data_4O3N
# 
_entry.id   4O3N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4O3N         
NDB   NA2812       
RCSB  RCSB084000   
WWPDB D_1000084000 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4O3O . unspecified 
PDB 4O3P . unspecified 
PDB 4O3Q . unspecified 
PDB 4O3R . unspecified 
PDB 4O3S . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4O3N 
_pdbx_database_status.recvd_initial_deposition_date   2013-12-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patra, A.' 1 
'Egli, M.'  2 
# 
_citation.id                        primary 
_citation.title                     
;Kinetics, Structure, and Mechanism of 8-Oxo-7,8-dihydro-2'-deoxyguanosine Bypass by Human DNA Polymerase eta
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            289 
_citation.page_first                16867 
_citation.page_last                 16882 
_citation.year                      2014 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24759104 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.551820 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Patra, A.'        1 
primary 'Nagy, L.D.'       2 
primary 'Zhang, Q.'        3 
primary 'Su, Y.'           4 
primary 'Muller, L.'       5 
primary 'Guengerich, F.P.' 6 
primary 'Egli, M.'         7 
# 
_cell.entry_id           4O3N 
_cell.length_a           98.662 
_cell.length_b           98.662 
_cell.length_c           81.787 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4O3N 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                                                        48617.707 1   
2.7.7.7 ? ? ?                                         
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*GP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3662.404  1   ?       ? ? 'Nucleic acids Template: CAT GAT GAC GCT' 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ? 'Nucleic acids Primar: AGCGTCAT'          
4 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" 466.172   1   ? ? ? 
?                                         
5 non-polymer syn 'MAGNESIUM ION'                                                                             24.305    2   ? ? ? 
?                                         
6 non-polymer syn GLYCEROL                                                                                    92.094    1   ? ? ? 
?                                         
7 water       nat water                                                                                       18.015    475 ? ? ? 
?                                         
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DG)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATGATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Chemically Synthesized' 
3 1 sample ? ? ? ? ? 'Chemically Synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4O3N       4O3N   2 ? ? ? 
3 PDB 4O3N       4O3N   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4O3N A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4O3N T 1 ? 12  ? 4O3N   1 ? 12  ? 1 12  
3 3 4O3N P 1 ? 8   ? 4O3N   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4O3N GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4O3N PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4O3N HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0KX non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" ? 
'C9 H17 N4 O12 P3' 466.172 
ALA 'L-peptide linking' y ALANINE                                                                                     ? 
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                         ? 
'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                ? 
'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ? 
'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                                                                                    
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                                       ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ? 
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                             ? 'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ? 
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                                      ? 
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ? 
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ? 
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                                      ? 
'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4O3N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_percent_sol   41.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'0.1M MES pH 5.5, 5mM magnesium chloride, 15.5% PEG 2000 MME, VAPOR DIFFUSION, HANGING DROP, temperature 291.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.details                ? 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2013-08-17 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07810 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.07810 
# 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_k_max                  ? 
_reflns.d_resolution_high            1.579 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_netI_over_sigmaI        37.397 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.limit_l_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.entry_id                     4O3N 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rsym_value              0.065 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.limit_l_min                  ? 
_reflns.limit_h_min                  ? 
_reflns.R_free_details               ? 
_reflns.number_all                   ? 
_reflns.d_resolution_low             50.00 
_reflns.pdbx_redundancy              7.4 
_reflns.number_obs                   61922 
_reflns.limit_h_max                  ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.58 1.61 99.9  0.900 0.900 2.204  7.1 ? 3076 ? ? ? ? 1  1 
1.61 1.64 99.9  0.827 0.827 2.437  7.2 ? 3072 ? ? ? ? 2  1 
1.64 1.67 100.0 0.684 0.684 3.042  7.2 ? 3113 ? ? ? ? 3  1 
1.67 1.70 100.0 0.584 0.584 3.574  7.2 ? 3069 ? ? ? ? 4  1 
1.70 1.74 100.0 0.512 0.512 4.212  7.3 ? 3110 ? ? ? ? 5  1 
1.74 1.78 100.0 0.404 0.404 5.234  7.3 ? 3066 ? ? ? ? 6  1 
1.78 1.82 100.0 0.335 0.335 6.500  7.3 ? 3113 ? ? ? ? 7  1 
1.82 1.87 100.0 0.290 0.290 7.680  7.3 ? 3060 ? ? ? ? 8  1 
1.87 1.93 100.0 0.272 0.272 9.571  7.4 ? 3081 ? ? ? ? 9  1 
1.93 1.99 100.0 0.192 0.192 12.571 7.4 ? 3100 ? ? ? ? 10 1 
1.99 2.06 100.0 0.158 0.158 15.607 7.4 ? 3094 ? ? ? ? 11 1 
# 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.overall_SU_B                             ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.entry_id                                 4O3N 
_refine.aniso_B[2][3]                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_ML                            0.18 
_refine.aniso_B[1][3]                            ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.aniso_B[3][3]                            ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_number_restraints                     ? 
_refine.aniso_B[1][1]                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_R_factor_obs                          0.1724 
_refine.occupancy_min                            ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4ECQ' 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.occupancy_max                            ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.ls_number_reflns_R_free                  3138 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.ls_percent_reflns_obs                    99.92 
_refine.ls_R_factor_R_work                       0.1701 
_refine.overall_SU_R_free                        ? 
_refine.ls_d_res_high                            1.579 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.B_iso_min                                ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.B_iso_mean                               ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.ls_R_factor_all                          ? 
_refine.aniso_B[2][2]                            ? 
_refine.B_iso_max                                ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_d_res_low                             42.242 
_refine.pdbx_overall_phase_error                 21.23 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.aniso_B[1][2]                            ? 
_refine.ls_R_factor_R_free                       0.2153 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_number_reflns_obs                     61922 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_number_parameters                     ? 
_refine.details                                  ? 
_refine.ls_number_reflns_all                     62010 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.solvent_model_param_bsol                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   389 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             475 
_refine_hist.number_atoms_total               4266 
_refine_hist.d_res_high                       1.579 
_refine_hist.d_res_low                        42.242 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.019  ? ? 4022 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.816  ? ? 5534 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 20.189 ? ? 1588 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.090  ? ? 615  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.010  ? ? 644  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.5793 1.6040  2666 0.2382 99.90  0.2556 . . 127 . . 2666 . 'X-RAY DIFFRACTION' 
. 1.6040 1.6303  2646 0.2344 99.90  0.2808 . . 145 . . 2646 . 'X-RAY DIFFRACTION' 
. 1.6303 1.6584  2654 0.2065 100.00 0.2291 . . 149 . . 2654 . 'X-RAY DIFFRACTION' 
. 1.6584 1.6886  2659 0.2039 100.00 0.2507 . . 160 . . 2659 . 'X-RAY DIFFRACTION' 
. 1.6886 1.7211  2677 0.1917 100.00 0.2324 . . 140 . . 2677 . 'X-RAY DIFFRACTION' 
. 1.7211 1.7562  2652 0.1824 100.00 0.2337 . . 140 . . 2652 . 'X-RAY DIFFRACTION' 
. 1.7562 1.7944  2653 0.1779 100.00 0.2292 . . 136 . . 2653 . 'X-RAY DIFFRACTION' 
. 1.7944 1.8361  2674 0.1762 100.00 0.2294 . . 153 . . 2674 . 'X-RAY DIFFRACTION' 
. 1.8361 1.8820  2648 0.1728 100.00 0.2424 . . 136 . . 2648 . 'X-RAY DIFFRACTION' 
. 1.8820 1.9329  2706 0.1748 100.00 0.2004 . . 124 . . 2606 . 'X-RAY DIFFRACTION' 
. 1.9329 1.9898  2673 0.1722 100.00 0.1996 . . 127 . . 2673 . 'X-RAY DIFFRACTION' 
. 1.9898 2.0540  2706 0.1757 100.00 0.2206 . . 125 . . 2606 . 'X-RAY DIFFRACTION' 
. 2.0540 2.1274  2648 0.1757 100.00 0.2343 . . 150 . . 2648 . 'X-RAY DIFFRACTION' 
. 2.1274 2.2126  2679 0.1684 100.00 0.2185 . . 141 . . 2679 . 'X-RAY DIFFRACTION' 
. 2.2126 2.3133  2662 0.1652 100.00 0.2323 . . 143 . . 2662 . 'X-RAY DIFFRACTION' 
. 2.3133 2.4353  2646 0.1639 100.00 0.1993 . . 165 . . 2646 . 'X-RAY DIFFRACTION' 
. 2.4353 2.5878  2680 0.1827 100.00 0.2394 . . 147 . . 2680 . 'X-RAY DIFFRACTION' 
. 2.5878 2.7876  2692 0.1714 100.00 0.2160 . . 139 . . 2692 . 'X-RAY DIFFRACTION' 
. 2.7876 3.0680  2665 0.1722 100.00 0.1854 . . 151 . . 2665 . 'X-RAY DIFFRACTION' 
. 3.0680 3.5118  2700 0.1552 100.00 0.1938 . . 147 . . 2700 . 'X-RAY DIFFRACTION' 
. 3.5118 4.4238  2677 0.1441 99.80  0.1796 . . 155 . . 2677 . 'X-RAY DIFFRACTION' 
. 4.4238 42.2570 2721 0.1770 98.60  0.2518 . . 138 . . 2721 . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4O3N 
_struct.title                     
'Crystal structure of human dna polymerase eta in ternary complex with native dna and incoming nucleotide (dcp)' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4O3N 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            
;Catalytic Domain, DNA, DNA Damage, DNA-Directed DNA Polymerase, Cytosine Triphosphate, Y-family polymerase, trans-lesion synthesis (TLS), DNA Binding, Transferase-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  6  LEU A 124 ? LEU A 135 ? LEU A 121 LEU A 132 1 ? 12 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? SER A 180 ? GLN A 162 SER A 177 1 ? 16 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 11 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P12 12 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P13 13 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P14 14 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P15 15 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P16 16 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P17 17 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 18 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 19 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 F MG  . MG ? ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.039 ? 
metalc2  metalc ? ? C DT  8   "O3'" B ? ? 1_555 F MG  . MG ? ? P DT  8   A MG  503 1_555 ? ? ? ? ? ? ?            2.047 ? 
metalc3  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 E MG  . MG ? ? A ASP 13  A MG  502 1_555 ? ? ? ? ? ? ?            2.053 ? 
metalc4  metalc ? ? A GLU 119 OE1   ? ? ? 1_555 F MG  . MG ? ? A GLU 116 A MG  503 1_555 ? ? ? ? ? ? ?            2.056 ? 
metalc5  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E MG  . MG ? ? A ASP 115 A MG  502 1_555 ? ? ? ? ? ? ?            2.123 ? 
metalc6  metalc ? ? D 0KX .   O1B   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.154 ? 
metalc7  metalc ? ? F MG  .   MG    ? ? ? 1_555 H HOH . O  ? ? A MG  503 A HOH 603 1_555 ? ? ? ? ? ? ?            2.155 ? 
metalc8  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F MG  . MG ? ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.156 ? 
metalc9  metalc ? ? D 0KX .   O1G   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.165 ? 
metalc10 metalc ? ? A MET 17  O     ? ? ? 1_555 E MG  . MG ? ? A MET 14  A MG  502 1_555 ? ? ? ? ? ? ?            2.210 ? 
metalc11 metalc ? ? D 0KX .   O2A   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.226 ? 
metalc12 metalc ? ? D 0KX .   O2A   ? ? ? 1_555 F MG  . MG ? ? A 0KX 501 A MG  503 1_555 ? ? ? ? ? ? ?            2.227 ? 
metalc13 metalc ? ? C DT  8   "O3'" A ? ? 1_555 F MG  . MG ? ? P DT  8   A MG  503 1_555 ? ? ? ? ? ? ?            2.440 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3 A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4 A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.32  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 5.40  
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -8.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE 0KX A 501' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 503'  
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 24 ASP A 16  ? ASP A 13   . ? 1_555 ? 
