   . GLU A 195 ? 0.4002 0.3939 0.4572 0.0645  0.0231  -0.1121 190 GLU A O   
1528 C CB  . GLU A 195 ? 0.4542 0.4551 0.5236 0.0881  0.0074  -0.1395 190 GLU A CB  
1529 C CG  . GLU A 195 ? 0.4908 0.5567 0.5450 0.0991  0.0185  -0.1567 190 GLU A CG  
1530 C CD  . GLU A 195 ? 0.5902 0.6804 0.6617 0.1250  -0.0059 -0.1989 190 GLU A CD  
1531 O OE1 . GLU A 195 ? 0.6602 0.7183 0.7587 0.1390  -0.0351 -0.2215 190 GLU A OE1 
1532 O OE2 . GLU A 195 ? 0.6309 0.7745 0.6918 0.1327  0.0008  -0.2105 190 GLU A OE2 
1533 N N   . PHE A 196 ? 0.3756 0.3452 0.4170 0.0450  0.0441  -0.0739 191 PHE A N   
1534 C CA  . PHE A 196 ? 0.3677 0.3446 0.3935 0.0331  0.0608  -0.0560 191 PHE A CA  
1535 C C   . PHE A 196 ? 0.3761 0.3339 0.4121 0.0278  0.0530  -0.0510 191 PHE A C   
1536 O O   . PHE A 196 ? 0.3607 0.3349 0.3910 0.0280  0.0570  -0.0548 191 PHE A O   
1537 C CB  . PHE A 196 ? 0.3444 0.3110 0.3585 0.0221  0.0744  -0.0334 191 PHE A CB  
1538 C CG  . PHE A 196 ? 0.3668 0.3311 0.3714 0.0122  0.0847  -0.0168 191 PHE A CG  
1539 C CD1 . PHE A 196 ? 0.3721 0.3583 0.3675 0.0095  0.0922  -0.0145 191 PHE A CD1 
1540 C CD2 . PHE A 196 ? 0.3267 0.2737 0.3331 0.0060  0.0851  -0.0020 191 PHE A CD2 
1541 C CE1 . PHE A 196 ? 0.3621 0.3424 0.3525 0.0023  0.0972  -0.0015 191 PHE A CE1 
1542 C CE2 . PHE A 196 ? 0.3736 0.3240 0.3720 0.0013  0.0926  0.0081  191 PHE A CE2 
1543 C CZ  . PHE A 196 ? 0.3286 0.2901 0.3200 0.0002  0.0973  0.0063  191 PHE A CZ  
1544 N N   . VAL A 197 ? 0.3745 0.3023 0.4280 0.0217  0.0404  -0.0395 192 VAL A N   
1545 C CA  . VAL A 197 ? 0.4009 0.3148 0.4679 0.0133  0.0318  -0.0286 192 VAL A CA  
1546 C C   . VAL A 197 ? 0.4159 0.3282 0.5023 0.0248  0.0102  -0.0553 192 VAL A C   
1547 O O   . VAL A 197 ? 0.4089 0.3252 0.4967 0.0225  0.0094  -0.0563 192 VAL A O   
1548 C CB  . VAL A 197 ? 0.4179 0.3116 0.5029 0.0007  0.0218  -0.0014 192 VAL A CB  
1549 C CG1 . VAL A 197 ? 0.4358 0.3186 0.5451 -0.0103 0.0058  0.0136  192 VAL A CG1 
1550 C CG2 . VAL A 197 ? 0.3958 0.3041 0.4587 -0.0061 0.0438  0.0190  192 VAL A CG2 
1551 N N   . LEU A 198 ? 0.4249 0.3350 0.5263 0.0401  -0.0087 -0.0808 193 LEU A N   
1552 C CA  . LEU A 198 ? 0.4563 0.3752 0.5751 0.0586  -0.0315 -0.1168 193 LEU A CA  
1553 C C   . LEU A 198 ? 0.4423 0.4081 0.5359 0.0664  -0.0130 -0.1308 193 LEU A C   
1554 O O   . LEU A 198 ? 0.4632 0.4366 0.5659 0.0736  -0.0249 -0.1474 193 LEU A O   
1555 C CB  . LEU A 198 ? 0.4624 0.3833 0.5977 0.0793  -0.0534 -0.1481 193 LEU A CB  
1556 C CG  . LEU A 198 ? 0.5229 0.4556 0.6826 0.1060  -0.0856 -0.1953 193 LEU A CG  
1557 C CD1 . LEU A 198 ? 0.5506 0.4421 0.7471 0.1005  -0.1175 -0.1944 193 LEU A CD1 
1558 C CD2 . LEU A 198 ? 0.5460 0.4754 0.7247 0.1261  -0.1091 -0.2232 193 LEU A CD2 
1559 N N   . ARG A 199 ? 0.4178 0.4154 0.4829 0.0631  0.0135  -0.1205 194 ARG A N   
1560 C CA  . ARG A 199 ? 0.4246 0.4745 0.4698 0.0681  0.0282  -0.1271 194 ARG A CA  
1561 C C   . ARG A 199 ? 0.4046 0.4475 0.4392 0.0521  0.0415  -0.1033 194 ARG A C   
1562 O O   . ARG A 199 ? 0.4011 0.4784 0.4288 0.0568  0.0442  -0.1110 194 ARG A O   
1563 C CB  . ARG A 199 ? 0.4248 0.5145 0.4516 0.0682  0.0456  -0.1204 194 ARG A CB  
1564 C CG  . ARG A 199 ? 0.4550 0.5919 0.4880 0.0931  0.0331  -0.1565 194 ARG A CG  
1565 C CD  . ARG A 199 ? 0.5501 0.7276 0.5695 0.0913  0.0483  -0.1464 194 ARG A CD  
1566 N NE  . ARG A 199 ? 0.6515 0.8676 0.6530 0.0746  0.0692  -0.1159 194 ARG A NE  
1567 C CZ  . ARG A 199 ? 0.6695 0.9510 0.6628 0.0735  0.0792  -0.1065 194 ARG A CZ  
1568 N NH1 . ARG A 199 ? 0.6816 1.0047 0.6784 0.0910  0.0737  -0.1292 194 ARG A NH1 
1569 N NH2 . ARG A 199 ? 0.6512 0.9596 0.6361 0.0543  0.0919  -0.0723 194 ARG A NH2 
1570 N N   . LEU A 200 ? 0.3893 0.3940 0.4232 0.0352  0.0487  -0.0759 195 LEU A N   
1571 C CA  . LEU A 200 ? 0.3788 0.3744 0.4075 0.0230  0.0568  -0.0574 195 LEU A CA  
1572 C C   . LEU A 200 ? 0.3760 0.3621 0.4235 0.0273  0.0387  -0.0710 195 LEU A C   
1573 O O   . LEU A 200 ? 0.3751 0.3776 0.4168 0.0273  0.0422  -0.0730 195 LEU A O   
1574 C CB  . LEU A 200 ? 0.3639 0.3318 0.3913 0.0094  0.0642  -0.0314 195 LEU A CB  
1575 C CG  . LEU A 200 ? 0.3919 0.3656 0.4037 0.0062  0.0785  -0.0201 195 LEU A CG  
1576 C CD1 . LEU A 200 ? 0.4081 0.3629 0.4208 -0.0015 0.0818  -0.0015 195 LEU A CD1 
1577 C CD2 . LEU A 200 ? 0.3632 0.3595 0.3609 0.0033  0.0892  -0.0140 195 LEU A CD2 
1578 N N   . VAL A 201 ? 0.3818 0.3404 0.4553 0.0306  0.0161  -0.0797 196 VAL A N   
1579 C CA  . VAL A 201 ? 0.4082 0.3515 0.5090 0.0346  -0.0095 -0.0937 196 VAL A CA  
1580 C C   . VAL A 201 ? 0.4139 0.3926 0.5135 0.0561  -0.0187 -0.1315 196 VAL A C   
1581 O O   . VAL A 201 ? 0.4039 0.3894 0.5071 0.0566  -0.0233 -0.1370 196 VAL A O   
1582 C CB  . VAL A 201 ? 0.4309 0.3344 0.5682 0.0317  -0.0391 -0.0910 196 VAL A CB  
1583 C CG1 . VAL A 201 ? 0.4681 0.3515 0.6429 0.0363  -0.0742 -0.1074 196 VAL A CG1 
1584 C CG2 . VAL A 201 ? 0.4640 0.3499 0.6019 0.0085  -0.0284 -0.0478 196 VAL A CG2 
1585 N N   . GLU A 202 ? 0.4162 0.4263 0.5100 0.0750  -0.0210 -0.1580 197 GLU A N   
1586 C CA  . GLU A 202 ? 0.4228 0.4882 0.5118 0.0986  -0.0274 -0.1948 197 GLU A CA  
1587 C C   . GLU A 202 ? 0.3919 0.4992 0.4539 0.0913  -0.0030 -0.1796 197 GLU A C   
1588 O O   . GLU A 202 ? 0.3930 0.5294 0.4574 0.1031  -0.0116 -0.2000 197 GLU A O   
1589 C CB  . GLU A 202 ? 0.4343 0.5436 0.5179 0.1196  -0.0292 -0.2212 197 GLU A CB  
1590 C CG  . GLU A 202 ? 0.5006 0.5756 0.6174 0.1354  -0.0633 -0.2495 197 GLU A CG  
1591 C CD  . GLU A 202 ? 0.6078 0.6728 0.7579 0.1556  -0.1021 -0.2889 197 GLU A CD  
1592 O OE1 . GLU A 202 ? 0.6319 0.7475 0.7726 0.1703  -0.1012 -0.3117 197 GLU A OE1 
1593 O OE2 . GLU A 202 ? 0.6596 0.6669 0.8488 0.1567  -0.1370 -0.2966 197 GLU A OE2 
1594 N N   . ALA A 203 ? 0.3700 0.4797 0.4094 0.0728  0.0239  -0.1446 198 ALA A N   
1595 C CA  . ALA A 203 ? 0.3703 0.5118 0.3893 0.0626  0.0432  -0.1238 198 ALA A CA  
1596 C C   . ALA A 203 ? 0.3772 0.4885 0.4028 0.0535  0.0396  -0.1153 198 ALA A C   
1597 O O   . ALA A 203 ? 0.3811 0.5267 0.3993 0.0567  0.0421  -0.1188 198 ALA A O   
1598 C CB  . ALA A 203 ? 0.3480 0.4840 0.3512 0.0447  0.0639  -0.0893 198 ALA A CB  
1599 N N   . GLN A 204 ? 0.3825 0.4381 0.4228 0.0421  0.0333  -0.1026 199 GLN A N   
1600 C CA  . GLN A 204 ? 0.3852 0.4176 0.4373 0.0342  0.0262  -0.0959 199 GLN A CA  
1601 C C   . GLN A 204 ? 0.4101 0.4540 0.4812 0.0505  0.0020  -0.1292 199 GLN A C   
1602 O O   . GLN A 204 ? 0.4017 0.4598 0.4693 0.0498  0.0033  -0.1299 199 GLN A O   
1603 C CB  . GLN A 204 ? 0.3960 0.3819 0.4650 0.0187  0.0210  -0.0733 199 GLN A CB  
1604 C CG  . GLN A 204 ? 0.3756 0.3543 0.4272 0.0052  0.0428  -0.0433 199 GLN A CG  
1605 C CD  . GLN A 204 ? 0.3988 0.3873 0.4344 -0.0029 0.0589  -0.0261 199 GLN A CD  
1606 O OE1 . GLN A 204 ? 0.4361 0.4278 0.4769 -0.0047 0.0550  -0.0268 199 GLN A OE1 
1607 N NE2 . GLN A 204 ? 0.3512 0.3431 0.3702 -0.0067 0.0741  -0.0122 199 GLN A NE2 
1608 N N   . ALA A 205 ? 0.4171 0.4558 0.5094 0.0670  -0.0224 -0.1592 200 ALA A N   
1609 C CA  . ALA A 205 ? 0.4481 0.4940 0.5655 0.0871  -0.0538 -0.1984 200 ALA A CA  
1610 C C   . ALA A 205 ? 0.4438 0.5597 0.5407 0.1062  -0.0465 -0.2236 200 ALA A C   
1611 O O   . ALA A 205 ? 0.4558 0.5810 0.5628 0.1141  -0.0605 -0.2411 200 ALA A O   
1612 C CB  . ALA A 205 ? 0.4557 0.4828 0.6032 0.1048  -0.0859 -0.2295 200 ALA A CB  
1613 N N   . THR A 206 ? 0.4327 0.6034 0.5025 0.1124  -0.0256 -0.2223 201 THR A N   
1614 C CA  . THR A 206 ? 0.4351 0.6875 0.4832 0.1253  -0.0148 -0.2333 201 THR A CA  
1615 C C   . THR A 206 ? 0.4162 0.6666 0.4512 0.1067  0.0011  -0.2035 201 THR A C   
1616 O O   . THR A 206 ? 0.4311 0.7238 0.4638 0.1184  -0.0046 -0.2205 201 THR A O   
1617 C CB  . THR A 206 ? 0.4189 0.7311 0.4430 0.1253  0.0070  -0.2198 201 THR A CB  
1618 O OG1 . THR A 206 ? 0.4478 0.7674 0.4839 0.1453  -0.0083 -0.2511 201 THR A OG1 
1619 C CG2 . THR A 206 ? 0.4235 0.8354 0.4285 0.1363  0.0163  -0.2243 201 THR A CG2 
1620 N N   . HIS A 207 ? 0.3949 0.5990 0.4225 0.0803  0.0189  -0.1621 202 HIS A N   
1621 C CA  . HIS A 207 ? 0.3900 0.5910 0.4060 0.0637  0.0331  -0.1335 202 HIS A CA  
1622 C C   . HIS A 207 ? 0.4034 0.5771 0.4378 0.0659  0.0162  -0.1473 202 HIS A C   
1623 O O   . HIS A 207 ? 0.4071 0.6131 0.4351 0.0696  0.0169  -0.1512 202 HIS A O   
1624 C CB  . HIS A 207 ? 0.3576 0.5153 0.3661 0.0407  0.0502  -0.0947 202 HIS A CB  
1625 C CG  . HIS A 207 ? 0.3637 0.5038 0.3682 0.0266  0.0578  -0.0717 202 HIS A CG  
1626 N ND1 . HIS A 207 ? 0.3678 0.5468 0.3595 0.0242  0.0652  -0.0601 202 HIS A ND1 
1627 C CD2 . HIS A 207 ? 0.3640 0.4582 0.3772 0.0149  0.0580  -0.0574 202 HIS A CD2 
1628 C CE1 . HIS A 207 ? 0.3188 0.4690 0.3117 0.0130  0.0687  -0.0428 202 HIS A CE1 
1629 N NE2 . HIS A 207 ? 0.3364 0.4393 0.3413 0.0081  0.0653  -0.0420 202 HIS A NE2 
1630 N N   . PHE A 208 ? 0.4206 0.5391 0.4809 0.0631  -0.0016 -0.1532 203 PHE A N   
1631 C CA  . PHE A 208 ? 0.4312 0.5173 0.5169 0.0597  -0.0215 -0.1587 203 PHE A CA  
1632 C C   . PHE A 208 ? 0.4603 0.5729 0.5638 0.0848  -0.0495 -0.2045 203 PHE A C   
1633 O O   . PHE A 208 ? 0.4642 0.5763 0.5783 0.0857  -0.0605 -0.2117 203 PHE A O   
1634 C CB  . PHE A 208 ? 0.4254 0.4522 0.5386 0.0445  -0.0346 -0.1414 203 PHE A CB  
1635 C CG  . PHE A 208 ? 0.4039 0.4126 0.5052 0.0212  -0.0120 -0.0994 203 PHE A CG  
1636 C CD1 . PHE A 208 ? 0.3982 0.4028 0.5034 0.0099  -0.0097 -0.0837 203 PHE A CD1 
1637 C CD2 . PHE A 208 ? 0.3733 0.3750 0.4590 0.0131  0.0063  -0.0786 203 PHE A CD2 
1638 C CE1 . PHE A 208 ? 0.3437 0.3423 0.4375 -0.0066 0.0099  -0.0506 203 PHE A CE1 
1639 C CE2 . PHE A 208 ? 0.3541 0.3476 0.4292 -0.0028 0.0244  -0.0469 203 PHE A CE2 
1640 C CZ  . PHE A 208 ? 0.3588 0.3530 0.4379 -0.0116 0.0259  -0.0340 203 PHE A CZ  
1641 N N   . GLN A 209 ? 0.4801 0.6217 0.5865 0.1080  -0.0621 -0.2385 204 GLN A N   
1642 C CA  . GLN A 209 ? 0.5109 0.6944 0.6301 0.1385  -0.0883 -0.2889 204 GLN A CA  
1643 C C   . GLN A 209 ? 0.4960 0.7573 0.5840 0.1464  -0.0685 -0.2905 204 GLN A C   
1644 O O   . GLN A 209 ? 0.5040 0.7853 0.6017 0.1599  -0.0851 -0.3158 204 GLN A O   
1645 C CB  . GLN A 209 ? 0.5360 0.7426 0.6647 0.1649  -0.1061 -0.3273 204 GLN A CB  
1646 C CG  . GLN A 209 ? 0.6005 0.8470 0.7509 0.2029  -0.1427 -0.3898 204 GLN A CG  
1647 C CD  . GLN A 209 ? 0.6744 1.0213 0.7985 0.2314  -0.1319 -0.4188 204 GLN A CD  
1648 O OE1 . GLN A 209 ? 0.7037 1.0658 0.8404 0.2553  -0.1504 -0.4538 204 GLN A OE1 
1649 N NE2 . GLN A 209 ? 0.6727 1.0951 0.7612 0.2281  -0.1021 -0.4008 204 GLN A NE2 
1650 N N   . GLN A 210 ? 0.4779 0.7837 0.5320 0.1367  -0.0359 -0.2610 205 GLN A N   
1651 C CA  . GLN A 210 ? 0.4663 0.8495 0.4937 0.1383  -0.0179 -0.2502 205 GLN A CA  
1652 C C   . GLN A 210 ? 0.4476 0.8005 0.4741 0.1204  -0.0122 -0.2263 205 GLN A C   
1653 O O   . GLN A 210 ? 0.4447 0.8483 0.4649 0.1306  -0.0148 -0.2378 205 GLN A O   
1654 C CB  . GLN A 210 ? 0.4468 0.8699 0.4472 0.1231  0.0112  -0.2108 205 GLN A CB  
1655 C CG  . GLN A 210 ? 0.4751 0.9785 0.4674 0.1441  0.0111  -0.2320 205 GLN A CG  
1656 C CD  . GLN A 210 ? 0.4701 0.9857 0.4460 0.1225  0.0350  -0.1873 205 GLN A CD  
1657 O OE1 . GLN A 210 ? 0.4693 0.9292 0.4411 0.0944  0.0490  -0.1448 205 GLN A OE1 
1658 N NE2 . GLN A 210 ? 0.4950 1.0858 0.4640 0.1373  0.0370  -0.1991 205 GLN A NE2 
1659 N N   . GLY A 211 ? 0.4245 0.7029 0.4569 0.0949  -0.0041 -0.1932 206 GLY A N   
1660 C CA  . GLY A 211 ? 0.4092 0.6619 0.4420 0.0792  0.0009  -0.1717 206 GLY A CA  
1661 C C   . GLY A 211 ? 0.4277 0.6605 0.4880 0.0900  -0.0268 -0.2023 206 GLY A C   
1662 O O   . GLY A 211 ? 0.4342 0.6888 0.4922 0.0925  -0.0289 -0.2062 206 GLY A O   
1663 N N   . HIS A 212 ? 0.4325 0.6226 0.5229 0.0958  -0.0517 -0.2233 207 HIS A N   
1664 C CA  . HIS A 212 ? 0.4387 0.5998 0.5651 0.1024  -0.0850 -0.2482 207 HIS A CA  
1665 C C   . HIS A 212 ? 0.4707 0.6935 0.5978 0.1339  -0.1036 -0.2967 207 HIS A C   
1666 O O   . HIS A 212 ? 0.4653 0.6911 0.6023 0.1357  -0.1150 -0.3054 207 HIS A O   
1667 C CB  . HIS A 212 ? 0.4370 0.5386 0.6032 0.1002  -0.1147 -0.2563 207 HIS A CB  
1668 C CG  . HIS A 212 ? 0.4784 0.5473 0.6917 0.1057  -0.1577 -0.2804 207 HIS A CG  
1669 N ND1 . HIS A 212 ? 0.4676 0.5099 0.6960 0.0851  -0.1606 -0.2554 207 HIS A ND1 
1670 C CD2 . HIS A 212 ? 0.4577 0.5189 0.7096 0.1308  -0.2032 -0.3293 207 HIS A CD2 
1671 C CE1 . HIS A 212 ? 0.4768 0.4939 0.7527 0.0941  -0.2061 -0.2838 207 HIS A CE1 
1672 N NE2 . HIS A 212 ? 0.5176 0.5426 0.8098 0.1228  -0.2346 -0.3305 207 HIS A NE2 
1673 N N   . GLU A 213 ? 0.4907 0.7709 0.6065 0.1599  -0.1063 -0.3287 208 GLU A N   
1674 C CA  . GLU A 213 ? 0.5209 0.8763 0.6372 0.1958  -0.1257 -0.3810 208 GLU A CA  
1675 C C   . GLU A 213 ? 0.5040 0.9200 0.5925 0.1937  -0.1055 -0.3672 208 GLU A C   
1676 O O   . GLU A 213 ? 0.5134 0.9551 0.6141 0.2126  -0.1270 -0.4010 208 GLU A O   
1677 C CB  . GLU A 213 ? 0.5384 0.9659 0.6413 0.2238  -0.1254 -0.4119 208 GLU A CB  
1678 C CG  . GLU A 213 ? 0.6236 1.1342 0.7342 0.2683  -0.1539 -0.4774 208 GLU A CG  
1679 C CD  . GLU A 213 ? 0.7112 1.3501 0.7866 0.2909  -0.1342 -0.4890 208 GLU A CD  
1680 O OE1 . GLU A 213 ? 0.7035 1.3599 0.7654 0.2870  -0.1175 -0.4738 208 GLU A OE1 
1681 O OE2 . GLU A 213 ? 0.7423 1.4716 0.8055 0.3131  -0.1371 -0.5131 208 GLU A OE2 
1682 N N   . GLU A 214 ? 0.4788 0.9186 0.5331 0.1715  -0.0677 -0.3182 209 GLU A N   
1683 C CA  . GLU A 214 ? 0.4807 0.9789 0.5103 0.1666  -0.0496 -0.2976 209 GLU A CA  
1684 C C   . GLU A 214 ? 0.4852 0.9279 0.5301 0.1530  -0.0576 -0.2890 209 GLU A C   
1685 O O   . GLU A 214 ? 0.5001 0.9876 0.5443 0.1673  -0.0674 -0.3096 209 GLU A O   
1686 C CB  . GLU A 214 ? 0.4540 0.9729 0.4543 0.1420  -0.0153 -0.2426 209 GLU A CB  
1687 C CG  . GLU A 214 ? 0.5168 1.0339 0.5031 0.1191  0.0021  -0.1991 209 GLU A CG  
1688 C CD  . GLU A 214 ? 0.5839 1.2065 0.5504 0.1287  0.0082  -0.1944 209 GLU A CD  
1689 O OE1 . GLU A 214 ? 0.6490 1.3600 0.6073 0.1509  0.0051  -0.2175 209 GLU A OE1 
1690 O OE2 . GLU A 214 ? 0.6088 1.2333 0.5687 0.1150  0.0151  -0.1672 209 GLU A OE2 
1691 N N   . LEU A 215 ? 0.4625 0.8168 0.5223 0.1275  -0.0550 -0.2609 210 LEU A N   
1692 C CA  . LEU A 215 ? 0.4665 0.7694 0.5449 0.1126  -0.0632 -0.2496 210 LEU A CA  
1693 C C   . LEU A 215 ? 0.4939 0.7842 0.6090 0.1311  -0.1028 -0.2949 210 LEU A C   
1694 O O   . LEU A 215 ? 0.4861 0.7744 0.6089 0.1278  -0.1094 -0.2948 210 LEU A O   
1695 C CB  . LEU A 215 ? 0.4392 0.6681 0.5266 0.0838  -0.0526 -0.2103 210 LEU A CB  
1696 C CG  . LEU A 215 ? 0.4355 0.6708 0.4913 0.0652  -0.0183 -0.1659 210 LEU A CG  
1697 C CD1 . LEU A 215 ? 0.3969 0.5753 0.4582 0.0453  -0.0085 -0.1369 210 LEU A CD1 
1698 C CD2 . LEU A 215 ? 0.4241 0.6720 0.4686 0.0559  -0.0075 -0.1455 210 LEU A CD2 
1699 N N   . SER A 216 ? 0.5280 0.8075 0.6694 0.1508  -0.1325 -0.3342 211 SER A N   
1700 C CA  . SER A 216 ? 0.5763 0.8488 0.7581 0.1742  -0.1784 -0.3854 211 SER A CA  
1701 C C   . SER A 216 ? 0.5928 0.9536 0.7588 0.2068  -0.1848 -0.4277 211 SER A C   
1702 O O   . SER A 216 ? 0.6131 0.9706 0.8020 0.2162  -0.2107 -0.4525 211 SER A O   
1703 C CB  . SER A 216 ? 0.6073 0.8478 0.8252 0.1911  -0.2146 -0.4211 211 SER A CB  
1704 O OG  . SER A 216 ? 0.6291 0.7883 0.8702 0.1600  -0.2161 -0.3813 211 SER A OG  
1705 N N   . ARG A 217 ? 0.5927 1.0385 0.7216 0.2236  -0.1629 -0.4345 212 ARG A N   
1706 C CA  . ARG A 217 ? 0.6139 1.1652 0.7212 0.2516  -0.1622 -0.4640 212 ARG A CA  
1707 C C   . ARG A 217 ? 0.6034 1.1571 0.6953 0.2308  -0.1435 -0.4285 212 ARG A C   
1708 O O   . ARG A 217 ? 0.6286 1.2385 0.7198 0.2516  -0.1566 -0.4581 212 ARG A O   
1709 C CB  . ARG A 217 ? 0.6040 1.2574 0.6731 0.2648  -0.1365 -0.4600 212 ARG A CB  
1710 C CG  . ARG A 217 ? 0.6407 1.3215 0.7217 0.2956  -0.1569 -0.5070 212 ARG A CG  
1711 C CD  . ARG A 217 ? 0.6972 1.5109 0.7408 0.3134  -0.1338 -0.5071 212 ARG A CD  
1712 N NE  . ARG A 217 ? 0.7372 1.5372 0.7629 0.2890  -0.1043 -0.4608 212 ARG A NE  
1713 C CZ  . ARG A 217 ? 0.7392 1.5365 0.7383 0.2521  -0.0672 -0.3922 212 ARG A CZ  
1714 N NH1 . ARG A 217 ? 0.7337 1.5434 0.7194 0.2348  -0.0534 -0.3592 212 ARG A NH1 
1715 N NH2 . ARG A 217 ? 0.7262 1.5068 0.7151 0.2334  -0.0471 -0.3576 212 ARG A NH2 
1716 N N   . LEU A 218 ? 0.5784 1.0730 0.6595 0.1923  -0.1154 -0.3686 213 LEU A N   
1717 C CA  . LEU A 218 ? 0.5659 1.0532 0.6357 0.1717  -0.0992 -0.3336 213 LEU A CA  
1718 C C   . LEU A 218 ? 0.5775 0.9963 0.6840 0.1644  -0.1247 -0.3436 213 LEU A C   
1719 O O   . LEU A 218 ? 0.5674 0.9832 0.6688 0.1516  -0.1162 -0.3228 213 LEU A O   
1720 C CB  . LEU A 218 ? 0.5414 0.9940 0.5895 0.1375  -0.0640 -0.2710 213 LEU A CB  
1721 C CG  . LEU A 218 ? 0.5364 1.0546 0.5477 0.1304  -0.0347 -0.2352 213 LEU A CG  
1722 C CD1 . LEU A 218 ? 0.5078 0.9656 0.5120 0.0981  -0.0122 -0.1818 213 LEU A CD1 
1723 C CD2 . LEU A 218 ? 0.5368 1.1303 0.5333 0.1396  -0.0335 -0.2363 213 LEU A CD2 
1724 N N   . SER A 219 ? 0.5994 0.9652 0.7462 0.1715  -0.1582 -0.3729 214 SER A N   
1725 C CA  . SER A 219 ? 0.6220 0.9132 0.8132 0.1560  -0.1856 -0.3699 214 SER A CA  
1726 C C   . SER A 219 ? 0.6410 0.9475 0.8494 0.1657  -0.2077 -0.3934 214 SER A C   
1727 O O   . SER A 219 ? 0.6383 0.9047 0.8598 0.1408  -0.2049 -0.3621 214 SER A O   
1728 C CB  . SER A 219 ? 0.6462 0.8804 0.8831 0.1603  -0.2228 -0.3923 214 SER A CB  
1729 O OG  . SER A 219 ? 0.7047 0.9000 0.9952 0.1645  -0.2702 -0.4187 214 SER A OG  
1730 N N   . GLN A 220 ? 0.6633 1.0334 0.8719 0.2027  -0.2298 -0.4486 215 GLN A N   
1731 C CA  . GLN A 220 ? 0.6849 1.0741 0.9076 0.2133  -0.2501 -0.4719 215 GLN A CA  
1732 C C   . GLN A 220 ? 0.6501 1.0773 0.8306 0.1963  -0.2094 -0.4294 215 GLN A C   
1733 O O   . GLN A 220 ? 0.6507 1.0554 0.8445 0.1834  -0.2147 -0.4175 215 GLN A O   
1734 C CB  . GLN A 220 ? 0.7224 1.1792 0.9569 0.2619  -0.2872 -0.5477 215 GLN A CB  
1735 C CG  . GLN A 220 ? 0.7995 1.2014 1.1008 0.2769  -0.3504 -0.5969 215 GLN A CG  
1736 C CD  . GLN A 220 ? 0.8608 1.2704 1.1784 0.2795  -0.3687 -0.6100 215 GLN A CD  
1737 O OE1 . GLN A 220 ? 0.8728 1.2291 1.2010 0.2439  -0.3586 -0.5632 215 GLN A OE1 
1738 N NE2 . GLN A 220 ? 0.9050 1.3868 1.2262 0.3241  -0.3976 -0.6767 215 GLN A NE2 
1739 N N   . TYR A 221 ? 0.6177 1.1001 0.7517 0.1945  -0.1716 -0.4037 216 TYR A N   
1740 C CA  . TYR A 221 ? 0.5883 1.1030 0.6873 0.1775  -0.1381 -0.3602 216 TYR A CA  
1741 C C   . TYR A 221 ? 0.5641 1.0006 0.6702 0.1403  -0.1219 -0.3091 216 TYR A C   
1742 O O   . TYR A 221 ? 0.5480 0.9890 0.6481 0.1305  -0.1142 -0.2906 216 TYR A O   
1743 C CB  . TYR A 221 ? 0.5738 1.1613 0.6301 0.1794  -0.1071 -0.3367 216 TYR A CB  
1744 C CG  . TYR A 221 ? 0.5577 1.1636 0.5872 0.1577  -0.0788 -0.2857 216 TYR A CG  
1745 C CD1 . TYR A 221 ? 0.5727 1.2445 0.5906 0.1687  -0.0811 -0.2920 216 TYR A CD1 
1746 C CD2 . TYR A 221 ? 0.5427 1.0978 0.5620 0.1273  -0.0539 -0.2329 216 TYR A CD2 
1747 C CE1 . TYR A 221 ? 0.5589 1.2416 0.5573 0.1481  -0.0598 -0.2435 216 TYR A CE1 
1748 C CE2 . TYR A 221 ? 0.5088 1.0740 0.5103 0.1095  -0.0352 -0.1895 216 TYR A CE2 
1749 C CZ  . TYR A 221 ? 0.5280 1.1548 0.5199 0.1190  -0.0386 -0.1934 216 TYR A CZ  
1750 O OH  . TYR A 221 ? 0.5302 1.1635 0.5087 0.1011  -0.0242 -0.1489 216 TYR A OH  
1751 N N   . ARG A 222 ? 0.5485 0.9219 0.6671 0.1223  -0.1178 -0.2887 217 ARG A N   
1752 C CA  . ARG A 222 ? 0.5390 0.8472 0.6688 0.0910  -0.1063 -0.2459 217 ARG A CA  
1753 C C   . ARG A 222 ? 0.5529 0.8279 0.7212 0.0844  -0.1325 -0.2540 217 ARG A C   
1754 O O   . ARG A 222 ? 0.5438 0.8090 0.7096 0.0673  -0.1202 -0.2253 217 ARG A O   
1755 C CB  . ARG A 222 ? 0.5298 0.7876 0.6710 0.0776  -0.1037 -0.2300 217 ARG A CB  
1756 C CG  . ARG A 222 ? 0.5323 0.8029 0.6382 0.0710  -0.0716 -0.2021 217 ARG A CG  
1757 C CD  . ARG A 222 ? 0.5314 0.7794 0.6466 0.0746  -0.0782 -0.2123 217 ARG A CD  
1758 N NE  . ARG A 222 ? 0.5112 0.6950 0.6592 0.0557  -0.0900 -0.1966 217 ARG A NE  
1759 C CZ  . ARG A 222 ? 0.4944 0.6466 0.6665 0.0570  -0.1082 -0.2074 217 ARG A CZ  
1760 N NH1 . ARG A 222 ? 0.5057 0.6087 0.7089 0.0358  -0.1186 -0.1834 217 ARG A NH1 
1761 N NH2 . ARG A 222 ? 0.4660 0.6411 0.6332 0.0792  -0.1172 -0.2401 217 ARG A NH2 
1762 N N   . LYS A 223 ? 0.5895 0.8474 0.7970 0.0982  -0.1717 -0.2932 218 LYS A N   
1763 C CA  . LYS A 223 ? 0.6164 0.8400 0.8699 0.0903  -0.2041 -0.3000 218 LYS A CA  
1764 C C   . LYS A 223 ? 0.6217 0.8892 0.8646 0.1026  -0.2059 -0.3165 218 LYS A C   
1765 O O   . LYS A 223 ? 0.6241 0.8717 0.8855 0.0854  -0.2103 -0.2972 218 LYS A O   
1766 C CB  . LYS A 223 ? 0.6534 0.8390 0.9603 0.1008  -0.2534 -0.3360 218 LYS A CB  
1767 C CG  . LYS A 223 ? 0.7053 0.9198 1.0350 0.1371  -0.2957 -0.4020 218 LYS A CG  
1768 C CD  . LYS A 223 ? 0.7609 0.9318 1.1518 0.1276  -0.3415 -0.4099 218 LYS A CD  
1769 C CE  . LYS A 223 ? 0.8039 0.9711 1.2435 0.1623  -0.4036 -0.4799 218 LYS A CE  
1770 N NZ  . LYS A 223 ? 0.8166 1.0488 1.2411 0.1962  -0.4131 -0.5295 218 LYS A NZ  
1771 N N   . GLU A 224 ? 0.6270 0.9622 0.8384 0.1313  -0.2003 -0.3479 219 GLU A N   
1772 C CA  . GLU A 224 ? 0.6291 1.0200 0.8239 0.1449  -0.1987 -0.3616 219 GLU A CA  
1773 C C   . GLU A 224 ? 0.5974 0.9963 0.7584 0.1219  -0.1595 -0.3093 219 GLU A C   
1774 O O   . GLU A 224 ? 0.5902 0.9876 0.7587 0.1149  -0.1625 -0.3016 219 GLU A O   
1775 C CB  . GLU A 224 ? 0.6454 1.1232 0.8164 0.1827  -0.2040 -0.4070 219 GLU A CB  
1776 C CG  . GLU A 224 ? 0.7052 1.1904 0.9167 0.2167  -0.2555 -0.4772 219 GLU A CG  
1777 C CD  . GLU A 224 ? 0.7527 1.3209 0.9445 0.2565  -0.2617 -0.5251 219 GLU A CD  
1778 O OE1 . GLU A 224 ? 0.7312 1.3465 0.8810 0.2538  -0.2263 -0.4992 219 GLU A OE1 
1779 O OE2 . GLU A 224 ? 0.8088 1.3988 1.0309 0.2922  -0.3059 -0.5910 219 GLU A OE2 
1780 N N   . LEU A 225 ? 0.5720 0.9768 0.6999 0.1110  -0.1267 -0.2749 220 LEU A N   
1781 C CA  . LEU A 225 ? 0.5498 0.9525 0.6524 0.0905  -0.0959 -0.2271 220 LEU A CA  
1782 C C   . LEU A 225 ? 0.5476 0.8903 0.6754 0.0665  -0.0968 -0.2018 220 LEU A C   
1783 O O   . LEU A 225 ? 0.5285 0.8759 0.6500 0.0575  -0.0870 -0.1812 220 LEU A O   
1784 C CB  . LEU A 225 ? 0.5341 0.9437 0.6072 0.0831  -0.0689 -0.1978 220 LEU A CB  
1785 C CG  . LEU A 225 ? 0.5139 0.9049 0.5689 0.0620  -0.0431 -0.1494 220 LEU A CG  
1786 C CD1 . LEU A 225 ? 0.5037 0.9373 0.5414 0.0635  -0.0369 -0.1351 220 LEU A CD1 
1787 C CD2 . LEU A 225 ? 0.4866 0.8806 0.5219 0.0576  -0.0261 -0.1296 220 LEU A CD2 
1788 N N   . GLY A 226 ? 0.5600 0.8536 0.7183 0.0564  -0.1103 -0.2022 221 GLY A N   
1789 C CA  . GLY A 226 ? 0.5635 0.8152 0.7489 0.0321  -0.1121 -0.1737 221 GLY A CA  
1790 C C   . GLY A 226 ? 0.5852 0.8417 0.7972 0.0322  -0.1340 -0.1860 221 GLY A C   
1791 O O   . GLY A 226 ? 0.5782 0.8305 0.7956 0.0163  -0.1253 -0.1594 221 GLY A O   
1792 N N   . ALA A 227 ? 0.6147 0.8851 0.8441 0.0527  -0.1640 -0.2295 222 ALA A N   
1793 C CA  . ALA A 227 ? 0.6411 0.9196 0.8977 0.0579  -0.1906 -0.2504 222 ALA A CA  
1794 C C   . ALA A 227 ? 0.6321 0.9565 0.8543 0.0644  -0.1698 -0.2445 222 ALA A C   
1795 O O   . ALA A 227 ? 0.6349 0.9535 0.8702 0.0515  -0.1707 -0.2280 222 ALA A O   
1796 C CB  . ALA A 227 ? 0.6697 0.9548 0.9544 0.0845  -0.2323 -0.3069 222 ALA A CB  
1797 N N   . GLN A 228 ? 0.6331 1.0073 0.8140 0.0830  -0.1528 -0.2547 223 GLN A N   
1798 C CA  . GLN A 228 ? 0.6304 1.0529 0.7785 0.0880  -0.1343 -0.2430 223 GLN A CA  
1799 C C   . GLN A 228 ? 0.6092 1.0076 0.7470 0.0645  -0.1090 -0.1957 223 GLN A C   
1800 O O   . GLN A 228 ? 0.6083 1.0252 0.7390 0.0630  -0.1044 -0.1856 223 GLN A O   
1801 C CB  . GLN A 228 ? 0.6330 1.1145 0.7409 0.1040  -0.1175 -0.2453 223 GLN A CB  
1802 C CG  . GLN A 228 ? 0.6762 1.2161 0.7842 0.1357  -0.1393 -0.2962 223 GLN A CG  
1803 C CD  . GLN A 228 ? 0.7045 1.3150 0.7736 0.1479  -0.1201 -0.2899 223 GLN A CD  
1804 O OE1 . GLN A 228 ? 0.7015 1.3318 0.7428 0.1341  -0.0943 -0.2466 223 GLN A OE1 
1805 N NE2 . GLN A 228 ? 0.7342 1.3864 0.8055 0.1742  -0.1362 -0.3328 223 GLN A NE2 
1806 N N   . LEU A 229 ? 0.5926 0.9536 0.7297 0.0489  -0.0944 -0.1700 224 LEU A N   
1807 C CA  . LEU A 229 ? 0.5758 0.9208 0.7017 0.0325  -0.0720 -0.1314 224 LEU A CA  
1808 C C   . LEU A 229 ? 0.5749 0.9017 0.7303 0.0189  -0.0803 -0.1216 224 LEU A C   
1809 O O   . LEU A 229 ? 0.5511 0.8909 0.6985 0.0164  -0.0715 -0.1069 224 LEU A O   
1810 C CB  . LEU A 229 ? 0.5641 0.8804 0.6836 0.0232  -0.0575 -0.1128 224 LEU A CB  
1811 C CG  . LEU A 229 ? 0.5749 0.8965 0.6637 0.0210  -0.0342 -0.0860 224 LEU A CG  
1812 C CD1 . LEU A 229 ? 0.5835 0.9502 0.6462 0.0326  -0.0310 -0.0863 224 LEU A CD1 
1813 C CD2 . LEU A 229 ? 0.5471 0.8466 0.6304 0.0172  -0.0256 -0.0794 224 LEU A CD2 
1814 N N   . HIS A 230 ? 0.5915 0.8913 0.7841 0.0095  -0.0997 -0.1276 225 HIS A N   
1815 C CA  . HIS A 230 ? 0.6034 0.8945 0.8330 -0.0063 -0.1136 -0.1159 225 HIS A CA  
1816 C C   . HIS A 230 ? 0.6076 0.9233 0.8423 0.0032  -0.1271 -0.1346 225 HIS A C   
1817 O O   . HIS A 230 ? 0.5992 0.9232 0.8459 -0.0068 -0.1260 -0.1186 225 HIS A O   
1818 C CB  . HIS A 230 ? 0.6227 0.8822 0.8984 -0.0189 -0.1408 -0.1181 225 HIS A CB  
1819 C CG  . HIS A 230 ? 0.6603 0.9162 0.9837 -0.0363 -0.1645 -0.1066 225 HIS A CG  
1820 N ND1 . HIS A 230 ? 0.6668 0.9366 0.9998 -0.0564 -0.1512 -0.0686 225 HIS A ND1 
1821 C CD2 . HIS A 230 ? 0.6871 0.9319 1.0545 -0.0363 -0.2035 -0.1281 225 HIS A CD2 
1822 C CE1 . HIS A 230 ? 0.6770 0.9474 1.0573 -0.0711 -0.1789 -0.0621 225 HIS A CE1 
1823 N NE2 . HIS A 230 ? 0.6942 0.9442 1.0980 -0.0600 -0.2125 -0.0976 225 HIS A NE2 
1824 N N   . GLN A 231 ? 0.6207 0.9559 0.8440 0.0245  -0.1390 -0.1692 226 GLN A N   
1825 C CA  . GLN A 231 ? 0.6356 1.0033 0.8574 0.0377  -0.1505 -0.1901 226 GLN A CA  
1826 C C   . GLN A 231 ? 0.6181 1.0134 0.8049 0.0381  -0.1242 -0.1669 226 GLN A C   
1827 O O   . GLN A 231 ? 0.6076 1.0125 0.8040 0.0342  -0.1277 -0.1613 226 GLN A O   
1828 C CB  . GLN A 231 ? 0.6557 1.0546 0.8672 0.0647  -0.1662 -0.2332 226 GLN A CB  
1829 C CG  . GLN A 231 ? 0.6971 1.1252 0.9233 0.0803  -0.1913 -0.2661 226 GLN A CG  
1830 C CD  . GLN A 231 ? 0.7540 1.1502 1.0356 0.0817  -0.2348 -0.2976 226 GLN A CD  
1831 O OE1 . GLN A 231 ? 0.7916 1.2126 1.0879 0.1045  -0.2646 -0.3424 226 GLN A OE1 
1832 N NE2 . GLN A 231 ? 0.7473 1.0912 1.0634 0.0577  -0.2425 -0.2742 226 GLN A NE2 
1833 N N   . LEU A 232 ? 0.6039 1.0106 0.7540 0.0424  -0.1013 -0.1524 227 LEU A N   
1834 C CA  . LEU A 232 ? 0.5959 1.0262 0.7176 0.0437  -0.0836 -0.1301 227 LEU A CA  
1835 C C   . LEU A 232 ? 0.5834 0.9926 0.7157 0.0296  -0.0748 -0.1045 227 LEU A C   
1836 O O   . LEU A 232 ? 0.5885 1.0150 0.7131 0.0319  -0.0718 -0.0952 227 LEU A O   
1837 C CB  . LEU A 232 ? 0.5933 1.0365 0.6826 0.0474  -0.0667 -0.1146 227 LEU A CB  
1838 C CG  . LEU A 232 ? 0.6136 1.1147 0.6789 0.0637  -0.0688 -0.1261 227 LEU A CG  
1839 C CD1 . LEU A 232 ? 0.6305 1.1749 0.6866 0.0703  -0.0728 -0.1223 227 LEU A CD1 
1840 C CD2 . LEU A 232 ? 0.6220 1.1434 0.6957 0.0795  -0.0853 -0.1667 227 LEU A CD2 
1841 N N   . VAL A 233 ? 0.5754 0.9543 0.7271 0.0162  -0.0726 -0.0940 228 VAL A N   
1842 C CA  . VAL A 233 ? 0.5615 0.9347 0.7230 0.0052  -0.0632 -0.0708 228 VAL A CA  
1843 C C   . VAL A 233 ? 0.5705 0.9569 0.7614 -0.0010 -0.0775 -0.0739 228 VAL A C   
1844 O O   . VAL A 233 ? 0.5741 0.9760 0.7661 -0.0026 -0.0708 -0.0606 228 VAL A O   
1845 C CB  . VAL A 233 ? 0.5627 0.9138 0.7342 -0.0067 -0.0554 -0.0558 228 VAL A CB  
1846 C CG1 . VAL A 233 ? 0.5401 0.9030 0.7173 -0.0128 -0.0442 -0.0344 228 VAL A CG1 
1847 C CG2 . VAL A 233 ? 0.5443 0.8813 0.6887 -0.0004 -0.0436 -0.0550 228 VAL A CG2 
1848 N N   . LEU A 234 ? 0.5807 0.9622 0.7980 -0.0029 -0.1002 -0.0935 229 LEU A N   
1849 C CA  . LEU A 234 ? 0.5859 0.9800 0.8333 -0.0073 -0.1196 -0.1005 229 LEU A CA  
1850 C C   . LEU A 234 ? 0.5815 1.0044 0.8075 0.0079  -0.1182 -0.1122 229 LEU A C   
1851 O O   . LEU A 234 ? 0.5785 1.0177 0.8132 0.0038  -0.1172 -0.1018 229 LEU A O   
1852 C CB  . LEU A 234 ? 0.6124 0.9889 0.8988 -0.0104 -0.1521 -0.1231 229 LEU A CB  
1853 C CG  . LEU A 234 ? 0.6300 0.9932 0.9707 -0.0349 -0.1730 -0.1045 229 LEU A CG  
1854 C CD1 . LEU A 234 ? 0.6023 0.9554 0.9477 -0.0529 -0.1577 -0.0707 229 LEU A CD1 
1855 C CD2 . LEU A 234 ? 0.6680 1.0078 1.0518 -0.0334 -0.2150 -0.1336 229 LEU A CD2 
1856 N N   . ASN A 235 ? 0.5782 1.0147 0.7777 0.0253  -0.1187 -0.1321 230 ASN A N   
1857 C CA  . ASN A 235 ? 0.5766 1.0485 0.7536 0.0393  -0.1173 -0.1385 230 ASN A CA  
1858 C C   . ASN A 235 ? 0.5583 1.0342 0.7185 0.0358  -0.0988 -0.1096 230 ASN A C   
1859 O O   . ASN A 235 ? 0.5538 1.0475 0.7178 0.0378  -0.1022 -0.1073 230 ASN A O   
1860 C CB  . ASN A 235 ? 0.5797 1.0790 0.7254 0.0560  -0.1144 -0.1518 230 ASN A CB  
1861 C CG  . ASN A 235 ? 0.5942 1.1038 0.7545 0.0688  -0.1371 -0.1911 230 ASN A CG  
1862 O OD1 . ASN A 235 ? 0.5933 1.0840 0.7912 0.0654  -0.1604 -0.2102 230 ASN A OD1 
1863 N ND2 . ASN A 235 ? 0.5991 1.1428 0.7332 0.0846  -0.1336 -0.2037 230 ASN A ND2 
1864 N N   . SER A 236 ? 0.5404 0.9986 0.6845 0.0323  -0.0823 -0.0905 231 SER A N   
1865 C CA  . SER A 236 ? 0.5300 0.9873 0.6607 0.0332  -0.0702 -0.0681 231 SER A CA  
1866 C C   . SER A 236 ? 0.5189 0.9780 0.6717 0.0271  -0.0703 -0.0612 231 SER A C   
1867 O O   . SER A 236 ? 0.5175 0.9882 0.6652 0.0335  -0.0689 -0.0532 231 SER A O   
1868 C CB  . SER A 236 ? 0.5218 0.9567 0.6373 0.0314  -0.0576 -0.0539 231 SER A CB  
1869 O OG  . SER A 236 ? 0.5354 0.9667 0.6424 0.0355  -0.0531 -0.0365 231 SER A OG  
1870 N N   . ALA A 237 ? 0.5117 0.9647 0.6918 0.0146  -0.0742 -0.0624 232 ALA A N   
1871 C CA  . ALA A 237 ? 0.5055 0.9776 0.7114 0.0065  -0.0761 -0.0532 232 ALA A CA  
1872 C C   . ALA A 237 ? 0.5162 1.0092 0.7340 0.0093  -0.0901 -0.0643 232 ALA A C   
1873 O O   . ALA A 237 ? 0.5089 1.0246 0.7295 0.0130  -0.0881 -0.0584 232 ALA A O   
1874 C CB  . ALA A 237 ? 0.5006 0.9683 0.7379 -0.0120 -0.0802 -0.0434 232 ALA A CB  
1875 N N   . ARG A 238 ? 0.5318 1.0198 0.7570 0.0103  -0.1060 -0.0838 233 ARG A N   
1876 C CA  . ARG A 238 ? 0.5556 1.0647 0.7913 0.0156  -0.1218 -0.0990 233 ARG A CA  
1877 C C   . ARG A 238 ? 0.5526 1.0831 0.7586 0.0310  -0.1147 -0.0977 233 ARG A C   
1878 O O   . ARG A 238 ? 0.5494 1.1004 0.7656 0.0324  -0.1201 -0.0975 233 ARG A O   
1879 C CB  . ARG A 238 ? 0.5749 1.0781 0.8239 0.0198  -0.1442 -0.1278 233 ARG A CB  
1880 C CG  . ARG A 238 ? 0.6188 1.1465 0.8798 0.0287  -0.1645 -0.1502 233 ARG A CG  
1881 C CD  . ARG A 238 ? 0.6848 1.2094 0.9620 0.0386  -0.1918 -0.1873 233 ARG A CD  
1882 N NE  . ARG A 238 ? 0.7076 1.2137 0.9724 0.0424  -0.1874 -0.1937 233 ARG A NE  
1883 C CZ  . ARG A 238 ? 0.7387 1.2439 1.0132 0.0557  -0.2096 -0.2288 233 ARG A CZ  
1884 N NH1 . ARG A 238 ? 0.7550 1.2759 1.0532 0.0682  -0.2403 -0.2641 233 ARG A NH1 
1885 N NH2 . ARG A 238 ? 0.7233 1.2140 0.9852 0.0589  -0.2030 -0.2318 233 ARG A NH2 
1886 N N   . GLU A 239 ? 0.5561 1.0832 0.7294 0.0406  -0.1047 -0.0934 234 GLU A N   
1887 C CA  . GLU A 239 ? 0.5647 1.1111 0.7142 0.0520  -0.1023 -0.0845 234 GLU A CA  
1888 C C   . GLU A 239 ? 0.5501 1.0913 0.7024 0.0526  -0.0958 -0.0668 234 GLU A C   
1889 O O   . GLU A 239 ? 0.5607 1.1188 0.7107 0.0602  -0.1014 -0.0632 234 GLU A O   
1890 C CB  . GLU A 239 ? 0.5716 1.1203 0.6922 0.0577  -0.0965 -0.0767 234 GLU A CB  
1891 C CG  . GLU A 239 ? 0.6205 1.2011 0.7313 0.0663  -0.1054 -0.0976 234 GLU A CG  
1892 C CD  . GLU A 239 ? 0.6612 1.2514 0.7483 0.0693  -0.0981 -0.0906 234 GLU A CD  
1893 O OE1 . GLU A 239 ? 0.6782 1.2367 0.7613 0.0617  -0.0870 -0.0738 234 GLU A OE1 
1894 O OE2 . GLU A 239 ? 0.6990 1.3356 0.7719 0.0803  -0.1041 -0.1028 234 GLU A OE2 
1895 N N   . LYS A 240 ? 0.5255 1.0470 0.6836 0.0470  -0.0861 -0.0584 235 LYS A N   
1896 C CA  . LYS A 240 ? 0.5105 1.0330 0.6722 0.0528  -0.0820 -0.0487 235 LYS A CA  
1897 C C   . LYS A 240 ? 0.4984 1.0502 0.6831 0.0517  -0.0867 -0.0534 235 LYS A C   
1898 O O   . LYS A 240 ? 0.5039 1.0701 0.6899 0.0630  -0.0899 -0.0521 235 LYS A O   
1899 C CB  . LYS A 240 ? 0.4982 1.0039 0.6614 0.0490  -0.0711 -0.0425 235 LYS A CB  
1900 C CG  . LYS A 240 ? 0.5072 1.0177 0.6718 0.0622  -0.0702 -0.0392 235 LYS A CG  
1901 C CD  . LYS A 240 ? 0.5180 1.0352 0.6918 0.0589  -0.0597 -0.0373 235 LYS A CD  
1902 C CE  . LYS A 240 ? 0.5184 1.0673 0.7021 0.0757  -0.0619 -0.0432 235 LYS A CE  
1903 N NZ  . LYS A 240 ? 0.5180 1.0901 0.7094 0.0755  -0.0515 -0.0418 235 LYS A NZ  
1904 N N   . ARG A 241 ? 0.4884 1.0496 0.6948 0.0383  -0.0907 -0.0586 236 ARG A N   
1905 C CA  . ARG A 241 ? 0.4851 1.0788 0.7182 0.0333  -0.0974 -0.0589 236 ARG A CA  
1906 C C   . ARG A 241 ? 0.4882 1.0945 0.7152 0.0432  -0.1081 -0.0689 236 ARG A C   
1907 O O   . ARG A 241 ? 0.4757 1.1094 0.7132 0.0483  -0.1111 -0.0681 236 ARG A O   
1908 C CB  . ARG A 241 ? 0.4910 1.0873 0.7567 0.0129  -0.1056 -0.0571 236 ARG A CB  
1909 C CG  . ARG A 241 ? 0.5153 1.0980 0.7877 0.0008  -0.0971 -0.0444 236 ARG A CG  
1910 C CD  . ARG A 241 ? 0.5339 1.1569 0.8344 -0.0120 -0.0928 -0.0239 236 ARG A CD  
1911 N NE  . ARG A 241 ? 0.5683 1.2060 0.9125 -0.0345 -0.1107 -0.0145 236 ARG A NE  
1912 C CZ  . ARG A 241 ? 0.5847 1.1949 0.9532 -0.0522 -0.1253 -0.0110 236 ARG A CZ  
1913 N NH1 . ARG A 241 ? 0.5558 1.1256 0.9056 -0.0489 -0.1208 -0.0180 236 ARG A NH1 
1914 N NH2 . ARG A 241 ? 0.5816 1.2044 0.9976 -0.0733 -0.1481 -0.0001 236 ARG A NH2 
1915 N N   . ASP A 242 ? 0.4936 1.0878 0.7037 0.0473  -0.1139 -0.0787 237 ASP A N   
1916 C CA  . ASP A 242 ? 0.5095 1.1230 0.7100 0.0579  -0.1240 -0.0866 237 ASP A CA  
1917 C C   . ASP A 242 ? 0.5045 1.1224 0.6891 0.0707  -0.1219 -0.0739 237 ASP A C   
1918 O O   . ASP A 242 ? 0.5089 1.1481 0.6995 0.0773  -0.1296 -0.0759 237 ASP A O   
1919 C CB  . ASP A 242 ? 0.5263 1.1415 0.7093 0.0627  -0.1299 -0.0991 237 ASP A CB  
1920 C CG  . ASP A 242 ? 0.5593 1.1741 0.7660 0.0563  -0.1436 -0.1219 237 ASP A CG  
1921 O OD1 . ASP A 242 ? 0.5780 1.1866 0.8178 0.0431  -0.1493 -0.1210 237 ASP A OD1 
1922 O OD2 . ASP A 242 ? 0.5931 1.2181 0.7881 0.0651  -0.1517 -0.1405 237 ASP A OD2 
1923 N N   . MET A 243 ? 0.5012 1.0966 0.6703 0.0741  -0.1148 -0.0613 238 MET A N   
1924 C CA  . MET A 243 ? 0.5028 1.0930 0.6643 0.0863  -0.1204 -0.0490 238 MET A CA  
1925 C C   . MET A 243 ? 0.4841 1.0859 0.6640 0.0949  -0.1224 -0.0537 238 MET A C   
1926 O O   . MET A 243 ? 0.4864 1.0973 0.6692 0.1071  -0.1343 -0.0527 238 MET A O   
1927 C CB  . MET A 243 ? 0.5121 1.0723 0.6591 0.0866  -0.1172 -0.0349 238 MET A CB  
1928 C CG  . MET A 243 ? 0.5583 1.1216 0.6851 0.0838  -0.1210 -0.0212 238 MET A CG  
1929 S SD  . MET A 243 ? 0.6745 1.2039 0.7931 0.0835  -0.1243 0.0037  238 MET A SD  
1930 C CE  . MET A 243 ? 0.6397 1.1622 0.7729 0.0962  -0.1483 0.0168  238 MET A CE  
1931 N N   . GLU A 244 ? 0.4595 1.0680 0.6531 0.0895  -0.1121 -0.0583 239 GLU A N   
1932 C CA  . GLU A 244 ? 0.4449 1.0861 0.6576 0.0989  -0.1127 -0.0645 239 GLU A CA  
1933 C C   . GLU A 244 ? 0.4220 1.0976 0.6497 0.0971  -0.1193 -0.0699 239 GLU A C   
1934 O O   . GLU A 244 ? 0.4194 1.1203 0.6557 0.1118  -0.1265 -0.0757 239 GLU A O   
1935 C CB  . GLU A 244 ? 0.4372 1.0973 0.6633 0.0903  -0.0997 -0.0628 239 GLU A CB  
1936 C CG  . GLU A 244 ? 0.4739 1.1058 0.6875 0.0931  -0.0924 -0.0596 239 GLU A CG  
1937 C CD  . GLU A 244 ? 0.5121 1.1725 0.7398 0.0829  -0.0796 -0.0548 239 GLU A CD  
1938 O OE1 . GLU A 244 ? 0.5296 1.2434 0.7736 0.0901  -0.0779 -0.0574 239 GLU A OE1 
1939 O OE2 . GLU A 244 ? 0.5447 1.1805 0.7681 0.0679  -0.0722 -0.0470 239 GLU A OE2 
1940 N N   . GLN A 245 ? 0.4046 1.0815 0.6382 0.0806  -0.1196 -0.0706 240 GLN A N   
1941 C CA  . GLN A 245 ? 0.3954 1.1017 0.6458 0.0774  -0.1291 -0.0768 240 GLN A CA  
1942 C C   . GLN A 245 ? 0.3957 1.1025 0.6313 0.0942  -0.1397 -0.0799 240 GLN A C   
1943 O O   . GLN A 245 ? 0.3768 1.1120 0.6242 0.1034  -0.1462 -0.0839 240 GLN A O   
1944 C CB  . GLN A 245 ? 0.3963 1.0949 0.6570 0.0607  -0.1350 -0.0824 240 GLN A CB  
1945 C CG  . GLN A 245 ? 0.4318 1.1597 0.7164 0.0562  -0.1487 -0.0903 240 GLN A CG  
1946 C CD  . GLN A 245 ? 0.4645 1.1810 0.7622 0.0456  -0.1632 -0.1039 240 GLN A CD  
1947 O OE1 . GLN A 245 ? 0.4744 1.1673 0.7779 0.0353  -0.1637 -0.1047 240 GLN A OE1 
1948 N NE2 . GLN A 245 ? 0.4359 1.1704 0.7406 0.0505  -0.1781 -0.1176 240 GLN A NE2 
1949 N N   . ARG A 246 ? 0.3954 1.0754 0.6065 0.0977  -0.1421 -0.0749 241 ARG A N   
1950 C CA  . ARG A 246 ? 0.4166 1.0981 0.6143 0.1100  -0.1544 -0.0688 241 ARG A CA  
1951 C C   . ARG A 246 ? 0.4215 1.1002 0.6261 0.1263  -0.1630 -0.0654 241 ARG A C   
1952 O O   . ARG A 246 ? 0.4253 1.1202 0.6356 0.1367  -0.1759 -0.0667 241 ARG A O   
1953 C CB  . ARG A 246 ? 0.4261 1.0889 0.5993 0.1076  -0.1548 -0.0555 241 ARG A CB  
1954 C CG  . ARG A 246 ? 0.4716 1.1398 0.6346 0.1167  -0.1704 -0.0377 241 ARG A CG  
1955 C CD  . ARG A 246 ? 0.4979 1.1635 0.6396 0.1111  -0.1709 -0.0174 241 ARG A CD  
1956 N NE  . ARG A 246 ? 0.5093 1.2128 0.6380 0.1083  -0.1692 -0.0256 241 ARG A NE  
1957 C CZ  . ARG A 246 ? 0.5113 1.2243 0.6247 0.1032  -0.1614 -0.0274 241 ARG A CZ  
1958 N NH1 . ARG A 246 ? 0.5373 1.2206 0.6460 0.0972  -0.1528 -0.0178 241 ARG A NH1 
1959 N NH2 . ARG A 246 ? 0.5385 1.2944 0.6424 0.1066  -0.1639 -0.0421 241 ARG A NH2 
1960 N N   . HIS A 247 ? 0.4261 1.0846 0.6319 0.1308  -0.1586 -0.0639 242 HIS A N   
1961 C CA  . HIS A 247 ? 0.4479 1.0997 0.6631 0.1513  -0.1727 -0.0669 242 HIS A CA  
1962 C C   . HIS A 247 ? 0.4536 1.1485 0.6890 0.1635  -0.1744 -0.0843 242 HIS A C   
1963 O O   . HIS A 247 ? 0.4762 1.1784 0.7214 0.1827  -0.1928 -0.0910 242 HIS A O   
1964 C CB  . HIS A 247 ? 0.4480 1.0702 0.6603 0.1548  -0.1696 -0.0654 242 HIS A CB  
1965 C CG  . HIS A 247 ? 0.4495 1.0328 0.6449 0.1449  -0.1726 -0.0448 242 HIS A CG  
1966 N ND1 . HIS A 247 ? 0.4753 1.0257 0.6689 0.1473  -0.1746 -0.0397 242 HIS A ND1 
1967 C CD2 . HIS A 247 ? 0.4551 1.0363 0.6355 0.1331  -0.1745 -0.0273 242 HIS A CD2 
1968 C CE1 . HIS A 247 ? 0.4724 1.0012 0.6517 0.1347  -0.1768 -0.0170 242 HIS A CE1 
1969 N NE2 . HIS A 247 ? 0.4599 1.0117 0.6303 0.1268  -0.1764 -0.0090 242 HIS A NE2 
1970 N N   . VAL A 248 ? 0.4455 1.1730 0.6903 0.1511  -0.1577 -0.0895 243 VAL A N   
1971 C CA  . VAL A 248 ? 0.4434 1.2271 0.7097 0.1571  -0.1573 -0.1003 243 VAL A CA  
1972 C C   . VAL A 248 ? 0.4624 1.2594 0.7326 0.1587  -0.1689 -0.1021 243 VAL A C   
1973 O O   . VAL A 248 ? 0.4715 1.3054 0.7561 0.1743  -0.1774 -0.1127 243 VAL A O   
1974 C CB  . VAL A 248 ? 0.4215 1.2392 0.7023 0.1354  -0.1404 -0.0947 243 VAL A CB  
1975 C CG1 . VAL A 248 ? 0.4112 1.2948 0.7176 0.1348  -0.1416 -0.0980 243 VAL A CG1 
1976 C CG2 . VAL A 248 ? 0.4091 1.2304 0.6890 0.1376  -0.1294 -0.0937 243 VAL A CG2 
1977 N N   . LEU A 249 ? 0.4791 1.2520 0.7361 0.1448  -0.1700 -0.0938 244 LEU A N   
1978 C CA  . LEU A 249 ? 0.5010 1.2878 0.7586 0.1464  -0.1816 -0.0955 244 LEU A CA  
1979 C C   . LEU A 249 ? 0.5293 1.3010 0.7797 0.1658  -0.2001 -0.0913 244 LEU A C   
1980 O O   . LEU A 249 ? 0.5305 1.3254 0.7909 0.1769  -0.2121 -0.0972 244 LEU A O   
1981 C CB  . LEU A 249 ? 0.5001 1.2756 0.7457 0.1300  -0.1793 -0.0923 244 LEU A CB  
1982 C CG  . LEU A 249 ? 0.4863 1.2759 0.7492 0.1107  -0.1726 -0.0990 244 LEU A CG  
1983 C CD1 . LEU A 249 ? 0.4834 1.2559 0.7318 0.1028  -0.1751 -0.1027 244 LEU A CD1 
1984 C CD2 . LEU A 249 ? 0.5037 1.3346 0.7928 0.1085  -0.1799 -0.1064 244 LEU A CD2 
1985 N N   . LEU A 250 ? 0.5584 1.2905 0.7951 0.1684  -0.2051 -0.0786 245 LEU A N   
1986 C CA  . LEU A 250 ? 0.6045 1.3158 0.8421 0.1836  -0.2292 -0.0680 245 LEU A CA  
1987 C C   . LEU A 250 ? 0.6336 1.3561 0.8937 0.2085  -0.2442 -0.0864 245 LEU A C   
1988 O O   . LEU A 250 ? 0.6553 1.3869 0.9258 0.2220  -0.2644 -0.0882 245 LEU A O   
1989 C CB  . LEU A 250 ? 0.6088 1.2770 0.8344 0.1781  -0.2337 -0.0474 245 LEU A CB  
1990 C CG  . LEU A 250 ? 0.6129 1.2821 0.8176 0.1615  -0.2317 -0.0238 245 LEU A CG  
1991 C CD1 . LEU A 250 ? 0.6006 1.2381 0.7945 0.1527  -0.2328 -0.0010 245 LEU A CD1 
1992 C CD2 . LEU A 250 ? 0.6330 1.3193 0.8404 0.1670  -0.2532 -0.0094 245 LEU A CD2 
1993 N N   . LYS A 251 ? 0.6510 1.3796 0.9190 0.2165  -0.2354 -0.1020 246 LYS A N   
1994 C CA  . LYS A 251 ? 0.6841 1.4393 0.9737 0.2453  -0.2492 -0.1268 246 LYS A CA  
1995 C C   . LYS A 251 ? 0.6912 1.5037 0.9933 0.2501  -0.2468 -0.1396 246 LYS A C   
1996 O O   . LYS A 251 ? 0.7094 1.5341 1.0261 0.2733  -0.2693 -0.1524 246 LYS A O   
1997 C CB  . LYS A 251 ? 0.6687 1.4386 0.9621 0.2524  -0.2362 -0.1417 246 LYS A CB  
1998 C CG  . LYS A 251 ? 0.7041 1.4257 1.0005 0.2692  -0.2563 -0.1456 246 LYS A CG  
1999 C CD  . LYS A 251 ? 0.6937 1.3615 0.9709 0.2454  -0.2475 -0.1195 246 LYS A CD  
2000 C CE  . LYS A 251 ? 0.6810 1.3595 0.9509 0.2377  -0.2228 -0.1250 246 LYS A CE  
2001 N NZ  . LYS A 251 ? 0.6834 1.3081 0.9380 0.2213  -0.2191 -0.1047 246 LYS A NZ  
2002 N N   . GLN A 252 ? 0.6919 1.5374 0.9914 0.2276  -0.2230 -0.1350 247 GLN A N   
2003 C CA  . GLN A 252 ? 0.7085 1.6124 1.0238 0.2269  -0.2200 -0.1432 247 GLN A CA  
2004 C C   . GLN A 252 ? 0.7389 1.6337 1.0509 0.2254  -0.2339 -0.1374 247 GLN A C   
2005 O O   . GLN A 252 ? 0.7614 1.6622 1.0823 0.2476  -0.2547 -0.1463 247 GLN A O   
2006 C CB  . GLN A 252 ? 0.6856 1.6214 1.0069 0.1992  -0.1967 -0.1349 247 GLN A CB  
2007 C CG  . GLN A 252 ? 0.6846 1.6913 1.0304 0.1952  -0.1940 -0.1391 247 GLN A CG  
2008 C CD  . GLN A 252 ? 0.6917 1.7647 1.0547 0.2204  -0.1955 -0.1557 247 GLN A CD  
2009 O OE1 . GLN A 252 ? 0.6820 1.7696 1.0445 0.2291  -0.1881 -0.1605 247 GLN A OE1 
2010 N NE2 . GLN A 252 ? 0.6926 1.8132 1.0710 0.2343  -0.2058 -0.1667 247 GLN A NE2 
2011 N N   . LYS A 253 ? 0.7525 1.6357 1.0532 0.2011  -0.2247 -0.1246 248 LYS A N   
2012 C CA  . LYS A 253 ? 0.7769 1.6657 1.0737 0.1970  -0.2344 -0.1208 248 LYS A CA  
2013 C C   . LYS A 253 ? 0.8139 1.6816 1.1049 0.2151  -0.2582 -0.1142 248 LYS A C   
2014 O O   . LYS A 253 ? 0.8308 1.7201 1.1271 0.2208  -0.2701 -0.1163 248 LYS A O   
2015 C CB  . LYS A 253 ? 0.7701 1.6404 1.0508 0.1742  -0.2247 -0.1115 248 LYS A CB  
2016 C CG  . LYS A 253 ? 0.7726 1.6607 1.0501 0.1682  -0.2321 -0.1135 248 LYS A CG  
2017 C CD  . LYS A 253 ? 0.7703 1.6378 1.0262 0.1557  -0.2273 -0.1075 248 LYS A CD  
2018 C CE  . LYS A 253 ? 0.7664 1.6592 1.0217 0.1506  -0.2340 -0.1183 248 LYS A CE  
2019 N NZ  . LYS A 253 ? 0.7467 1.6481 1.0249 0.1354  -0.2299 -0.1336 248 LYS A NZ  
2020 N N   . GLU A 254 ? 0.8391 1.6652 1.1236 0.2229  -0.2681 -0.1042 249 GLU A N   
2021 C CA  . GLU A 254 ? 0.8773 1.6760 1.1593 0.2319  -0.2948 -0.0863 249 GLU A CA  
2022 C C   . GLU A 254 ? 0.9041 1.6921 1.2095 0.2602  -0.3239 -0.0971 249 GLU A C   
2023 O O   . GLU A 254 ? 0.9032 1.7274 1.2257 0.2775  -0.3266 -0.1219 249 GLU A O   
2024 C CB  . GLU A 254 ? 0.8848 1.6451 1.1478 0.2168  -0.2941 -0.0588 249 GLU A CB  
2025 C CG  . GLU A 254 ? 0.8820 1.6587 1.1220 0.1944  -0.2730 -0.0510 249 GLU A CG  
2026 C CD  . GLU A 254 ? 0.9116 1.7225 1.1449 0.1920  -0.2800 -0.0455 249 GLU A CD  
2027 O OE1 . GLU A 254 ? 0.9391 1.7570 1.1830 0.2043  -0.3016 -0.0394 249 GLU A OE1 
2028 O OE2 . GLU A 254 ? 0.9130 1.7455 1.1316 0.1794  -0.2663 -0.0494 249 GLU A OE2 
2029 N N   . LEU A 255 ? 0.9331 1.6741 1.2425 0.2651  -0.3485 -0.0783 250 LEU A N   
2030 C CA  . LEU A 255 ? 0.9687 1.6860 1.3056 0.2908  -0.3901 -0.0815 250 LEU A CA  
2031 C C   . LEU A 255 ? 0.9707 1.7151 1.3327 0.3241  -0.4017 -0.1235 250 LEU A C   
2032 O O   . LEU A 255 ? 0.9523 1.7240 1.3143 0.3313  -0.3809 -0.1497 250 LEU A O   
2033 C CB  . LEU A 255 ? 0.9944 1.6527 1.3394 0.2896  -0.4138 -0.0598 250 LEU A CB  
2034 C CG  . LEU A 255 ? 0.9916 1.6294 1.3444 0.3025  -0.4109 -0.0834 250 LEU A CG  
2035 C CD1 . LEU A 255 ? 1.0384 1.6157 1.4178 0.3135  -0.4557 -0.0700 250 LEU A CD1 
2036 C CD2 . LEU A 255 ? 0.9584 1.6025 1.2827 0.2783  -0.3689 -0.0780 250 LEU A CD2 
2037 N N   . GLY A 256 ? 1.3026 1.7139 1.2887 -0.1534 0.0689  0.5500  251 GLY A N   
2038 C CA  . GLY A 256 ? 1.2848 1.8322 1.2812 -0.1186 0.0997  0.5757  251 GLY A CA  
2039 C C   . GLY A 256 ? 1.2578 1.7906 1.1927 -0.0411 0.1101  0.5380  251 GLY A C   
2040 O O   . GLY A 256 ? 1.2724 1.8881 1.1874 0.0009  0.1399  0.5527  251 GLY A O   
2041 N N   . GLY A 257 ? 1.2272 1.6518 1.1283 -0.0247 0.0860  0.4896  252 GLY A N   