2  AC1 24 MET A 17  ? MET A 14   . ? 1_555 ? 
3  AC1 24 ASP A 18  ? ASP A 15   . ? 1_555 ? 
4  AC1 24 CYS A 19  ? CYS A 16   . ? 1_555 ? 
5  AC1 24 PHE A 20  ? PHE A 17   . ? 1_555 ? 
6  AC1 24 PHE A 21  ? PHE A 18   . ? 1_555 ? 
7  AC1 24 ILE A 51  ? ILE A 48   . ? 1_555 ? 
8  AC1 24 ALA A 52  ? ALA A 49   . ? 1_555 ? 
9  AC1 24 TYR A 55  ? TYR A 52   . ? 1_555 ? 
10 AC1 24 ARG A 58  ? ARG A 55   . ? 1_555 ? 
11 AC1 24 ARG A 64  ? ARG A 61   . ? 1_555 ? 
12 AC1 24 ASP A 118 ? ASP A 115  . ? 1_555 ? 
13 AC1 24 LYS A 234 ? LYS A 231  . ? 1_555 ? 
14 AC1 24 MG  E .   ? MG  A 502  . ? 1_555 ? 
15 AC1 24 MG  F .   ? MG  A 503  . ? 1_555 ? 
16 AC1 24 HOH H .   ? HOH A 603  . ? 1_555 ? 
17 AC1 24 HOH H .   ? HOH A 604  . ? 1_555 ? 
18 AC1 24 HOH H .   ? HOH A 606  . ? 1_555 ? 
19 AC1 24 HOH H .   ? HOH A 609  . ? 1_555 ? 
20 AC1 24 HOH H .   ? HOH A 619  . ? 1_555 ? 
21 AC1 24 HOH H .   ? HOH A 832  . ? 1_555 ? 
22 AC1 24 DT  C 8   ? DT  P 8    . ? 1_555 ? 
23 AC1 24 HOH J .   ? HOH P 102  . ? 1_555 ? 
24 AC1 24 DG  B 4   ? DG  T 4    . ? 1_555 ? 
25 AC2 5  ASP A 16  ? ASP A 13   . ? 1_555 ? 
26 AC2 5  MET A 17  ? MET A 14   . ? 1_555 ? 
27 AC2 5  ASP A 118 ? ASP A 115  . ? 1_555 ? 
28 AC2 5  0KX D .   ? 0KX A 501  . ? 1_555 ? 
29 AC2 5  MG  F .   ? MG  A 503  . ? 1_555 ? 
30 AC3 7  ASP A 16  ? ASP A 13   . ? 1_555 ? 
31 AC3 7  ASP A 118 ? ASP A 115  . ? 1_555 ? 
32 AC3 7  GLU A 119 ? GLU A 116  . ? 1_555 ? 
33 AC3 7  0KX D .   ? 0KX A 501  . ? 1_555 ? 
34 AC3 7  MG  E .   ? MG  A 502  . ? 1_555 ? 
35 AC3 7  HOH H .   ? HOH A 603  . ? 1_555 ? 
36 AC3 7  DT  C 8   ? DT  P 8    . ? 1_555 ? 
37 AC4 8  PRO A 247 ? PRO A 244  . ? 1_555 ? 
38 AC4 8  PHE A 250 ? PHE A 247  . ? 1_555 ? 
39 AC4 8  SER A 251 ? SER A 248  . ? 1_555 ? 
40 AC4 8  GLY A 279 ? GLY A 276  . ? 1_555 ? 
41 AC4 8  GLU A 280 ? GLU A 277  . ? 1_555 ? 
42 AC4 8  HOH H .   ? HOH A 999  . ? 1_555 ? 
43 AC4 8  HOH H .   ? HOH A 1000 . ? 1_555 ? 
44 AC4 8  HOH H .   ? HOH A 1001 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4O3N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4O3N 
_atom_sites.fract_transf_matrix[1][1]   0.010136 
_atom_sites.fract_transf_matrix[1][2]   0.005852 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011704 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012227 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 63.284  211.133 -7.610  1.00 46.71 ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 63.138  212.581 -7.635  1.00 46.71 ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 62.473  213.126 -8.886  1.00 44.56 ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 61.268  213.408 -8.868  1.00 48.14 ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 63.254  213.290 -9.974  1.00 42.47 ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 62.842  213.868 -11.271 1.00 38.73 ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 61.733  213.103 -11.991 1.00 44.65 ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 61.103  213.647 -12.920 1.00 46.33 ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 64.127  213.812 -12.117 1.00 43.04 ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 65.238  213.634 -11.127 1.00 45.12 ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 64.672  212.879 -9.980  1.00 43.21 ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 61.506  211.857 -11.572 1.00 35.63 ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 60.585  210.955 -12.278 1.00 43.15 ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 59.426  210.501 -11.424 1.00 42.31 ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 58.681  209.596 -11.830 1.00 43.00 ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 61.328  209.709 -12.777 1.00 34.09 ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 62.654  210.014 -13.388 1.00 31.71 ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 62.781  210.773 -14.533 1.00 33.59 ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 63.911  209.641 -13.036 1.00 31.36 ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 64.062  210.877 -14.846 1.00 33.67 ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 64.765  210.185 -13.966 1.00 31.61 ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 59.310  211.072 -10.224 1.00 39.80 ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 58.192  210.756 -9.341  1.00 46.14 ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 57.068  211.744 -9.638  1.00 40.90 ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 57.219  212.937 -9.420  1.00 41.16 ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 58.594  210.829 -7.858  1.00 47.90 ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 59.612  209.771 -7.409  1.00 57.97 ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 59.784  209.658 -5.600  1.00 76.64 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.569  209.803 -5.373  1.00 51.35 ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 55.956  211.254 -10.166 1.00 45.06 ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 54.837  212.141 -10.447 1.00 39.67 ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 54.144  212.523 -9.135  1.00 36.50 ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 54.030  211.714 -8.212  1.00 35.65 ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 53.855  211.490 -11.428 1.00 39.11 ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 53.704  213.776 -9.035  1.00 29.70 ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 53.202  214.279 -7.754  1.00 26.95 ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 51.689  214.540 -7.760  1.00 23.87 ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 51.154  215.153 -6.823  1.00 25.53 ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 53.914  215.575 -7.387  1.00 28.05 ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 53.755  216.522 -8.471  1.00 26.73 ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 55.414  215.283 -7.142  1.00 30.54 ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 51.016  214.127 -8.835  1.00 24.66 ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 49.559  214.309 -8.922  1.00 21.55 ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 49.138  215.782 -8.899  1.00 20.02 ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 48.119  216.136 -8.260  1.00 21.27 ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 49.907  216.643 -9.575  1.00 19.90 ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 49.648  218.093 -9.553  1.00 17.87 ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 49.325  218.698 -10.917 1.00 17.38 ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 49.418  219.892 -11.079 1.00 20.87 ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 50.879  218.832 -8.969  1.00 18.91 ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 51.055  218.585 -7.460  1.00 22.37 ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 52.271  219.312 -6.930  1.00 22.51 ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 52.192  220.341 -6.234  1.00 24.69 ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 53.392  218.807 -7.275  1.00 20.61 ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 48.862  217.827 -11.810 1.00 20.04 ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 48.701  218.091 -13.248 1.00 20.40 ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 47.399  218.861 -13.506 1.00 22.96 ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 47.323  219.665 -14.428 1.00 28.87 ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 48.727  216.729 -14.024 1.00 25.69 ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 47.793  215.662 -13.396 1.00 30.95 ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 47.904  215.333 -12.183 1.00 30.85 ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 46.895  215.132 -14.111 1.00 35.66 ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 46.409  218.700 -12.624 1.00 18.06 ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 45.074  219.232 -12.884 1.00 20.16 ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 44.631  220.148 -11.776 1.00 16.09 ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 45.111  220.026 -10.638 1.00 16.86 ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 44.014  218.118 -12.984 1.00 18.81 ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 44.199  217.018 -14.043 1.00 21.87 ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 43.060  215.962 -13.866 1.00 25.49 ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 43.255  215.106 -12.685 1.00 22.93 ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 42.317  214.394 -12.058 1.00 23.31 ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 42.660  213.663 -10.975 1.00 21.21 ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 41.036  214.420 -12.481 1.00 22.83 ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 43.658  221.011 -12.104 1.00 15.08 ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 42.950  221.762 -11.064 1.00 12.64 ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 41.527  221.276 -11.047 1.00 15.84 ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 40.852  221.367 -12.062 1.00 16.72 ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 42.972  223.276 -11.291 1.00 14.98 ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 42.243  224.005 -10.192 1.00 15.17 ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 44.456  223.775 -11.421 1.00 17.95 ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 41.069  220.745 -9.898  1.00 14.31 ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 39.724  220.149 -9.836  1.00 14.01 ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 38.997  220.812 -8.686  1.00 14.42 ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 39.593  221.003 -7.607  1.00 14.32 ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 39.780  218.602 -9.580  1.00 12.48 ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 38.455  217.979 -9.294  1.00 17.85 ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 40.435  217.884 -10.788 1.00 14.88 ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 37.715  221.183 -8.900  1.00 13.61 ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 36.951  221.691 -7.780  1.00 12.95 ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 35.752  220.821 -7.597  1.00 15.21 ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 35.277  220.182 -8.518  1.00 15.31 ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 36.516  223.156 -7.993  1.00 15.24 ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 35.227  220.869 -6.373  1.00 12.08 ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 33.918  220.245 -6.068  1.00 13.29 ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 33.070  221.313 -5.411  1.00 14.07 ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 33.493  221.920 -4.385  1.00 14.51 ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 34.123  219.053 -5.148  1.00 15.46 ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 32.961  218.181 -4.639  1.00 15.44 ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 32.232  218.829 -3.417  1.00 17.87 ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 31.956  217.963 -5.787  1.00 13.54 ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 31.893  221.575 -5.997  1.00 13.24 ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 30.976  222.571 -5.420  1.00 13.88 ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 29.794  221.819 -4.853  1.00 14.97 ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 29.237  220.944 -5.540  1.00 14.34 ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 30.495  223.524 -6.533  1.00 15.46 ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 29.480  224.521 -6.003  1.00 16.69 ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 31.696  224.249 -7.159  1.00 18.19 ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 29.455  222.087 -3.576  1.00 13.46 ? 13   ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 28.373  221.356 -2.911  1.00 12.40 ? 13   ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 27.441  222.353 -2.265  1.00 13.62 ? 13   ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 27.862  223.158 -1.440  1.00 13.67 ? 13   ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 28.890  220.393 -1.848  1.00 14.73 ? 13   ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 27.789  219.582 -1.255  1.00 16.43 ? 13   ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 27.583  218.473 -1.714  1.00 19.76 ? 13   ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 27.126  220.093 -0.383  1.00 14.77 ? 13   ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 26.166  222.248 -2.569  1.00 12.26 ? 14   MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 25.267  223.231 -2.019  1.00 13.19 ? 14   MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 25.081  223.103 -0.503  1.00 13.50 ? 14   MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 25.081  222.021 0.031   1.00 13.44 ? 14   MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 23.867  223.103 -2.660  1.00 15.26 ? 14   MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 23.919  223.190 -4.216  1.00 14.49 ? 14   MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 24.691  224.646 -4.917  1.00 15.42 ? 14   MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 23.664  225.903 -4.342  1.00 16.91 ? 14   MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 24.936  224.234 0.153   1.00 11.40 ? 15   ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 24.709  224.208 1.613   1.00 12.47 ? 15   ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 23.252  223.834 1.884   1.00 11.19 ? 15   ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 22.350  224.356 1.210   1.00 13.03 ? 15   ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 25.085  225.544 2.251   1.00 14.16 ? 15   ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 26.572  225.901 2.061   1.00 13.21 ? 15   ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 27.406  224.992 1.955   1.00 14.71 ? 15   ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 26.880  227.071 2.047   1.00 16.68 ? 15   ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 23.062  222.932 2.839   1.00 11.58 ? 16   CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 21.743  222.417 3.290   1.00 12.29 ? 16   CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 20.720  222.552 2.158   1.00 13.53 ? 16   CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 19.729  223.268 2.272   1.00 13.07 ? 16   CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 21.254  223.123 4.568   1.00 14.73 ? 16   CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 21.233  224.931 4.618   1.00 15.86 ? 16   CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 20.974  221.822 1.067   1.00 11.83 ? 17   PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 20.350  222.186 -0.210  1.00 12.32 ? 17   PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 18.819  222.219 -0.166  1.00 12.06 ? 17   PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 18.256  223.222 -0.551  1.00 12.04 ? 17   PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 20.803  221.226 -1.289  1.00 14.01 ? 17   PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 20.328  221.605 -2.674  1.00 11.04 ? 17   PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 20.349  222.918 -3.108  1.00 12.07 ? 17   PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 19.794  220.630 -3.504  1.00 13.62 ? 17   PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 19.915  223.274 -4.388  1.00 13.66 ? 17   PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 19.339  220.991 -4.820  1.00 13.78 ? 17   PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 19.413  222.298 -5.209  1.00 13.52 ? 17   PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 18.167  221.132 0.246   1.00 12.34 ? 18   PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 16.695  221.118 0.151   1.00 11.28 ? 18   PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 16.114  222.183 1.076   1.00 14.35 ? 18   PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 15.129  222.788 0.733   1.00 13.01 ? 18   PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 16.058  219.781 0.509   1.00 12.21 ? 18   PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 16.300  218.678 -0.472  1.00 13.10 ? 18   PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 17.250  218.789 -1.504  1.00 13.19 ? 18   PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 15.595  217.487 -0.324  1.00 13.26 ? 18   PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 17.434  217.722 -2.411  1.00 14.08 ? 18   PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 15.743  216.427 -1.239  1.00 14.40 ? 18   PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 16.719  216.555 -2.278  1.00 15.78 ? 18   PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 16.759  222.462 2.211   1.00 12.76 ? 19   VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 16.309  223.564 3.072   1.00 11.06 ? 19   VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 16.425  224.892 2.300   1.00 12.44 ? 19   VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 15.496  225.702 2.363   1.00 13.21 ? 19   VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 17.100  223.585 4.346   1.00 11.73 ? 19   VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 16.916  224.917 5.120   1.00 14.62 ? 19   VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 16.720  222.390 5.219   1.00 14.67 ? 19   VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 17.536  225.137 1.609   1.00 12.31 ? 20   GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 17.614  226.434 0.938   1.00 10.58 ? 20   GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 16.547  226.555 -0.154  1.00 11.35 ? 20   GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 16.096  227.696 -0.421  1.00 12.79 ? 20   GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 18.982  226.677 0.272   1.00 12.01 ? 20   GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 20.074  226.941 1.271   1.00 14.64 ? 20   GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 21.230  227.547 0.499   1.00 15.75 ? 20   GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 21.229  228.757 0.277   1.00 16.13 ? 20   GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 22.169  226.701 0.022   1.00 17.80 ? 20   GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 16.268  225.458 -0.827  1.00 10.56 ? 21   VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 15.161  225.489 -1.837  1.00 11.57 ? 21   VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 13.849  225.915 -1.177  1.00 13.77 ? 21   VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 13.160  226.814 -1.683  1.00 13.75 ? 21   VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 14.979  224.112 -2.522  1.00 11.32 ? 21   VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 13.810  224.150 -3.522  1.00 14.58 ? 21   VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 16.246  223.731 -3.310  1.00 12.88 ? 21   VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 13.551  225.342 -0.026  1.00 11.37 ? 