2042 C CA  . GLY A 257 ? 1.2039 1.5937 1.0432 0.0355  0.0867  0.4489  252 GLY A CA  
2043 C C   . GLY A 257 ? 1.1506 1.4830 0.9893 0.0491  0.0634  0.3959  252 GLY A C   
2044 O O   . GLY A 257 ? 1.1408 1.4543 0.9352 0.0946  0.0639  0.3608  252 GLY A O   
2045 N N   . GLU A 258 ? 1.1243 1.4229 1.0053 0.0065  0.0429  0.3905  253 GLU A N   
2046 C CA  . GLU A 258 ? 1.0838 1.3417 0.9702 0.0134  0.0223  0.3468  253 GLU A CA  
2047 C C   . GLU A 258 ? 1.0692 1.2359 0.9076 0.0419  0.0080  0.3076  253 GLU A C   
2048 O O   . GLU A 258 ? 1.0889 1.1985 0.9057 0.0362  0.0027  0.3143  253 GLU A O   
2049 C CB  . GLU A 258 ? 1.0852 1.3159 1.0130 -0.0439 0.0027  0.3494  253 GLU A CB  
2050 C CG  . GLU A 258 ? 1.0941 1.4277 1.0783 -0.0809 0.0066  0.3814  253 GLU A CG  
2051 C CD  . GLU A 258 ? 1.0960 1.4166 1.1078 -0.1198 -0.0197 0.3619  253 GLU A CD  
2052 O OE1 . GLU A 258 ? 1.1170 1.4928 1.1715 -0.1753 -0.0271 0.3895  253 GLU A OE1 
2053 O OE2 . GLU A 258 ? 1.0723 1.3315 1.0606 -0.0984 -0.0341 0.3206  253 GLU A OE2 
2054 N N   . GLU A 259 ? 1.0362 1.1944 0.8610 0.0717  0.0015  0.2718  254 GLU A N   
2055 C CA  . GLU A 259 ? 1.0212 1.0995 0.8125 0.0865  -0.0161 0.2362  254 GLU A CA  
2056 C C   . GLU A 259 ? 1.0137 1.0298 0.8268 0.0519  -0.0333 0.2324  254 GLU A C   
2057 O O   . GLU A 259 ? 1.0156 1.0417 0.8636 0.0177  -0.0362 0.2423  254 GLU A O   
2058 C CB  . GLU A 259 ? 1.0043 1.0802 0.7843 0.1146  -0.0205 0.2038  254 GLU A CB  
2059 C CG  . GLU A 259 ? 1.0320 1.1242 0.7643 0.1605  -0.0049 0.1927  254 GLU A CG  
2060 C CD  . GLU A 259 ? 1.0676 1.1092 0.7399 0.1719  -0.0105 0.1797  254 GLU A CD  
2061 O OE1 . GLU A 259 ? 1.0555 1.0357 0.7066 0.1696  -0.0306 0.1536  254 GLU A OE1 
2062 O OE2 . GLU A 259 ? 1.0823 1.1539 0.7281 0.1809  0.0045  0.1985  254 GLU A OE2 
2063 N N   . PRO A 260 ? 1.0139 0.9671 0.8039 0.0601  -0.0443 0.2189  255 PRO A N   
2064 C CA  . PRO A 260 ? 1.0121 0.9047 0.8184 0.0381  -0.0548 0.2116  255 PRO A CA  
2065 C C   . PRO A 260 ? 0.9878 0.8778 0.8058 0.0329  -0.0642 0.1829  255 PRO A C   
2066 O O   . PRO A 260 ? 0.9633 0.8702 0.7685 0.0564  -0.0672 0.1635  255 PRO A O   
2067 C CB  . PRO A 260 ? 1.0113 0.8624 0.7953 0.0587  -0.0624 0.2057  255 PRO A CB  
2068 C CG  . PRO A 260 ? 1.0020 0.8848 0.7546 0.0844  -0.0643 0.1949  255 PRO A CG  
2069 C CD  . PRO A 260 ? 1.0213 0.9603 0.7699 0.0877  -0.0484 0.2101  255 PRO A CD  
2070 N N   . GLU A 261 ? 1.0058 0.8701 0.8417 0.0005  -0.0692 0.1811  256 GLU A N   
2071 C CA  . GLU A 261 ? 0.9942 0.8570 0.8357 -0.0080 -0.0803 0.1560  256 GLU A CA  
2072 C C   . GLU A 261 ? 0.9952 0.7908 0.8176 0.0045  -0.0852 0.1334  256 GLU A C   
2073 O O   . GLU A 261 ? 1.0329 0.7760 0.8485 0.0025  -0.0805 0.1403  256 GLU A O   
2074 C CB  . GLU A 261 ? 1.0232 0.8890 0.8828 -0.0548 -0.0863 0.1629  256 GLU A CB  
2075 C CG  . GLU A 261 ? 1.0475 0.9655 0.9306 -0.0792 -0.0779 0.1992  256 GLU A CG  
2076 C CD  . GLU A 261 ? 1.0473 1.0445 0.9634 -0.1117 -0.0861 0.2102  256 GLU A CD  
2077 O OE1 . GLU A 261 ? 1.0561 1.0323 0.9702 -0.1415 -0.1032 0.1919  256 GLU A OE1 
2078 O OE2 . GLU A 261 ? 1.0340 1.1216 0.9774 -0.1068 -0.0752 0.2393  256 GLU A OE2 
2079 N N   . PRO A 262 ? 0.9638 0.7630 0.7783 0.0206  -0.0922 0.1109  257 PRO A N   
2080 C CA  . PRO A 262 ? 0.9659 0.7161 0.7672 0.0329  -0.0938 0.0954  257 PRO A CA  
2081 C C   . PRO A 262 ? 1.0092 0.7006 0.8056 0.0146  -0.0898 0.0912  257 PRO A C   
2082 O O   . PRO A 262 ? 1.0377 0.7212 0.8328 -0.0152 -0.0939 0.0858  257 PRO A O   
2083 C CB  . PRO A 262 ? 0.9380 0.7017 0.7332 0.0399  -0.1020 0.0756  257 PRO A CB  
2084 C CG  . PRO A 262 ? 0.9349 0.7486 0.7415 0.0307  -0.1056 0.0807  257 PRO A CG  
2085 C CD  . PRO A 262 ? 0.9415 0.7883 0.7596 0.0303  -0.0972 0.1033  257 PRO A CD  
2086 N N   . SER A 263 ? 1.0281 0.6780 0.8188 0.0326  -0.0820 0.0947  258 SER A N   
2087 C CA  . SER A 263 ? 1.0984 0.6757 0.8758 0.0253  -0.0723 0.0921  258 SER A CA  
2088 C C   . SER A 263 ? 1.1193 0.6596 0.8782 0.0351  -0.0677 0.0660  258 SER A C   
2089 O O   . SER A 263 ? 1.0771 0.6485 0.8421 0.0566  -0.0687 0.0605  258 SER A O   
2090 C CB  . SER A 263 ? 1.1239 0.6758 0.9061 0.0461  -0.0616 0.1192  258 SER A CB  
2091 O OG  . SER A 263 ? 1.1190 0.6778 0.9070 0.0811  -0.0572 0.1207  258 SER A OG  
2092 N N   . LEU A 264 ? 1.1939 0.6650 0.9247 0.0155  -0.0625 0.0505  259 LEU A N   
2093 C CA  . LEU A 264 ? 1.2409 0.6655 0.9399 0.0242  -0.0539 0.0231  259 LEU A CA  
2094 C C   . LEU A 264 ? 1.3193 0.6655 1.0020 0.0536  -0.0307 0.0286  259 LEU A C   
2095 O O   . LEU A 264 ? 1.3815 0.6679 1.0541 0.0420  -0.0259 0.0403  259 LEU A O   
2096 C CB  . LEU A 264 ? 1.2922 0.6831 0.9560 -0.0197 -0.0649 -0.0022 259 LEU A CB  
2097 C CG  . LEU A 264 ? 1.2463 0.7080 0.9191 -0.0519 -0.0883 -0.0081 259 LEU A CG  
2098 C CD1 . LEU A 264 ? 1.2008 0.7075 0.8718 -0.0307 -0.0909 -0.0196 259 LEU A CD1 
2099 C CD2 . LEU A 264 ? 1.1940 0.7287 0.9103 -0.0633 -0.0990 0.0199  259 LEU A CD2 
2100 N N   . ARG A 265 ? 1.3271 0.6751 1.0089 0.0934  -0.0147 0.0245  260 ARG A N   
2101 C CA  . ARG A 265 ? 1.4068 0.6921 1.0792 0.1346  0.0115  0.0356  260 ARG A CA  
2102 C C   . ARG A 265 ? 1.4310 0.7182 1.0933 0.1755  0.0338  0.0240  260 ARG A C   
2103 O O   . ARG A 265 ? 1.3718 0.7234 1.0432 0.1711  0.0266  0.0141  260 ARG A O   
2104 C CB  . ARG A 265 ? 1.3745 0.7035 1.0915 0.1580  0.0104  0.0779  260 ARG A CB  
2105 C CG  . ARG A 265 ? 1.2741 0.7161 1.0342 0.1562  -0.0095 0.0931  260 ARG A CG  
2106 C CD  . ARG A 265 ? 1.2734 0.7621 1.0689 0.1901  -0.0074 0.1318  260 ARG A CD  
2107 N NE  . ARG A 265 ? 1.2987 0.8086 1.1103 0.2325  0.0100  0.1402  260 ARG A NE  
2108 C CZ  . ARG A 265 ? 1.2424 0.8311 1.0788 0.2364  0.0032  0.1403  260 ARG A CZ  
2109 N NH1 . ARG A 265 ? 1.1648 0.8030 1.0054 0.2026  -0.0208 0.1291  260 ARG A NH1 
2110 N NH2 . ARG A 265 ? 1.2665 0.8831 1.1230 0.2756  0.0227  0.1542  260 ARG A NH2 
2111 N N   . GLU A 266 ? 1.5293 0.7420 1.1700 0.2170  0.0634  0.0278  261 GLU A N   
2112 C CA  . GLU A 266 ? 1.5535 0.7889 1.2021 0.2736  0.0925  0.0338  261 GLU A CA  
2113 C C   . GLU A 266 ? 1.5755 0.8097 1.1852 0.2738  0.1042  -0.0010 261 GLU A C   
2114 O O   . GLU A 266 ? 1.5253 0.7959 1.1271 0.2307  0.0808  -0.0201 261 GLU A O   
2115 C CB  . GLU A 266 ? 1.4561 0.8172 1.1797 0.2956  0.0834  0.0759  261 GLU A CB  
2116 C CG  . GLU A 266 ? 1.4925 0.8522 1.2469 0.3421  0.0977  0.1180  261 GLU A CG  
2117 C CD  . GLU A 266 ? 1.5603 0.8360 1.2942 0.3248  0.0912  0.1266  261 GLU A CD  
2118 O OE1 . GLU A 266 ? 1.4953 0.8160 1.2510 0.2874  0.0627  0.1394  261 GLU A OE1 
2119 O OE2 . GLU A 266 ? 1.6647 0.8248 1.3567 0.3498  0.1170  0.1217  261 GLU A OE2 
2120 N N   . GLY A 267 ? 1.6530 0.8512 1.2384 0.3275  0.1426  -0.0053 262 GLY A N   
2121 C CA  . GLY A 267 ? 1.6862 0.8854 1.2281 0.3347  0.1601  -0.0355 262 GLY A CA  
2122 C C   . GLY A 267 ? 1.6214 0.9418 1.2101 0.3656  0.1742  -0.0135 262 GLY A C   
2123 O O   . GLY A 267 ? 1.6947 0.9980 1.2479 0.4065  0.2112  -0.0256 262 GLY A O   
2124 N N   . PRO A 268 ? 1.4943 0.9345 1.1565 0.3444  0.1463  0.0182  263 PRO A N   
2125 C CA  . PRO A 268 ? 1.4408 0.9889 1.1398 0.3599  0.1571  0.0374  263 PRO A CA  
2126 C C   . PRO A 268 ? 1.3938 0.9641 1.0657 0.3145  0.1384  0.0149  263 PRO A C   
2127 O O   . PRO A 268 ? 1.3091 0.9315 1.0130 0.2737  0.1037  0.0250  263 PRO A O   
2128 C CB  . PRO A 268 ? 1.3504 1.0034 1.1343 0.3563  0.1347  0.0835  263 PRO A CB  
2129 C CG  . PRO A 268 ? 1.3365 0.9397 1.1197 0.3286  0.1058  0.0818  263 PRO A CG  
2130 C CD  . PRO A 268 ? 1.4097 0.8919 1.1195 0.3092  0.1084  0.0393  263 PRO A CD  
2131 N N   . GLY A 269 ? 1.4605 0.9866 1.0674 0.3252  0.1627  -0.0146 264 GLY A N   
2132 C CA  . GLY A 269 ? 1.4313 0.9694 1.0004 0.2852  0.1460  -0.0354 264 GLY A CA  
2133 C C   . GLY A 269 ? 1.4333 0.8988 0.9578 0.2375  0.1138  -0.0668 264 GLY A C   
2134 O O   . GLY A 269 ? 1.3669 0.8735 0.9095 0.1967  0.0797  -0.0622 264 GLY A O   
2135 N N   . GLY A 270 ? 1.5204 0.8775 0.9862 0.2433  0.1256  -0.0964 265 GLY A N   
2136 C CA  . GLY A 270 ? 1.5270 0.8171 0.9564 0.1937  0.0950  -0.1214 265 GLY A CA  
2137 C C   . GLY A 270 ? 1.4585 0.7555 0.9458 0.1815  0.0748  -0.0973 265 GLY A C   
2138 O O   . GLY A 270 ? 1.4449 0.7565 0.9769 0.2183  0.0905  -0.0700 265 GLY A O   
2139 N N   . LEU A 271 ? 1.4175 0.7128 0.9045 0.1312  0.0406  -0.1038 266 LEU A N   
2140 C CA  . LEU A 271 ? 1.3425 0.6592 0.8826 0.1166  0.0212  -0.0789 266 LEU A CA  
2141 C C   . LEU A 271 ? 1.2122 0.6367 0.8185 0.1183  0.0046  -0.0492 266 LEU A C   
2142 O O   . LEU A 271 ? 1.1716 0.6498 0.7813 0.1168  0.0003  -0.0490 266 LEU A O   
2143 C CB  . LEU A 271 ? 1.3715 0.6517 0.8867 0.0629  -0.0053 -0.0942 266 LEU A CB  
2144 C CG  . LEU A 271 ? 1.3473 0.6269 0.9010 0.0462  -0.0180 -0.0710 266 LEU A CG  
2145 C CD1 . LEU A 271 ? 1.4368 0.6165 0.9688 0.0651  0.0044  -0.0687 266 LEU A CD1 
2146 C CD2 . LEU A 271 ? 1.3536 0.6485 0.9008 -0.0101 -0.0478 -0.0781 266 LEU A CD2 
2147 N N   . VAL A 272 ? 1.1496 0.5968 0.8005 0.1196  -0.0046 -0.0243 267 VAL A N   
2148 C CA  . VAL A 272 ? 1.0395 0.5696 0.7401 0.1191  -0.0210 -0.0002 267 VAL A CA  
2149 C C   . VAL A 272 ? 0.9930 0.5343 0.7054 0.0896  -0.0441 0.0048  267 VAL A C   
2150 O O   . VAL A 272 ? 1.0309 0.5255 0.7317 0.0767  -0.0434 0.0032  267 VAL A O   
2151 C CB  . VAL A 272 ? 1.0238 0.5840 0.7637 0.1547  -0.0081 0.0285  267 VAL A CB  
2152 C CG1 . VAL A 272 ? 1.0392 0.5799 0.7952 0.1577  -0.0117 0.0473  267 VAL A CG1 
2153 C CG2 . VAL A 272 ? 0.9639 0.6046 0.7392 0.1527  -0.0212 0.0459  267 VAL A CG2 
2154 N N   . MET A 273 ? 0.9079 0.5065 0.6396 0.0794  -0.0621 0.0119  268 MET A N   
2155 C CA  . MET A 273 ? 0.8670 0.4881 0.6147 0.0650  -0.0770 0.0228  268 MET A CA  
2156 C C   . MET A 273 ? 0.8159 0.4810 0.5874 0.0778  -0.0842 0.0404  268 MET A C   
2157 O O   . MET A 273 ? 0.7974 0.4858 0.5723 0.0834  -0.0877 0.0409  268 MET A O   
2158 C CB  . MET A 273 ? 0.8616 0.5009 0.5995 0.0402  -0.0917 0.0131  268 MET A CB  
2159 C CG  . MET A 273 ? 0.8664 0.5293 0.6209 0.0262  -0.0999 0.0263  268 MET A CG  
2160 S SD  . MET A 273 ? 0.8846 0.5975 0.6416 0.0033  -0.1166 0.0248  268 MET A SD  
2161 C CE  . MET A 273 ? 0.8618 0.6212 0.6321 0.0315  -0.1198 0.0360  268 MET A CE  
2162 N N   . GLU A 274 ? 0.8037 0.4767 0.5862 0.0787  -0.0871 0.0554  269 GLU A N   
2163 C CA  . GLU A 274 ? 0.7713 0.4786 0.5635 0.0876  -0.0957 0.0692  269 GLU A CA  
2164 C C   . GLU A 274 ? 0.7555 0.4777 0.5440 0.0827  -0.1008 0.0777  269 GLU A C   
2165 O O   . GLU A 274 ? 0.7732 0.4834 0.5643 0.0749  -0.0946 0.0849  269 GLU A O   
2166 C CB  . GLU A 274 ? 0.7768 0.4898 0.5853 0.1052  -0.0897 0.0872  269 GLU A CB  
2167 C CG  . GLU A 274 ? 0.8377 0.5159 0.6487 0.1139  -0.0764 0.0994  269 GLU A CG  
2168 C CD  . GLU A 274 ? 0.8890 0.5781 0.7196 0.1409  -0.0685 0.1238  269 GLU A CD  
2169 O OE1 . GLU A 274 ? 0.9546 0.6090 0.7851 0.1528  -0.0574 0.1399  269 GLU A OE1 
2170 O OE2 . GLU A 274 ? 0.8755 0.6098 0.7236 0.1495  -0.0734 0.1310  269 GLU A OE2 
2171 N N   . GLY A 275 ? 0.7268 0.4716 0.5045 0.0860  -0.1107 0.0771  270 GLY A N   
2172 C CA  . GLY A 275 ? 0.7183 0.4804 0.4845 0.0882  -0.1111 0.0841  270 GLY A CA  
2173 C C   . GLY A 275 ? 0.7242 0.4905 0.4630 0.0944  -0.1211 0.0745  270 GLY A C   
2174 O O   . GLY A 275 ? 0.7032 0.4560 0.4353 0.0913  -0.1287 0.0631  270 GLY A O   
2175 N N   . HIS A 276 ? 0.7427 0.5212 0.4589 0.1018  -0.1200 0.0796  271 HIS A N   
2176 C CA  . HIS A 276 ? 0.7771 0.5420 0.4503 0.1086  -0.1276 0.0654  271 HIS A CA  
2177 C C   . HIS A 276 ? 0.7906 0.5435 0.4520 0.1216  -0.1205 0.0517  271 HIS A C   
2178 O O   . HIS A 276 ? 0.7729 0.5524 0.4572 0.1274  -0.1089 0.0590  271 HIS A O   
2179 C CB  . HIS A 276 ? 0.8016 0.5805 0.4427 0.1166  -0.1253 0.0729  271 HIS A CB  
2180 C CG  . HIS A 276 ? 0.8104 0.6012 0.4490 0.1062  -0.1392 0.0867  271 HIS A CG  
2181 N ND1 . HIS A 276 ? 0.8323 0.6118 0.4487 0.0925  -0.1604 0.0780  271 HIS A ND1 
2182 C CD2 . HIS A 276 ? 0.7748 0.5923 0.4310 0.1069  -0.1363 0.1131  271 HIS A CD2 
2183 C CE1 . HIS A 276 ? 0.8179 0.6291 0.4425 0.0866  -0.1713 0.0994  271 HIS A CE1 
2184 N NE2 . HIS A 276 ? 0.8021 0.6329 0.4497 0.0987  -0.1558 0.1215  271 HIS A NE2 
2185 N N   . LEU A 277 ? 0.8313 0.5450 0.4587 0.1237  -0.1292 0.0353  272 LEU A N   
2186 C CA  . LEU A 277 ? 0.8715 0.5623 0.4738 0.1461  -0.1211 0.0247  272 LEU A CA  
2187 C C   . LEU A 277 ? 0.9594 0.5887 0.4949 0.1503  -0.1287 0.0056  272 LEU A C   
2188 O O   . LEU A 277 ? 0.9735 0.5797 0.4929 0.1238  -0.1473 0.0004  272 LEU A O   
2189 C CB  . LEU A 277 ? 0.8477 0.5331 0.4754 0.1423  -0.1237 0.0254  272 LEU A CB  
2190 C CG  . LEU A 277 ? 0.7813 0.5126 0.4593 0.1349  -0.1193 0.0373  272 LEU A CG  
2191 C CD1 . LEU A 277 ? 0.7246 0.4426 0.4095 0.1292  -0.1253 0.0353  272 LEU A CD1 
2192 C CD2 . LEU A 277 ? 0.7818 0.5603 0.4750 0.1523  -0.1064 0.0481  272 LEU A CD2 
2193 N N   . PHE A 278 ? 1.0231 0.6268 0.5172 0.1834  -0.1140 -0.0039 273 PHE A N   
2194 C CA  . PHE A 278 ? 1.1260 0.6444 0.5434 0.1903  -0.1188 -0.0273 273 PHE A CA  
2195 C C   . PHE A 278 ? 1.1527 0.6211 0.5720 0.1852  -0.1262 -0.0295 273 PHE A C   
2196 O O   . PHE A 278 ? 1.1118 0.6114 0.5736 0.2013  -0.1172 -0.0153 273 PHE A O   
2197 C CB  . PHE A 278 ? 1.1904 0.6908 0.5563 0.2383  -0.0937 -0.0367 273 PHE A CB  
2198 C CG  . PHE A 278 ? 1.2104 0.7399 0.5464 0.2426  -0.0863 -0.0384 273 PHE A CG  
2199 C CD1 . PHE A 278 ? 1.2999 0.7647 0.5515 0.2312  -0.0979 -0.0632 273 PHE A CD1 
2200 C CD2 . PHE A 278 ? 1.1518 0.7724 0.5387 0.2543  -0.0691 -0.0138 273 PHE A CD2 
2201 C CE1 . PHE A 278 ? 1.3232 0.8185 0.5388 0.2361  -0.0915 -0.0631 273 PHE A CE1 
2202 C CE2 . PHE A 278 ? 1.1783 0.8281 0.5351 0.2585  -0.0605 -0.0101 273 PHE A CE2 
2203 C CZ  . PHE A 278 ? 1.2596 0.8486 0.5290 0.2523  -0.0710 -0.0348 273 PHE A CZ  
2204 N N   . LYS A 279 ? 1.2258 0.6198 0.5976 0.1583  -0.1446 -0.0445 274 LYS A N   
2205 C CA  . LYS A 279 ? 1.2724 0.6090 0.6365 0.1517  -0.1504 -0.0434 274 LYS A CA  
2206 C C   . LYS A 279 ? 1.4113 0.6259 0.6821 0.1520  -0.1555 -0.0675 274 LYS A C   
2207 O O   . LYS A 279 ? 1.4651 0.6408 0.6866 0.1191  -0.1736 -0.0849 274 LYS A O   
2208 C CB  . LYS A 279 ? 1.2112 0.5837 0.6276 0.1059  -0.1690 -0.0284 274 LYS A CB  
2209 C CG  . LYS A 279 ? 1.2367 0.6158 0.6449 0.0614  -0.1917 -0.0321 274 LYS A CG  
2210 C CD  . LYS A 279 ? 1.2835 0.6352 0.6957 0.0180  -0.2105 -0.0244 274 LYS A CD  
2211 C CE  . LYS A 279 ? 1.3238 0.6771 0.7152 -0.0300 -0.2379 -0.0282 274 LYS A CE  
2212 N NZ  . LYS A 279 ? 1.4327 0.7138 0.7367 -0.0282 -0.2452 -0.0564 274 LYS A NZ  
2213 N N   . ARG A 280 ? 1.4806 0.6327 0.7231 0.1904  -0.1399 -0.0676 275 ARG A N   
2214 C CA  . ARG A 280 ? 1.6331 0.6440 0.7846 0.1897  -0.1440 -0.0878 275 ARG A CA  
2215 C C   . ARG A 280 ? 1.6360 0.6203 0.8001 0.1253  -0.1724 -0.0792 275 ARG A C   
2216 O O   . ARG A 280 ? 1.5542 0.6071 0.7908 0.1128  -0.1750 -0.0529 275 ARG A O   
2217 C CB  . ARG A 280 ? 1.6907 0.6519 0.8235 0.2529  -0.1182 -0.0794 275 ARG A CB  
2218 C CG  . ARG A 280 ? 1.8743 0.6669 0.9057 0.2590  -0.1184 -0.0984 275 ARG A CG  
2219 C CD  . ARG A 280 ? 1.9559 0.7064 0.9832 0.3222  -0.0947 -0.0783 275 ARG A CD  
2220 N NE  . ARG A 280 ? 2.0075 0.7753 1.0175 0.4038  -0.0593 -0.0809 275 ARG A NE  
2221 C CZ  . ARG A 280 ? 2.1625 0.8153 1.0709 0.4467  -0.0388 -0.1106 275 ARG A CZ  
2222 N NH1 . ARG A 280 ? 2.3116 0.8093 1.1171 0.4091  -0.0545 -0.1450 275 ARG A NH1 
2223 N NH2 . ARG A 280 ? 2.1793 0.8742 1.0861 0.5262  -0.0020 -0.1059 275 ARG A NH2 
2224 N N   . ALA A 281 ? 1.7434 0.6370 0.8371 0.0806  -0.1942 -0.1003 276 ALA A N   
2225 C CA  . ALA A 281 ? 1.7662 0.6361 0.8711 0.0154  -0.2209 -0.0875 276 ALA A CA  
2226 C C   . ALA A 281 ? 1.8660 0.6211 0.9292 0.0326  -0.2116 -0.0811 276 ALA A C   
2227 O O   . ALA A 281 ? 1.9949 0.6287 0.9720 0.0702  -0.1980 -0.1030 276 ALA A O   
2228 C CB  . ALA A 281 ? 1.8487 0.6726 0.8960 -0.0476 -0.2525 -0.1087 276 ALA A CB  
2229 N N   . SER A 282 ? 1.8171 0.6089 0.9374 0.0080  -0.2170 -0.0494 277 SER A N   
2230 C CA  . SER A 282 ? 1.8572 0.5953 0.9727 0.0422  -0.2012 -0.0279 277 SER A CA  
2231 C C   . SER A 282 ? 2.0179 0.5961 1.0556 0.0134  -0.2110 -0.0261 277 SER A C   
2232 O O   . SER A 282 ? 2.0134 0.5922 1.0787 -0.0094 -0.2148 0.0061  277 SER A O   
2233 C CB  . SER A 282 ? 1.7164 0.5844 0.9295 0.0385  -0.1978 0.0074  277 SER A CB  
2234 O OG  . SER A 282 ? 1.7473 0.5890 0.9607 0.0800  -0.1823 0.0311  277 SER A OG  
2235 N N   . ASN A 283 ? 2.1738 0.6091 1.1081 0.0143  -0.2138 -0.0602 278 ASN A N   
2236 C CA  . ASN A 283 ? 2.3600 0.6109 1.2032 0.0048  -0.2157 -0.0615 278 ASN A CA  
2237 C C   . ASN A 283 ? 2.5346 0.6275 1.2554 0.0455  -0.2030 -0.1059 278 ASN A C   
2238 O O   . ASN A 283 ? 2.6889 0.6482 1.3151 -0.0089 -0.2246 -0.1362 278 ASN A O   
2239 C CB  . ASN A 283 ? 2.4085 0.6211 1.2455 -0.0967 -0.2503 -0.0487 278 ASN A CB  
2240 C CG  . ASN A 283 ? 2.5567 0.6115 1.3346 -0.1071 -0.2487 -0.0277 278 ASN A CG  
2241 O OD1 . ASN A 283 ? 2.7006 0.5919 1.3835 -0.0587 -0.2319 -0.0453 278 ASN A OD1 
2242 N ND2 . ASN A 283 ? 2.5128 0.6155 1.3450 -0.1681 -0.2638 0.0125  278 ASN A ND2 
2243 N N   . ALA A 284 ? 2.5212 0.6323 1.2414 0.1405  -0.1675 -0.1091 279 ALA A N   
2244 C CA  . ALA A 284 ? 2.6787 0.6588 1.2870 0.2001  -0.1442 -0.1495 279 ALA A CA  
2245 C C   . ALA A 284 ? 2.7262 0.6832 1.2698 0.1527  -0.1640 -0.1964 279 ALA A C   
2246 O O   . ALA A 284 ? 2.9069 0.7068 1.3233 0.1709  -0.1557 -0.2384 279 ALA A O   
2247 C CB  . ALA A 284 ? 2.8969 0.6553 1.3963 0.2228  -0.1334 -0.1529 279 ALA A CB  
2248 N N   . PHE A 285 ? 2.5717 0.6846 1.1992 0.0951  -0.1893 -0.1878 280 PHE A N   
2249 C CA  . PHE A 285 ? 2.6001 0.7185 1.1814 0.0397  -0.2157 -0.2220 280 PHE A CA  
2250 C C   . PHE A 285 ? 2.6391 0.7488 1.1583 0.1072  -0.1878 -0.2559 280 PHE A C   
2251 O O   . PHE A 285 ? 2.7990 0.7830 1.1934 0.0929  -0.1952 -0.3007 280 PHE A O   
2252 C CB  . PHE A 285 ? 2.4149 0.7201 1.1141 -0.0201 -0.2429 -0.1953 280 PHE A CB  
2253 C CG  . PHE A 285 ? 2.4336 0.7311 1.1571 -0.1130 -0.2803 -0.1753 280 PHE A CG  
2254 C CD1 . PHE A 285 ? 2.6115 0.7832 1.2378 -0.1878 -0.3143 -0.2015 280 PHE A CD1 
2255 C CD2 . PHE A 285 ? 2.2996 0.7204 1.1404 -0.1287 -0.2817 -0.1298 280 PHE A CD2 
2256 C CE1 . PHE A 285 ? 2.6309 0.8104 1.2875 -0.2793 -0.3494 -0.1767 280 PHE A CE1 
2257 C CE2 . PHE A 285 ? 2.3156 0.7450 1.1842 -0.2116 -0.3117 -0.1060 280 PHE A CE2 
2258 C CZ  . PHE A 285 ? 2.4749 0.7902 1.2573 -0.2885 -0.3460 -0.1266 280 PHE A CZ  
2259 N N   . LYS A 286 ? 2.4953 0.7385 1.0982 0.1779  -0.1559 -0.2334 281 LYS A N   
2260 C CA  . LYS A 286 ? 2.5014 0.7749 1.0707 0.2486  -0.1228 -0.2529 281 LYS A CA  
2261 C C   . LYS A 286 ? 2.3784 0.7961 0.9963 0.2166  -0.1375 -0.2535 281 LYS A C   
2262 O O   . LYS A 286 ? 2.4321 0.8488 0.9893 0.2482  -0.1212 -0.2783 281 LYS A O   
2263 C CB  . LYS A 286 ? 2.7320 0.8105 1.1373 0.2801  -0.1071 -0.3022 281 LYS A CB  
2264 C CG  . LYS A 286 ? 2.8315 0.8078 1.1953 0.3725  -0.0639 -0.2977 281 LYS A CG  
2265 C CD  . LYS A 286 ? 3.0748 0.8324 1.2604 0.4012  -0.0479 -0.3517 281 LYS A CD  
2266 C CE  . LYS A 286 ? 3.1573 0.8634 1.3087 0.5255  0.0108  -0.3468 281 LYS A CE  
2267 N NZ  . LYS A 286 ? 3.1591 0.8322 1.3619 0.5594  0.0208  -0.3051 281 LYS A NZ  
2268 N N   . THR A 287 ? 2.2214 0.7622 0.9449 0.1589  -0.1654 -0.2240 282 THR A N   
2269 C CA  . THR A 287 ? 2.1154 0.7806 0.8807 0.1278  -0.1812 -0.2208 282 THR A CA  
2270 C C   . THR A 287 ? 1.9155 0.7513 0.8129 0.1502  -0.1676 -0.1818 282 THR A C   
2271 O O   . THR A 287 ? 1.8067 0.7139 0.7927 0.1164  -0.1828 -0.1537 282 THR A O   
2272 C CB  . THR A 287 ? 2.1376 0.7972 0.8909 0.0345  -0.2299 -0.2258 282 THR A CB  
2273 O OG1 . THR A 287 ? 2.3119 0.8038 0.9634 -0.0011 -0.2471 -0.2520 282 THR A OG1 
2274 C CG2 . THR A 287 ? 2.1421 0.8525 0.8583 0.0165  -0.2438 -0.2420 282 THR A CG2 
2275 N N   . TRP A 288 ? 1.8760 0.7717 0.7794 0.2066  -0.1373 -0.1808 283 TRP A N   
2276 C CA  . TRP A 288 ? 1.7048 0.7538 0.7183 0.2193  -0.1268 -0.1477 283 TRP A CA  
2277 C C   . TRP A 288 ? 1.6418 0.7627 0.6778 0.1678  -0.1532 -0.1433 283 TRP A C   
2278 O O   . TRP A 288 ? 1.6946 0.8141 0.6719 0.1702  -0.1528 -0.1590 283 TRP A O   
2279 C CB  . TRP A 288 ? 1.7046 0.7972 0.7178 0.2917  -0.0858 -0.1428 283 TRP A CB  
2280 C CG  . TRP A 288 ? 1.7280 0.7850 0.7470 0.3473  -0.0603 -0.1338 283 TRP A CG  
2281 C CD1 . TRP A 288 ? 1.8657 0.8166 0.7966 0.4035  -0.0345 -0.1540 283 TRP A CD1 
2282 C CD2 . TRP A 288 ? 1.6136 0.7387 0.7267 0.3537  -0.0590 -0.1007 283 TRP A CD2 
2283 N NE1 . TRP A 288 ? 1.8414 0.7983 0.8141 0.4481  -0.0172 -0.1301 283 TRP A NE1 
2284 C CE2 . TRP A 288 ? 1.6843 0.7516 0.7678 0.4154  -0.0338 -0.0974 283 TRP A CE2 
2285 C CE3 . TRP A 288 ? 1.4575 0.6840 0.6704 0.3160  -0.0757 -0.0740 283 TRP A CE3 
2286 C CZ2 . TRP A 288 ? 1.6153 0.7344 0.7693 0.4360  -0.0292 -0.0651 283 TRP A CZ2 
2287 C CZ3 . TRP A 288 ? 1.3987 0.6668 0.6724 0.3337  -0.0703 -0.0481 283 TRP A CZ3 
2288 C CH2 . TRP A 288 ? 1.4880 0.7089 0.7345 0.3912  -0.0494 -0.0422 283 TRP A CH2 
2289 N N   . SER A 289 ? 1.5327 0.7145 0.6492 0.1243  -0.1752 -0.1201 284 SER A N   
2290 C CA  . SER A 289 ? 1.4638 0.7211 0.6163 0.0790  -0.2006 -0.1073 284 SER A CA  
2291 C C   . SER A 289 ? 1.3111 0.6851 0.5711 0.0898  -0.1892 -0.0739 284 SER A C   
2292 O O   . SER A 289 ? 1.2411 0.6348 0.5601 0.0948  -0.1822 -0.0593 284 SER A O   
2293 C CB  . SER A 289 ? 1.4951 0.7204 0.6459 0.0177  -0.2354 -0.1071 284 SER A CB  
2294 O OG  . SER A 289 ? 1.4786 0.7663 0.6416 -0.0249 -0.2634 -0.0976 284 SER A OG  
2295 N N   . ARG A 290 ? 1.2644 0.7075 0.5410 0.0920  -0.1879 -0.0621 285 ARG A N   
2296 C CA  . ARG A 290 ? 1.1440 0.6788 0.5080 0.1010  -0.1762 -0.0325 285 ARG A CA  
2297 C C   . ARG A 290 ? 1.0849 0.6651 0.5064 0.0636  -0.1983 -0.0129 285 ARG A C   
2298 O O   . ARG A 290 ? 1.1124 0.7080 0.5164 0.0359  -0.2215 -0.0094 285 ARG A O   
2299 C CB  . ARG A 290 ? 1.1409 0.7209 0.4925 0.1218  -0.1619 -0.0239 285 ARG A CB  
2300 C CG  . ARG A 290 ? 1.0668 0.7259 0.4985 0.1283  -0.1489 0.0074  285 ARG A CG  
2301 C CD  . ARG A 290 ? 1.0842 0.7765 0.4966 0.1544  -0.1269 0.0163  285 ARG A CD  
2302 N NE  . ARG A 290 ? 1.0239 0.7812 0.5004 0.1520  -0.1173 0.0486  285 ARG A NE  
2303 C CZ  . ARG A 290 ? 0.9892 0.7797 0.5132 0.1641  -0.0971 0.0627  285 ARG A CZ  
2304 N NH1 . ARG A 290 ? 0.9760 0.7562 0.4999 0.1843  -0.0842 0.0509  285 ARG A NH1 
2305 N NH2 . ARG A 290 ? 0.9528 0.7861 0.5240 0.1541  -0.0911 0.0911  285 ARG A NH2 
2306 N N   . ARG A 291 ? 1.0065 0.6114 0.4933 0.0645  -0.1910 0.0006  286 ARG A N   
2307 C CA  . ARG A 291 ? 0.9481 0.6018 0.4936 0.0410  -0.2027 0.0213  286 ARG A CA  
2308 C C   . ARG A 291 ? 0.8640 0.5633 0.4727 0.0590  -0.1834 0.0389  286 ARG A C   
2309 O O   . ARG A 291 ? 0.8447 0.5404 0.4572 0.0808  -0.1653 0.0355  286 ARG A O   
2310 C CB  . ARG A 291 ? 0.9611 0.5873 0.5098 0.0145  -0.2157 0.0182  286 ARG A CB  
2311 C CG  . ARG A 291 ? 1.0436 0.6673 0.5662 -0.0266 -0.2457 0.0186  286 ARG A CG  
2312 C CD  . ARG A 291 ? 1.1687 0.7073 0.6012 -0.0348 -0.2561 -0.0105 286 ARG A CD  
2313 N NE  . ARG A 291 ? 1.2504 0.7695 0.6509 -0.0871 -0.2893 -0.0135 286 ARG A NE  
2314 C CZ  . ARG A 291 ? 1.3313 0.8258 0.6640 -0.1099 -0.3118 -0.0289 286 ARG A CZ  
2315 N NH1 . ARG A 291 ? 1.3474 0.8352 0.6365 -0.0786 -0.3002 -0.0416 286 ARG A NH1 
2316 N NH2 . ARG A 291 ? 1.3990 0.8790 0.7048 -0.1677 -0.3468 -0.0301 286 ARG A NH2 
2317 N N   . TRP A 292 ? 0.8279 0.5704 0.4834 0.0492  -0.1878 0.0587  287 TRP A N   
2318 C CA  . TRP A 292 ? 0.7699 0.5385 0.4753 0.0639  -0.1701 0.0729  287 TRP A CA  
2319 C C   . TRP A 292 ? 0.7502 0.5116 0.4796 0.0602  -0.1638 0.0691  287 TRP A C   
2320 O O   . TRP A 292 ? 0.7372 0.5194 0.4863 0.0474  -0.1708 0.0785  287 TRP A O   
2321 C CB  . TRP A 292 ? 0.7539 0.5674 0.4898 0.0648  -0.1745 0.0985  287 TRP A CB  
2322 C CG  . TRP A 292 ? 0.7061 0.5276 0.4802 0.0842  -0.1544 0.1138  287 TRP A CG  
2323 C CD1 . TRP A 292 ? 0.6897 0.5257 0.5013 0.0931  -0.1446 0.1259  287 TRP A CD1 
2324 C CD2 . TRP A 292 ? 0.6714 0.4799 0.4433 0.0960  -0.1406 0.1194  287 TRP A CD2 
2325 N NE1 . TRP A 292 ? 0.6673 0.4839 0.4917 0.1110  -0.1258 0.1343  287 TRP A NE1 
2326 C CE2 . TRP A 292 ? 0.6693 0.4697 0.4721 0.1083  -0.1251 0.1321  287 TRP A CE2 
2327 C CE3 . TRP A 292 ? 0.6634 0.4666 0.4084 0.0972  -0.1379 0.1168  287 TRP A CE3 
2328 C CZ2 . TRP A 292 ? 0.6778 0.4543 0.4830 0.1144  -0.1110 0.1418  287 TRP A CZ2 
2329 C CZ3 . TRP A 292 ? 0.6569 0.4551 0.4135 0.1030  -0.1229 0.1312  287 TRP A CZ3 
2330 C CH2 . TRP A 292 ? 0.6652 0.4448 0.4507 0.1078  -0.1115 0.1431  287 TRP A CH2 
2331 N N   . PHE A 293 ? 0.7508 0.4930 0.4797 0.0706  -0.1506 0.0587  288 PHE A N   
2332 C CA  . PHE A 293 ? 0.7528 0.4880 0.4947 0.0683  -0.1441 0.0544  288 PHE A CA  
2333 C C   . PHE A 293 ? 0.7326 0.4801 0.5033 0.0753  -0.1294 0.0600  288 PHE A C   
2334 O O   . PHE A 293 ? 0.7400 0.4864 0.5175 0.0824  -0.1217 0.0638  288 PHE A O   
2335 C CB  . PHE A 293 ? 0.7584 0.4712 0.4801 0.0752  -0.1413 0.0424  288 PHE A CB  
2336 C CG  . PHE A 293 ? 0.8292 0.5080 0.5145 0.0734  -0.1513 0.0348  288 PHE A CG  
2337 C CD1 . PHE A 293 ? 0.8703 0.5312 0.5222 0.0795  -0.1558 0.0282  288 PHE A CD1 
2338 C CD2 . PHE A 293 ? 0.8485 0.5040 0.5245 0.0661  -0.1547 0.0343  288 PHE A CD2 
2339 C CE1 . PHE A 293 ? 0.9516 0.5601 0.5563 0.0793  -0.1632 0.0166  288 PHE A CE1 
2340 C CE2 . PHE A 293 ? 0.9138 0.5181 0.5487 0.0638  -0.1631 0.0279  288 PHE A CE2 
2341 C CZ  . PHE A 293 ? 0.9790 0.5531 0.5752 0.0710  -0.1673 0.0166  288 PHE A CZ  
2342 N N   . THR A 294 ? 0.7238 0.4769 0.5054 0.0729  -0.1238 0.0612  289 THR A N   
2343 C CA  . THR A 294 ? 0.7234 0.4723 0.5162 0.0829  -0.1062 0.0598  289 THR A CA  
2344 C C   . THR A 294 ? 0.7219 0.4603 0.4993 0.0781  -0.1013 0.0482  289 THR A C   
2345 O O   . THR A 294 ? 0.7179 0.4668 0.4924 0.0702  -0.1061 0.0525  289 THR A O   
2346 C CB  . THR A 294 ? 0.7258 0.5029 0.5464 0.0956  -0.0967 0.0779  289 THR A CB  
2347 O OG1 . THR A 294 ? 0.7490 0.5438 0.5817 0.0991  -0.1057 0.0932  289 THR A OG1 
2348 C CG2 . THR A 294 ? 0.7527 0.5062 0.5730 0.1148  -0.0736 0.0734  289 THR A CG2 
2349 N N   . ILE A 295 ? 0.7447 0.4614 0.5083 0.0786  -0.0936 0.0351  290 ILE A N   
2350 C CA  . ILE A 295 ? 0.7595 0.4692 0.5026 0.0756  -0.0868 0.0246  290 ILE A CA  
2351 C C   . ILE A 295 ? 0.7980 0.4981 0.5409 0.0910  -0.0648 0.0231  290 ILE A C   
2352 O O   . ILE A 295 ? 0.8228 0.4906 0.5613 0.0992  -0.0546 0.0171  290 ILE A O   
2353 C CB  . ILE A 295 ? 0.7790 0.4747 0.4999 0.0632  -0.0941 0.0105  290 ILE A CB  
2354 C CG1 . ILE A 295 ? 0.7235 0.4384 0.4491 0.0594  -0.1108 0.0173  290 ILE A CG1 
2355 C CG2 . ILE A 295 ? 0.7895 0.4786 0.4790 0.0586  -0.0884 -0.0012 290 ILE A CG2 
2356 C CD1 . ILE A 295 ? 0.7402 0.4656 0.4604 0.0484  -0.1196 0.0126  290 ILE A CD1 
2357 N N   . GLN A 296 ? 0.8017 0.5279 0.5488 0.0970  -0.0552 0.0317  291 GLN A N   
2358 C CA  . GLN A 296 ? 0.8448 0.5785 0.5996 0.1213  -0.0293 0.0374  291 GLN A CA  
2359 C C   . GLN A 296 ? 0.8616 0.6236 0.6063 0.1237  -0.0156 0.0419  291 GLN A C   
2360 O O   . GLN A 296 ? 0.8398 0.6361 0.5965 0.1061  -0.0279 0.0571  291 GLN A O   
2361 C CB  . GLN A 296 ? 0.8270 0.6001 0.6281 0.1338  -0.0298 0.0633  291 GLN A CB  
2362 C CG  . GLN A 296 ? 0.8944 0.6874 0.7133 0.1698  0.0003  0.0768  291 GLN A CG  
2363 C CD  . GLN A 296 ? 0.9157 0.7571 0.7836 0.1838  -0.0038 0.1076  291 GLN A CD  
2364 O OE1 . GLN A 296 ? 0.9113 0.7731 0.7949 0.1611  -0.0311 0.1169  291 GLN A OE1 
2365 N NE2 . GLN A 296 ? 0.9384 0.7999 0.8267 0.2242  0.0239  0.1244  291 GLN A NE2 
2366 N N   . SER A 297 ? 0.9153 0.6554 0.6314 0.1456  0.0118  0.0289  292 SER A N   
2367 C CA  . SER A 297 ? 0.9518 0.7208 0.6509 0.1545  0.0330  0.0332  292 SER A CA  
2368 C C   . SER A 297 ? 0.9350 0.7207 0.6194 0.1243  0.0130  0.0374  292 SER A C   
2369 O O   . SER A 297 ? 0.9253 0.7616 0.6325 0.1163  0.0142  0.0630  292 SER A O   
2370 C CB  . SER A 297 ? 0.9415 0.7809 0.6920 0.1762  0.0524  0.0663  292 SER A CB  
2371 O OG  . SER A 297 ? 0.9709 0.7979 0.7395 0.2109  0.0701  0.0690  292 SER A OG  
2372 N N   . ASN A 298 ? 0.9433 0.6890 0.5924 0.1063  -0.0066 0.0166  293 ASN A N   
2373 C CA  . ASN A 298 ? 0.9454 0.7025 0.5727 0.0862  -0.0227 0.0220  293 ASN A CA  
2374 C C   . ASN A 298 ? 0.8978 0.6755 0.5608 0.0706  -0.0443 0.0461  293 ASN A C   
2375 O O   . ASN A 298 ? 0.9059 0.6949 0.5583 0.0588  -0.0514 0.0618  293 ASN A O   
2376 C CB  . ASN A 298 ? 0.9953 0.7761 0.5923 0.0940  0.0009  0.0279  293 ASN A CB  
2377 C CG  . ASN A 298 ? 1.0289 0.8104 0.5836 0.0770  -0.0134 0.0291  293 ASN A CG  
2378 O OD1 . ASN A 298 ? 1.0636 0.8238 0.6007 0.0642  -0.0372 0.0165  293 ASN A OD1 
2379 N ND2 . ASN A 298 ? 1.0544 0.8697 0.5956 0.0774  0.0014  0.0494  293 ASN A ND2 
2380 N N   . GLN A 299 ? 0.8685 0.6428 0.5661 0.0706  -0.0544 0.0488  294 GLN A N   
2381 C CA  . GLN A 299 ? 0.8412 0.6219 0.5619 0.0559  -0.0737 0.0659  294 GLN A CA  
2382 C C   . GLN A 299 ? 0.8198 0.5770 0.5473 0.0563  -0.0900 0.0556  294 GLN A C   
2383 O O   . GLN A 299 ? 0.8111 0.5590 0.5422 0.0663  -0.0847 0.0431  294 GLN A O   
2384 C CB  . GLN A 299 ? 0.8316 0.6537 0.5894 0.0517  -0.0671 0.0885  294 GLN A CB  
2385 C CG  . GLN A 299 ? 0.8777 0.7387 0.6351 0.0532  -0.0455 0.1047  294 GLN A CG  
2386 C CD  . GLN A 299 ? 0.8871 0.8052 0.6875 0.0377  -0.0449 0.1366  294 GLN A CD  
2387 O OE1 . GLN A 299 ? 0.8486 0.7894 0.6841 0.0351  -0.0541 0.1447  294 GLN A OE1 
2388 N NE2 . GLN A 299 ? 0.9012 0.8499 0.6994 0.0237  -0.0354 0.1586  294 GLN A NE2 
2389 N N   . LEU A 300 ? 0.8177 0.5591 0.5407 0.0465  -0.1078 0.0615  295 LEU A N   
2390 C CA  . LEU A 300 ? 0.8020 0.5278 0.5296 0.0494  -0.1195 0.0551  295 LEU A CA  
2391 C C   . LEU A 300 ? 0.8143 0.5438 0.5533 0.0352  -0.1290 0.0669  295 LEU A C   
2392 O O   . LEU A 300 ? 0.8400 0.5562 0.5678 0.0183  -0.1366 0.0775  295 LEU A O   
2393 C CB  . LEU A 300 ? 0.8125 0.5142 0.5176 0.0553  -0.1297 0.0505  295 LEU A CB  
2394 C CG  . LEU A 300 ? 0.8149 0.5016 0.5174 0.0633  -0.1374 0.0450  295 LEU A CG  
2395 C CD1 . LEU A 300 ? 0.7956 0.5022 0.5149 0.0698  -0.1318 0.0377  295 LEU A CD1 
2396 C CD2 . LEU A 300 ? 0.8270 0.4914 0.5066 0.0769  -0.1427 0.0464  295 LEU A CD2 
2397 N N   . VAL A 301 ? 0.7913 0.5384 0.5502 0.0384  -0.1301 0.0676  296 VAL A N   
2398 C CA  . VAL A 301 ? 0.7960 0.5629 0.5686 0.0209  -0.1427 0.0808  296 VAL A CA  
2399 C C   . VAL A 301 ? 0.8049 0.5588 0.5664 0.0236  -0.1549 0.0734  296 VAL A C   
2400 O O   . VAL A 301 ? 0.7995 0.5437 0.5569 0.0422  -0.1477 0.0636  296 VAL A O   
2401 C CB  . VAL A 301 ? 0.7771 0.6037 0.5915 0.0258  -0.1304 0.0993  296 VAL A CB  
2402 C CG1 . VAL A 301 ? 0.7740 0.6188 0.5942 0.0288  -0.1119 0.1064  296 VAL A CG1 
2403 C CG2 . VAL A 301 ? 0.7535 0.5862 0.5817 0.0530  -0.1178 0.0955  296 VAL A CG2 
2404 N N   . TYR A 302 ? 0.8325 0.5886 0.5857 0.0015  -0.1740 0.0789  297 TYR A N   
2405 C CA  . TYR A 302 ? 0.8484 0.5990 0.5843 0.0048  -0.1847 0.0729  297 TYR A CA  
2406 C C   . TYR A 302 ? 0.8532 0.6505 0.6052 -0.0170 -0.2032 0.0903  297 TYR A C   
2407 O O   . TYR A 302 ? 0.8622 0.6901 0.6339 -0.0431 -0.2126 0.1057  297 TYR A O   
2408 C CB  . TYR A 302 ? 0.8985 0.5833 0.5781 0.0056  -0.1921 0.0518  297 TYR A CB  
2409 C CG  . TYR A 302 ? 0.9792 0.6222 0.6212 -0.0270 -0.2127 0.0477  297 TYR A CG  
2410 C CD1 . TYR A 302 ? 1.0359 0.6892 0.6613 -0.0551 -0.2357 0.0497  297 TYR A CD1 
2411 C CD2 . TYR A 302 ? 1.0235 0.6130 0.6421 -0.0337 -0.2116 0.0438  297 TYR A CD2 
2412 C CE1 . TYR A 302 ? 1.1153 0.7192 0.6976 -0.0956 -0.2587 0.0435  297 TYR A CE1 
2413 C CE2 . TYR A 302 ? 1.1127 0.6461 0.6897 -0.0694 -0.2312 0.0407  297 TYR A CE2 
2414 C CZ  . TYR A 302 ? 1.1578 0.6956 0.7153 -0.1032 -0.2554 0.0385  297 TYR A CZ  
2415 O OH  . TYR A 302 ? 1.2601 0.7338 0.7695 -0.1480 -0.2784 0.0332  297 TYR A OH  
2416 N N   . GLN A 303 ? 0.8526 0.6643 0.5980 -0.0077 -0.2088 0.0919  298 GLN A N   
2417 C CA  . GLN A 303 ? 0.8626 0.7251 0.6163 -0.0281 -0.2317 0.1101  298 GLN A CA  
2418 C C   . GLN A 303 ? 0.8968 0.7280 0.5946 -0.0308 -0.2458 0.0951  298 GLN A C   
2419 O O   . GLN A 303 ? 0.8879 0.6831 0.5619 -0.0048 -0.2300 0.0805  298 GLN A O   
2420 C CB  . GLN A 303 ? 0.8263 0.7596 0.6373 -0.0032 -0.2198 0.1395  298 GLN A CB  
2421 C CG  . GLN A 303 ? 0.8132 0.7740 0.6726 0.0130  -0.1965 0.1521  298 GLN A CG  
2422 C CD  . GLN A 303 ? 0.8052 0.8194 0.7124 0.0477  -0.1796 0.1799  298 GLN A CD  
2423 O OE1 . GLN A 303 ? 0.7766 0.7616 0.6903 0.0795  -0.1523 0.1742  298 GLN A OE1 
2424 N NE2 . GLN A 303 ? 0.8042 0.8939 0.7417 0.0414  -0.1967 0.2110  298 GLN A NE2 
2425 N N   . LYS A 304 ? 0.9406 0.7914 0.6153 -0.0643 -0.2759 0.1000  299 LYS A N   
2426 C CA  . LYS A 304 ? 0.9786 0.8193 0.6006 -0.0641 -0.2892 0.0917  299 LYS A CA  
2427 C C   . LYS A 304 ? 0.9402 0.8628 0.6063 -0.0452 -0.2889 0.1258  299 LYS A C   
2428 O O   . LYS A 304 ? 0.9270 0.8425 0.5811 -0.0160 -0.2738 0.1270  299 LYS A O   
2429 C CB  . LYS A 304 ? 1.0667 0.8772 0.6248 -0.1123 -0.3247 0.0761  299 LYS A CB  
2430 C CG  . LYS A 304 ? 1.1405 0.9305 0.6257 -0.1106 -0.3366 0.0613  299 LYS A CG  
2431 C CD  . LYS A 304 ? 1.2812 1.0019 0.6756 -0.1566 -0.3676 0.0313  299 LYS A CD  
2432 C CE  . LYS A 304 ? 1.3105 1.0773 0.7303 -0.2174 -0.4051 0.0496  299 LYS A CE  
2433 N NZ  . LYS A 304 ? 1.4511 1.1540 0.7693 -0.2696 -0.4425 0.0210  299 LYS A NZ  
2434 N N   . LYS A 305 ? 0.9249 0.9280 0.6458 -0.0592 -0.3031 0.1583  300 LYS A N   
2435 C CA  . LYS A 305 ? 0.9192 1.0031 0.6802 -0.0391 -0.3061 0.1969  300 LYS A CA  
2436 C C   . LYS A 305 ? 0.8680 0.9948 0.7080 -0.0035 -0.2779 0.2246  300 LYS A C   
2437 O O   . LYS A 305 ? 0.8473 0.9644 0.7129 -0.0066 -0.2646 0.2174  300 LYS A O   
2438 C CB  . LYS A 305 ? 0.9570 1.1160 0.7161 -0.0809 -0.3486 0.2187  300 LYS A CB  
2439 C CG  . LYS A 305 ? 1.0078 1.2214 0.7551 -0.0705 -0.3647 0.2451  300 LYS A CG  
2440 C CD  . LYS A 305 ? 0.9821 1.3107 0.8160 -0.0452 -0.3640 0.3026  300 LYS A CD  
2441 C CE  . LYS A 305 ? 1.0132 1.3981 0.8316 -0.0345 -0.3830 0.3347  300 LYS A CE  
2442 N NZ  . LYS A 305 ? 1.0203 1.3293 0.7810 -0.0075 -0.3629 0.3163  300 LYS A NZ  
2443 N N   . TYR A 306 ? 0.8641 1.0324 0.7355 0.0322  -0.2674 0.2567  301 TYR A N   
2444 C CA  . TYR A 306 ? 0.8459 1.0488 0.7838 0.0730  -0.2392 0.2853  301 TYR A CA  
2445 C C   . TYR A 306 ? 0.8436 1.1278 0.8372 0.0607  -0.2454 0.3079  301 TYR A C   
2446 O O   . TYR A 306 ? 0.8246 1.0962 0.8458 0.0775  -0.2180 0.3024  301 TYR A O   
2447 C CB  . TYR A 306 ? 0.8567 1.0961 0.8153 0.1109  -0.2338 0.3251  301 TYR A CB  
2448 C CG  . TYR A 306 ? 0.8418 1.0864 0.8536 0.1633  -0.1977 0.3502  301 TYR A CG  
2449 C CD1 . TYR A 306 ? 0.8717 1.2068 0.9390 0.1948  -0.1980 0.4024  301 TYR A CD1 
2450 C CD2 . TYR A 306 ? 0.8265 0.9844 0.8286 0.1831  -0.1633 0.3220  301 TYR A CD2 
2451 C CE1 . TYR A 306 ? 0.8896 1.2158 0.9969 0.2521  -0.1595 0.4239  301 TYR A CE1 
2452 C CE2 . TYR A 306 ? 0.8449 0.9887 0.8793 0.2312  -0.1290 0.3387  301 TYR A CE2 
2453 C CZ  . TYR A 306 ? 0.8851 1.1067 0.9696 0.2688  -0.1246 0.3883  301 TYR A CZ  
2454 O OH  . TYR A 306 ? 0.9366 1.1319 1.0450 0.3248  -0.0856 0.4035  301 TYR A OH  
2455 N N   . LYS A 307 ? 0.8703 1.2422 0.8779 0.0281  -0.2817 0.3341  302 LYS A N   
2456 C CA  . LYS A 307 ? 0.8799 1.3498 0.9481 0.0082  -0.2910 0.3632  302 LYS A CA  
2457 C C   . LYS A 307 ? 0.8807 1.3064 0.9346 -0.0305 -0.2890 0.3329  302 LYS A C   
2458 O O   . LYS A 307 ? 0.8629 1.3463 0.9715 -0.0259 -0.2730 0.3535  302 LYS A O   
2459 C CB  . LYS A 307 ? 0.9167 1.4960 0.9995 -0.0306 -0.3381 0.3986  302 LYS A CB  
2460 C CG  . LYS A 307 ? 0.9766 1.5418 1.0102 -0.1115 -0.3822 0.3742  302 LYS A CG  
2461 C CD  . LYS A 307 ? 0.9828 1.6515 1.0808 -0.1520 -0.3968 0.4058  302 LYS A CD  
2462 C CE  . LYS A 307 ? 1.0166 1.6039 1.0608 -0.2187 -0.4147 0.3667  302 LYS A CE  
2463 N NZ  . LYS A 307 ? 1.0326 1.7266 1.1361 -0.2723 -0.4355 0.4028  302 LYS A NZ  
2464 N N   . ASP A 308 ? 0.9077 1.2305 0.8868 -0.0620 -0.3011 0.2872  303 ASP A N   
2465 C CA  . ASP A 308 ? 0.9289 1.2048 0.8801 -0.1100 -0.3118 0.2629  303 ASP A CA  
2466 C C   . ASP A 308 ? 0.8971 1.1631 0.8820 -0.0915 -0.2775 0.2621  303 ASP A C   
2467 O O   . ASP A 308 ? 0.8679 1.0742 0.8430 -0.0485 -0.2446 0.2429  303 ASP A O   
2468 C CB  . ASP A 308 ? 0.9686 1.1212 0.8284 -0.1268 -0.3213 0.2141  303 ASP A CB  
2469 C CG  . ASP A 308 ? 1.0346 1.1862 0.8395 -0.1577 -0.3590 0.2078  303 ASP A CG  
2470 O OD1 . ASP A 308 ? 1.0369 1.2884 0.8743 -0.1752 -0.3851 0.2428  303 ASP A OD1 
2471 O OD2 . ASP A 308 ? 1.0826 1.1360 0.8082 -0.1618 -0.3617 0.1687  303 ASP A OD2 
2472 N N   . PRO A 309 ? 0.9067 1.2319 0.9268 -0.1292 -0.2865 0.2836  304 PRO A N   
2473 C CA  . PRO A 309 ? 0.8837 1.1993 0.9257 -0.1147 -0.2537 0.2834  304 PRO A CA  
2474 C C   . PRO A 309 ? 0.8898 1.0744 0.8649 -0.1078 -0.2418 0.2374  304 PRO A C   
2475 O O   . PRO A 309 ? 0.9304 1.0379 0.8442 -0.1372 -0.2655 0.2102  304 PRO A O   
2476 C CB  . PRO A 309 ? 0.9116 1.2870 0.9779 -0.1774 -0.2765 0.3084  304 PRO A CB  
2477 C CG  . PRO A 309 ? 0.9700 1.3337 0.9964 -0.2350 -0.3262 0.3021  304 PRO A CG  
2478 C CD  . PRO A 309 ? 0.9515 1.3394 0.9782 -0.1967 -0.3302 0.3043  304 PRO A CD  
2479 N N   . VAL A 310 ? 0.8608 1.0219 0.8440 -0.0662 -0.2050 0.2291  305 VAL A N   
2480 C CA  . VAL A 310 ? 0.8616 0.9180 0.7908 -0.0544 -0.1931 0.1916  305 VAL A CA  
2481 C C   . VAL A 310 ? 0.8938 0.9072 0.7937 -0.0959 -0.2045 0.1853  305 VAL A C   
2482 O O   . VAL A 310 ? 0.8947 0.9603 0.8266 -0.1159 -0.2000 0.2101  305 VAL A O   
2483 C CB  . VAL A 310 ? 0.8329 0.8835 0.7763 -0.0043 -0.1545 0.1863  305 VAL A CB  
2484 C CG1 . VAL A 310 ? 0.8448 0.8232 0.7477 -0.0032 -0.1435 0.1604  305 VAL A CG1 
2485 C CG2 . VAL A 310 ? 0.8129 0.8491 0.7557 0.0328  -0.1461 0.1801  305 VAL A CG2 
2486 N N   . THR A 311 ? 0.9288 0.8486 0.7676 -0.1075 -0.2181 0.1561  306 THR A N   
2487 C CA  . THR A 311 ? 0.9851 0.8413 0.7872 -0.1372 -0.2247 0.1499  306 THR A CA  
2488 C C   . THR A 311 ? 0.9659 0.7701 0.7471 -0.1018 -0.2000 0.1333  306 THR A C   
2489 O O   . THR A 311 ? 0.9450 0.7132 0.7052 -0.0693 -0.1925 0.1111  306 THR A O   
2490 C CB  . THR A 311 ? 1.0626 0.8352 0.8002 -0.1711 -0.2545 0.1297  306 THR A CB  
2491 O OG1 . THR A 311 ? 1.0827 0.7799 0.7730 -0.1345 -0.2456 0.0985  306 THR A OG1 
2492 C CG2 . THR A 311 ? 1.0795 0.9005 0.8240 -0.2031 -0.2835 0.1385  306 THR A CG2 
2493 N N   . VAL A 312 ? 0.9754 0.7846 0.7632 -0.1113 -0.1888 0.1478  307 VAL A N   
2494 C CA  . VAL A 312 ? 0.9647 0.7472 0.7373 -0.0794 -0.1665 0.1381  307 VAL A CA  
2495 C C   . VAL A 312 ? 1.0084 0.6982 0.7257 -0.0779 -0.1754 0.1216  307 VAL A C   
2496 O O   . VAL A 312 ? 1.0712 0.7107 0.7603 -0.1093 -0.1906 0.1284  307 VAL A O   
2497 C CB  . VAL A 312 ? 0.9617 0.7940 0.7580 -0.0849 -0.1475 0.1629  307 VAL A CB  
2498 C CG1 . VAL A 312 ? 0.9639 0.7751 0.7375 -0.0524 -0.1272 0.1504  307 VAL A CG1 
2499 C CG2 . VAL A 312 ? 0.9303 0.8609 0.7838 -0.0793 -0.1339 0.1842  307 VAL A CG2 
2500 N N   . VAL A 313 ? 0.9851 0.6524 0.6870 -0.0417 -0.1656 0.1028  308 VAL A N   
2501 C CA  . VAL A 313 ? 1.0248 0.6202 0.6820 -0.0281 -0.1695 0.0927  308 VAL A CA  
2502 C C   . VAL A 313 ? 1.0200 0.6195 0.6714 -0.0126 -0.1571 0.1021  308 VAL A C   
2503 O O   . VAL A 313 ? 1.0640 0.6112 0.6826 -0.0067 -0.1606 0.1079  308 VAL A O   
2504 C CB  . VAL A 313 ? 1.0139 0.5921 0.6583 0.0007  -0.1698 0.0708  308 VAL A CB  
2505 C CG1 . VAL A 313 ? 1.0473 0.5744 0.6569 0.0272  -0.1673 0.0662  308 VAL A CG1 
2506 C CG2 . VAL A 313 ? 1.0459 0.6046 0.6759 -0.0146 -0.1843 0.0612  308 VAL A CG2 
2507 N N   . VAL A 314 ? 0.9737 0.6319 0.6511 -0.0034 -0.1424 0.1032  309 VAL A N   
2508 C CA  . VAL A 314 ? 0.9638 0.6359 0.6295 0.0080  -0.1317 0.1093  309 VAL A CA  
2509 C C   . VAL A 314 ? 0.9472 0.6748 0.6355 0.0004  -0.1148 0.1188  309 VAL A C   
2510 O O   . VAL A 314 ? 0.9180 0.6766 0.6257 0.0133  -0.1038 0.1062  309 VAL A O   
2511 C CB  . VAL A 314 ? 0.9367 0.6174 0.5974 0.0333  -0.1298 0.0906  309 VAL A CB  
2512 C CG1 . VAL A 314 ? 0.9393 0.6392 0.5809 0.0389  -0.1237 0.0958  309 VAL A CG1 
2513 C CG2 . VAL A 314 ? 0.9539 0.5970 0.6005 0.0484  -0.1414 0.0847  309 VAL A CG2 
2514 N N   . ASP A 315 ? 0.9715 0.7100 0.6561 -0.0181 -0.1101 0.1435  310 ASP A N   
2515 C CA  . ASP A 315 ? 0.9607 0.7629 0.6691 -0.0213 -0.0890 0.1572  310 ASP A CA  
2516 C C   . ASP A 315 ? 0.9486 0.7700 0.6368 0.0053  -0.0689 0.1418  310 ASP A C   
2517 O O   . ASP A 315 ? 0.9486 0.8092 0.6522 0.0198  -0.0476 0.1372  310 ASP A O   
2518 C CB  . ASP A 315 ? 1.0016 0.8198 0.7137 -0.0526 -0.0875 0.1929  310 ASP A CB  
2519 C CG  . ASP A 315 ? 1.0696 0.8544 0.7390 -0.0532 -0.0875 0.2062  310 ASP A CG  
2520 O OD1 . ASP A 315 ? 1.0930 0.8434 0.7319 -0.0304 -0.0937 0.1888  310 ASP A OD1 
2521 O OD2 . ASP A 315 ? 1.1562 0.9564 0.8248 -0.0781 -0.0818 0.2394  310 ASP A OD2 
2522 N N   . ASP A 316 ? 0.9501 0.7411 0.6001 0.0130  -0.0767 0.1335  311 ASP A N   
2523 C CA  . ASP A 316 ? 0.9527 0.7555 0.5695 0.0286  -0.0646 0.1175  311 ASP A CA  
2524 C C   . ASP A 316 ? 0.9424 0.7179 0.5367 0.0355  -0.0846 0.1015  311 ASP A C   
2525 O O   . ASP A 316 ? 0.9608 0.7212 0.5399 0.0338  -0.0991 0.1179  311 ASP A O   
2526 C CB  . ASP A 316 ? 0.9942 0.8219 0.5827 0.0228  -0.0507 0.1409  311 ASP A CB  
2527 C CG  . ASP A 316 ? 1.0258 0.8681 0.5690 0.0375  -0.0340 0.1207  311 ASP A CG  
2528 O OD1 . ASP A 316 ? 1.0564 0.9306 0.5784 0.0387  -0.0118 0.1356  311 ASP A OD1 
2529 O OD2 . ASP A 316 ? 1.0120 0.8330 0.5360 0.0451  -0.0425 0.0902  311 ASP A OD2 
2530 N N   . LEU A 317 ? 0.9125 0.6844 0.5056 0.0435  -0.0844 0.0736  312 LEU A N   
2531 C CA  . LEU A 317 ? 0.9062 0.6705 0.4869 0.0449  -0.1035 0.0617  312 LEU A CA  
2532 C C   . LEU A 317 ? 0.9402 0.7213 0.4791 0.0419  -0.1123 0.0681  312 LEU A C   
2533 O O   . LEU A 317 ? 0.9358 0.7274 0.4719 0.0429  -0.1319 0.0704  312 LEU A O   
2534 C CB  . LEU A 317 ? 0.8920 0.6477 0.4765 0.0449  -0.1007 0.0333  312 LEU A CB  
2535 C CG  . LEU A 317 ? 0.8710 0.6142 0.4954 0.0497  -0.0985 0.0294  312 LEU A CG  
2536 C CD1 . LEU A 317 ? 0.8643 0.5895 0.4831 0.0507  -0.0880 0.0057  312 LEU A CD1 
2537 C CD2 . LEU A 317 ? 0.8488 0.5898 0.4927 0.0516  -0.1172 0.0371  312 LEU A CD2 
2538 N N   . ARG A 318 ? 0.9784 0.7716 0.4851 0.0394  -0.0976 0.0741  313 ARG A N   
2539 C CA  . ARG A 318 ? 1.0227 0.8361 0.4820 0.0356  -0.1068 0.0828  313 ARG A CA  
2540 C C   . ARG A 318 ? 1.0287 0.8430 0.4954 0.0404  -0.1203 0.1206  313 ARG A C   
2541 O O   . ARG A 318 ? 1.0549 0.8890 0.4968 0.0431  -0.1371 0.1350  313 ARG A O   
2542 C CB  . ARG A 318 ? 1.0719 0.8972 0.4856 0.0345  -0.0827 0.0778  313 ARG A CB  
2543 C CG  . ARG A 318 ? 1.0941 0.9007 0.4819 0.0358  -0.0677 0.0364  313 ARG A CG  
2544 C CD  . ARG A 318 ? 1.1401 0.9532 0.4797 0.0450  -0.0351 0.0297  313 ARG A CD  
2545 N NE  . ARG A 318 ? 1.1096 0.9425 0.4910 0.0580  -0.0070 0.0525  313 ARG A NE  
2546 C CZ  . ARG A 318 ? 1.1521 1.0080 0.5069 0.0718  0.0277  0.0570  313 ARG A CZ  
2547 N NH1 . ARG A 318 ? 1.2204 1.0685 0.4963 0.0764  0.0396  0.0350  313 ARG A NH1 
2548 N NH2 . ARG A 318 ? 1.1233 1.0153 0.5276 0.0798  0.0506  0.0845  313 ARG A NH2 
2549 N N   . LEU A 319 ? 1.0212 0.8104 0.5202 0.0410  -0.1144 0.1373  314 LEU A N   
2550 C CA  . LEU A 319 ? 1.0558 0.8200 0.5540 0.0445  -0.1235 0.1723  314 LEU A CA  
2551 C C   . LEU A 319 ? 1.0482 0.7743 0.5742 0.0560  -0.1362 0.1697  314 LEU A C   
2552 O O   . LEU A 319 ? 1.0797 0.7595 0.6104 0.0526  -0.1366 0.1863  314 LEU A O   
2553 C CB  . LEU A 319 ? 1.0728 0.8276 0.5734 0.0279  -0.1075 0.1964  314 LEU A CB  
2554 C CG  . LEU A 319 ? 1.0925 0.8906 0.5667 0.0203  -0.0865 0.2027  314 LEU A CG  
2555 C CD1 . LEU A 319 ? 1.1038 0.9109 0.6028 0.0018  -0.0681 0.2239  314 LEU A CD1 