22   GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 12.292  225.740 0.655   1.00 11.65 ? 22   GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 12.384  227.140 1.244   1.00 15.17 ? 22   GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 11.364  227.824 1.341   1.00 13.78 ? 22   GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 11.975  224.673 1.732   1.00 10.56 ? 22   GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 11.716  223.290 1.202   1.00 12.57 ? 22   GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 10.484  223.167 0.348   1.00 15.62 ? 22   GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 9.575   224.014 0.466   1.00 16.77 ? 22   GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 10.398  222.177 -0.451  1.00 18.01 ? 22   GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 13.568  227.561 1.689   1.00 12.80 ? 23   GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 13.712  228.918 2.253   1.00 12.51 ? 23   GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 13.598  229.996 1.175   1.00 14.48 ? 23   GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 13.073  231.097 1.436   1.00 13.29 ? 23   GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 15.042  229.076 2.989   1.00 12.30 ? 23   GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 15.082  228.245 4.280   1.00 12.76 ? 23   GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 16.479  228.300 4.886   1.00 13.34 ? 23   GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 17.461  228.240 4.154   1.00 16.34 ? 23   GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 16.563  228.514 6.208   1.00 15.20 ? 23   GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 14.106  229.715 -0.028  1.00 12.32 ? 24   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 13.895  230.675 -1.089  1.00 11.57 ? 24   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 12.387  230.851 -1.366  1.00 14.20 ? 24   ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 11.937  231.961 -1.568  1.00 14.17 ? 24   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 14.600  230.201 -2.364  1.00 13.57 ? 24   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 14.476  231.228 -3.522  1.00 15.23 ? 24   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 15.324  230.755 -4.735  1.00 13.67 ? 24   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 14.695  229.602 -5.401  1.00 13.40 ? 24   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 15.090  229.113 -6.564  1.00 14.09 ? 24   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 16.132  229.671 -7.206  1.00 14.06 ? 24   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 14.443  228.124 -7.113  1.00 14.00 ? 24   ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 11.661  229.731 -1.377  1.00 11.78 ? 25   GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 10.242  229.754 -1.707  1.00 12.52 ? 25   GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 9.424   230.457 -0.630  1.00 13.28 ? 25   GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 8.418   231.148 -0.916  1.00 14.37 ? 25   GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 9.740   228.332 -1.874  1.00 13.71 ? 25   GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 8.259   228.284 -2.315  1.00 14.60 ? 25   GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 7.815   226.838 -2.393  1.00 17.93 ? 25   GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 8.511   226.014 -2.975  1.00 17.70 ? 25   GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 6.689   226.513 -1.758  1.00 26.32 ? 25   GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 9.773   230.185 0.615   1.00 11.41 ? 26   ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 9.041   230.689 1.765   1.00 13.95 ? 26   ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 9.952   231.514 2.690   1.00 14.33 ? 26   ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 10.666  230.961 3.538   1.00 13.80 ? 26   ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 8.418   229.522 2.560   1.00 15.65 ? 26   ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 7.520   230.039 3.736   1.00 15.50 ? 26   ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 7.487   231.220 4.029   1.00 16.75 ? 26   ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 6.880   229.111 4.415   1.00 18.84 ? 26   ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 9.936   232.852 2.528   1.00 14.14 ? 27   PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 10.821  233.722 3.292   1.00 17.20 ? 27   PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 10.620  233.565 4.798   1.00 16.01 ? 27   PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 11.572  233.860 5.521   1.00 15.76 ? 27   PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 10.433  235.166 2.825   1.00 19.18 ? 27   PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 9.805   234.919 1.442   1.00 16.82 ? 27   PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 9.119   233.548 1.502   1.00 13.84 ? 27   PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 9.470   233.035 5.244   1.00 13.80 ? 28   HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 9.332   232.822 6.706   1.00 20.54 ? 28   HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 10.281  231.814 7.288   1.00 19.44 ? 28   HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 10.456  231.791 8.505   1.00 19.73 ? 28   HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 7.921   232.354 7.064   1.00 21.17 ? 28   HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 6.888   233.411 6.952   1.00 23.41 ? 28   HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 5.635   233.166 6.432   1.00 32.14 ? 28   HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 6.896   234.702 7.341   1.00 23.69 ? 28   HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 4.924   234.279 6.472   1.00 27.32 ? 28   HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 5.672   235.230 7.007   1.00 30.57 ? 28   HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 10.842  230.958 6.447   1.00 15.75 ? 29   LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 11.761  229.899 6.906   1.00 14.13 ? 29   LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 13.217  230.390 6.930   1.00 16.26 ? 29   LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 14.088  229.692 7.449   1.00 15.24 ? 29   LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 11.670  228.684 6.005   1.00 14.12 ? 29   LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 10.272  228.129 5.891   1.00 15.18 ? 29   LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 10.334  226.876 4.974   1.00 13.91 ? 29   LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 9.718   227.701 7.285   1.00 20.34 ? 29   LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 13.515  231.574 6.362   1.00 14.43 ? 30   ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 14.888  232.045 6.223   1.00 14.91 ? 30   ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 15.501  232.384 7.580   1.00 15.02 ? 30   ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 14.830  232.931 8.460   1.00 16.56 ? 30   ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 14.945  233.271 5.297   1.00 15.19 ? 30   ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 14.481  232.967 3.840   1.00 15.62 ? 30   ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 14.462  234.192 2.976   1.00 16.53 ? 30   ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 13.918  233.849 1.654   1.00 16.21 ? 30   ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 13.927  234.706 0.624   1.00 18.58 ? 30   ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 14.384  235.952 0.815   1.00 19.56 ? 30   ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 13.396  234.342 -0.552  1.00 17.53 ? 30   ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 16.781  232.017 7.712   1.00 17.62 ? 31   ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 17.584  232.321 8.918   1.00 19.61 ? 31   ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 16.943  231.775 10.183  1.00 22.20 ? 31   ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 16.989  232.394 11.256  1.00 24.83 ? 31   ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 17.806  233.841 9.037   1.00 21.90 ? 31   ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 18.431  234.394 7.797   1.00 26.90 ? 31   ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 19.500  233.952 7.383   1.00 30.63 ? 31   ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 17.699  235.268 7.115   1.00 30.87 ? 31   ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 16.341  230.592 10.061  1.00 16.87 ? 32   LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 15.652  229.971 11.163  1.00 20.63 ? 32   LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 16.147  228.558 11.280  1.00 17.67 ? 32   LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 16.564  227.998 10.266  1.00 16.76 ? 32   LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 14.149  229.901 10.930  1.00 18.55 ? 32   LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 13.425  231.260 10.848  1.00 24.44 ? 32   LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 13.165  231.820 12.184  1.00 32.70 ? 32   LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 12.395  233.144 12.009  1.00 31.28 ? 32   LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 12.209  233.632 13.389  1.00 39.17 ? 32   LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 16.032  227.935 12.477  1.00 15.04 ? 33   PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 16.172  226.488 12.539  1.00 15.72 ? 33   PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 15.020  225.808 11.774  1.00 16.32 ? 33   PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 13.834  225.975 12.129  1.00 16.74 ? 33   PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 16.108  226.206 14.047  1.00 17.90 ? 33   PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 15.246  227.289 14.589  1.00 20.37 ? 33   PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 15.527  228.506 13.756  1.00 17.50 ? 33   PRO A CD    1 