2556 C CD2 . LEU A 319 ? 1.1471 0.9580 0.5736 0.0242  -0.0930 0.2290  314 LEU A CD2 
2557 N N   . CYS A 320 ? 1.0259 0.7684 0.5653 0.0674  -0.1459 0.1489  315 CYS A N   
2558 C CA  . CYS A 320 ? 1.0267 0.7412 0.5855 0.0856  -0.1544 0.1494  315 CYS A CA  
2559 C C   . CYS A 320 ? 1.0213 0.7766 0.5858 0.1053  -0.1681 0.1516  315 CYS A C   
2560 O O   . CYS A 320 ? 1.0194 0.8258 0.5750 0.0956  -0.1756 0.1465  315 CYS A O   
2561 C CB  . CYS A 320 ? 0.9953 0.6908 0.5809 0.0777  -0.1481 0.1255  315 CYS A CB  
2562 S SG  . CYS A 320 ? 0.9770 0.7098 0.5875 0.0801  -0.1506 0.0969  315 CYS A SG  
2563 N N   . THR A 321 ? 1.0309 0.7656 0.6073 0.1322  -0.1711 0.1603  316 THR A N   
2564 C CA  . THR A 321 ? 1.0240 0.8126 0.6194 0.1547  -0.1809 0.1671  316 THR A CA  
2565 C C   . THR A 321 ? 0.9958 0.7761 0.6175 0.1678  -0.1745 0.1507  316 THR A C   
2566 O O   . THR A 321 ? 0.9955 0.7141 0.6110 0.1676  -0.1650 0.1383  316 THR A O   
2567 C CB  . THR A 321 ? 1.0775 0.8667 0.6607 0.1913  -0.1865 0.2049  316 THR A CB  
2568 O OG1 . THR A 321 ? 1.1284 0.9006 0.6786 0.1806  -0.1885 0.2253  316 THR A OG1 
2569 C CG2 . THR A 321 ? 1.0753 0.9598 0.6831 0.2059  -0.2010 0.2199  316 THR A CG2 
2570 N N   . VAL A 322 ? 0.9732 0.8229 0.6228 0.1750  -0.1812 0.1525  317 VAL A N   
2571 C CA  . VAL A 322 ? 0.9479 0.8067 0.6230 0.1917  -0.1731 0.1445  317 VAL A CA  
2572 C C   . VAL A 322 ? 0.9677 0.8941 0.6653 0.2289  -0.1767 0.1735  317 VAL A C   
2573 O O   . VAL A 322 ? 0.9697 0.9667 0.6771 0.2237  -0.1926 0.1936  317 VAL A O   
2574 C CB  . VAL A 322 ? 0.9002 0.7917 0.5983 0.1570  -0.1742 0.1208  317 VAL A CB  
2575 C CG1 . VAL A 322 ? 0.8679 0.7299 0.5753 0.1677  -0.1606 0.1079  317 VAL A CG1 
2576 C CG2 . VAL A 322 ? 0.8807 0.7457 0.5605 0.1204  -0.1756 0.1013  317 VAL A CG2 
2577 N N   . LYS A 323 ? 0.9896 0.8998 0.6934 0.2674  -0.1615 0.1767  318 LYS A N   
2578 C CA  . LYS A 323 ? 1.0262 0.9995 0.7532 0.3175  -0.1569 0.2081  318 LYS A CA  
2579 C C   . LYS A 323 ? 1.0302 1.0097 0.7714 0.3442  -0.1366 0.1998  318 LYS A C   
2580 O O   . LYS A 323 ? 1.0500 0.9385 0.7566 0.3499  -0.1227 0.1758  318 LYS A O   
2581 C CB  . LYS A 323 ? 1.0978 1.0097 0.7906 0.3638  -0.1517 0.2322  318 LYS A CB  
2582 C CG  . LYS A 323 ? 1.1486 0.9195 0.7874 0.3610  -0.1409 0.2099  318 LYS A CG  
2583 C CD  . LYS A 323 ? 1.2192 0.9222 0.8199 0.3745  -0.1444 0.2328  318 LYS A CD  
2584 C CE  . LYS A 323 ? 1.3215 0.9554 0.8923 0.4417  -0.1270 0.2522  318 LYS A CE  
2585 N NZ  . LYS A 323 ? 1.4141 0.9172 0.9273 0.4388  -0.1259 0.2579  318 LYS A NZ  
2586 N N   . LEU A 324 ? 1.0183 1.1127 0.8090 0.3557  -0.1362 0.2214  319 LEU A N   
2587 C CA  . LEU A 324 ? 1.0335 1.1570 0.8410 0.3908  -0.1126 0.2239  319 LEU A CA  
2588 C C   . LEU A 324 ? 1.1210 1.1692 0.8878 0.4638  -0.0875 0.2300  319 LEU A C   
2589 O O   . LEU A 324 ? 1.1733 1.1686 0.9123 0.4902  -0.0906 0.2434  319 LEU A O   
2590 C CB  . LEU A 324 ? 1.0028 1.2834 0.8784 0.3935  -0.1170 0.2589  319 LEU A CB  
2591 C CG  . LEU A 324 ? 0.9469 1.3096 0.8658 0.3270  -0.1325 0.2543  319 LEU A CG  
2592 C CD1 . LEU A 324 ? 0.9101 1.1799 0.7985 0.2827  -0.1300 0.2126  319 LEU A CD1 
2593 C CD2 . LEU A 324 ? 0.9245 1.3611 0.8663 0.2810  -0.1665 0.2688  319 LEU A CD2 
2594 N N   . CYS A 325 ? 1.1536 1.1887 0.9093 0.4967  -0.0612 0.2202  320 CYS A N   
2595 C CA  . CYS A 325 ? 1.2602 1.2225 0.9692 0.5742  -0.0322 0.2240  320 CYS A CA  
2596 C C   . CYS A 325 ? 1.2762 1.3206 1.0089 0.6279  -0.0006 0.2393  320 CYS A C   
2597 O O   . CYS A 325 ? 1.3302 1.3002 1.0113 0.6529  0.0238  0.2134  320 CYS A O   
2598 C CB  . CYS A 325 ? 1.3212 1.1124 0.9467 0.5641  -0.0284 0.1825  320 CYS A CB  
2599 S SG  . CYS A 325 ? 1.3641 1.0546 0.9555 0.5301  -0.0538 0.1803  320 CYS A SG  
2600 N N   . PRO A 326 ? 1.2421 1.4466 1.0509 0.6458  -0.0010 0.2838  321 PRO A N   
2601 C CA  . PRO A 326 ? 1.2539 1.5568 1.0944 0.6947  0.0318  0.3043  321 PRO A CA  
2602 C C   . PRO A 326 ? 1.3696 1.6138 1.1636 0.8001  0.0711  0.3152  321 PRO A C   
2603 O O   . PRO A 326 ? 1.3934 1.7322 1.2159 0.8615  0.1045  0.3420  321 PRO A O   
2604 C CB  . PRO A 326 ? 1.1842 1.6828 1.1250 0.6711  0.0128  0.3530  321 PRO A CB  
2605 C CG  . PRO A 326 ? 1.1626 1.6509 1.1092 0.6325  -0.0266 0.3601  321 PRO A CG  
2606 C CD  . PRO A 326 ? 1.2128 1.5127 1.0735 0.6357  -0.0276 0.3223  321 PRO A CD  
2607 N N   . ASP A 327 ? 1.4454 1.5270 1.1639 0.8187  0.0686  0.2939  322 ASP A N   
2608 C CA  . ASP A 327 ? 1.5764 1.5612 1.2345 0.9151  0.1018  0.3015  322 ASP A CA  
2609 C C   . ASP A 327 ? 1.6779 1.4550 1.2190 0.9228  0.1184  0.2458  322 ASP A C   
2610 O O   . ASP A 327 ? 1.8154 1.4804 1.2853 1.0022  0.1500  0.2420  322 ASP A O   
2611 C CB  . ASP A 327 ? 1.6062 1.5697 1.2710 0.9297  0.0816  0.3331  322 ASP A CB  
2612 C CG  . ASP A 327 ? 1.7172 1.6812 1.3727 1.0438  0.1159  0.3738  322 ASP A CG  
2613 O OD1 . ASP A 327 ? 1.7241 1.8179 1.4282 1.1041  0.1457  0.4036  322 ASP A OD1 
2614 O OD2 . ASP A 327 ? 1.8157 1.6537 1.4175 1.0750  0.1143  0.3804  322 ASP A OD2 
2615 N N   . SER A 328 ? 1.6173 1.3423 1.1361 0.8401  0.0959  0.2040  323 SER A N   
2616 C CA  . SER A 328 ? 1.7012 1.2428 1.1135 0.8256  0.0999  0.1512  323 SER A CA  
2617 C C   . SER A 328 ? 1.7589 1.2829 1.1197 0.8657  0.1359  0.1264  323 SER A C   
2618 O O   . SER A 328 ? 1.7180 1.3835 1.1346 0.9008  0.1596  0.1523  323 SER A O   
2619 C CB  . SER A 328 ? 1.6189 1.1285 1.0349 0.7234  0.0597  0.1239  323 SER A CB  
2620 O OG  . SER A 328 ? 1.6065 1.0933 1.0407 0.6933  0.0322  0.1399  323 SER A OG  
2621 N N   . GLU A 329 ? 1.8573 1.2115 1.1091 0.8568  0.1390  0.0777  324 GLU A N   
2622 C CA  . GLU A 329 ? 1.9400 1.2542 1.1183 0.8960  0.1732  0.0480  324 GLU A CA  
2623 C C   . GLU A 329 ? 1.8311 1.2456 1.0442 0.8376  0.1638  0.0378  324 GLU A C   
2624 O O   . GLU A 329 ? 1.8552 1.3343 1.0604 0.8798  0.1977  0.0406  324 GLU A O   
2625 C CB  . GLU A 329 ? 2.1200 1.2065 1.1542 0.9076  0.1786  -0.0023 324 GLU A CB  
2626 C CG  . GLU A 329 ? 2.1240 1.1282 1.0992 0.8208  0.1473  -0.0494 324 GLU A CG  
2627 C CD  . GLU A 329 ? 2.2661 1.0637 1.1392 0.7904  0.1264  -0.0840 324 GLU A CD  
2628 O OE1 . GLU A 329 ? 2.1973 0.9777 1.0844 0.7007  0.0841  -0.0953 324 GLU A OE1 
2629 O OE2 . GLU A 329 ? 2.4355 1.0890 1.2156 0.8559  0.1532  -0.0974 324 GLU A OE2 
2630 N N   . ARG A 330 ? 1.7136 1.1400 0.9623 0.7461  0.1214  0.0292  325 ARG A N   
2631 C CA  . ARG A 330 ? 1.6115 1.1339 0.9014 0.6915  0.1109  0.0274  325 ARG A CA  
2632 C C   . ARG A 330 ? 1.4664 1.1671 0.8806 0.6739  0.1043  0.0732  325 ARG A C   
2633 O O   . ARG A 330 ? 1.4139 1.1501 0.8832 0.6662  0.0874  0.0970  325 ARG A O   
2634 C CB  . ARG A 330 ? 1.5756 1.0250 0.8410 0.6063  0.0710  -0.0026 325 ARG A CB  
2635 C CG  . ARG A 330 ? 1.7233 0.9970 0.8675 0.5987  0.0645  -0.0486 325 ARG A CG  
2636 C CD  . ARG A 330 ? 1.8125 1.0600 0.8798 0.6035  0.0787  -0.0778 325 ARG A CD  
2637 N NE  . ARG A 330 ? 1.9708 1.0451 0.9125 0.5902  0.0682  -0.1243 325 ARG A NE  
2638 C CZ  . ARG A 330 ? 2.1430 1.1096 0.9688 0.6446  0.0974  -0.1555 325 ARG A CZ  
2639 N NH1 . ARG A 330 ? 2.1828 1.2053 1.0041 0.7257  0.1447  -0.1431 325 ARG A NH1 
2640 N NH2 . ARG A 330 ? 2.2768 1.0779 0.9858 0.6160  0.0796  -0.1998 325 ARG A NH2 
2641 N N   . ARG A 331 ? 1.4065 1.2155 0.8586 0.6628  0.1162  0.0860  326 ARG A N   
2642 C CA  . ARG A 331 ? 1.2807 1.2480 0.8430 0.6272  0.1051  0.1255  326 ARG A CA  
2643 C C   . ARG A 331 ? 1.1892 1.1380 0.7846 0.5438  0.0613  0.1167  326 ARG A C   
2644 O O   . ARG A 331 ? 1.1926 1.0365 0.7350 0.5094  0.0439  0.0838  326 ARG A O   
2645 C CB  . ARG A 331 ? 1.2623 1.3264 0.8440 0.6261  0.1278  0.1395  326 ARG A CB  
2646 C CG  . ARG A 331 ? 1.3573 1.4433 0.8974 0.7128  0.1781  0.1465  326 ARG A CG  
2647 C CD  . ARG A 331 ? 1.3819 1.4732 0.8748 0.7081  0.1985  0.1340  326 ARG A CD  
2648 N NE  . ARG A 331 ? 1.2923 1.4967 0.8628 0.6420  0.1834  0.1617  326 ARG A NE  
2649 C CZ  . ARG A 331 ? 1.2997 1.5029 0.8408 0.6113  0.1858  0.1547  326 ARG A CZ  
2650 N NH1 . ARG A 331 ? 1.3930 1.4969 0.8266 0.6373  0.2002  0.1184  326 ARG A NH1 
2651 N NH2 . ARG A 331 ? 1.2219 1.5186 0.8360 0.5524  0.1723  0.1848  326 ARG A NH2 
2652 N N   . PHE A 332 ? 1.1094 1.1619 0.7891 0.5140  0.0443  0.1469  327 PHE A N   
2653 C CA  . PHE A 332 ? 1.0367 1.0891 0.7510 0.4390  0.0090  0.1414  327 PHE A CA  
2654 C C   . PHE A 332 ? 1.0519 0.9835 0.7220 0.4148  -0.0143 0.1130  327 PHE A C   
2655 O O   . PHE A 332 ? 1.0192 0.9123 0.6834 0.3636  -0.0327 0.0950  327 PHE A O   
2656 C CB  . PHE A 332 ? 0.9891 1.0726 0.7185 0.3927  0.0070  0.1390  327 PHE A CB  
2657 C CG  . PHE A 332 ? 0.9993 1.1879 0.7580 0.4159  0.0346  0.1666  327 PHE A CG  
2658 C CD1 . PHE A 332 ? 1.0372 1.2040 0.7517 0.4259  0.0542  0.1563  327 PHE A CD1 
2659 C CD2 . PHE A 332 ? 0.9770 1.2965 0.8082 0.4250  0.0402  0.2066  327 PHE A CD2 
2660 C CE1 . PHE A 332 ? 1.0510 1.3213 0.7908 0.4479  0.0836  0.1856  327 PHE A CE1 
2661 C CE2 . PHE A 332 ? 0.9878 1.4191 0.8528 0.4441  0.0680  0.2381  327 PHE A CE2 
2662 C CZ  . PHE A 332 ? 1.0219 1.4269 0.8404 0.4569  0.0919  0.2277  327 PHE A CZ  
2663 N N   . CYS A 333 ? 1.1037 0.9818 0.7461 0.4532  -0.0119 0.1140  328 CYS A N   
2664 C CA  . CYS A 333 ? 1.1248 0.8983 0.7303 0.4297  -0.0325 0.0957  328 CYS A CA  
2665 C C   . CYS A 333 ? 1.0619 0.8808 0.7143 0.4027  -0.0548 0.1148  328 CYS A C   
2666 O O   . CYS A 333 ? 1.0272 0.9512 0.7338 0.4116  -0.0557 0.1434  328 CYS A O   
2667 C CB  . CYS A 333 ? 1.2371 0.8990 0.7702 0.4823  -0.0176 0.0852  328 CYS A CB  
2668 S SG  . CYS A 333 ? 1.3553 0.9077 0.7982 0.4898  -0.0041 0.0457  328 CYS A SG  
2669 N N   . PHE A 334 ? 1.0544 0.7981 0.6828 0.3677  -0.0732 0.0999  329 PHE A N   
2670 C CA  . PHE A 334 ? 1.0167 0.7880 0.6727 0.3404  -0.0930 0.1134  329 PHE A CA  
2671 C C   . PHE A 334 ? 1.0413 0.7118 0.6555 0.3137  -0.1041 0.0971  329 PHE A C   
2672 O O   . PHE A 334 ? 1.0603 0.6674 0.6430 0.2956  -0.1039 0.0740  329 PHE A O   
2673 C CB  . PHE A 334 ? 0.9355 0.7981 0.6452 0.2943  -0.1060 0.1172  329 PHE A CB  
2674 C CG  . PHE A 334 ? 0.9163 0.7440 0.6205 0.2471  -0.1129 0.0930  329 PHE A CG  
2675 C CD1 . PHE A 334 ? 0.9067 0.7109 0.6089 0.2102  -0.1273 0.0853  329 PHE A CD1 
2676 C CD2 . PHE A 334 ? 0.9120 0.7393 0.6143 0.2433  -0.1032 0.0822  329 PHE A CD2 
2677 C CE1 . PHE A 334 ? 0.8680 0.6493 0.5704 0.1758  -0.1304 0.0683  329 PHE A CE1 
2678 C CE2 . PHE A 334 ? 0.8988 0.7017 0.6005 0.2049  -0.1099 0.0665  329 PHE A CE2 
2679 C CZ  . PHE A 334 ? 0.8855 0.6656 0.5895 0.1738  -0.1227 0.0600  329 PHE A CZ  
2680 N N   . GLU A 335 ? 1.0512 0.7146 0.6652 0.3099  -0.1146 0.1129  330 GLU A N   
2681 C CA  . GLU A 335 ? 1.0945 0.6647 0.6686 0.2887  -0.1221 0.1062  330 GLU A CA  
2682 C C   . GLU A 335 ? 1.0473 0.6499 0.6427 0.2431  -0.1367 0.1094  330 GLU A C   
2683 O O   . GLU A 335 ? 1.0109 0.6902 0.6366 0.2390  -0.1433 0.1230  330 GLU A O   
2684 C CB  . GLU A 335 ? 1.1799 0.6840 0.7164 0.3314  -0.1162 0.1257  330 GLU A CB  
2685 C CG  . GLU A 335 ? 1.2396 0.6349 0.7293 0.3054  -0.1233 0.1220  330 GLU A CG  
2686 C CD  . GLU A 335 ? 1.3677 0.6723 0.8099 0.3492  -0.1154 0.1420  330 GLU A CD  
2687 O OE1 . GLU A 335 ? 1.3960 0.7097 0.8345 0.4103  -0.1000 0.1540  330 GLU A OE1 
2688 O OE2 . GLU A 335 ? 1.4283 0.6517 0.8370 0.3236  -0.1229 0.1491  330 GLU A OE2 
2689 N N   . VAL A 336 ? 1.0573 0.6032 0.6329 0.2087  -0.1416 0.0976  331 VAL A N   
2690 C CA  . VAL A 336 ? 1.0310 0.6026 0.6203 0.1724  -0.1492 0.1020  331 VAL A CA  
2691 C C   . VAL A 336 ? 1.0872 0.5902 0.6435 0.1606  -0.1521 0.1159  331 VAL A C   
2692 O O   . VAL A 336 ? 1.1304 0.5650 0.6620 0.1441  -0.1536 0.1076  331 VAL A O   
2693 C CB  . VAL A 336 ? 0.9728 0.5690 0.5842 0.1387  -0.1495 0.0823  331 VAL A CB  
2694 C CG1 . VAL A 336 ? 0.9735 0.5835 0.5902 0.1091  -0.1510 0.0872  331 VAL A CG1 
2695 C CG2 . VAL A 336 ? 0.9316 0.5940 0.5751 0.1426  -0.1473 0.0744  331 VAL A CG2 
2696 N N   . VAL A 337 ? 1.0978 0.6209 0.6512 0.1643  -0.1549 0.1392  332 VAL A N   
2697 C CA  . VAL A 337 ? 1.1624 0.6235 0.6848 0.1517  -0.1564 0.1594  332 VAL A CA  
2698 C C   . VAL A 337 ? 1.1407 0.6500 0.6754 0.1170  -0.1569 0.1668  332 VAL A C   
2699 O O   . VAL A 337 ? 1.1014 0.6829 0.6528 0.1177  -0.1575 0.1649  332 VAL A O   
2700 C CB  . VAL A 337 ? 1.2289 0.6595 0.7263 0.1924  -0.1560 0.1894  332 VAL A CB  
2701 C CG1 . VAL A 337 ? 1.3025 0.6462 0.7606 0.1766  -0.1567 0.2131  332 VAL A CG1 
2702 C CG2 . VAL A 337 ? 1.2498 0.6456 0.7366 0.2393  -0.1490 0.1823  332 VAL A CG2 
2703 N N   . SER A 338 ? 1.1831 0.6524 0.7063 0.0848  -0.1560 0.1748  333 SER A N   
2704 C CA  . SER A 338 ? 1.1831 0.6962 0.7132 0.0570  -0.1509 0.1888  333 SER A CA  
2705 C C   . SER A 338 ? 1.2711 0.7243 0.7709 0.0422  -0.1518 0.2222  333 SER A C   
2706 O O   . SER A 338 ? 1.3413 0.7113 0.8113 0.0570  -0.1569 0.2315  333 SER A O   
2707 C CB  . SER A 338 ? 1.1378 0.6860 0.6981 0.0277  -0.1456 0.1712  333 SER A CB  
2708 O OG  . SER A 338 ? 1.1584 0.6555 0.7183 0.0109  -0.1528 0.1625  333 SER A OG  
2709 N N   . THR A 339 ? 1.2828 0.7741 0.7861 0.0149  -0.1443 0.2416  334 THR A N   
2710 C CA  . THR A 339 ? 1.3687 0.8131 0.8463 -0.0078 -0.1434 0.2802  334 THR A CA  
2711 C C   . THR A 339 ? 1.4361 0.7879 0.9013 -0.0370 -0.1525 0.2809  334 THR A C   
2712 O O   . THR A 339 ? 1.5280 0.7861 0.9536 -0.0359 -0.1576 0.3027  334 THR A O   
2713 C CB  . THR A 339 ? 1.3497 0.8688 0.8409 -0.0362 -0.1291 0.2989  334 THR A CB  
2714 O OG1 . THR A 339 ? 1.3084 0.8781 0.8400 -0.0561 -0.1230 0.2766  334 THR A OG1 
2715 C CG2 . THR A 339 ? 1.3208 0.9082 0.8004 -0.0104 -0.1219 0.2987  334 THR A CG2 
2716 N N   . SER A 340 ? 1.4031 0.7767 0.8971 -0.0627 -0.1558 0.2570  335 SER A N   
2717 C CA  . SER A 340 ? 1.4737 0.7719 0.9537 -0.1026 -0.1692 0.2546  335 SER A CA  
2718 C C   . SER A 340 ? 1.4823 0.7232 0.9446 -0.0817 -0.1791 0.2167  335 SER A C   
2719 O O   . SER A 340 ? 1.5775 0.7087 0.9937 -0.0935 -0.1898 0.2118  335 SER A O   
2720 C CB  . SER A 340 ? 1.4360 0.8118 0.9612 -0.1519 -0.1689 0.2623  335 SER A CB  
2721 O OG  . SER A 340 ? 1.3429 0.8064 0.9105 -0.1321 -0.1624 0.2357  335 SER A OG  
2722 N N   . LYS A 341 ? 1.3953 0.7050 0.8880 -0.0519 -0.1741 0.1901  336 LYS A N   
2723 C CA  . LYS A 341 ? 1.3941 0.6695 0.8743 -0.0325 -0.1801 0.1569  336 LYS A CA  
2724 C C   . LYS A 341 ? 1.3995 0.6490 0.8588 0.0259  -0.1730 0.1493  336 LYS A C   
2725 O O   . LYS A 341 ? 1.3767 0.6683 0.8467 0.0521  -0.1658 0.1655  336 LYS A O   
2726 C CB  . LYS A 341 ? 1.3051 0.6725 0.8337 -0.0378 -0.1787 0.1375  336 LYS A CB  
2727 C CG  . LYS A 341 ? 1.3100 0.7062 0.8617 -0.0886 -0.1888 0.1419  336 LYS A CG  
2728 C CD  . LYS A 341 ? 1.3665 0.7132 0.8926 -0.1011 -0.2052 0.1174  336 LYS A CD  
2729 C CE  . LYS A 341 ? 1.4085 0.7620 0.9418 -0.1631 -0.2244 0.1282  336 LYS A CE  
2730 N NZ  . LYS A 341 ? 1.3201 0.7934 0.9185 -0.1732 -0.2226 0.1355  336 LYS A NZ  
2731 N N   . SER A 342 ? 1.4394 0.6234 0.8660 0.0457  -0.1752 0.1265  337 SER A N   
2732 C CA  . SER A 342 ? 1.4178 0.6102 0.8404 0.1033  -0.1652 0.1160  337 SER A CA  
2733 C C   . SER A 342 ? 1.3968 0.5923 0.8171 0.1020  -0.1668 0.0838  337 SER A C   
2734 O O   . SER A 342 ? 1.4525 0.5895 0.8424 0.0675  -0.1777 0.0699  337 SER A O   
2735 C CB  . SER A 342 ? 1.5254 0.6129 0.8926 0.1421  -0.1593 0.1272  337 SER A CB  
2736 O OG  . SER A 342 ? 1.5112 0.6034 0.8714 0.1987  -0.1472 0.1145  337 SER A OG  
2737 N N   . CYS A 343 ? 1.3214 0.5881 0.7719 0.1344  -0.1580 0.0745  338 CYS A N   
2738 C CA  . CYS A 343 ? 1.2995 0.5764 0.7472 0.1351  -0.1576 0.0490  338 CYS A CA  
2739 C C   . CYS A 343 ? 1.2684 0.5810 0.7231 0.1870  -0.1425 0.0450  338 CYS A C   
2740 O O   . CYS A 343 ? 1.1942 0.5942 0.6967 0.1999  -0.1380 0.0572  338 CYS A O   
2741 C CB  . CYS A 343 ? 1.2191 0.5771 0.7162 0.0982  -0.1644 0.0457  338 CYS A CB  
2742 S SG  . CYS A 343 ? 1.2728 0.6239 0.7541 0.0795  -0.1726 0.0220  338 CYS A SG  
2743 N N   . LEU A 344 ? 1.3269 0.5732 0.7305 0.2146  -0.1344 0.0284  339 LEU A N   
2744 C CA  . LEU A 344 ? 1.3009 0.5932 0.7129 0.2634  -0.1162 0.0259  339 LEU A CA  
2745 C C   . LEU A 344 ? 1.2240 0.5818 0.6630 0.2408  -0.1186 0.0125  339 LEU A C   
2746 O O   . LEU A 344 ? 1.2327 0.5548 0.6463 0.2066  -0.1303 -0.0043 339 LEU A O   
2747 C CB  . LEU A 344 ? 1.4196 0.6110 0.7571 0.3097  -0.1005 0.0126  339 LEU A CB  
2748 C CG  . LEU A 344 ? 1.4422 0.6671 0.7891 0.3816  -0.0762 0.0311  339 LEU A CG  
2749 C CD1 . LEU A 344 ? 1.5876 0.6758 0.8464 0.4335  -0.0582 0.0209  339 LEU A CD1 
2750 C CD2 . LEU A 344 ? 1.3315 0.6736 0.7258 0.4026  -0.0622 0.0345  339 LEU A CD2 
2751 N N   . LEU A 345 ? 1.1462 0.6023 0.6377 0.2564  -0.1096 0.0241  340 LEU A N   
2752 C CA  . LEU A 345 ? 1.0739 0.5945 0.5978 0.2342  -0.1110 0.0191  340 LEU A CA  
2753 C C   . LEU A 345 ? 1.0712 0.6463 0.6053 0.2725  -0.0915 0.0252  340 LEU A C   
2754 O O   . LEU A 345 ? 1.0890 0.6950 0.6367 0.3101  -0.0796 0.0412  340 LEU A O   
2755 C CB  . LEU A 345 ? 0.9832 0.5714 0.5662 0.2017  -0.1206 0.0307  340 LEU A CB  
2756 C CG  . LEU A 345 ? 0.9756 0.5391 0.5625 0.1660  -0.1347 0.0311  340 LEU A CG  
2757 C CD1 . LEU A 345 ? 0.8951 0.5242 0.5309 0.1439  -0.1370 0.0378  340 LEU A CD1 
2758 C CD2 . LEU A 345 ? 1.0147 0.5305 0.5734 0.1396  -0.1446 0.0184  340 LEU A CD2 
2759 N N   . GLN A 346 ? 1.0536 0.6495 0.5831 0.2643  -0.0874 0.0173  341 GLN A N   
2760 C CA  . GLN A 346 ? 1.0518 0.7051 0.5896 0.2991  -0.0658 0.0266  341 GLN A CA  
2761 C C   . GLN A 346 ? 0.9903 0.7128 0.5687 0.2701  -0.0674 0.0353  341 GLN A C   
2762 O O   . GLN A 346 ? 0.9921 0.6897 0.5533 0.2430  -0.0776 0.0247  341 GLN A O   
2763 C CB  . GLN A 346 ? 1.1433 0.7270 0.6037 0.3364  -0.0497 0.0075  341 GLN A CB  
2764 C CG  . GLN A 346 ? 1.1398 0.7886 0.6046 0.3786  -0.0214 0.0192  341 GLN A CG  
2765 C CD  . GLN A 346 ? 1.2349 0.8118 0.6103 0.4090  -0.0049 -0.0058 341 GLN A CD  
2766 O OE1 . GLN A 346 ? 1.2859 0.8988 0.6473 0.4584  0.0255  0.0013  341 GLN A OE1 
2767 N NE2 . GLN A 346 ? 1.2637 0.7412 0.5747 0.3789  -0.0245 -0.0347 341 GLN A NE2 
2768 N N   . ALA A 347 ? 0.9520 0.7628 0.5855 0.2736  -0.0591 0.0582  342 ALA A N   
2769 C CA  . ALA A 347 ? 0.9112 0.7817 0.5820 0.2461  -0.0582 0.0712  342 ALA A CA  
2770 C C   . ALA A 347 ? 0.9550 0.8559 0.6039 0.2751  -0.0350 0.0780  342 ALA A C   
2771 O O   . ALA A 347 ? 1.0083 0.8858 0.6141 0.3204  -0.0180 0.0704  342 ALA A O   
2772 C CB  . ALA A 347 ? 0.8609 0.8058 0.5950 0.2256  -0.0635 0.0924  342 ALA A CB  
2773 N N   . ASP A 348 ? 0.9300 0.8775 0.6031 0.2517  -0.0317 0.0932  343 ASP A N   
2774 C CA  . ASP A 348 ? 0.9760 0.9597 0.6265 0.2755  -0.0081 0.1037  343 ASP A CA  
2775 C C   . ASP A 348 ? 0.9649 1.0545 0.6651 0.2915  0.0134  0.1364  343 ASP A C   
2776 O O   . ASP A 348 ? 1.0053 1.1336 0.6846 0.3244  0.0401  0.1468  343 ASP A O   
2777 C CB  . ASP A 348 ? 0.9704 0.9465 0.6132 0.2437  -0.0149 0.1086  343 ASP A CB  
2778 C CG  . ASP A 348 ? 1.0016 0.8945 0.5939 0.2331  -0.0343 0.0819  343 ASP A CG  
2779 O OD1 . ASP A 348 ? 1.0689 0.9131 0.5944 0.2585  -0.0301 0.0599  343 ASP A OD1 
2780 O OD2 . ASP A 348 ? 1.0079 0.8835 0.6253 0.1991  -0.0537 0.0832  343 ASP A OD2 
2781 N N   . SER A 349 ? 0.9222 1.0643 0.6864 0.2657  0.0014  0.1537  344 SER A N   
2782 C CA  . SER A 349 ? 0.9166 1.1764 0.7403 0.2662  0.0150  0.1907  344 SER A CA  
2783 C C   . SER A 349 ? 0.8888 1.1893 0.7599 0.2556  -0.0021 0.1996  344 SER A C   
2784 O O   . SER A 349 ? 0.8761 1.1091 0.7330 0.2420  -0.0237 0.1773  344 SER A O   
2785 C CB  . SER A 349 ? 0.8984 1.2007 0.7563 0.2162  0.0135  0.2147  344 SER A CB  
2786 O OG  . SER A 349 ? 0.8781 1.1606 0.7685 0.1606  -0.0139 0.2128  344 SER A OG  
2787 N N   . GLU A 350 ? 0.8883 1.3090 0.8161 0.2607  0.0074  0.2357  345 GLU A N   
2788 C CA  . GLU A 350 ? 0.8751 1.3569 0.8507 0.2484  -0.0118 0.2508  345 GLU A CA  
2789 C C   . GLU A 350 ? 0.8439 1.2897 0.8328 0.1768  -0.0452 0.2392  345 GLU A C   
2790 O O   . GLU A 350 ? 0.8429 1.2510 0.8229 0.1693  -0.0661 0.2235  345 GLU A O   
2791 C CB  . GLU A 350 ? 0.8756 1.5152 0.9188 0.2590  0.0023  0.2988  345 GLU A CB  
2792 C CG  . GLU A 350 ? 0.9129 1.6068 0.9651 0.3317  0.0177  0.3147  345 GLU A CG  
2793 C CD  . GLU A 350 ? 0.9114 1.5904 0.9723 0.3231  -0.0131 0.3096  345 GLU A CD  
2794 O OE1 . GLU A 350 ? 0.9502 1.5784 0.9766 0.3831  -0.0046 0.3005  345 GLU A OE1 
2795 O OE2 . GLU A 350 ? 0.8769 1.5886 0.9721 0.2559  -0.0454 0.3150  345 GLU A OE2 
2796 N N   . ARG A 351 ? 0.8398 1.2896 0.8426 0.1275  -0.0473 0.2472  346 ARG A N   
2797 C CA  . ARG A 351 ? 0.8331 1.2365 0.8403 0.0603  -0.0734 0.2362  346 ARG A CA  
2798 C C   . ARG A 351 ? 0.8260 1.1022 0.7824 0.0599  -0.0850 0.1958  346 ARG A C   
2799 O O   . ARG A 351 ? 0.8276 1.0680 0.7805 0.0236  -0.1062 0.1812  346 ARG A O   
2800 C CB  . ARG A 351 ? 0.8511 1.2645 0.8724 0.0198  -0.0657 0.2556  346 ARG A CB  
2801 C CG  . ARG A 351 ? 0.8807 1.2818 0.9210 -0.0556 -0.0895 0.2595  346 ARG A CG  
2802 C CD  . ARG A 351 ? 0.9285 1.2859 0.9611 -0.0875 -0.0799 0.2717  346 ARG A CD  
2803 N NE  . ARG A 351 ? 0.9897 1.3261 1.0352 -0.1627 -0.0999 0.2786  346 ARG A NE  
2804 C CZ  . ARG A 351 ? 1.0299 1.2677 1.0431 -0.1937 -0.1201 0.2467  346 ARG A CZ  
2805 N NH1 . ARG A 351 ? 1.0062 1.1726 0.9820 -0.1564 -0.1226 0.2104  346 ARG A NH1 
2806 N NH2 . ARG A 351 ? 1.0924 1.3006 1.1068 -0.2639 -0.1369 0.2515  346 ARG A NH2 
2807 N N   . LEU A 352 ? 0.8269 1.0394 0.7419 0.0975  -0.0710 0.1788  347 LEU A N   
2808 C CA  . LEU A 352 ? 0.8220 0.9313 0.6965 0.0968  -0.0812 0.1469  347 LEU A CA  
2809 C C   . LEU A 352 ? 0.8135 0.9059 0.6757 0.1176  -0.0910 0.1330  347 LEU A C   
2810 O O   . LEU A 352 ? 0.8022 0.8417 0.6507 0.0992  -0.1052 0.1148  347 LEU A O   
2811 C CB  . LEU A 352 ? 0.8298 0.8875 0.6640 0.1237  -0.0685 0.1363  347 LEU A CB  
2812 C CG  . LEU A 352 ? 0.8500 0.8964 0.6821 0.1038  -0.0623 0.1473  347 LEU A CG  
2813 C CD1 . LEU A 352 ? 0.8655 0.8680 0.6500 0.1321  -0.0556 0.1351  347 LEU A CD1 
2814 C CD2 . LEU A 352 ? 0.8304 0.8286 0.6722 0.0629  -0.0762 0.1421  347 LEU A CD2 
2815 N N   . LEU A 353 ? 0.8229 0.9591 0.6872 0.1608  -0.0800 0.1443  348 LEU A N   
2816 C CA  . LEU A 353 ? 0.8349 0.9638 0.6909 0.1857  -0.0874 0.1410  348 LEU A CA  
2817 C C   . LEU A 353 ? 0.8173 0.9800 0.7004 0.1450  -0.1106 0.1459  348 LEU A C   
2818 O O   . LEU A 353 ? 0.8190 0.9263 0.6790 0.1341  -0.1238 0.1285  348 LEU A O   
2819 C CB  . LEU A 353 ? 0.8569 1.0458 0.7213 0.2416  -0.0684 0.1622  348 LEU A CB  
2820 C CG  . LEU A 353 ? 0.8761 1.0563 0.7285 0.2845  -0.0697 0.1672  348 LEU A CG  
2821 C CD1 . LEU A 353 ? 0.8564 1.1550 0.7661 0.2805  -0.0803 0.2013  348 LEU A CD1 
2822 C CD2 . LEU A 353 ? 0.8514 0.9290 0.6625 0.2723  -0.0854 0.1420  348 LEU A CD2 
2823 N N   . GLN A 354 ? 0.8122 1.0665 0.7405 0.1178  -0.1158 0.1698  349 GLN A N   
2824 C CA  . GLN A 354 ? 0.8137 1.1002 0.7597 0.0681  -0.1418 0.1722  349 GLN A CA  
2825 C C   . GLN A 354 ? 0.8201 1.0187 0.7368 0.0211  -0.1528 0.1435  349 GLN A C   
2826 O O   . GLN A 354 ? 0.8339 1.0251 0.7398 -0.0114 -0.1729 0.1336  349 GLN A O   
2827 C CB  . GLN A 354 ? 0.8177 1.2219 0.8182 0.0375  -0.1478 0.2055  349 GLN A CB  
2828 C CG  . GLN A 354 ? 0.8187 1.3389 0.8601 0.0831  -0.1387 0.2418  349 GLN A CG  
2829 C CD  . GLN A 354 ? 0.8285 1.4680 0.9283 0.0585  -0.1334 0.2789  349 GLN A CD  
2830 O OE1 . GLN A 354 ? 0.8320 1.4524 0.9315 0.0442  -0.1174 0.2795  349 GLN A OE1 
2831 N NE2 . GLN A 354 ? 0.8455 1.6178 0.9983 0.0514  -0.1476 0.3151  349 GLN A NE2 
2832 N N   . LEU A 355 ? 0.8187 0.9534 0.7194 0.0193  -0.1393 0.1318  350 LEU A N   
2833 C CA  . LEU A 355 ? 0.8308 0.8797 0.7037 -0.0136 -0.1451 0.1076  350 LEU A CA  
2834 C C   . LEU A 355 ? 0.8179 0.8024 0.6561 0.0083  -0.1460 0.0845  350 LEU A C   
2835 O O   . LEU A 355 ? 0.8384 0.7885 0.6558 -0.0136 -0.1559 0.0681  350 LEU A O   
2836 C CB  . LEU A 355 ? 0.8417 0.8489 0.7124 -0.0220 -0.1316 0.1096  350 LEU A CB  
2837 C CG  . LEU A 355 ? 0.8927 0.8357 0.7483 -0.0672 -0.1380 0.0975  350 LEU A CG  
2838 C CD1 . LEU A 355 ? 0.9400 0.9310 0.8176 -0.1195 -0.1516 0.1127  350 LEU A CD1 
2839 C CD2 . LEU A 355 ? 0.9377 0.8176 0.7822 -0.0620 -0.1234 0.0989  350 LEU A CD2 
2840 N N   . TRP A 356 ? 0.7952 0.7640 0.6231 0.0492  -0.1352 0.0840  351 TRP A N   
2841 C CA  . TRP A 356 ? 0.7854 0.6962 0.5839 0.0652  -0.1357 0.0676  351 TRP A CA  
2842 C C   . TRP A 356 ? 0.7928 0.7164 0.5819 0.0697  -0.1468 0.0680  351 TRP A C   
2843 O O   . TRP A 356 ? 0.7953 0.6763 0.5614 0.0646  -0.1495 0.0552  351 TRP A O   
2844 C CB  . TRP A 356 ? 0.7805 0.6673 0.5643 0.0989  -0.1250 0.0674  351 TRP A CB  
2845 C CG  . TRP A 356 ? 0.7845 0.6327 0.5601 0.0927  -0.1192 0.0606  351 TRP A CG  
2846 C CD1 . TRP A 356 ? 0.7893 0.6519 0.5711 0.0947  -0.1105 0.0698  351 TRP A CD1 
2847 C CD2 . TRP A 356 ? 0.7758 0.5756 0.5379 0.0856  -0.1213 0.0490  351 TRP A CD2 
2848 N NE1 . TRP A 356 ? 0.7914 0.6152 0.5628 0.0896  -0.1097 0.0650  351 TRP A NE1 
2849 C CE2 . TRP A 356 ? 0.7902 0.5797 0.5533 0.0849  -0.1160 0.0530  351 TRP A CE2 
2850 C CE3 . TRP A 356 ? 0.7705 0.5442 0.5220 0.0808  -0.1259 0.0400  351 TRP A CE3 
2851 C CZ2 . TRP A 356 ? 0.7921 0.5528 0.5515 0.0818  -0.1168 0.0500  351 TRP A CZ2 
2852 C CZ3 . TRP A 356 ? 0.7879 0.5344 0.5368 0.0768  -0.1237 0.0363  351 TRP A CZ3 
2853 C CH2 . TRP A 356 ? 0.7989 0.5423 0.5544 0.0784  -0.1200 0.0420  351 TRP A CH2 
2854 N N   . VAL A 357 ? 0.7971 0.7865 0.6051 0.0821  -0.1520 0.0871  352 VAL A N   
2855 C CA  . VAL A 357 ? 0.8051 0.8149 0.6045 0.0899  -0.1642 0.0947  352 VAL A CA  
2856 C C   . VAL A 357 ? 0.8122 0.8365 0.6037 0.0469  -0.1820 0.0867  352 VAL A C   
2857 O O   . VAL A 357 ? 0.8220 0.8112 0.5826 0.0428  -0.1867 0.0762  352 VAL A O   
2858 C CB  . VAL A 357 ? 0.8148 0.8941 0.6365 0.1276  -0.1632 0.1234  352 VAL A CB  
2859 C CG1 . VAL A 357 ? 0.8388 0.8721 0.6434 0.1762  -0.1435 0.1235  352 VAL A CG1 
2860 C CG2 . VAL A 357 ? 0.8209 0.9968 0.6877 0.1119  -0.1671 0.1438  352 VAL A CG2 
2861 N N   . SER A 358 ? 0.8135 0.8840 0.6265 0.0115  -0.1915 0.0908  353 SER A N   
2862 C CA  . SER A 358 ? 0.8464 0.9118 0.6371 -0.0363 -0.2098 0.0763  353 SER A CA  
2863 C C   . SER A 358 ? 0.8611 0.8269 0.6118 -0.0465 -0.1982 0.0448  353 SER A C   
2864 O O   . SER A 358 ? 0.8950 0.8297 0.6059 -0.0620 -0.2045 0.0272  353 SER A O   
2865 C CB  . SER A 358 ? 0.8626 0.9904 0.6810 -0.0819 -0.2252 0.0876  353 SER A CB  
2866 O OG  . SER A 358 ? 0.8636 0.9589 0.6952 -0.0951 -0.2114 0.0844  353 SER A OG  
2867 N N   . ALA A 359 ? 0.8394 0.7616 0.5993 -0.0328 -0.1798 0.0406  354 ALA A N   
2868 C CA  . ALA A 359 ? 0.8503 0.6916 0.5823 -0.0280 -0.1652 0.0193  354 ALA A CA  
2869 C C   . ALA A 359 ? 0.8396 0.6616 0.5468 -0.0073 -0.1619 0.0134  354 ALA A C   
2870 O O   . ALA A 359 ? 0.8633 0.6448 0.5380 -0.0156 -0.1567 -0.0042 354 ALA A O   
2871 C CB  . ALA A 359 ? 0.8219 0.6403 0.5732 -0.0089 -0.1493 0.0249  354 ALA A CB  
2872 N N   . VAL A 360 ? 0.8182 0.6641 0.5372 0.0208  -0.1622 0.0293  355 VAL A N   
2873 C CA  . VAL A 360 ? 0.8302 0.6592 0.5267 0.0354  -0.1606 0.0307  355 VAL A CA  
2874 C C   . VAL A 360 ? 0.8583 0.7129 0.5289 0.0211  -0.1741 0.0312  355 VAL A C   
2875 O O   . VAL A 360 ? 0.8789 0.7073 0.5175 0.0172  -0.1687 0.0217  355 VAL A O   
2876 C CB  . VAL A 360 ? 0.8180 0.6478 0.5235 0.0663  -0.1586 0.0478  355 VAL A CB  
2877 C CG1 . VAL A 360 ? 0.8201 0.6265 0.5008 0.0737  -0.1580 0.0537  355 VAL A CG1 
2878 C CG2 . VAL A 360 ? 0.8028 0.6030 0.5198 0.0759  -0.1479 0.0435  355 VAL A CG2 
2879 N N   . GLN A 361 ? 0.8694 0.7835 0.5534 0.0133  -0.1913 0.0447  356 GLN A N   
2880 C CA  . GLN A 361 ? 0.9112 0.8631 0.5691 -0.0045 -0.2103 0.0484  356 GLN A CA  
2881 C C   . GLN A 361 ? 0.9674 0.8800 0.5816 -0.0414 -0.2116 0.0175  356 GLN A C   
2882 O O   . GLN A 361 ? 1.0089 0.9096 0.5774 -0.0475 -0.2137 0.0089  356 GLN A O   
2883 C CB  . GLN A 361 ? 0.9049 0.9438 0.5947 -0.0130 -0.2312 0.0709  356 GLN A CB  
2884 C CG  . GLN A 361 ? 0.8777 0.9616 0.6024 0.0316  -0.2285 0.1039  356 GLN A CG  
2885 C CD  . GLN A 361 ? 0.8719 1.0546 0.6430 0.0267  -0.2421 0.1287  356 GLN A CD  
2886 O OE1 . GLN A 361 ? 0.8676 1.0765 0.6513 -0.0161 -0.2521 0.1201  356 GLN A OE1 
2887 N NE2 . GLN A 361 ? 0.8584 1.0961 0.6555 0.0711  -0.2411 0.1623  356 GLN A NE2 
2888 N N   . SER A 362 ? 0.9841 0.8712 0.6067 -0.0643 -0.2086 0.0016  357 SER A N   
2889 C CA  . SER A 362 ? 1.0518 0.8764 0.6267 -0.0952 -0.2052 -0.0310 357 SER A CA  
2890 C C   . SER A 362 ? 1.0654 0.8242 0.6103 -0.0697 -0.1781 -0.0473 357 SER A C   
2891 O O   . SER A 362 ? 1.1309 0.8463 0.6191 -0.0811 -0.1721 -0.0720 357 SER A O   
2892 C CB  . SER A 362 ? 1.0632 0.8629 0.6579 -0.1198 -0.2043 -0.0373 357 SER A CB  
2893 O OG  . SER A 362 ? 1.1410 0.8521 0.6842 -0.1401 -0.1941 -0.0696 357 SER A OG  
2894 N N   . SER A 363 ? 1.0159 0.7708 0.5965 -0.0363 -0.1613 -0.0332 358 SER A N   
2895 C CA  . SER A 363 ? 1.0232 0.7404 0.5892 -0.0130 -0.1372 -0.0392 358 SER A CA  
2896 C C   . SER A 363 ? 1.0397 0.7780 0.5759 -0.0063 -0.1379 -0.0320 358 SER A C   
2897 O O   . SER A 363 ? 1.0805 0.7932 0.5806 0.0000  -0.1196 -0.0442 358 SER A O   
2898 C CB  . SER A 363 ? 0.9694 0.6872 0.5816 0.0113  -0.1261 -0.0229 358 SER A CB  
2899 O OG  . SER A 363 ? 0.9692 0.6668 0.6029 0.0074  -0.1227 -0.0269 358 SER A OG  
2900 N N   . ILE A 364 ? 1.0187 0.8048 0.5689 -0.0042 -0.1566 -0.0092 359 ILE A N   
2901 C CA  . ILE A 364 ? 1.0335 0.8434 0.5550 0.0012  -0.1613 0.0059  359 ILE A CA  
2902 C C   . ILE A 364 ? 1.1003 0.9135 0.5603 -0.0226 -0.1698 -0.0130 359 ILE A C   
2903 O O   . ILE A 364 ? 1.1327 0.9350 0.5490 -0.0179 -0.1565 -0.0165 359 ILE A O   
2904 C CB  . ILE A 364 ? 1.0057 0.8602 0.5556 0.0151  -0.1793 0.0381  359 ILE A CB  
2905 C CG1 . ILE A 364 ? 0.9725 0.8029 0.5570 0.0399  -0.1675 0.0532  359 ILE A CG1 
2906 C CG2 . ILE A 364 ? 1.0441 0.9296 0.5588 0.0166  -0.1906 0.0577  359 ILE A CG2 
2907 C CD1 . ILE A 364 ? 0.9759 0.8287 0.5806 0.0623  -0.1789 0.0808  359 ILE A CD1 
2908 N N   . ALA A 365 ? 1.1201 0.9511 0.5739 -0.0510 -0.1922 -0.0240 360 ALA A N   
2909 C CA  . ALA A 365 ? 1.2000 1.0310 0.5869 -0.0838 -0.2077 -0.0456 360 ALA A CA  
2910 C C   . ALA A 365 ? 1.2615 1.0109 0.5905 -0.0876 -0.1819 -0.0853 360 ALA A C   
2911 O O   . ALA A 365 ? 1.3221 1.0557 0.5845 -0.0882 -0.1736 -0.0997 360 ALA A O   
2912 C CB  . ALA A 365 ? 1.2114 1.0823 0.6129 -0.1218 -0.2400 -0.0461 360 ALA A CB  
2913 N N   . SER A 366 ? 1.2518 0.9502 0.6057 -0.0846 -0.1666 -0.0997 361 SER A N   
2914 C CA  . SER A 366 ? 1.3168 0.9318 0.6277 -0.0751 -0.1363 -0.1316 361 SER A CA  
2915 C C   . SER A 366 ? 1.3282 0.9373 0.6151 -0.0392 -0.1042 -0.1296 361 SER A C   
2916 O O   . SER A 366 ? 1.4209 0.9816 0.6350 -0.0358 -0.0850 -0.1581 361 SER A O   
2917 C CB  . SER A 366 ? 1.2723 0.8545 0.6377 -0.0627 -0.1231 -0.1283 361 SER A CB  
2918 O OG  . SER A 366 ? 1.3708 0.8658 0.6932 -0.0532 -0.0962 -0.1575 361 SER A OG  
2919 N N   . ALA A 367 ? 1.2519 0.9084 0.5963 -0.0138 -0.0972 -0.0955 362 ALA A N   
2920 C CA  . ALA A 367 ? 1.2514 0.9134 0.5921 0.0165  -0.0653 -0.0851 362 ALA A CA  
2921 C C   . ALA A 367 ? 1.3016 0.9903 0.5839 0.0148  -0.0628 -0.0806 362 ALA A C   
2922 O O   . ALA A 367 ? 1.3128 1.0161 0.5905 0.0370  -0.0345 -0.0677 362 ALA A O   
2923 C CB  . ALA A 367 ? 1.1641 0.8610 0.5810 0.0332  -0.0627 -0.0509 362 ALA A CB  
2924 N N   . PHE A 368 ? 1.3344 1.0386 0.5739 -0.0128 -0.0925 -0.0869 363 PHE A N   
2925 C CA  . PHE A 368 ? 1.4046 1.1297 0.5711 -0.0177 -0.0923 -0.0868 363 PHE A CA  
2926 C C   . PHE A 368 ? 1.5220 1.1863 0.5919 -0.0227 -0.0736 -0.1338 363 PHE A C   
2927 O O   . PHE A 368 ? 1.5937 1.2681 0.5907 -0.0205 -0.0636 -0.1382 363 PHE A O   
2928 C CB  . PHE A 368 ? 1.3990 1.1786 0.5594 -0.0435 -0.1353 -0.0677 363 PHE A CB  
2929 C CG  . PHE A 368 ? 1.3244 1.1576 0.5463 -0.0271 -0.1446 -0.0176 363 PHE A CG  
2930 C CD1 . PHE A 368 ? 1.3311 1.1871 0.5359 -0.0112 -0.1293 0.0119  363 PHE A CD1 
2931 C CD2 . PHE A 368 ? 1.2531 1.1082 0.5445 -0.0269 -0.1664 0.0013  363 PHE A CD2 
2932 C CE1 . PHE A 368 ? 1.2789 1.1638 0.5318 0.0019  -0.1377 0.0581  363 PHE A CE1 
2933 C CE2 . PHE A 368 ? 1.2065 1.0914 0.5428 -0.0071 -0.1721 0.0443  363 PHE A CE2 
2934 C CZ  . PHE A 368 ? 1.2258 1.1184 0.5409 0.0057  -0.1590 0.0721  363 PHE A CZ  
2935 N N   . SER A 369 ? 1.5548 1.1489 0.6173 -0.0280 -0.0672 -0.1682 364 SER A N   
2936 C CA  . SER A 369 ? 1.6934 1.2011 0.6525 -0.0357 -0.0518 -0.2200 364 SER A CA  
2937 C C   . SER A 369 ? 1.7757 1.2677 0.6632 -0.0001 -0.0075 -0.2318 364 SER A C   
2938 O O   . SER A 369 ? 1.7554 1.2455 0.6777 0.0446  0.0346  -0.2205 364 SER A O   
2939 C CB  . SER A 369 ? 1.7103 1.1336 0.6856 -0.0325 -0.0398 -0.2451 364 SER A CB  
2940 O OG  . SER A 369 ? 1.6314 1.0685 0.6858 0.0121  -0.0084 -0.2196 364 SER A OG  
2941 N N   . SER B 5   ? 0.9925 1.7065 0.9591 0.0341  0.0050  0.5109  0   SER B N   
2942 C CA  . SER B 5   ? 1.0131 1.7877 0.9938 0.0359  0.0004  0.5618  0   SER B CA  
2943 C C   . SER B 5   ? 1.0154 1.7957 0.9734 0.0513  -0.0016 0.5374  0   SER B C   
2944 O O   . SER B 5   ? 1.0249 1.8867 0.9643 0.0687  0.0041  0.5478  0   SER B O   
2945 C CB  . SER B 5   ? 1.0267 1.7619 1.0577 0.0123  -0.0158 0.6131  0   SER B CB  
2946 O OG  . SER B 5   ? 1.0401 1.8249 1.0884 0.0129  -0.0225 0.6616  0   SER B OG  
2947 N N   . MET B 6   ? 1.0059 1.7038 0.9661 0.0460  -0.0100 0.5057  1   MET B N   
2948 C CA  . MET B 6   ? 1.0039 1.6977 0.9453 0.0589  -0.0129 0.4793  1   MET B CA  
2949 C C   . MET B 6   ? 0.9785 1.6456 0.8887 0.0707  -0.0066 0.4149  1   MET B C   
2950 O O   . MET B 6   ? 0.9659 1.5895 0.8755 0.0643  -0.0033 0.3898  1   MET B O   
2951 C CB  . MET B 6   ? 1.0130 1.6395 0.9811 0.0466  -0.0282 0.4904  1   MET B CB  
2952 C CG  . MET B 6   ? 1.0493 1.7108 1.0464 0.0406  -0.0383 0.5507  1   MET B CG  
2953 S SD  . MET B 6   ? 1.0903 1.6624 1.1344 0.0212  -0.0614 0.5718  1   MET B SD  
2954 C CE  . MET B 6   ? 1.0969 1.7293 1.1840 0.0101  -0.0719 0.6556  1   MET B CE  
2955 N N   . THR B 7   ? 0.9709 1.6658 0.8582 0.0879  -0.0064 0.3899  2   THR B N   
2956 C CA  . THR B 7   ? 0.9485 1.6114 0.8148 0.0973  -0.0052 0.3312  2   THR B CA  
2957 C C   . THR B 7   ? 0.9322 1.5247 0.8095 0.0895  -0.0139 0.3170  2   THR B C   
2958 O O   . THR B 7   ? 0.9411 1.5415 0.8250 0.0908  -0.0207 0.3368  2   THR B O   
2959 C CB  . THR B 7   ? 0.9583 1.6910 0.7960 0.1223  -0.0032 0.3065  2   THR B CB  
2960 O OG1 . THR B 7   ? 0.9662 1.7813 0.7948 0.1329  0.0039  0.3303  2   THR B OG1 
2961 C CG2 . THR B 7   ? 0.9507 1.6530 0.7731 0.1309  -0.0040 0.2462  2   THR B CG2 
2962 N N   . VAL B 8   ? 0.8985 1.4263 0.7783 0.0822  -0.0137 0.2846  3   VAL B N   
2963 C CA  . VAL B 8   ? 0.8774 1.3477 0.7631 0.0791  -0.0204 0.2633  3   VAL B CA  
2964 C C   . VAL B 8   ? 0.8683 1.3672 0.7370 0.0946  -0.0225 0.2373  3   VAL B C   
2965 O O   . VAL B 8   ? 0.8658 1.3998 0.7171 0.1068  -0.0192 0.2111  3   VAL B O   
2966 C CB  . VAL B 8   ? 0.8590 1.2664 0.7491 0.0709  -0.0184 0.2328  3   VAL B CB  
2967 C CG1 . VAL B 8   ? 0.8592 1.2314 0.7688 0.0563  -0.0199 0.2572  3   VAL B CG1 
2968 C CG2 . VAL B 8   ? 0.8487 1.2721 0.7224 0.0780  -0.0115 0.1988  3   VAL B CG2 
2969 N N   . LYS B 9   ? 0.8605 1.3455 0.7359 0.0951  -0.0298 0.2441  4   LYS B N   
2970 C CA  . LYS B 9   ? 0.8522 1.3584 0.7150 0.1085  -0.0336 0.2197  4   LYS B CA  
2971 C C   . LYS B 9   ? 0.8366 1.2872 0.7100 0.1037  -0.0392 0.2028  4   LYS B C   
2972 O O   . LYS B 9   ? 0.8423 1.2779 0.7270 0.1010  -0.0455 0.2233  4   LYS B O   
2973 C CB  . LYS B 9   ? 0.8714 1.4389 0.7282 0.1187  -0.0364 0.2478  4   LYS B CB  
2974 C CG  . LYS B 9   ? 0.8902 1.5304 0.7248 0.1363  -0.0325 0.2362  4   LYS B CG  
2975 C CD  . LYS B 9   ? 0.8954 1.5499 0.7163 0.1522  -0.0389 0.1947  4   LYS B CD  
2976 C CE  . LYS B 9   ? 0.8895 1.5880 0.7052 0.1633  -0.0444 0.2122  4   LYS B CE  
2977 N NZ  . LYS B 9   ? 0.9035 1.6730 0.7127 0.1700  -0.0398 0.2533  4   LYS B NZ  
2978 N N   . LEU B 10  ? 0.8130 1.2367 0.6847 0.1036  -0.0378 0.1661  5   LEU B N   
2979 C CA  . LEU B 10  ? 0.7903 1.1626 0.6740 0.0980  -0.0408 0.1509  5   LEU B CA  
2980 C C   . LEU B 10  ? 0.7796 1.1565 0.6611 0.1052  -0.0447 0.1169  5   LEU B C   
2981 O O   . LEU B 10  ? 0.7637 1.1055 0.6555 0.1002  -0.0447 0.0984  5   LEU B O   
2982 C CB  . LEU B 10  ? 0.7756 1.1034 0.6679 0.0868  -0.0360 0.1473  5   LEU B CB  
2983 C CG  . LEU B 10  ? 0.7760 1.0615 0.6833 0.0787  -0.0392 0.1671  5   LEU B CG  
2984 C CD1 . LEU B 10  ? 0.7951 1.0931 0.7093 0.0798  -0.0468 0.2000  5   LEU B CD1 
2985 C CD2 . LEU B 10  ? 0.7469 1.0087 0.6590 0.0695  -0.0346 0.1717  5   LEU B CD2 
2986 N N   . ASP B 11  ? 0.7775 1.2016 0.6479 0.1176  -0.0490 0.1105  6   ASP B N   
2987 C CA  . ASP B 11  ? 0.7685 1.2005 0.6408 0.1254  -0.0567 0.0793  6   ASP B CA  
2988 C C   . ASP B 11  ? 0.7661 1.1901 0.6454 0.1267  -0.0622 0.0864  6   ASP B C   
2989 O O   . ASP B 11  ? 0.7738 1.2015 0.6519 0.1262  -0.0619 0.1152  6   ASP B O   
2990 C CB  . ASP B 11  ? 0.7811 1.2694 0.6381 0.1413  -0.0615 0.0639  6   ASP B CB  
2991 C CG  . ASP B 11  ? 0.8012 1.3402 0.6436 0.1506  -0.0602 0.0929  6   ASP B CG  
2992 O OD1 . ASP B 11  ? 0.8152 1.3573 0.6600 0.1519  -0.0638 0.1085  6   ASP B OD1 
2993 O OD2 . ASP B 11  ? 0.8084 1.3882 0.6378 0.1574  -0.0558 0.1015  6   ASP B OD2 
2994 N N   . PHE B 12  ? 0.7493 1.1634 0.6392 0.1281  -0.0687 0.0619  7   PHE B N   
2995 C CA  . PHE B 12  ? 0.7452 1.1511 0.6434 0.1294  -0.0737 0.0669  7   PHE B CA  
2996 C C   . PHE B 12  ? 0.7570 1.2012 0.6432 0.1397  -0.0778 0.0853  7   PHE B C   
2997 O O   . PHE B 12  ? 0.7636 1.1971 0.6549 0.1393  -0.0798 0.1019  7   PHE B O   
2998 C CB  . PHE B 12  ? 0.7360 1.1372 0.6497 0.1301  -0.0816 0.0386  7   PHE B CB  
2999 C CG  . PHE B 12  ? 0.7436 1.1859 0.6523 0.1427  -0.0927 0.0178  7   PHE B CG  
3000 C CD1 . PHE B 12  ? 0.7441 1.2097 0.6517 0.1515  -0.1006 0.0187  7   PHE B CD1 
3001 C CD2 . PHE B 12  ? 0.7373 1.1965 0.6426 0.1477  -0.0969 -0.0045 7   PHE B CD2 
3002 C CE1 . PHE B 12  ? 0.7710 1.2771 0.6736 0.1654  -0.1127 -0.0028 7   PHE B CE1 
3003 C CE2 . PHE B 12  ? 0.7630 1.2621 0.6639 0.1629  -0.1102 -0.0280 7   PHE B CE2 
3004 C CZ  . PHE B 12  ? 0.7697 1.2929 0.6689 0.1720  -0.1183 -0.0275 7   PHE B CZ  
3005 N N   . GLU B 13  ? 0.7622 1.2540 0.6329 0.1505  -0.0796 0.0825  8   GLU B N   
3006 C CA  . GLU B 13  ? 0.7797 1.3166 0.6386 0.1615  -0.0828 0.1031  8   GLU B CA  
3007 C C   . GLU B 13  ? 0.7776 1.2993 0.6408 0.1532  -0.0781 0.1447  8   GLU B C   
3008 O O   . GLU B 13  ? 0.7793 1.2910 0.6499 0.1532  -0.0827 0.1600  8   GLU B O   
3009 C CB  . GLU B 13  ? 0.7918 1.3893 0.6317 0.1763  -0.0839 0.0954  8   GLU B CB  
3010 C CG  . GLU B 13  ? 0.8226 1.4783 0.6481 0.1874  -0.0833 0.1272  8   GLU B CG  
3011 C CD  . GLU B 13  ? 0.8438 1.5561 0.6514 0.1986  -0.0787 0.1300  8   GLU B CD  
3012 O OE1 . GLU B 13  ? 0.8375 1.6092 0.6332 0.2093  -0.0773 0.1577  8   GLU B OE1 
3013 O OE2 . GLU B 13  ? 0.8496 1.5503 0.6560 0.1975  -0.0766 0.1057  8   GLU B OE2 
3014 N N   . GLU B 14  ? 0.7690 1.2860 0.6309 0.1460  -0.0709 0.1613  9   GLU B N   
3015 C CA  . GLU B 14  ? 0.7656 1.2683 0.6372 0.1371  -0.0694 0.2016  9   GLU B CA  
3016 C C   . GLU B 14  ? 0.7467 1.1874 0.6368 0.1276  -0.0729 0.2035  9   GLU B C   
3017 O O   . GLU B 14  ? 0.7606 1.1895 0.6628 0.1248  -0.0788 0.2327  9   GLU B O   
3018 C CB  . GLU B 14  ? 0.7636 1.2751 0.6324 0.1311  -0.0617 0.2151  9   GLU B CB  
3019 C CG  . GLU B 14  ? 0.8022 1.3355 0.6792 0.1267  -0.0623 0.2640  9   GLU B CG  
3020 C CD  . GLU B 14  ? 0.8321 1.4432 0.6957 0.1400  -0.0623 0.2846  9   GLU B CD  
3021 O OE1 . GLU B 14  ? 0.8565 1.5135 0.6997 0.1531  -0.0586 0.2612  9   GLU B OE1 
3022 O OE2 . GLU B 14  ? 0.8503 1.4794 0.7251 0.1384  -0.0672 0.3253  9   GLU B OE2 
3023 N N   . CYS B 15  ? 0.7136 1.1191 0.6076 0.1243  -0.0710 0.1728  10  CYS B N   
3024 C CA  . CYS B 15  ? 0.6975 1.0537 0.6065 0.1198  -0.0741 0.1693  10  CYS B CA  
3025 C C   . CYS B 15  ? 0.6790 1.0394 0.5931 0.1272  -0.0826 0.1745  10  CYS B C   
3026 O O   . CYS B 15  ? 0.6777 1.0125 0.6037 0.1266  -0.0889 0.1911  10  CYS B O   
3027 C CB  . CYS B 15  ? 0.6806 1.0126 0.5931 0.1166  -0.0696 0.1374  10  CYS B CB  
3028 S SG  . CYS B 15  ? 0.7544 1.0631 0.6666 0.1063  -0.0605 0.1309  10  CYS B SG  
3029 N N   . LEU B 16  ? 0.6593 1.0513 0.5657 0.1352  -0.0845 0.1584  11  LEU B N   
3030 C CA  . LEU B 16  ? 0.6569 1.0565 0.5675 0.1428  -0.0921 0.1594  11  LEU B CA  
3031 C C   . LEU B 16  ? 0.6656 1.0884 0.5749 0.1472  -0.0980 0.1932  11  LEU B C   
3032 O O   . LEU B 16  ? 0.6718 1.0853 0.5901 0.1513  -0.1058 0.2037  11  LEU B O   
3033 C CB  . LEU B 16  ? 0.6558 1.0854 0.5608 0.1498  -0.0944 0.1321  11  LEU B CB  
3034 C CG  . LEU B 16  ? 0.6409 1.0540 0.5548 0.1457  -0.0929 0.1004  11  LEU B CG  
3035 C CD1 . LEU B 16  ? 0.6585 1.0912 0.5783 0.1527  -0.1012 0.0836  11  LEU B CD1 
3036 C CD2 . LEU B 16  ? 0.6348 1.0034 0.5619 0.1378  -0.0885 0.1001  11  LEU B CD2 
3037 N N   . LYS B 17  ? 0.6525 1.1091 0.5523 0.1470  -0.0946 0.2114  12  LYS B N   
3038 C CA  . LYS B 17  ? 0.6546 1.1419 0.5561 0.1496  -0.0992 0.2502  12  LYS B CA  
3039 C C   . LYS B 17  ? 0.6513 1.0961 0.5747 0.1401  -0.1053 0.2795  12  LYS B C   
3040 O O   . LYS B 17  ? 0.6598 1.1111 0.5954 0.1416  -0.1146 0.3100  12  LYS B O   
3041 C CB  . LYS B 17  ? 0.6611 1.1998 0.5480 0.1520  -0.0924 0.2613  12  LYS B CB  
3042 C CG  . LYS B 17  ? 0.6735 1.2786 0.5495 0.1639  -0.0949 0.2823  12  LYS B CG  
3043 C CD  . LYS B 17  ? 0.6777 1.3373 0.5303 0.1756  -0.0890 0.2593  12  LYS B CD  
3044 C CE  . LYS B 17  ? 0.6571 1.3349 0.5054 0.1710  -0.0803 0.2734  12  LYS B CE  
3045 N NZ  . LYS B 17  ? 0.7065 1.4599 0.5463 0.1806  -0.0789 0.3101  12  LYS B NZ  
3046 N N   . ASP B 18  ? 0.6270 1.0294 0.5573 0.1309  -0.1017 0.2698  13  ASP B N   
3047 C CA  . ASP B 18  ? 0.6273 0.9845 0.5806 0.1228  -0.1101 0.2911  13  ASP B CA  
3048 C C   . ASP B 18  ? 0.6353 1.0155 0.6016 0.1166  -0.1151 0.3376  13  ASP B C   
3049 O O   . ASP B 18  ? 0.6434 1.0064 0.6335 0.1146  -0.1294 0.3662  13  ASP B O   
3050 C CB  . ASP B 18  ? 0.6413 0.9632 0.6095 0.1286  -0.1226 0.2865  13  ASP B CB  
3051 C CG  . ASP B 18  ? 0.6596 0.9275 0.6516 0.1238  -0.1339 0.2943  13  ASP B CG  
3052 O OD1 . ASP B 18  ? 0.6320 0.8800 0.6255 0.1160  -0.1290 0.2894  13  ASP B OD1 
3053 O OD2 . ASP B 18  ? 0.7088 0.9539 0.7191 0.1293  -0.1494 0.3035  13  ASP B OD2 
3054 N N   . SER B 19  ? 0.6129 1.0345 0.5660 0.1141  -0.1044 0.3456  14  SER B N   
3055 C CA  . SER B 19  ? 0.6222 1.0842 0.5856 0.1098  -0.1066 0.3926  14  SER B CA  
3056 C C   . SER B 19  ? 0.6189 1.0443 0.6070 0.0953  -0.1113 0.4144  14  SER B C   
3057 O O   . SER B 19  ? 0.5880 0.9678 0.5755 0.0908  -0.1084 0.3869  14  SER B O   
3058 C CB  . SER B 19  ? 0.6143 1.1468 0.5510 0.1173  -0.0933 0.3900  14  SER B CB  
3059 O OG  . SER B 19  ? 0.6081 1.1266 0.5288 0.1164  -0.0826 0.3527  14  SER B OG  
3060 N N   . PRO B 20  ? 0.6378 1.0856 0.6502 0.0880  -0.1196 0.4659  15  PRO B N   
3061 C CA  . PRO B 20  ? 0.6454 1.0693 0.6841 0.0735  -0.1249 0.4912  15  PRO B CA  
3062 C C   . PRO B 20  ? 0.6347 1.0724 0.6518 0.0710  -0.1077 0.4703  15  PRO B C   
3063 O O   . PRO B 20  ? 0.6233 1.0182 0.6539 0.0611  -0.1099 0.4654  15  PRO B O   
3064 C CB  . PRO B 20  ? 0.6634 1.1397 0.7253 0.0684  -0.1319 0.5528  15  PRO B CB  
3065 C CG  . PRO B 20  ? 0.6771 1.1710 0.7376 0.0785  -0.1392 0.5599  15  PRO B CG  
3066 C CD  . PRO B 20  ? 0.6550 1.1551 0.6746 0.0927  -0.1256 0.5058  15  PRO B CD  
3067 N N   . ARG B 21  ? 0.6337 1.1307 0.6185 0.0815  -0.0925 0.4564  16  ARG B N   
3068 C CA  . ARG B 21  ? 0.6285 1.1426 0.5914 0.0822  -0.0773 0.4325  16  ARG B CA  
3069 C C   . ARG B 21  ? 0.6037 1.0569 0.5575 0.0810  -0.0740 0.3828  16  ARG B C   
3070 O O   . ARG B 21  ? 0.5988 1.0339 0.5520 0.0743  -0.0678 0.3726  16  ARG B O   
3071 C CB  . ARG B 21  ? 0.6366 1.2284 0.5682 0.0981  -0.0662 0.4232  16  ARG B CB  
3072 C CG  . ARG B 21  ? 0.6507 1.2472 0.5549 0.1052  -0.0542 0.3757  16  ARG B CG  
3073 C CD  . ARG B 21  ? 0.7079 1.3406 0.6079 0.1028  -0.0448 0.3888  16  ARG B CD  
3074 N NE  . ARG B 21  ? 0.7618 1.4793 0.6365 0.1211  -0.0378 0.3861  16  ARG B NE  
3075 C CZ  . ARG B 21  ? 0.7809 1.5345 0.6377 0.1290  -0.0286 0.3684  16  ARG B CZ  
3076 N NH1 . ARG B 21  ? 0.8001 1.6354 0.6338 0.1498  -0.0249 0.3642  16  ARG B NH1 
3077 N NH2 . ARG B 21  ? 0.7682 1.4794 0.6297 0.1185  -0.0242 0.3535  16  ARG B NH2 
3078 N N   . PHE B 22  ? 0.5986 1.0251 0.5462 0.0879  -0.0776 0.3539  17  PHE B N   
3079 C CA  . PHE B 22  ? 0.5804 0.9538 0.5238 0.0870  -0.0752 0.3125  17  PHE B CA  
3080 C C   . PHE B 22  ? 0.5796 0.8952 0.5474 0.0765  -0.0838 0.3214  17  PHE B C   
3081 O O   . PHE B 22  ? 0.5712 0.8572 0.5365 0.0721  -0.0784 0.3003  17  PHE B O   
3082 C CB  . PHE B 22  ? 0.5814 0.9433 0.5184 0.0964  -0.0789 0.2868  17  PHE B CB  
3083 C CG  . PHE B 22  ? 0.5860 0.8948 0.5260 0.0951  -0.0787 0.2537  17  PHE B CG  
3084 C CD1 . PHE B 22  ? 0.5752 0.8809 0.5020 0.0950  -0.0685 0.2214  17  PHE B CD1 
3085 C CD2 . PHE B 22  ? 0.6108 0.8767 0.5684 0.0958  -0.0900 0.2557  17  PHE B CD2 
3086 C CE1 . PHE B 22  ? 0.5863 0.8510 0.5177 0.0941  -0.0677 0.1962  17  PHE B CE1 
3087 C CE2 . PHE B 22  ? 0.5887 0.8162 0.5476 0.0976  -0.0892 0.2268  17  PHE B CE2 
3088 C CZ  . PHE B 22  ? 0.5871 0.8162 0.5331 0.0962  -0.0771 0.1993  17  PHE B CZ  
3089 N N   . ARG B 23  ? 0.6022 0.9026 0.5951 0.0737  -0.0991 0.3520  18  ARG B N   
3090 C CA  . ARG B 23  ? 0.6180 0.8650 0.6399 0.0658  -0.1133 0.3627  18  ARG B CA  
3091 C C   . ARG B 23  ? 0.6135 0.8629 0.6444 0.0538  -0.1095 0.3800  18  ARG B C   
3092 O O   . ARG B 23  ? 0.6059 0.8131 0.6418 0.0498  -0.1105 0.3614  18  ARG B O   
3093 C CB  . ARG B 23  ? 0.6486 0.8857 0.7007 0.0656  -0.1340 0.3963  18  ARG B CB  
3094 C CG  . ARG B 23  ? 0.6882 0.8590 0.7697 0.0651  -0.1547 0.3900  18  ARG B CG  
3095 C CD  . ARG B 23  ? 0.7125 0.8479 0.7764 0.0760  -0.1504 0.3400  18  ARG B CD  
3096 N NE  . ARG B 23  ? 0.7281 0.8745 0.7789 0.0884  -0.1496 0.3238  18  ARG B NE  
3097 C CZ  . ARG B 23  ? 0.7361 0.8503 0.8003 0.0987  -0.1654 0.3128  18  ARG B CZ  
3098 N NH1 . ARG B 23  ? 0.7359 0.8036 0.8270 0.0997  -0.1849 0.3132  18  ARG B NH1 
3099 N NH2 . ARG B 23  ? 0.7537 0.8834 0.8056 0.1095  -0.1633 0.2999  18  ARG B NH2 
3100 N N   . ALA B 24  ? 0.6148 0.9180 0.6470 0.0494  -0.1048 0.4156  19  ALA B N   
3101 C CA  . ALA B 24  ? 0.6183 0.9354 0.6582 0.0386  -0.0996 0.4351  19  ALA B CA  
3102 C C   . ALA B 24  ? 0.5998 0.9156 0.6114 0.0409  -0.0822 0.3960  19  ALA B C   
3103 O O   . ALA B 24  ? 0.5917 0.8884 0.6114 0.0322  -0.0805 0.3965  19  ALA B O   
3104 C CB  . ALA B 24  ? 0.6226 1.0116 0.6665 0.0367  -0.0958 0.4812  19  ALA B CB  
3105 N N   . SER B 25  ? 0.5980 0.9329 0.5795 0.0524  -0.0713 0.3622  20  SER B N   
3106 C CA  . SER B 25  ? 0.5859 0.9154 0.5448 0.0550  -0.0578 0.3229  20  SER B CA  
3107 C C   . SER B 25  ? 0.5871 0.8509 0.5536 0.0509  -0.0611 0.2962  20  SER B C   
3108 O O   . SER B 25  ? 0.5853 0.8344 0.5481 0.0461  -0.0542 0.2826  20  SER B O   
3109 C CB  . SER B 25  ? 0.5752 0.9388 0.5074 0.0680  -0.0500 0.2941  20  SER B CB  
3110 O OG  . SER B 25  ? 0.5762 1.0084 0.4966 0.0749  -0.0452 0.3129  20  SER B OG  
3111 N N   . ILE B 26  ? 0.6034 0.8320 0.5798 0.0547  -0.0718 0.2887  21  ILE B N   
3112 C CA  . ILE B 26  ? 0.6083 0.7820 0.5924 0.0547  -0.0767 0.2652  21  ILE B CA  
3113 C C   . ILE B 26  ? 0.6264 0.7704 0.6337 0.0451  -0.0860 0.2837  21  ILE B C   
3114 O O   . ILE B 26  ? 0.6270 0.7436 0.6328 0.0428  -0.0826 0.2645  21  ILE B O   
3115 C CB  . ILE B 26  ? 0.6117 0.7611 0.6027 0.0641  -0.0879 0.2547  21  ILE B CB  
3116 C CG1 . ILE B 26  ? 0.6123 0.7845 0.5822 0.0729  -0.0784 0.2297  21  ILE B CG1 
3117 C CG2 . ILE B 26  ? 0.5979 0.6973 0.5996 0.0670  -0.0958 0.2352  21  ILE B CG2 
3118 C CD1 . ILE B 26  ? 0.5904 0.7611 0.5446 0.0726  -0.0646 0.1979  21  ILE B CD1 
3119 N N   . GLU B 27  ? 0.6569 0.8076 0.6883 0.0390  -0.0990 0.3224  22  GLU B N   
3120 C CA  . GLU B 27  ? 0.6865 0.8087 0.7464 0.0285  -0.1114 0.3425  22  GLU B CA  
3121 C C   . GLU B 27  ? 0.6699 0.8095 0.7205 0.0201  -0.0971 0.3433  22  GLU B C   
3122 O O   . GLU B 27  ? 0.6636 0.7683 0.7259 0.0149  -0.1020 0.3360  22  GLU B O   
3123 C CB  . GLU B 27  ? 0.7105 0.8397 0.8054 0.0218  -0.1303 0.3896  22  GLU B CB  
3124 C CG  . GLU B 27  ? 0.7776 0.8686 0.8921 0.0298  -0.1517 0.3854  22  GLU B CG  
3125 C CD  . GLU B 27  ? 0.8464 0.9639 0.9824 0.0277  -0.1641 0.4276  22  GLU B CD  
3126 O OE1 . GLU B 27  ? 0.8851 0.9814 1.0299 0.0368  -0.1782 0.4214  22  GLU B OE1 
3127 O OE2 . GLU B 27  ? 0.8739 1.0369 1.0187 0.0179  -0.1600 0.4684  22  GLU B OE2 
3128 N N   . LEU B 28  ? 0.6672 0.8623 0.6964 0.0209  -0.0808 0.3500  23  LEU B N   
3129 C CA  . LEU B 28  ? 0.6597 0.8801 0.6773 0.0158  -0.0667 0.3495  23  LEU B CA  
3130 C C   . LEU B 28  ? 0.6437 0.8337 0.6425 0.0190  -0.0569 0.3056  23  LEU B C   
3131 O O   . LEU B 28  ? 0.6456 0.8190 0.6492 0.0123  -0.0545 0.3026  23  LEU B O   
3132 C CB  . LEU B 28  ? 0.6549 0.9460 0.6508 0.0217  -0.0532 0.3593  23  LEU B CB  
3133 C CG  . LEU B 28  ? 0.6827 1.0195 0.6811 0.0157  -0.0455 0.3863  23  LEU B CG  
3134 C CD1 . LEU B 28  ? 0.7072 1.0764 0.7345 0.0082  -0.0560 0.4426  23  LEU B CD1 
3135 C CD2 . LEU B 28  ? 0.6911 1.0859 0.6560 0.0277  -0.0289 0.3669  23  LEU B CD2 
3136 N N   . VAL B 29  ? 0.6293 0.8140 0.6093 0.0288  -0.0518 0.2738  24  VAL B N   
3137 C CA  . VAL B 29  ? 0.6076 0.7673 0.5741 0.0315  -0.0435 0.2366  24  VAL B CA  
3138 C C   . VAL B 29  ? 0.6124 0.7191 0.5960 0.0286  -0.0534 0.2304  24  VAL B C   
3139 O O   . VAL B 29  ? 0.5911 0.6802 0.5714 0.0258  -0.0478 0.2149  24  VAL B O   
3140 C CB  . VAL B 29  ? 0.5993 0.7669 0.5491 0.0414  -0.0385 0.2088  24  VAL B CB  
3141 C CG1 . VAL B 29  ? 0.5653 0.7035 0.5099 0.0430  -0.0331 0.1767  24  VAL B CG1 
3142 C CG2 . VAL B 29  ? 0.5843 0.8036 0.5164 0.0458  -0.0296 0.2067  24  VAL B CG2 
3143 N N   . GLU B 30  ? 0.6218 0.7049 0.6248 0.0305  -0.0700 0.2429  25  GLU B N   
3144 C CA  . GLU B 30  ? 0.6227 0.6577 0.6426 0.0320  -0.0832 0.2331  25  GLU B CA  
3145 C C   . GLU B 30  ? 0.6356 0.6585 0.6735 0.0209  -0.0887 0.2508  25  GLU B C   
3146 O O   . GLU B 30  ? 0.6254 0.6173 0.6666 0.0219  -0.0915 0.2329  25  GLU B O   
3147 C CB  . GLU B 30  ? 0.6407 0.6532 0.6788 0.0396  -0.1027 0.2382  25  GLU B CB  
3148 C CG  . GLU B 30  ? 0.5943 0.6059 0.6157 0.0528  -0.0979 0.2099  25  GLU B CG  
3149 C CD  . GLU B 30  ? 0.6080 0.6001 0.6457 0.0626  -0.1171 0.2126  25  GLU B CD  
3150 O OE1 . GLU B 30  ? 0.5651 0.5603 0.5910 0.0743  -0.1139 0.1917  25  GLU B OE1 
3151 O OE2 . GLU B 30  ? 0.6476 0.6224 0.7131 0.0588  -0.1367 0.2365  25  GLU B OE2 
3152 N N   . ALA B 31  ? 0.6498 0.7020 0.6996 0.0111  -0.0901 0.2869  26  ALA B N   
3153 C CA  . ALA B 31  ? 0.6636 0.7166 0.7302 -0.0011 -0.0922 0.3081  26  ALA B CA  
3154 C C   . ALA B 31  ? 0.6518 0.7162 0.6941 -0.0023 -0.0725 0.2860  26  ALA B C   
3155 O O   . ALA B 31  ? 0.6566 0.6953 0.7085 -0.0071 -0.0759 0.2807  26  ALA B O   
3156 C CB  . ALA B 31  ? 0.6594 0.7543 0.7431 -0.0106 -0.0950 0.3547  26  ALA B CB  
3157 N N   . GLU B 32  ? 0.6480 0.7492 0.6616 0.0027  -0.0544 0.2724  27  GLU B N   
3158 C CA  . GLU B 32  ? 0.6467 0.7596 0.6421 0.0014  -0.0386 0.2543  27  GLU B CA  
3159 C C   . GLU B 32  ? 0.6341 0.7108 0.6191 0.0062  -0.0344 0.2170  27  GLU B C   
3160 O O   . GLU B 32  ? 0.6283 0.7034 0.6062 0.0033  -0.0256 0.2053  27  GLU B O   
3161 C CB  . GLU B 32  ? 0.6449 0.8145 0.6186 0.0054  -0.0242 0.2553  27  GLU B CB  
3162 C CG  . GLU B 32  ? 0.6826 0.8655 0.6348 0.0164  -0.0176 0.2280  27  GLU B CG  
3163 C CD  . GLU B 32  ? 0.7354 0.9794 0.6744 0.0229  -0.0122 0.2395  27  GLU B CD  
3164 O OE1 . GLU B 32  ? 0.7644 1.0270 0.6849 0.0324  -0.0065 0.2137  27  GLU B OE1 
3165 O OE2 . GLU B 32  ? 0.7575 1.0339 0.7062 0.0194  -0.0149 0.2750  27  GLU B OE2 
3166 N N   . VAL B 33  ? 0.6354 0.6871 0.6206 0.0142  -0.0409 0.2006  28  VAL B N   
3167 C CA  . VAL B 33  ? 0.6209 0.6440 0.5999 0.0202  -0.0383 0.1707  28  VAL B CA  
3168 C C   . VAL B 33  ? 0.6494 0.6353 0.6465 0.0188  -0.0512 0.1720  28  VAL B C   
3169 O O   . VAL B 33  ? 0.6357 0.6066 0.6282 0.0200  -0.0466 0.1544  28  VAL B O   
3170 C CB  . VAL B 33  ? 0.6159 0.6336 0.5897 0.0314  -0.0408 0.1543  28  VAL B CB  
3171 C CG1 . VAL B 33  ? 0.5744 0.5685 0.5457 0.0390  -0.0397 0.1290  28  VAL B CG1 
3172 C CG2 . VAL B 33  ? 0.5747 0.6261 0.5330 0.0332  -0.0300 0.1486  28  VAL B CG2 
3173 N N   . SER B 34  ? 0.6861 0.6577 0.7062 0.0169  -0.0694 0.1930  29  SER B N   
3174 C CA  . SER B 34  ? 0.7157 0.6503 0.7586 0.0163  -0.0870 0.1938  29  SER B CA  
3175 C C   . SER B 34  ? 0.7187 0.6554 0.7660 0.0048  -0.0818 0.2026  29  SER B C   
3176 O O   . SER B 34  ? 0.7288 0.6395 0.7800 0.0074  -0.0864 0.1862  29  SER B O   
3177 C CB  . SER B 34  ? 0.7417 0.6605 0.8151 0.0150  -0.1110 0.2175  29  SER B CB  
3178 O OG  . SER B 34  ? 0.7813 0.6577 0.8738 0.0231  -0.1320 0.2025  29  SER B OG  
3179 N N   . GLU B 35  ? 0.7158 0.6875 0.7618 -0.0060 -0.0723 0.2276  30  GLU B N   
3180 C CA  . GLU B 35  ? 0.7164 0.6984 0.7620 -0.0153 -0.0637 0.2337  30  GLU B CA  
3181 C C   . GLU B 35  ? 0.6932 0.6797 0.7109 -0.0105 -0.0448 0.2027  30  GLU B C   
3182 O O   . GLU B 35  ? 0.6800 0.6591 0.6982 -0.0148 -0.0410 0.1975  30  GLU B O   
3183 C CB  . GLU B 35  ? 0.7219 0.7495 0.7723 -0.0252 -0.0577 0.2686  30  GLU B CB  
3184 C CG  . GLU B 35  ? 0.7760 0.7972 0.8651 -0.0371 -0.0764 0.3066  30  GLU B CG  
3185 C CD  . GLU B 35  ? 0.7994 0.7831 0.9068 -0.0423 -0.0869 0.2996  30  GLU B CD  
3186 O OE1 . GLU B 35  ? 0.8193 0.7591 0.9514 -0.0399 -0.1097 0.2950  30  GLU B OE1 
3187 O OE2 . GLU B 35  ? 0.7621 0.7611 0.8596 -0.0470 -0.0737 0.2967  30  GLU B OE2 
3188 N N   . LEU B 36  ? 0.6847 0.6834 0.6815 -0.0021 -0.0345 0.1836  31  LEU B N   
3189 C CA  . LEU B 36  ? 0.6654 0.6674 0.6424 0.0015  -0.0195 0.1568  31  LEU B CA  
3190 C C   . LEU B 36  ? 0.6660 0.6331 0.6471 0.0066  -0.0247 0.1381  31  LEU B C   
3191 O O   . LEU B 36  ? 0.6633 0.6272 0.6385 0.0048  -0.0167 0.1269  31  LEU B O   
3192 C CB  . LEU B 36  ? 0.6513 0.6709 0.6127 0.0089  -0.0116 0.1417  31  LEU B CB  
3193 C CG  . LEU B 36  ? 0.6264 0.6663 0.5719 0.0102  0.0025  0.1231  31  LEU B CG  
3194 C CD1 . LEU B 36  ? 0.5791 0.6148 0.5202 0.0179  0.0039  0.1042  31  LEU B CD1 
3195 C CD2 . LEU B 36  ? 0.5582 0.5906 0.5018 0.0062  0.0094  0.1139  31  LEU B CD2 
3196 N N   . GLU B 37  ? 0.6804 0.6245 0.6715 0.0147  -0.0389 0.1342  32  GLU B N   
3197 C CA  . GLU B 37  ? 0.6831 0.6004 0.6768 0.0245  -0.0458 0.1139  32  GLU B CA  
3198 C C   . GLU B 37  ? 0.6867 0.5834 0.6952 0.0190  -0.0552 0.1191  32  GLU B C   
3199 O O   . GLU B 37  ? 0.6699 0.5587 0.6725 0.0225  -0.0508 0.1030  32  GLU B O   
3200 C CB  . GLU B 37  ? 0.6971 0.5983 0.6991 0.0375  -0.0616 0.1074  32  GLU B CB  
3201 C CG  . GLU B 37  ? 0.7138 0.6299 0.7002 0.0488  -0.0524 0.0905  32  GLU B CG  
3202 C CD  . GLU B 37  ? 0.7901 0.7002 0.7846 0.0592  -0.0668 0.0916  32  GLU B CD  
3203 O OE1 . GLU B 37  ? 0.8076 0.7319 0.7919 0.0690  -0.0607 0.0798  32  GLU B OE1 
3204 O OE2 . GLU B 37  ? 0.8088 0.7008 0.8227 0.0572  -0.0852 0.1059  32  GLU B OE2 
3205 N N   . THR B 38  ? 0.6933 0.5837 0.7237 0.0101  -0.0691 0.1437  33  THR B N   
3206 C CA  . THR B 38  ? 0.7047 0.5770 0.7553 0.0024  -0.0806 0.1531  33  THR B CA  
3207 C C   . THR B 38  ? 0.6870 0.5776 0.7246 -0.0067 -0.0621 0.1537  33  THR B C   
3208 O O   . THR B 38  ? 0.6866 0.5606 0.7291 -0.0069 -0.0654 0.1445  33  THR B O   
3209 C CB  . THR B 38  ? 0.7251 0.5924 0.8085 -0.0080 -0.1000 0.1867  33  THR B CB  
3210 O OG1 . THR B 38  ? 0.7576 0.5988 0.8574 0.0025  -0.1220 0.1812  33  THR B OG1 
3211 C CG2 . THR B 38  ? 0.7275 0.5787 0.8371 -0.0183 -0.1128 0.2000  33  THR B CG2 
3212 N N   . ARG B 39  ? 0.6710 0.5963 0.6920 -0.0120 -0.0439 0.1614  34  ARG B N   
3213 C CA  . ARG B 39  ? 0.6619 0.6077 0.6725 -0.0191 -0.0286 0.1625  34  ARG B CA  
3214 C C   . ARG B 39  ? 0.6479 0.5919 0.6378 -0.0125 -0.0146 0.1341  34  ARG B C   
3215 O O   . ARG B 39  ? 0.6369 0.5861 0.6222 -0.0168 -0.0061 0.1304  34  ARG B O   
3216 C CB  . ARG B 39  ? 0.6610 0.6488 0.6650 -0.0248 -0.0183 0.1818  34  ARG B CB  
3217 C CG  . ARG B 39  ? 0.6903 0.6914 0.7183 -0.0348 -0.0292 0.2188  34  ARG B CG  
3218 C CD  . ARG B 39  ? 0.7238 0.7752 0.7400 -0.0351 -0.0181 0.2346  34  ARG B CD  
3219 N NE  . ARG B 39  ? 0.7823 0.8560 0.8216 -0.0432 -0.0277 0.2747  34  ARG B NE  
3220 C CZ  . ARG B 39  ? 0.7971 0.9132 0.8424 -0.0501 -0.0220 0.3019  34  ARG B CZ  
3221 N NH1 . ARG B 39  ? 0.7966 0.9330 0.8246 -0.0486 -0.0073 0.2887  34  ARG B NH1 
3222 N NH2 . ARG B 39  ? 0.8086 0.9493 0.8789 -0.0580 -0.0314 0.3434  34  ARG B NH2 
3223 N N   . LEU B 40  ? 0.6399 0.5787 0.6201 -0.0024 -0.0130 0.1165  35  LEU B N   
3224 C CA  . LEU B 40  ? 0.6233 0.5592 0.5912 0.0039  -0.0032 0.0940  35  LEU B CA  
3225 C C   . LEU B 40  ? 0.6283 0.5390 0.6024 0.0104  -0.0116 0.0826  35  LEU B C   
3226 O O   . LEU B 40  ? 0.6175 0.5286 0.5853 0.0109  -0.0033 0.0720  35  LEU B O   
3227 C CB  . LEU B 40  ? 0.6146 0.5596 0.5738 0.0124  0.0010  0.0827  35  LEU B CB  
3228 C CG  . LEU B 40  ? 0.6171 0.5889 0.5677 0.0091  0.0105  0.0847  35  LEU B CG  
3229 C CD1 . LEU B 40  ? 0.6235 0.6003 0.5701 0.0169  0.0141  0.0710  35  LEU B CD1 
3230 C CD2 . LEU B 40  ? 0.6091 0.5969 0.5541 0.0024  0.0209  0.0833  35  LEU B CD2 
3231 N N   . GLU B 41  ? 0.6446 0.5346 0.6318 0.0168  -0.0295 0.0834  36  GLU B N   
3232 C CA  . GLU B 41  ? 0.6575 0.5249 0.6512 0.0272  -0.0416 0.0683  36  GLU B CA  
3233 C C   . GLU B 41  ? 0.6464 0.5030 0.6505 0.0176  -0.0453 0.0751  36  GLU B C   
3234 O O   . GLU B 41  ? 0.6442 0.4928 0.6455 0.0242  -0.0460 0.0602  36  GLU B O   
3235 C CB  . GLU B 41  ? 0.6812 0.5277 0.6894 0.0390  -0.0643 0.0640  36  GLU B CB  
3236 C CG  . GLU B 41  ? 0.7336 0.5916 0.7323 0.0506  -0.0620 0.0564  36  GLU B CG  
3237 C CD  . GLU B 41  ? 0.7966 0.6612 0.7833 0.0707  -0.0600 0.0317  36  GLU B CD  
3238 O OE1 . GLU B 41  ? 0.8064 0.6857 0.7808 0.0711  -0.0448 0.0243  36  GLU B OE1 
3239 O OE2 . GLU B 41  ? 0.8269 0.6861 0.8175 0.0870  -0.0737 0.0208  36  GLU B OE2 
3240 N N   . LYS B 42  ? 0.6336 0.4943 0.6507 0.0029  -0.0480 0.0991  37  LYS B N   
3241 C CA  . LYS B 42  ? 0.6285 0.4838 0.6589 -0.0078 -0.0516 0.1101  37  LYS B CA  
3242 C C   . LYS B 42  ? 0.6019 0.4755 0.6131 -0.0114 -0.0303 0.1025  37  LYS B C   
3243 O O   . LYS B 42  ? 0.5858 0.4500 0.6006 -0.0127 -0.0316 0.0970  37  LYS B O   
3244 C CB  . LYS B 42  ? 0.6343 0.4986 0.6859 -0.0222 -0.0592 0.1429  37  LYS B CB  
3245 C CG  . LYS B 42  ? 0.6544 0.5339 0.7150 -0.0366 -0.0539 0.1624  37  LYS B CG  
3246 C CD  . LYS B 42  ? 0.7207 0.5721 0.8059 -0.0395 -0.0720 0.1623  37  LYS B CD  
3247 C CE  . LYS B 42  ? 0.7183 0.5897 0.8173 -0.0552 -0.0679 0.1879  37  LYS B CE  
3248 N NZ  . LYS B 42  ? 0.7703 0.6581 0.8972 -0.0678 -0.0782 0.2269  37  LYS B NZ  
3249 N N   . LEU B 43  ? 0.5751 0.4737 0.5684 -0.0122 -0.0131 0.1012  38  LEU B N   
3250 C CA  . LEU B 43  ? 0.5544 0.4691 0.5327 -0.0142 0.0042  0.0922  38  LEU B CA  
3251 C C   . LEU B 43  ? 0.5449 0.4487 0.5153 -0.0041 0.0074  0.0707  38  LEU B C   
3252 O O   . LEU B 43  ? 0.5338 0.4407 0.4996 -0.0061 0.0156  0.0650  38  LEU B O   
3253 C CB  . LEU B 43  ? 0.5346 0.4761 0.5005 -0.0152 0.0164  0.0931  38  LEU B CB  
3254 C CG  . LEU B 43  ? 0.5445 0.5087 0.5002 -0.0187 0.0304  0.0885  38  LEU B CG  
3255 C CD1 . LEU B 43  ? 0.5035 0.4704 0.4508 -0.0130 0.0381  0.0705  38  LEU B CD1 
3256 C CD2 . LEU B 43  ? 0.5069 0.4721 0.4658 -0.0247 0.0334  0.0918  38  LEU B CD2 
3257 N N   . LEU B 44  ? 0.5482 0.4430 0.5177 0.0078  0.0005  0.0603  39  LEU B N   
3258 C CA  . LEU B 44  ? 0.5445 0.4373 0.5077 0.0199  0.0025  0.0431  39  LEU B CA  
3259 C C   . LEU B 44  ? 0.5527 0.4269 0.5238 0.0230  -0.0086 0.0377  39  LEU B C   
3260 O O   . LEU B 44  ? 0.5439 0.4219 0.5094 0.0258  -0.0020 0.0294  39  LEU B O   
3261 C CB  . LEU B 44  ? 0.5505 0.4449 0.5111 0.0345  -0.0032 0.0339  39  LEU B CB  
3262 C CG  . LEU B 44  ? 0.5477 0.4627 0.5010 0.0350  0.0077  0.0352  39  LEU B CG  
3263 C CD1 . LEU B 44  ? 0.5415 0.4561 0.4956 0.0492  -0.0021 0.0291  39  LEU B CD1 
3264 C CD2 . LEU B 44  ? 0.4941 0.4269 0.4417 0.0358  0.0217  0.0303  39  LEU B CD2 
3265 N N   . LYS B 45  ? 0.5638 0.4183 0.5510 0.0220  -0.0272 0.0436  40  LYS B N   
3266 C CA  . LYS B 45  ? 0.5755 0.4091 0.5771 0.0229  -0.0428 0.0403  40  LYS B CA  
3267 C C   . LYS B 45  ? 0.5609 0.4006 0.5625 0.0093  -0.0322 0.0488  40  LYS B C   
3268 O O   . LYS B 45  ? 0.5579 0.3924 0.5578 0.0145  -0.0332 0.0369  40  LYS B O   
3269 C CB  . LYS B 45  ? 0.6025 0.4146 0.6289 0.0200  -0.0664 0.0513  40  LYS B CB  
3270 C CG  . LYS B 45  ? 0.6775 0.4624 0.7235 0.0285  -0.0914 0.0396  40  LYS B CG  
3271 C CD  . LYS B 45  ? 0.7517 0.5148 0.8323 0.0179  -0.1156 0.0594  40  LYS B CD  
3272 C CE  . LYS B 45  ? 0.7905 0.5360 0.8940 0.0114  -0.1309 0.0620  40  LYS B CE  
3273 N NZ  . LYS B 45  ? 0.8298 0.5622 0.9720 -0.0055 -0.1508 0.0921  40  LYS B NZ  
3274 N N   . LEU B 46  ? 0.5280 0.3827 0.5302 -0.0058 -0.0220 0.0680  41  LEU B N   
3275 C CA  . LEU B 46  ? 0.5133 0.3805 0.5133 -0.0166 -0.0103 0.0754  41  LEU B CA  
3276 C C   . LEU B 46  ? 0.4929 0.3725 0.4738 -0.0117 0.0071  0.0602  41  LEU B C   
3277 O O   . LEU B 46  ? 0.4718 0.3555 0.4513 -0.0162 0.0138  0.0596  41  LEU B O   
3278 C CB  . LEU B 46  ? 0.5078 0.3979 0.5091 -0.0285 -0.0028 0.0965  41  LEU B CB  
3279 C CG  . LEU B 46  ? 0.5314 0.4304 0.5524 -0.0417 -0.0098 0.1235  41  LEU B CG  
3280 C CD1 . LEU B 46  ? 0.5341 0.4066 0.5827 -0.0452 -0.0317 0.1312  41  LEU B CD1 
3281 C CD2 . LEU B 46  ? 0.5235 0.4424 0.5458 -0.0450 -0.0090 0.1413  41  LEU B CD2 
3282 N N   . GLY B 47  ? 0.4783 0.3651 0.4479 -0.0032 0.0134  0.0506  42  GLY B N   
3283 C CA  . GLY B 47  ? 0.4790 0.3785 0.4377 0.0005  0.0272  0.0406  42  GLY B CA  
3284 C C   . GLY B 47  ? 0.4853 0.3775 0.4428 0.0114  0.0234  0.0284  42  GLY B C   
3285 O O   . GLY B 47  ? 0.4690 0.3683 0.4228 0.0108  0.0321  0.0251  42  GLY B O   
3286 N N   . THR B 48  ? 0.5037 0.3834 0.4651 0.0229  0.0087  0.0209  43  THR B N   
3287 C CA  . THR B 48  ? 0.5204 0.3954 0.4810 0.0367  0.0011  0.0066  43  THR B CA  
3288 C C   . THR B 48  ? 0.5168 0.3792 0.4855 0.0283  -0.0034 0.0091  43  THR B C   
3289 O O   . THR B 48  ? 0.5062 0.3759 0.4692 0.0319  0.0030  0.0028  43  THR B O   
3290 C CB  . THR B 48  ? 0.5479 0.4115 0.5131 0.0535  -0.0181 -0.0056 43  THR B CB  
3291 O OG1 . THR B 48  ? 0.5601 0.4403 0.5168 0.0621  -0.0121 -0.0075 43  THR B OG1 
3292 C CG2 . THR B 48  ? 0.5649 0.4284 0.5280 0.0715  -0.0278 -0.0241 43  THR B CG2 
3293 N N   . GLY B 49  ? 0.5185 0.3653 0.5024 0.0167  -0.0143 0.0207  44  GLY B N   
3294 C CA  . GLY B 49  ? 0.5066 0.3462 0.5015 0.0056  -0.0174 0.0283  44  GLY B CA  
3295 C C   . GLY B 49  ? 0.4873 0.3444 0.4708 -0.0016 0.0024  0.0308  44  GLY B C   
3296 O O   . GLY B 49  ? 0.4792 0.3336 0.4635 -0.0003 0.0021  0.0252  44  GLY B O   
3297 N N   . LEU B 50  ? 0.4591 0.3335 0.4335 -0.0078 0.0177  0.0377  45  LEU B N   
3298 C CA  . LEU B 50  ? 0.4408 0.3304 0.4085 -0.0140 0.0330  0.0390  45  LEU B CA  
3299 C C   . LEU B 50  ? 0.4448 0.3383 0.4046 -0.0044 0.0395  0.0267  45  LEU B C   
3300 O O   . LEU B 50  ? 0.4209 0.3175 0.3804 -0.0070 0.0449  0.0254  45  LEU B O   
3301 C CB  . LEU B 50  ? 0.4291 0.3358 0.3913 -0.0194 0.0433  0.0449  45  LEU B CB  
3302 C CG  . LEU B 50  ? 0.4163 0.3388 0.3740 -0.0234 0.0558  0.0427  45  LEU B CG  
3303 C CD1 . LEU B 50  ? 0.4207 0.3617 0.3762 -0.0281 0.0602  0.0484  45  LEU B CD1 
3304 C CD2 . LEU B 50  ? 0.4461 0.3709 0.4004 -0.0169 0.0620  0.0331  45  LEU B CD2 
3305 N N   . LEU B 51  ? 0.4441 0.3415 0.3988 0.0071  0.0388  0.0197  46  LEU B N   
3306 C CA  . LEU B 51  ? 0.4399 0.3510 0.3892 0.0164  0.0461  0.0138  46  LEU B CA  
3307 C C   . LEU B 51  ? 0.4407 0.3468 0.3893 0.0267  0.0382  0.0046  46  LEU B C   
3308 O O   . LEU B 51  ? 0.4377 0.3537 0.3843 0.0282  0.0451  0.0039  46  LEU B O   
3309 C CB  . LEU B 51  ? 0.4502 0.3743 0.3958 0.0270  0.0472  0.0118  46  LEU B CB  
3310 C CG  . LEU B 51  ? 0.4552 0.3938 0.4025 0.0221  0.0566  0.0188  46  LEU B CG  
3311 C CD1 . LEU B 51  ? 0.4794 0.4133 0.4300 0.0079  0.0603  0.0243  46  LEU B CD1 
3312 C CD2 . LEU B 51  ? 0.4861 0.4297 0.4311 0.0315  0.0517  0.0169  46  LEU B CD2 
3313 N N   . GLU B 52  ? 0.4423 0.3338 0.3942 0.0349  0.0219  -0.0034 47  GLU B N   
3314 C CA  . GLU B 52  ? 0.4579 0.3444 0.4105 0.0477  0.0103  -0.0165 47  GLU B CA  
3315 C C   . GLU B 52  ? 0.4518 0.3286 0.4112 0.0356  0.0107  -0.0120 47  GLU B C   
3316 O O   . GLU B 52  ? 0.4464 0.3289 0.4026 0.0431  0.0106  -0.0196 47  GLU B O   
3317 C CB  . GLU B 52  ? 0.4778 0.3462 0.4381 0.0597  -0.0127 -0.0288 47  GLU B CB  
3318 C CG  . GLU B 52  ? 0.5603 0.4449 0.5112 0.0810  -0.0158 -0.0407 47  GLU B CG  
3319 C CD  . GLU B 52  ? 0.6633 0.5266 0.6248 0.0930  -0.0412 -0.0539 47  GLU B CD  
3320 O OE1 . GLU B 52  ? 0.6970 0.5313 0.6771 0.0816  -0.0569 -0.0496 47  GLU B OE1 
3321 O OE2 . GLU B 52  ? 0.6744 0.5521 0.6283 0.1142  -0.0466 -0.0673 47  GLU B OE2 
3322 N N   . SER B 53  ? 0.4257 0.2923 0.3942 0.0180  0.0113  0.0010  48  SER B N   
3323 C CA  . SER B 53  ? 0.4408 0.3033 0.4164 0.0076  0.0120  0.0063  48  SER B CA  
3324 C C   . SER B 53  ? 0.4130 0.2927 0.3797 0.0025  0.0310  0.0102  48  SER B C   
3325 O O   . SER B 53  ? 0.4374 0.3181 0.4055 0.0010  0.0328  0.0087  48  SER B O   
3326 C CB  . SER B 53  ? 0.4245 0.2770 0.4162 -0.0076 0.0043  0.0213  48  SER B CB  
3327 O OG  . SER B 53  ? 0.4687 0.3349 0.4554 -0.0168 0.0171  0.0332  48  SER B OG  
3328 N N   . GLY B 54  ? 0.4012 0.2934 0.3615 0.0005  0.0429  0.0142  49  GLY B N   
3329 C CA  . GLY B 54  ? 0.3865 0.2927 0.3434 -0.0026 0.0569  0.0163  49  GLY B CA  
3330 C C   . GLY B 54  ? 0.3947 0.3099 0.3482 0.0082  0.0594  0.0107  49  GLY B C   
3331 O O   . GLY B 54  ? 0.3925 0.3113 0.3477 0.0052  0.0646  0.0118  49  GLY B O   
3332 N N   . ARG B 55  ? 0.4087 0.3316 0.3573 0.0222  0.0560  0.0053  50  ARG B N   
3333 C CA  . ARG B 55  ? 0.4182 0.3598 0.3624 0.0358  0.0586  0.0021  50  ARG B CA  
3334 C C   . ARG B 55  ? 0.4250 0.3594 0.3683 0.0410  0.0506  -0.0068 50  ARG B C   
3335 O O   . ARG B 55  ? 0.4058 0.3546 0.3474 0.0457  0.0560  -0.0057 50  ARG B O   
3336 C CB  . ARG B 55  ? 0.4262 0.3844 0.3640 0.0536  0.0548  -0.0033 50  ARG B CB  
3337 C CG  . ARG B 55  ? 0.4569 0.4233 0.3965 0.0505  0.0603  0.0044  50  ARG B CG  
3338 C CD  . ARG B 55  ? 0.4493 0.4397 0.3960 0.0464  0.0735  0.0191  50  ARG B CD  
3339 N NE  . ARG B 55  ? 0.4549 0.4495 0.4066 0.0415  0.0763  0.0258  50  ARG B NE  
3340 C CZ  . ARG B 55  ? 0.4965 0.5007 0.4615 0.0316  0.0836  0.0384  50  ARG B CZ  
3341 N NH1 . ARG B 55  ? 0.3931 0.4032 0.3692 0.0253  0.0886  0.0469  50  ARG B NH1 
3342 N NH2 . ARG B 55  ? 0.4982 0.5056 0.4682 0.0285  0.0837  0.0423  50  ARG B NH2 
3343 N N   . HIS B 56  ? 0.4417 0.3549 0.3888 0.0410  0.0358  -0.0148 51  HIS B N   
3344 C CA  . HIS B 56  ? 0.4603 0.3637 0.4114 0.0439  0.0253  -0.0231 51  HIS B CA  
3345 C C   . HIS B 56  ? 0.4492 0.3511 0.4047 0.0286  0.0351  -0.0134 51  HIS B C   
3346 O O   . HIS B 56  ? 0.4468 0.3549 0.4010 0.0329  0.0359  -0.0170 51  HIS B O   
3347 C CB  . HIS B 56  ? 0.4843 0.3625 0.4470 0.0425  0.0052  -0.0291 51  HIS B CB  
3348 C CG  . HIS B 56  ? 0.5449 0.4115 0.5162 0.0468  -0.0101 -0.0393 51  HIS B CG  
3349 N ND1 . HIS B 56  ? 0.6288 0.4985 0.5969 0.0690  -0.0253 -0.0596 51  HIS B ND1 
3350 C CD2 . HIS B 56  ? 0.5901 0.4451 0.5743 0.0331  -0.0136 -0.0326 51  HIS B CD2 
3351 C CE1 . HIS B 56  ? 0.6506 0.5074 0.6302 0.0681  -0.0388 -0.0662 51  HIS B CE1 
3352 N NE2 . HIS B 56  ? 0.6429 0.4904 0.6332 0.0454  -0.0316 -0.0486 51  HIS B NE2 
3353 N N   . TYR B 57  ? 0.4300 0.3270 0.3903 0.0126  0.0419  -0.0021 52  TYR B N   
3354 C CA  . TYR B 57  ? 0.4330 0.3319 0.3973 0.0003  0.0501  0.0052  52  TYR B CA  
3355 C C   . TYR B 57  ? 0.4219 0.3364 0.3817 0.0043  0.0619  0.0059  52  TYR B C   
3356 O O   . TYR B 57  ? 0.4274 0.3440 0.3891 0.0032  0.0638  0.0055  52  TYR B O   
3357 C CB  . TYR B 57  ? 0.4132 0.3133 0.3806 -0.0122 0.0557  0.0148  52  TYR B CB  
3358 C CG  . TYR B 57  ? 0.4196 0.3289 0.3891 -0.0208 0.0652  0.0195  52  TYR B CG  
3359 C CD1 . TYR B 57  ? 0.4279 0.3366 0.4027 -0.0248 0.0633  0.0206  52  TYR B CD1 
3360 C CD2 . TYR B 57  ? 0.4334 0.3527 0.4013 -0.0237 0.0741  0.0213  52  TYR B CD2 
3361 C CE1 . TYR B 57  ? 0.4152 0.3354 0.3917 -0.0304 0.0714  0.0234  52  TYR B CE1 
3362 C CE2 . TYR B 57  ? 0.4362 0.3651 0.4069 -0.0283 0.0800  0.0216  52  TYR B CE2 
3363 C CZ  . TYR B 57  ? 0.4307 0.3609 0.4047 -0.0312 0.0792  0.0228  52  TYR B CZ  
3364 O OH  . TYR B 57  ? 0.4277 0.3700 0.4039 -0.0335 0.0842  0.0217  52  TYR B OH  
3365 N N   . LEU B 58  ? 0.4176 0.3438 0.3748 0.0081  0.0688  0.0091  53  LEU B N   
3366 C CA  . LEU B 58  ? 0.3928 0.3342 0.3530 0.0094  0.0782  0.0149  53  LEU B CA  
3367 C C   . LEU B 58  ? 0.3909 0.3452 0.3466 0.0226  0.0765  0.0119  53  LEU B C   
3368 O O   . LEU B 58  ? 0.3699 0.3338 0.3299 0.0221  0.0819  0.0172  53  LEU B O   
3369 C CB  . LEU B 58  ? 0.3926 0.3452 0.3569 0.0093  0.0836  0.0222  53  LEU B CB  
3370 C CG  . LEU B 58  ? 0.3870 0.3314 0.3562 -0.0017 0.0849  0.0238  53  LEU B CG  
3371 C CD1 . LEU B 58  ? 0.3545 0.3109 0.3316 -0.0008 0.0881  0.0310  53  LEU B CD1 
3372 C CD2 . LEU B 58  ? 0.3410 0.2802 0.3166 -0.0112 0.0871  0.0229  53  LEU B CD2 
3373 N N   . ALA B 59  ? 0.3884 0.3437 0.3364 0.0358  0.0671  0.0019  54  ALA B N   
3374 C CA  . ALA B 59  ? 0.3965 0.3701 0.3382 0.0526  0.0641  -0.0040 54  ALA B CA  
3375 C C   . ALA B 59  ? 0.4021 0.3639 0.3464 0.0484  0.0599  -0.0091 54  ALA B C   
3376 O O   . ALA B 59  ? 0.4136 0.3913 0.3572 0.0533  0.0646  -0.0060 54  ALA B O   
3377 C CB  . ALA B 59  ? 0.3935 0.3737 0.3263 0.0722  0.0522  -0.0183 54  ALA B CB  
3378 N N   . ALA B 60  ? 0.4042 0.3405 0.3540 0.0379  0.0515  -0.0136 55  ALA B N   
3379 C CA  . ALA B 60  ? 0.3965 0.3215 0.3526 0.0309  0.0469  -0.0157 55  ALA B CA  
3380 C C   . ALA B 60  ? 0.3887 0.3203 0.3483 0.0201  0.0604  -0.0051 55  ALA B C   
3381 O O   . ALA B 60  ? 0.3893 0.3238 0.3503 0.0213  0.0601  -0.0067 55  ALA B O   
3382 C CB  . ALA B 60  ? 0.4026 0.3045 0.3693 0.0193  0.0356  -0.0158 55  ALA B CB  
3383 N N   . SER B 61  ? 0.3746 0.3077 0.3369 0.0108  0.0700  0.0039  56  SER B N   
3384 C CA  . SER B 61  ? 0.3828 0.3207 0.3513 0.0031  0.0790  0.0104  56  SER B CA  
3385 C C   . SER B 61  ? 0.3890 0.3436 0.3586 0.0112  0.0841  0.0153  56  SER B C   
3386 O O   . SER B 61  ? 0.4069 0.3640 0.3819 0.0085  0.0870  0.0179  56  SER B O   
3387 C CB  . SER B 61  ? 0.3700 0.3064 0.3435 -0.0059 0.0845  0.0153  56  SER B CB  
3388 O OG  . SER B 61  ? 0.4190 0.3463 0.3910 -0.0124 0.0805  0.0138  56  SER B OG  
3389 N N   . ARG B 62  ? 0.3891 0.3586 0.3549 0.0214  0.0849  0.0184  57  ARG B N   
3390 C CA  . ARG B 62  ? 0.3975 0.3924 0.3660 0.0305  0.0900  0.0284  57  ARG B CA  
3391 C C   . ARG B 62  ? 0.3884 0.3915 0.3498 0.0409  0.0862  0.0218  57  ARG B C   
3392 O O   . ARG B 62  ? 0.3769 0.3920 0.3446 0.0412  0.0906  0.0304  57  ARG B O   
3393 C CB  . ARG B 62  ? 0.4043 0.4195 0.3680 0.0418  0.0906  0.0324  57  ARG B CB  
3394 C CG  . ARG B 62  ? 0.4872 0.5275 0.4649 0.0411  0.0985  0.0531  57  ARG B CG  
3395 C CD  . ARG B 62  ? 0.5371 0.5816 0.5176 0.0399  0.0995  0.0579  57  ARG B CD  
3396 N NE  . ARG B 62  ? 0.5986 0.6505 0.5622 0.0543  0.0948  0.0461  57  ARG B NE  
3397 C CZ  . ARG B 62  ? 0.5342 0.5761 0.4949 0.0525  0.0924  0.0414  57  ARG B CZ  
3398 N NH1 . ARG B 62  ? 0.5497 0.5760 0.5215 0.0374  0.0947  0.0471  57  ARG B NH1 
3399 N NH2 . ARG B 62  ? 0.5389 0.5873 0.4861 0.0676  0.0859  0.0292  57  ARG B NH2 
3400 N N   . ALA B 63  ? 0.3843 0.3802 0.3353 0.0498  0.0758  0.0062  58  ALA B N   
3401 C CA  . ALA B 63  ? 0.3877 0.3886 0.3331 0.0608  0.0682  -0.0045 58  ALA B CA  
3402 C C   . ALA B 63  ? 0.3819 0.3667 0.3352 0.0477  0.0689  -0.0037 58  ALA B C   
3403 O O   . ALA B 63  ? 0.3933 0.3894 0.3455 0.0543  0.0685  -0.0048 58  ALA B O   
3404 C CB  . ALA B 63  ? 0.3775 0.3685 0.3160 0.0729  0.0518  -0.0242 58  ALA B CB  
3405 N N   . PHE B 64  ? 0.3832 0.3474 0.3441 0.0308  0.0711  -0.0006 59  PHE B N   
3406 C CA  . PHE B 64  ? 0.3809 0.3356 0.3497 0.0190  0.0731  0.0013  59  PHE B CA  
3407 C C   . PHE B 64  ? 0.3913 0.3583 0.3662 0.0177  0.0827  0.0113  59  PHE B C   
3408 O O   . PHE B 64  ? 0.3803 0.3503 0.3578 0.0183  0.0826  0.0107  59  PHE B O   
3409 C CB  . PHE B 64  ? 0.3730 0.3126 0.3471 0.0049  0.0733  0.0030  59  PHE B CB  
3410 C CG  . PHE B 64  ? 0.3767 0.3141 0.3583 -0.0054 0.0761  0.0054  59  PHE B CG  
3411 C CD1 . PHE B 64  ? 0.3509 0.2836 0.3369 -0.0086 0.0687  0.0025  59  PHE B CD1 
3412 C CD2 . PHE B 64  ? 0.3590 0.3005 0.3453 -0.0111 0.0843  0.0098  59  PHE B CD2 
3413 C CE1 . PHE B 64  ? 0.3952 0.3320 0.3884 -0.0169 0.0720  0.0061  59  PHE B CE1 
3414 C CE2 . PHE B 64  ? 0.3593 0.3036 0.3512 -0.0173 0.0861  0.0097  59  PHE B CE2 
3415 C CZ  . PHE B 64  ? 0.3611 0.3053 0.3554 -0.0203 0.0814  0.0090  59  PHE B CZ  
3416 N N   . VAL B 65  ? 0.3934 0.3667 0.3740 0.0155  0.0893  0.0211  60  VAL B N   
3417 C CA  . VAL B 65  ? 0.3953 0.3788 0.3883 0.0143  0.0947  0.0326  60  VAL B CA  
3418 C C   . VAL B 65  ? 0.4074 0.4141 0.3977 0.0268  0.0954  0.0390  60  VAL B C   
3419 O O   . VAL B 65  ? 0.4224 0.4331 0.4196 0.0262  0.0966  0.0432  60  VAL B O   
3420 C CB  . VAL B 65  ? 0.3910 0.3762 0.3973 0.0090  0.0978  0.0432  60  VAL B CB  
3421 C CG1 . VAL B 65  ? 0.3687 0.3630 0.3953 0.0075  0.0993  0.0574  60  VAL B CG1 
3422 C CG2 . VAL B 65  ? 0.3595 0.3256 0.3668 -0.0010 0.0963  0.0343  60  VAL B CG2 
3423 N N   . VAL B 66  ? 0.4246 0.4496 0.4040 0.0398  0.0941  0.0386  61  VAL B N   
3424 C CA  . VAL B 66  ? 0.4259 0.4804 0.3990 0.0558  0.0939  0.0419  61  VAL B CA  
3425 C C   . VAL B 66  ? 0.4327 0.4786 0.4005 0.0580  0.0882  0.0291  61  VAL B C   
3426 O O   . VAL B 66  ? 0.4472 0.5096 0.4188 0.0623  0.0908  0.0371  61  VAL B O   
3427 C CB  . VAL B 66  ? 0.4374 0.5179 0.3968 0.0740  0.0916  0.0386  61  VAL B CB  
3428 C CG1 . VAL B 66  ? 0.4410 0.5540 0.3889 0.0950  0.0883  0.0342  61  VAL B CG1 
3429 C CG2 . VAL B 66  ? 0.4171 0.5203 0.3863 0.0735  0.0994  0.0595  61  VAL B CG2 
3430 N N   . GLY B 67  ? 0.4389 0.4602 0.4013 0.0540  0.0798  0.0118  62  GLY B N   
3431 C CA  . GLY B 67  ? 0.4296 0.4397 0.3920 0.0527  0.0726  0.0007  62  GLY B CA  
3432 C C   . GLY B 67  ? 0.4147 0.4222 0.3879 0.0425  0.0793  0.0098  62  GLY B C   
3433 O O   . GLY B 67  ? 0.4082 0.4229 0.3813 0.0472  0.0771  0.0074  62  GLY B O   
3434 N N   . ILE B 68  ? 0.4025 0.4006 0.3855 0.0303  0.0861  0.0186  63  ILE B N   
3435 C CA  . ILE B 68  ? 0.3904 0.3852 0.3860 0.0223  0.0904  0.0248  63  ILE B CA  
3436 C C   . ILE B 68  ? 0.3959 0.4116 0.3987 0.0297  0.0939  0.0386  63  ILE B C   
3437 O O   . ILE B 68  ? 0.3702 0.3879 0.3784 0.0296  0.0937  0.0396  63  ILE B O   
3438 C CB  . ILE B 68  ? 0.3908 0.3733 0.3965 0.0115  0.0936  0.0278  63  ILE B CB  
3439 C CG1 . ILE B 68  ? 0.3829 0.3508 0.3822 0.0043  0.0909  0.0177  63  ILE B CG1 
3440 C CG2 . ILE B 68  ? 0.3937 0.3734 0.4148 0.0068  0.0948  0.0306  63  ILE B CG2 
3441 C CD1 . ILE B 68  ? 0.3466 0.3071 0.3535 -0.0039 0.0933  0.0177  63  ILE B CD1 
3442 N N   . CYS B 69  ? 0.4033 0.4377 0.4080 0.0358  0.0970  0.0516  64  CYS B N   
3443 C CA  . CYS B 69  ? 0.4327 0.4944 0.4472 0.0429  0.1003  0.0709  64  CYS B CA  
3444 C C   . CYS B 69  ? 0.4281 0.5116 0.4282 0.0578  0.0982  0.0657  64  CYS B C   
3445 O O   . CYS B 69  ? 0.4111 0.5085 0.4191 0.0606  0.0996  0.0762  64  CYS B O   
3446 C CB  . CYS B 69  ? 0.4404 0.5245 0.4629 0.0460  0.1041  0.0900  64  CYS B CB  
3447 S SG  . CYS B 69  ? 0.5679 0.6259 0.6134 0.0287  0.1034  0.0957  64  CYS B SG  
3448 N N   . ASP B 70  ? 0.4426 0.5288 0.4234 0.0683  0.0931  0.0488  65  ASP B N   
3449 C CA  . ASP B 70  ? 0.4710 0.5749 0.4380 0.0845  0.0869  0.0370  65  ASP B CA  
3450 C C   . ASP B 70  ? 0.4610 0.5460 0.4331 0.0766  0.0836  0.0293  65  ASP B C   
3451 O O   . ASP B 70  ? 0.4689 0.5734 0.4398 0.0857  0.0830  0.0322  65  ASP B O   
3452 C CB  . ASP B 70  ? 0.4719 0.5734 0.4222 0.0969  0.0763  0.0145  65  ASP B CB  
3453 C CG  . ASP B 70  ? 0.5570 0.6864 0.4990 0.1106  0.0788  0.0197  65  ASP B CG  
3454 O OD1 . ASP B 70  ? 0.5921 0.7121 0.5238 0.1183  0.0691  0.0004  65  ASP B OD1 
3455 O OD2 . ASP B 70  ? 0.5568 0.7187 0.5050 0.1141  0.0889  0.0438  65  ASP B OD2 
3456 N N   . LEU B 71  ? 0.4511 0.5032 0.4293 0.0606  0.0820  0.0213  66  LEU B N   
3457 C CA  . LEU B 71  ? 0.4487 0.4867 0.4327 0.0530  0.0793  0.0150  66  LEU B CA  
3458 C C   . LEU B 71  ? 0.4628 0.5111 0.4590 0.0511  0.0859  0.0302  66  LEU B C   
3459 O O   . LEU B 71  ? 0.4740 0.5350 0.4696 0.0580  0.0842  0.0303  66  LEU B O   
3460 C CB  . LEU B 71  ? 0.4296 0.4401 0.4192 0.0371  0.0779  0.0080  66  LEU B CB  
3461 C CG  . LEU B 71  ? 0.4021 0.4035 0.4001 0.0282  0.0768  0.0046  66  LEU B CG  
3462 C CD1 . LEU B 71  ? 0.3926 0.3980 0.3876 0.0347  0.0672  -0.0056 66  LEU B CD1 
3463 C CD2 . LEU B 71  ? 0.3575 0.3428 0.3607 0.0145  0.0769  0.0017  66  LEU B CD2 
3464 N N   . ALA B 72  ? 0.4597 0.5028 0.4693 0.0427  0.0916  0.0430  67  ALA B N   
3465 C CA  . ALA B 72  ? 0.4685 0.5165 0.4964 0.0400  0.0942  0.0576  67  ALA B CA  
3466 C C   . ALA B 72  ? 0.4817 0.5626 0.5121 0.0521  0.0962  0.0757  67  ALA B C   
3467 O O   . ALA B 72  ? 0.4822 0.5698 0.5273 0.0518  0.0964  0.0877  67  ALA B O   
3468 C CB  . ALA B 72  ? 0.4655 0.4996 0.5114 0.0299  0.0954  0.0654  67  ALA B CB  
3469 N N   . ARG B 73  ? 0.4879 0.5932 0.5044 0.0642  0.0971  0.0781  68  ARG B N   
3470 C CA  . ARG B 73  ? 0.5143 0.6615 0.5313 0.0784  0.0998  0.0971  68  ARG B CA  
3471 C C   . ARG B 73  ? 0.5336 0.6925 0.5436 0.0875  0.0967  0.0906  68  ARG B C   
3472 O O   . ARG B 73  ? 0.5327 0.7256 0.5484 0.0969  0.0992  0.1099  68  ARG B O   
3473 C CB  . ARG B 73  ? 0.5145 0.6918 0.5151 0.0934  0.1008  0.0973  68  ARG B CB  
3474 C CG  . ARG B 73  ? 0.5502 0.7727 0.5630 0.1010  0.1071  0.1299  68  ARG B CG  
3475 C CD  . ARG B 73  ? 0.6018 0.8589 0.5976 0.1176  0.1087  0.1291  68  ARG B CD  
3476 N NE  . ARG B 73  ? 0.6619 0.9427 0.6304 0.1405  0.1030  0.1070  68  ARG B NE  
3477 C CZ  . ARG B 73  ? 0.6972 0.9611 0.6456 0.1484  0.0946  0.0758  68  ARG B CZ  
3478 N NH1 . ARG B 73  ? 0.7097 0.9352 0.6603 0.1343  0.0931  0.0656  68  ARG B NH1 
3479 N NH2 . ARG B 73  ? 0.7063 0.9925 0.6345 0.1712  0.0857  0.0544  68  ARG B NH2 
3480 N N   . LEU B 74  ? 0.5535 0.6864 0.5538 0.0840  0.0908  0.0660  69  LEU B N   
3481 C CA  . LEU B 74  ? 0.5770 0.7171 0.5727 0.0910  0.0864  0.0576  69  LEU B CA  
3482 C C   . LEU B 74  ? 0.5828 0.7192 0.5976 0.0832  0.0893  0.0718  69  LEU B C   
3483 O O   . LEU B 74  ? 0.5834 0.6954 0.6146 0.0689  0.0911  0.0760  69  LEU B O   
3484 C CB  . LEU B 74  ? 0.5774 0.6909 0.5638 0.0872  0.0775  0.0305  69  LEU B CB  
3485 C CG  . LEU B 74  ? 0.5850 0.7060 0.5540 0.1011  0.0680  0.0116  69  LEU B CG  
3486 C CD1 . LEU B 74  ? 0.5973 0.6868 0.5684 0.0915  0.0576  -0.0088 69  LEU B CD1 
3487 C CD2 . LEU B 74  ? 0.5867 0.7468 0.5437 0.1243  0.0636  0.0092  69  LEU B CD2 
3488 N N   . GLY B 75  ? 0.6080 0.7699 0.6209 0.0945  0.0882  0.0774  70  GLY B N   
3489 C CA  . GLY B 75  ? 0.6228 0.7815 0.6541 0.0889  0.0891  0.0894  70  GLY B CA  
3490 C C   . GLY B 75  ? 0.6362 0.8191 0.6880 0.0900  0.0935  0.1227  70  GLY B C   
3491 O O   . GLY B 75  ? 0.6400 0.8510 0.6884 0.0976  0.0970  0.1372  70  GLY B O   
3492 N N   . PRO B 76  ? 0.6429 0.8172 0.7193 0.0828  0.0921  0.1364  71  PRO B N   
3493 C CA  . PRO B 76  ? 0.6470 0.8439 0.7512 0.0822  0.0932  0.1727  71  PRO B CA  
3494 C C   . PRO B 76  ? 0.6474 0.8211 0.7738 0.0686  0.0918  0.1812  71  PRO B C   
3495 O O   . PRO B 76  ? 0.6470 0.7863 0.7659 0.0602  0.0906  0.1574  71  PRO B O   
3496 C CB  . PRO B 76  ? 0.6489 0.8404 0.7735 0.0802  0.0886  0.1806  71  PRO B CB  
3497 C CG  . PRO B 76  ? 0.6470 0.8021 0.7595 0.0748  0.0857  0.1465  71  PRO B CG  
3498 C CD  . PRO B 76  ? 0.6416 0.7856 0.7257 0.0746  0.0881  0.1209  71  PRO B CD  
3499 N N   . PRO B 77  ? 0.6514 0.8469 0.8062 0.0667  0.0913  0.2164  72  PRO B N   
3500 C CA  . PRO B 77  ? 0.6455 0.8153 0.8259 0.0531  0.0869  0.2225  72  PRO B CA  
3501 C C   . PRO B 77  ? 0.6401 0.7686 0.8456 0.0430  0.0766  0.2112  72  PRO B C   
3502 O O   . PRO B 77  ? 0.6524 0.7839 0.8773 0.0444  0.0712  0.2225  72  PRO B O   
3503 C CB  . PRO B 77  ? 0.6514 0.8594 0.8623 0.0535  0.0868  0.2672  72  PRO B CB  
3504 C CG  . PRO B 77  ? 0.6683 0.9304 0.8549 0.0710  0.0953  0.2792  72  PRO B CG  
3505 C CD  . PRO B 77  ? 0.6572 0.9055 0.8223 0.0769  0.0945  0.2527  72  PRO B CD  
3506 N N   . GLU B 78  ? 0.6172 0.7104 0.8203 0.0352  0.0734  0.1873  73  GLU B N   
3507 C CA  . GLU B 78  ? 0.6080 0.6652 0.8284 0.0295  0.0634  0.1684  73  GLU B CA  
3508 C C   . GLU B 78  ? 0.5865 0.6240 0.8352 0.0207  0.0545  0.1728  73  GLU B C   
3509 O O   . GLU B 78  ? 0.5798 0.6103 0.8112 0.0180  0.0589  0.1602  73  GLU B O   
3510 C CB  . GLU B 78  ? 0.6154 0.6569 0.8011 0.0313  0.0684  0.1322  73  GLU B CB  
3511 C CG  . GLU B 78  ? 0.6587 0.7228 0.8113 0.0397  0.0775  0.1273  73  GLU B CG  
3512 C CD  . GLU B 78  ? 0.7141 0.7672 0.8350 0.0393  0.0819  0.0981  73  GLU B CD  
3513 O OE1 . GLU B 78  ? 0.7311 0.7992 0.8295 0.0461  0.0855  0.0920  73  GLU B OE1 
3514 O OE2 . GLU B 78  ? 0.7436 0.7751 0.8639 0.0329  0.0804  0.0821  73  GLU B OE2 
3515 N N   . PRO B 79  ? 0.5743 0.6023 0.8697 0.0164  0.0399  0.1912  74  PRO B N   
3516 C CA  . PRO B 79  ? 0.5603 0.5715 0.8915 0.0080  0.0275  0.1999  74  PRO B CA  
3517 C C   . PRO B 79  ? 0.5378 0.5184 0.8568 0.0064  0.0235  0.1637  74  PRO B C   
3518 O O   . PRO B 79  ? 0.5252 0.5005 0.8525 0.0009  0.0211  0.1666  74  PRO B O   
3519 C CB  . PRO B 79  ? 0.5825 0.5815 0.9677 0.0054  0.0077  0.2175  74  PRO B CB  
3520 C CG  . PRO B 79  ? 0.5818 0.6069 0.9596 0.0115  0.0148  0.2349  74  PRO B CG  
3521 C CD  . PRO B 79  ? 0.5813 0.6113 0.9020 0.0192  0.0314  0.2038  74  PRO B CD  
3522 N N   . MET B 80  ? 0.5129 0.4782 0.8132 0.0119  0.0230  0.1316  75  MET B N   
3523 C CA  . MET B 80  ? 0.5058 0.4504 0.7949 0.0131  0.0192  0.0984  75  MET B CA  
3524 C C   . MET B 80  ? 0.4859 0.4400 0.7323 0.0115  0.0358  0.0888  75  MET B C   
3525 O O   . MET B 80  ? 0.4823 0.4260 0.7249 0.0092  0.0339  0.0755  75  MET B O   
3526 C CB  . MET B 80  ? 0.5145 0.4499 0.7967 0.0213  0.0146  0.0704  75  MET B CB  
3527 C CG  . MET B 80  ? 0.5327 0.4601 0.7941 0.0253  0.0150  0.0369  75  MET B CG  
3528 S SD  . MET B 80  ? 0.6210 0.5479 0.8768 0.0376  0.0093  0.0054  75  MET B SD  
3529 C CE  . MET B 80  ? 0.5935 0.5427 0.8110 0.0361  0.0299  0.0124  75  MET B CE  
3530 N N   . MET B 81  ? 0.4630 0.4366 0.6792 0.0137  0.0500  0.0943  76  MET B N   
3531 C CA  . MET B 81  ? 0.4622 0.4434 0.6419 0.0131  0.0626  0.0857  76  MET B CA  
3532 C C   . MET B 81  ? 0.4544 0.4454 0.6406 0.0093  0.0650  0.1063  76  MET B C   
3533 O O   . MET B 81  ? 0.4436 0.4300 0.6148 0.0067  0.0686  0.0972  76  MET B O   
3534 C CB  . MET B 81  ? 0.4595 0.4575 0.6116 0.0183  0.0723  0.0842  76  MET B CB  
3535 C CG  . MET B 81  ? 0.5150 0.5260 0.6374 0.0199  0.0817  0.0834  76  MET B CG  
3536 S SD  . MET B 81  ? 0.6348 0.6291 0.7356 0.0153  0.0840  0.0579  76  MET B SD  
3537 C CE  . MET B 81  ? 0.5928 0.5888 0.6776 0.0177  0.0856  0.0414  76  MET B CE  
3538 N N   . ALA B 82  ? 0.4431 0.4503 0.6543 0.0091  0.0623  0.1360  77  ALA B N   
3539 C CA  . ALA B 82  ? 0.4409 0.4655 0.6628 0.0063  0.0644  0.1605  77  ALA B CA  
3540 C C   . ALA B 82  ? 0.4429 0.4460 0.6940 -0.0020 0.0530  0.1597  77  ALA B C   
3541 O O   . ALA B 82  ? 0.4230 0.4322 0.6675 -0.0045 0.0572  0.1641  77  ALA B O   
3542 C CB  . ALA B 82  ? 0.4344 0.4903 0.6786 0.0087  0.0645  0.1973  77  ALA B CB  
3543 N N   . GLU B 83  ? 0.4545 0.4335 0.7393 -0.0048 0.0369  0.1534  78  GLU B N   
3544 C CA  . GLU B 83  ? 0.4565 0.4117 0.7698 -0.0102 0.0220  0.1449  78  GLU B CA  
3545 C C   . GLU B 83  ? 0.4538 0.3964 0.7321 -0.0081 0.0278  0.1112  78  GLU B C   
3546 O O   . GLU B 83  ? 0.4589 0.3935 0.7448 -0.0120 0.0232  0.1078  78  GLU B O   
3547 C CB  . GLU B 83  ? 0.4681 0.3994 0.8219 -0.0094 0.0007  0.1371  78  GLU B CB  
3548 C CG  . GLU B 83  ? 0.5156 0.4209 0.8964 -0.0112 -0.0180 0.1190  78  GLU B CG  
3549 C CD  . GLU B 83  ? 0.5655 0.4462 0.9933 -0.0080 -0.0445 0.1096  78  GLU B CD  
3550 O OE1 . GLU B 83  ? 0.5862 0.4629 1.0059 0.0002  -0.0459 0.0933  78  GLU B OE1 
3551 O OE2 . GLU B 83  ? 0.6114 0.4762 1.0865 -0.0130 -0.0658 0.1172  78  GLU B OE2 
3552 N N   . CYS B 84  ? 0.4338 0.3771 0.6763 -0.0024 0.0373  0.0891  79  CYS B N   
3553 C CA  . CYS B 84  ? 0.4491 0.3865 0.6604 -0.0008 0.0432  0.0626  79  CYS B CA  
3554 C C   . CYS B 84  ? 0.4429 0.3920 0.6291 -0.0040 0.0558  0.0704  79  CYS B C   
3555 O O   . CYS B 84  ? 0.4372 0.3789 0.6174 -0.0061 0.0548  0.0594  79  CYS B O   
3556 C CB  . CYS B 84  ? 0.4404 0.3797 0.6268 0.0050  0.0487  0.0417  79  CYS B CB  
3557 S SG  . CYS B 84  ? 0.4910 0.4353 0.6358 0.0050  0.0607  0.0219  79  CYS B SG  
3558 N N   . LEU B 85  ? 0.4418 0.4105 0.6137 -0.0024 0.0660  0.0875  80  LEU B N   
3559 C CA  . LEU B 85  ? 0.4522 0.4345 0.6037 -0.0024 0.0753  0.0947  80  LEU B CA  
3560 C C   . LEU B 85  ? 0.4554 0.4428 0.6336 -0.0071 0.0706  0.1152  80  LEU B C   
3561 O O   . LEU B 85  ? 0.4525 0.4401 0.6213 -0.0089 0.0734  0.1127  80  LEU B O   
3562 C CB  . LEU B 85  ? 0.4649 0.4722 0.5974 0.0046  0.0844  0.1063  80  LEU B CB  
3563 C CG  . LEU B 85  ? 0.4797 0.4882 0.5796 0.0100  0.0902  0.0883  80  LEU B CG  
3564 C CD1 . LEU B 85  ? 0.4965 0.4880 0.5773 0.0065  0.0912  0.0662  80  LEU B CD1 
3565 C CD2 . LEU B 85  ? 0.5326 0.5374 0.6388 0.0114  0.0875  0.0842  80  LEU B CD2 
3566 N N   . GLU B 86  ? 0.4473 0.4401 0.6621 -0.0095 0.0624  0.1378  81  GLU B N   
3567 C CA  . GLU B 86  ? 0.4552 0.4549 0.7022 -0.0156 0.0561  0.1614  81  GLU B CA  
3568 C C   . GLU B 86  ? 0.4579 0.4321 0.7130 -0.0207 0.0471  0.1421  81  GLU B C   
3569 O O   . GLU B 86  ? 0.4695 0.4512 0.7256 -0.0239 0.0492  0.1506  81  GLU B O   
3570 C CB  . GLU B 86  ? 0.4625 0.4679 0.7576 -0.0197 0.0442  0.1902  81  GLU B CB  
3571 C CG  . GLU B 86  ? 0.4733 0.4682 0.8128 -0.0288 0.0291  0.2035  81  GLU B CG  
3572 C CD  . GLU B 86  ? 0.4797 0.4724 0.8751 -0.0345 0.0120  0.2300  81  GLU B CD  
3573 O OE1 . GLU B 86  ? 0.4729 0.4825 0.9061 -0.0421 0.0060  0.2642  81  GLU B OE1 
3574 O OE2 . GLU B 86  ? 0.4995 0.4759 0.9038 -0.0316 0.0040  0.2190  81  GLU B OE2 
3575 N N   . LYS B 87  ? 0.4541 0.4023 0.7142 -0.0197 0.0368  0.1157  82  LYS B N   
3576 C CA  . LYS B 87  ? 0.4445 0.3727 0.7143 -0.0216 0.0258  0.0959  82  LYS B CA  
3577 C C   . LYS B 87  ? 0.4192 0.3481 0.6455 -0.0190 0.0380  0.0744  82  LYS B C   
3578 O O   . LYS B 87  ? 0.4019 0.3280 0.6290 -0.0218 0.0361  0.0717  82  LYS B O   
3579 C CB  . LYS B 87  ? 0.4565 0.3621 0.7503 -0.0177 0.0075  0.0738  82  LYS B CB  
3580 C CG  . LYS B 87  ? 0.4860 0.3835 0.8351 -0.0212 -0.0117 0.0941  82  LYS B CG  
3581 C CD  . LYS B 87  ? 0.5047 0.3770 0.8788 -0.0145 -0.0344 0.0649  82  LYS B CD  
3582 C CE  . LYS B 87  ? 0.5580 0.4186 0.9869 -0.0163 -0.0557 0.0813  82  LYS B CE  
3583 N NZ  . LYS B 87  ? 0.5701 0.4182 1.0567 -0.0250 -0.0786 0.0995  82  LYS B NZ  
3584 N N   . PHE B 88  ? 0.3942 0.3274 0.5861 -0.0143 0.0490  0.0610  83  PHE B N   