ATOM   289  N  N     A CYS A 1 37  ? 15.359  225.055 10.737  0.56 14.00 ? 34   CYS A N     1 
ATOM   290  N  N     B CYS A 1 37  ? 15.385  225.088 10.705  0.44 14.01 ? 34   CYS A N     1 
ATOM   291  C  CA    A CYS A 1 37  ? 14.310  224.460 9.964   0.56 14.34 ? 34   CYS A CA    1 
ATOM   292  C  CA    B CYS A 1 37  ? 14.446  224.589 9.704   0.44 14.34 ? 34   CYS A CA    1 
ATOM   293  C  C     A CYS A 1 37  ? 14.847  223.241 9.233   0.56 13.91 ? 34   CYS A C     1 
ATOM   294  C  C     B CYS A 1 37  ? 14.870  223.178 9.310   0.44 13.91 ? 34   CYS A C     1 
ATOM   295  O  O     A CYS A 1 37  ? 16.068  223.120 9.060   0.56 14.98 ? 34   CYS A O     1 
ATOM   296  O  O     B CYS A 1 37  ? 16.033  222.863 9.434   0.44 15.08 ? 34   CYS A O     1 
ATOM   297  C  CB    A CYS A 1 37  ? 13.710  225.511 9.022   0.56 14.12 ? 34   CYS A CB    1 
ATOM   298  C  CB    B CYS A 1 37  ? 14.432  225.521 8.482   0.44 15.20 ? 34   CYS A CB    1 
ATOM   299  S  SG    A CYS A 1 37  ? 14.798  226.059 7.695   0.56 16.33 ? 34   CYS A SG    1 
ATOM   300  S  SG    B CYS A 1 37  ? 13.197  225.200 7.221   0.44 14.93 ? 34   CYS A SG    1 
ATOM   301  N  N     . ALA A 1 38  ? 13.932  222.327 8.894   1.00 13.46 ? 35   ALA A N     1 
ATOM   302  C  CA    . ALA A 1 38  ? 14.283  221.030 8.279   1.00 12.95 ? 35   ALA A CA    1 
ATOM   303  C  C     . ALA A 1 38  ? 13.262  220.713 7.253   1.00 13.90 ? 35   ALA A C     1 
ATOM   304  O  O     . ALA A 1 38  ? 12.138  221.217 7.333   1.00 14.14 ? 35   ALA A O     1 
ATOM   305  C  CB    . ALA A 1 38  ? 14.320  219.909 9.327   1.00 14.08 ? 35   ALA A CB    1 
ATOM   306  N  N     . VAL A 1 39  ? 13.654  219.842 6.314   1.00 11.89 ? 36   VAL A N     1 
ATOM   307  C  CA    . VAL A 1 39  ? 12.761  219.313 5.304   1.00 11.69 ? 36   VAL A CA    1 
ATOM   308  C  C     . VAL A 1 39  ? 12.440  217.897 5.674   1.00 16.58 ? 36   VAL A C     1 
ATOM   309  O  O     . VAL A 1 39  ? 13.363  217.123 6.027   1.00 14.74 ? 36   VAL A O     1 
ATOM   310  C  CB    . VAL A 1 39  ? 13.419  219.400 3.911   1.00 12.42 ? 36   VAL A CB    1 
ATOM   311  C  CG1   . VAL A 1 39  ? 12.526  218.677 2.920   1.00 13.90 ? 36   VAL A CG1   1 
ATOM   312  C  CG2   . VAL A 1 39  ? 13.639  220.872 3.565   1.00 14.17 ? 36   VAL A CG2   1 
ATOM   313  N  N     . VAL A 1 40  ? 11.136  217.555 5.639   1.00 14.60 ? 37   VAL A N     1 
ATOM   314  C  CA    . VAL A 1 40  ? 10.708  216.236 6.108   1.00 14.63 ? 37   VAL A CA    1 
ATOM   315  C  C     . VAL A 1 40  ? 9.901   215.561 5.020   1.00 18.16 ? 37   VAL A C     1 
ATOM   316  O  O     . VAL A 1 40  ? 9.334   216.249 4.174   1.00 17.36 ? 37   VAL A O     1 
ATOM   317  C  CB    . VAL A 1 40  ? 9.775   216.315 7.369   1.00 17.61 ? 37   VAL A CB    1 
ATOM   318  C  CG1   . VAL A 1 40  ? 10.573  216.787 8.590   1.00 21.19 ? 37   VAL A CG1   1 
ATOM   319  C  CG2   . VAL A 1 40  ? 8.572   217.205 7.083   1.00 19.61 ? 37   VAL A CG2   1 
ATOM   320  N  N     . GLN A 1 41  ? 9.859   214.226 5.055   1.00 16.86 ? 38   GLN A N     1 
ATOM   321  C  CA    . GLN A 1 41  ? 8.946   213.518 4.122   1.00 15.85 ? 38   GLN A CA    1 
ATOM   322  C  C     . GLN A 1 41  ? 8.050   212.629 4.943   1.00 16.72 ? 38   GLN A C     1 
ATOM   323  O  O     . GLN A 1 41  ? 8.497   212.008 5.898   1.00 18.36 ? 38   GLN A O     1 
ATOM   324  C  CB    . GLN A 1 41  ? 9.667   212.731 3.038   1.00 23.16 ? 38   GLN A CB    1 
ATOM   325  C  CG    . GLN A 1 41  ? 10.679  211.770 3.506   1.00 23.13 ? 38   GLN A CG    1 
ATOM   326  C  CD    . GLN A 1 41  ? 11.519  211.204 2.365   1.00 21.46 ? 38   GLN A CD    1 
ATOM   327  O  OE1   . GLN A 1 41  ? 11.489  211.695 1.215   1.00 24.28 ? 38   GLN A OE1   1 
ATOM   328  N  NE2   . GLN A 1 41  ? 12.308  210.188 2.694   1.00 22.81 ? 38   GLN A NE2   1 
ATOM   329  N  N     . TYR A 1 42  ? 6.796   212.551 4.495   1.00 17.84 ? 39   TYR A N     1 
ATOM   330  C  CA    . TYR A 1 42  ? 5.719   211.738 5.120   1.00 17.28 ? 39   TYR A CA    1 
ATOM   331  C  C     . TYR A 1 42  ? 5.301   212.122 6.565   1.00 21.89 ? 39   TYR A C     1 
ATOM   332  O  O     . TYR A 1 42  ? 5.671   211.425 7.505   1.00 25.06 ? 39   TYR A O     1 
ATOM   333  C  CB    . TYR A 1 42  ? 6.090   210.272 5.112   1.00 20.38 ? 39   TYR A CB    1 
ATOM   334  C  CG    . TYR A 1 42  ? 6.314   209.693 3.740   1.00 17.62 ? 39   TYR A CG    1 
ATOM   335  C  CD1   . TYR A 1 42  ? 5.334   209.726 2.801   1.00 18.28 ? 39   TYR A CD1   1 
ATOM   336  C  CD2   . TYR A 1 42  ? 7.541   209.147 3.410   1.00 15.23 ? 39   TYR A CD2   1 
ATOM   337  C  CE1   . TYR A 1 42  ? 5.552   209.182 1.521   1.00 21.22 ? 39   TYR A CE1   1 
ATOM   338  C  CE2   . TYR A 1 42  ? 7.794   208.582 2.129   1.00 18.04 ? 39   TYR A CE2   1 
ATOM   339  C  CZ    . TYR A 1 42  ? 6.779   208.624 1.208   1.00 15.96 ? 39   TYR A CZ    1 
ATOM   340  O  OH    . TYR A 1 42  ? 6.941   208.080 -0.050  1.00 16.81 ? 39   TYR A OH    1 
ATOM   341  N  N     . LYS A 1 43  ? 4.470   213.137 6.710   1.00 31.96 ? 40   LYS A N     1 
ATOM   342  C  CA    . LYS A 1 43  ? 4.116   213.685 8.054   1.00 27.60 ? 40   LYS A CA    1 
ATOM   343  C  C     . LYS A 1 43  ? 3.504   212.705 9.046   1.00 30.29 ? 40   LYS A C     1 
ATOM   344  O  O     . LYS A 1 43  ? 3.622   212.926 10.272  1.00 32.08 ? 40   LYS A O     1 
ATOM   345  C  CB    . LYS A 1 43  ? 3.174   214.890 7.917   1.00 32.87 ? 40   LYS A CB    1 
ATOM   346  C  CG    . LYS A 1 43  ? 3.269   215.872 9.148   1.00 34.43 ? 40   LYS A CG    1 
ATOM   347  C  CD    . LYS A 1 43  ? 4.452   216.885 8.980   1.00 29.18 ? 40   LYS A CD    1 
ATOM   348  C  CE    . LYS A 1 43  ? 4.888   217.576 10.277  1.00 29.23 ? 40   LYS A CE    1 
ATOM   349  N  NZ    . LYS A 1 43  ? 5.544   216.762 11.352  1.00 37.70 ? 40   LYS A NZ    1 
ATOM   350  N  N     . SER A 1 44  ? 2.855   211.625 8.579   1.00 27.59 ? 41   SER A N     1 
ATOM   351  C  CA    . SER A 1 44  ? 2.083   210.765 9.491   1.00 27.55 ? 41   SER A CA    1 
ATOM   352  C  C     . SER A 1 44  ? 2.886   209.898 10.436  1.00 33.78 ? 41   SER A C     1 
ATOM   353  O  O     . SER A 1 44  ? 2.409   209.557 11.520  1.00 30.36 ? 41   SER A O     1 
ATOM   354  C  CB    . SER A 1 44  ? 1.153   209.838 8.694   1.00 30.57 ? 41   SER A CB    1 
ATOM   355  O  OG    . SER A 1 44  ? 0.501   210.574 7.688   1.00 41.80 ? 41   SER A OG    1 
ATOM   356  N  N     . TRP A 1 45  ? 4.103   209.522 10.060  1.00 30.25 ? 42   TRP A N     1 
ATOM   357  C  CA    . TRP A 1 45  ? 4.818   208.600 10.915  1.00 31.78 ? 42   TRP A CA    1 
ATOM   358  C  C     . TRP A 1 45  ? 5.842   209.442 11.668  1.00 33.37 ? 42   TRP A C     1 
ATOM   359  O  O     . TRP A 1 45  ? 6.877   209.858 11.107  1.00 32.34 ? 42   TRP A O     1 
ATOM   360  C  CB    . TRP A 1 45  ? 5.480   207.452 10.127  1.00 36.44 ? 42   TRP A CB    1 
ATOM   361  C  CG    . TRP A 1 45  ? 6.183   206.438 10.996  1.00 39.47 ? 42   TRP A CG    1 
ATOM   362  C  CD1   . TRP A 1 45  ? 7.519   206.394 11.297  1.00 37.11 ? 42   TRP A CD1   1 
ATOM   363  C  CD2   . TRP A 1 45  ? 5.596   205.312 11.655  1.00 36.15 ? 42   TRP A CD2   1 
ATOM   364  N  NE1   . TRP A 1 45  ? 7.791   205.336 12.117  1.00 35.24 ? 42   TRP A NE1   1 
ATOM   365  C  CE2   . TRP A 1 45  ? 6.630   204.647 12.352  1.00 43.25 ? 42   TRP A CE2   1 
ATOM   366  C  CE3   . TRP A 1 45  ? 4.295   204.807 11.735  1.00 42.22 ? 42   TRP A CE3   1 
ATOM   367  C  CZ2   . TRP A 1 45  ? 6.407   203.492 13.106  1.00 43.69 ? 42   TRP A CZ2   1 
ATOM   368  C  CZ3   . TRP A 1 45  ? 4.071   203.658 12.496  1.00 42.35 ? 42   TRP A CZ3   1 
ATOM   369  C  CH2   . TRP A 1 45  ? 5.122   203.010 13.162  1.00 46.05 ? 42   TRP A CH2   1 
ATOM   370  N  N     . LYS A 1 46  ? 5.471   209.800 12.896  1.00 29.37 ? 43   LYS A N     1 
ATOM   371  C  CA    . LYS A 1 46  ? 6.380   210.481 13.822  1.00 27.25 ? 43   LYS A CA    1 
ATOM   372  C  C     . LYS A 1 46  ? 6.830   211.839 13.343  1.00 28.13 ? 43   LYS A C     1 
ATOM   373  O  O     . LYS A 1 46  ? 7.932   212.285 13.687  1.00 26.05 ? 43   LYS A O     1 
ATOM   374  C  CB    . LYS A 1 46  ? 7.579   209.583 14.093  1.00 30.72 ? 43   LYS A CB    1 
ATOM   375  C  CG    . LYS A 1 46  ? 7.237   208.402 14.973  1.00 34.64 ? 43   LYS A CG    1 
ATOM   376  C  CD    . LYS A 1 46  ? 8.345   207.372 15.056  1.00 37.19 ? 43   LYS A CD    1 
ATOM   377  C  CE    . LYS A 1 46  ? 7.894   206.211 15.945  1.00 44.46 ? 43   LYS A CE    1 
ATOM   378  N  NZ    . LYS A 1 46  ? 8.931   205.143 16.039  1.00 45.42 ? 43   LYS A NZ    1 
ATOM   379  N  N     . GLY A 1 47  ? 5.939   212.512 12.617  1.00 25.09 ? 44   GLY A N     1 
ATOM   380  C  CA    . GLY A 1 47  ? 6.098   213.864 12.183  1.00 24.63 ? 44   GLY A CA    1 
ATOM   381  C  C     . GLY A 1 47  ? 6.798   213.945 10.840  1.00 21.20 ? 44   GLY A C     1 
ATOM   382  O  O     . GLY A 1 47  ? 6.946   215.033 10.291  1.00 27.22 ? 44   GLY A O     1 