3585 C CA  . PHE B 88  ? 0.3943 0.3270 0.5522 -0.0127 0.0571  0.0418  83  PHE B CA  
3586 C C   . PHE B 88  ? 0.3919 0.3367 0.5280 -0.0142 0.0686  0.0532  83  PHE B C   
3587 O O   . PHE B 88  ? 0.4081 0.3509 0.5287 -0.0152 0.0714  0.0445  83  PHE B O   
3588 C CB  . PHE B 88  ? 0.3760 0.3099 0.5117 -0.0080 0.0618  0.0243  83  PHE B CB  
3589 C CG  . PHE B 88  ? 0.3988 0.3244 0.5505 -0.0028 0.0499  0.0053  83  PHE B CG  
3590 C CD1 . PHE B 88  ? 0.4246 0.3554 0.5657 0.0024  0.0522  -0.0060 83  PHE B CD1 
3591 C CD2 . PHE B 88  ? 0.4086 0.3227 0.5885 -0.0016 0.0344  -0.0023 83  PHE B CD2 
3592 C CE1 . PHE B 88  ? 0.4636 0.3914 0.6185 0.0106  0.0405  -0.0259 83  PHE B CE1 
3593 C CE2 . PHE B 88  ? 0.4453 0.3531 0.6409 0.0070  0.0203  -0.0240 83  PHE B CE2 
3594 C CZ  . PHE B 88  ? 0.4739 0.3901 0.6556 0.0142  0.0238  -0.0367 83  PHE B CZ  
3595 N N   . THR B 89  ? 0.3888 0.3489 0.5226 -0.0125 0.0748  0.0716  84  THR B N   
3596 C CA  . THR B 89  ? 0.3931 0.3675 0.5041 -0.0099 0.0841  0.0779  84  THR B CA  
3597 C C   . THR B 89  ? 0.3801 0.3610 0.5069 -0.0132 0.0821  0.0922  84  THR B C   
3598 O O   . THR B 89  ? 0.3624 0.3462 0.4713 -0.0121 0.0866  0.0879  84  THR B O   
3599 C CB  . THR B 89  ? 0.3933 0.3882 0.4951 -0.0032 0.0901  0.0901  84  THR B CB  
3600 O OG1 . THR B 89  ? 0.4542 0.4559 0.5257 0.0026  0.0962  0.0813  84  THR B OG1 
3601 C CG2 . THR B 89  ? 0.3771 0.3952 0.5001 -0.0019 0.0902  0.1177  84  THR B CG2 
3602 N N   . VAL B 90  ? 0.3797 0.3614 0.5436 -0.0179 0.0734  0.1090  85  VAL B N   
3603 C CA  . VAL B 90  ? 0.3836 0.3723 0.5674 -0.0224 0.0700  0.1242  85  VAL B CA  
3604 C C   . VAL B 90  ? 0.3969 0.3632 0.5745 -0.0253 0.0647  0.1004  85  VAL B C   
3605 O O   . VAL B 90  ? 0.3745 0.3451 0.5437 -0.0262 0.0676  0.1009  85  VAL B O   
3606 C CB  . VAL B 90  ? 0.4001 0.3961 0.6307 -0.0279 0.0598  0.1513  85  VAL B CB  
3607 C CG1 . VAL B 90  ? 0.3997 0.4018 0.6591 -0.0348 0.0531  0.1683  85  VAL B CG1 
3608 C CG2 . VAL B 90  ? 0.3971 0.4256 0.6265 -0.0228 0.0683  0.1773  85  VAL B CG2 
3609 N N   . SER B 91  ? 0.3968 0.3437 0.5734 -0.0244 0.0583  0.0780  86  SER B N   
3610 C CA  . SER B 91  ? 0.4129 0.3456 0.5819 -0.0242 0.0532  0.0544  86  SER B CA  
3611 C C   . SER B 91  ? 0.3956 0.3325 0.5250 -0.0220 0.0650  0.0433  86  SER B C   
3612 O O   . SER B 91  ? 0.4030 0.3375 0.5278 -0.0232 0.0637  0.0370  86  SER B O   
3613 C CB  . SER B 91  ? 0.4310 0.3505 0.6084 -0.0202 0.0430  0.0329  86  SER B CB  
3614 O OG  . SER B 91  ? 0.4568 0.3715 0.6229 -0.0169 0.0392  0.0098  86  SER B OG  
3615 N N   . LEU B 92  ? 0.3833 0.3258 0.4875 -0.0191 0.0745  0.0412  87  LEU B N   
3616 C CA  . LEU B 92  ? 0.3798 0.3250 0.4533 -0.0179 0.0826  0.0345  87  LEU B CA  
3617 C C   . LEU B 92  ? 0.3747 0.3288 0.4436 -0.0174 0.0864  0.0469  87  LEU B C   
3618 O O   . LEU B 92  ? 0.3827 0.3341 0.4386 -0.0181 0.0876  0.0403  87  LEU B O   
3619 C CB  . LEU B 92  ? 0.3712 0.3195 0.4252 -0.0152 0.0883  0.0310  87  LEU B CB  
3620 C CG  . LEU B 92  ? 0.3982 0.3428 0.4502 -0.0149 0.0867  0.0180  87  LEU B CG  
3621 C CD1 . LEU B 92  ? 0.3717 0.3210 0.4133 -0.0126 0.0907  0.0208  87  LEU B CD1 
3622 C CD2 . LEU B 92  ? 0.3552 0.3001 0.3945 -0.0160 0.0868  0.0051  87  LEU B CD2 
3623 N N   . ASN B 93  ? 0.3711 0.3400 0.4506 -0.0151 0.0884  0.0654  88  ASN B N   
3624 C CA  . ASN B 93  ? 0.3781 0.3638 0.4568 -0.0125 0.0917  0.0791  88  ASN B CA  
3625 C C   . ASN B 93  ? 0.3767 0.3584 0.4725 -0.0181 0.0867  0.0823  88  ASN B C   
3626 O O   . ASN B 93  ? 0.3863 0.3739 0.4706 -0.0161 0.0896  0.0824  88  ASN B O   
3627 C CB  . ASN B 93  ? 0.3580 0.3704 0.4478 -0.0074 0.0949  0.1019  88  ASN B CB  
3628 C CG  . ASN B 93  ? 0.4029 0.4257 0.4695 0.0021  0.1001  0.0972  88  ASN B CG  
3629 O OD1 . ASN B 93  ? 0.4350 0.4763 0.5103 0.0062  0.1016  0.1115  88  ASN B OD1 
3630 N ND2 . ASN B 93  ? 0.3289 0.3395 0.3691 0.0053  0.1009  0.0777  88  ASN B ND2 
3631 N N   . HIS B 94  ? 0.3840 0.3552 0.5089 -0.0242 0.0772  0.0834  89  HIS B N   
3632 C CA  . HIS B 94  ? 0.3928 0.3572 0.5379 -0.0292 0.0688  0.0827  89  HIS B CA  
3633 C C   . HIS B 94  ? 0.3941 0.3468 0.5153 -0.0283 0.0695  0.0606  89  HIS B C   
3634 O O   . HIS B 94  ? 0.3992 0.3550 0.5219 -0.0297 0.0686  0.0629  89  HIS B O   
3635 C CB  . HIS B 94  ? 0.4067 0.3581 0.5898 -0.0338 0.0540  0.0827  89  HIS B CB  
3636 C CG  . HIS B 94  ? 0.4499 0.3886 0.6519 -0.0369 0.0412  0.0716  89  HIS B CG  
3637 N ND1 . HIS B 94  ? 0.4636 0.4088 0.6959 -0.0427 0.0341  0.0895  89  HIS B ND1 
3638 C CD2 . HIS B 94  ? 0.4525 0.3769 0.6466 -0.0338 0.0340  0.0443  89  HIS B CD2 
3639 C CE1 . HIS B 94  ? 0.4638 0.3946 0.7071 -0.0433 0.0215  0.0717  89  HIS B CE1 
3640 N NE2 . HIS B 94  ? 0.4567 0.3764 0.6757 -0.0368 0.0216  0.0434  89  HIS B NE2 
3641 N N   . LYS B 95  ? 0.3836 0.3273 0.4841 -0.0258 0.0714  0.0421  90  LYS B N   
3642 C CA  . LYS B 95  ? 0.3736 0.3132 0.4523 -0.0248 0.0730  0.0263  90  LYS B CA  
3643 C C   . LYS B 95  ? 0.3710 0.3171 0.4271 -0.0234 0.0813  0.0322  90  LYS B C   
3644 O O   . LYS B 95  ? 0.3690 0.3139 0.4164 -0.0238 0.0809  0.0271  90  LYS B O   
3645 C CB  . LYS B 95  ? 0.3650 0.3020 0.4284 -0.0223 0.0743  0.0109  90  LYS B CB  
3646 C CG  . LYS B 95  ? 0.3816 0.3145 0.4634 -0.0201 0.0659  0.0013  90  LYS B CG  
3647 C CD  . LYS B 95  ? 0.3996 0.3269 0.5066 -0.0193 0.0523  -0.0069 90  LYS B CD  
3648 C CE  . LYS B 95  ? 0.3615 0.2816 0.4943 -0.0164 0.0404  -0.0137 90  LYS B CE  
3649 N NZ  . LYS B 95  ? 0.3812 0.2973 0.5408 -0.0216 0.0376  0.0074  90  LYS B NZ  
3650 N N   . LEU B 96  ? 0.3602 0.3134 0.4070 -0.0200 0.0872  0.0409  91  LEU B N   
3651 C CA  . LEU B 96  ? 0.3567 0.3169 0.3849 -0.0150 0.0917  0.0440  91  LEU B CA  
3652 C C   . LEU B 96  ? 0.3603 0.3334 0.3985 -0.0136 0.0919  0.0562  91  LEU B C   
3653 O O   . LEU B 96  ? 0.3718 0.3455 0.3980 -0.0112 0.0925  0.0529  91  LEU B O   
3654 C CB  . LEU B 96  ? 0.3498 0.3183 0.3690 -0.0085 0.0950  0.0475  91  LEU B CB  
3655 C CG  . LEU B 96  ? 0.3812 0.3397 0.3832 -0.0074 0.0946  0.0358  91  LEU B CG  
3656 C CD1 . LEU B 96  ? 0.3169 0.2626 0.3155 -0.0144 0.0927  0.0257  91  LEU B CD1 
3657 C CD2 . LEU B 96  ? 0.3608 0.3257 0.3630 -0.0032 0.0958  0.0383  91  LEU B CD2 
3658 N N   . ASP B 97  ? 0.3548 0.3401 0.4177 -0.0152 0.0907  0.0722  92  ASP B N   
3659 C CA  . ASP B 97  ? 0.3724 0.3738 0.4507 -0.0156 0.0900  0.0872  92  ASP B CA  
3660 C C   . ASP B 97  ? 0.3712 0.3582 0.4568 -0.0219 0.0838  0.0779  92  ASP B C   
3661 O O   . ASP B 97  ? 0.3580 0.3525 0.4396 -0.0203 0.0848  0.0807  92  ASP B O   
3662 C CB  . ASP B 97  ? 0.3772 0.3979 0.4876 -0.0181 0.0883  0.1118  92  ASP B CB  
3663 C CG  . ASP B 97  ? 0.4363 0.4813 0.5377 -0.0090 0.0955  0.1238  92  ASP B CG  
3664 O OD1 . ASP B 97  ? 0.4964 0.5464 0.5671 0.0013  0.1008  0.1125  92  ASP B OD1 
3665 O OD2 . ASP B 97  ? 0.4790 0.5388 0.6064 -0.0116 0.0939  0.1442  92  ASP B OD2 
3666 N N   . SER B 98  ? 0.3713 0.3400 0.4656 -0.0269 0.0768  0.0648  93  SER B N   
3667 C CA  . SER B 98  ? 0.3844 0.3433 0.4848 -0.0300 0.0694  0.0533  93  SER B CA  
3668 C C   . SER B 98  ? 0.3729 0.3285 0.4415 -0.0268 0.0746  0.0406  93  SER B C   
3669 O O   . SER B 98  ? 0.3638 0.3210 0.4305 -0.0271 0.0730  0.0391  93  SER B O   
3670 C CB  . SER B 98  ? 0.3961 0.3415 0.5139 -0.0319 0.0585  0.0395  93  SER B CB  
3671 O OG  . SER B 98  ? 0.4636 0.4037 0.5856 -0.0318 0.0501  0.0255  93  SER B OG  
3672 N N   . HIS B 99  ? 0.3628 0.3148 0.4092 -0.0242 0.0800  0.0340  94  HIS B N   
3673 C CA  . HIS B 99  ? 0.3623 0.3122 0.3846 -0.0222 0.0833  0.0281  94  HIS B CA  
3674 C C   . HIS B 99  ? 0.3600 0.3178 0.3761 -0.0180 0.0859  0.0367  94  HIS B C   
3675 O O   . HIS B 99  ? 0.3714 0.3275 0.3793 -0.0178 0.0847  0.0332  94  HIS B O   
3676 C CB  . HIS B 99  ? 0.3644 0.3097 0.3705 -0.0213 0.0862  0.0230  94  HIS B CB  
3677 C CG  . HIS B 99  ? 0.3853 0.3279 0.3758 -0.0223 0.0858  0.0179  94  HIS B CG  
3678 N ND1 . HIS B 99  ? 0.4357 0.3806 0.4219 -0.0246 0.0853  0.0119  94  HIS B ND1 
3679 C CD2 . HIS B 99  ? 0.3914 0.3324 0.3721 -0.0209 0.0850  0.0201  94  HIS B CD2 
3680 C CE1 . HIS B 99  ? 0.4664 0.4127 0.4423 -0.0259 0.0847  0.0139  94  HIS B CE1 
3681 N NE2 . HIS B 99  ? 0.4258 0.3667 0.3989 -0.0240 0.0837  0.0181  94  HIS B NE2 
3682 N N   . ALA B 100 ? 0.3572 0.3277 0.3782 -0.0134 0.0889  0.0479  95  ALA B N   
3683 C CA  . ALA B 100 ? 0.3651 0.3502 0.3796 -0.0058 0.0910  0.0545  95  ALA B CA  
3684 C C   . ALA B 100 ? 0.3550 0.3467 0.3830 -0.0089 0.0889  0.0605  95  ALA B C   
3685 O O   . ALA B 100 ? 0.3557 0.3504 0.3730 -0.0045 0.0888  0.0582  95  ALA B O   
3686 C CB  . ALA B 100 ? 0.3253 0.3329 0.3435 0.0022  0.0949  0.0667  95  ALA B CB  
3687 N N   . GLU B 101 ? 0.3568 0.3495 0.4108 -0.0164 0.0852  0.0677  96  GLU B N   
3688 C CA  . GLU B 101 ? 0.3601 0.3558 0.4327 -0.0211 0.0799  0.0719  96  GLU B CA  
3689 C C   . GLU B 101 ? 0.3571 0.3380 0.4150 -0.0223 0.0768  0.0551  96  GLU B C   
3690 O O   . GLU B 101 ? 0.3430 0.3291 0.4026 -0.0219 0.0751  0.0567  96  GLU B O   
3691 C CB  . GLU B 101 ? 0.3686 0.3612 0.4767 -0.0293 0.0711  0.0782  96  GLU B CB  
3692 C CG  . GLU B 101 ? 0.4412 0.4506 0.5755 -0.0311 0.0714  0.1009  96  GLU B CG  
3693 C CD  . GLU B 101 ? 0.5502 0.5463 0.7233 -0.0400 0.0575  0.1022  96  GLU B CD  
3694 O OE1 . GLU B 101 ? 0.5752 0.5565 0.7604 -0.0436 0.0464  0.0886  96  GLU B OE1 
3695 O OE2 . GLU B 101 ? 0.5586 0.5587 0.7503 -0.0421 0.0561  0.1150  96  GLU B OE2 
3696 N N   . LEU B 102 ? 0.3621 0.3287 0.4069 -0.0233 0.0760  0.0409  97  LEU B N   
3697 C CA  . LEU B 102 ? 0.3730 0.3331 0.4030 -0.0233 0.0741  0.0283  97  LEU B CA  
3698 C C   . LEU B 102 ? 0.3728 0.3344 0.3829 -0.0192 0.0778  0.0305  97  LEU B C   
3699 O O   . LEU B 102 ? 0.3911 0.3533 0.3966 -0.0192 0.0755  0.0273  97  LEU B O   
3700 C CB  . LEU B 102 ? 0.3813 0.3350 0.4013 -0.0239 0.0739  0.0169  97  LEU B CB  
3701 C CG  . LEU B 102 ? 0.3918 0.3474 0.3938 -0.0230 0.0739  0.0088  97  LEU B CG  
3702 C CD1 . LEU B 102 ? 0.4200 0.3815 0.4281 -0.0220 0.0677  0.0012  97  LEU B CD1 
3703 C CD2 . LEU B 102 ? 0.3940 0.3520 0.3904 -0.0227 0.0746  0.0016  97  LEU B CD2 
3704 N N   . LEU B 103 ? 0.3683 0.3303 0.3677 -0.0146 0.0817  0.0341  98  LEU B N   
3705 C CA  . LEU B 103 ? 0.3773 0.3382 0.3608 -0.0083 0.0813  0.0334  98  LEU B CA  
3706 C C   . LEU B 103 ? 0.3719 0.3469 0.3606 -0.0031 0.0816  0.0400  98  LEU B C   
3707 O O   . LEU B 103 ? 0.3760 0.3496 0.3567 0.0001  0.0791  0.0376  98  LEU B O   
3708 C CB  . LEU B 103 ? 0.3670 0.3251 0.3406 -0.0020 0.0816  0.0319  98  LEU B CB  
3709 C CG  . LEU B 103 ? 0.3962 0.3413 0.3647 -0.0070 0.0805  0.0269  98  LEU B CG  
3710 C CD1 . LEU B 103 ? 0.3580 0.3015 0.3205 0.0004  0.0787  0.0246  98  LEU B CD1 
3711 C CD2 . LEU B 103 ? 0.4013 0.3376 0.3635 -0.0113 0.0765  0.0248  98  LEU B CD2 
3712 N N   . ASP B 104 ? 0.3646 0.3559 0.3691 -0.0023 0.0842  0.0506  99  ASP B N   
3713 C CA  . ASP B 104 ? 0.3794 0.3910 0.3941 0.0014  0.0848  0.0610  99  ASP B CA  
3714 C C   . ASP B 104 ? 0.3748 0.3803 0.3972 -0.0053 0.0803  0.0580  99  ASP B C   
3715 O O   . ASP B 104 ? 0.3609 0.3734 0.3780 -0.0005 0.0797  0.0587  99  ASP B O   
3716 C CB  . ASP B 104 ? 0.3791 0.4114 0.4182 -0.0008 0.0869  0.0782  99  ASP B CB  
3717 C CG  . ASP B 104 ? 0.4322 0.4828 0.4648 0.0089  0.0921  0.0850  99  ASP B CG  
3718 O OD1 . ASP B 104 ? 0.4470 0.4979 0.4565 0.0206  0.0929  0.0750  99  ASP B OD1 
3719 O OD2 . ASP B 104 ? 0.5098 0.5757 0.5635 0.0053  0.0937  0.1009  99  ASP B OD2 
3720 N N   . ALA B 105 ? 0.3789 0.3732 0.4143 -0.0144 0.0760  0.0533  100 ALA B N   
3721 C CA  . ALA B 105 ? 0.3858 0.3760 0.4291 -0.0188 0.0695  0.0469  100 ALA B CA  
3722 C C   . ALA B 105 ? 0.3936 0.3762 0.4126 -0.0157 0.0698  0.0371  100 ALA B C   
3723 O O   . ALA B 105 ? 0.4103 0.3972 0.4296 -0.0149 0.0670  0.0365  100 ALA B O   
3724 C CB  . ALA B 105 ? 0.3688 0.3501 0.4288 -0.0247 0.0623  0.0387  100 ALA B CB  
3725 N N   . THR B 106 ? 0.3877 0.3607 0.3889 -0.0145 0.0723  0.0320  101 THR B N   
3726 C CA  . THR B 106 ? 0.3833 0.3504 0.3664 -0.0126 0.0714  0.0282  101 THR B CA  
3727 C C   . THR B 106 ? 0.3971 0.3668 0.3737 -0.0057 0.0710  0.0324  101 THR B C   
3728 O O   . THR B 106 ? 0.3963 0.3657 0.3675 -0.0046 0.0679  0.0316  101 THR B O   
3729 C CB  . THR B 106 ? 0.3862 0.3440 0.3583 -0.0140 0.0727  0.0261  101 THR B CB  
3730 O OG1 . THR B 106 ? 0.3724 0.3320 0.3496 -0.0183 0.0729  0.0208  101 THR B OG1 
3731 C CG2 . THR B 106 ? 0.3860 0.3396 0.3468 -0.0141 0.0697  0.0274  101 THR B CG2 
3732 N N   . GLN B 107 ? 0.3912 0.3665 0.3680 0.0010  0.0733  0.0361  102 GLN B N   
3733 C CA  . GLN B 107 ? 0.4042 0.3875 0.3752 0.0117  0.0717  0.0372  102 GLN B CA  
3734 C C   . GLN B 107 ? 0.3994 0.3976 0.3801 0.0118  0.0718  0.0426  102 GLN B C   
3735 O O   . GLN B 107 ? 0.3941 0.3928 0.3680 0.0175  0.0684  0.0405  102 GLN B O   
3736 C CB  . GLN B 107 ? 0.4095 0.4067 0.3793 0.0225  0.0743  0.0395  102 GLN B CB  
3737 C CG  . GLN B 107 ? 0.4416 0.4460 0.4011 0.0380  0.0696  0.0345  102 GLN B CG  
3738 C CD  . GLN B 107 ? 0.5268 0.5494 0.4815 0.0531  0.0703  0.0326  102 GLN B CD  
3739 O OE1 . GLN B 107 ? 0.5659 0.5996 0.5260 0.0512  0.0761  0.0390  102 GLN B OE1 
3740 N NE2 . GLN B 107 ? 0.5355 0.5633 0.4803 0.0702  0.0631  0.0228  102 GLN B NE2 
3741 N N   . HIS B 108 ? 0.3680 0.3775 0.3678 0.0055  0.0740  0.0501  103 HIS B N   
3742 C CA  . HIS B 108 ? 0.3705 0.3949 0.3867 0.0034  0.0724  0.0572  103 HIS B CA  
3743 C C   . HIS B 108 ? 0.3779 0.3928 0.3905 -0.0004 0.0671  0.0494  103 HIS B C   
3744 O O   . HIS B 108 ? 0.3632 0.3890 0.3780 0.0033  0.0658  0.0528  103 HIS B O   
3745 C CB  . HIS B 108 ? 0.3452 0.3797 0.3903 -0.0049 0.0715  0.0679  103 HIS B CB  
3746 C CG  . HIS B 108 ? 0.3568 0.4094 0.4092 -0.0009 0.0770  0.0811  103 HIS B CG  
3747 N ND1 . HIS B 108 ? 0.3552 0.4110 0.4319 -0.0088 0.0758  0.0912  103 HIS B ND1 
3748 C CD2 . HIS B 108 ? 0.3542 0.4260 0.3935 0.0120  0.0826  0.0858  103 HIS B CD2 
3749 C CE1 . HIS B 108 ? 0.3473 0.4258 0.4255 -0.0022 0.0820  0.1046  103 HIS B CE1 
3750 N NE2 . HIS B 108 ? 0.3942 0.4842 0.4484 0.0116  0.0863  0.1001  103 HIS B NE2 
3751 N N   . THR B 109 ? 0.3901 0.3900 0.3970 -0.0062 0.0644  0.0399  104 THR B N   
3752 C CA  . THR B 109 ? 0.4180 0.4155 0.4181 -0.0070 0.0600  0.0334  104 THR B CA  
3753 C C   . THR B 109 ? 0.4202 0.4126 0.4016 -0.0013 0.0600  0.0339  104 THR B C   
3754 O O   . THR B 109 ? 0.4419 0.4380 0.4205 0.0004  0.0568  0.0336  104 THR B O   
3755 C CB  . THR B 109 ? 0.4212 0.4130 0.4157 -0.0108 0.0574  0.0240  104 THR B CB  
3756 O OG1 . THR B 109 ? 0.5096 0.4967 0.5098 -0.0139 0.0587  0.0212  104 THR B OG1 
3757 C CG2 . THR B 109 ? 0.3870 0.3867 0.3893 -0.0114 0.0507  0.0172  104 THR B CG2 
3758 N N   . LEU B 110 ? 0.4251 0.4078 0.3959 0.0017  0.0615  0.0342  105 LEU B N   
3759 C CA  . LEU B 110 ? 0.4408 0.4155 0.4002 0.0078  0.0572  0.0345  105 LEU B CA  
3760 C C   . LEU B 110 ? 0.4486 0.4343 0.4101 0.0171  0.0559  0.0359  105 LEU B C   
3761 O O   . LEU B 110 ? 0.4751 0.4588 0.4324 0.0203  0.0511  0.0358  105 LEU B O   
3762 C CB  . LEU B 110 ? 0.4400 0.4018 0.3934 0.0107  0.0555  0.0330  105 LEU B CB  
3763 C CG  . LEU B 110 ? 0.4868 0.4365 0.4365 0.0032  0.0528  0.0350  105 LEU B CG  
3764 C CD1 . LEU B 110 ? 0.4402 0.3866 0.3877 0.0010  0.0463  0.0410  105 LEU B CD1 
3765 C CD2 . LEU B 110 ? 0.5161 0.4724 0.4684 -0.0048 0.0587  0.0341  105 LEU B CD2 
3766 N N   . GLN B 111 ? 0.4377 0.4389 0.4066 0.0221  0.0602  0.0389  106 GLN B N   
3767 C CA  . GLN B 111 ? 0.4500 0.4702 0.4212 0.0329  0.0599  0.0419  106 GLN B CA  
3768 C C   . GLN B 111 ? 0.4533 0.4838 0.4356 0.0271  0.0595  0.0463  106 GLN B C   
3769 O O   . GLN B 111 ? 0.4611 0.4973 0.4404 0.0334  0.0562  0.0458  106 GLN B O   
3770 C CB  . GLN B 111 ? 0.4383 0.4829 0.4168 0.0401  0.0656  0.0485  106 GLN B CB  
3771 C CG  . GLN B 111 ? 0.4499 0.4878 0.4202 0.0448  0.0665  0.0441  106 GLN B CG  
3772 C CD  . GLN B 111 ? 0.4631 0.5315 0.4413 0.0519  0.0729  0.0535  106 GLN B CD  
3773 O OE1 . GLN B 111 ? 0.5075 0.5963 0.4777 0.0694  0.0723  0.0509  106 GLN B OE1 
3774 N NE2 . GLN B 111 ? 0.4640 0.5394 0.4601 0.0397  0.0779  0.0654  106 GLN B NE2 
3775 N N   . GLN B 112 ? 0.4557 0.4879 0.4527 0.0159  0.0608  0.0493  107 GLN B N   
3776 C CA  . GLN B 112 ? 0.4660 0.5099 0.4798 0.0109  0.0579  0.0531  107 GLN B CA  
3777 C C   . GLN B 112 ? 0.4766 0.5103 0.4813 0.0087  0.0525  0.0448  107 GLN B C   
3778 O O   . GLN B 112 ? 0.4947 0.5386 0.5045 0.0107  0.0495  0.0466  107 GLN B O   
3779 C CB  . GLN B 112 ? 0.4579 0.5070 0.4971 0.0012  0.0570  0.0586  107 GLN B CB  
3780 C CG  . GLN B 112 ? 0.4892 0.5438 0.5507 -0.0056 0.0493  0.0588  107 GLN B CG  
3781 C CD  . GLN B 112 ? 0.5544 0.6142 0.6499 -0.0147 0.0445  0.0669  107 GLN B CD  
3782 O OE1 . GLN B 112 ? 0.5731 0.6414 0.6784 -0.0154 0.0493  0.0792  107 GLN B OE1 
3783 N NE2 . GLN B 112 ? 0.5631 0.6189 0.6795 -0.0210 0.0329  0.0602  107 GLN B NE2 
3784 N N   . GLN B 113 ? 0.4753 0.4935 0.4663 0.0058  0.0515  0.0379  108 GLN B N   
3785 C CA  . GLN B 113 ? 0.4871 0.5031 0.4690 0.0048  0.0472  0.0333  108 GLN B CA  
3786 C C   . GLN B 113 ? 0.4995 0.5077 0.4657 0.0102  0.0455  0.0364  108 GLN B C   
3787 O O   . GLN B 113 ? 0.5123 0.5251 0.4759 0.0136  0.0418  0.0379  108 GLN B O   
3788 C CB  . GLN B 113 ? 0.4878 0.5009 0.4667 -0.0004 0.0463  0.0266  108 GLN B CB  
3789 C CG  . GLN B 113 ? 0.5192 0.5366 0.5170 -0.0048 0.0433  0.0198  108 GLN B CG  
3790 C CD  . GLN B 113 ? 0.5649 0.5922 0.5811 -0.0053 0.0369  0.0188  108 GLN B CD  
3791 O OE1 . GLN B 113 ? 0.6728 0.7075 0.6857 -0.0030 0.0314  0.0124  108 GLN B OE1 
3792 N NE2 . GLN B 113 ? 0.5143 0.5455 0.5522 -0.0082 0.0369  0.0267  108 GLN B NE2 
3793 N N   . ILE B 114 ? 0.4962 0.4915 0.4548 0.0110  0.0463  0.0377  109 ILE B N   
3794 C CA  . ILE B 114 ? 0.4935 0.4777 0.4436 0.0136  0.0408  0.0417  109 ILE B CA  
3795 C C   . ILE B 114 ? 0.5124 0.4927 0.4622 0.0246  0.0362  0.0406  109 ILE B C   
3796 O O   . ILE B 114 ? 0.5140 0.4916 0.4621 0.0288  0.0295  0.0430  109 ILE B O   
3797 C CB  . ILE B 114 ? 0.4950 0.4668 0.4420 0.0092  0.0406  0.0440  109 ILE B CB  
3798 C CG1 . ILE B 114 ? 0.4938 0.4750 0.4402 0.0011  0.0455  0.0432  109 ILE B CG1 
3799 C CG2 . ILE B 114 ? 0.4837 0.4429 0.4297 0.0103  0.0313  0.0518  109 ILE B CG2 
3800 C CD1 . ILE B 114 ? 0.5262 0.5248 0.4701 -0.0003 0.0443  0.0440  109 ILE B CD1 
3801 N N   . GLN B 115 ? 0.5089 0.4923 0.4605 0.0310  0.0392  0.0368  110 GLN B N   
3802 C CA  . GLN B 115 ? 0.5302 0.5143 0.4796 0.0456  0.0335  0.0326  110 GLN B CA  
3803 C C   . GLN B 115 ? 0.5258 0.5283 0.4782 0.0522  0.0336  0.0337  110 GLN B C   
3804 O O   . GLN B 115 ? 0.5281 0.5275 0.4776 0.0634  0.0253  0.0302  110 GLN B O   
3805 C CB  . GLN B 115 ? 0.5387 0.5292 0.4872 0.0545  0.0362  0.0279  110 GLN B CB  
3806 C CG  . GLN B 115 ? 0.5618 0.5602 0.5066 0.0749  0.0287  0.0197  110 GLN B CG  
3807 C CD  . GLN B 115 ? 0.6409 0.6537 0.5830 0.0868  0.0314  0.0143  110 GLN B CD  
3808 O OE1 . GLN B 115 ? 0.6942 0.6974 0.6315 0.1006  0.0209  0.0025  110 GLN B OE1 
3809 N NE2 . GLN B 115 ? 0.6191 0.6560 0.5669 0.0820  0.0437  0.0234  110 GLN B NE2 
3810 N N   . THR B 116 ? 0.5078 0.5287 0.4689 0.0458  0.0409  0.0385  111 THR B N   
3811 C CA  . THR B 116 ? 0.5185 0.5589 0.4854 0.0512  0.0404  0.0413  111 THR B CA  
3812 C C   . THR B 116 ? 0.5253 0.5566 0.4882 0.0485  0.0340  0.0410  111 THR B C   
3813 O O   . THR B 116 ? 0.5284 0.5693 0.4917 0.0571  0.0304  0.0410  111 THR B O   
3814 C CB  . THR B 116 ? 0.5040 0.5679 0.4886 0.0445  0.0467  0.0490  111 THR B CB  
3815 O OG1 . THR B 116 ? 0.5501 0.6057 0.5411 0.0308  0.0455  0.0481  111 THR B OG1 
3816 C CG2 . THR B 116 ? 0.4730 0.5484 0.4644 0.0455  0.0529  0.0538  111 THR B CG2 
3817 N N   . LEU B 117 ? 0.5298 0.5465 0.4883 0.0383  0.0326  0.0416  112 LEU B N   
3818 C CA  . LEU B 117 ? 0.5379 0.5519 0.4924 0.0357  0.0273  0.0445  112 LEU B CA  
3819 C C   . LEU B 117 ? 0.5607 0.5616 0.5110 0.0447  0.0179  0.0460  112 LEU B C   
3820 O O   . LEU B 117 ? 0.5508 0.5566 0.5014 0.0491  0.0129  0.0480  112 LEU B O   
3821 C CB  . LEU B 117 ? 0.5477 0.5578 0.4983 0.0254  0.0284  0.0469  112 LEU B CB  
3822 C CG  . LEU B 117 ? 0.5659 0.5894 0.5139 0.0215  0.0266  0.0489  112 LEU B CG  
3823 C CD1 . LEU B 117 ? 0.5650 0.5885 0.5063 0.0162  0.0262  0.0557  112 LEU B CD1 
3824 C CD2 . LEU B 117 ? 0.5606 0.5908 0.5080 0.0270  0.0211  0.0523  112 LEU B CD2 
3825 N N   . VAL B 118 ? 0.5726 0.5559 0.5215 0.0479  0.0133  0.0444  113 VAL B N   
3826 C CA  . VAL B 118 ? 0.6011 0.5671 0.5520 0.0572  -0.0006 0.0439  113 VAL B CA  
3827 C C   . VAL B 118 ? 0.6162 0.5902 0.5670 0.0750  -0.0050 0.0339  113 VAL B C   
3828 O O   . VAL B 118 ? 0.6298 0.5913 0.5839 0.0857  -0.0191 0.0305  113 VAL B O   
3829 C CB  . VAL B 118 ? 0.6164 0.5595 0.5706 0.0563  -0.0085 0.0433  113 VAL B CB  
3830 C CG1 . VAL B 118 ? 0.6256 0.5648 0.5814 0.0403  -0.0056 0.0560  113 VAL B CG1 
3831 C CG2 . VAL B 118 ? 0.5900 0.5363 0.5410 0.0631  -0.0033 0.0323  113 VAL B CG2 
3832 N N   . LYS B 119 ? 0.6123 0.6095 0.5619 0.0789  0.0058  0.0301  114 LYS B N   
3833 C CA  . LYS B 119 ? 0.6329 0.6494 0.5820 0.0977  0.0042  0.0224  114 LYS B CA  
3834 C C   . LYS B 119 ? 0.6261 0.6665 0.5793 0.0964  0.0097  0.0283  114 LYS B C   
3835 O O   . LYS B 119 ? 0.6317 0.6668 0.5852 0.0980  0.0025  0.0295  114 LYS B O   
3836 C CB  . LYS B 119 ? 0.6335 0.6685 0.5818 0.1037  0.0127  0.0192  114 LYS B CB  
3837 C CG  . LYS B 119 ? 0.6622 0.6791 0.6062 0.1103  0.0060  0.0098  114 LYS B CG  
3838 C CD  . LYS B 119 ? 0.7278 0.7319 0.6704 0.1306  -0.0123 -0.0043 114 LYS B CD  
3839 C CE  . LYS B 119 ? 0.7588 0.7760 0.6963 0.1525  -0.0168 -0.0197 114 LYS B CE  
3840 N NZ  . LYS B 119 ? 0.7723 0.7642 0.7105 0.1472  -0.0221 -0.0243 114 LYS B NZ  
3841 N N   . GLU B 120 ? 0.6053 0.6721 0.5650 0.0925  0.0211  0.0337  115 GLU B N   
3842 C CA  . GLU B 120 ? 0.5999 0.6928 0.5691 0.0914  0.0250  0.0404  115 GLU B CA  
3843 C C   . GLU B 120 ? 0.5725 0.6543 0.5443 0.0766  0.0232  0.0440  115 GLU B C   
3844 O O   . GLU B 120 ? 0.5677 0.6616 0.5435 0.0789  0.0207  0.0460  115 GLU B O   
3845 C CB  . GLU B 120 ? 0.5936 0.7177 0.5763 0.0887  0.0353  0.0495  115 GLU B CB  
3846 C CG  . GLU B 120 ? 0.6347 0.7836 0.6363 0.0806  0.0380  0.0604  115 GLU B CG  
3847 C CD  . GLU B 120 ? 0.6836 0.8553 0.6859 0.0946  0.0347  0.0609  115 GLU B CD  
3848 O OE1 . GLU B 120 ? 0.6768 0.8492 0.6863 0.0876  0.0315  0.0633  115 GLU B OE1 
3849 O OE2 . GLU B 120 ? 0.7210 0.9116 0.7162 0.1141  0.0345  0.0574  115 GLU B OE2 
3850 N N   . GLY B 121 ? 0.5527 0.6150 0.5212 0.0637  0.0240  0.0441  116 GLY B N   
3851 C CA  . GLY B 121 ? 0.5168 0.5765 0.4867 0.0519  0.0229  0.0459  116 GLY B CA  
3852 C C   . GLY B 121 ? 0.5187 0.5713 0.4809 0.0553  0.0151  0.0474  116 GLY B C   
3853 O O   . GLY B 121 ? 0.4995 0.5605 0.4631 0.0504  0.0137  0.0487  116 GLY B O   
3854 N N   . LEU B 122 ? 0.5288 0.5665 0.4854 0.0645  0.0082  0.0470  117 LEU B N   
3855 C CA  . LEU B 122 ? 0.5505 0.5783 0.5043 0.0678  -0.0017 0.0514  117 LEU B CA  
3856 C C   . LEU B 122 ? 0.5691 0.6034 0.5251 0.0829  -0.0084 0.0475  117 LEU B C   
3857 O O   . LEU B 122 ? 0.5895 0.6136 0.5459 0.0878  -0.0192 0.0509  117 LEU B O   
3858 C CB  . LEU B 122 ? 0.5520 0.5546 0.5047 0.0662  -0.0095 0.0552  117 LEU B CB  
3859 C CG  . LEU B 122 ? 0.5437 0.5438 0.4944 0.0522  -0.0073 0.0657  117 LEU B CG  
3860 C CD1 . LEU B 122 ? 0.5355 0.5122 0.4911 0.0505  -0.0165 0.0725  117 LEU B CD1 
3861 C CD2 . LEU B 122 ? 0.5671 0.5817 0.5163 0.0490  -0.0093 0.0751  117 LEU B CD2 
3862 N N   . ARG B 123 ? 0.5606 0.6151 0.5199 0.0909  -0.0026 0.0422  118 ARG B N   
3863 C CA  . ARG B 123 ? 0.5734 0.6409 0.5339 0.1086  -0.0082 0.0373  118 ARG B CA  
3864 C C   . ARG B 123 ? 0.5643 0.6419 0.5276 0.1083  -0.0115 0.0417  118 ARG B C   
3865 O O   . ARG B 123 ? 0.5925 0.6636 0.5548 0.1201  -0.0223 0.0392  118 ARG B O   
3866 C CB  . ARG B 123 ? 0.5672 0.6649 0.5319 0.1177  0.0004  0.0348  118 ARG B CB  
3867 C CG  . ARG B 123 ? 0.6092 0.7304 0.5748 0.1387  -0.0042 0.0298  118 ARG B CG  
3868 C CD  . ARG B 123 ? 0.6744 0.8355 0.6449 0.1492  0.0051  0.0315  118 ARG B CD  
3869 N NE  . ARG B 123 ? 0.7431 0.9008 0.7066 0.1590  0.0051  0.0235  118 ARG B NE  
3870 C CZ  . ARG B 123 ? 0.7833 0.9404 0.7385 0.1829  -0.0054 0.0082  118 ARG B CZ  
3871 N NH1 . ARG B 123 ? 0.8148 0.9721 0.7684 0.1993  -0.0172 -0.0005 118 ARG B NH1 
3872 N NH2 . ARG B 123 ? 0.7807 0.9366 0.7302 0.1919  -0.0061 -0.0002 118 ARG B NH2 
3873 N N   . GLY B 124 ? 0.5418 0.6349 0.5101 0.0959  -0.0043 0.0469  119 GLY B N   
3874 C CA  . GLY B 124 ? 0.5248 0.6291 0.4958 0.0949  -0.0079 0.0503  119 GLY B CA  
3875 C C   . GLY B 124 ? 0.5311 0.6157 0.4948 0.0944  -0.0175 0.0545  119 GLY B C   
3876 O O   . GLY B 124 ? 0.5358 0.6226 0.5000 0.1031  -0.0252 0.0558  119 GLY B O   
3877 N N   . PHE B 125 ? 0.5176 0.5856 0.4766 0.0844  -0.0172 0.0588  120 PHE B N   
3878 C CA  . PHE B 125 ? 0.5306 0.5843 0.4868 0.0820  -0.0259 0.0687  120 PHE B CA  
3879 C C   . PHE B 125 ? 0.5580 0.5923 0.5189 0.0946  -0.0396 0.0689  120 PHE B C   
3880 O O   . PHE B 125 ? 0.5754 0.6074 0.5395 0.0979  -0.0495 0.0770  120 PHE B O   
3881 C CB  . PHE B 125 ? 0.5300 0.5738 0.4830 0.0702  -0.0224 0.0747  120 PHE B CB  
3882 C CG  . PHE B 125 ? 0.5502 0.5866 0.5044 0.0660  -0.0308 0.0910  120 PHE B CG  
3883 C CD1 . PHE B 125 ? 0.5542 0.6120 0.5037 0.0600  -0.0285 0.1008  120 PHE B CD1 
3884 C CD2 . PHE B 125 ? 0.5833 0.5942 0.5463 0.0693  -0.0430 0.0976  120 PHE B CD2 
3885 C CE1 . PHE B 125 ? 0.5722 0.6307 0.5253 0.0563  -0.0360 0.1216  120 PHE B CE1 
3886 C CE2 . PHE B 125 ? 0.6064 0.6123 0.5772 0.0637  -0.0527 0.1181  120 PHE B CE2 
3887 C CZ  . PHE B 125 ? 0.5844 0.6166 0.5501 0.0568  -0.0479 0.1323  120 PHE B CZ  
3888 N N   . ARG B 126 ? 0.5600 0.5812 0.5225 0.1030  -0.0422 0.0593  121 ARG B N   
3889 C CA  . ARG B 126 ? 0.5835 0.5838 0.5528 0.1179  -0.0592 0.0540  121 ARG B CA  
3890 C C   . ARG B 126 ? 0.5863 0.5997 0.5572 0.1345  -0.0653 0.0469  121 ARG B C   
3891 O O   . ARG B 126 ? 0.6054 0.6021 0.5842 0.1449  -0.0826 0.0464  121 ARG B O   
3892 C CB  . ARG B 126 ? 0.5884 0.5786 0.5573 0.1265  -0.0605 0.0406  121 ARG B CB  
3893 C CG  . ARG B 126 ? 0.6129 0.5837 0.5833 0.1126  -0.0595 0.0471  121 ARG B CG  
3894 C CD  . ARG B 126 ? 0.6322 0.5945 0.6017 0.1222  -0.0612 0.0326  121 ARG B CD  
3895 N NE  . ARG B 126 ? 0.6453 0.5929 0.6160 0.1063  -0.0576 0.0405  121 ARG B NE  
3896 C CZ  . ARG B 126 ? 0.6375 0.5949 0.6009 0.0992  -0.0429 0.0380  121 ARG B CZ  
3897 N NH1 . ARG B 126 ? 0.5869 0.5693 0.5438 0.1055  -0.0306 0.0298  121 ARG B NH1 
3898 N NH2 . ARG B 126 ? 0.6315 0.5753 0.5970 0.0855  -0.0414 0.0459  121 ARG B NH2 
3899 N N   . GLU B 127 ? 0.5691 0.6129 0.5355 0.1369  -0.0524 0.0421  122 GLU B N   
3900 C CA  . GLU B 127 ? 0.5752 0.6407 0.5433 0.1519  -0.0549 0.0368  122 GLU B CA  
3901 C C   . GLU B 127 ? 0.5721 0.6385 0.5422 0.1460  -0.0596 0.0475  122 GLU B C   
3902 O O   . GLU B 127 ? 0.5838 0.6465 0.5580 0.1588  -0.0722 0.0459  122 GLU B O   
3903 C CB  . GLU B 127 ? 0.5575 0.6585 0.5257 0.1496  -0.0387 0.0360  122 GLU B CB  
3904 C CG  . GLU B 127 ? 0.6207 0.7507 0.5906 0.1704  -0.0377 0.0269  122 GLU B CG  
3905 C CD  . GLU B 127 ? 0.6805 0.8386 0.6538 0.1651  -0.0221 0.0303  122 GLU B CD  
3906 O OE1 . GLU B 127 ? 0.6847 0.8576 0.6661 0.1486  -0.0127 0.0404  122 GLU B OE1 
3907 O OE2 . GLU B 127 ? 0.7134 0.8785 0.6833 0.1775  -0.0211 0.0229  122 GLU B OE2 
3908 N N   . ALA B 128 ? 0.5516 0.6261 0.5191 0.1282  -0.0502 0.0573  123 ALA B N   
3909 C CA  . ALA B 128 ? 0.5596 0.6421 0.5272 0.1235  -0.0534 0.0669  123 ALA B CA  
3910 C C   . ALA B 128 ? 0.5847 0.6429 0.5560 0.1235  -0.0678 0.0786  123 ALA B C   
3911 O O   . ALA B 128 ? 0.5955 0.6546 0.5710 0.1304  -0.0779 0.0837  123 ALA B O   
3912 C CB  . ALA B 128 ? 0.5432 0.6425 0.5072 0.1079  -0.0423 0.0706  123 ALA B CB  
3913 N N   . ARG B 129 ? 0.5980 0.6351 0.5710 0.1158  -0.0701 0.0842  124 ARG B N   
3914 C CA  . ARG B 129 ? 0.6295 0.6422 0.6137 0.1148  -0.0866 0.0985  124 ARG B CA  
3915 C C   . ARG B 129 ? 0.6538 0.6503 0.6491 0.1329  -0.1049 0.0910  124 ARG B C   
3916 O O   . ARG B 129 ? 0.6720 0.6640 0.6769 0.1352  -0.1179 0.1035  124 ARG B O   
3917 C CB  . ARG B 129 ? 0.6390 0.6302 0.6275 0.1071  -0.0880 0.1012  124 ARG B CB  
3918 C CG  . ARG B 129 ? 0.6689 0.6360 0.6758 0.1026  -0.1065 0.1209  124 ARG B CG  
3919 C CD  . ARG B 129 ? 0.7413 0.6781 0.7592 0.1062  -0.1175 0.1122  124 ARG B CD  
3920 N NE  . ARG B 129 ? 0.7633 0.6858 0.7966 0.0914  -0.1251 0.1348  124 ARG B NE  
3921 C CZ  . ARG B 129 ? 0.8141 0.7143 0.8740 0.0901  -0.1482 0.1529  124 ARG B CZ  
3922 N NH1 . ARG B 129 ? 0.8290 0.7157 0.9017 0.1040  -0.1668 0.1484  124 ARG B NH1 
3923 N NH2 . ARG B 129 ? 0.8208 0.7136 0.8975 0.0749  -0.1537 0.1771  124 ARG B NH2 
3924 N N   . ARG B 130 ? 0.6530 0.6442 0.6471 0.1475  -0.1066 0.0702  125 ARG B N   
3925 C CA  . ARG B 130 ? 0.6717 0.6529 0.6742 0.1704  -0.1245 0.0559  125 ARG B CA  
3926 C C   . ARG B 130 ? 0.6647 0.6653 0.6668 0.1788  -0.1263 0.0573  125 ARG B C   
3927 O O   . ARG B 130 ? 0.6814 0.6656 0.6965 0.1878  -0.1459 0.0607  125 ARG B O   
3928 C CB  . ARG B 130 ? 0.6692 0.6585 0.6652 0.1875  -0.1211 0.0319  125 ARG B CB  
3929 C CG  . ARG B 130 ? 0.7470 0.7202 0.7535 0.2142  -0.1451 0.0132  125 ARG B CG  
3930 C CD  . ARG B 130 ? 0.8283 0.8318 0.8244 0.2388  -0.1396 -0.0106 125 ARG B CD  
3931 N NE  . ARG B 130 ? 0.8615 0.9085 0.8472 0.2375  -0.1194 -0.0065 125 ARG B NE  
3932 C CZ  . ARG B 130 ? 0.8540 0.9324 0.8305 0.2315  -0.0978 -0.0054 125 ARG B CZ  
3933 N NH1 . ARG B 130 ? 0.8390 0.9111 0.8116 0.2274  -0.0922 -0.0093 125 ARG B NH1 
3934 N NH2 . ARG B 130 ? 0.8313 0.9476 0.8054 0.2296  -0.0834 0.0006  125 ARG B NH2 
3935 N N   . ASP B 131 ? 0.6375 0.6721 0.6277 0.1764  -0.1079 0.0544  126 ASP B N   
3936 C CA  . ASP B 131 ? 0.6353 0.6923 0.6253 0.1843  -0.1083 0.0546  126 ASP B CA  
3937 C C   . ASP B 131 ? 0.6346 0.6880 0.6283 0.1728  -0.1137 0.0749  126 ASP B C   
3938 O O   . ASP B 131 ? 0.6349 0.6941 0.6333 0.1821  -0.1227 0.0769  126 ASP B O   
3939 C CB  . ASP B 131 ? 0.6113 0.7058 0.5934 0.1815  -0.0886 0.0496  126 ASP B CB  
3940 C CG  . ASP B 131 ? 0.6532 0.7633 0.6336 0.1971  -0.0838 0.0335  126 ASP B CG  
3941 O OD1 . ASP B 131 ? 0.7000 0.8009 0.6831 0.2185  -0.0976 0.0203  126 ASP B OD1 
3942 O OD2 . ASP B 131 ? 0.6615 0.7961 0.6397 0.1890  -0.0674 0.0343  126 ASP B OD2 
3943 N N   . PHE B 132 ? 0.6238 0.6716 0.6155 0.1540  -0.1083 0.0904  127 PHE B N   
3944 C CA  . PHE B 132 ? 0.6256 0.6787 0.6200 0.1443  -0.1124 0.1121  127 PHE B CA  
3945 C C   . PHE B 132 ? 0.6594 0.6845 0.6727 0.1501  -0.1358 0.1252  127 PHE B C   
3946 O O   . PHE B 132 ? 0.6695 0.7004 0.6892 0.1548  -0.1454 0.1355  127 PHE B O   
3947 C CB  . PHE B 132 ? 0.6049 0.6674 0.5917 0.1255  -0.1002 0.1248  127 PHE B CB  
3948 C CG  . PHE B 132 ? 0.6004 0.6694 0.5923 0.1168  -0.1066 0.1518  127 PHE B CG  
3949 C CD1 . PHE B 132 ? 0.5881 0.6886 0.5723 0.1156  -0.1022 0.1595  127 PHE B CD1 
3950 C CD2 . PHE B 132 ? 0.5909 0.6389 0.5971 0.1100  -0.1175 0.1711  127 PHE B CD2 
3951 C CE1 . PHE B 132 ? 0.6110 0.7261 0.5991 0.1092  -0.1072 0.1870  127 PHE B CE1 
3952 C CE2 . PHE B 132 ? 0.6225 0.6845 0.6365 0.1015  -0.1229 0.2019  127 PHE B CE2 
3953 C CZ  . PHE B 132 ? 0.5853 0.6830 0.5888 0.1018  -0.1169 0.2102  127 PHE B CZ  
3954 N N   . TRP B 133 ? 0.6717 0.6662 0.6969 0.1498  -0.1468 0.1248  128 TRP B N   
3955 C CA  . TRP B 133 ? 0.7100 0.6736 0.7609 0.1535  -0.1731 0.1386  128 TRP B CA  
3956 C C   . TRP B 133 ? 0.7353 0.6884 0.7950 0.1765  -0.1907 0.1213  128 TRP B C   
3957 O O   . TRP B 133 ? 0.7607 0.6989 0.8407 0.1808  -0.2116 0.1345  128 TRP B O   
3958 C CB  . TRP B 133 ? 0.7135 0.6464 0.7786 0.1478  -0.1830 0.1405  128 TRP B CB  
3959 C CG  . TRP B 133 ? 0.7033 0.6470 0.7670 0.1251  -0.1715 0.1666  128 TRP B CG  
3960 C CD1 . TRP B 133 ? 0.6846 0.6347 0.7348 0.1148  -0.1545 0.1617  128 TRP B CD1 
3961 C CD2 . TRP B 133 ? 0.7135 0.6690 0.7897 0.1115  -0.1760 0.2027  128 TRP B CD2 
3962 N NE1 . TRP B 133 ? 0.6881 0.6532 0.7409 0.0968  -0.1484 0.1902  128 TRP B NE1 
3963 C CE2 . TRP B 133 ? 0.6939 0.6656 0.7621 0.0946  -0.1608 0.2169  128 TRP B CE2 
3964 C CE3 . TRP B 133 ? 0.7306 0.6879 0.8250 0.1128  -0.1920 0.2260  128 TRP B CE3 
3965 C CZ2 . TRP B 133 ? 0.7087 0.7040 0.7854 0.0804  -0.1599 0.2540  128 TRP B CZ2 
3966 C CZ3 . TRP B 133 ? 0.7386 0.7183 0.8426 0.0971  -0.1911 0.2654  128 TRP B CZ3 
3967 C CH2 . TRP B 133 ? 0.7316 0.7324 0.8262 0.0817  -0.1749 0.2790  128 TRP B CH2 
3968 N N   . ARG B 134 ? 0.7336 0.6995 0.7789 0.1919  -0.1818 0.0930  129 ARG B N   
3969 C CA  . ARG B 134 ? 0.7524 0.7206 0.8013 0.2167  -0.1946 0.0739  129 ARG B CA  
3970 C C   . ARG B 134 ? 0.7454 0.7355 0.7922 0.2151  -0.1919 0.0872  129 ARG B C   
3971 O O   . ARG B 134 ? 0.7650 0.7438 0.8265 0.2288  -0.2122 0.0873  129 ARG B O   
3972 C CB  . ARG B 134 ? 0.7443 0.7364 0.7763 0.2314  -0.1801 0.0467  129 ARG B CB  
3973 C CG  . ARG B 134 ? 0.7994 0.7985 0.8345 0.2626  -0.1941 0.0222  129 ARG B CG  
3974 C CD  . ARG B 134 ? 0.8265 0.8490 0.8481 0.2774  -0.1823 -0.0012 129 ARG B CD  
3975 N NE  . ARG B 134 ? 0.8417 0.8382 0.8665 0.2750  -0.1879 -0.0080 129 ARG B NE  
3976 C CZ  . ARG B 134 ? 0.8860 0.8904 0.9060 0.2963  -0.1910 -0.0325 129 ARG B CZ  
3977 N NH1 . ARG B 134 ? 0.9116 0.9533 0.9234 0.3226  -0.1885 -0.0512 129 ARG B NH1 
3978 N NH2 . ARG B 134 ? 0.8839 0.8630 0.9077 0.2931  -0.1973 -0.0380 129 ARG B NH2 
3979 N N   . GLY B 135 ? 0.7117 0.7325 0.7420 0.1992  -0.1689 0.0972  130 GLY B N   
3980 C CA  . GLY B 135 ? 0.7012 0.7469 0.7277 0.1969  -0.1653 0.1090  130 GLY B CA  
3981 C C   . GLY B 135 ? 0.7122 0.7478 0.7525 0.1873  -0.1786 0.1382  130 GLY B C   
3982 O O   . GLY B 135 ? 0.7201 0.7634 0.7661 0.1942  -0.1876 0.1455  130 GLY B O   
3983 N N   . ALA B 136 ? 0.7103 0.7324 0.7571 0.1714  -0.1796 0.1571  131 ALA B N   
3984 C CA  . ALA B 136 ? 0.7258 0.7425 0.7905 0.1613  -0.1929 0.1910  131 ALA B CA  
3985 C C   . ALA B 136 ? 0.7642 0.7461 0.8594 0.1737  -0.2239 0.1958  131 ALA B C   
3986 O O   . ALA B 136 ? 0.7787 0.7628 0.8902 0.1715  -0.2371 0.2216  131 ALA B O   
3987 C CB  . ALA B 136 ? 0.7118 0.7251 0.7795 0.1430  -0.1873 0.2098  131 ALA B CB  
3988 N N   . GLU B 137 ? 0.7811 0.7327 0.8847 0.1882  -0.2367 0.1702  132 GLU B N   
3989 C CA  . GLU B 137 ? 0.8178 0.7324 0.9524 0.2036  -0.2701 0.1670  132 GLU B CA  
3990 C C   . GLU B 137 ? 0.8215 0.7496 0.9531 0.2217  -0.2756 0.1565  132 GLU B C   
3991 O O   . GLU B 137 ? 0.8473 0.7620 1.0034 0.2252  -0.2982 0.1742  132 GLU B O   
3992 C CB  . GLU B 137 ? 0.8386 0.7251 0.9774 0.2185  -0.2807 0.1350  132 GLU B CB  
3993 C CG  . GLU B 137 ? 0.9009 0.7384 1.0805 0.2278  -0.3203 0.1356  132 GLU B CG  
3994 C CD  . GLU B 137 ? 0.9355 0.7473 1.1192 0.2346  -0.3281 0.1110  132 GLU B CD  
3995 O OE1 . GLU B 137 ? 0.8968 0.7262 1.0556 0.2238  -0.3016 0.1060  132 GLU B OE1 
3996 O OE2 . GLU B 137 ? 0.9736 0.7473 1.1871 0.2517  -0.3626 0.0959  132 GLU B OE2 
3997 N N   . SER B 138 ? 0.7899 0.7470 0.8940 0.2323  -0.2555 0.1308  133 SER B N   
3998 C CA  . SER B 138 ? 0.7919 0.7654 0.8934 0.2510  -0.2603 0.1190  133 SER B CA  
3999 C C   . SER B 138 ? 0.7749 0.7759 0.8714 0.2393  -0.2518 0.1447  133 SER B C   
4000 O O   . SER B 138 ? 0.7966 0.8014 0.9009 0.2522  -0.2641 0.1451  133 SER B O   
4001 C CB  . SER B 138 ? 0.7777 0.7775 0.8571 0.2675  -0.2439 0.0861  133 SER B CB  
4002 O OG  . SER B 138 ? 0.7664 0.8073 0.8240 0.2564  -0.2170 0.0905  133 SER B OG  
4003 N N   . LEU B 139 ? 0.7432 0.7656 0.8261 0.2170  -0.2317 0.1645  134 LEU B N   
4004 C CA  . LEU B 139 ? 0.7268 0.7783 0.8052 0.2073  -0.2257 0.1895  134 LEU B CA  
4005 C C   . LEU B 139 ? 0.7531 0.7855 0.8606 0.2028  -0.2496 0.2231  134 LEU B C   
4006 O O   . LEU B 139 ? 0.7589 0.8039 0.8728 0.2077  -0.2578 0.2365  134 LEU B O   
4007 C CB  . LEU B 139 ? 0.6910 0.7758 0.7466 0.1887  -0.1997 0.1977  134 LEU B CB  
4008 C CG  . LEU B 139 ? 0.6640 0.7861 0.7122 0.1801  -0.1934 0.2222  134 LEU B CG  
4009 C CD1 . LEU B 139 ? 0.6329 0.7774 0.6746 0.1927  -0.1934 0.2118  134 LEU B CD1 
4010 C CD2 . LEU B 139 ? 0.5851 0.7378 0.6126 0.1650  -0.1717 0.2259  134 LEU B CD2 
4011 N N   . GLU B 140 ? 0.7662 0.7697 0.8941 0.1931  -0.2615 0.2382  135 GLU B N   
4012 C CA  . GLU B 140 ? 0.8003 0.7849 0.9641 0.1863  -0.2866 0.2753  135 GLU B CA  
4013 C C   . GLU B 140 ? 0.8353 0.7880 1.0269 0.2061  -0.3179 0.2669  135 GLU B C   
4014 O O   . GLU B 140 ? 0.8606 0.8065 1.0817 0.2032  -0.3388 0.2988  135 GLU B O   
4015 C CB  . GLU B 140 ? 0.8092 0.7691 0.9931 0.1714  -0.2941 0.2920  135 GLU B CB  
4016 C CG  . GLU B 140 ? 0.8416 0.8041 1.0588 0.1551  -0.3096 0.3443  135 GLU B CG  
4017 C CD  . GLU B 140 ? 0.8980 0.8078 1.1666 0.1584  -0.3491 0.3555  135 GLU B CD  
4018 O OE1 . GLU B 140 ? 0.9379 0.8371 1.2369 0.1639  -0.3740 0.3754  135 GLU B OE1 
4019 O OE2 . GLU B 140 ? 0.8882 0.7665 1.1689 0.1558  -0.3570 0.3437  135 GLU B OE2 
4020 N N   . ALA B 141 ? 0.8338 0.7714 1.0169 0.2274  -0.3213 0.2248  136 ALA B N   
4021 C CA  . ALA B 141 ? 0.8622 0.7769 1.0658 0.2517  -0.3492 0.2085  136 ALA B CA  
4022 C C   . ALA B 141 ? 0.8562 0.8053 1.0451 0.2589  -0.3405 0.2109  136 ALA B C   
4023 O O   . ALA B 141 ? 0.8868 0.8241 1.0999 0.2686  -0.3643 0.2224  136 ALA B O   
4024 C CB  . ALA B 141 ? 0.8662 0.7642 1.0624 0.2753  -0.3542 0.1619  136 ALA B CB  
4025 N N   . ALA B 142 ? 0.8197 0.8105 0.9719 0.2544  -0.3081 0.2000  137 ALA B N   
4026 C CA  . ALA B 142 ? 0.8124 0.8386 0.9490 0.2619  -0.2984 0.1972  137 ALA B CA  
4027 C C   . ALA B 142 ? 0.8200 0.8655 0.9641 0.2480  -0.3003 0.2374  137 ALA B C   
4028 O O   . ALA B 142 ? 0.8306 0.8856 0.9811 0.2582  -0.3102 0.2427  137 ALA B O   
4029 C CB  . ALA B 142 ? 0.7794 0.8426 0.8816 0.2594  -0.2668 0.1757  137 ALA B CB  
4030 N N   . LEU B 143 ? 0.8120 0.8668 0.9553 0.2262  -0.2909 0.2660  138 LEU B N   
4031 C CA  . LEU B 143 ? 0.8193 0.8990 0.9710 0.2133  -0.2929 0.3088  138 LEU B CA  
4032 C C   . LEU B 143 ? 0.8591 0.9108 1.0530 0.2174  -0.3264 0.3373  138 LEU B C   
4033 O O   . LEU B 143 ? 0.8637 0.9376 1.0627 0.2194  -0.3317 0.3591  138 LEU B O   
4034 C CB  . LEU B 143 ? 0.8026 0.8997 0.9475 0.1916  -0.2776 0.3328  138 LEU B CB  
4035 C CG  . LEU B 143 ? 0.7607 0.8981 0.8660 0.1849  -0.2454 0.3160  138 LEU B CG  
4036 C CD1 . LEU B 143 ? 0.7534 0.8957 0.8552 0.1674  -0.2341 0.3306  138 LEU B CD1 
4037 C CD2 . LEU B 143 ? 0.7506 0.9383 0.8381 0.1862  -0.2350 0.3263  138 LEU B CD2 
4038 N N   . THR B 144 ? 0.8908 0.8939 1.1171 0.2186  -0.3507 0.3376  139 THR B N   
4039 C CA  . THR B 144 ? 0.9445 0.9133 1.2203 0.2215  -0.3884 0.3653  139 THR B CA  
4040 C C   . THR B 144 ? 0.9693 0.9219 1.2540 0.2468  -0.4082 0.3411  139 THR B C   
4041 O O   . THR B 144 ? 1.0013 0.9526 1.3126 0.2492  -0.4288 0.3683  139 THR B O   
4042 C CB  . THR B 144 ? 0.9639 0.8806 1.2759 0.2181  -0.4133 0.3655  139 THR B CB  
4043 O OG1 . THR B 144 ? 0.9654 0.8604 1.2585 0.2345  -0.4091 0.3132  139 THR B OG1 
4044 C CG2 . THR B 144 ? 0.9540 0.8852 1.2696 0.1916  -0.4006 0.4009  139 THR B CG2 
4045 N N   . HIS B 145 ? 0.9686 0.9122 1.2320 0.2663  -0.4023 0.2913  140 HIS B N   
4046 C CA  . HIS B 145 ? 0.9915 0.9292 1.2571 0.2934  -0.4169 0.2632  140 HIS B CA  
4047 C C   . HIS B 145 ? 0.9878 0.9699 1.2358 0.2928  -0.4028 0.2783  140 HIS B C   
4048 O O   . HIS B 145 ? 1.0154 0.9898 1.2860 0.3043  -0.4254 0.2884  140 HIS B O   
4049 C CB  . HIS B 145 ? 0.9777 0.9154 1.2177 0.3138  -0.4060 0.2105  140 HIS B CB  
4050 C CG  . HIS B 145 ? 1.0033 0.9483 1.2404 0.3430  -0.4160 0.1816  140 HIS B CG  
4051 N ND1 . HIS B 145 ? 1.0623 0.9732 1.3356 0.3629  -0.4545 0.1783  140 HIS B ND1 
4052 C CD2 . HIS B 145 ? 0.9849 0.9698 1.1903 0.3554  -0.3937 0.1568  140 HIS B CD2 
4053 C CE1 . HIS B 145 ? 1.0655 0.9967 1.3260 0.3879  -0.4541 0.1510  140 HIS B CE1 
4054 N NE2 . HIS B 145 ? 1.0332 1.0107 1.2532 0.3831  -0.4170 0.1390  140 HIS B NE2 
4055 N N   . ASN B 146 ? 0.9582 0.9857 1.1683 0.2799  -0.3676 0.2791  141 ASN B N   
4056 C CA  . ASN B 146 ? 0.9509 1.0247 1.1418 0.2783  -0.3527 0.2912  141 ASN B CA  
4057 C C   . ASN B 146 ? 0.9783 1.0628 1.1916 0.2656  -0.3650 0.3419  141 ASN B C   
4058 O O   . ASN B 146 ? 0.9919 1.1034 1.2025 0.2709  -0.3660 0.3538  141 ASN B O   
4059 C CB  . ASN B 146 ? 0.9086 1.0241 1.0588 0.2673  -0.3163 0.2778  141 ASN B CB  
4060 C CG  . ASN B 146 ? 0.8893 1.0540 1.0206 0.2642  -0.3021 0.2901  141 ASN B CG  
4061 O OD1 . ASN B 146 ? 0.8865 1.0746 1.0192 0.2509  -0.2997 0.3251  141 ASN B OD1 
4062 N ND2 . ASN B 146 ? 0.8659 1.0513 0.9797 0.2771  -0.2925 0.2617  141 ASN B ND2 
4063 N N   . ALA B 147 ? 1.0003 1.0658 1.2385 0.2494  -0.3755 0.3735  142 ALA B N   
4064 C CA  . ALA B 147 ? 1.0359 1.1134 1.3029 0.2365  -0.3897 0.4287  142 ALA B CA  
4065 C C   . ALA B 147 ? 1.0908 1.1274 1.4068 0.2477  -0.4300 0.4433  142 ALA B C   
4066 O O   . ALA B 147 ? 1.1050 1.1610 1.4374 0.2470  -0.4407 0.4777  142 ALA B O   
4067 C CB  . ALA B 147 ? 1.0295 1.1089 1.3075 0.2141  -0.3850 0.4606  142 ALA B CB  
4068 N N   . GLU B 148 ? 1.1273 1.1079 1.4682 0.2590  -0.4542 0.4171  143 GLU B N   
4069 C CA  . GLU B 148 ? 1.1868 1.1199 1.5823 0.2695  -0.4989 0.4296  143 GLU B CA  
4070 C C   . GLU B 148 ? 1.2118 1.1380 1.6064 0.2973  -0.5131 0.3994  143 GLU B C   
4071 O O   . GLU B 148 ? 1.2537 1.1440 1.6939 0.3083  -0.5517 0.4096  143 GLU B O   
4072 C CB  . GLU B 148 ? 1.2075 1.0827 1.6361 0.2708  -0.5245 0.4152  143 GLU B CB  
4073 C CG  . GLU B 148 ? 1.2227 1.0924 1.6842 0.2428  -0.5313 0.4660  143 GLU B CG  
4074 C CD  . GLU B 148 ? 1.2484 1.0638 1.7387 0.2428  -0.5535 0.4483  143 GLU B CD  
4075 O OE1 . GLU B 148 ? 1.2127 1.0163 1.6725 0.2567  -0.5415 0.3962  143 GLU B OE1 
4076 O OE2 . GLU B 148 ? 1.2921 1.0790 1.8380 0.2285  -0.5838 0.4887  143 GLU B OE2 
4077 N N   . VAL B 149 ? 1.1938 1.1554 1.5399 0.3085  -0.4835 0.3640  144 VAL B N   
4078 C CA  . VAL B 149 ? 1.2124 1.1790 1.5530 0.3344  -0.4919 0.3368  144 VAL B CA  
4079 C C   . VAL B 149 ? 1.2382 1.2306 1.5916 0.3298  -0.4986 0.3775  144 VAL B C   
4080 O O   . VAL B 149 ? 1.2175 1.2598 1.5437 0.3139  -0.4710 0.4009  144 VAL B O   
4081 C CB  . VAL B 149 ? 1.1744 1.1792 1.4630 0.3443  -0.4569 0.2942  144 VAL B CB  
4082 C CG1 . VAL B 149 ? 1.1755 1.1984 1.4578 0.3673  -0.4618 0.2759  144 VAL B CG1 
4083 C CG2 . VAL B 149 ? 1.1668 1.1481 1.4455 0.3550  -0.4540 0.2513  144 VAL B CG2 
4084 N N   . PRO B 150 ? 1.2867 1.2466 1.6824 0.3451  -0.5370 0.3853  145 PRO B N   
4085 C CA  . PRO B 150 ? 1.3072 1.2920 1.7165 0.3432  -0.5451 0.4233  145 PRO B CA  
4086 C C   . PRO B 150 ? 1.2937 1.3238 1.6607 0.3573  -0.5212 0.3973  145 PRO B C   
4087 O O   . PRO B 150 ? 1.2752 1.3075 1.6144 0.3739  -0.5082 0.3482  145 PRO B O   
4088 C CB  . PRO B 150 ? 1.3566 1.2859 1.8244 0.3597  -0.5956 0.4276  145 PRO B CB  
4089 C CG  . PRO B 150 ? 1.3652 1.2414 1.8560 0.3629  -0.6152 0.4045  145 PRO B CG  
4090 C CD  . PRO B 150 ? 1.3224 1.2207 1.7586 0.3656  -0.5776 0.3601  145 PRO B CD  
4091 N N   . ARG B 151 ? 1.3047 1.3745 1.6687 0.3508  -0.5158 0.4321  146 ARG B N   
4092 C CA  . ARG B 151 ? 1.2977 1.4118 1.6259 0.3630  -0.4956 0.4110  146 ARG B CA  
4093 C C   . ARG B 151 ? 1.3339 1.4279 1.6864 0.3889  -0.5249 0.3982  146 ARG B C   
4094 O O   . ARG B 151 ? 1.3225 1.4349 1.6502 0.4077  -0.5144 0.3603  146 ARG B O   
4095 C CB  . ARG B 151 ? 1.2829 1.4561 1.5914 0.3458  -0.4743 0.4504  146 ARG B CB  
4096 C CG  . ARG B 151 ? 1.2481 1.4736 1.5041 0.3455  -0.4369 0.4224  146 ARG B CG  
4097 C CD  . ARG B 151 ? 1.2397 1.4587 1.4789 0.3674  -0.4327 0.3688  146 ARG B CD  
4098 N NE  . ARG B 151 ? 1.2109 1.4823 1.4098 0.3659  -0.4023 0.3501  146 ARG B NE  
4099 C CZ  . ARG B 151 ? 1.2059 1.5082 1.3963 0.3783  -0.4012 0.3431  146 ARG B CZ  
4100 N NH1 . ARG B 151 ? 1.2325 1.5192 1.4492 0.3942  -0.4274 0.3524  146 ARG B NH1 
4101 N NH2 . ARG B 151 ? 1.1757 1.5235 1.3338 0.3750  -0.3757 0.3260  146 ARG B NH2 
4102 N N   . ARG B 152 ? 1.3847 1.4416 1.7887 0.3899  -0.5628 0.4302  147 ARG B N   
4103 C CA  . ARG B 152 ? 1.4292 1.4700 1.8634 0.4119  -0.5947 0.4306  147 ARG B CA  
4104 C C   . ARG B 152 ? 1.4363 1.4644 1.8583 0.4453  -0.6011 0.3703  147 ARG B C   
4105 O O   . ARG B 152 ? 1.4571 1.4903 1.8889 0.4650  -0.6167 0.3649  147 ARG B O   
4106 C CB  . ARG B 152 ? 1.4784 1.4686 1.9792 0.4077  -0.6403 0.4703  147 ARG B CB  
4107 C CG  . ARG B 152 ? 1.5147 1.4367 2.0517 0.4271  -0.6769 0.4346  147 ARG B CG  
4108 C CD  . ARG B 152 ? 1.5218 1.4153 2.0690 0.4089  -0.6762 0.4389  147 ARG B CD  
4109 N NE  . ARG B 152 ? 1.5422 1.3897 2.0950 0.4325  -0.6940 0.3824  147 ARG B NE  
4110 C CZ  . ARG B 152 ? 1.5914 1.3810 2.1955 0.4540  -0.7432 0.3667  147 ARG B CZ  
4111 N NH1 . ARG B 152 ? 1.6009 1.3586 2.2026 0.4780  -0.7558 0.3113  147 ARG B NH1 
4112 N NH2 . ARG B 152 ? 1.6351 1.4004 2.2943 0.4532  -0.7816 0.4055  147 ARG B NH2 
4113 N N   . ARG B 153 ? 1.4239 1.4386 1.8264 0.4523  -0.5898 0.3275  148 ARG B N   
4114 C CA  . ARG B 153 ? 1.4182 1.4430 1.7957 0.4813  -0.5826 0.2708  148 ARG B CA  
4115 C C   . ARG B 153 ? 1.3855 1.4197 1.7293 0.4736  -0.5529 0.2432  148 ARG B C   
4116 O O   . ARG B 153 ? 1.4003 1.3947 1.7606 0.4717  -0.5660 0.2354  148 ARG B O   
4117 C CB  . ARG B 153 ? 1.4638 1.4412 1.8794 0.5151  -0.6269 0.2420  148 ARG B CB  
4118 C CG  . ARG B 153 ? 1.4961 1.4085 1.9586 0.5135  -0.6642 0.2481  148 ARG B CG  
4119 C CD  . ARG B 153 ? 1.5344 1.4035 2.0324 0.5524  -0.7097 0.2099  148 ARG B CD  
4120 N NE  . ARG B 153 ? 1.5433 1.4112 2.0676 0.5665  -0.7352 0.2247  148 ARG B NE  
4121 C CZ  . ARG B 153 ? 1.5843 1.4241 2.1368 0.6036  -0.7741 0.1916  148 ARG B CZ  
4122 N NH1 . ARG B 153 ? 1.5943 1.4075 2.1511 0.6324  -0.7925 0.1397  148 ARG B NH1 
4123 N NH2 . ARG B 153 ? 1.5991 1.4399 2.1750 0.6140  -0.7954 0.2089  148 ARG B NH2 
4124 N N   . ALA B 154 ? 1.3463 1.4324 1.6458 0.4679  -0.5143 0.2302  149 ALA B N   
4125 C CA  . ALA B 154 ? 1.3141 1.4119 1.5838 0.4556  -0.4848 0.2121  149 ALA B CA  
4126 C C   . ALA B 154 ? 1.2788 1.4268 1.5090 0.4619  -0.4518 0.1816  149 ALA B C   
4127 O O   . ALA B 154 ? 1.2599 1.4502 1.4726 0.4558  -0.4345 0.1915  149 ALA B O   
4128 C CB  . ALA B 154 ? 1.2989 1.4006 1.5643 0.4211  -0.4694 0.2517  149 ALA B CB  
4129 N N   . GLN B 155 ? 1.2713 1.4152 1.4910 0.4746  -0.4453 0.1457  150 GLN B N   
4130 C CA  . GLN B 155 ? 1.2323 1.4206 1.4180 0.4712  -0.4108 0.1244  150 GLN B CA  
4131 C C   . GLN B 155 ? 1.2204 1.3885 1.3998 0.4628  -0.4022 0.1125  150 GLN B C   
4132 O O   . GLN B 155 ? 1.1873 1.3836 1.3422 0.4487  -0.3726 0.1069  150 GLN B O   
4133 C CB  . GLN B 155 ? 1.2346 1.4540 1.4139 0.5021  -0.4106 0.0907  150 GLN B CB  
4134 C CG  . GLN B 155 ? 1.1960 1.4631 1.3474 0.4978  -0.3768 0.0728  150 GLN B CG  
4135 C CD  . GLN B 155 ? 1.1981 1.5116 1.3440 0.5230  -0.3723 0.0509  150 GLN B CD  
4136 O OE1 . GLN B 155 ? 1.2110 1.5379 1.3639 0.5318  -0.3817 0.0578  150 GLN B OE1 
4137 N NE2 . GLN B 155 ? 1.1770 1.5199 1.3113 0.5347  -0.3572 0.0264  150 GLN B NE2 
4138 N N   . GLU B 156 ? 1.2485 1.3665 1.4532 0.4718  -0.4304 0.1088  151 GLU B N   
4139 C CA  . GLU B 156 ? 1.2390 1.3324 1.4416 0.4612  -0.4258 0.1026  151 GLU B CA  
4140 C C   . GLU B 156 ? 1.2148 1.3146 1.4064 0.4238  -0.4039 0.1377  151 GLU B C   
4141 O O   . GLU B 156 ? 1.1980 1.2941 1.3773 0.4097  -0.3879 0.1342  151 GLU B O   
4142 C CB  . GLU B 156 ? 1.2789 1.3143 1.5169 0.4767  -0.4651 0.0946  151 GLU B CB  
4143 C CG  . GLU B 156 ? 1.3047 1.3021 1.5793 0.4632  -0.4931 0.1338  151 GLU B CG  
4144 C CD  . GLU B 156 ? 1.3410 1.2777 1.6559 0.4741  -0.5332 0.1268  151 GLU B CD  
4145 O OE1 . GLU B 156 ? 1.3238 1.2402 1.6387 0.4625  -0.5295 0.1240  151 GLU B OE1 
4146 O OE2 . GLU B 156 ? 1.3909 1.2987 1.7401 0.4945  -0.5705 0.1238  151 GLU B OE2 
4147 N N   . ALA B 157 ? 1.2152 1.3288 1.4108 0.4104  -0.4039 0.1706  152 ALA B N   
4148 C CA  . ALA B 157 ? 1.1907 1.3262 1.3714 0.3798  -0.3816 0.2022  152 ALA B CA  
4149 C C   . ALA B 157 ? 1.1492 1.3312 1.2944 0.3722  -0.3466 0.1854  152 ALA B C   
4150 O O   . ALA B 157 ? 1.1242 1.3126 1.2539 0.3531  -0.3267 0.1886  152 ALA B O   
4151 C CB  . ALA B 157 ? 1.2024 1.3499 1.3957 0.3731  -0.3919 0.2389  152 ALA B CB  
4152 N N   . GLU B 158 ? 1.1405 1.3546 1.2764 0.3872  -0.3411 0.1686  153 GLU B N   
4153 C CA  . GLU B 158 ? 1.1047 1.3622 1.2153 0.3827  -0.3127 0.1512  153 GLU B CA  
4154 C C   . GLU B 158 ? 1.0827 1.3321 1.1844 0.3810  -0.2999 0.1298  153 GLU B C   
4155 O O   . GLU B 158 ? 1.0566 1.3245 1.1418 0.3623  -0.2771 0.1304  153 GLU B O   
4156 C CB  . GLU B 158 ? 1.1121 1.3989 1.2228 0.4050  -0.3152 0.1332  153 GLU B CB  
4157 C CG  . GLU B 158 ? 1.0942 1.4321 1.1872 0.3971  -0.2906 0.1266  153 GLU B CG  
4158 C CD  . GLU B 158 ? 1.1233 1.4909 1.2208 0.4140  -0.2971 0.1225  153 GLU B CD  
4159 O OE1 . GLU B 158 ? 1.1403 1.5084 1.2465 0.4398  -0.3083 0.1033  153 GLU B OE1 
4160 O OE2 . GLU B 158 ? 1.1261 1.5188 1.2182 0.4031  -0.2917 0.1376  153 GLU B OE2 
4161 N N   . GLU B 159 ? 1.0946 1.3164 1.2086 0.4017  -0.3168 0.1101  154 GLU B N   
4162 C CA  . GLU B 159 ? 1.0702 1.2859 1.1766 0.4046  -0.3073 0.0884  154 GLU B CA  
4163 C C   . GLU B 159 ? 1.0625 1.2425 1.1717 0.3841  -0.3075 0.1022  154 GLU B C   
4164 O O   . GLU B 159 ? 1.0449 1.2238 1.1442 0.3801  -0.2946 0.0886  154 GLU B O   
4165 C CB  . GLU B 159 ? 1.0928 1.3000 1.2094 0.4389  -0.3260 0.0581  154 GLU B CB  
4166 C CG  . GLU B 159 ? 1.0920 1.3455 1.2029 0.4603  -0.3206 0.0420  154 GLU B CG  
4167 C CD  . GLU B 159 ? 1.1191 1.3721 1.2382 0.4984  -0.3394 0.0101  154 GLU B CD  
4168 O OE1 . GLU B 159 ? 1.1480 1.3858 1.2837 0.5194  -0.3654 0.0057  154 GLU B OE1 
4169 O OE2 . GLU B 159 ? 1.1114 1.3816 1.2209 0.5090  -0.3290 -0.0108 154 GLU B OE2 
4170 N N   . ALA B 160 ? 1.0687 1.2232 1.1928 0.3715  -0.3221 0.1313  155 ALA B N   
4171 C CA  . ALA B 160 ? 1.0577 1.1867 1.1857 0.3489  -0.3206 0.1514  155 ALA B CA  
4172 C C   . ALA B 160 ? 1.0176 1.1804 1.1215 0.3240  -0.2909 0.1644  155 ALA B C   
4173 O O   . ALA B 160 ? 1.0034 1.1597 1.0988 0.3093  -0.2782 0.1645  155 ALA B O   
4174 C CB  . ALA B 160 ? 1.0846 1.1815 1.2416 0.3440  -0.3472 0.1828  155 ALA B CB  
4175 N N   . GLY B 161 ? 1.0032 1.2023 1.0972 0.3210  -0.2819 0.1733  156 GLY B N   
4176 C CA  . GLY B 161 ? 0.9666 1.2013 1.0394 0.3016  -0.2578 0.1811  156 GLY B CA  
4177 C C   . GLY B 161 ? 0.9311 1.1835 0.9880 0.2994  -0.2366 0.1551  156 GLY B C   
4178 O O   . GLY B 161 ? 0.9114 1.1699 0.9565 0.2821  -0.2208 0.1573  156 GLY B O   
4179 N N   . ALA B 162 ? 0.9233 1.1869 0.9817 0.3177  -0.2371 0.1320  157 ALA B N   
4180 C CA  . ALA B 162 ? 0.8930 1.1766 0.9419 0.3173  -0.2188 0.1109  157 ALA B CA  
4181 C C   . ALA B 162 ? 0.8863 1.1409 0.9347 0.3144  -0.2170 0.1031  157 ALA B C   
4182 O O   . ALA B 162 ? 0.8614 1.1276 0.9003 0.3022  -0.1991 0.0971  157 ALA B O   
4183 C CB  . ALA B 162 ? 0.8952 1.2037 0.9484 0.3396  -0.2207 0.0922  157 ALA B CB  
4184 N N   . ALA B 163 ? 0.9038 1.1199 0.9651 0.3256  -0.2375 0.1032  158 ALA B N   
4185 C CA  . ALA B 163 ? 0.8983 1.0838 0.9615 0.3234  -0.2394 0.0962  158 ALA B CA  
4186 C C   . ALA B 163 ? 0.8847 1.0593 0.9423 0.2962  -0.2294 0.1170  158 ALA B C   
4187 O O   . ALA B 163 ? 0.8687 1.0386 0.9185 0.2871  -0.2170 0.1097  158 ALA B O   
4188 C CB  . ALA B 163 ? 0.9312 1.0766 1.0148 0.3429  -0.2686 0.0902  158 ALA B CB  
4189 N N   . LEU B 164 ? 0.8867 1.0616 0.9485 0.2847  -0.2350 0.1434  159 LEU B N   
4190 C CA  . LEU B 164 ? 0.8735 1.0497 0.9292 0.2614  -0.2255 0.1659  159 LEU B CA  
4191 C C   . LEU B 164 ? 0.8394 1.0496 0.8741 0.2496  -0.2003 0.1559  159 LEU B C   
4192 O O   . LEU B 164 ? 0.8280 1.0353 0.8548 0.2350  -0.1888 0.1581  159 LEU B O   
4193 C CB  . LEU B 164 ? 0.8952 1.0798 0.9587 0.2558  -0.2356 0.1969  159 LEU B CB  
4194 C CG  . LEU B 164 ? 0.8979 1.1049 0.9515 0.2356  -0.2244 0.2231  159 LEU B CG  
4195 C CD1 . LEU B 164 ? 0.9195 1.1247 0.9910 0.2332  -0.2417 0.2598  159 LEU B CD1 
4196 C CD2 . LEU B 164 ? 0.8898 1.1425 0.9209 0.2308  -0.2049 0.2139  159 LEU B CD2 
4197 N N   . ARG B 165 ? 0.8280 1.0699 0.8568 0.2561  -0.1938 0.1450  160 ARG B N   
4198 C CA  . ARG B 165 ? 0.7994 1.0732 0.8158 0.2463  -0.1744 0.1340  160 ARG B CA  
4199 C C   . ARG B 165 ? 0.7787 1.0445 0.7923 0.2429  -0.1626 0.1174  160 ARG B C   
4200 O O   . ARG B 165 ? 0.7600 1.0326 0.7658 0.2275  -0.1498 0.1169  160 ARG B O   
4201 C CB  . ARG B 165 ? 0.8001 1.1057 0.8184 0.2566  -0.1738 0.1246  160 ARG B CB  
4202 C CG  . ARG B 165 ? 0.7903 1.1313 0.8019 0.2448  -0.1613 0.1208  160 ARG B CG  
4203 C CD  . ARG B 165 ? 0.8203 1.1813 0.8279 0.2435  -0.1676 0.1348  160 ARG B CD  
4204 N NE  . ARG B 165 ? 0.8430 1.2259 0.8569 0.2561  -0.1745 0.1319  160 ARG B NE  
4205 C CZ  . ARG B 165 ? 0.8512 1.2430 0.8744 0.2682  -0.1747 0.1183  160 ARG B CZ  
4206 N NH1 . ARG B 165 ? 0.8544 1.2685 0.8829 0.2788  -0.1814 0.1182  160 ARG B NH1 
4207 N NH2 . ARG B 165 ? 0.8500 1.2336 0.8770 0.2709  -0.1681 0.1059  160 ARG B NH2 
4208 N N   . THR B 166 ? 0.7792 1.0329 0.7995 0.2589  -0.1680 0.1034  161 THR B N   
4209 C CA  . THR B 166 ? 0.7595 1.0121 0.7771 0.2579  -0.1568 0.0890  161 THR B CA  
4210 C C   . THR B 166 ? 0.7494 0.9683 0.7647 0.2472  -0.1575 0.0945  161 THR B C   
4211 O O   . THR B 166 ? 0.7278 0.9493 0.7373 0.2366  -0.1440 0.0892  161 THR B O   
4212 C CB  . THR B 166 ? 0.7717 1.0327 0.7951 0.2818  -0.1613 0.0709  161 THR B CB  
4213 O OG1 . THR B 166 ? 0.8118 1.0372 0.8417 0.2970  -0.1802 0.0664  161 THR B OG1 
4214 C CG2 . THR B 166 ? 0.7645 1.0592 0.7924 0.2938  -0.1632 0.0685  161 THR B CG2 
4215 N N   . ALA B 167 ? 0.7578 0.9463 0.7806 0.2490  -0.1742 0.1072  162 ALA B N   
4216 C CA  . ALA B 167 ? 0.7486 0.9069 0.7732 0.2372  -0.1764 0.1163  162 ALA B CA  
4217 C C   . ALA B 167 ? 0.7241 0.8971 0.7380 0.2150  -0.1623 0.1319  162 ALA B C   
4218 O O   . ALA B 167 ? 0.7142 0.8774 0.7234 0.2037  -0.1540 0.1318  162 ALA B O   
4219 C CB  . ALA B 167 ? 0.7813 0.9044 0.8242 0.2438  -0.2007 0.1292  162 ALA B CB  
4220 N N   . ARG B 168 ? 0.7130 0.9125 0.7223 0.2109  -0.1602 0.1430  163 ARG B N   
4221 C CA  . ARG B 168 ? 0.6924 0.9142 0.6898 0.1945  -0.1480 0.1528  163 ARG B CA  
4222 C C   . ARG B 168 ? 0.6602 0.9001 0.6483 0.1878  -0.1311 0.1333  163 ARG B C   
4223 O O   . ARG B 168 ? 0.6422 0.8821 0.6234 0.1756  -0.1219 0.1336  163 ARG B O   
4224 C CB  . ARG B 168 ? 0.6962 0.9461 0.6909 0.1953  -0.1523 0.1679  163 ARG B CB  
4225 C CG  . ARG B 168 ? 0.6774 0.9608 0.6575 0.1841  -0.1407 0.1704  163 ARG B CG  
4226 C CD  . ARG B 168 ? 0.6602 0.9384 0.6365 0.1727  -0.1378 0.1880  163 ARG B CD  
4227 N NE  . ARG B 168 ? 0.6821 0.9531 0.6696 0.1738  -0.1513 0.2185  163 ARG B NE  
4228 C CZ  . ARG B 168 ? 0.6765 0.9423 0.6685 0.1646  -0.1531 0.2425  163 ARG B CZ  
4229 N NH1 . ARG B 168 ? 0.6581 0.9250 0.6410 0.1548  -0.1413 0.2369  163 ARG B NH1 
4230 N NH2 . ARG B 168 ? 0.6851 0.9464 0.6938 0.1649  -0.1676 0.2740  163 ARG B NH2 
4231 N N   . ALA B 169 ? 0.6517 0.9086 0.6430 0.1959  -0.1283 0.1182  164 ALA B N   
4232 C CA  . ALA B 169 ? 0.6258 0.9006 0.6165 0.1893  -0.1154 0.1032  164 ALA B CA  
4233 C C   . ALA B 169 ? 0.6141 0.8681 0.6046 0.1852  -0.1084 0.0967  164 ALA B C   
4234 O O   . ALA B 169 ? 0.5977 0.8569 0.5856 0.1731  -0.0983 0.0920  164 ALA B O   
4235 C CB  . ALA B 169 ? 0.6163 0.9144 0.6163 0.2000  -0.1156 0.0932  164 ALA B CB  
4236 N N   . GLY B 170 ? 0.6223 0.8519 0.6164 0.1966  -0.1160 0.0954  165 GLY B N   
4237 C CA  . GLY B 170 ? 0.5998 0.8110 0.5939 0.1967  -0.1115 0.0873  165 GLY B CA  
4238 C C   . GLY B 170 ? 0.5988 0.7886 0.5875 0.1821  -0.1096 0.0970  165 GLY B C   
4239 O O   . GLY B 170 ? 0.5704 0.7583 0.5555 0.1729  -0.0989 0.0915  165 GLY B O   
4240 N N   . TYR B 171 ? 0.6097 0.7862 0.5999 0.1802  -0.1204 0.1138  166 TYR B N   
4241 C CA  . TYR B 171 ? 0.6047 0.7667 0.5926 0.1670  -0.1200 0.1286  166 TYR B CA  
4242 C C   . TYR B 171 ? 0.5840 0.7715 0.5603 0.1534  -0.1060 0.1288  166 TYR B C   
4243 O O   . TYR B 171 ? 0.5853 0.7661 0.5571 0.1432  -0.0991 0.1302  166 TYR B O   
4244 C CB  . TYR B 171 ? 0.6287 0.7814 0.6253 0.1675  -0.1352 0.1524  166 TYR B CB  
4245 C CG  . TYR B 171 ? 0.6338 0.7843 0.6298 0.1529  -0.1336 0.1738  166 TYR B CG  
4246 C CD1 . TYR B 171 ? 0.6130 0.7314 0.6204 0.1490  -0.1411 0.1808  166 TYR B CD1 
4247 C CD2 . TYR B 171 ? 0.6212 0.8059 0.6060 0.1444  -0.1253 0.1864  166 TYR B CD2 
4248 C CE1 . TYR B 171 ? 0.6419 0.7629 0.6512 0.1354  -0.1393 0.2031  166 TYR B CE1 
4249 C CE2 . TYR B 171 ? 0.6387 0.8300 0.6226 0.1332  -0.1229 0.2071  166 TYR B CE2 
4250 C CZ  . TYR B 171 ? 0.6264 0.7860 0.6233 0.1277  -0.1294 0.2173  166 TYR B CZ  
4251 O OH  . TYR B 171 ? 0.5942 0.7646 0.5925 0.1162  -0.1268 0.2407  166 TYR B OH  
4252 N N   . ARG B 172 ? 0.5792 0.7962 0.5517 0.1546  -0.1035 0.1255  167 ARG B N   
4253 C CA  . ARG B 172 ? 0.5735 0.8160 0.5372 0.1450  -0.0942 0.1210  167 ARG B CA  
4254 C C   . ARG B 172 ? 0.5461 0.7856 0.5112 0.1387  -0.0838 0.1039  167 ARG B C   
4255 O O   . ARG B 172 ? 0.5368 0.7794 0.4960 0.1294  -0.0777 0.1020  167 ARG B O   
4256 C CB  . ARG B 172 ? 0.5857 0.8596 0.5482 0.1496  -0.0972 0.1180  167 ARG B CB  
4257 C CG  . ARG B 172 ? 0.6159 0.9187 0.5682 0.1442  -0.0944 0.1175  167 ARG B CG  
4258 C CD  . ARG B 172 ? 0.6926 1.0265 0.6460 0.1502  -0.0992 0.1092  167 ARG B CD  
4259 N NE  . ARG B 172 ? 0.7464 1.0854 0.7011 0.1595  -0.1079 0.1233  167 ARG B NE  
4260 C CZ  . ARG B 172 ? 0.7841 1.1439 0.7306 0.1629  -0.1131 0.1405  167 ARG B CZ  
4261 N NH1 . ARG B 172 ? 0.8031 1.1858 0.7376 0.1596  -0.1099 0.1457  167 ARG B NH1 
4262 N NH2 . ARG B 172 ? 0.7939 1.1555 0.7451 0.1711  -0.1218 0.1536  167 ARG B NH2 
4263 N N   . GLY B 173 ? 0.5317 0.7686 0.5059 0.1447  -0.0823 0.0930  168 GLY B N   
4264 C CA  . GLY B 173 ? 0.5143 0.7505 0.4939 0.1392  -0.0730 0.0814  168 GLY B CA  
4265 C C   . GLY B 173 ? 0.5085 0.7191 0.4835 0.1343  -0.0689 0.0829  168 GLY B C   
4266 O O   . GLY B 173 ? 0.4930 0.7039 0.4669 0.1241  -0.0615 0.0784  168 GLY B O   
4267 N N   . ARG B 174 ? 0.5227 0.7102 0.4970 0.1420  -0.0758 0.0887  169 ARG B N   
4268 C CA  . ARG B 174 ? 0.5275 0.6887 0.4995 0.1379  -0.0752 0.0912  169 ARG B CA  
4269 C C   . ARG B 174 ? 0.5187 0.6784 0.4837 0.1249  -0.0729 0.1029  169 ARG B C   
4270 O O   . ARG B 174 ? 0.5117 0.6589 0.4744 0.1176  -0.0677 0.1023  169 ARG B O   
4271 C CB  . ARG B 174 ? 0.5591 0.6941 0.5370 0.1498  -0.0889 0.0950  169 ARG B CB  
4272 C CG  . ARG B 174 ? 0.6087 0.7489 0.5927 0.1681  -0.0963 0.0853  169 ARG B CG  
4273 C CD  . ARG B 174 ? 0.6576 0.8060 0.6425 0.1774  -0.0893 0.0690  169 ARG B CD  
4274 N NE  . ARG B 174 ? 0.7066 0.8645 0.6967 0.1986  -0.0980 0.0601  169 ARG B NE  
4275 C CZ  . ARG B 174 ? 0.7619 0.8993 0.7561 0.2163  -0.1128 0.0519  169 ARG B CZ  
4276 N NH1 . ARG B 174 ? 0.7879 0.8917 0.7843 0.2137  -0.1212 0.0528  169 ARG B NH1 
4277 N NH2 . ARG B 174 ? 0.7794 0.9311 0.7776 0.2379  -0.1208 0.0416  169 ARG B NH2 
4278 N N   . ALA B 175 ? 0.5179 0.6942 0.4792 0.1235  -0.0769 0.1146  170 ALA B N   
4279 C CA  . ALA B 175 ? 0.5206 0.7047 0.4747 0.1139  -0.0742 0.1273  170 ALA B CA  
4280 C C   . ALA B 175 ? 0.5033 0.7062 0.4505 0.1071  -0.0636 0.1126  170 ALA B C   
4281 O O   . ALA B 175 ? 0.4963 0.6960 0.4389 0.0997  -0.0580 0.1133  170 ALA B O   
4282 C CB  . ALA B 175 ? 0.5239 0.7277 0.4762 0.1162  -0.0817 0.1470  170 ALA B CB  
4283 N N   . LEU B 176 ? 0.5047 0.7254 0.4546 0.1101  -0.0628 0.0986  171 LEU B N   
4284 C CA  . LEU B 176 ? 0.5043 0.7389 0.4555 0.1044  -0.0573 0.0822  171 LEU B CA  
4285 C C   . LEU B 176 ? 0.4927 0.7081 0.4501 0.0983  -0.0501 0.0740  171 LEU B C   
4286 O O   . LEU B 176 ? 0.4979 0.7147 0.4529 0.0915  -0.0459 0.0679  171 LEU B O   
4287 C CB  . LEU B 176 ? 0.4979 0.7536 0.4580 0.1083  -0.0615 0.0713  171 LEU B CB  
4288 C CG  . LEU B 176 ? 0.5205 0.8015 0.4720 0.1142  -0.0684 0.0767  171 LEU B CG  
4289 C CD1 . LEU B 176 ? 0.5340 0.8321 0.4959 0.1195  -0.0744 0.0685  171 LEU B CD1 
4290 C CD2 . LEU B 176 ? 0.5190 0.8217 0.4596 0.1125  -0.0682 0.0715  171 LEU B CD2 
4291 N N   . ASP B 177 ? 0.4994 0.7001 0.4644 0.1026  -0.0492 0.0737  172 ASP B N   
4292 C CA  . ASP B 177 ? 0.4853 0.6726 0.4560 0.0989  -0.0422 0.0677  172 ASP B CA  
4293 C C   . ASP B 177 ? 0.4874 0.6545 0.4491 0.0935  -0.0395 0.0729  172 ASP B C   
4294 O O   . ASP B 177 ? 0.4685 0.6323 0.4308 0.0858  -0.0332 0.0673  172 ASP B O   
4295 C CB  . ASP B 177 ? 0.4881 0.6704 0.4655 0.1093  -0.0427 0.0668  172 ASP B CB  
4296 C CG  . ASP B 177 ? 0.5081 0.7158 0.4980 0.1141  -0.0435 0.0632  172 ASP B CG  
4297 O OD1 . ASP B 177 ? 0.5115 0.7364 0.5100 0.1064  -0.0435 0.0595  172 ASP B OD1 
4298 O OD2 . ASP B 177 ? 0.5391 0.7511 0.5321 0.1266  -0.0459 0.0635  172 ASP B OD2 
4299 N N   . TYR B 178 ? 0.4986 0.6528 0.4549 0.0971  -0.0457 0.0851  173 TYR B N   
4300 C CA  . TYR B 178 ? 0.4991 0.6356 0.4511 0.0914  -0.0453 0.0942  173 TYR B CA  
4301 C C   . TYR B 178 ? 0.4981 0.6521 0.4420 0.0828  -0.0403 0.0965  173 TYR B C   
4302 O O   . TYR B 178 ? 0.4966 0.6428 0.4382 0.0763  -0.0349 0.0953  173 TYR B O   
4303 C CB  . TYR B 178 ? 0.5171 0.6382 0.4727 0.0963  -0.0569 0.1104  173 TYR B CB  
4304 C CG  . TYR B 178 ? 0.5066 0.6047 0.4656 0.0910  -0.0601 0.1209  173 TYR B CG  
4305 C CD1 . TYR B 178 ? 0.5268 0.6171 0.4935 0.0897  -0.0713 0.1426  173 TYR B CD1 
4306 C CD2 . TYR B 178 ? 0.4968 0.5822 0.4543 0.0863  -0.0528 0.1113  173 TYR B CD2 
4307 C CE1 . TYR B 178 ? 0.5195 0.5893 0.4948 0.0833  -0.0764 0.1548  173 TYR B CE1 
4308 C CE2 . TYR B 178 ? 0.4778 0.5422 0.4401 0.0811  -0.0568 0.1210  173 TYR B CE2 
4309 C CZ  . TYR B 178 ? 0.5224 0.5788 0.4947 0.0793  -0.0691 0.1429  173 TYR B CZ  
4310 O OH  . TYR B 178 ? 0.5159 0.5524 0.4988 0.0729  -0.0756 0.1554  173 TYR B OH  
4311 N N   . ALA B 179 ? 0.5091 0.6899 0.4483 0.0848  -0.0427 0.0986  174 ALA B N   
4312 C CA  . ALA B 179 ? 0.5067 0.7123 0.4369 0.0813  -0.0393 0.0959  174 ALA B CA  
4313 C C   . ALA B 179 ? 0.4890 0.6940 0.4232 0.0770  -0.0341 0.0752  174 ALA B C   
4314 O O   . ALA B 179 ? 0.4851 0.6923 0.4143 0.0728  -0.0300 0.0724  174 ALA B O   
4315 C CB  . ALA B 179 ? 0.5154 0.7544 0.4398 0.0878  -0.0444 0.0977  174 ALA B CB  
4316 N N   . LEU B 180 ? 0.4795 0.6830 0.4252 0.0781  -0.0354 0.0628  175 LEU B N   
4317 C CA  . LEU B 180 ? 0.4789 0.6801 0.4360 0.0726  -0.0328 0.0473  175 LEU B CA  
4318 C C   . LEU B 180 ? 0.4744 0.6521 0.4318 0.0668  -0.0253 0.0496  175 LEU B C   
4319 O O   . LEU B 180 ? 0.4716 0.6488 0.4302 0.0616  -0.0229 0.0416  175 LEU B O   
4320 C CB  . LEU B 180 ? 0.4721 0.6785 0.4473 0.0737  -0.0360 0.0409  175 LEU B CB  
4321 C CG  . LEU B 180 ? 0.4837 0.6948 0.4805 0.0673  -0.0382 0.0282  175 LEU B CG  
4322 C CD1 . LEU B 180 ? 0.4958 0.6940 0.5054 0.0629  -0.0313 0.0331  175 LEU B CD1 
4323 C CD2 . LEU B 180 ? 0.5059 0.7214 0.5008 0.0643  -0.0417 0.0151  175 LEU B CD2 
4324 N N   . GLN B 181 ? 0.4718 0.6305 0.4283 0.0691  -0.0233 0.0590  176 GLN B N   
4325 C CA  . GLN B 181 ? 0.4629 0.6005 0.4189 0.0654  -0.0178 0.0603  176 GLN B CA  
4326 C C   . GLN B 181 ? 0.4654 0.5995 0.4108 0.0601  -0.0158 0.0661  176 GLN B C   
4327 O O   . GLN B 181 ? 0.4361 0.5622 0.3820 0.0546  -0.0107 0.0615  176 GLN B O   
4328 C CB  . GLN B 181 ? 0.4659 0.5863 0.4234 0.0727  -0.0196 0.0655  176 GLN B CB  
4329 C CG  . GLN B 181 ? 0.4606 0.5910 0.4291 0.0792  -0.0186 0.0595  176 GLN B CG  
4330 C CD  . GLN B 181 ? 0.4938 0.6323 0.4738 0.0725  -0.0117 0.0534  176 GLN B CD  
4331 O OE1 . GLN B 181 ? 0.5134 0.6705 0.5077 0.0715  -0.0119 0.0514  176 GLN B OE1 
4332 N NE2 . GLN B 181 ? 0.4710 0.5959 0.4480 0.0671  -0.0068 0.0524  176 GLN B NE2 
4333 N N   . ILE B 182 ? 0.4831 0.6280 0.4205 0.0621  -0.0200 0.0779  177 ILE B N   
4334 C CA  . ILE B 182 ? 0.5053 0.6576 0.4343 0.0580  -0.0182 0.0882  177 ILE B CA  
4335 C C   . ILE B 182 ? 0.5196 0.6937 0.4438 0.0566  -0.0146 0.0741  177 ILE B C   
4336 O O   . ILE B 182 ? 0.5087 0.6798 0.4299 0.0522  -0.0099 0.0735  177 ILE B O   
4337 C CB  . ILE B 182 ? 0.5202 0.6874 0.4454 0.0609  -0.0240 0.1091  177 ILE B CB  
4338 C CG1 . ILE B 182 ? 0.5262 0.6646 0.4608 0.0615  -0.0311 0.1233  177 ILE B CG1 
4339 C CG2 . ILE B 182 ? 0.5102 0.7022 0.4273 0.0579  -0.0211 0.1220  177 ILE B CG2 
4340 C CD1 . ILE B 182 ? 0.5334 0.6815 0.4711 0.0665  -0.0401 0.1396  177 ILE B CD1 
4341 N N   . ASN B 183 ? 0.5450 0.7408 0.4700 0.0614  -0.0186 0.0611  178 ASN B N   
4342 C CA  . ASN B 183 ? 0.5699 0.7824 0.4948 0.0625  -0.0196 0.0422  178 ASN B CA  
4343 C C   . ASN B 183 ? 0.5618 0.7508 0.4986 0.0553  -0.0159 0.0310  178 ASN B C   
4344 O O   . ASN B 183 ? 0.5570 0.7491 0.4907 0.0539  -0.0139 0.0242  178 ASN B O   
4345 C CB  . ASN B 183 ? 0.5826 0.8185 0.5116 0.0696  -0.0285 0.0269  178 ASN B CB  
4346 C CG  . ASN B 183 ? 0.6439 0.9008 0.5727 0.0746  -0.0342 0.0045  178 ASN B CG  
4347 O OD1 . ASN B 183 ? 0.7116 1.0031 0.6263 0.0847  -0.0375 0.0015  178 ASN B OD1 
4348 N ND2 . ASN B 183 ? 0.6619 0.9011 0.6080 0.0693  -0.0367 -0.0110 178 ASN B ND2 
4349 N N   . VAL B 184 ? 0.5598 0.7294 0.5102 0.0520  -0.0150 0.0310  179 VAL B N   
4350 C CA  . VAL B 184 ? 0.5605 0.7125 0.5240 0.0455  -0.0113 0.0253  179 VAL B CA  
4351 C C   . VAL B 184 ? 0.5705 0.7060 0.5255 0.0414  -0.0038 0.0318  179 VAL B C   
4352 O O   . VAL B 184 ? 0.5688 0.7003 0.5287 0.0373  -0.0020 0.0235  179 VAL B O   
4353 C CB  . VAL B 184 ? 0.5577 0.7012 0.5359 0.0450  -0.0102 0.0295  179 VAL B CB  
4354 C CG1 . VAL B 184 ? 0.5350 0.6659 0.5260 0.0391  -0.0050 0.0287  179 VAL B CG1 
4355 C CG2 . VAL B 184 ? 0.5398 0.7002 0.5325 0.0470  -0.0181 0.0231  179 VAL B CG2 
4356 N N   . ILE B 185 ? 0.5873 0.7119 0.5327 0.0424  -0.0013 0.0464  180 ILE B N   
4357 C CA  . ILE B 185 ? 0.6055 0.7142 0.5458 0.0381  0.0036  0.0527  180 ILE B CA  
4358 C C   . ILE B 185 ? 0.6140 0.7390 0.5443 0.0367  0.0049  0.0550  180 ILE B C   
4359 O O   . ILE B 185 ? 0.6180 0.7353 0.5470 0.0324  0.0092  0.0550  180 ILE B O   
4360 C CB  . ILE B 185 ? 0.6114 0.6992 0.5508 0.0399  0.0022  0.0656  180 ILE B CB  
4361 C CG1 . ILE B 185 ? 0.6321 0.7271 0.5675 0.0433  -0.0043 0.0796  180 ILE B CG1 
4362 C CG2 . ILE B 185 ? 0.6263 0.7028 0.5741 0.0443  0.0025  0.0598  180 ILE B CG2 
4363 C CD1 . ILE B 185 ? 0.6902 0.7849 0.6223 0.0389  -0.0055 0.0964  180 ILE B CD1 
4364 N N   . GLU B 186 ? 0.6290 0.7809 0.5522 0.0417  0.0011  0.0568  181 GLU B N   
4365 C CA  . GLU B 186 ? 0.6580 0.8381 0.5710 0.0443  0.0022  0.0565  181 GLU B CA  
4366 C C   . GLU B 186 ? 0.6536 0.8340 0.5710 0.0442  0.0025  0.0342  181 GLU B C   
4367 O O   . GLU B 186 ? 0.6499 0.8347 0.5626 0.0428  0.0064  0.0340  181 GLU B O   
4368 C CB  . GLU B 186 ? 0.6696 0.8857 0.5744 0.0531  -0.0030 0.0582  181 GLU B CB  
4369 C CG  . GLU B 186 ? 0.7330 0.9894 0.6243 0.0587  -0.0012 0.0679  181 GLU B CG  
4370 C CD  . GLU B 186 ? 0.8150 1.1074 0.6993 0.0707  -0.0057 0.0428  181 GLU B CD  
4371 O OE1 . GLU B 186 ? 0.8259 1.1649 0.6969 0.0810  -0.0063 0.0494  181 GLU B OE1 
4372 O OE2 . GLU B 186 ? 0.8316 1.1082 0.7257 0.0710  -0.0103 0.0171  181 GLU B OE2 
4373 N N   . ASP B 187 ? 0.6524 0.8277 0.5826 0.0451  -0.0031 0.0171  182 ASP B N   
4374 C CA  . ASP B 187 ? 0.6568 0.8305 0.5984 0.0449  -0.0071 -0.0036 182 ASP B CA  
4375 C C   . ASP B 187 ? 0.6416 0.7869 0.5922 0.0359  -0.0008 -0.0006 182 ASP B C   
4376 O O   . ASP B 187 ? 0.6314 0.7760 0.5837 0.0352  -0.0005 -0.0098 182 ASP B O   
4377 C CB  . ASP B 187 ? 0.6604 0.8376 0.6200 0.0472  -0.0182 -0.0195 182 ASP B CB  
4378 C CG  . ASP B 187 ? 0.7047 0.9151 0.6565 0.0592  -0.0280 -0.0326 182 ASP B CG  
4379 O OD1 . ASP B 187 ? 0.7427 0.9785 0.6759 0.0672  -0.0262 -0.0333 182 ASP B OD1 
4380 O OD2 . ASP B 187 ? 0.7271 0.9425 0.6917 0.0618  -0.0378 -0.0418 182 ASP B OD2 
4381 N N   . LYS B 188 ? 0.6422 0.7673 0.5979 0.0310  0.0038  0.0116  183 LYS B N   
4382 C CA  . LYS B 188 ? 0.6422 0.7448 0.6052 0.0248  0.0099  0.0156  183 LYS B CA  
4383 C C   . LYS B 188 ? 0.6442 0.7404 0.5939 0.0226  0.0162  0.0226  183 LYS B C   
4384 O O   . LYS B 188 ? 0.6298 0.7183 0.5837 0.0191  0.0188  0.0173  183 LYS B O   
4385 C CB  . LYS B 188 ? 0.6384 0.7298 0.6064 0.0250  0.0122  0.0256  183 LYS B CB  
4386 C CG  . LYS B 188 ? 0.6518 0.7310 0.6324 0.0214  0.0167  0.0272  183 LYS B CG  
4387 C CD  . LYS B 188 ? 0.6747 0.7554 0.6606 0.0260  0.0175  0.0346  183 LYS B CD  
4388 C CE  . LYS B 188 ? 0.7019 0.7819 0.7014 0.0246  0.0223  0.0383  183 LYS B CE  
4389 N NZ  . LYS B 188 ? 0.7280 0.8209 0.7347 0.0316  0.0231  0.0452  183 LYS B NZ  
4390 N N   . ARG B 189 ? 0.6536 0.7545 0.5903 0.0243  0.0172  0.0362  184 ARG B N   
4391 C CA  . ARG B 189 ? 0.6638 0.7641 0.5921 0.0214  0.0213  0.0461  184 ARG B CA  
4392 C C   . ARG B 189 ? 0.6572 0.7746 0.5827 0.0227  0.0224  0.0339  184 ARG B C   
4393 O O   . ARG B 189 ? 0.6527 0.7585 0.5803 0.0186  0.0264  0.0319  184 ARG B O   
4394 C CB  . ARG B 189 ? 0.6806 0.7934 0.6012 0.0227  0.0193  0.0654  184 ARG B CB  
4395 C CG  . ARG B 189 ? 0.7260 0.8476 0.6422 0.0190  0.0223  0.0795  184 ARG B CG  
4396 C CD  . ARG B 189 ? 0.8063 0.9441 0.7215 0.0187  0.0188  0.1047  184 ARG B CD  
4397 N NE  . ARG B 189 ? 0.8610 1.0360 0.7682 0.0262  0.0170  0.1057  184 ARG B NE  
4398 C CZ  . ARG B 189 ? 0.8962 1.1127 0.7934 0.0324  0.0195  0.1034  184 ARG B CZ  
4399 N NH1 . ARG B 189 ? 0.9289 1.1807 0.8182 0.0415  0.0165  0.1031  184 ARG B NH1 
4400 N NH2 . ARG B 189 ? 0.8988 1.1249 0.7930 0.0315  0.0245  0.0998  184 ARG B NH2 
4401 N N   . LYS B 190 ? 0.6520 0.7977 0.5734 0.0301  0.0176  0.0237  185 LYS B N   
4402 C CA  . LYS B 190 ? 0.6491 0.8163 0.5673 0.0359  0.0156  0.0078  185 LYS B CA  
4403 C C   . LYS B 190 ? 0.6295 0.7761 0.5625 0.0325  0.0136  -0.0093 185 LYS B C   
4404 O O   . LYS B 190 ? 0.6225 0.7683 0.5532 0.0315  0.0172  -0.0115 185 LYS B O   
4405 C CB  . LYS B 190 ? 0.6620 0.8640 0.5751 0.0481  0.0073  -0.0058 185 LYS B CB  
4406 C CG  . LYS B 190 ? 0.7030 0.9413 0.5990 0.0542  0.0101  0.0119  185 LYS B CG  
4407 C CD  . LYS B 190 ? 0.7526 1.0310 0.6416 0.0695  0.0012  -0.0049 185 LYS B CD  
4408 C CE  . LYS B 190 ? 0.7782 1.0841 0.6563 0.0731  0.0025  0.0167  185 LYS B CE  
4409 N NZ  . LYS B 190 ? 0.8098 1.1624 0.6784 0.0908  -0.0061 -0.0002 185 LYS B NZ  
4410 N N   . PHE B 191 ? 0.6165 0.7490 0.5672 0.0306  0.0072  -0.0192 186 PHE B N   
4411 C CA  . PHE B 191 ? 0.6103 0.7258 0.5818 0.0265  0.0026  -0.0319 186 PHE B CA  
4412 C C   . PHE B 191 ? 0.5866 0.6772 0.5618 0.0173  0.0121  -0.0192 186 PHE B C   
4413 O O   . PHE B 191 ? 0.5821 0.6635 0.5687 0.0146  0.0108  -0.0263 186 PHE B O   
4414 C CB  . PHE B 191 ? 0.6169 0.7282 0.6131 0.0254  -0.0087 -0.0409 186 PHE B CB  
4415 C CG  . PHE B 191 ? 0.6380 0.7280 0.6614 0.0163  -0.0104 -0.0390 186 PHE B CG  
4416 C CD1 . PHE B 191 ? 0.6635 0.7489 0.7074 0.0163  -0.0211 -0.0547 186 PHE B CD1 
4417 C CD2 . PHE B 191 ? 0.6429 0.7208 0.6724 0.0092  -0.0020 -0.0204 186 PHE B CD2 
4418 C CE1 . PHE B 191 ? 0.6617 0.7300 0.7344 0.0068  -0.0231 -0.0478 186 PHE B CE1 
4419 C CE2 . PHE B 191 ? 0.6275 0.6944 0.6823 0.0017  -0.0025 -0.0142 186 PHE B CE2 
4420 C CZ  . PHE B 191 ? 0.6452 0.7069 0.7227 -0.0007 -0.0127 -0.0256 186 PHE B CZ  
4421 N N   . ASP B 192 ? 0.5798 0.6602 0.5471 0.0140  0.0197  -0.0020 187 ASP B N   
4422 C CA  . ASP B 192 ? 0.5697 0.6297 0.5394 0.0084  0.0270  0.0075  187 ASP B CA  
4423 C C   . ASP B 192 ? 0.5608 0.6185 0.5184 0.0070  0.0324  0.0105  187 ASP B C   
4424 O O   . ASP B 192 ? 0.5581 0.6022 0.5209 0.0031  0.0362  0.0112  187 ASP B O   
4425 C CB  . ASP B 192 ? 0.5826 0.6335 0.5483 0.0089  0.0303  0.0206  187 ASP B CB  
4426 C CG  . ASP B 192 ? 0.6071 0.6607 0.5889 0.0095  0.0274  0.0205  187 ASP B CG  
4427 O OD1 . ASP B 192 ? 0.6122 0.6735 0.6108 0.0079  0.0212  0.0120  187 ASP B OD1 
4428 O OD2 . ASP B 192 ? 0.6516 0.7011 0.6313 0.0125  0.0298  0.0289  187 ASP B OD2 
4429 N N   . ILE B 193 ? 0.5440 0.6186 0.4872 0.0102  0.0326  0.0147  188 ILE B N   
4430 C CA  . ILE B 193 ? 0.5317 0.6109 0.4658 0.0086  0.0374  0.0210  188 ILE B CA  
4431 C C   . ILE B 193 ? 0.5175 0.6080 0.4545 0.0119  0.0356  0.0041  188 ILE B C   
4432 O O   . ILE B 193 ? 0.5071 0.5884 0.4459 0.0087  0.0392  0.0033  188 ILE B O   
4433 C CB  . ILE B 193 ? 0.5381 0.6392 0.4600 0.0107  0.0378  0.0364  188 ILE B CB  
4434 C CG1 . ILE B 193 ? 0.5385 0.6205 0.4621 0.0066  0.0372  0.0540  188 ILE B CG1 
4435 C CG2 . ILE B 193 ? 0.5432 0.6626 0.4587 0.0105  0.0419  0.0426  188 ILE B CG2 
4436 C CD1 . ILE B 193 ? 0.5524 0.6561 0.4705 0.0083  0.0345  0.0713  188 ILE B CD1 
4437 N N   . MET B 194 ? 0.5176 0.6283 0.4563 0.0198  0.0280  -0.0115 189 MET B N   
4438 C CA  . MET B 194 ? 0.5122 0.6336 0.4563 0.0262  0.0220  -0.0323 189 MET B CA  
4439 C C   . MET B 194 ? 0.4950 0.5886 0.4611 0.0202  0.0183  -0.0410 189 MET B C   
4440 O O   . MET B 194 ? 0.4875 0.5794 0.4570 0.0213  0.0177  -0.0494 189 MET B O   
4441 C CB  . MET B 194 ? 0.5266 0.6768 0.4690 0.0389  0.0111  -0.0504 189 MET B CB  
4442 C CG  . MET B 194 ? 0.5578 0.7485 0.4777 0.0480  0.0153  -0.0422 189 MET B CG  
4443 S SD  . MET B 194 ? 0.6199 0.8538 0.5342 0.0678  0.0019  -0.0665 189 MET B SD  
4444 C CE  . MET B 194 ? 0.5794 0.7968 0.5025 0.0625  -0.0029 -0.0616 189 MET B CE  
4445 N N   . GLU B 195 ? 0.4713 0.5469 0.4533 0.0141  0.0160  -0.0365 190 GLU B N   
4446 C CA  . GLU B 195 ? 0.4717 0.5265 0.4771 0.0072  0.0138  -0.0370 190 GLU B CA  
4447 C C   . GLU B 195 ? 0.4413 0.4818 0.4387 0.0012  0.0258  -0.0231 190 GLU B C   
4448 O O   . GLU B 195 ? 0.4342 0.4653 0.4433 -0.0015 0.0250  -0.0265 190 GLU B O   
4449 C CB  . GLU B 195 ? 0.4704 0.5181 0.4962 0.0024  0.0096  -0.0302 190 GLU B CB  
4450 C CG  . GLU B 195 ? 0.5547 0.5945 0.6161 -0.0016 -0.0027 -0.0372 190 GLU B CG  
4451 C CD  . GLU B 195 ? 0.6497 0.6785 0.7297 -0.0107 0.0030  -0.0185 190 GLU B CD  
4452 O OE1 . GLU B 195 ? 0.6700 0.6994 0.7364 -0.0118 0.0149  -0.0026 190 GLU B OE1 
4453 O OE2 . GLU B 195 ? 0.6622 0.6843 0.7727 -0.0155 -0.0061 -0.0197 190 GLU B OE2 
4454 N N   . PHE B 196 ? 0.4236 0.4623 0.4032 0.0000  0.0346  -0.0086 191 PHE B N   
4455 C CA  . PHE B 196 ? 0.4205 0.4465 0.3923 -0.0039 0.0431  0.0020  191 PHE B CA  
4456 C C   . PHE B 196 ? 0.4282 0.4599 0.3947 -0.0031 0.0445  -0.0043 191 PHE B C   
4457 O O   . PHE B 196 ? 0.4247 0.4456 0.3991 -0.0060 0.0462  -0.0062 191 PHE B O   
4458 C CB  . PHE B 196 ? 0.4221 0.4455 0.3795 -0.0038 0.0469  0.0159  191 PHE B CB  
4459 C CG  . PHE B 196 ? 0.4371 0.4494 0.3875 -0.0067 0.0517  0.0246  191 PHE B CG  
4460 C CD1 . PHE B 196 ? 0.4357 0.4322 0.3916 -0.0082 0.0546  0.0259  191 PHE B CD1 
4461 C CD2 . PHE B 196 ? 0.4525 0.4737 0.3931 -0.0076 0.0524  0.0328  191 PHE B CD2 
4462 C CE1 . PHE B 196 ? 0.4587 0.4447 0.4096 -0.0099 0.0568  0.0315  191 PHE B CE1 
4463 C CE2 . PHE B 196 ? 0.4580 0.4683 0.3972 -0.0113 0.0543  0.0416  191 PHE B CE2 
4464 C CZ  . PHE B 196 ? 0.4421 0.4329 0.3860 -0.0122 0.0559  0.0390  191 PHE B CZ  
4465 N N   . VAL B 197 ? 0.4350 0.4883 0.3891 0.0020  0.0435  -0.0071 192 VAL B N   
4466 C CA  . VAL B 197 ? 0.4426 0.5089 0.3912 0.0050  0.0451  -0.0129 192 VAL B CA  
4467 C C   . VAL B 197 ? 0.4427 0.5068 0.4068 0.0090  0.0370  -0.0339 192 VAL B C   
4468 O O   . VAL B 197 ? 0.4447 0.5063 0.4110 0.0091  0.0384  -0.0384 192 VAL B O   
4469 C CB  . VAL B 197 ? 0.4358 0.5371 0.3682 0.0118  0.0462  -0.0088 192 VAL B CB  
4470 C CG1 . VAL B 197 ? 0.4638 0.5812 0.3904 0.0141  0.0502  -0.0088 192 VAL B CG1 
4471 C CG2 . VAL B 197 ? 0.4107 0.5114 0.3355 0.0066  0.0504  0.0143  192 VAL B CG2 
4472 N N   . LEU B 198 ? 0.4456 0.5094 0.4238 0.0122  0.0266  -0.0464 193 LEU B N   
4473 C CA  . LEU B 198 ? 0.4389 0.4970 0.4392 0.0157  0.0144  -0.0661 193 LEU B CA  
4474 C C   . LEU B 198 ? 0.4290 0.4602 0.4489 0.0055  0.0164  -0.0573 193 LEU B C   
4475 O O   . LEU B 198 ? 0.4338 0.4593 0.4670 0.0069  0.0105  -0.0675 193 LEU B O   
4476 C CB  . LEU B 198 ? 0.4424 0.5058 0.4593 0.0212  -0.0012 -0.0817 193 LEU B CB  
4477 C CG  . LEU B 198 ? 0.4530 0.5051 0.5024 0.0236  -0.0194 -0.1014 193 LEU B CG  
4478 C CD1 . LEU B 198 ? 0.4501 0.5154 0.4950 0.0362  -0.0262 -0.1236 193 LEU B CD1 
4479 C CD2 . LEU B 198 ? 0.4572 0.5109 0.5287 0.0270  -0.0371 -0.1143 193 LEU B CD2 
4480 N N   . ARG B 199 ? 0.4034 0.4221 0.4258 -0.0028 0.0236  -0.0389 194 ARG B N   
4481 C CA  . ARG B 199 ? 0.3961 0.3985 0.4332 -0.0104 0.0278  -0.0268 194 ARG B CA  
4482 C C   . ARG B 199 ? 0.3875 0.3850 0.4101 -0.0116 0.0375  -0.0222 194 ARG B C   
4483 O O   . ARG B 199 ? 0.3950 0.3835 0.4317 -0.0146 0.0367  -0.0211 194 ARG B O   
4484 C CB  . ARG B 199 ? 0.3872 0.3864 0.4281 -0.0150 0.0331  -0.0095 194 ARG B CB  
4485 C CG  . ARG B 199 ? 0.4048 0.4081 0.4711 -0.0165 0.0223  -0.0103 194 ARG B CG  
4486 C CD  . ARG B 199 ? 0.4771 0.4842 0.5463 -0.0191 0.0287  0.0079  194 ARG B CD  
4487 N NE  . ARG B 199 ? 0.4803 0.4872 0.5672 -0.0236 0.0328  0.0236  194 ARG B NE  
4488 C CZ  . ARG B 199 ? 0.5029 0.5191 0.5863 -0.0222 0.0414  0.0397  194 ARG B CZ  
4489 N NH1 . ARG B 199 ? 0.4684 0.4900 0.5328 -0.0168 0.0456  0.0408  194 ARG B NH1 
4490 N NH2 . ARG B 199 ? 0.4521 0.4757 0.5519 -0.0246 0.0449  0.0548  194 ARG B NH2 
4491 N N   . LEU B 200 ? 0.3832 0.3869 0.3810 -0.0100 0.0454  -0.0173 195 LEU B N   
4492 C CA  . LEU B 200 ? 0.3986 0.4001 0.3854 -0.0111 0.0523  -0.0138 195 LEU B CA  
4493 C C   . LEU B 200 ? 0.3955 0.4048 0.3880 -0.0065 0.0470  -0.0292 195 LEU B C   
4494 O O   . LEU B 200 ? 0.3983 0.3991 0.3966 -0.0086 0.0489  -0.0291 195 LEU B O   
4495 C CB  . LEU B 200 ? 0.3963 0.4068 0.3625 -0.0108 0.0581  -0.0043 195 LEU B CB  
4496 C CG  . LEU B 200 ? 0.4207 0.4217 0.3810 -0.0134 0.0607  0.0093  195 LEU B CG  
4497 C CD1 . LEU B 200 ? 0.4529 0.4658 0.4000 -0.0135 0.0620  0.0191  195 LEU B CD1 
4498 C CD2 . LEU B 200 ? 0.4243 0.4077 0.3872 -0.0162 0.0645  0.0161  195 LEU B CD2 
4499 N N   . VAL B 201 ? 0.4004 0.4279 0.3915 0.0016  0.0394  -0.0439 196 VAL B N   
4500 C CA  . VAL B 201 ? 0.4195 0.4578 0.4161 0.0101  0.0316  -0.0631 196 VAL B CA  
4501 C C   . VAL B 201 ? 0.4184 0.4366 0.4448 0.0081  0.0204  -0.0724 196 VAL B C   
4502 O O   . VAL B 201 ? 0.4253 0.4395 0.4582 0.0098  0.0185  -0.0788 196 VAL B O   
4503 C CB  . VAL B 201 ? 0.4344 0.5047 0.4200 0.0238  0.0247  -0.0794 196 VAL B CB  
4504 C CG1 . VAL B 201 ? 0.4250 0.5057 0.4219 0.0368  0.0108  -0.1068 196 VAL B CG1 
4505 C CG2 . VAL B 201 ? 0.4329 0.5301 0.3920 0.0254  0.0371  -0.0650 196 VAL B CG2 
4506 N N   . GLU B 202 ? 0.4209 0.4277 0.4682 0.0039  0.0124  -0.0706 197 GLU B N   
4507 C CA  . GLU B 202 ? 0.4251 0.4141 0.5090 -0.0004 -0.0004 -0.0733 197 GLU B CA  
4508 C C   . GLU B 202 ? 0.3994 0.3743 0.4892 -0.0096 0.0094  -0.0544 197 GLU B C   
4509 O O   . GLU B 202 ? 0.3921 0.3565 0.5074 -0.0114 0.0005  -0.0568 197 GLU B O   
4510 C CB  . GLU B 202 ? 0.4346 0.4188 0.5430 -0.0050 -0.0102 -0.0687 197 GLU B CB  
4511 C CG  . GLU B 202 ? 0.4852 0.4801 0.5996 0.0052  -0.0270 -0.0924 197 GLU B CG  
4512 C CD  . GLU B 202 ? 0.5486 0.5401 0.6865 0.0146  -0.0479 -0.1186 197 GLU B CD  
4513 O OE1 . GLU B 202 ? 0.5663 0.5764 0.6910 0.0301  -0.0564 -0.1441 197 GLU B OE1 
4514 O OE2 . GLU B 202 ? 0.5869 0.5598 0.7573 0.0079  -0.0567 -0.1137 197 GLU B OE2 
4515 N N   . ALA B 203 ? 0.3742 0.3498 0.4417 -0.0141 0.0258  -0.0368 198 ALA B N   
4516 C CA  . ALA B 203 ? 0.3702 0.3371 0.4395 -0.0199 0.0347  -0.0210 198 ALA B CA  
4517 C C   . ALA B 203 ? 0.3808 0.3477 0.4378 -0.0169 0.0385  -0.0284 198 ALA B C   
4518 O O   . ALA B 203 ? 0.3715 0.3305 0.4409 -0.0197 0.0388  -0.0236 198 ALA B O   
4519 C CB  . ALA B 203 ? 0.3659 0.3345 0.4165 -0.0224 0.0475  -0.0042 198 ALA B CB  
4520 N N   . GLN B 204 ? 0.3976 0.3769 0.4308 -0.0114 0.0421  -0.0370 199 GLN B N   
4521 C CA  . GLN B 204 ? 0.4109 0.3967 0.4362 -0.0070 0.0437  -0.0456 199 GLN B CA  
4522 C C   . GLN B 204 ? 0.4118 0.3937 0.4612 -0.0017 0.0295  -0.0629 199 GLN B C   
4523 O O   . GLN B 204 ? 0.4313 0.4073 0.4873 -0.0019 0.0296  -0.0639 199 GLN B O   
4524 C CB  . GLN B 204 ? 0.4139 0.4235 0.4154 -0.0004 0.0476  -0.0505 199 GLN B CB  
4525 C CG  . GLN B 204 ? 0.4535 0.4644 0.4365 -0.0063 0.0583  -0.0319 199 GLN B CG  
4526 C CD  . GLN B 204 ? 0.4625 0.4648 0.4392 -0.0120 0.0667  -0.0194 199 GLN B CD  
4527 O OE1 . GLN B 204 ? 0.5227 0.5275 0.5014 -0.0105 0.0673  -0.0241 199 GLN B OE1 
4528 N NE2 . GLN B 204 ? 0.4918 0.4847 0.4615 -0.0174 0.0715  -0.0049 199 GLN B NE2 
4529 N N   . ALA B 205 ? 0.4100 0.3937 0.4755 0.0033  0.0152  -0.0771 200 ALA B N   
4530 C CA  . ALA B 205 ? 0.4171 0.3968 0.5088 0.0112  -0.0037 -0.0989 200 ALA B CA  
4531 C C   . ALA B 205 ? 0.4142 0.3707 0.5405 0.0021  -0.0108 -0.0881 200 ALA B C   
4532 O O   . ALA B 205 ? 0.4296 0.3799 0.5709 0.0059  -0.0193 -0.0978 200 ALA B O   
4533 C CB  . ALA B 205 ? 0.4083 0.3964 0.5114 0.0213  -0.0215 -0.1210 200 ALA B CB  
4534 N N   . THR B 206 ? 0.4124 0.3598 0.5535 -0.0090 -0.0082 -0.0669 201 THR B N   
4535 C CA  . THR B 206 ? 0.4124 0.3465 0.5840 -0.0186 -0.0106 -0.0477 201 THR B CA  
4536 C C   . THR B 206 ? 0.3988 0.3319 0.5547 -0.0199 0.0028  -0.0390 201 THR B C   
4537 O O   . THR B 206 ? 0.3903 0.3142 0.5704 -0.0212 -0.0052 -0.0376 201 THR B O   
4538 C CB  . THR B 206 ? 0.4154 0.3520 0.5960 -0.0284 -0.0041 -0.0219 201 THR B CB  
4539 O OG1 . THR B 206 ? 0.4380 0.3757 0.6352 -0.0277 -0.0173 -0.0298 201 THR B OG1 
4540 C CG2 . THR B 206 ? 0.3964 0.3290 0.6120 -0.0375 -0.0067 0.0028  201 THR B CG2 
4541 N N   . HIS B 207 ? 0.3835 0.3251 0.5020 -0.0196 0.0210  -0.0329 202 HIS B N   
4542 C CA  . HIS B 207 ? 0.3821 0.3234 0.4844 -0.0203 0.0328  -0.0261 202 HIS B CA  
4543 C C   . HIS B 207 ? 0.3993 0.3414 0.5018 -0.0130 0.0267  -0.0449 202 HIS B C   
4544 O O   . HIS B 207 ? 0.4095 0.3446 0.5248 -0.0143 0.0251  -0.0415 202 HIS B O   
4545 C CB  . HIS B 207 ? 0.3747 0.3240 0.4414 -0.0204 0.0482  -0.0200 202 HIS B CB  
4546 C CG  . HIS B 207 ? 0.3776 0.3269 0.4280 -0.0207 0.0579  -0.0155 202 HIS B CG  
4547 N ND1 . HIS B 207 ? 0.3774 0.3213 0.4351 -0.0240 0.0622  -0.0023 202 HIS B ND1 
4548 C CD2 . HIS B 207 ? 0.3790 0.3363 0.4084 -0.0179 0.0633  -0.0213 202 HIS B CD2 
4549 C CE1 . HIS B 207 ? 0.3277 0.2727 0.3686 -0.0231 0.0690  -0.0028 202 HIS B CE1 
4550 N NE2 . HIS B 207 ? 0.3512 0.3039 0.3765 -0.0202 0.0697  -0.0132 202 HIS B NE2 
4551 N N   . PHE B 208 ? 0.4110 0.3659 0.4992 -0.0038 0.0229  -0.0645 203 PHE B N   
4552 C CA  . PHE B 208 ? 0.4266 0.3904 0.5120 0.0063  0.0179  -0.0833 203 PHE B CA  
4553 C C   . PHE B 208 ? 0.4462 0.3972 0.5674 0.0114  -0.0029 -0.0989 203 PHE B C   
4554 O O   . PHE B 208 ? 0.4460 0.3974 0.5725 0.0179  -0.0077 -0.1098 203 PHE B O   
4555 C CB  . PHE B 208 ? 0.4247 0.4158 0.4842 0.0174  0.0202  -0.0982 203 PHE B CB  
4556 C CG  . PHE B 208 ? 0.4325 0.4369 0.4626 0.0129  0.0383  -0.0822 203 PHE B CG  
4557 C CD1 . PHE B 208 ? 0.3936 0.4081 0.4137 0.0148  0.0452  -0.0810 203 PHE B CD1 
4558 C CD2 . PHE B 208 ? 0.3815 0.3863 0.3980 0.0059  0.0468  -0.0670 203 PHE B CD2 
4559 C CE1 . PHE B 208 ? 0.4046 0.4291 0.4045 0.0090  0.0588  -0.0642 203 PHE B CE1 
4560 C CE2 . PHE B 208 ? 0.3791 0.3921 0.3750 0.0008  0.0597  -0.0511 203 PHE B CE2 
4561 C CZ  . PHE B 208 ? 0.3662 0.3886 0.3551 0.0016  0.0653  -0.0489 203 PHE B CZ  
4562 N N   . GLN B 209 ? 0.4536 0.3928 0.6031 0.0082  -0.0169 -0.0988 204 GLN B N   
4563 C CA  . GLN B 209 ? 0.4889 0.4120 0.6818 0.0112  -0.0412 -0.1111 204 GLN B CA  
4564 C C   . GLN B 209 ? 0.4789 0.3848 0.6994 -0.0002 -0.0412 -0.0878 204 GLN B C   
4565 O O   . GLN B 209 ? 0.4968 0.3928 0.7413 0.0043  -0.0553 -0.0978 204 GLN B O   
4566 C CB  . GLN B 209 ? 0.4947 0.4118 0.7145 0.0114  -0.0597 -0.1187 204 GLN B CB  
4567 C CG  . GLN B 209 ? 0.5738 0.4734 0.8429 0.0168  -0.0911 -0.1368 204 GLN B CG  
4568 C CD  . GLN B 209 ? 0.6498 0.5304 0.9661 0.0005  -0.1012 -0.1098 204 GLN B CD  
4569 O OE1 . GLN B 209 ? 0.6907 0.5695 1.0093 -0.0126 -0.0862 -0.0780 204 GLN B OE1 
4570 N NE2 . GLN B 209 ? 0.6747 0.5449 1.0310 0.0016  -0.1276 -0.1210 204 GLN B NE2 
4571 N N   . GLN B 210 ? 0.4655 0.3708 0.6844 -0.0133 -0.0269 -0.0572 205 GLN B N   
4572 C CA  . GLN B 210 ? 0.4545 0.3534 0.6940 -0.0227 -0.0233 -0.0312 205 GLN B CA  
4573 C C   . GLN B 210 ? 0.4430 0.3440 0.6610 -0.0178 -0.0138 -0.0369 205 GLN B C   
4574 O O   . GLN B 210 ? 0.4480 0.3398 0.6916 -0.0183 -0.0230 -0.0342 205 GLN B O   
4575 C CB  . GLN B 210 ? 0.4412 0.3506 0.6679 -0.0322 -0.0048 -0.0009 205 GLN B CB  
4576 C CG  . GLN B 210 ? 0.4252 0.3370 0.6799 -0.0394 -0.0124 0.0148  205 GLN B CG  
4577 C CD  . GLN B 210 ? 0.4311 0.3595 0.6611 -0.0430 0.0069  0.0357  205 GLN B CD  
4578 O OE1 . GLN B 210 ? 0.4816 0.4185 0.7355 -0.0492 0.0041  0.0559  205 GLN B OE1 
4579 N NE2 . GLN B 210 ? 0.4274 0.3618 0.6127 -0.0384 0.0246  0.0306  205 GLN B NE2 
4580 N N   . GLY B 211 ? 0.4195 0.3328 0.5938 -0.0141 0.0038  -0.0422 206 GLY B N   
4581 C CA  . GLY B 211 ? 0.4270 0.3449 0.5808 -0.0105 0.0135  -0.0456 206 GLY B CA  
4582 C C   . GLY B 211 ? 0.4390 0.3552 0.6056 0.0005  -0.0015 -0.0706 206 GLY B C   
4583 O O   . GLY B 211 ? 0.4229 0.3327 0.6027 0.0011  -0.0046 -0.0687 206 GLY B O   
4584 N N   . HIS B 212 ? 0.4454 0.3698 0.6085 0.0112  -0.0118 -0.0951 207 HIS B N   
4585 C CA  . HIS B 212 ? 0.4629 0.3925 0.6340 0.0267  -0.0272 -0.1241 207 HIS B CA  
4586 C C   . HIS B 212 ? 0.4812 0.3871 0.7012 0.0265  -0.0509 -0.1279 207 HIS B C   
4587 O O   . HIS B 212 ? 0.4840 0.3880 0.7139 0.0357  -0.0603 -0.1424 207 HIS B O   
4588 C CB  . HIS B 212 ? 0.4640 0.4140 0.6208 0.0412  -0.0346 -0.1506 207 HIS B CB  
4589 C CG  . HIS B 212 ? 0.4881 0.4481 0.6548 0.0616  -0.0536 -0.1845 207 HIS B CG  
4590 N ND1 . HIS B 212 ? 0.4957 0.4782 0.6409 0.0725  -0.0457 -0.1943 207 HIS B ND1 
4591 C CD2 . HIS B 212 ? 0.4470 0.3974 0.6466 0.0740  -0.0824 -0.2116 207 HIS B CD2 
4592 C CE1 . HIS B 212 ? 0.4858 0.4751 0.6469 0.0928  -0.0678 -0.2273 207 HIS B CE1 
4593 N NE2 . HIS B 212 ? 0.5009 0.4692 0.6954 0.0945  -0.0914 -0.2398 207 HIS B NE2 
4594 N N   . GLU B 213 ? 0.4877 0.3764 0.7412 0.0156  -0.0611 -0.1120 208 GLU B N   
4595 C CA  . GLU B 213 ? 0.5167 0.3830 0.8240 0.0143  -0.0868 -0.1124 208 GLU B CA  
4596 C C   . GLU B 213 ? 0.5042 0.3630 0.8247 0.0041  -0.0791 -0.0848 208 GLU B C   
4597 O O   . GLU B 213 ? 0.5141 0.3586 0.8695 0.0074  -0.0979 -0.0904 208 GLU B O   
4598 C CB  . GLU B 213 ? 0.5322 0.3844 0.8824 0.0079  -0.1078 -0.1077 208 GLU B CB  
4599 C CG  . GLU B 213 ? 0.5588 0.4111 0.9207 -0.0115 -0.0954 -0.0663 208 GLU B CG  
4600 C CD  . GLU B 213 ? 0.6311 0.4697 1.0484 -0.0189 -0.1211 -0.0587 208 GLU B CD  
4601 O OE1 . GLU B 213 ? 0.6451 0.4673 1.1174 -0.0249 -0.1428 -0.0465 208 GLU B OE1 
4602 O OE2 . GLU B 213 ? 0.6465 0.4913 1.0553 -0.0192 -0.1206 -0.0636 208 GLU B OE2 
4603 N N   . GLU B 214 ? 0.4685 0.3381 0.7615 -0.0063 -0.0532 -0.0573 209 GLU B N   
4604 C CA  . GLU B 214 ? 0.4675 0.3361 0.7669 -0.0133 -0.0444 -0.0329 209 GLU B CA  
4605 C C   . GLU B 214 ? 0.4600 0.3326 0.7368 -0.0029 -0.0396 -0.0517 209 GLU B C   
4606 O O   . GLU B 214 ? 0.4742 0.3384 0.7742 -0.0022 -0.0481 -0.0479 209 GLU B O   
4607 C CB  . GLU B 214 ? 0.4447 0.3273 0.7214 -0.0237 -0.0207 -0.0019 209 GLU B CB  
4608 C CG  . GLU B 214 ? 0.4926 0.3803 0.7794 -0.0298 -0.0128 0.0266  209 GLU B CG  
4609 C CD  . GLU B 214 ? 0.5485 0.4407 0.8038 -0.0238 -0.0001 0.0180  209 GLU B CD  
4610 O OE1 . GLU B 214 ? 0.5853 0.4800 0.8532 -0.0263 0.0018  0.0358  209 GLU B OE1 
4611 O OE2 . GLU B 214 ? 0.5515 0.4478 0.7716 -0.0169 0.0078  -0.0042 209 GLU B OE2 
4612 N N   . LEU B 215 ? 0.4541 0.3419 0.6886 0.0053  -0.0271 -0.0703 210 LEU B N   
4613 C CA  . LEU B 215 ? 0.4700 0.3680 0.6838 0.0158  -0.0227 -0.0875 210 LEU B CA  