ATOM   383  N  N     . GLY A 1 48  ? 7.258   212.795 10.383  1.00 25.41 ? 45   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 48  ? 7.969   212.748 9.121   1.00 27.38 ? 45   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 48  ? 9.462   212.557 9.324   1.00 23.80 ? 45   GLY A C     1 
ATOM   386  O  O     . GLY A 1 48  ? 10.075  212.935 10.354  1.00 23.51 ? 45   GLY A O     1 
ATOM   387  N  N     . GLY A 1 49  ? 10.065  211.979 8.305   1.00 17.34 ? 46   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 49  ? 11.491  211.746 8.394   1.00 17.85 ? 46   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 49  ? 12.310  212.940 7.906   1.00 17.35 ? 46   GLY A C     1 
ATOM   390  O  O     . GLY A 1 49  ? 12.084  213.394 6.790   1.00 17.68 ? 46   GLY A O     1 
ATOM   391  N  N     . ILE A 1 50  ? 13.301  213.375 8.699   1.00 15.72 ? 47   ILE A N     1 
ATOM   392  C  CA    . ILE A 1 50  ? 14.095  214.562 8.294   1.00 14.35 ? 47   ILE A CA    1 
ATOM   393  C  C     . ILE A 1 50  ? 15.117  214.191 7.231   1.00 16.49 ? 47   ILE A C     1 
ATOM   394  O  O     . ILE A 1 50  ? 15.884  213.237 7.411   1.00 16.73 ? 47   ILE A O     1 
ATOM   395  C  CB    . ILE A 1 50  ? 14.815  215.155 9.502   1.00 14.58 ? 47   ILE A CB    1 
ATOM   396  C  CG1   . ILE A 1 50  ? 13.760  215.820 10.390  1.00 20.66 ? 47   ILE A CG1   1 
ATOM   397  C  CG2   . ILE A 1 50  ? 15.894  216.184 9.109   1.00 15.94 ? 47   ILE A CG2   1 
ATOM   398  C  CD1   . ILE A 1 50  ? 14.385  216.382 11.678  1.00 21.31 ? 47   ILE A CD1   1 
ATOM   399  N  N     . ILE A 1 51  ? 15.109  214.921 6.127   1.00 13.84 ? 48   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 51  ? 16.119  214.613 5.082   1.00 15.01 ? 48   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 51  ? 17.068  215.800 4.839   1.00 14.89 ? 48   ILE A C     1 
ATOM   402  O  O     . ILE A 1 51  ? 18.087  215.629 4.155   1.00 15.97 ? 48   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 51  ? 15.494  214.187 3.790   1.00 18.49 ? 48   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 51  ? 14.691  215.312 3.122   1.00 17.55 ? 48   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 51  ? 14.675  212.870 4.033   1.00 18.38 ? 48   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 51  ? 14.109  214.876 1.791   1.00 18.82 ? 48   ILE A CD1   1 
ATOM   407  N  N     . ALA A 1 52  ? 16.816  216.962 5.437   1.00 15.05 ? 49   ALA A N     1 
ATOM   408  C  CA    . ALA A 1 52  ? 17.780  218.089 5.333   1.00 13.80 ? 49   ALA A CA    1 
ATOM   409  C  C     . ALA A 1 52  ? 17.559  219.028 6.483   1.00 12.81 ? 49   ALA A C     1 
ATOM   410  O  O     . ALA A 1 52  ? 16.409  219.182 6.934   1.00 13.74 ? 49   ALA A O     1 
ATOM   411  C  CB    . ALA A 1 52  ? 17.613  218.841 3.965   1.00 13.46 ? 49   ALA A CB    1 
ATOM   412  N  N     . VAL A 1 53  ? 18.644  219.711 6.927   1.00 11.89 ? 50   VAL A N     1 
ATOM   413  C  CA    . VAL A 1 53  ? 18.626  220.453 8.172   1.00 12.82 ? 50   VAL A CA    1 
ATOM   414  C  C     . VAL A 1 53  ? 19.380  221.752 8.010   1.00 12.54 ? 50   VAL A C     1 
ATOM   415  O  O     . VAL A 1 53  ? 20.574  221.723 7.599   1.00 13.30 ? 50   VAL A O     1 
ATOM   416  C  CB    . VAL A 1 53  ? 19.304  219.599 9.310   1.00 13.81 ? 50   VAL A CB    1 
ATOM   417  C  CG1   . VAL A 1 53  ? 19.072  220.265 10.682  1.00 16.38 ? 50   VAL A CG1   1 
ATOM   418  C  CG2   . VAL A 1 53  ? 18.723  218.202 9.323   1.00 17.19 ? 50   VAL A CG2   1 
ATOM   419  N  N     . SER A 1 54  ? 18.783  222.905 8.344   1.00 12.90 ? 51   SER A N     1 
ATOM   420  C  CA    . SER A 1 54  ? 19.538  224.156 8.293   1.00 14.08 ? 51   SER A CA    1 
ATOM   421  C  C     . SER A 1 54  ? 20.620  224.231 9.365   1.00 14.06 ? 51   SER A C     1 
ATOM   422  O  O     . SER A 1 54  ? 20.558  223.481 10.358  1.00 14.29 ? 51   SER A O     1 
ATOM   423  C  CB    . SER A 1 54  ? 18.584  225.355 8.488   1.00 16.18 ? 51   SER A CB    1 
ATOM   424  O  OG    . SER A 1 54  ? 18.236  225.523 9.870   1.00 14.57 ? 51   SER A OG    1 
ATOM   425  N  N     . TYR A 1 55  ? 21.601  225.076 9.122   1.00 14.71 ? 52   TYR A N     1 
ATOM   426  C  CA    . TYR A 1 55  ? 22.685  225.171 10.100  1.00 13.71 ? 52   TYR A CA    1 
ATOM   427  C  C     . TYR A 1 55  ? 22.200  225.671 11.438  1.00 14.47 ? 52   TYR A C     1 
ATOM   428  O  O     . TYR A 1 55  ? 22.723  225.157 12.438  1.00 17.36 ? 52   TYR A O     1 
ATOM   429  C  CB    . TYR A 1 55  ? 23.863  226.022 9.537   1.00 13.43 ? 52   TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 55  ? 24.655  225.223 8.537   1.00 14.04 ? 52   TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 55  ? 24.212  225.063 7.226   1.00 15.41 ? 52   TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 55  ? 25.778  224.504 8.930   1.00 16.59 ? 52   TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 55  ? 24.890  224.226 6.336   1.00 14.20 ? 52   TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 55  ? 26.462  223.660 8.062   1.00 18.30 ? 52   TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 55  ? 26.042  223.530 6.763   1.00 16.47 ? 52   TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 55  ? 26.738  222.727 5.870   1.00 16.21 ? 52   TYR A OH    1 
ATOM   437  N  N     . GLU A 1 56  ? 21.206  226.573 11.491  1.00 16.46 ? 53   GLU A N     1 
ATOM   438  C  CA    . GLU A 1 56  ? 20.684  226.962 12.794  1.00 16.05 ? 53   GLU A CA    1 
ATOM   439  C  C     . GLU A 1 56  ? 20.101  225.754 13.538  1.00 16.81 ? 53   GLU A C     1 
ATOM   440  O  O     . GLU A 1 56  ? 20.173  225.670 14.778  1.00 18.77 ? 53   GLU A O     1 
ATOM   441  C  CB    . GLU A 1 56  ? 19.630  228.050 12.604  1.00 18.18 ? 53   GLU A CB    1 
ATOM   442  C  CG    . GLU A 1 56  ? 20.160  229.293 11.937  1.00 20.18 ? 53   GLU A CG    1 
ATOM   443  C  CD    . GLU A 1 56  ? 20.167  229.275 10.389  1.00 25.04 ? 53   GLU A CD    1 
ATOM   444  O  OE1   . GLU A 1 56  ? 20.088  228.219 9.732   1.00 21.28 ? 53   GLU A OE1   1 
ATOM   445  O  OE2   . GLU A 1 56  ? 20.238  230.379 9.822   1.00 28.11 ? 53   GLU A OE2   1 
ATOM   446  N  N     . ALA A 1 57  ? 19.445  224.842 12.826  1.00 14.84 ? 54   ALA A N     1 
ATOM   447  C  CA    . ALA A 1 57  ? 18.865  223.685 13.478  1.00 14.53 ? 54   ALA A CA    1 
ATOM   448  C  C     . ALA A 1 57  ? 19.949  222.638 13.890  1.00 15.49 ? 54   ALA A C     1 
ATOM   449  O  O     . ALA A 1 57  ? 19.785  221.992 14.915  1.00 16.11 ? 54   ALA A O     1 
ATOM   450  C  CB    . ALA A 1 57  ? 17.769  222.982 12.546  1.00 15.12 ? 54   ALA A CB    1 
ATOM   451  N  N     . ARG A 1 58  ? 21.021  222.507 13.086  1.00 15.74 ? 55   ARG A N     1 
ATOM   452  C  CA    . ARG A 1 58  ? 22.149  221.606 13.442  1.00 14.34 ? 55   ARG A CA    1 
ATOM   453  C  C     . ARG A 1 58  ? 22.757  221.980 14.814  1.00 15.40 ? 55   ARG A C     1 
ATOM   454  O  O     . ARG A 1 58  ? 23.246  221.061 15.510  1.00 18.05 ? 55   ARG A O     1 
ATOM   455  C  CB    . ARG A 1 58  ? 23.253  221.645 12.371  1.00 14.09 ? 55   ARG A CB    1 
ATOM   456  C  CG    . ARG A 1 58  ? 22.756  221.139 11.060  1.00 17.04 ? 55   ARG A CG    1 
ATOM   457  C  CD    . ARG A 1 58  ? 23.849  221.161 9.980   1.00 15.79 ? 55   ARG A CD    1 
ATOM   458  N  NE    . ARG A 1 58  ? 23.221  221.065 8.647   1.00 13.95 ? 55   ARG A NE    1 
ATOM   459  C  CZ    . ARG A 1 58  ? 23.849  220.735 7.528   1.00 16.56 ? 55   ARG A CZ    1 
ATOM   460  N  NH1   . ARG A 1 58  ? 25.161  220.481 7.550   1.00 18.41 ? 55   ARG A NH1   1 
ATOM   461  N  NH2   . ARG A 1 58  ? 23.135  220.686 6.381   1.00 15.41 ? 55   ARG A NH2   1 
ATOM   462  N  N     . ALA A 1 59  ? 22.702  223.277 15.136  1.00 16.86 ? 56   ALA A N     1 
ATOM   463  C  CA    . ALA A 1 59  ? 23.248  223.785 16.410  1.00 19.04 ? 56   ALA A CA    1 
ATOM   464  C  C     . ALA A 1 59  ? 22.511  223.228 17.603  1.00 21.30 ? 56   ALA A C     1 
ATOM   465  O  O     . ALA A 1 59  ? 23.066  223.171 18.699  1.00 22.92 ? 56   ALA A O     1 
ATOM   466  C  CB    . ALA A 1 59  ? 23.234  225.313 16.430  1.00 18.99 ? 56   ALA A CB    1 
ATOM   467  N  N     . PHE A 1 60  ? 21.283  222.778 17.396  1.00 16.73 ? 57   PHE A N     1 
ATOM   468  C  CA    . PHE A 1 60  ? 20.495  222.099 18.440  1.00 18.58 ? 57   PHE A CA    1 
ATOM   469  C  C     . PHE A 1 60  ? 20.674  220.602 18.457  1.00 18.28 ? 57   PHE A C     1 
ATOM   470  O  O     . PHE A 1 60  ? 20.110  219.903 19.317  1.00 23.35 ? 57   PHE A O     1 
ATOM   471  C  CB    . PHE A 1 60  ? 18.999  222.411 18.274  1.00 16.62 ? 57   PHE A CB    1 
ATOM   472  C  CG    . PHE A 1 60  ? 18.642  223.851 18.563  1.00 18.89 ? 57   PHE A CG    1 
ATOM   473  C  CD1   . PHE A 1 60  ? 18.074  224.209 19.808  1.00 22.86 ? 57   PHE A CD1   1 
ATOM   474  C  CD2   . PHE A 1 60  ? 18.795  224.845 17.595  1.00 19.97 ? 57   PHE A CD2   1 
ATOM   475  C  CE1   . PHE A 1 60  ? 17.668  225.512 20.063  1.00 25.29 ? 57   PHE A CE1   1 
ATOM   476  C  CE2   . PHE A 1 60  ? 18.405  226.175 17.841  1.00 22.38 ? 57   PHE A CE2   1 
ATOM   477  C  CZ    . PHE A 1 60  ? 17.849  226.518 19.082  1.00 25.91 ? 57   PHE A CZ    1 
ATOM   478  N  N     . GLY A 1 61  ? 21.428  220.084 17.503  1.00 16.27 ? 58   GLY A N     1 
ATOM   479  C  CA    . GLY A 1 61  ? 21.621  218.647 17.365  1.00 19.51 ? 58   GLY A CA    1 
ATOM   480  C  C     . GLY A 1 61  ? 20.679  217.887 16.445  1.00 18.65 ? 58   GLY A C     1 
ATOM   481  O  O     . GLY A 1 61  ? 20.668  216.645 16.396  1.00 19.99 ? 58   GLY A O     1 
ATOM   482  N  N     . VAL A 1 62  ? 19.872  218.651 15.682  1.00 17.02 ? 59   VAL A N     1 
ATOM   483  C  CA    . VAL A 1 62  ? 18.992  218.045 14.691  1.00 17.07 ? 59   VAL A CA    1 
ATOM   484  C  C     . VAL A 1 62  ? 19.837  217.488 13.549  1.00 15.08 ? 59   VAL A C     1 