4614 C C   . LEU B 215 ? 0.4984 0.3901 0.7389 0.0305  -0.0475 -0.1170 210 LEU B C   
4615 O O   . LEU B 215 ? 0.5027 0.3957 0.7448 0.0371  -0.0494 -0.1241 210 LEU B O   
4616 C CB  . LEU B 215 ? 0.4411 0.3624 0.6086 0.0200  -0.0044 -0.0952 210 LEU B CB  
4617 C CG  . LEU B 215 ? 0.4392 0.3646 0.5811 0.0081  0.0180  -0.0692 210 LEU B CG  
4618 C CD1 . LEU B 215 ? 0.4142 0.3561 0.5227 0.0083  0.0305  -0.0711 210 LEU B CD1 
4619 C CD2 . LEU B 215 ? 0.4237 0.3526 0.5563 0.0077  0.0272  -0.0626 210 LEU B CD2 
4620 N N   . SER B 216 ? 0.5313 0.4160 0.7942 0.0368  -0.0681 -0.1351 211 SER B N   
4621 C CA  . SER B 216 ? 0.5676 0.4450 0.8602 0.0537  -0.0970 -0.1678 211 SER B CA  
4622 C C   . SER B 216 ? 0.5818 0.4312 0.9263 0.0476  -0.1171 -0.1561 211 SER B C   
4623 O O   . SER B 216 ? 0.6011 0.4437 0.9670 0.0617  -0.1374 -0.1795 211 SER B O   
4624 C CB  . SER B 216 ? 0.5898 0.4666 0.8952 0.0626  -0.1166 -0.1913 211 SER B CB  
4625 O OG  . SER B 216 ? 0.6133 0.5216 0.8725 0.0735  -0.1019 -0.2073 211 SER B OG  
4626 N N   . ARG B 217 ? 0.5667 0.4032 0.9339 0.0280  -0.1127 -0.1192 212 ARG B N   
4627 C CA  . ARG B 217 ? 0.5854 0.4008 1.0044 0.0202  -0.1300 -0.0998 212 ARG B CA  
4628 C C   . ARG B 217 ? 0.5627 0.3837 0.9663 0.0207  -0.1160 -0.0901 212 ARG B C   
4629 O O   . ARG B 217 ? 0.5746 0.3806 1.0175 0.0193  -0.1321 -0.0818 212 ARG B O   
4630 C CB  . ARG B 217 ? 0.5782 0.3874 1.0285 0.0002  -0.1294 -0.0594 212 ARG B CB  
4631 C CG  . ARG B 217 ? 0.6335 0.4320 1.1156 -0.0007 -0.1515 -0.0687 212 ARG B CG  
4632 C CD  . ARG B 217 ? 0.6916 0.4873 1.2143 -0.0206 -0.1540 -0.0250 212 ARG B CD  
4633 N NE  . ARG B 217 ? 0.7713 0.5536 1.3357 -0.0225 -0.1805 -0.0328 212 ARG B NE  
4634 C CZ  . ARG B 217 ? 0.7984 0.5916 1.3449 -0.0268 -0.1707 -0.0297 212 ARG B CZ  
4635 N NH1 . ARG B 217 ? 0.7771 0.5932 1.2652 -0.0290 -0.1359 -0.0196 212 ARG B NH1 
4636 N NH2 . ARG B 217 ? 0.8197 0.5998 1.4087 -0.0284 -0.1975 -0.0374 212 ARG B NH2 
4637 N N   . LEU B 218 ? 0.5465 0.3892 0.8953 0.0223  -0.0874 -0.0903 213 LEU B N   
4638 C CA  . LEU B 218 ? 0.5343 0.3844 0.8658 0.0236  -0.0741 -0.0840 213 LEU B CA  
4639 C C   . LEU B 218 ? 0.5392 0.3986 0.8555 0.0431  -0.0807 -0.1205 213 LEU B C   
4640 O O   . LEU B 218 ? 0.5470 0.4127 0.8521 0.0460  -0.0726 -0.1189 213 LEU B O   
4641 C CB  . LEU B 218 ? 0.5084 0.3772 0.7932 0.0149  -0.0420 -0.0635 213 LEU B CB  
4642 C CG  . LEU B 218 ? 0.5068 0.3770 0.7952 -0.0008 -0.0292 -0.0258 213 LEU B CG  
4643 C CD1 . LEU B 218 ? 0.4550 0.3433 0.6939 -0.0036 -0.0022 -0.0185 213 LEU B CD1 
4644 C CD2 . LEU B 218 ? 0.5235 0.3870 0.8472 -0.0065 -0.0362 -0.0012 213 LEU B CD2 
4645 N N   . SER B 219 ? 0.5478 0.4128 0.8619 0.0577  -0.0945 -0.1533 214 SER B N   
4646 C CA  . SER B 219 ? 0.5586 0.4448 0.8520 0.0796  -0.0980 -0.1883 214 SER B CA  
4647 C C   . SER B 219 ? 0.5667 0.4443 0.8821 0.0876  -0.1102 -0.1954 214 SER B C   
4648 O O   . SER B 219 ? 0.5465 0.4462 0.8331 0.0953  -0.0963 -0.2018 214 SER B O   
4649 C CB  . SER B 219 ? 0.5847 0.4775 0.8857 0.0984  -0.1201 -0.2257 214 SER B CB  
4650 O OG  . SER B 219 ? 0.5857 0.5156 0.8514 0.1197  -0.1139 -0.2539 214 SER B OG  
4651 N N   . GLN B 220 ? 0.5876 0.4337 0.9573 0.0847  -0.1372 -0.1918 215 GLN B N   
4652 C CA  . GLN B 220 ? 0.6062 0.4387 1.0064 0.0915  -0.1537 -0.1964 215 GLN B CA  
4653 C C   . GLN B 220 ? 0.5878 0.4265 0.9698 0.0787  -0.1287 -0.1649 215 GLN B C   
4654 O O   . GLN B 220 ? 0.5834 0.4349 0.9501 0.0896  -0.1242 -0.1771 215 GLN B O   
4655 C CB  . GLN B 220 ? 0.6342 0.4301 1.1031 0.0859  -0.1881 -0.1894 215 GLN B CB  
4656 C CG  . GLN B 220 ? 0.6794 0.4574 1.1901 0.1000  -0.2181 -0.2087 215 GLN B CG  
4657 C CD  . GLN B 220 ? 0.7568 0.5451 1.2626 0.1310  -0.2402 -0.2645 215 GLN B CD  
4658 O OE1 . GLN B 220 ? 0.7799 0.5990 1.2429 0.1475  -0.2253 -0.2860 215 GLN B OE1 
4659 N NE2 . GLN B 220 ? 0.7972 0.5629 1.3496 0.1404  -0.2779 -0.2883 215 GLN B NE2 
4660 N N   . TYR B 221 ? 0.5686 0.4016 0.9522 0.0573  -0.1133 -0.1252 216 TYR B N   
4661 C CA  . TYR B 221 ? 0.5482 0.3899 0.9133 0.0467  -0.0907 -0.0963 216 TYR B CA  
4662 C C   . TYR B 221 ? 0.5294 0.3991 0.8381 0.0529  -0.0651 -0.1078 216 TYR B C   
4663 O O   . TYR B 221 ? 0.5250 0.4025 0.8227 0.0544  -0.0559 -0.1029 216 TYR B O   
4664 C CB  . TYR B 221 ? 0.5288 0.3687 0.8994 0.0266  -0.0777 -0.0550 216 TYR B CB  
4665 C CG  . TYR B 221 ? 0.5152 0.3702 0.8586 0.0196  -0.0534 -0.0306 216 TYR B CG  
4666 C CD1 . TYR B 221 ? 0.5193 0.3697 0.8878 0.0176  -0.0587 -0.0127 216 TYR B CD1 
4667 C CD2 . TYR B 221 ? 0.5060 0.3803 0.7995 0.0162  -0.0269 -0.0271 216 TYR B CD2 
4668 C CE1 . TYR B 221 ? 0.5069 0.3734 0.8493 0.0133  -0.0377 0.0067  216 TYR B CE1 
4669 C CE2 . TYR B 221 ? 0.4637 0.3511 0.7339 0.0118  -0.0081 -0.0089 216 TYR B CE2 
4670 C CZ  . TYR B 221 ? 0.4809 0.3654 0.7741 0.0109  -0.0132 0.0069  216 TYR B CZ  
4671 O OH  . TYR B 221 ? 0.5008 0.4002 0.7708 0.0084  0.0040  0.0225  216 TYR B OH  
4672 N N   . ARG B 222 ? 0.5146 0.4002 0.7920 0.0566  -0.0556 -0.1220 217 ARG B N   
4673 C CA  . ARG B 222 ? 0.5007 0.4157 0.7304 0.0608  -0.0333 -0.1289 217 ARG B CA  
4674 C C   . ARG B 222 ? 0.5157 0.4498 0.7377 0.0793  -0.0381 -0.1553 217 ARG B C   
4675 O O   . ARG B 222 ? 0.4910 0.4449 0.6866 0.0783  -0.0206 -0.1489 217 ARG B O   
4676 C CB  . ARG B 222 ? 0.4947 0.4245 0.7001 0.0621  -0.0266 -0.1380 217 ARG B CB  
4677 C CG  . ARG B 222 ? 0.4822 0.4106 0.6685 0.0449  -0.0078 -0.1110 217 ARG B CG  
4678 C CD  . ARG B 222 ? 0.5066 0.4588 0.6607 0.0491  0.0024  -0.1217 217 ARG B CD  
4679 N NE  . ARG B 222 ? 0.4797 0.4244 0.6448 0.0502  -0.0085 -0.1297 217 ARG B NE  
4680 C CZ  . ARG B 222 ? 0.4779 0.4419 0.6312 0.0627  -0.0133 -0.1522 217 ARG B CZ  
4681 N NH1 . ARG B 222 ? 0.4302 0.4271 0.5606 0.0763  -0.0079 -0.1682 217 ARG B NH1 
4682 N NH2 . ARG B 222 ? 0.4944 0.4480 0.6611 0.0622  -0.0245 -0.1578 217 ARG B NH2 
4683 N N   . LYS B 223 ? 0.5460 0.4770 0.7914 0.0972  -0.0628 -0.1860 218 LYS B N   
4684 C CA  . LYS B 223 ? 0.5831 0.5350 0.8256 0.1196  -0.0718 -0.2156 218 LYS B CA  
4685 C C   . LYS B 223 ? 0.5826 0.5191 0.8467 0.1183  -0.0773 -0.2070 218 LYS B C   
4686 O O   . LYS B 223 ? 0.5891 0.5490 0.8342 0.1261  -0.0674 -0.2123 218 LYS B O   
4687 C CB  . LYS B 223 ? 0.6076 0.5590 0.8732 0.1429  -0.1019 -0.2555 218 LYS B CB  
4688 C CG  . LYS B 223 ? 0.6443 0.6159 0.8896 0.1493  -0.0999 -0.2698 218 LYS B CG  
4689 C CD  . LYS B 223 ? 0.6985 0.6703 0.9692 0.1760  -0.1338 -0.3137 218 LYS B CD  
4690 C CE  . LYS B 223 ? 0.7145 0.7111 0.9632 0.1844  -0.1320 -0.3289 218 LYS B CE  
4691 N NZ  . LYS B 223 ? 0.7603 0.7808 1.0163 0.2196  -0.1587 -0.3784 218 LYS B NZ  
4692 N N   . GLU B 224 ? 0.5933 0.4936 0.9001 0.1088  -0.0943 -0.1926 219 GLU B N   
4693 C CA  . GLU B 224 ? 0.6012 0.4860 0.9325 0.1051  -0.0998 -0.1778 219 GLU B CA  
4694 C C   . GLU B 224 ? 0.5768 0.4765 0.8750 0.0912  -0.0695 -0.1490 219 GLU B C   
4695 O O   . GLU B 224 ? 0.5759 0.4820 0.8731 0.0962  -0.0674 -0.1494 219 GLU B O   
4696 C CB  . GLU B 224 ? 0.6112 0.4596 0.9953 0.0929  -0.1205 -0.1567 219 GLU B CB  
4697 C CG  . GLU B 224 ? 0.6796 0.5046 1.1144 0.1082  -0.1601 -0.1850 219 GLU B CG  
4698 C CD  . GLU B 224 ? 0.7214 0.5123 1.2141 0.0920  -0.1810 -0.1569 219 GLU B CD  
4699 O OE1 . GLU B 224 ? 0.7515 0.5176 1.2975 0.0982  -0.2130 -0.1636 219 GLU B OE1 
4700 O OE2 . GLU B 224 ? 0.7211 0.5119 1.2089 0.0730  -0.1664 -0.1262 219 GLU B OE2 
4701 N N   . LEU B 225 ? 0.5548 0.4598 0.8279 0.0753  -0.0484 -0.1262 220 LEU B N   
4702 C CA  . LEU B 225 ? 0.5330 0.4511 0.7766 0.0639  -0.0234 -0.1024 220 LEU B CA  
4703 C C   . LEU B 225 ? 0.5294 0.4780 0.7384 0.0735  -0.0104 -0.1190 220 LEU B C   
4704 O O   . LEU B 225 ? 0.5212 0.4790 0.7220 0.0733  -0.0022 -0.1125 220 LEU B O   
4705 C CB  . LEU B 225 ? 0.5124 0.4294 0.7389 0.0477  -0.0074 -0.0783 220 LEU B CB  
4706 C CG  . LEU B 225 ? 0.4819 0.4128 0.6766 0.0383  0.0157  -0.0588 220 LEU B CG  
4707 C CD1 . LEU B 225 ? 0.4760 0.4044 0.6830 0.0374  0.0156  -0.0446 220 LEU B CD1 
4708 C CD2 . LEU B 225 ? 0.4585 0.3856 0.6450 0.0259  0.0255  -0.0375 220 LEU B CD2 
4709 N N   . GLY B 226 ? 0.5366 0.5046 0.7273 0.0819  -0.0089 -0.1383 221 GLY B N   
4710 C CA  . GLY B 226 ? 0.5311 0.5364 0.6943 0.0928  0.0013  -0.1524 221 GLY B CA  
4711 C C   . GLY B 226 ? 0.5412 0.5567 0.7169 0.1099  -0.0099 -0.1715 221 GLY B C   
4712 O O   . GLY B 226 ? 0.5334 0.5728 0.6924 0.1115  0.0022  -0.1679 221 GLY B O   
4713 N N   . ALA B 227 ? 0.5612 0.5581 0.7690 0.1231  -0.0348 -0.1920 222 ALA B N   
4714 C CA  . ALA B 227 ? 0.5808 0.5848 0.8040 0.1418  -0.0491 -0.2133 222 ALA B CA  
4715 C C   . ALA B 227 ? 0.5778 0.5668 0.8094 0.1297  -0.0425 -0.1890 222 ALA B C   
4716 O O   . ALA B 227 ? 0.5819 0.5929 0.8025 0.1372  -0.0360 -0.1934 222 ALA B O   
4717 C CB  . ALA B 227 ? 0.5996 0.5804 0.8620 0.1579  -0.0821 -0.2406 222 ALA B CB  
4718 N N   . GLN B 228 ? 0.5767 0.5333 0.8268 0.1115  -0.0431 -0.1619 223 GLN B N   
4719 C CA  . GLN B 228 ? 0.5770 0.5236 0.8329 0.0996  -0.0353 -0.1350 223 GLN B CA  
4720 C C   . GLN B 228 ? 0.5531 0.5258 0.7705 0.0924  -0.0095 -0.1227 223 GLN B C   
4721 O O   . GLN B 228 ? 0.5528 0.5361 0.7683 0.0969  -0.0068 -0.1228 223 GLN B O   
4722 C CB  . GLN B 228 ? 0.5837 0.5026 0.8621 0.0823  -0.0378 -0.1050 223 GLN B CB  
4723 C CG  . GLN B 228 ? 0.6122 0.5275 0.8962 0.0720  -0.0297 -0.0752 223 GLN B CG  
4724 C CD  . GLN B 228 ? 0.6807 0.5708 1.0144 0.0689  -0.0502 -0.0580 223 GLN B CD  
4725 O OE1 . GLN B 228 ? 0.6891 0.5709 1.0373 0.0554  -0.0485 -0.0286 223 GLN B OE1 
4726 N NE2 . GLN B 228 ? 0.6967 0.5773 1.0591 0.0819  -0.0708 -0.0748 223 GLN B NE2 
4727 N N   . LEU B 229 ? 0.5260 0.5085 0.7163 0.0817  0.0070  -0.1126 224 LEU B N   
4728 C CA  . LEU B 229 ? 0.5138 0.5175 0.6737 0.0734  0.0277  -0.0996 224 LEU B CA  
4729 C C   . LEU B 229 ? 0.5061 0.5425 0.6535 0.0852  0.0314  -0.1148 224 LEU B C   
4730 O O   . LEU B 229 ? 0.4868 0.5340 0.6253 0.0809  0.0408  -0.1043 224 LEU B O   
4731 C CB  . LEU B 229 ? 0.4906 0.5005 0.6274 0.0627  0.0405  -0.0909 224 LEU B CB  
4732 C CG  . LEU B 229 ? 0.5184 0.5060 0.6571 0.0481  0.0449  -0.0680 224 LEU B CG  
4733 C CD1 . LEU B 229 ? 0.4851 0.4801 0.5994 0.0388  0.0573  -0.0607 224 LEU B CD1 
4734 C CD2 . LEU B 229 ? 0.5209 0.5056 0.6607 0.0431  0.0499  -0.0511 224 LEU B CD2 
4735 N N   . HIS B 230 ? 0.5247 0.5814 0.6707 0.1008  0.0243  -0.1389 225 HIS B N   
4736 C CA  . HIS B 230 ? 0.5418 0.6403 0.6754 0.1150  0.0282  -0.1531 225 HIS B CA  
4737 C C   . HIS B 230 ? 0.5495 0.6472 0.6995 0.1262  0.0190  -0.1621 225 HIS B C   
4738 O O   . HIS B 230 ? 0.5518 0.6791 0.6911 0.1294  0.0278  -0.1602 225 HIS B O   
4739 C CB  . HIS B 230 ? 0.5667 0.6919 0.6958 0.1334  0.0206  -0.1789 225 HIS B CB  
4740 C CG  . HIS B 230 ? 0.5982 0.7706 0.7214 0.1554  0.0190  -0.1990 225 HIS B CG  
4741 N ND1 . HIS B 230 ? 0.6505 0.8272 0.7907 0.1808  -0.0016 -0.2315 225 HIS B ND1 
4742 C CD2 . HIS B 230 ? 0.6281 0.8476 0.7329 0.1566  0.0342  -0.1905 225 HIS B CD2 
4743 C CE1 . HIS B 230 ? 0.6501 0.8781 0.7790 0.1987  0.0024  -0.2437 225 HIS B CE1 
4744 N NE2 . HIS B 230 ? 0.6476 0.9039 0.7557 0.1835  0.0248  -0.2171 225 HIS B NE2 
4745 N N   . GLN B 231 ? 0.5568 0.6208 0.7359 0.1314  0.0000  -0.1699 226 GLN B N   
4746 C CA  . GLN B 231 ? 0.5611 0.6174 0.7612 0.1412  -0.0118 -0.1767 226 GLN B CA  
4747 C C   . GLN B 231 ? 0.5425 0.5889 0.7393 0.1244  0.0008  -0.1479 226 GLN B C   
4748 O O   . GLN B 231 ? 0.5289 0.5913 0.7243 0.1304  0.0032  -0.1496 226 GLN B O   
4749 C CB  . GLN B 231 ? 0.5795 0.5995 0.8181 0.1489  -0.0385 -0.1889 226 GLN B CB  
4750 C CG  . GLN B 231 ? 0.6261 0.6366 0.8921 0.1617  -0.0556 -0.1990 226 GLN B CG  
4751 C CD  . GLN B 231 ? 0.6833 0.7353 0.9353 0.1845  -0.0555 -0.2260 226 GLN B CD  
4752 O OE1 . GLN B 231 ? 0.7187 0.7841 0.9654 0.1847  -0.0475 -0.2184 226 GLN B OE1 
4753 N NE2 . GLN B 231 ? 0.6717 0.7491 0.9169 0.2050  -0.0639 -0.2570 226 GLN B NE2 
4754 N N   . LEU B 232 ? 0.5182 0.5424 0.7125 0.1054  0.0086  -0.1230 227 LEU B N   
4755 C CA  . LEU B 232 ? 0.5027 0.5213 0.6910 0.0915  0.0202  -0.0969 227 LEU B CA  
4756 C C   . LEU B 232 ? 0.4844 0.5330 0.6449 0.0876  0.0372  -0.0930 227 LEU B C   
4757 O O   . LEU B 232 ? 0.4760 0.5292 0.6353 0.0850  0.0415  -0.0832 227 LEU B O   
4758 C CB  . LEU B 232 ? 0.4908 0.4874 0.6802 0.0756  0.0246  -0.0733 227 LEU B CB  
4759 C CG  . LEU B 232 ? 0.5217 0.4894 0.7459 0.0750  0.0078  -0.0660 227 LEU B CG  
4760 C CD1 . LEU B 232 ? 0.5268 0.4847 0.7491 0.0600  0.0159  -0.0377 227 LEU B CD1 
4761 C CD2 . LEU B 232 ? 0.5228 0.4809 0.7770 0.0826  -0.0067 -0.0650 227 LEU B CD2 
4762 N N   . VAL B 233 ? 0.4742 0.5444 0.6157 0.0870  0.0452  -0.0992 228 VAL B N   
4763 C CA  . VAL B 233 ? 0.4700 0.5702 0.5912 0.0811  0.0593  -0.0915 228 VAL B CA  
4764 C C   . VAL B 233 ? 0.4835 0.6149 0.6078 0.0951  0.0575  -0.1039 228 VAL B C   
4765 O O   . VAL B 233 ? 0.4712 0.6189 0.5900 0.0897  0.0652  -0.0934 228 VAL B O   
4766 C CB  . VAL B 233 ? 0.4705 0.5887 0.5761 0.0773  0.0665  -0.0917 228 VAL B CB  
4767 C CG1 . VAL B 233 ? 0.4561 0.6125 0.5490 0.0730  0.0776  -0.0830 228 VAL B CG1 
4768 C CG2 . VAL B 233 ? 0.4723 0.5611 0.5729 0.0622  0.0697  -0.0772 228 VAL B CG2 
4769 N N   . LEU B 234 ? 0.4927 0.6326 0.6276 0.1142  0.0457  -0.1276 229 LEU B N   
4770 C CA  . LEU B 234 ? 0.5098 0.6784 0.6500 0.1319  0.0409  -0.1436 229 LEU B CA  
4771 C C   . LEU B 234 ? 0.5081 0.6554 0.6643 0.1315  0.0349  -0.1382 229 LEU B C   
4772 O O   . LEU B 234 ? 0.5077 0.6796 0.6607 0.1350  0.0398  -0.1366 229 LEU B O   
4773 C CB  . LEU B 234 ? 0.5308 0.7105 0.6803 0.1558  0.0255  -0.1746 229 LEU B CB  
4774 C CG  . LEU B 234 ? 0.5654 0.8036 0.7005 0.1743  0.0293  -0.1916 229 LEU B CG  
4775 C CD1 . LEU B 234 ? 0.5576 0.8208 0.6715 0.1614  0.0456  -0.1749 229 LEU B CD1 
4776 C CD2 . LEU B 234 ? 0.6083 0.8486 0.7561 0.2013  0.0084  -0.2276 229 LEU B CD2 
4777 N N   . ASN B 235 ? 0.5147 0.6197 0.6898 0.1275  0.0240  -0.1334 230 ASN B N   
4778 C CA  . ASN B 235 ? 0.5165 0.6033 0.7087 0.1267  0.0180  -0.1239 230 ASN B CA  
4779 C C   . ASN B 235 ? 0.4916 0.5860 0.6670 0.1112  0.0341  -0.1008 230 ASN B C   
4780 O O   . ASN B 235 ? 0.4860 0.5896 0.6646 0.1141  0.0347  -0.0978 230 ASN B O   
4781 C CB  . ASN B 235 ? 0.5243 0.5695 0.7432 0.1225  0.0041  -0.1149 230 ASN B CB  
4782 C CG  . ASN B 235 ? 0.5626 0.5936 0.8093 0.1393  -0.0191 -0.1393 230 ASN B CG  
4783 O OD1 . ASN B 235 ? 0.5832 0.6366 0.8281 0.1581  -0.0260 -0.1670 230 ASN B OD1 
4784 N ND2 . ASN B 235 ? 0.5762 0.5722 0.8510 0.1333  -0.0328 -0.1285 230 ASN B ND2 
4785 N N   . SER B 236 ? 0.4747 0.5651 0.6336 0.0959  0.0452  -0.0863 231 SER B N   
4786 C CA  . SER B 236 ? 0.4565 0.5525 0.6012 0.0827  0.0568  -0.0681 231 SER B CA  
4787 C C   . SER B 236 ? 0.4545 0.5866 0.5898 0.0845  0.0638  -0.0712 231 SER B C   
4788 O O   . SER B 236 ? 0.4407 0.5788 0.5757 0.0812  0.0662  -0.0630 231 SER B O   
4789 C CB  . SER B 236 ? 0.4484 0.5342 0.5790 0.0691  0.0641  -0.0569 231 SER B CB  
4790 O OG  . SER B 236 ? 0.4463 0.5305 0.5674 0.0588  0.0703  -0.0417 231 SER B OG  
4791 N N   . ALA B 237 ? 0.4597 0.6194 0.5886 0.0900  0.0666  -0.0815 232 ALA B N   
4792 C CA  . ALA B 237 ? 0.4622 0.6647 0.5859 0.0919  0.0733  -0.0807 232 ALA B CA  
4793 C C   . ALA B 237 ? 0.4689 0.6857 0.6033 0.1056  0.0681  -0.0903 232 ALA B C   
4794 O O   . ALA B 237 ? 0.4630 0.6991 0.5971 0.1010  0.0728  -0.0810 232 ALA B O   
4795 C CB  . ALA B 237 ? 0.4667 0.7044 0.5831 0.0986  0.0770  -0.0886 232 ALA B CB  
4796 N N   . ARG B 238 ? 0.4824 0.6883 0.6291 0.1225  0.0562  -0.1092 233 ARG B N   
4797 C CA  . ARG B 238 ? 0.4967 0.7087 0.6570 0.1372  0.0479  -0.1200 233 ARG B CA  
4798 C C   . ARG B 238 ? 0.4829 0.6709 0.6491 0.1269  0.0480  -0.1033 233 ARG B C   
4799 O O   . ARG B 238 ? 0.4606 0.6688 0.6280 0.1293  0.0504  -0.1009 233 ARG B O   
4800 C CB  . ARG B 238 ? 0.5331 0.7301 0.7101 0.1568  0.0305  -0.1444 233 ARG B CB  
4801 C CG  . ARG B 238 ? 0.6072 0.7800 0.8083 0.1670  0.0151  -0.1506 233 ARG B CG  
4802 C CD  . ARG B 238 ? 0.7053 0.8305 0.9274 0.1648  0.0001  -0.1502 233 ARG B CD  
4803 N NE  . ARG B 238 ? 0.7716 0.8787 1.0249 0.1824  -0.0227 -0.1671 233 ARG B NE  
4804 C CZ  . ARG B 238 ? 0.7991 0.8677 1.0806 0.1833  -0.0413 -0.1684 233 ARG B CZ  
4805 N NH1 . ARG B 238 ? 0.8251 0.8773 1.1399 0.1996  -0.0651 -0.1837 233 ARG B NH1 
4806 N NH2 . ARG B 238 ? 0.7950 0.8416 1.0750 0.1678  -0.0379 -0.1536 233 ARG B NH2 
4807 N N   . GLU B 239 ? 0.4725 0.6225 0.6422 0.1164  0.0457  -0.0909 234 GLU B N   
4808 C CA  . GLU B 239 ? 0.4695 0.6024 0.6428 0.1083  0.0462  -0.0735 234 GLU B CA  
4809 C C   . GLU B 239 ? 0.4424 0.5945 0.6002 0.0969  0.0573  -0.0614 234 GLU B C   
4810 O O   . GLU B 239 ? 0.4483 0.6036 0.6093 0.0971  0.0566  -0.0550 234 GLU B O   
4811 C CB  . GLU B 239 ? 0.4687 0.5679 0.6470 0.0998  0.0433  -0.0597 234 GLU B CB  
4812 C CG  . GLU B 239 ? 0.5334 0.6245 0.7098 0.0921  0.0463  -0.0391 234 GLU B CG  
4813 C CD  . GLU B 239 ? 0.6080 0.6774 0.7857 0.0840  0.0464  -0.0223 234 GLU B CD  
4814 O OE1 . GLU B 239 ? 0.6286 0.7009 0.7879 0.0747  0.0550  -0.0134 234 GLU B OE1 
4815 O OE2 . GLU B 239 ? 0.6358 0.6870 0.8357 0.0875  0.0364  -0.0175 234 GLU B OE2 
4816 N N   . LYS B 240 ? 0.4134 0.5775 0.5577 0.0872  0.0653  -0.0582 235 LYS B N   
4817 C CA  . LYS B 240 ? 0.3983 0.5803 0.5347 0.0760  0.0718  -0.0476 235 LYS B CA  
4818 C C   . LYS B 240 ? 0.3776 0.5965 0.5199 0.0828  0.0728  -0.0520 235 LYS B C   
4819 O O   . LYS B 240 ? 0.3685 0.5970 0.5127 0.0771  0.0735  -0.0439 235 LYS B O   
4820 C CB  . LYS B 240 ? 0.4004 0.5864 0.5268 0.0642  0.0775  -0.0416 235 LYS B CB  
4821 C CG  . LYS B 240 ? 0.4368 0.6384 0.5619 0.0508  0.0801  -0.0291 235 LYS B CG  
4822 C CD  . LYS B 240 ? 0.4988 0.7237 0.6223 0.0436  0.0849  -0.0237 235 LYS B CD  
4823 C CE  . LYS B 240 ? 0.5247 0.7728 0.6572 0.0307  0.0845  -0.0089 235 LYS B CE  
4824 N NZ  . LYS B 240 ? 0.5393 0.7578 0.6709 0.0183  0.0786  -0.0017 235 LYS B NZ  
4825 N N   . ARG B 241 ? 0.3701 0.6127 0.5158 0.0962  0.0721  -0.0657 236 ARG B N   
4826 C CA  . ARG B 241 ? 0.3798 0.6645 0.5312 0.1060  0.0732  -0.0707 236 ARG B CA  
4827 C C   . ARG B 241 ? 0.3723 0.6476 0.5337 0.1140  0.0668  -0.0741 236 ARG B C   
4828 O O   . ARG B 241 ? 0.3593 0.6585 0.5242 0.1120  0.0691  -0.0678 236 ARG B O   
4829 C CB  . ARG B 241 ? 0.3953 0.7119 0.5468 0.1241  0.0722  -0.0885 236 ARG B CB  
4830 C CG  . ARG B 241 ? 0.4227 0.7960 0.5785 0.1363  0.0752  -0.0923 236 ARG B CG  
4831 C CD  . ARG B 241 ? 0.5206 0.9269 0.6757 0.1617  0.0710  -0.1163 236 ARG B CD  
4832 N NE  . ARG B 241 ? 0.5880 0.9816 0.7545 0.1821  0.0583  -0.1379 236 ARG B NE  
4833 C CZ  . ARG B 241 ? 0.6211 1.0575 0.7926 0.2054  0.0543  -0.1553 236 ARG B CZ  
4834 N NH1 . ARG B 241 ? 0.6225 1.1248 0.7874 0.2127  0.0636  -0.1528 236 ARG B NH1 
4835 N NH2 . ARG B 241 ? 0.6560 1.0716 0.8409 0.2225  0.0399  -0.1744 236 ARG B NH2 
4836 N N   . ASP B 242 ? 0.3732 0.6150 0.5419 0.1223  0.0579  -0.0819 237 ASP B N   
4837 C CA  . ASP B 242 ? 0.3872 0.6167 0.5678 0.1293  0.0506  -0.0818 237 ASP B CA  
4838 C C   . ASP B 242 ? 0.3692 0.5923 0.5450 0.1158  0.0547  -0.0639 237 ASP B C   
4839 O O   . ASP B 242 ? 0.3608 0.5998 0.5415 0.1192  0.0538  -0.0625 237 ASP B O   
4840 C CB  . ASP B 242 ? 0.4071 0.5988 0.6016 0.1363  0.0389  -0.0860 237 ASP B CB  
4841 C CG  . ASP B 242 ? 0.4843 0.6791 0.6885 0.1532  0.0293  -0.1088 237 ASP B CG  
4842 O OD1 . ASP B 242 ? 0.5410 0.7722 0.7440 0.1673  0.0294  -0.1250 237 ASP B OD1 
4843 O OD2 . ASP B 242 ? 0.5650 0.7283 0.7798 0.1538  0.0203  -0.1108 237 ASP B OD2 
4844 N N   . MET B 243 ? 0.3540 0.5553 0.5204 0.1024  0.0579  -0.0521 238 MET B N   
4845 C CA  . MET B 243 ? 0.3585 0.5547 0.5191 0.0928  0.0594  -0.0390 238 MET B CA  
4846 C C   . MET B 243 ? 0.3508 0.5763 0.5104 0.0865  0.0625  -0.0368 238 MET B C   
4847 O O   . MET B 243 ? 0.3587 0.5916 0.5219 0.0871  0.0598  -0.0332 238 MET B O   
4848 C CB  . MET B 243 ? 0.3488 0.5227 0.4982 0.0820  0.0617  -0.0303 238 MET B CB  
4849 C CG  . MET B 243 ? 0.3897 0.5387 0.5428 0.0859  0.0578  -0.0229 238 MET B CG  
4850 S SD  . MET B 243 ? 0.4777 0.6091 0.6163 0.0759  0.0610  -0.0122 238 MET B SD  
4851 C CE  . MET B 243 ? 0.4735 0.6033 0.6057 0.0683  0.0657  -0.0201 238 MET B CE  
4852 N N   . GLU B 244 ? 0.3423 0.5862 0.4994 0.0800  0.0673  -0.0368 239 GLU B N   
4853 C CA  . GLU B 244 ? 0.3347 0.6095 0.4973 0.0717  0.0690  -0.0296 239 GLU B CA  
4854 C C   . GLU B 244 ? 0.3191 0.6236 0.4919 0.0828  0.0680  -0.0344 239 GLU B C   
4855 O O   . GLU B 244 ? 0.3119 0.6296 0.4918 0.0774  0.0656  -0.0276 239 GLU B O   
4856 C CB  . GLU B 244 ? 0.3323 0.6278 0.4943 0.0633  0.0742  -0.0242 239 GLU B CB  
4857 C CG  . GLU B 244 ? 0.3727 0.6885 0.5456 0.0474  0.0725  -0.0088 239 GLU B CG  
4858 C CD  . GLU B 244 ? 0.4135 0.7638 0.5924 0.0401  0.0777  0.0020  239 GLU B CD  
4859 O OE1 . GLU B 244 ? 0.3860 0.7738 0.5814 0.0331  0.0773  0.0156  239 GLU B OE1 
4860 O OE2 . GLU B 244 ? 0.4402 0.7836 0.6092 0.0417  0.0820  -0.0013 239 GLU B OE2 
4861 N N   . GLN B 245 ? 0.3147 0.6293 0.4898 0.0992  0.0680  -0.0476 240 GLN B N   
4862 C CA  . GLN B 245 ? 0.3243 0.6661 0.5094 0.1131  0.0655  -0.0549 240 GLN B CA  
4863 C C   . GLN B 245 ? 0.3182 0.6397 0.5075 0.1143  0.0597  -0.0519 240 GLN B C   
4864 O O   . GLN B 245 ? 0.3056 0.6506 0.5018 0.1140  0.0590  -0.0481 240 GLN B O   
4865 C CB  . GLN B 245 ? 0.3255 0.6794 0.5137 0.1343  0.0627  -0.0742 240 GLN B CB  
4866 C CG  . GLN B 245 ? 0.3623 0.7527 0.5456 0.1365  0.0691  -0.0770 240 GLN B CG  
4867 C CD  . GLN B 245 ? 0.3919 0.8070 0.5776 0.1616  0.0649  -0.0999 240 GLN B CD  
4868 O OE1 . GLN B 245 ? 0.4527 0.9226 0.6396 0.1714  0.0694  -0.1025 240 GLN B OE1 
4869 N NE2 . GLN B 245 ? 0.4169 0.7955 0.6055 0.1728  0.0550  -0.1162 240 GLN B NE2 
4870 N N   . ARG B 246 ? 0.3219 0.6040 0.5080 0.1152  0.0554  -0.0513 241 ARG B N   
4871 C CA  . ARG B 246 ? 0.3464 0.6129 0.5357 0.1170  0.0503  -0.0452 241 ARG B CA  
4872 C C   . ARG B 246 ? 0.3266 0.6014 0.5113 0.1049  0.0511  -0.0353 241 ARG B C   
4873 O O   . ARG B 246 ? 0.3366 0.6229 0.5269 0.1084  0.0476  -0.0337 241 ARG B O   
4874 C CB  . ARG B 246 ? 0.3534 0.5833 0.5407 0.1173  0.0469  -0.0394 241 ARG B CB  
4875 C CG  . ARG B 246 ? 0.4397 0.6540 0.6349 0.1258  0.0430  -0.0483 241 ARG B CG  
4876 C CD  . ARG B 246 ? 0.5594 0.7725 0.7739 0.1428  0.0329  -0.0575 241 ARG B CD  
4877 N NE  . ARG B 246 ? 0.6499 0.8410 0.8759 0.1500  0.0248  -0.0663 241 ARG B NE  
4878 C CZ  . ARG B 246 ? 0.6850 0.8600 0.9339 0.1631  0.0108  -0.0719 241 ARG B CZ  
4879 N NH1 . ARG B 246 ? 0.7090 0.8879 0.9704 0.1707  0.0047  -0.0685 241 ARG B NH1 
4880 N NH2 . ARG B 246 ? 0.7083 0.8622 0.9705 0.1685  0.0010  -0.0810 241 ARG B NH2 
4881 N N   . HIS B 247 ? 0.3036 0.5720 0.4804 0.0915  0.0536  -0.0299 242 HIS B N   
4882 C CA  . HIS B 247 ? 0.2902 0.5624 0.4663 0.0803  0.0500  -0.0233 242 HIS B CA  
4883 C C   . HIS B 247 ? 0.2881 0.5950 0.4782 0.0768  0.0487  -0.0212 242 HIS B C   
4884 O O   . HIS B 247 ? 0.2929 0.6050 0.4884 0.0746  0.0421  -0.0189 242 HIS B O   
4885 C CB  . HIS B 247 ? 0.2717 0.5313 0.4412 0.0676  0.0511  -0.0196 242 HIS B CB  
4886 C CG  . HIS B 247 ? 0.2897 0.5187 0.4458 0.0693  0.0510  -0.0192 242 HIS B CG  
4887 N ND1 . HIS B 247 ? 0.2974 0.5119 0.4459 0.0601  0.0495  -0.0170 242 HIS B ND1 
4888 C CD2 . HIS B 247 ? 0.3059 0.5190 0.4577 0.0793  0.0513  -0.0187 242 HIS B CD2 
4889 C CE1 . HIS B 247 ? 0.3208 0.5147 0.4583 0.0652  0.0504  -0.0159 242 HIS B CE1 
4890 N NE2 . HIS B 247 ? 0.2999 0.4932 0.4405 0.0759  0.0516  -0.0150 242 HIS B NE2 
4891 N N   . VAL B 248 ? 0.2822 0.6169 0.4790 0.0777  0.0544  -0.0216 243 VAL B N   
4892 C CA  . VAL B 248 ? 0.3042 0.6807 0.5169 0.0762  0.0542  -0.0166 243 VAL B CA  
4893 C C   . VAL B 248 ? 0.3160 0.7001 0.5332 0.0894  0.0508  -0.0229 243 VAL B C   
4894 O O   . VAL B 248 ? 0.3046 0.7058 0.5331 0.0851  0.0460  -0.0176 243 VAL B O   
4895 C CB  . VAL B 248 ? 0.2919 0.7084 0.5098 0.0786  0.0621  -0.0146 243 VAL B CB  
4896 C CG1 . VAL B 248 ? 0.2964 0.7629 0.5333 0.0761  0.0621  -0.0046 243 VAL B CG1 
4897 C CG2 . VAL B 248 ? 0.3043 0.7154 0.5196 0.0647  0.0647  -0.0056 243 VAL B CG2 
4898 N N   . LEU B 249 ? 0.3439 0.7138 0.5554 0.1052  0.0515  -0.0336 244 LEU B N   
4899 C CA  . LEU B 249 ? 0.3564 0.7320 0.5744 0.1181  0.0470  -0.0384 244 LEU B CA  
4900 C C   . LEU B 249 ? 0.3556 0.7107 0.5703 0.1131  0.0409  -0.0322 244 LEU B C   
4901 O O   . LEU B 249 ? 0.3523 0.7240 0.5747 0.1145  0.0367  -0.0306 244 LEU B O   
4902 C CB  . LEU B 249 ? 0.3649 0.7265 0.5835 0.1360  0.0450  -0.0501 244 LEU B CB  
4903 C CG  . LEU B 249 ? 0.3782 0.7622 0.5999 0.1479  0.0476  -0.0627 244 LEU B CG  
4904 C CD1 . LEU B 249 ? 0.3892 0.7428 0.6139 0.1622  0.0406  -0.0743 244 LEU B CD1 
4905 C CD2 . LEU B 249 ? 0.3712 0.8050 0.6032 0.1585  0.0487  -0.0676 244 LEU B CD2 
4906 N N   . LEU B 250 ? 0.3725 0.6959 0.5754 0.1080  0.0400  -0.0290 245 LEU B N   
4907 C CA  . LEU B 250 ? 0.3882 0.6991 0.5853 0.1060  0.0338  -0.0246 245 LEU B CA  
4908 C C   . LEU B 250 ? 0.3960 0.7252 0.6010 0.0962  0.0275  -0.0229 245 LEU B C   
4909 O O   . LEU B 250 ? 0.4090 0.7489 0.6189 0.1011  0.0215  -0.0235 245 LEU B O   
4910 C CB  . LEU B 250 ? 0.3917 0.6742 0.5745 0.1029  0.0342  -0.0213 245 LEU B CB  
4911 C CG  . LEU B 250 ? 0.3981 0.6612 0.5769 0.1132  0.0353  -0.0171 245 LEU B CG  
4912 C CD1 . LEU B 250 ? 0.3458 0.5889 0.5118 0.1084  0.0369  -0.0123 245 LEU B CD1 
4913 C CD2 . LEU B 250 ? 0.4196 0.6891 0.6010 0.1240  0.0302  -0.0118 245 LEU B CD2 
4914 N N   . LYS B 251 ? 0.3985 0.7329 0.6086 0.0823  0.0274  -0.0198 246 LYS B N   
4915 C CA  . LYS B 251 ? 0.4059 0.7547 0.6311 0.0706  0.0176  -0.0161 246 LYS B CA  
4916 C C   . LYS B 251 ? 0.4140 0.7991 0.6586 0.0708  0.0166  -0.0124 246 LYS B C   
4917 O O   . LYS B 251 ? 0.4259 0.8211 0.6851 0.0647  0.0055  -0.0103 246 LYS B O   
4918 C CB  . LYS B 251 ? 0.3967 0.7430 0.6289 0.0544  0.0163  -0.0096 246 LYS B CB  
4919 C CG  . LYS B 251 ? 0.3852 0.6985 0.6005 0.0526  0.0161  -0.0130 246 LYS B CG  
4920 C CD  . LYS B 251 ? 0.3851 0.7011 0.6119 0.0364  0.0148  -0.0046 246 LYS B CD  
4921 C CE  . LYS B 251 ? 0.3726 0.6600 0.5825 0.0351  0.0179  -0.0074 246 LYS B CE  
4922 N NZ  . LYS B 251 ? 0.3782 0.6747 0.5992 0.0211  0.0206  0.0032  246 LYS B NZ  
4923 N N   . GLN B 252 ? 0.4233 0.8303 0.6700 0.0786  0.0264  -0.0126 247 GLN B N   
4924 C CA  . GLN B 252 ? 0.4435 0.8923 0.7089 0.0804  0.0264  -0.0084 247 GLN B CA  
4925 C C   . GLN B 252 ? 0.4683 0.9206 0.7328 0.0955  0.0236  -0.0157 247 GLN B C   
4926 O O   . GLN B 252 ? 0.4664 0.9498 0.7469 0.0958  0.0205  -0.0124 247 GLN B O   
4927 C CB  . GLN B 252 ? 0.4329 0.9156 0.7027 0.0838  0.0372  -0.0056 247 GLN B CB  
4928 C CG  . GLN B 252 ? 0.4167 0.9109 0.6948 0.0666  0.0392  0.0078  247 GLN B CG  
4929 C CD  . GLN B 252 ? 0.4017 0.9263 0.7087 0.0496  0.0310  0.0254  247 GLN B CD  
4930 O OE1 . GLN B 252 ? 0.3664 0.9234 0.6885 0.0531  0.0290  0.0289  247 GLN B OE1 
4931 N NE2 . GLN B 252 ? 0.3919 0.9057 0.7098 0.0310  0.0246  0.0374  247 GLN B NE2 
4932 N N   . LYS B 253 ? 0.5013 0.9234 0.7496 0.1072  0.0241  -0.0231 248 LYS B N   
4933 C CA  . LYS B 253 ? 0.5319 0.9578 0.7809 0.1238  0.0226  -0.0284 248 LYS B CA  
4934 C C   . LYS B 253 ? 0.5423 0.9440 0.7816 0.1291  0.0162  -0.0280 248 LYS B C   
4935 O O   . LYS B 253 ? 0.5571 0.9700 0.8016 0.1375  0.0112  -0.0285 248 LYS B O   
4936 C CB  . LYS B 253 ? 0.5342 0.9565 0.7808 0.1378  0.0284  -0.0358 248 LYS B CB  
4937 C CG  . LYS B 253 ? 0.5573 1.0180 0.8135 0.1411  0.0341  -0.0393 248 LYS B CG  
4938 C CD  . LYS B 253 ? 0.5907 1.0441 0.8434 0.1568  0.0365  -0.0515 248 LYS B CD  
4939 C CE  . LYS B 253 ? 0.6086 1.0737 0.8707 0.1769  0.0316  -0.0617 248 LYS B CE  
4940 N NZ  . LYS B 253 ? 0.6501 1.0990 0.9124 0.1925  0.0288  -0.0758 248 LYS B NZ  
4941 N N   . GLU B 254 ? 0.5494 0.9232 0.7748 0.1250  0.0163  -0.0262 249 GLU B N   
4942 C CA  . GLU B 254 ? 0.5670 0.9215 0.7808 0.1338  0.0134  -0.0231 249 GLU B CA  
4943 C C   . GLU B 254 ? 0.5717 0.9186 0.7744 0.1292  0.0065  -0.0229 249 GLU B C   
4944 O O   . GLU B 254 ? 0.5893 0.9339 0.7828 0.1393  0.0030  -0.0196 249 GLU B O   
4945 C CB  . GLU B 254 ? 0.5721 0.9030 0.7799 0.1381  0.0192  -0.0200 249 GLU B CB  
4946 C CG  . GLU B 254 ? 0.6058 0.9394 0.8248 0.1454  0.0226  -0.0249 249 GLU B CG  
4947 C CD  . GLU B 254 ? 0.6655 1.0072 0.8962 0.1599  0.0177  -0.0249 249 GLU B CD  
4948 O OE1 . GLU B 254 ? 0.7151 1.0535 0.9438 0.1649  0.0133  -0.0163 249 GLU B OE1 
4949 O OE2 . GLU B 254 ? 0.6576 1.0116 0.8997 0.1680  0.0177  -0.0336 249 GLU B OE2 
4950 N N   . LEU B 255 ? 0.5623 0.9077 0.7669 0.1160  0.0033  -0.0261 250 LEU B N   
4951 C CA  . LEU B 255 ? 0.5601 0.8958 0.7550 0.1145  -0.0062 -0.0302 250 LEU B CA  
4952 C C   . LEU B 255 ? 0.5624 0.9137 0.7653 0.1168  -0.0206 -0.0368 250 LEU B C   
4953 O O   . LEU B 255 ? 0.5807 0.9366 0.7727 0.1302  -0.0261 -0.0394 250 LEU B O   
4954 C CB  . LEU B 255 ? 0.5569 0.8781 0.7516 0.1007  -0.0070 -0.0316 250 LEU B CB  
4955 C CG  . LEU B 255 ? 0.5517 0.8507 0.7284 0.1028  0.0004  -0.0293 250 LEU B CG  
4956 C CD1 . LEU B 255 ? 0.5365 0.8233 0.7158 0.0886  -0.0018 -0.0311 250 LEU B CD1 
4957 C CD2 . LEU B 255 ? 0.5354 0.8317 0.6948 0.1165  -0.0037 -0.0303 250 LEU B CD2 
4958 N N   . GLY B 256 ? 1.1883 0.7461 1.1286 0.0934  0.2839  -0.4075 251 GLY B N   
4959 C CA  . GLY B 256 ? 1.1118 0.7376 1.1495 0.1032  0.2961  -0.4152 251 GLY B CA  
4960 C C   . GLY B 256 ? 1.0389 0.6986 1.0621 0.1033  0.2583  -0.3736 251 GLY B C   
4961 O O   . GLY B 256 ? 1.0196 0.6579 0.9702 0.0994  0.2188  -0.3374 251 GLY B O   
4962 N N   . GLY B 257 ? 0.9883 0.7034 1.0891 0.1079  0.2712  -0.3826 252 GLY B N   
4963 C CA  . GLY B 257 ? 0.9342 0.6793 1.0238 0.1058  0.2461  -0.3505 252 GLY B CA  
4964 C C   . GLY B 257 ? 0.8601 0.6699 1.0494 0.1317  0.2025  -0.3381 252 GLY B C   
4965 O O   . GLY B 257 ? 0.8264 0.6744 1.0461 0.1302  0.2007  -0.3323 252 GLY B O   
4966 N N   . GLU B 258 ? 0.8518 0.6652 1.0826 0.1542  0.1658  -0.3335 253 GLU B N   
4967 C CA  . GLU B 258 ? 0.8056 0.6612 1.1059 0.1779  0.1164  -0.3162 253 GLU B CA  
4968 C C   . GLU B 258 ? 0.7731 0.6240 1.0082 0.1733  0.0766  -0.2697 253 GLU B C   
4969 O O   . GLU B 258 ? 0.7873 0.6005 0.9461 0.1630  0.0679  -0.2501 253 GLU B O   
4970 C CB  . GLU B 258 ? 0.8276 0.6750 1.1852 0.2032  0.0901  -0.3266 253 GLU B CB  
4971 C CG  . GLU B 258 ? 0.9071 0.6983 1.1918 0.1999  0.0743  -0.3096 253 GLU B CG  
4972 C CD  . GLU B 258 ? 0.9933 0.7399 1.2245 0.1817  0.1214  -0.3356 253 GLU B CD  
4973 O OE1 . GLU B 258 ? 1.0401 0.7640 1.1856 0.1572  0.1409  -0.3257 253 GLU B OE1 
4974 O OE2 . GLU B 258 ? 1.0352 0.7628 1.3040 0.1922  0.1368  -0.3659 253 GLU B OE2 
4975 N N   . GLU B 259 ? 0.7212 0.6110 0.9910 0.1801  0.0537  -0.2559 254 GLU B N   
4976 C CA  . GLU B 259 ? 0.6920 0.5816 0.9164 0.1783  0.0176  -0.2165 254 GLU B CA  
4977 C C   . GLU B 259 ? 0.7027 0.5632 0.9088 0.1875  -0.0184 -0.1968 254 GLU B C   
4978 O O   . GLU B 259 ? 0.7072 0.5626 0.9632 0.2059  -0.0356 -0.2082 254 GLU B O   
4979 C CB  . GLU B 259 ? 0.6558 0.5862 0.9273 0.1865  -0.0024 -0.2114 254 GLU B CB  
4980 C CG  . GLU B 259 ? 0.6547 0.6092 0.9262 0.1712  0.0304  -0.2220 254 GLU B CG  
4981 C CD  . GLU B 259 ? 0.6778 0.6021 0.8613 0.1503  0.0549  -0.2087 254 GLU B CD  
4982 O OE1 . GLU B 259 ? 0.6655 0.5833 0.7999 0.1465  0.0342  -0.1789 254 GLU B OE1 
4983 O OE2 . GLU B 259 ? 0.7088 0.6117 0.8714 0.1378  0.0945  -0.2298 254 GLU B OE2 
4984 N N   . PRO B 260 ? 0.7021 0.5425 0.8405 0.1743  -0.0304 -0.1684 255 PRO B N   
4985 C CA  . PRO B 260 ? 0.7138 0.5250 0.8321 0.1768  -0.0606 -0.1490 255 PRO B CA  
4986 C C   . PRO B 260 ? 0.7133 0.5302 0.8592 0.1907  -0.0949 -0.1343 255 PRO B C   
4987 O O   . PRO B 260 ? 0.6957 0.5419 0.8569 0.1929  -0.1000 -0.1295 255 PRO B O   
4988 C CB  . PRO B 260 ? 0.6994 0.5046 0.7575 0.1576  -0.0622 -0.1261 255 PRO B CB  
4989 C CG  . PRO B 260 ? 0.6789 0.5149 0.7314 0.1520  -0.0468 -0.1242 255 PRO B CG  
4990 C CD  . PRO B 260 ? 0.6819 0.5281 0.7683 0.1573  -0.0187 -0.1539 255 PRO B CD  
4991 N N   . GLU B 261 ? 0.7496 0.5301 0.8940 0.1990  -0.1196 -0.1274 256 GLU B N   
4992 C CA  . GLU B 261 ? 0.7693 0.5346 0.9242 0.2128  -0.1575 -0.1126 256 GLU B CA  
4993 C C   . GLU B 261 ? 0.8004 0.5243 0.8918 0.1971  -0.1736 -0.0820 256 GLU B C   
4994 O O   . GLU B 261 ? 0.8372 0.5197 0.9121 0.1948  -0.1783 -0.0809 256 GLU B O   
4995 C CB  . GLU B 261 ? 0.8008 0.5494 1.0150 0.2399  -0.1756 -0.1344 256 GLU B CB  
4996 C CG  . GLU B 261 ? 0.7778 0.5742 1.0726 0.2569  -0.1686 -0.1641 256 GLU B CG  
4997 C CD  . GLU B 261 ? 0.8392 0.6271 1.2119 0.2871  -0.1883 -0.1906 256 GLU B CD  
4998 O OE1 . GLU B 261 ? 0.8342 0.6680 1.2880 0.2980  -0.1716 -0.2241 256 GLU B OE1 
4999 O OE2 . GLU B 261 ? 0.8815 0.6170 1.2401 0.2999  -0.2191 -0.1805 256 GLU B OE2 
5000 N N   . PRO B 262 ? 0.7878 0.5203 0.8439 0.1840  -0.1783 -0.0595 257 PRO B N   
5001 C CA  . PRO B 262 ? 0.8214 0.5177 0.8197 0.1639  -0.1851 -0.0330 257 PRO B CA  
5002 C C   . PRO B 262 ? 0.9003 0.5333 0.8812 0.1737  -0.2170 -0.0233 257 PRO B C   
5003 O O   . PRO B 262 ? 0.9275 0.5500 0.9315 0.1966  -0.2452 -0.0274 257 PRO B O   
5004 C CB  . PRO B 262 ? 0.8089 0.5245 0.7842 0.1553  -0.1852 -0.0181 257 PRO B CB  
5005 C CG  . PRO B 262 ? 0.7469 0.5163 0.7657 0.1662  -0.1726 -0.0365 257 PRO B CG  
5006 C CD  . PRO B 262 ? 0.7586 0.5307 0.8314 0.1878  -0.1777 -0.0609 257 PRO B CD  
5007 N N   . SER B 263 ? 0.9466 0.5342 0.8906 0.1577  -0.2162 -0.0123 258 SER B N   
5008 C CA  . SER B 263 ? 1.0441 0.5573 0.9591 0.1659  -0.2482 0.0001  258 SER B CA  
5009 C C   . SER B 263 ? 1.1033 0.5691 0.9443 0.1451  -0.2581 0.0302  258 SER B C   
5010 O O   . SER B 263 ? 1.0876 0.5680 0.8987 0.1151  -0.2308 0.0403  258 SER B O   
5011 C CB  . SER B 263 ? 1.0784 0.5506 0.9936 0.1637  -0.2459 -0.0079 258 SER B CB  
5012 O OG  . SER B 263 ? 1.0601 0.5495 0.9602 0.1344  -0.2163 -0.0081 258 SER B OG  
5013 N N   . LEU B 264 ? 1.1808 0.5892 0.9936 0.1617  -0.2977 0.0420  259 LEU B N   
5014 C CA  . LEU B 264 ? 1.2773 0.6121 0.9982 0.1406  -0.3099 0.0715  259 LEU B CA  
5015 C C   . LEU B 264 ? 1.3435 0.6154 1.0217 0.1173  -0.2987 0.0818  259 LEU B C   
5016 O O   . LEU B 264 ? 1.3863 0.6122 1.0756 0.1347  -0.3207 0.0769  259 LEU B O   
5017 C CB  . LEU B 264 ? 1.3593 0.6315 1.0524 0.1674  -0.3654 0.0815  259 LEU B CB  
5018 C CG  . LEU B 264 ? 1.3585 0.6519 1.0514 0.1815  -0.3910 0.0822  259 LEU B CG  
5019 C CD1 . LEU B 264 ? 1.2617 0.6559 1.0634 0.2057  -0.3826 0.0511  259 LEU B CD1 
5020 C CD2 . LEU B 264 ? 1.4597 0.6621 1.1080 0.2053  -0.4561 0.0959  259 LEU B CD2 
5021 N N   . ARG B 265 ? 1.3540 0.6259 0.9904 0.0776  -0.2627 0.0931  260 ARG B N   
5022 C CA  . ARG B 265 ? 1.4293 0.6403 1.0224 0.0475  -0.2482 0.1028  260 ARG B CA  
5023 C C   . ARG B 265 ? 1.5254 0.6583 1.0171 0.0133  -0.2401 0.1296  260 ARG B C   
5024 O O   . ARG B 265 ? 1.5120 0.6681 0.9790 0.0003  -0.2240 0.1356  260 ARG B O   
5025 C CB  . ARG B 265 ? 1.3561 0.6367 1.0020 0.0258  -0.2085 0.0859  260 ARG B CB  
5026 C CG  . ARG B 265 ? 1.3041 0.6531 1.0317 0.0542  -0.2113 0.0594  260 ARG B CG  
5027 C CD  . ARG B 265 ? 1.2657 0.7017 1.0376 0.0395  -0.1790 0.0459  260 ARG B CD  
5028 N NE  . ARG B 265 ? 1.3314 0.7619 1.1002 0.0052  -0.1578 0.0442  260 ARG B NE  
5029 C CZ  . ARG B 265 ? 1.3665 0.8007 1.1163 -0.0295 -0.1328 0.0532  260 ARG B CZ  
5030 N NH1 . ARG B 265 ? 1.3720 0.8100 1.0930 -0.0354 -0.1231 0.0658  260 ARG B NH1 
5031 N NH2 . ARG B 265 ? 1.3908 0.8256 1.1540 -0.0600 -0.1157 0.0464  260 ARG B NH2 
5032 N N   . GLU B 266 ? 1.6301 0.6624 1.0570 -0.0020 -0.2498 0.1448  261 GLU B N   
5033 C CA  . GLU B 266 ? 1.7441 0.6883 1.0641 -0.0450 -0.2308 0.1688  261 GLU B CA  
5034 C C   . GLU B 266 ? 1.7060 0.6991 1.0567 -0.0896 -0.1731 0.1579  261 GLU B C   
5035 O O   . GLU B 266 ? 1.7170 0.6944 1.0875 -0.1036 -0.1642 0.1510  261 GLU B O   
5036 C CB  . GLU B 266 ? 1.8888 0.6960 1.1241 -0.0453 -0.2639 0.1891  261 GLU B CB  
5037 C CG  . GLU B 266 ? 1.9392 0.6873 1.1530 0.0041  -0.3327 0.1981  261 GLU B CG  
5038 C CD  . GLU B 266 ? 2.0189 0.6985 1.1306 0.0012  -0.3575 0.2218  261 GLU B CD  
5039 O OE1 . GLU B 266 ? 2.0413 0.7119 1.0883 -0.0411 -0.3159 0.2319  261 GLU B OE1 
5040 O OE2 . GLU B 266 ? 2.0603 0.6939 1.1582 0.0420  -0.4203 0.2280  261 GLU B OE2 
5041 N N   . GLY B 267 ? 1.6590 0.7145 1.0220 -0.1107 -0.1358 0.1531  262 GLY B N   
5042 C CA  . GLY B 267 ? 1.6255 0.7347 1.0312 -0.1517 -0.0831 0.1393  262 GLY B CA  
5043 C C   . GLY B 267 ? 1.7541 0.7696 1.0693 -0.2047 -0.0490 0.1545  262 GLY B C   
5044 O O   . GLY B 267 ? 1.8798 0.7785 1.0854 -0.2085 -0.0695 0.1789  262 GLY B O   
5045 N N   . PRO B 268 ? 1.7336 0.7940 1.0932 -0.2473 0.0024  0.1391  263 PRO B N   
5046 C CA  . PRO B 268 ? 1.8510 0.8301 1.1234 -0.3035 0.0485  0.1502  263 PRO B CA  
5047 C C   . PRO B 268 ? 1.8455 0.8451 1.0857 -0.3128 0.0773  0.1518  263 PRO B C   
5048 O O   . PRO B 268 ? 1.7405 0.8522 1.0734 -0.3092 0.1018  0.1298  263 PRO B O   
5049 C CB  . PRO B 268 ? 1.8203 0.8550 1.1766 -0.3430 0.0914  0.1264  263 PRO B CB  
5050 C CG  . PRO B 268 ? 1.6641 0.8357 1.1545 -0.3075 0.0751  0.1011  263 PRO B CG  
5051 C CD  . PRO B 268 ? 1.6186 0.7928 1.1026 -0.2485 0.0184  0.1104  263 PRO B CD  
5052 N N   . GLY B 269 ? 1.9613 0.8474 1.0667 -0.3220 0.0695  0.1773  264 GLY B N   
5053 C CA  . GLY B 269 ? 1.9674 0.8553 1.0222 -0.3294 0.0912  0.1798  264 GLY B CA  
5054 C C   . GLY B 269 ? 1.9365 0.8198 0.9629 -0.2779 0.0315  0.1918  264 GLY B C   
5055 O O   . GLY B 269 ? 1.9159 0.8313 0.9317 -0.2744 0.0433  0.1877  264 GLY B O   
5056 N N   . GLY B 270 ? 1.9358 0.7798 0.9557 -0.2386 -0.0317 0.2039  265 GLY B N   
5057 C CA  . GLY B 270 ? 1.9114 0.7512 0.9179 -0.1887 -0.0936 0.2121  265 GLY B CA  
5058 C C   . GLY B 270 ? 1.7632 0.7049 0.8985 -0.1365 -0.1308 0.1941  265 GLY B C   
5059 O O   . GLY B 270 ? 1.6824 0.6904 0.9092 -0.1362 -0.1144 0.1772  265 GLY B O   
5060 N N   . LEU B 271 ? 1.7326 0.6839 0.8730 -0.0945 -0.1802 0.1960  266 LEU B N   
5061 C CA  . LEU B 271 ? 1.6051 0.6439 0.8604 -0.0473 -0.2115 0.1773  266 LEU B CA  
5062 C C   . LEU B 271 ? 1.4589 0.6275 0.8133 -0.0463 -0.1741 0.1538  266 LEU B C   
5063 O O   . LEU B 271 ? 1.4472 0.6430 0.7846 -0.0595 -0.1501 0.1524  266 LEU B O   
5064 C CB  . LEU B 271 ? 1.6370 0.6434 0.8767 -0.0041 -0.2770 0.1831  266 LEU B CB  
5065 C CG  . LEU B 271 ? 1.7505 0.6443 0.9342 0.0118  -0.3280 0.1997  266 LEU B CG  
5066 C CD1 . LEU B 271 ? 1.9422 0.6960 0.9702 -0.0094 -0.3502 0.2303  266 LEU B CD1 
5067 C CD2 . LEU B 271 ? 1.7060 0.6300 0.9712 0.0677  -0.3856 0.1858  266 LEU B CD2 
5068 N N   . VAL B 272 ? 1.3561 0.5957 0.8063 -0.0323 -0.1687 0.1352  267 VAL B N   
5069 C CA  . VAL B 272 ? 1.2175 0.5699 0.7576 -0.0279 -0.1410 0.1138  267 VAL B CA  
5070 C C   . VAL B 272 ? 1.1348 0.5441 0.7498 0.0153  -0.1702 0.0978  267 VAL B C   
5071 O O   . VAL B 272 ? 1.1465 0.5265 0.7752 0.0371  -0.1998 0.0955  267 VAL B O   
5072 C CB  . VAL B 272 ? 1.1854 0.5759 0.7718 -0.0558 -0.1032 0.1022  267 VAL B CB  
5073 C CG1 . VAL B 272 ? 1.0623 0.5569 0.7260 -0.0531 -0.0780 0.0831  267 VAL B CG1 
5074 C CG2 . VAL B 272 ? 1.2661 0.5911 0.7855 -0.1028 -0.0709 0.1144  267 VAL B CG2 
5075 N N   . MET B 273 ? 1.0413 0.5270 0.7029 0.0262  -0.1588 0.0854  268 MET B N   
5076 C CA  . MET B 273 ? 0.9575 0.5051 0.6936 0.0573  -0.1704 0.0663  268 MET B CA  
5077 C C   . MET B 273 ? 0.8744 0.4991 0.6516 0.0519  -0.1405 0.0546  268 MET B C   
5078 O O   . MET B 273 ? 0.8877 0.5186 0.6381 0.0367  -0.1230 0.0606  268 MET B O   
5079 C CB  . MET B 273 ? 0.9721 0.5075 0.7111 0.0880  -0.2079 0.0650  268 MET B CB  
5080 C CG  . MET B 273 ? 0.9157 0.4987 0.7330 0.1178  -0.2173 0.0421  268 MET B CG  
5081 S SD  . MET B 273 ? 0.9553 0.5290 0.8023 0.1550  -0.2638 0.0334  268 MET B SD  
5082 C CE  . MET B 273 ? 0.8945 0.5152 0.7391 0.1510  -0.2558 0.0322  268 MET B CE  
5083 N N   . GLU B 274 ? 0.7962 0.4716 0.6314 0.0641  -0.1348 0.0375  269 GLU B N   
5084 C CA  . GLU B 274 ? 0.7225 0.4626 0.5934 0.0651  -0.1144 0.0266  269 GLU B CA  
5085 C C   . GLU B 274 ? 0.6655 0.4362 0.5765 0.0908  -0.1231 0.0103  269 GLU B C   
5086 O O   . GLU B 274 ? 0.6788 0.4307 0.6031 0.1040  -0.1371 0.0029  269 GLU B O   
5087 C CB  . GLU B 274 ? 0.7115 0.4750 0.6029 0.0455  -0.0944 0.0220  269 GLU B CB  
5088 C CG  . GLU B 274 ? 0.7731 0.5084 0.6692 0.0413  -0.1040 0.0183  269 GLU B CG  
5089 C CD  . GLU B 274 ? 0.8023 0.5714 0.7329 0.0300  -0.0948 0.0065  269 GLU B CD  
5090 O OE1 . GLU B 274 ? 0.8222 0.5804 0.7619 0.0353  -0.1057 -0.0032 269 GLU B OE1 
5091 O OE2 . GLU B 274 ? 0.7930 0.5976 0.7429 0.0165  -0.0787 0.0051  269 GLU B OE2 
5092 N N   . GLY B 275 ? 0.6040 0.4172 0.5332 0.0967  -0.1117 0.0031  270 GLY B N   
5093 C CA  . GLY B 275 ? 0.5559 0.3939 0.5180 0.1155  -0.1122 -0.0138 270 GLY B CA  
5094 C C   . GLY B 275 ? 0.5181 0.3917 0.4866 0.1167  -0.0987 -0.0173 270 GLY B C   
5095 O O   . GLY B 275 ? 0.5012 0.3767 0.4493 0.1069  -0.0936 -0.0071 270 GLY B O   
5096 N N   . HIS B 276 ? 0.5004 0.3957 0.4922 0.1263  -0.0896 -0.0327 271 HIS B N   
5097 C CA  . HIS B 276 ? 0.5077 0.4293 0.5026 0.1266  -0.0761 -0.0368 271 HIS B CA  
5098 C C   . HIS B 276 ? 0.5260 0.4525 0.5328 0.1342  -0.0868 -0.0409 271 HIS B C   
5099 O O   . HIS B 276 ? 0.5449 0.4645 0.5764 0.1454  -0.1026 -0.0496 271 HIS B O   
5100 C CB  . HIS B 276 ? 0.4939 0.4249 0.4973 0.1295  -0.0596 -0.0513 271 HIS B CB  
5101 C CG  . HIS B 276 ? 0.5159 0.4400 0.5017 0.1231  -0.0556 -0.0482 271 HIS B CG  
5102 N ND1 . HIS B 276 ? 0.5633 0.4986 0.5398 0.1180  -0.0525 -0.0403 271 HIS B ND1 
5103 C CD2 . HIS B 276 ? 0.5246 0.4303 0.5023 0.1219  -0.0573 -0.0546 271 HIS B CD2 
5104 C CE1 . HIS B 276 ? 0.5710 0.4976 0.5390 0.1151  -0.0574 -0.0414 271 HIS B CE1 
5105 N NE2 . HIS B 276 ? 0.6000 0.5060 0.5625 0.1160  -0.0602 -0.0495 271 HIS B NE2 
5106 N N   . LEU B 277 ? 0.5280 0.4647 0.5200 0.1287  -0.0816 -0.0360 272 LEU B N   
5107 C CA  . LEU B 277 ? 0.5430 0.4880 0.5466 0.1338  -0.0918 -0.0434 272 LEU B CA  
5108 C C   . LEU B 277 ? 0.5289 0.4932 0.5277 0.1279  -0.0707 -0.0477 272 LEU B C   
5109 O O   . LEU B 277 ? 0.5324 0.4979 0.5125 0.1213  -0.0549 -0.0404 272 LEU B O   
5110 C CB  . LEU B 277 ? 0.5871 0.5041 0.5568 0.1310  -0.1165 -0.0300 272 LEU B CB  
5111 C CG  . LEU B 277 ? 0.6196 0.5049 0.5885 0.1394  -0.1449 -0.0246 272 LEU B CG  
5112 C CD1 . LEU B 277 ? 0.6998 0.5388 0.6080 0.1309  -0.1656 -0.0059 272 LEU B CD1 
5113 C CD2 . LEU B 277 ? 0.6178 0.5182 0.6453 0.1586  -0.1646 -0.0445 272 LEU B CD2 
5114 N N   . PHE B 278 ? 0.5308 0.5103 0.5529 0.1307  -0.0713 -0.0619 273 PHE B N   
5115 C CA  . PHE B 278 ? 0.5188 0.5078 0.5294 0.1237  -0.0553 -0.0651 273 PHE B CA  
5116 C C   . PHE B 278 ? 0.5455 0.5196 0.5205 0.1180  -0.0697 -0.0545 273 PHE B C   
5117 O O   . PHE B 278 ? 0.5844 0.5406 0.5490 0.1206  -0.0970 -0.0490 273 PHE B O   
5118 C CB  . PHE B 278 ? 0.5135 0.5220 0.5637 0.1244  -0.0479 -0.0868 273 PHE B CB  
5119 C CG  . PHE B 278 ? 0.5087 0.5194 0.5692 0.1223  -0.0198 -0.0970 273 PHE B CG  
5120 C CD1 . PHE B 278 ? 0.5457 0.5481 0.5794 0.1148  0.0043  -0.0962 273 PHE B CD1 
5121 C CD2 . PHE B 278 ? 0.5121 0.5238 0.6005 0.1274  -0.0172 -0.1078 273 PHE B CD2 
5122 C CE1 . PHE B 278 ? 0.5493 0.5373 0.5727 0.1106  0.0283  -0.1035 273 PHE B CE1 
5123 C CE2 . PHE B 278 ? 0.5370 0.5383 0.6175 0.1218  0.0116  -0.1177 273 PHE B CE2 
5124 C CZ  . PHE B 278 ? 0.5650 0.5508 0.6071 0.1124  0.0335  -0.1144 273 PHE B CZ  
5125 N N   . LYS B 279 ? 0.5399 0.5134 0.4895 0.1100  -0.0514 -0.0518 274 LYS B N   
5126 C CA  . LYS B 279 ? 0.5789 0.5318 0.4843 0.1010  -0.0564 -0.0440 274 LYS B CA  
5127 C C   . LYS B 279 ? 0.5654 0.5257 0.4663 0.0962  -0.0407 -0.0544 274 LYS B C   
5128 O O   . LYS B 279 ? 0.5360 0.5109 0.4569 0.0987  -0.0198 -0.0608 274 LYS B O   