ATOM   485  O  O     . VAL A 1 62  ? 20.748  218.180 13.033  1.00 16.97 ? 59   VAL A O     1 
ATOM   486  C  CB    . VAL A 1 62  ? 17.968  219.095 14.172  1.00 14.58 ? 59   VAL A CB    1 
ATOM   487  C  CG1   . VAL A 1 62  ? 17.008  218.431 13.186  1.00 16.17 ? 59   VAL A CG1   1 
ATOM   488  C  CG2   . VAL A 1 62  ? 17.171  219.597 15.330  1.00 19.10 ? 59   VAL A CG2   1 
ATOM   489  N  N     . THR A 1 63  ? 19.521  216.250 13.151  1.00 16.55 ? 60   THR A N     1 
ATOM   490  C  CA    . THR A 1 63  ? 20.264  215.593 12.073  1.00 18.81 ? 60   THR A CA    1 
ATOM   491  C  C     . THR A 1 63  ? 19.317  214.979 11.107  1.00 19.63 ? 60   THR A C     1 
ATOM   492  O  O     . THR A 1 63  ? 18.139  214.736 11.430  1.00 19.56 ? 60   THR A O     1 
ATOM   493  C  CB    . THR A 1 63  ? 21.214  214.492 12.593  1.00 19.99 ? 60   THR A CB    1 
ATOM   494  O  OG1   . THR A 1 63  ? 20.451  213.430 13.180  1.00 23.93 ? 60   THR A OG1   1 
ATOM   495  C  CG2   . THR A 1 63  ? 22.167  215.086 13.618  1.00 18.55 ? 60   THR A CG2   1 
ATOM   496  N  N     . ARG A 1 64  ? 19.832  214.683 9.906   1.00 18.51 ? 61   ARG A N     1 
ATOM   497  C  CA    . ARG A 1 64  ? 19.146  213.810 8.981   1.00 21.82 ? 61   ARG A CA    1 
ATOM   498  C  C     . ARG A 1 64  ? 18.846  212.455 9.614   1.00 23.57 ? 61   ARG A C     1 
ATOM   499  O  O     . ARG A 1 64  ? 19.577  211.985 10.507  1.00 22.84 ? 61   ARG A O     1 
ATOM   500  C  CB    . ARG A 1 64  ? 19.984  213.651 7.703   1.00 25.00 ? 61   ARG A CB    1 
ATOM   501  C  CG    . ARG A 1 64  ? 19.441  212.750 6.669   1.00 32.98 ? 61   ARG A CG    1 
ATOM   502  C  CD    . ARG A 1 64  ? 20.569  212.377 5.717   1.00 35.83 ? 61   ARG A CD    1 
ATOM   503  N  NE    . ARG A 1 64  ? 21.231  213.567 5.219   1.00 38.70 ? 61   ARG A NE    1 
ATOM   504  C  CZ    . ARG A 1 64  ? 22.541  213.824 5.318   1.00 38.96 ? 61   ARG A CZ    1 
ATOM   505  N  NH1   . ARG A 1 64  ? 23.382  212.970 5.911   1.00 41.31 ? 61   ARG A NH1   1 
ATOM   506  N  NH2   . ARG A 1 64  ? 23.014  214.954 4.781   1.00 35.35 ? 61   ARG A NH2   1 
ATOM   507  N  N     . SER A 1 65  ? 17.763  211.852 9.163   1.00 23.87 ? 62   SER A N     1 
ATOM   508  C  CA    . SER A 1 65  ? 17.215  210.552 9.578   1.00 30.16 ? 62   SER A CA    1 
ATOM   509  C  C     . SER A 1 65  ? 16.466  210.558 10.914  1.00 26.55 ? 62   SER A C     1 
ATOM   510  O  O     . SER A 1 65  ? 15.846  209.577 11.312  1.00 34.81 ? 62   SER A O     1 
ATOM   511  C  CB    . SER A 1 65  ? 18.297  209.481 9.634   1.00 32.51 ? 62   SER A CB    1 
ATOM   512  O  OG    . SER A 1 65  ? 18.860  209.435 10.914  1.00 41.33 ? 62   SER A OG    1 
ATOM   513  N  N     . MET A 1 66  ? 16.539  211.653 11.615  1.00 22.88 ? 63   MET A N     1 
ATOM   514  C  CA    . MET A 1 66  ? 15.743  211.810 12.802  1.00 20.56 ? 63   MET A CA    1 
ATOM   515  C  C     . MET A 1 66  ? 14.307  211.891 12.359  1.00 19.91 ? 63   MET A C     1 
ATOM   516  O  O     . MET A 1 66  ? 14.019  212.536 11.331  1.00 21.80 ? 63   MET A O     1 
ATOM   517  C  CB    . MET A 1 66  ? 16.136  213.116 13.499  1.00 21.35 ? 63   MET A CB    1 
ATOM   518  C  CG    . MET A 1 66  ? 16.175  213.135 14.915  1.00 30.71 ? 63   MET A CG    1 
ATOM   519  S  SD    . MET A 1 66  ? 17.102  214.616 15.348  1.00 24.53 ? 63   MET A SD    1 
ATOM   520  C  CE    . MET A 1 66  ? 18.443  213.929 16.300  1.00 25.04 ? 63   MET A CE    1 
ATOM   521  N  N     . TRP A 1 67  ? 13.398  211.346 13.176  1.00 18.42 ? 64   TRP A N     1 
ATOM   522  C  CA    . TRP A 1 67  ? 11.966  211.681 13.059  1.00 18.28 ? 64   TRP A CA    1 
ATOM   523  C  C     . TRP A 1 67  ? 11.710  213.108 13.520  1.00 17.80 ? 64   TRP A C     1 
ATOM   524  O  O     . TRP A 1 67  ? 12.264  213.558 14.503  1.00 17.43 ? 64   TRP A O     1 
ATOM   525  C  CB    . TRP A 1 67  ? 11.072  210.749 13.891  1.00 19.72 ? 64   TRP A CB    1 
ATOM   526  C  CG    . TRP A 1 67  ? 11.291  209.302 13.474  1.00 21.70 ? 64   TRP A CG    1 
ATOM   527  C  CD1   . TRP A 1 67  ? 11.790  208.277 14.235  1.00 23.16 ? 64   TRP A CD1   1 
ATOM   528  C  CD2   . TRP A 1 67  ? 11.025  208.763 12.181  1.00 26.53 ? 64   TRP A CD2   1 
ATOM   529  N  NE1   . TRP A 1 67  ? 11.831  207.097 13.466  1.00 27.63 ? 64   TRP A NE1   1 
ATOM   530  C  CE2   . TRP A 1 67  ? 11.373  207.384 12.210  1.00 29.74 ? 64   TRP A CE2   1 
ATOM   531  C  CE3   . TRP A 1 67  ? 10.511  209.308 10.998  1.00 22.71 ? 64   TRP A CE3   1 
ATOM   532  C  CZ2   . TRP A 1 67  ? 11.225  206.547 11.092  1.00 28.47 ? 64   TRP A CZ2   1 
ATOM   533  C  CZ3   . TRP A 1 67  ? 10.336  208.469 9.892   1.00 25.34 ? 64   TRP A CZ3   1 
ATOM   534  C  CH2   . TRP A 1 67  ? 10.733  207.111 9.941   1.00 27.39 ? 64   TRP A CH2   1 
ATOM   535  N  N     . ALA A 1 68  ? 10.865  213.826 12.830  1.00 19.32 ? 65   ALA A N     1 
ATOM   536  C  CA    . ALA A 1 68  ? 10.639  215.202 13.214  1.00 18.98 ? 65   ALA A CA    1 
ATOM   537  C  C     . ALA A 1 68  ? 10.083  215.341 14.646  1.00 19.62 ? 65   ALA A C     1 
ATOM   538  O  O     . ALA A 1 68  ? 10.393  216.325 15.319  1.00 18.05 ? 65   ALA A O     1 
ATOM   539  C  CB    . ALA A 1 68  ? 9.700   215.894 12.196  1.00 18.49 ? 65   ALA A CB    1 
ATOM   540  N  N     . ASP A 1 69  ? 9.275   214.385 15.095  1.00 19.03 ? 66   ASP A N     1 
ATOM   541  C  CA    . ASP A 1 69  ? 8.760   214.450 16.486  1.00 20.20 ? 66   ASP A CA    1 
ATOM   542  C  C     . ASP A 1 69  ? 9.948   214.435 17.449  1.00 19.53 ? 66   ASP A C     1 
ATOM   543  O  O     . ASP A 1 69  ? 9.913   215.065 18.500  1.00 19.85 ? 66   ASP A O     1 
ATOM   544  C  CB    . ASP A 1 69  ? 7.861   213.271 16.831  1.00 23.08 ? 66   ASP A CB    1 
ATOM   545  C  CG    . ASP A 1 69  ? 6.474   213.355 16.205  1.00 26.56 ? 66   ASP A CG    1 
ATOM   546  O  OD1   . ASP A 1 69  ? 6.099   214.425 15.704  1.00 25.43 ? 66   ASP A OD1   1 
ATOM   547  O  OD2   . ASP A 1 69  ? 5.748   212.341 16.276  1.00 32.84 ? 66   ASP A OD2   1 
ATOM   548  N  N     . ASP A 1 70  ? 10.979  213.667 17.088  1.00 18.23 ? 67   ASP A N     1 
ATOM   549  C  CA    . ASP A 1 70  ? 12.151  213.592 17.955  1.00 18.28 ? 67   ASP A CA    1 
ATOM   550  C  C     . ASP A 1 70  ? 13.011  214.841 17.820  1.00 18.99 ? 67   ASP A C     1 
ATOM   551  O  O     . ASP A 1 70  ? 13.544  215.373 18.805  1.00 17.02 ? 67   ASP A O     1 
ATOM   552  C  CB    . ASP A 1 70  ? 12.953  212.339 17.600  1.00 21.19 ? 67   ASP A CB    1 
ATOM   553  C  CG    . ASP A 1 70  ? 12.208  211.073 17.945  1.00 26.16 ? 67   ASP A CG    1 
ATOM   554  O  OD1   . ASP A 1 70  ? 11.443  211.091 18.928  1.00 24.92 ? 67   ASP A OD1   1 
ATOM   555  O  OD2   . ASP A 1 70  ? 12.376  210.044 17.230  1.00 28.17 ? 67   ASP A OD2   1 
ATOM   556  N  N     . ALA A 1 71  ? 13.142  215.377 16.592  1.00 15.09 ? 68   ALA A N     1 
ATOM   557  C  CA    . ALA A 1 71  ? 13.883  216.629 16.433  1.00 18.23 ? 68   ALA A CA    1 
ATOM   558  C  C     . ALA A 1 71  ? 13.274  217.807 17.205  1.00 15.81 ? 68   ALA A C     1 
ATOM   559  O  O     . ALA A 1 71  ? 13.997  218.651 17.704  1.00 17.90 ? 68   ALA A O     1 
ATOM   560  C  CB    . ALA A 1 71  ? 14.010  217.009 14.920  1.00 19.13 ? 68   ALA A CB    1 
ATOM   561  N  N     . LYS A 1 72  ? 11.939  217.822 17.310  1.00 16.34 ? 69   LYS A N     1 
ATOM   562  C  CA    . LYS A 1 72  ? 11.247  218.851 18.075  1.00 18.27 ? 69   LYS A CA    1 
ATOM   563  C  C     . LYS A 1 72  ? 11.572  218.812 19.580  1.00 19.17 ? 69   LYS A C     1 
ATOM   564  O  O     . LYS A 1 72  ? 11.468  219.805 20.277  1.00 22.02 ? 69   LYS A O     1 
ATOM   565  C  CB    . LYS A 1 72  ? 9.713   218.689 17.844  1.00 22.39 ? 69   LYS A CB    1 
ATOM   566  C  CG    . LYS A 1 72  ? 9.181   219.342 16.522  1.00 24.58 ? 69   LYS A CG    1 
ATOM   567  C  CD    . LYS A 1 72  ? 9.111   220.824 16.761  1.00 25.84 ? 69   LYS A CD    1 
ATOM   568  C  CE    . LYS A 1 72  ? 8.182   221.646 15.831  1.00 30.03 ? 69   LYS A CE    1 
ATOM   569  N  NZ    . LYS A 1 72  ? 8.286   223.136 16.131  1.00 24.74 ? 69   LYS A NZ    1 
ATOM   570  N  N     . LYS A 1 73  ? 11.990  217.642 20.056  1.00 18.57 ? 70   LYS A N     1 
ATOM   571  C  CA    . LYS A 1 73  ? 12.400  217.518 21.460  1.00 17.63 ? 70   LYS A CA    1 
ATOM   572  C  C     . LYS A 1 73  ? 13.738  218.258 21.671  1.00 20.39 ? 70   LYS A C     1 
ATOM   573  O  O     . LYS A 1 73  ? 13.957  218.860 22.732  1.00 22.38 ? 70   LYS A O     1 
ATOM   574  C  CB    . LYS A 1 73  ? 12.517  216.029 21.818  1.00 18.06 ? 70   LYS A CB    1 
ATOM   575  C  CG    . LYS A 1 73  ? 11.242  215.270 21.586  1.00 19.79 ? 70   LYS A CG    1 
ATOM   576  C  CD    . LYS A 1 73  ? 11.436  213.733 21.705  1.00 19.40 ? 70   LYS A CD    1 
ATOM   577  C  CE    . LYS A 1 73  ? 10.038  213.078 21.552  1.00 22.80 ? 70   LYS A CE    1 
ATOM   578  N  NZ    . LYS A 1 73  ? 10.173  211.687 21.214  1.00 27.32 ? 70   LYS A NZ    1 
ATOM   579  N  N     . LEU A 1 74  ? 14.621  218.207 20.650  1.00 17.87 ? 71   LEU A N     1 
ATOM   580  C  CA    . LEU A 1 74  ? 15.909  218.962 20.714  1.00 17.87 ? 71   LEU A CA    1 
ATOM   581  C  C     . LEU A 1 74  ? 15.748  220.457 20.410  1.00 19.86 ? 71   LEU A C     1 
ATOM   582  O  O     . LEU A 1 74  ? 16.492  221.260 20.904  1.00 20.52 ? 71   LEU A O     1 
ATOM   583  C  CB    . LEU A 1 74  ? 16.929  218.371 19.717  1.00 17.01 ? 71   LEU A CB    1 
ATOM   584  C  CG    . LEU A 1 74  ? 17.247  216.896 19.928  1.00 21.09 ? 71   LEU A CG    1 
ATOM   585  C  CD1   . LEU A 1 74  ? 18.283  216.532 18.850  1.00 19.10 ? 71   LEU A CD1   1 