5129 C CB  . LYS B 279 ? 0.5951 0.5356 0.4731 0.0932  -0.0403 -0.0306 274 LYS B CB  
5130 C CG  . LYS B 279 ? 0.6137 0.5673 0.4940 0.0901  -0.0098 -0.0339 274 LYS B CG  
5131 C CD  . LYS B 279 ? 0.7208 0.6542 0.5580 0.0767  0.0037  -0.0322 274 LYS B CD  
5132 C CE  . LYS B 279 ? 0.7782 0.6810 0.5763 0.0643  -0.0021 -0.0197 274 LYS B CE  
5133 N NZ  . LYS B 279 ? 0.8921 0.7539 0.6230 0.0494  -0.0033 -0.0177 274 LYS B NZ  
5134 N N   . ARG B 280 ? 0.5861 0.5282 0.4535 0.0886  -0.0528 -0.0561 275 ARG B N   
5135 C CA  . ARG B 280 ? 0.5716 0.5144 0.4280 0.0820  -0.0370 -0.0668 275 ARG B CA  
5136 C C   . ARG B 280 ? 0.5845 0.5077 0.3956 0.0728  -0.0118 -0.0606 275 ARG B C   
5137 O O   . ARG B 280 ? 0.6175 0.5131 0.3830 0.0638  -0.0157 -0.0513 275 ARG B O   
5138 C CB  . ARG B 280 ? 0.5983 0.5344 0.4504 0.0781  -0.0658 -0.0780 275 ARG B CB  
5139 C CG  . ARG B 280 ? 0.6009 0.5487 0.4686 0.0724  -0.0509 -0.0951 275 ARG B CG  
5140 C CD  . ARG B 280 ? 0.6754 0.5984 0.5000 0.0615  -0.0687 -0.1013 275 ARG B CD  
5141 N NE  . ARG B 280 ? 0.6931 0.6325 0.5581 0.0614  -0.0997 -0.1187 275 ARG B NE  
5142 C CZ  . ARG B 280 ? 0.7353 0.6535 0.5702 0.0540  -0.1331 -0.1260 275 ARG B CZ  
5143 N NH1 . ARG B 280 ? 0.7975 0.6688 0.5473 0.0441  -0.1356 -0.1159 275 ARG B NH1 
5144 N NH2 . ARG B 280 ? 0.7359 0.6786 0.6272 0.0553  -0.1641 -0.1458 275 ARG B NH2 
5145 N N   . ALA B 281 ? 0.5597 0.4927 0.3829 0.0744  0.0158  -0.0672 276 ALA B N   
5146 C CA  . ALA B 281 ? 0.5777 0.4979 0.3744 0.0681  0.0439  -0.0680 276 ALA B CA  
5147 C C   . ALA B 281 ? 0.6464 0.5342 0.3853 0.0533  0.0426  -0.0734 276 ALA B C   
5148 O O   . ALA B 281 ? 0.6779 0.5582 0.4064 0.0503  0.0190  -0.0798 276 ALA B O   
5149 C CB  . ALA B 281 ? 0.5426 0.4746 0.3675 0.0773  0.0659  -0.0761 276 ALA B CB  
5150 N N   . SER B 282 ? 0.6896 0.5569 0.3916 0.0423  0.0685  -0.0734 277 SER B N   
5151 C CA  . SER B 282 ? 0.7552 0.5809 0.3872 0.0250  0.0744  -0.0801 277 SER B CA  
5152 C C   . SER B 282 ? 0.7583 0.5813 0.3905 0.0246  0.1012  -0.0978 277 SER B C   
5153 O O   . SER B 282 ? 0.8095 0.5954 0.3814 0.0100  0.1046  -0.1071 277 SER B O   
5154 C CB  . SER B 282 ? 0.8248 0.6188 0.4050 0.0077  0.0965  -0.0737 277 SER B CB  
5155 O OG  . SER B 282 ? 0.8929 0.6669 0.4458 0.0037  0.0665  -0.0569 277 SER B OG  
5156 N N   . ASN B 283 ? 0.6929 0.5466 0.3848 0.0403  0.1185  -0.1025 278 ASN B N   
5157 C CA  . ASN B 283 ? 0.6996 0.5445 0.3928 0.0427  0.1391  -0.1185 278 ASN B CA  
5158 C C   . ASN B 283 ? 0.6848 0.5264 0.3776 0.0416  0.1145  -0.1241 278 ASN B C   
5159 O O   . ASN B 283 ? 0.6582 0.5146 0.3672 0.0428  0.0844  -0.1170 278 ASN B O   
5160 C CB  . ASN B 283 ? 0.6580 0.5268 0.4104 0.0618  0.1598  -0.1210 278 ASN B CB  
5161 C CG  . ASN B 283 ? 0.6103 0.5035 0.4073 0.0768  0.1380  -0.1102 278 ASN B CG  
5162 O OD1 . ASN B 283 ? 0.6253 0.5140 0.4255 0.0792  0.1260  -0.1121 278 ASN B OD1 
5163 N ND2 . ASN B 283 ? 0.5871 0.5032 0.4167 0.0845  0.1350  -0.1004 278 ASN B ND2 
5164 N N   . ALA B 284 ? 0.6932 0.5170 0.3755 0.0392  0.1300  -0.1391 279 ALA B N   
5165 C CA  . ALA B 284 ? 0.7006 0.5153 0.3762 0.0307  0.1129  -0.1496 279 ALA B CA  
5166 C C   . ALA B 284 ? 0.6599 0.4992 0.3878 0.0391  0.1020  -0.1471 279 ALA B C   
5167 O O   . ALA B 284 ? 0.6551 0.4982 0.3921 0.0294  0.0845  -0.1561 279 ALA B O   
5168 C CB  . ALA B 284 ? 0.7509 0.5317 0.3945 0.0232  0.1373  -0.1680 279 ALA B CB  
5169 N N   . PHE B 285 ? 0.6293 0.4838 0.3914 0.0552  0.1121  -0.1365 280 PHE B N   
5170 C CA  . PHE B 285 ? 0.6106 0.4787 0.4071 0.0602  0.1051  -0.1331 280 PHE B CA  
5171 C C   . PHE B 285 ? 0.5928 0.4873 0.4100 0.0572  0.0792  -0.1283 280 PHE B C   
5172 O O   . PHE B 285 ? 0.5655 0.4712 0.4110 0.0542  0.0745  -0.1335 280 PHE B O   
5173 C CB  . PHE B 285 ? 0.5997 0.4672 0.4151 0.0784  0.1164  -0.1225 280 PHE B CB  
5174 C CG  . PHE B 285 ? 0.6373 0.4733 0.4428 0.0852  0.1353  -0.1287 280 PHE B CG  
5175 C CD1 . PHE B 285 ? 0.6653 0.4907 0.4636 0.0921  0.1511  -0.1344 280 PHE B CD1 
5176 C CD2 . PHE B 285 ? 0.6417 0.4530 0.4432 0.0838  0.1398  -0.1302 280 PHE B CD2 
5177 C CE1 . PHE B 285 ? 0.7188 0.5117 0.5127 0.1021  0.1659  -0.1414 280 PHE B CE1 
5178 C CE2 . PHE B 285 ? 0.6717 0.4426 0.4565 0.0910  0.1540  -0.1343 280 PHE B CE2 
5179 C CZ  . PHE B 285 ? 0.7008 0.4633 0.4849 0.1024  0.1644  -0.1397 280 PHE B CZ  
5180 N N   . LYS B 286 ? 0.6146 0.5144 0.4168 0.0569  0.0648  -0.1200 281 LYS B N   
5181 C CA  . LYS B 286 ? 0.6128 0.5309 0.4329 0.0569  0.0350  -0.1152 281 LYS B CA  
5182 C C   . LYS B 286 ? 0.5778 0.5184 0.4435 0.0665  0.0358  -0.1115 281 LYS B C   
5183 O O   . LYS B 286 ? 0.5582 0.5167 0.4572 0.0652  0.0187  -0.1184 281 LYS B O   
5184 C CB  . LYS B 286 ? 0.6383 0.5561 0.4595 0.0456  0.0087  -0.1297 281 LYS B CB  
5185 C CG  . LYS B 286 ? 0.7065 0.5930 0.4728 0.0324  0.0056  -0.1377 281 LYS B CG  
5186 C CD  . LYS B 286 ? 0.7976 0.6597 0.5111 0.0290  -0.0150 -0.1266 281 LYS B CD  
5187 C CE  . LYS B 286 ? 0.9161 0.7378 0.5632 0.0124  -0.0234 -0.1374 281 LYS B CE  
5188 N NZ  . LYS B 286 ? 0.9972 0.7740 0.5629 0.0034  -0.0229 -0.1261 281 LYS B NZ  
5189 N N   . THR B 287 ? 0.5676 0.5059 0.4360 0.0762  0.0542  -0.1025 282 THR B N   
5190 C CA  . THR B 287 ? 0.5386 0.4866 0.4338 0.0835  0.0554  -0.0987 282 THR B CA  
5191 C C   . THR B 287 ? 0.5279 0.4930 0.4388 0.0883  0.0358  -0.0899 282 THR B C   
5192 O O   . THR B 287 ? 0.5262 0.4899 0.4219 0.0898  0.0294  -0.0795 282 THR B O   
5193 C CB  . THR B 287 ? 0.5469 0.4803 0.4346 0.0943  0.0709  -0.0909 282 THR B CB  
5194 O OG1 . THR B 287 ? 0.5610 0.4708 0.4307 0.0929  0.0871  -0.0978 282 THR B OG1 
5195 C CG2 . THR B 287 ? 0.5073 0.4354 0.4035 0.0975  0.0723  -0.0890 282 THR B CG2 
5196 N N   . TRP B 288 ? 0.5108 0.4882 0.4516 0.0886  0.0301  -0.0964 283 TRP B N   
5197 C CA  . TRP B 288 ? 0.5078 0.4971 0.4676 0.0951  0.0136  -0.0907 283 TRP B CA  
5198 C C   . TRP B 288 ? 0.5031 0.4855 0.4573 0.1019  0.0247  -0.0812 283 TRP B C   
5199 O O   . TRP B 288 ? 0.5145 0.4841 0.4619 0.1011  0.0416  -0.0852 283 TRP B O   
5200 C CB  . TRP B 288 ? 0.5012 0.5080 0.5052 0.0933  0.0065  -0.1075 283 TRP B CB  
5201 C CG  . TRP B 288 ? 0.4911 0.5084 0.5120 0.0909  -0.0210 -0.1167 283 TRP B CG  
5202 C CD1 . TRP B 288 ? 0.4976 0.5210 0.5312 0.0811  -0.0224 -0.1333 283 TRP B CD1 
5203 C CD2 . TRP B 288 ? 0.4892 0.5044 0.5099 0.0981  -0.0557 -0.1096 283 TRP B CD2 
5204 N NE1 . TRP B 288 ? 0.4817 0.5096 0.5253 0.0831  -0.0603 -0.1377 283 TRP B NE1 
5205 C CE2 . TRP B 288 ? 0.5109 0.5295 0.5421 0.0943  -0.0819 -0.1219 283 TRP B CE2 
5206 C CE3 . TRP B 288 ? 0.5020 0.5064 0.5101 0.1066  -0.0692 -0.0939 283 TRP B CE3 
5207 C CZ2 . TRP B 288 ? 0.5538 0.5605 0.5787 0.1011  -0.1256 -0.1176 283 TRP B CZ2 
5208 C CZ3 . TRP B 288 ? 0.5275 0.5180 0.5273 0.1116  -0.1068 -0.0888 283 TRP B CZ3 
5209 C CH2 . TRP B 288 ? 0.5723 0.5614 0.5776 0.1100  -0.1371 -0.0999 283 TRP B CH2 
5210 N N   . SER B 289 ? 0.4954 0.4797 0.4465 0.1071  0.0140  -0.0689 284 SER B N   
5211 C CA  . SER B 289 ? 0.5061 0.4849 0.4560 0.1131  0.0178  -0.0623 284 SER B CA  
5212 C C   . SER B 289 ? 0.5033 0.4871 0.4635 0.1154  0.0023  -0.0557 284 SER B C   
5213 O O   . SER B 289 ? 0.5154 0.5006 0.4733 0.1129  -0.0104 -0.0509 284 SER B O   
5214 C CB  . SER B 289 ? 0.5093 0.4823 0.4470 0.1171  0.0255  -0.0554 284 SER B CB  
5215 O OG  . SER B 289 ? 0.5185 0.5005 0.4566 0.1143  0.0236  -0.0493 284 SER B OG  
5216 N N   . ARG B 290 ? 0.4990 0.4765 0.4614 0.1190  0.0025  -0.0552 285 ARG B N   
5217 C CA  . ARG B 290 ? 0.5074 0.4845 0.4792 0.1207  -0.0108 -0.0515 285 ARG B CA  
5218 C C   . ARG B 290 ? 0.5046 0.4825 0.4715 0.1192  -0.0162 -0.0396 285 ARG B C   
5219 O O   . ARG B 290 ? 0.5134 0.4917 0.4778 0.1214  -0.0119 -0.0380 285 ARG B O   
5220 C CB  . ARG B 290 ? 0.5140 0.4792 0.4859 0.1224  -0.0050 -0.0606 285 ARG B CB  
5221 C CG  . ARG B 290 ? 0.5339 0.4951 0.5182 0.1247  -0.0158 -0.0621 285 ARG B CG  
5222 C CD  . ARG B 290 ? 0.5458 0.4910 0.5247 0.1237  -0.0018 -0.0761 285 ARG B CD  
5223 N NE  . ARG B 290 ? 0.5843 0.5215 0.5742 0.1265  -0.0098 -0.0804 285 ARG B NE  
5224 C CZ  . ARG B 290 ? 0.5785 0.5250 0.6047 0.1322  -0.0157 -0.0901 285 ARG B CZ  
5225 N NH1 . ARG B 290 ? 0.5979 0.5649 0.6539 0.1349  -0.0181 -0.0965 285 ARG B NH1 
5226 N NH2 . ARG B 290 ? 0.5677 0.5008 0.6020 0.1361  -0.0225 -0.0947 285 ARG B NH2 
5227 N N   . ARG B 291 ? 0.4904 0.4665 0.4582 0.1149  -0.0263 -0.0327 286 ARG B N   
5228 C CA  . ARG B 291 ? 0.4855 0.4629 0.4536 0.1079  -0.0259 -0.0244 286 ARG B CA  
5229 C C   . ARG B 291 ? 0.4942 0.4571 0.4619 0.1047  -0.0391 -0.0199 286 ARG B C   
5230 O O   . ARG B 291 ? 0.5008 0.4521 0.4674 0.1099  -0.0504 -0.0222 286 ARG B O   
5231 C CB  . ARG B 291 ? 0.5079 0.4849 0.4612 0.0984  -0.0154 -0.0199 286 ARG B CB  
5232 C CG  . ARG B 291 ? 0.4992 0.4887 0.4555 0.1010  0.0007  -0.0258 286 ARG B CG  
5233 C CD  . ARG B 291 ? 0.5466 0.5500 0.5293 0.1090  0.0027  -0.0296 286 ARG B CD  
5234 N NE  . ARG B 291 ? 0.5897 0.5993 0.5784 0.1153  0.0150  -0.0356 286 ARG B NE  
5235 C CZ  . ARG B 291 ? 0.6125 0.6123 0.5945 0.1259  0.0125  -0.0391 286 ARG B CZ  
5236 N NH1 . ARG B 291 ? 0.6213 0.6063 0.5886 0.1286  0.0033  -0.0390 286 ARG B NH1 
5237 N NH2 . ARG B 291 ? 0.6278 0.6269 0.6142 0.1325  0.0220  -0.0440 286 ARG B NH2 
5238 N N   . TRP B 292 ? 0.4871 0.4510 0.4620 0.0962  -0.0384 -0.0157 287 TRP B N   
5239 C CA  . TRP B 292 ? 0.5017 0.4456 0.4720 0.0893  -0.0487 -0.0106 287 TRP B CA  
5240 C C   . TRP B 292 ? 0.5455 0.4704 0.4907 0.0751  -0.0436 -0.0005 287 TRP B C   
5241 O O   . TRP B 292 ? 0.5630 0.4969 0.5103 0.0615  -0.0258 0.0006  287 TRP B O   
5242 C CB  . TRP B 292 ? 0.4806 0.4329 0.4716 0.0838  -0.0509 -0.0138 287 TRP B CB  
5243 C CG  . TRP B 292 ? 0.5018 0.4302 0.4884 0.0748  -0.0607 -0.0108 287 TRP B CG  
5244 C CD1 . TRP B 292 ? 0.4860 0.4077 0.4764 0.0555  -0.0551 -0.0062 287 TRP B CD1 
5245 C CD2 . TRP B 292 ? 0.4740 0.3793 0.4533 0.0828  -0.0743 -0.0147 287 TRP B CD2 
5246 N NE1 . TRP B 292 ? 0.4951 0.3869 0.4760 0.0514  -0.0674 -0.0048 287 TRP B NE1 
5247 C CE2 . TRP B 292 ? 0.4844 0.3665 0.4598 0.0696  -0.0798 -0.0105 287 TRP B CE2 
5248 C CE3 . TRP B 292 ? 0.4732 0.3741 0.4512 0.0980  -0.0778 -0.0241 287 TRP B CE3 
5249 C CZ2 . TRP B 292 ? 0.5082 0.3606 0.4770 0.0742  -0.0922 -0.0147 287 TRP B CZ2 
5250 C CZ3 . TRP B 292 ? 0.5295 0.4050 0.5055 0.1021  -0.0863 -0.0304 287 TRP B CZ3 
5251 C CH2 . TRP B 292 ? 0.4733 0.3237 0.4441 0.0917  -0.0952 -0.0253 287 TRP B CH2 
5252 N N   . PHE B 293 ? 0.5944 0.4883 0.5142 0.0780  -0.0593 0.0055  288 PHE B N   
5253 C CA  . PHE B 293 ? 0.6525 0.5083 0.5263 0.0642  -0.0604 0.0177  288 PHE B CA  
5254 C C   . PHE B 293 ? 0.6978 0.5157 0.5528 0.0519  -0.0664 0.0268  288 PHE B C   
5255 O O   . PHE B 293 ? 0.7028 0.5163 0.5775 0.0610  -0.0807 0.0236  288 PHE B O   
5256 C CB  . PHE B 293 ? 0.6718 0.5078 0.5237 0.0766  -0.0832 0.0193  288 PHE B CB  
5257 C CG  . PHE B 293 ? 0.6633 0.5202 0.5119 0.0780  -0.0734 0.0136  288 PHE B CG  
5258 C CD1 . PHE B 293 ? 0.5986 0.4965 0.4888 0.0908  -0.0667 0.0003  288 PHE B CD1 
5259 C CD2 . PHE B 293 ? 0.7012 0.5291 0.4967 0.0637  -0.0678 0.0209  288 PHE B CD2 
5260 C CE1 . PHE B 293 ? 0.5765 0.4891 0.4627 0.0910  -0.0568 -0.0056 288 PHE B CE1 
5261 C CE2 . PHE B 293 ? 0.7123 0.5569 0.5030 0.0641  -0.0572 0.0135  288 PHE B CE2 
5262 C CZ  . PHE B 293 ? 0.6354 0.5246 0.4758 0.0786  -0.0524 0.0001  288 PHE B CZ  
5263 N N   . THR B 294 ? 0.7516 0.5365 0.5632 0.0288  -0.0520 0.0368  289 THR B N   
5264 C CA  . THR B 294 ? 0.8064 0.5424 0.5870 0.0111  -0.0536 0.0471  289 THR B CA  
5265 C C   . THR B 294 ? 0.8917 0.5584 0.5884 -0.0039 -0.0571 0.0630  289 THR B C   
5266 O O   . THR B 294 ? 0.9153 0.5776 0.5796 -0.0204 -0.0327 0.0636  289 THR B O   
5267 C CB  . THR B 294 ? 0.7975 0.5583 0.6105 -0.0125 -0.0231 0.0405  289 THR B CB  
5268 O OG1 . THR B 294 ? 0.7484 0.5620 0.6271 0.0028  -0.0294 0.0270  289 THR B OG1 
5269 C CG2 . THR B 294 ? 0.8597 0.5650 0.6382 -0.0366 -0.0201 0.0502  289 THR B CG2 
5270 N N   . ILE B 295 ? 0.9457 0.5528 0.6035 0.0034  -0.0895 0.0747  290 ILE B N   
5271 C CA  . ILE B 295 ? 1.0616 0.5791 0.6226 -0.0142 -0.0987 0.0937  290 ILE B CA  
5272 C C   . ILE B 295 ? 1.1081 0.5869 0.6461 -0.0452 -0.0741 0.1004  290 ILE B C   
5273 O O   . ILE B 295 ? 1.0918 0.5683 0.6618 -0.0384 -0.0868 0.0988  290 ILE B O   
5274 C CB  . ILE B 295 ? 1.1075 0.5712 0.6410 0.0123  -0.1539 0.1031  290 ILE B CB  
5275 C CG1 . ILE B 295 ? 1.0648 0.5740 0.6399 0.0432  -0.1807 0.0916  290 ILE B CG1 
5276 C CG2 . ILE B 295 ? 1.2413 0.5958 0.6579 -0.0066 -0.1693 0.1257  290 ILE B CG2 
5277 C CD1 . ILE B 295 ? 1.1106 0.5863 0.6937 0.0746  -0.2368 0.0927  290 ILE B CD1 
5278 N N   . GLN B 296 ? 1.1668 0.6167 0.6527 -0.0814 -0.0347 0.1046  291 GLN B N   
5279 C CA  . GLN B 296 ? 1.2264 0.6370 0.6887 -0.1190 -0.0026 0.1084  291 GLN B CA  
5280 C C   . GLN B 296 ? 1.3279 0.6752 0.6968 -0.1586 0.0358  0.1164  291 GLN B C   
5281 O O   . GLN B 296 ? 1.3061 0.6853 0.6752 -0.1624 0.0600  0.1074  291 GLN B O   
5282 C CB  . GLN B 296 ? 1.1398 0.6374 0.7076 -0.1263 0.0268  0.0876  291 GLN B CB  
5283 C CG  . GLN B 296 ? 1.2151 0.6816 0.7762 -0.1675 0.0600  0.0866  291 GLN B CG  
5284 C CD  . GLN B 296 ? 1.1762 0.6939 0.8259 -0.1616 0.0512  0.0730  291 GLN B CD  
5285 O OE1 . GLN B 296 ? 1.2404 0.7125 0.8736 -0.1853 0.0564  0.0765  291 GLN B OE1 
5286 N NE2 . GLN B 296 ? 1.0510 0.6542 0.7854 -0.1325 0.0375  0.0574  291 GLN B NE2 
5287 N N   . SER B 297 ? 1.4437 0.6937 0.7269 -0.1892 0.0431  0.1324  292 SER B N   
5288 C CA  . SER B 297 ? 1.5740 0.7377 0.7446 -0.2353 0.0847  0.1418  292 SER B CA  
5289 C C   . SER B 297 ? 1.6207 0.7534 0.7137 -0.2292 0.0764  0.1474  292 SER B C   
5290 O O   . SER B 297 ? 1.6355 0.7839 0.7150 -0.2551 0.1277  0.1352  292 SER B O   
5291 C CB  . SER B 297 ? 1.5557 0.7699 0.7841 -0.2771 0.1573  0.1205  292 SER B CB  
5292 O OG  . SER B 297 ? 1.4300 0.7623 0.7694 -0.2593 0.1748  0.0960  292 SER B OG  
5293 N N   . ASN B 298 ? 1.6440 0.7359 0.6947 -0.1937 0.0103  0.1627  293 ASN B N   
5294 C CA  . ASN B 298 ? 1.6887 0.7477 0.6675 -0.1820 -0.0151 0.1682  293 ASN B CA  
5295 C C   . ASN B 298 ? 1.5931 0.7489 0.6402 -0.1763 0.0166  0.1455  293 ASN B C   
5296 O O   . ASN B 298 ? 1.6572 0.7752 0.6262 -0.1912 0.0307  0.1454  293 ASN B O   
5297 C CB  . ASN B 298 ? 1.8766 0.7887 0.6789 -0.2200 -0.0084 0.1899  293 ASN B CB  
5298 C CG  . ASN B 298 ? 1.9843 0.7852 0.7075 -0.2253 -0.0431 0.2148  293 ASN B CG  
5299 O OD1 . ASN B 298 ? 2.1245 0.8199 0.7326 -0.2708 -0.0093 0.2284  293 ASN B OD1 
5300 N ND2 . ASN B 298 ? 1.9224 0.7424 0.7063 -0.1802 -0.1075 0.2192  293 ASN B ND2 
5301 N N   . GLN B 299 ? 1.4507 0.7235 0.6369 -0.1548 0.0261  0.1262  294 GLN B N   
5302 C CA  . GLN B 299 ? 1.3518 0.7176 0.6139 -0.1404 0.0452  0.1054  294 GLN B CA  
5303 C C   . GLN B 299 ? 1.2311 0.6759 0.5960 -0.0957 0.0037  0.0978  294 GLN B C   
5304 O O   . GLN B 299 ? 1.1963 0.6569 0.6115 -0.0830 -0.0149 0.0994  294 GLN B O   
5305 C CB  . GLN B 299 ? 1.3088 0.7359 0.6368 -0.1664 0.1120  0.0852  294 GLN B CB  
5306 C CG  . GLN B 299 ? 1.4334 0.7982 0.6720 -0.2129 0.1693  0.0832  294 GLN B CG  
5307 C CD  . GLN B 299 ? 1.4001 0.8377 0.7276 -0.2358 0.2364  0.0567  294 GLN B CD  
5308 O OE1 . GLN B 299 ? 1.4893 0.8953 0.7679 -0.2721 0.2929  0.0468  294 GLN B OE1 
5309 N NE2 . GLN B 299 ? 1.3027 0.8352 0.7613 -0.2148 0.2297  0.0430  294 GLN B NE2 
5310 N N   . LEU B 300 ? 1.1760 0.6621 0.5641 -0.0745 -0.0087 0.0884  295 LEU B N   
5311 C CA  . LEU B 300 ? 1.0610 0.6278 0.5484 -0.0390 -0.0318 0.0763  295 LEU B CA  
5312 C C   . LEU B 300 ? 0.9798 0.6247 0.5392 -0.0416 0.0107  0.0575  295 LEU B C   
5313 O O   . LEU B 300 ? 0.9828 0.6297 0.5180 -0.0521 0.0361  0.0503  295 LEU B O   
5314 C CB  . LEU B 300 ? 1.0657 0.6246 0.5376 -0.0138 -0.0770 0.0766  295 LEU B CB  
5315 C CG  . LEU B 300 ? 0.9706 0.6037 0.5413 0.0195  -0.0981 0.0629  295 LEU B CG  
5316 C CD1 . LEU B 300 ? 0.9337 0.5745 0.5512 0.0318  -0.1131 0.0646  295 LEU B CD1 
5317 C CD2 . LEU B 300 ? 0.9849 0.6152 0.5525 0.0404  -0.1393 0.0587  295 LEU B CD2 
5318 N N   . VAL B 301 ? 0.9065 0.6082 0.5497 -0.0327 0.0166  0.0491  296 VAL B N   
5319 C CA  . VAL B 301 ? 0.8344 0.6086 0.5545 -0.0297 0.0460  0.0314  296 VAL B CA  
5320 C C   . VAL B 301 ? 0.7576 0.5866 0.5489 0.0008  0.0222  0.0236  296 VAL B C   
5321 O O   . VAL B 301 ? 0.7471 0.5659 0.5431 0.0158  -0.0089 0.0288  296 VAL B O   
5322 C CB  . VAL B 301 ? 0.8377 0.6276 0.5922 -0.0547 0.0821  0.0243  296 VAL B CB  
5323 C CG1 . VAL B 301 ? 0.9298 0.6591 0.6088 -0.0918 0.1166  0.0297  296 VAL B CG1 
5324 C CG2 . VAL B 301 ? 0.8045 0.6009 0.5955 -0.0505 0.0621  0.0272  296 VAL B CG2 
5325 N N   . TYR B 302 ? 0.7119 0.5927 0.5546 0.0095  0.0384  0.0100  297 TYR B N   
5326 C CA  . TYR B 302 ? 0.6520 0.5744 0.5513 0.0328  0.0215  0.0027  297 TYR B CA  
5327 C C   . TYR B 302 ? 0.6225 0.5908 0.5835 0.0334  0.0385  -0.0100 297 TYR B C   
5328 O O   . TYR B 302 ? 0.6297 0.6094 0.6034 0.0192  0.0679  -0.0176 297 TYR B O   
5329 C CB  . TYR B 302 ? 0.6367 0.5639 0.5280 0.0519  0.0067  0.0003  297 TYR B CB  
5330 C CG  . TYR B 302 ? 0.6496 0.5936 0.5429 0.0528  0.0270  -0.0083 297 TYR B CG  
5331 C CD1 . TYR B 302 ? 0.6282 0.6087 0.5692 0.0639  0.0361  -0.0186 297 TYR B CD1 
5332 C CD2 . TYR B 302 ? 0.7124 0.6284 0.5547 0.0431  0.0341  -0.0064 297 TYR B CD2 
5333 C CE1 . TYR B 302 ? 0.6397 0.6303 0.5836 0.0666  0.0542  -0.0274 297 TYR B CE1 
5334 C CE2 . TYR B 302 ? 0.7157 0.6429 0.5577 0.0434  0.0544  -0.0164 297 TYR B CE2 
5335 C CZ  . TYR B 302 ? 0.6863 0.6519 0.5824 0.0558  0.0656  -0.0271 297 TYR B CZ  
5336 O OH  . TYR B 302 ? 0.7314 0.7032 0.6282 0.0578  0.0854  -0.0378 297 TYR B OH  
5337 N N   . GLN B 303 ? 0.5896 0.5796 0.5877 0.0495  0.0188  -0.0139 298 GLN B N   
5338 C CA  . GLN B 303 ? 0.5663 0.5946 0.6212 0.0579  0.0193  -0.0256 298 GLN B CA  
5339 C C   . GLN B 303 ? 0.5566 0.5862 0.6091 0.0807  -0.0018 -0.0267 298 GLN B C   
5340 O O   . GLN B 303 ? 0.5555 0.5633 0.5770 0.0861  -0.0143 -0.0213 298 GLN B O   
5341 C CB  . GLN B 303 ? 0.5619 0.6010 0.6531 0.0480  0.0116  -0.0293 298 GLN B CB  
5342 C CG  . GLN B 303 ? 0.5947 0.6322 0.6954 0.0202  0.0370  -0.0312 298 GLN B CG  
5343 C CD  . GLN B 303 ? 0.6185 0.6480 0.7334 0.0066  0.0248  -0.0306 298 GLN B CD  
5344 O OE1 . GLN B 303 ? 0.5865 0.5782 0.6582 0.0061  0.0090  -0.0193 298 GLN B OE1 
5345 N NE2 . GLN B 303 ? 0.6009 0.6664 0.7820 -0.0041 0.0314  -0.0452 298 GLN B NE2 
5346 N N   . LYS B 304 ? 0.5580 0.6082 0.6420 0.0935  -0.0049 -0.0349 299 LYS B N   
5347 C CA  . LYS B 304 ? 0.5655 0.6044 0.6381 0.1110  -0.0265 -0.0354 299 LYS B CA  
5348 C C   . LYS B 304 ? 0.5680 0.6044 0.6535 0.1102  -0.0496 -0.0369 299 LYS B C   
5349 O O   . LYS B 304 ? 0.5686 0.5811 0.6231 0.1097  -0.0594 -0.0336 299 LYS B O   
5350 C CB  . LYS B 304 ? 0.5697 0.6154 0.6570 0.1266  -0.0277 -0.0413 299 LYS B CB  
5351 C CG  . LYS B 304 ? 0.5954 0.6541 0.6935 0.1250  -0.0019 -0.0460 299 LYS B CG  
5352 C CD  . LYS B 304 ? 0.6379 0.7054 0.7677 0.1432  -0.0063 -0.0549 299 LYS B CD  
5353 C CE  . LYS B 304 ? 0.6500 0.6937 0.7419 0.1513  0.0038  -0.0539 299 LYS B CE  
5354 N NZ  . LYS B 304 ? 0.6689 0.6953 0.7643 0.1723  -0.0138 -0.0565 299 LYS B NZ  
5355 N N   . LYS B 305 ? 0.5692 0.6311 0.7051 0.1092  -0.0576 -0.0447 300 LYS B N   
5356 C CA  . LYS B 305 ? 0.5864 0.6470 0.7387 0.1083  -0.0853 -0.0490 300 LYS B CA  
5357 C C   . LYS B 305 ? 0.5816 0.6628 0.7737 0.0870  -0.0772 -0.0533 300 LYS B C   
5358 O O   . LYS B 305 ? 0.5693 0.6712 0.7881 0.0741  -0.0494 -0.0560 300 LYS B O   
5359 C CB  . LYS B 305 ? 0.6045 0.6766 0.7911 0.1256  -0.1122 -0.0576 300 LYS B CB  
5360 C CG  . LYS B 305 ? 0.6425 0.6955 0.7997 0.1450  -0.1126 -0.0545 300 LYS B CG  
5361 C CD  . LYS B 305 ? 0.6898 0.6907 0.7672 0.1495  -0.1213 -0.0459 300 LYS B CD  
5362 C CE  . LYS B 305 ? 0.7474 0.7135 0.7988 0.1650  -0.1583 -0.0468 300 LYS B CE  
5363 N NZ  . LYS B 305 ? 0.7778 0.7684 0.8871 0.1684  -0.1924 -0.0559 300 LYS B NZ  
5364 N N   . TYR B 306 ? 0.5932 0.6624 0.7834 0.0807  -0.0991 -0.0552 301 TYR B N   
5365 C CA  . TYR B 306 ? 0.6024 0.6887 0.8354 0.0586  -0.0959 -0.0621 301 TYR B CA  
5366 C C   . TYR B 306 ? 0.5975 0.7342 0.9110 0.0531  -0.0819 -0.0764 301 TYR B C   
5367 O O   . TYR B 306 ? 0.5883 0.7459 0.9332 0.0726  -0.0930 -0.0835 301 TYR B O   
5368 C CB  . TYR B 306 ? 0.6131 0.6860 0.8462 0.0587  -0.1323 -0.0682 301 TYR B CB  
5369 C CG  . TYR B 306 ? 0.6113 0.6847 0.8675 0.0330  -0.1300 -0.0734 301 TYR B CG  
5370 C CD1 . TYR B 306 ? 0.5946 0.6965 0.9152 0.0241  -0.1533 -0.0899 301 TYR B CD1 
5371 C CD2 . TYR B 306 ? 0.6035 0.6451 0.8179 0.0177  -0.1086 -0.0627 301 TYR B CD2 
5372 C CE1 . TYR B 306 ? 0.6082 0.7083 0.9505 -0.0028 -0.1494 -0.0962 301 TYR B CE1 
5373 C CE2 . TYR B 306 ? 0.6206 0.6527 0.8490 -0.0074 -0.1055 -0.0665 301 TYR B CE2 
5374 C CZ  . TYR B 306 ? 0.6289 0.6909 0.9207 -0.0194 -0.1232 -0.0835 301 TYR B CZ  
5375 O OH  . TYR B 306 ? 0.6673 0.7174 0.9731 -0.0480 -0.1180 -0.0887 301 TYR B OH  
5376 N N   . LYS B 307 ? 0.6164 0.7679 0.9620 0.0260  -0.0545 -0.0817 302 LYS B N   
5377 C CA  . LYS B 307 ? 0.6254 0.8280 1.0580 0.0145  -0.0307 -0.1010 302 LYS B CA  
5378 C C   . LYS B 307 ? 0.6156 0.8360 1.0598 0.0288  -0.0075 -0.1046 302 LYS B C   
5379 O O   . LYS B 307 ? 0.6114 0.8788 1.1402 0.0317  0.0017  -0.1251 302 LYS B O   
5380 C CB  . LYS B 307 ? 0.6240 0.8681 1.1453 0.0189  -0.0653 -0.1216 302 LYS B CB  
5381 C CG  . LYS B 307 ? 0.6612 0.8923 1.1831 -0.0016 -0.0840 -0.1237 302 LYS B CG  
5382 C CD  . LYS B 307 ? 0.6953 0.9014 1.1846 -0.0366 -0.0411 -0.1162 302 LYS B CD  
5383 C CE  . LYS B 307 ? 0.7086 0.9085 1.2194 -0.0622 -0.0532 -0.1240 302 LYS B CE  
5384 N NZ  . LYS B 307 ? 0.7328 0.8717 1.1586 -0.0828 -0.0298 -0.1046 302 LYS B NZ  
5385 N N   . ASP B 308 ? 0.6209 0.8047 0.9862 0.0385  0.0008  -0.0873 303 ASP B N   
5386 C CA  . ASP B 308 ? 0.6250 0.8161 0.9877 0.0449  0.0298  -0.0903 303 ASP B CA  
5387 C C   . ASP B 308 ? 0.6572 0.8384 1.0011 0.0134  0.0788  -0.0910 303 ASP B C   
5388 O O   . ASP B 308 ? 0.6839 0.8263 0.9690 -0.0059 0.0839  -0.0768 303 ASP B O   
5389 C CB  . ASP B 308 ? 0.6170 0.7721 0.9043 0.0646  0.0187  -0.0741 303 ASP B CB  
5390 C CG  . ASP B 308 ? 0.6242 0.7822 0.9231 0.0942  -0.0158 -0.0762 303 ASP B CG  
5391 O OD1 . ASP B 308 ? 0.6407 0.8303 1.0093 0.1048  -0.0329 -0.0908 303 ASP B OD1 
5392 O OD2 . ASP B 308 ? 0.6669 0.7918 0.9041 0.1064  -0.0268 -0.0641 303 ASP B OD2 
5393 N N   . PRO B 309 ? 0.6594 0.8676 1.0464 0.0078  0.1157  -0.1081 304 PRO B N   
5394 C CA  . PRO B 309 ? 0.6985 0.8784 1.0363 -0.0228 0.1655  -0.1065 304 PRO B CA  
5395 C C   . PRO B 309 ? 0.7070 0.8265 0.9308 -0.0198 0.1560  -0.0810 304 PRO B C   
5396 O O   . PRO B 309 ? 0.6795 0.7944 0.8807 0.0063  0.1341  -0.0745 304 PRO B O   
5397 C CB  . PRO B 309 ? 0.7007 0.9133 1.0909 -0.0182 0.2005  -0.1292 304 PRO B CB  
5398 C CG  . PRO B 309 ? 0.6591 0.9005 1.0966 0.0227  0.1598  -0.1335 304 PRO B CG  
5399 C CD  . PRO B 309 ? 0.6397 0.8920 1.1048 0.0316  0.1125  -0.1280 304 PRO B CD  
5400 N N   . VAL B 310 ? 0.7448 0.8162 0.9003 -0.0463 0.1691  -0.0675 305 VAL B N   
5401 C CA  . VAL B 310 ? 0.7647 0.7789 0.8204 -0.0429 0.1553  -0.0459 305 VAL B CA  
5402 C C   . VAL B 310 ? 0.7839 0.7810 0.7952 -0.0445 0.1807  -0.0490 305 VAL B C   
5403 O O   . VAL B 310 ? 0.8127 0.8128 0.8321 -0.0656 0.2253  -0.0633 305 VAL B O   
5404 C CB  . VAL B 310 ? 0.8225 0.7778 0.8097 -0.0687 0.1562  -0.0295 305 VAL B CB  
5405 C CG1 . VAL B 310 ? 0.8176 0.7889 0.8528 -0.0725 0.1387  -0.0309 305 VAL B CG1 
5406 C CG2 . VAL B 310 ? 0.8954 0.8149 0.8388 -0.1067 0.2065  -0.0334 305 VAL B CG2 
5407 N N   . THR B 311 ? 0.7656 0.7453 0.7335 -0.0233 0.1539  -0.0384 306 THR B N   
5408 C CA  . THR B 311 ? 0.8101 0.7556 0.7116 -0.0288 0.1690  -0.0371 306 THR B CA  
5409 C C   . THR B 311 ? 0.8769 0.7539 0.6828 -0.0450 0.1556  -0.0175 306 THR B C   
5410 O O   . THR B 311 ? 0.8601 0.7234 0.6522 -0.0311 0.1162  -0.0040 306 THR B O   
5411 C CB  . THR B 311 ? 0.7669 0.7279 0.6743 0.0002  0.1457  -0.0383 306 THR B CB  
5412 O OG1 . THR B 311 ? 0.7191 0.7324 0.7085 0.0187  0.1484  -0.0530 306 THR B OG1 
5413 C CG2 . THR B 311 ? 0.8026 0.7298 0.6454 -0.0078 0.1622  -0.0410 306 THR B CG2 
5414 N N   . VAL B 312 ? 0.9677 0.7966 0.7057 -0.0746 0.1887  -0.0173 307 VAL B N   
5415 C CA  . VAL B 312 ? 1.0568 0.8043 0.6870 -0.0909 0.1724  0.0027  307 VAL B CA  
5416 C C   . VAL B 312 ? 1.0884 0.8021 0.6514 -0.0799 0.1488  0.0076  307 VAL B C   
5417 O O   . VAL B 312 ? 1.1292 0.8289 0.6566 -0.0916 0.1777  -0.0029 307 VAL B O   
5418 C CB  . VAL B 312 ? 1.1527 0.8464 0.7251 -0.1344 0.2182  0.0034  307 VAL B CB  
5419 C CG1 . VAL B 312 ? 1.1489 0.8845 0.7755 -0.1519 0.2798  -0.0230 307 VAL B CG1 
5420 C CG2 . VAL B 312 ? 1.2682 0.8580 0.6980 -0.1543 0.2083  0.0218  307 VAL B CG2 
5421 N N   . VAL B 313 ? 1.0747 0.7794 0.6296 -0.0571 0.0963  0.0200  308 VAL B N   
5422 C CA  . VAL B 313 ? 1.1033 0.7847 0.6125 -0.0445 0.0645  0.0222  308 VAL B CA  
5423 C C   . VAL B 313 ? 1.2282 0.8142 0.6147 -0.0635 0.0455  0.0379  308 VAL B C   
5424 O O   . VAL B 313 ? 1.2811 0.8336 0.6066 -0.0659 0.0339  0.0357  308 VAL B O   
5425 C CB  . VAL B 313 ? 1.0227 0.7506 0.5999 -0.0102 0.0209  0.0209  308 VAL B CB  
5426 C CG1 . VAL B 313 ? 0.9929 0.7344 0.6143 -0.0006 0.0034  0.0283  308 VAL B CG1 
5427 C CG2 . VAL B 313 ? 1.0688 0.7629 0.6004 -0.0001 -0.0228 0.0249  308 VAL B CG2 
5428 N N   . VAL B 314 ? 1.2825 0.8177 0.6264 -0.0783 0.0411  0.0533  309 VAL B N   
5429 C CA  . VAL B 314 ? 1.4171 0.8441 0.6277 -0.1005 0.0258  0.0708  309 VAL B CA  
5430 C C   . VAL B 314 ? 1.5004 0.8767 0.6564 -0.1405 0.0765  0.0760  309 VAL B C   
5431 O O   . VAL B 314 ? 1.4686 0.8658 0.6765 -0.1429 0.0846  0.0790  309 VAL B O   
5432 C CB  . VAL B 314 ? 1.4391 0.8263 0.6293 -0.0776 -0.0441 0.0881  309 VAL B CB  
5433 C CG1 . VAL B 314 ? 1.5957 0.8580 0.6375 -0.0992 -0.0667 0.1084  309 VAL B CG1 
5434 C CG2 . VAL B 314 ? 1.3624 0.8008 0.6131 -0.0422 -0.0898 0.0784  309 VAL B CG2 
5435 N N   . ASP B 315 ? 1.6144 0.9209 0.6635 -0.1744 0.1122  0.0750  310 ASP B N   
5436 C CA  . ASP B 315 ? 1.7084 0.9619 0.6982 -0.2207 0.1748  0.0746  310 ASP B CA  
5437 C C   . ASP B 315 ? 1.8108 0.9709 0.7160 -0.2372 0.1523  0.1001  310 ASP B C   
5438 O O   . ASP B 315 ? 1.8248 0.9830 0.7503 -0.2627 0.1922  0.0990  310 ASP B O   
5439 C CB  . ASP B 315 ? 1.8287 1.0093 0.6992 -0.2555 0.2176  0.0676  310 ASP B CB  
5440 C CG  . ASP B 315 ? 1.7572 1.0097 0.6890 -0.2416 0.2401  0.0421  310 ASP B CG  
5441 O OD1 . ASP B 315 ? 1.8584 1.0567 0.7006 -0.2701 0.2813  0.0317  310 ASP B OD1 
5442 O OD2 . ASP B 315 ? 1.6005 0.9533 0.6589 -0.2044 0.2185  0.0323  310 ASP B OD2 
5443 N N   . ASP B 316 ? 1.8949 0.9726 0.7035 -0.2234 0.0868  0.1218  311 ASP B N   
5444 C CA  . ASP B 316 ? 2.0179 0.9827 0.7214 -0.2364 0.0552  0.1489  311 ASP B CA  
5445 C C   . ASP B 316 ? 2.0192 0.9610 0.7121 -0.1932 -0.0381 0.1638  311 ASP B C   
5446 O O   . ASP B 316 ? 2.0723 0.9738 0.6962 -0.1848 -0.0748 0.1660  311 ASP B O   
5447 C CB  . ASP B 316 ? 2.2104 1.0398 0.7352 -0.2879 0.0929  0.1594  311 ASP B CB  
5448 C CG  . ASP B 316 ? 2.3510 1.0552 0.7627 -0.3102 0.0758  0.1873  311 ASP B CG  
5449 O OD1 . ASP B 316 ? 2.5412 1.1067 0.7772 -0.3482 0.0875  0.2023  311 ASP B OD1 
5450 O OD2 . ASP B 316 ? 2.2978 1.0337 0.7878 -0.2914 0.0518  0.1940  311 ASP B OD2 
5451 N N   . LEU B 317 ? 1.9626 0.9321 0.7305 -0.1658 -0.0761 0.1708  312 LEU B N   
5452 C CA  . LEU B 317 ? 1.9286 0.9130 0.7391 -0.1181 -0.1579 0.1750  312 LEU B CA  
5453 C C   . LEU B 317 ? 2.0947 0.9414 0.7674 -0.1154 -0.2253 0.2005  312 LEU B C   
5454 O O   . LEU B 317 ? 2.0806 0.9312 0.7856 -0.0755 -0.2991 0.2019  312 LEU B O   
5455 C CB  . LEU B 317 ? 1.8026 0.8721 0.7519 -0.0889 -0.1685 0.1678  312 LEU B CB  
5456 C CG  . LEU B 317 ? 1.6791 0.8394 0.7472 -0.0411 -0.2143 0.1527  312 LEU B CG  
5457 C CD1 . LEU B 317 ? 1.5470 0.8214 0.7135 -0.0380 -0.1707 0.1291  312 LEU B CD1 
5458 C CD2 . LEU B 317 ? 1.6374 0.8203 0.7841 -0.0150 -0.2419 0.1533  312 LEU B CD2 
5459 N N   . ARG B 318 ? 2.2568 0.9796 0.7771 -0.1584 -0.1994 0.2188  313 ARG B N   
5460 C CA  . ARG B 318 ? 2.4492 1.0160 0.8054 -0.1622 -0.2618 0.2460  313 ARG B CA  
5461 C C   . ARG B 318 ? 2.5584 1.0591 0.7898 -0.1782 -0.2724 0.2463  313 ARG B C   
5462 O O   . ARG B 318 ? 2.7474 1.0994 0.8092 -0.1927 -0.3136 0.2691  313 ARG B O   
5463 C CB  . ARG B 318 ? 2.5865 1.0324 0.8277 -0.2015 -0.2337 0.2690  313 ARG B CB  
5464 C CG  . ARG B 318 ? 2.5870 1.0492 0.8171 -0.2562 -0.1266 0.2582  313 ARG B CG  
5465 C CD  . ARG B 318 ? 2.5684 1.0348 0.8470 -0.2711 -0.0947 0.2626  313 ARG B CD  
5466 N NE  . ARG B 318 ? 2.7773 1.0711 0.8847 -0.3042 -0.1036 0.2923  313 ARG B NE  
5467 C CZ  . ARG B 318 ? 2.8058 1.0633 0.9191 -0.3182 -0.0910 0.3024  313 ARG B CZ  
5468 N NH1 . ARG B 318 ? 2.6430 1.0277 0.9262 -0.3015 -0.0712 0.2841  313 ARG B NH1 
5469 N NH2 . ARG B 318 ? 3.0091 1.0945 0.9498 -0.3504 -0.0998 0.3310  313 ARG B NH2 
5470 N N   . LEU B 319 ? 2.4513 1.0564 0.7621 -0.1755 -0.2372 0.2207  314 LEU B N   
5471 C CA  . LEU B 319 ? 2.5270 1.0916 0.7466 -0.1848 -0.2498 0.2147  314 LEU B CA  
5472 C C   . LEU B 319 ? 2.3951 1.0708 0.7450 -0.1383 -0.3012 0.1948  314 LEU B C   
5473 O O   . LEU B 319 ? 2.4064 1.0944 0.7322 -0.1436 -0.2972 0.1804  314 LEU B O   
5474 C CB  . LEU B 319 ? 2.5378 1.1137 0.7203 -0.2311 -0.1501 0.1984  314 LEU B CB  
5475 C CG  . LEU B 319 ? 2.6734 1.1483 0.7296 -0.2887 -0.0759 0.2086  314 LEU B CG  
5476 C CD1 . LEU B 319 ? 2.6020 1.1562 0.7168 -0.3187 0.0261  0.1795  314 LEU B CD1 
5477 C CD2 . LEU B 319 ? 2.9182 1.2038 0.7386 -0.3203 -0.1044 0.2322  314 LEU B CD2 
5478 N N   . CYS B 320 ? 2.2805 1.0320 0.7651 -0.0956 -0.3460 0.1921  315 CYS B N   
5479 C CA  . CYS B 320 ? 2.1425 1.0097 0.7699 -0.0549 -0.3823 0.1696  315 CYS B CA  
5480 C C   . CYS B 320 ? 2.1553 1.0092 0.8242 -0.0115 -0.4787 0.1743  315 CYS B C   
5481 O O   . CYS B 320 ? 2.2495 1.0181 0.8606 -0.0061 -0.5169 0.1955  315 CYS B O   
5482 C CB  . CYS B 320 ? 1.9591 0.9668 0.7505 -0.0453 -0.3235 0.1502  315 CYS B CB  
5483 S SG  . CYS B 320 ? 1.9279 0.9746 0.7123 -0.0873 -0.2150 0.1378  315 CYS B SG  
5484 N N   . THR B 321 ? 2.0684 1.0042 0.8395 0.0187  -0.5173 0.1523  316 THR B N   
5485 C CA  . THR B 321 ? 2.0412 1.0044 0.9073 0.0642  -0.5976 0.1455  316 THR B CA  
5486 C C   . THR B 321 ? 1.8512 0.9682 0.9069 0.0886  -0.5722 0.1153  316 THR B C   
5487 O O   . THR B 321 ? 1.7630 0.9508 0.8567 0.0723  -0.5096 0.1014  316 THR B O   
5488 C CB  . THR B 321 ? 2.1612 1.0539 0.9586 0.0782  -0.6892 0.1459  316 THR B CB  
5489 O OG1 . THR B 321 ? 2.1455 1.0742 0.9334 0.0625  -0.6703 0.1281  316 THR B OG1 
5490 C CG2 . THR B 321 ? 2.3677 1.0878 0.9673 0.0594  -0.7296 0.1791  316 THR B CG2 
5491 N N   . VAL B 322 ? 1.8012 0.9629 0.9715 0.1268  -0.6189 0.1045  317 VAL B N   
5492 C CA  . VAL B 322 ? 1.6473 0.9430 0.9898 0.1481  -0.5938 0.0749  317 VAL B CA  
5493 C C   . VAL B 322 ? 1.6387 0.9779 1.0770 0.1806  -0.6616 0.0500  317 VAL B C   
5494 O O   . VAL B 322 ? 1.7262 1.0099 1.1544 0.2047  -0.7374 0.0547  317 VAL B O   
5495 C CB  . VAL B 322 ? 1.5792 0.9085 1.0009 0.1623  -0.5699 0.0756  317 VAL B CB  
5496 C CG1 . VAL B 322 ? 1.4115 0.8616 0.9589 0.1641  -0.5090 0.0515  317 VAL B CG1 
5497 C CG2 . VAL B 322 ? 1.6490 0.8973 0.9614 0.1360  -0.5372 0.1045  317 VAL B CG2 
5498 N N   . LYS B 323 ? 1.5439 0.9810 1.0797 0.1812  -0.6354 0.0221  318 LYS B N   
5499 C CA  . LYS B 323 ? 1.5258 1.0197 1.1761 0.2086  -0.6906 -0.0080 318 LYS B CA  
5500 C C   . LYS B 323 ? 1.3837 1.0007 1.1872 0.2152  -0.6401 -0.0398 318 LYS B C   
5501 O O   . LYS B 323 ? 1.3142 0.9707 1.1157 0.1940  -0.5672 -0.0394 318 LYS B O   
5502 C CB  . LYS B 323 ? 1.6014 1.0631 1.1891 0.1981  -0.7340 -0.0135 318 LYS B CB  
5503 C CG  . LYS B 323 ? 1.7151 1.0709 1.1164 0.1650  -0.7234 0.0156  318 LYS B CG  
5504 C CD  . LYS B 323 ? 1.6421 1.0403 1.0238 0.1331  -0.6356 0.0117  318 LYS B CD  
5505 C CE  . LYS B 323 ? 1.6226 1.0672 1.0404 0.1272  -0.6434 -0.0146 318 LYS B CE  
5506 N NZ  . LYS B 323 ? 1.7597 1.1113 1.0527 0.1165  -0.7048 -0.0084 318 LYS B NZ  
5507 N N   . LEU B 324 ? 1.3573 1.0297 1.2925 0.2443  -0.6797 -0.0686 319 LEU B N   
5508 C CA  . LEU B 324 ? 1.2487 1.0304 1.3253 0.2468  -0.6383 -0.1046 319 LEU B CA  
5509 C C   . LEU B 324 ? 1.2436 1.0513 1.3059 0.2244  -0.6253 -0.1172 319 LEU B C   
5510 O O   . LEU B 324 ? 1.3313 1.0774 1.2962 0.2148  -0.6663 -0.1047 319 LEU B O   
5511 C CB  . LEU B 324 ? 1.2383 1.0686 1.4610 0.2809  -0.6888 -0.1378 319 LEU B CB  
5512 C CG  . LEU B 324 ? 1.2339 1.0615 1.5219 0.3104  -0.7028 -0.1408 319 LEU B CG  
5513 C CD1 . LEU B 324 ? 1.1559 1.0068 1.4444 0.2981  -0.6200 -0.1335 319 LEU B CD1 
5514 C CD2 . LEU B 324 ? 1.3511 1.0735 1.5454 0.3282  -0.7777 -0.1116 319 LEU B CD2 
5515 N N   . CYS B 325 ? 1.1547 1.0438 1.3036 0.2143  -0.5677 -0.1417 320 CYS B N   
5516 C CA  . CYS B 325 ? 1.1495 1.0690 1.3064 0.1950  -0.5568 -0.1599 320 CYS B CA  
5517 C C   . CYS B 325 ? 1.1014 1.1066 1.4177 0.2053  -0.5647 -0.2044 320 CYS B C   
5518 O O   . CYS B 325 ? 1.0247 1.0904 1.4125 0.1958  -0.5010 -0.2225 320 CYS B O   
5519 C CB  . CYS B 325 ? 1.0945 1.0237 1.1986 0.1680  -0.4763 -0.1494 320 CYS B CB  
5520 S SG  . CYS B 325 ? 1.1477 0.9975 1.0975 0.1532  -0.4462 -0.1052 320 CYS B SG  
5521 N N   . PRO B 326 ? 1.1567 1.1642 1.5296 0.2237  -0.6432 -0.2236 321 PRO B N   
5522 C CA  . PRO B 326 ? 1.1137 1.2082 1.6518 0.2312  -0.6525 -0.2717 321 PRO B CA  
5523 C C   . PRO B 326 ? 1.0902 1.2186 1.6360 0.2012  -0.6230 -0.2913 321 PRO B C   
5524 O O   . PRO B 326 ? 1.0494 1.2522 1.7289 0.1979  -0.6164 -0.3334 321 PRO B O   
5525 C CB  . PRO B 326 ? 1.1989 1.2711 1.7747 0.2605  -0.7576 -0.2816 321 PRO B CB  
5526 C CG  . PRO B 326 ? 1.3003 1.2656 1.6967 0.2534  -0.8018 -0.2404 321 PRO B CG  
5527 C CD  . PRO B 326 ? 1.2730 1.1973 1.5567 0.2375  -0.7295 -0.2026 321 PRO B CD  
5528 N N   . ASP B 327 ? 1.1167 1.1883 1.5214 0.1784  -0.6031 -0.2626 322 ASP B N   
5529 C CA  . ASP B 327 ? 1.1037 1.1913 1.4924 0.1493  -0.5731 -0.2765 322 ASP B CA  
5530 C C   . ASP B 327 ? 1.0467 1.1277 1.3685 0.1279  -0.4838 -0.2572 322 ASP B C   
5531 O O   . ASP B 327 ? 1.0694 1.1187 1.3041 0.1062  -0.4628 -0.2479 322 ASP B O   
5532 C CB  . ASP B 327 ? 1.2044 1.2257 1.4871 0.1415  -0.6362 -0.2663 322 ASP B CB  
5533 C CG  . ASP B 327 ? 1.2214 1.2800 1.5584 0.1223  -0.6481 -0.3016 322 ASP B CG  
5534 O OD1 . ASP B 327 ? 1.2493 1.3302 1.6666 0.1344  -0.7216 -0.3288 322 ASP B OD1 
5535 O OD2 . ASP B 327 ? 1.2066 1.2704 1.5085 0.0955  -0.5866 -0.3032 322 ASP B OD2 
5536 N N   . SER B 328 ? 0.9753 1.0813 1.3355 0.1354  -0.4351 -0.2521 323 SER B N   
5537 C CA  . SER B 328 ? 0.9063 1.0231 1.2420 0.1171  -0.3537 -0.2452 323 SER B CA  
5538 C C   . SER B 328 ? 0.8310 1.0135 1.2862 0.1141  -0.3080 -0.2764 323 SER B C   
5539 O O   . SER B 328 ? 0.8148 1.0369 1.3746 0.1301  -0.3296 -0.3000 323 SER B O   
5540 C CB  . SER B 328 ? 0.9081 0.9778 1.1443 0.1199  -0.3261 -0.2066 323 SER B CB  
5541 O OG  . SER B 328 ? 0.8838 0.9669 1.1650 0.1379  -0.3209 -0.2031 323 SER B OG  
5542 N N   . GLU B 329 ? 0.7891 0.9766 1.2238 0.0928  -0.2438 -0.2775 324 GLU B N   
5543 C CA  . GLU B 329 ? 0.7397 0.9733 1.2615 0.0803  -0.1909 -0.3070 324 GLU B CA  
5544 C C   . GLU B 329 ? 0.6908 0.9365 1.2475 0.0928  -0.1613 -0.3060 324 GLU B C   
5545 O O   . GLU B 329 ? 0.6765 0.9675 1.3393 0.0933  -0.1461 -0.3392 324 GLU B O   
5546 C CB  . GLU B 329 ? 0.7390 0.9534 1.2030 0.0542  -0.1350 -0.3026 324 GLU B CB  
5547 C CG  . GLU B 329 ? 0.7544 0.9159 1.0989 0.0563  -0.1146 -0.2626 324 GLU B CG  
5548 C CD  . GLU B 329 ? 0.8020 0.9369 1.0861 0.0359  -0.0822 -0.2587 324 GLU B CD  
5549 O OE1 . GLU B 329 ? 0.8311 0.9820 1.1531 0.0184  -0.0807 -0.2844 324 GLU B OE1 
5550 O OE2 . GLU B 329 ? 0.8289 0.9270 1.0327 0.0377  -0.0594 -0.2320 324 GLU B OE2 
5551 N N   . ARG B 330 ? 0.6672 0.8723 1.1373 0.1011  -0.1514 -0.2710 325 ARG B N   
5552 C CA  . ARG B 330 ? 0.6221 0.8288 1.1063 0.1099  -0.1216 -0.2676 325 ARG B CA  
5553 C C   . ARG B 330 ? 0.6246 0.8322 1.1427 0.1367  -0.1694 -0.2647 325 ARG B C   
5554 O O   . ARG B 330 ? 0.6542 0.8402 1.1430 0.1486  -0.2259 -0.2507 325 ARG B O   
5555 C CB  . ARG B 330 ? 0.6123 0.7774 0.9957 0.1036  -0.0859 -0.2355 325 ARG B CB  
5556 C CG  . ARG B 330 ? 0.6180 0.7453 0.9101 0.1038  -0.1088 -0.2052 325 ARG B CG  
5557 C CD  . ARG B 330 ? 0.5800 0.6836 0.8062 0.0901  -0.0648 -0.1906 325 ARG B CD  
5558 N NE  . ARG B 330 ? 0.5581 0.6441 0.7504 0.0965  -0.0434 -0.1720 325 ARG B NE  
5559 C CZ  . ARG B 330 ? 0.5267 0.5982 0.6899 0.0881  -0.0031 -0.1680 325 ARG B CZ  
5560 N NH1 . ARG B 330 ? 0.5077 0.5759 0.6679 0.0725  0.0242  -0.1800 325 ARG B NH1 
5561 N NH2 . ARG B 330 ? 0.5288 0.5834 0.6618 0.0948  0.0067  -0.1520 325 ARG B NH2 
5562 N N   . ARG B 331 ? 0.5904 0.8153 1.1643 0.1451  -0.1461 -0.2789 326 ARG B N   
5563 C CA  . ARG B 331 ? 0.5958 0.8228 1.2176 0.1722  -0.1873 -0.2822 326 ARG B CA  
5564 C C   . ARG B 331 ? 0.5995 0.7730 1.1247 0.1823  -0.2022 -0.2421 326 ARG B C   
5565 O O   . ARG B 331 ? 0.5791 0.7269 1.0244 0.1689  -0.1661 -0.2192 326 ARG B O   
5566 C CB  . ARG B 331 ? 0.5803 0.8429 1.2981 0.1761  -0.1500 -0.3163 326 ARG B CB  
5567 C CG  . ARG B 331 ? 0.5807 0.9031 1.4187 0.1647  -0.1285 -0.3647 326 ARG B CG  
5568 C CD  . ARG B 331 ? 0.5808 0.9238 1.4832 0.1608  -0.0705 -0.3950 326 ARG B CD  
5569 N NE  . ARG B 331 ? 0.5740 0.8727 1.3692 0.1423  -0.0151 -0.3710 326 ARG B NE  
5570 C CZ  . ARG B 331 ? 0.5845 0.8664 1.3691 0.1420  0.0247  -0.3762 326 ARG B CZ  
5571 N NH1 . ARG B 331 ? 0.5626 0.8701 1.4423 0.1594  0.0226  -0.4065 326 ARG B NH1 
5572 N NH2 . ARG B 331 ? 0.5934 0.8291 1.2706 0.1252  0.0639  -0.3519 326 ARG B NH2 
5573 N N   . PHE B 332 ? 0.6231 0.7789 1.1617 0.2060  -0.2573 -0.2359 327 PHE B N   
5574 C CA  . PHE B 332 ? 0.6440 0.7474 1.1079 0.2163  -0.2732 -0.2033 327 PHE B CA  
5575 C C   . PHE B 332 ? 0.6659 0.7201 1.0099 0.2035  -0.2838 -0.1663 327 PHE B C   
5576 O O   . PHE B 332 ? 0.6679 0.6849 0.9405 0.1997  -0.2708 -0.1396 327 PHE B O   
5577 C CB  . PHE B 332 ? 0.6142 0.7182 1.0789 0.2137  -0.2226 -0.2042 327 PHE B CB  
5578 C CG  . PHE B 332 ? 0.5981 0.7477 1.1740 0.2203  -0.1970 -0.2451 327 PHE B CG  
5579 C CD1 . PHE B 332 ? 0.6247 0.7934 1.2968 0.2456  -0.2372 -0.2698 327 PHE B CD1 
5580 C CD2 . PHE B 332 ? 0.5677 0.7363 1.1508 0.2005  -0.1320 -0.2609 327 PHE B CD2 
5581 C CE1 . PHE B 332 ? 0.6053 0.8211 1.3927 0.2506  -0.2067 -0.3138 327 PHE B CE1 
5582 C CE2 . PHE B 332 ? 0.5628 0.7683 1.2430 0.2015  -0.0991 -0.3021 327 PHE B CE2 
5583 C CZ  . PHE B 332 ? 0.5724 0.8062 1.3613 0.2262  -0.1334 -0.3305 327 PHE B CZ  
5584 N N   . CYS B 333 ? 0.6860 0.7403 1.0119 0.1953  -0.3058 -0.1679 328 CYS B N   
5585 C CA  . CYS B 333 ? 0.7257 0.7318 0.9388 0.1810  -0.3121 -0.1383 328 CYS B CA  
5586 C C   . CYS B 333 ? 0.8008 0.7440 0.9475 0.1910  -0.3708 -0.1162 328 CYS B C   
5587 O O   . CYS B 333 ? 0.8407 0.7792 1.0312 0.2104  -0.4272 -0.1274 328 CYS B O   
5588 C CB  . CYS B 333 ? 0.7218 0.7458 0.9307 0.1646  -0.3056 -0.1505 328 CYS B CB  
5589 S SG  . CYS B 333 ? 0.6850 0.7402 0.8967 0.1446  -0.2293 -0.1563 328 CYS B SG  
5590 N N   . PHE B 334 ? 0.8290 0.7202 0.8686 0.1767  -0.3568 -0.0860 329 PHE B N   
5591 C CA  . PHE B 334 ? 0.9188 0.7341 0.8660 0.1771  -0.4031 -0.0623 329 PHE B CA  
5592 C C   . PHE B 334 ? 0.9525 0.7250 0.7874 0.1505  -0.3736 -0.0408 329 PHE B C   
5593 O O   . PHE B 334 ? 0.8989 0.7005 0.7332 0.1363  -0.3174 -0.0406 329 PHE B O   
5594 C CB  . PHE B 334 ? 0.9460 0.7233 0.8874 0.1927  -0.4244 -0.0481 329 PHE B CB  
5595 C CG  . PHE B 334 ? 0.9025 0.6850 0.8318 0.1831  -0.3706 -0.0360 329 PHE B CG  
5596 C CD1 . PHE B 334 ? 0.9580 0.6762 0.7900 0.1683  -0.3630 -0.0074 329 PHE B CD1 
5597 C CD2 . PHE B 334 ? 0.8125 0.6586 0.8252 0.1871  -0.3293 -0.0546 329 PHE B CD2 
5598 C CE1 . PHE B 334 ? 0.9176 0.6441 0.7482 0.1589  -0.3184 0.0008  329 PHE B CE1 
5599 C CE2 . PHE B 334 ? 0.7768 0.6230 0.7751 0.1789  -0.2883 -0.0443 329 PHE B CE2 
5600 C CZ  . PHE B 334 ? 0.8301 0.6212 0.7440 0.1656  -0.2847 -0.0175 329 PHE B CZ  
5601 N N   . GLU B 335 ? 1.0573 0.7554 0.7953 0.1443  -0.4133 -0.0241 330 GLU B N   
5602 C CA  . GLU B 335 ? 1.1129 0.7621 0.7387 0.1169  -0.3856 -0.0079 330 GLU B CA  
5603 C C   . GLU B 335 ? 1.2086 0.7681 0.7262 0.1069  -0.3966 0.0207  330 GLU B C   
5604 O O   . GLU B 335 ? 1.2780 0.7837 0.7695 0.1210  -0.4545 0.0299  330 GLU B O   
5605 C CB  . GLU B 335 ? 1.1679 0.7994 0.7563 0.1098  -0.4167 -0.0184 330 GLU B CB  
5606 C CG  . GLU B 335 ? 1.2521 0.8343 0.7263 0.0800  -0.3817 -0.0078 330 GLU B CG  
5607 C CD  . GLU B 335 ? 1.3051 0.8927 0.7667 0.0717  -0.3955 -0.0259 330 GLU B CD  
5608 O OE1 . GLU B 335 ? 1.2791 0.9036 0.7546 0.0585  -0.3423 -0.0365 330 GLU B OE1 
5609 O OE2 . GLU B 335 ? 1.3652 0.9188 0.8057 0.0793  -0.4623 -0.0306 330 GLU B OE2 
5610 N N   . VAL B 336 ? 1.2172 0.7601 0.6765 0.0821  -0.3398 0.0330  331 VAL B N   
5611 C CA  . VAL B 336 ? 1.3316 0.7834 0.6727 0.0612  -0.3349 0.0579  331 VAL B CA  
5612 C C   . VAL B 336 ? 1.4227 0.8225 0.6553 0.0333  -0.3178 0.0601  331 VAL B C   
5613 O O   . VAL B 336 ? 1.3727 0.8163 0.6230 0.0197  -0.2643 0.0484  331 VAL B O   
5614 C CB  . VAL B 336 ? 1.2813 0.7539 0.6443 0.0498  -0.2786 0.0655  331 VAL B CB  
5615 C CG1 . VAL B 336 ? 1.4022 0.7778 0.6451 0.0232  -0.2684 0.0890  331 VAL B CG1 
5616 C CG2 . VAL B 336 ? 1.1945 0.7169 0.6609 0.0764  -0.2932 0.0600  331 VAL B CG2 
5617 N N   . VAL B 337 ? 1.5727 0.8733 0.6892 0.0257  -0.3653 0.0741  332 VAL B N   
5618 C CA  . VAL B 337 ? 1.6817 0.9217 0.6829 -0.0009 -0.3564 0.0737  332 VAL B CA  
5619 C C   . VAL B 337 ? 1.8232 0.9533 0.6733 -0.0362 -0.3273 0.0958  332 VAL B C   
5620 O O   . VAL B 337 ? 1.9347 0.9710 0.6972 -0.0372 -0.3713 0.1171  332 VAL B O   
5621 C CB  . VAL B 337 ? 1.7528 0.9603 0.7264 0.0133  -0.4354 0.0667  332 VAL B CB  
5622 C CG1 . VAL B 337 ? 1.8595 0.9978 0.7029 -0.0170 -0.4245 0.0644  332 VAL B CG1 
5623 C CG2 . VAL B 337 ? 1.6252 0.9455 0.7554 0.0418  -0.4527 0.0402  332 VAL B CG2 
5624 N N   . SER B 338 ? 1.8252 0.9655 0.6480 -0.0655 -0.2511 0.0886  333 SER B N   
5625 C CA  . SER B 338 ? 1.9564 1.0015 0.6449 -0.1060 -0.2047 0.1026  333 SER B CA  
5626 C C   . SER B 338 ? 2.0977 1.0547 0.6448 -0.1305 -0.2110 0.1002  333 SER B C   
5627 O O   . SER B 338 ? 2.0980 1.0688 0.6570 -0.1134 -0.2604 0.0893  333 SER B O   
5628 C CB  . SER B 338 ? 1.8710 0.9843 0.6274 -0.1236 -0.1149 0.0907  333 SER B CB  
5629 O OG  . SER B 338 ? 1.7565 0.9423 0.6319 -0.1031 -0.1130 0.0931  333 SER B OG  
5630 N N   . THR B 339 ? 2.2293 1.0931 0.6416 -0.1730 -0.1594 0.1081  334 THR B N   
5631 C CA  . THR B 339 ? 2.3861 1.1466 0.6377 -0.2030 -0.1577 0.1057  334 THR B CA  
5632 C C   . THR B 339 ? 2.3144 1.1487 0.6258 -0.1977 -0.1357 0.0765  334 THR B C   
5633 O O   . THR B 339 ? 2.3404 1.1617 0.6314 -0.1829 -0.1982 0.0709  334 THR B O   
5634 C CB  . THR B 339 ? 2.5366 1.1845 0.6343 -0.2560 -0.0880 0.1152  334 THR B CB  
5635 O OG1 . THR B 339 ? 2.6226 1.2239 0.6217 -0.2872 -0.0435 0.0975  334 THR B OG1 
5636 C CG2 . THR B 339 ? 2.4359 1.1580 0.6367 -0.2672 -0.0076 0.1096  334 THR B CG2 
5637 N N   . SER B 340 ? 2.2264 1.1380 0.6176 -0.2082 -0.0513 0.0566  335 SER B N   
5638 C CA  . SER B 340 ? 2.1609 1.1406 0.6143 -0.2013 -0.0273 0.0288  335 SER B CA  
5639 C C   . SER B 340 ? 1.9732 1.0916 0.6169 -0.1613 -0.0385 0.0179  335 SER B C   
5640 O O   . SER B 340 ? 1.9198 1.0850 0.6169 -0.1432 -0.0647 0.0025  335 SER B O   
5641 C CB  . SER B 340 ? 2.1941 1.1654 0.6147 -0.2356 0.0703  0.0095  335 SER B CB  
5642 O OG  . SER B 340 ? 2.3616 1.2224 0.6168 -0.2677 0.0775  0.0040  335 SER B OG  
5643 N N   . LYS B 341 ? 1.8832 1