ATOM   586  C  CD2   . LEU A 1 74  ? 17.901  216.694 21.293  1.00 21.45 ? 71   LEU A CD2   1 
ATOM   587  N  N     . CYS A 1 75  ? 14.780  220.797 19.553  1.00 20.14 ? 72   CYS A N     1 
ATOM   588  C  CA    . CYS A 1 75  ? 14.615  222.131 18.975  1.00 19.21 ? 72   CYS A CA    1 
ATOM   589  C  C     . CYS A 1 75  ? 13.119  222.401 18.915  1.00 21.43 ? 72   CYS A C     1 
ATOM   590  O  O     . CYS A 1 75  ? 12.472  222.187 17.885  1.00 20.25 ? 72   CYS A O     1 
ATOM   591  C  CB    . CYS A 1 75  ? 15.267  222.163 17.601  1.00 18.06 ? 72   CYS A CB    1 
ATOM   592  S  SG    . CYS A 1 75  ? 15.213  223.777 16.859  1.00 20.69 ? 72   CYS A SG    1 
ATOM   593  N  N     . PRO A 1 76  ? 12.509  222.883 20.018  1.00 22.47 ? 73   PRO A N     1 
ATOM   594  C  CA    . PRO A 1 76  ? 11.048  223.011 20.036  1.00 22.79 ? 73   PRO A CA    1 
ATOM   595  C  C     . PRO A 1 76  ? 10.473  224.004 18.996  1.00 18.97 ? 73   PRO A C     1 
ATOM   596  O  O     . PRO A 1 76  ? 9.331   223.782 18.552  1.00 24.36 ? 73   PRO A O     1 
ATOM   597  C  CB    . PRO A 1 76  ? 10.747  223.507 21.478  1.00 27.60 ? 73   PRO A CB    1 
ATOM   598  C  CG    . PRO A 1 76  ? 11.948  223.066 22.277  1.00 29.17 ? 73   PRO A CG    1 
ATOM   599  C  CD    . PRO A 1 76  ? 13.129  223.181 21.331  1.00 27.15 ? 73   PRO A CD    1 
ATOM   600  N  N     . ASP A 1 77  ? 11.275  224.973 18.622  1.00 23.64 ? 74   ASP A N     1 
ATOM   601  C  CA    . ASP A 1 77  ? 10.840  225.967 17.638  1.00 28.75 ? 74   ASP A CA    1 
ATOM   602  C  C     . ASP A 1 77  ? 11.227  225.604 16.199  1.00 26.43 ? 74   ASP A C     1 
ATOM   603  O  O     . ASP A 1 77  ? 11.136  226.467 15.310  1.00 23.27 ? 74   ASP A O     1 
ATOM   604  C  CB    . ASP A 1 77  ? 11.442  227.321 17.964  1.00 32.00 ? 74   ASP A CB    1 
ATOM   605  C  CG    . ASP A 1 77  ? 10.848  227.930 19.229  1.00 36.72 ? 74   ASP A CG    1 
ATOM   606  O  OD1   . ASP A 1 77  ? 11.604  228.584 19.968  1.00 42.06 ? 74   ASP A OD1   1 
ATOM   607  O  OD2   . ASP A 1 77  ? 9.639   227.726 19.484  1.00 42.15 ? 74   ASP A OD2   1 
ATOM   608  N  N     . LEU A 1 78  ? 11.713  224.380 15.986  1.00 17.95 ? 75   LEU A N     1 
ATOM   609  C  CA    . LEU A 1 78  ? 12.118  223.947 14.623  1.00 16.96 ? 75   LEU A CA    1 
ATOM   610  C  C     . LEU A 1 78  ? 10.982  224.154 13.643  1.00 16.08 ? 75   LEU A C     1 
ATOM   611  O  O     . LEU A 1 78  ? 9.849   223.704 13.897  1.00 18.54 ? 75   LEU A O     1 
ATOM   612  C  CB    . LEU A 1 78  ? 12.471  222.456 14.654  1.00 16.53 ? 75   LEU A CB    1 
ATOM   613  C  CG    . LEU A 1 78  ? 12.910  221.788 13.340  1.00 15.47 ? 75   LEU A CG    1 
ATOM   614  C  CD1   . LEU A 1 78  ? 14.282  222.411 12.949  1.00 15.13 ? 75   LEU A CD1   1 
ATOM   615  C  CD2   . LEU A 1 78  ? 13.037  220.318 13.571  1.00 15.41 ? 75   LEU A CD2   1 
ATOM   616  N  N     . LEU A 1 79  ? 11.290  224.784 12.500  1.00 15.77 ? 76   LEU A N     1 
ATOM   617  C  CA    . LEU A 1 79  ? 10.277  224.928 11.451  1.00 15.03 ? 76   LEU A CA    1 
ATOM   618  C  C     . LEU A 1 79  ? 10.471  223.794 10.434  1.00 17.64 ? 76   LEU A C     1 
ATOM   619  O  O     . LEU A 1 79  ? 11.588  223.359 10.248  1.00 16.02 ? 76   LEU A O     1 
ATOM   620  C  CB    . LEU A 1 79  ? 10.363  226.313 10.780  1.00 13.77 ? 76   LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 79  ? 10.202  227.510 11.734  1.00 16.24 ? 76   LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 79  ? 10.354  228.843 10.983  1.00 16.42 ? 76   LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 79  ? 8.846   227.427 12.476  1.00 18.48 ? 76   LEU A CD2   1 
ATOM   624  N  N     . LEU A 1 80  ? 9.397   223.362 9.770   1.00 14.73 ? 77   LEU A N     1 
ATOM   625  C  CA    . LEU A 1 80  ? 9.450   222.248 8.838   1.00 15.67 ? 77   LEU A CA    1 
ATOM   626  C  C     . LEU A 1 80  ? 8.836   222.641 7.521   1.00 18.88 ? 77   LEU A C     1 
ATOM   627  O  O     . LEU A 1 80  ? 7.817   223.392 7.449   1.00 21.21 ? 77   LEU A O     1 
ATOM   628  C  CB    . LEU A 1 80  ? 8.727   221.056 9.385   1.00 16.26 ? 77   LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 80  ? 9.259   220.565 10.711  1.00 17.47 ? 77   LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 80  ? 8.368   219.414 11.250  1.00 19.84 ? 77   LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 80  ? 10.675  220.075 10.536  1.00 17.95 ? 77   LEU A CD2   1 
ATOM   632  N  N     . ALA A 1 81  ? 9.456   222.135 6.470   1.00 13.39 ? 78   ALA A N     1 
ATOM   633  C  CA    . ALA A 1 81  ? 8.836   222.128 5.135   1.00 13.62 ? 78   ALA A CA    1 
ATOM   634  C  C     . ALA A 1 81  ? 8.732   220.694 4.696   1.00 16.07 ? 78   ALA A C     1 
ATOM   635  O  O     . ALA A 1 81  ? 9.667   219.927 4.871   1.00 18.87 ? 78   ALA A O     1 
ATOM   636  C  CB    . ALA A 1 81  ? 9.686   222.974 4.114   1.00 16.70 ? 78   ALA A CB    1 
ATOM   637  N  N     . GLN A 1 82  ? 7.609   220.337 4.099   1.00 15.63 ? 79   GLN A N     1 
ATOM   638  C  CA    . GLN A 1 82  ? 7.428   218.937 3.686   1.00 16.89 ? 79   GLN A CA    1 
ATOM   639  C  C     . GLN A 1 82  ? 7.603   218.722 2.183   1.00 14.78 ? 79   GLN A C     1 
ATOM   640  O  O     . GLN A 1 82  ? 7.222   219.555 1.362   1.00 17.21 ? 79   GLN A O     1 
ATOM   641  C  CB    . GLN A 1 82  ? 6.047   218.410 4.145   1.00 21.80 ? 79   GLN A CB    1 
ATOM   642  C  CG    . GLN A 1 82  ? 4.889   219.048 3.647   1.00 28.71 ? 79   GLN A CG    1 
ATOM   643  C  CD    . GLN A 1 82  ? 3.660   218.659 4.519   1.00 31.79 ? 79   GLN A CD    1 
ATOM   644  O  OE1   . GLN A 1 82  ? 3.604   218.967 5.726   1.00 30.60 ? 79   GLN A OE1   1 
ATOM   645  N  NE2   . GLN A 1 82  ? 2.733   217.934 3.919   1.00 31.95 ? 79   GLN A NE2   1 
ATOM   646  N  N     . VAL A 1 83  ? 8.226   217.596 1.867   1.00 14.85 ? 80   VAL A N     1 
ATOM   647  C  CA    . VAL A 1 83  ? 8.342   217.184 0.480   1.00 15.23 ? 80   VAL A CA    1 
ATOM   648  C  C     . VAL A 1 83  ? 6.959   216.968 -0.096  1.00 17.08 ? 80   VAL A C     1 
ATOM   649  O  O     . VAL A 1 83  ? 6.083   216.354 0.528   1.00 16.54 ? 80   VAL A O     1 
ATOM   650  C  CB    . VAL A 1 83  ? 9.185   215.875 0.376   1.00 16.45 ? 80   VAL A CB    1 
ATOM   651  C  CG1   . VAL A 1 83  ? 9.231   215.351 -1.011  1.00 17.33 ? 80   VAL A CG1   1 
ATOM   652  C  CG2   . VAL A 1 83  ? 10.626  216.132 0.953   1.00 16.34 ? 80   VAL A CG2   1 
ATOM   653  N  N     . ARG A 1 84  ? 6.826   217.380 -1.347  1.00 16.40 ? 81   ARG A N     1 
ATOM   654  C  CA    . ARG A 1 84  ? 5.572   217.159 -2.051  1.00 16.60 ? 81   ARG A CA    1 
ATOM   655  C  C     . ARG A 1 84  ? 5.229   215.665 -2.110  1.00 17.56 ? 81   ARG A C     1 
ATOM   656  O  O     . ARG A 1 84  ? 6.115   214.825 -2.236  1.00 16.27 ? 81   ARG A O     1 
ATOM   657  C  CB    . ARG A 1 84  ? 5.719   217.749 -3.451  1.00 22.00 ? 81   ARG A CB    1 
ATOM   658  C  CG    . ARG A 1 84  ? 4.483   217.498 -4.322  1.00 24.09 ? 81   ARG A CG    1 
ATOM   659  C  CD    . ARG A 1 84  ? 4.619   218.285 -5.607  1.00 31.32 ? 81   ARG A CD    1 
ATOM   660  N  NE    . ARG A 1 84  ? 3.977   217.607 -6.728  1.00 41.52 ? 81   ARG A NE    1 
ATOM   661  C  CZ    . ARG A 1 84  ? 4.253   217.835 -8.013  1.00 43.23 ? 81   ARG A CZ    1 
ATOM   662  N  NH1   . ARG A 1 84  ? 5.166   218.746 -8.360  1.00 37.22 ? 81   ARG A NH1   1 
ATOM   663  N  NH2   . ARG A 1 84  ? 3.606   217.140 -8.953  1.00 44.68 ? 81   ARG A NH2   1 
ATOM   664  N  N     . GLU A 1 85  ? 3.942   215.353 -2.010  1.00 16.96 ? 82   GLU A N     1 
ATOM   665  C  CA    A GLU A 1 85  ? 3.507   213.978 -2.179  0.52 18.85 ? 82   GLU A CA    1 
ATOM   666  C  CA    B GLU A 1 85  ? 3.503   213.972 -2.144  0.48 18.86 ? 82   GLU A CA    1 
ATOM   667  C  C     . GLU A 1 85  ? 2.576   213.932 -3.360  1.00 20.18 ? 82   GLU A C     1 
ATOM   668  O  O     . GLU A 1 85  ? 1.679   214.767 -3.475  1.00 21.49 ? 82   GLU A O     1 
ATOM   669  C  CB    A GLU A 1 85  ? 2.839   213.457 -0.906  0.52 22.27 ? 82   GLU A CB    1 
ATOM   670  C  CB    B GLU A 1 85  ? 2.816   213.483 -0.845  0.48 22.25 ? 82   GLU A CB    1 
ATOM   671  C  CG    A GLU A 1 85  ? 3.865   213.130 0.107   0.52 17.79 ? 82   GLU A CG    1 
ATOM   672  C  CG    B GLU A 1 85  ? 2.480   211.990 -0.808  0.48 22.77 ? 82   GLU A CG    1 
ATOM   673  C  CD    A GLU A 1 85  ? 3.309   212.826 1.469   0.52 22.19 ? 82   GLU A CD    1 
ATOM   674  C  CD    B GLU A 1 85  ? 2.135   211.478 0.593   0.48 22.67 ? 82   GLU A CD    1 
ATOM   675  O  OE1   A GLU A 1 85  ? 2.180   212.317 1.541   0.52 29.24 ? 82   GLU A OE1   1 
ATOM   676  O  OE1   B GLU A 1 85  ? 2.907   211.747 1.546   0.48 27.69 ? 82   GLU A OE1   1 
ATOM   677  O  OE2   A GLU A 1 85  ? 4.011   213.098 2.454   0.52 27.58 ? 82   GLU A OE2   1 
ATOM   678  O  OE2   B GLU A 1 85  ? 1.099   210.806 0.750   0.48 25.38 ? 82   GLU A OE2   1 
ATOM   679  N  N     . SER A 1 86  ? 2.840   213.000 -4.284  1.00 20.02 ? 83   SER A N     1 
ATOM   680  C  CA    . SER A 1 86  ? 2.037   212.771 -5.476  1.00 19.41 ? 83   SER A CA    1 
ATOM   681  C  C     . SER A 1 86  ? 1.891   211.269 -5.654  1.00 22.17 ? 83   SER A C     1 
ATOM   682  O  O     . SER A 1 86  ? 2.859   210.548 -5.538  1.00 22.17 ? 83   SER A O     1 
ATOM   683  C  CB    . SER A 1 86  ? 2.646   213.336 -6.745  1.00 22.29 ? 83   SER A CB    1 
ATOM   684  O  OG    . SER A 1 86  ? 2.993   214.683 -6.567  1.00 29.82 ? 83   SER A OG    1 
ATOM   685  N  N     . ARG A 1 87  ? 0.669   210.834 -5.929  1.00 26.89 ? 84   ARG A N     1 
ATOM   686  C  CA    A ARG A 1 87  ? 0.375   209.413 -6.080  0.38 25.70 ? 84   ARG A CA    1 
ATOM   687  C  CA    B ARG A 1 87  ? 0.359   209.410 -6.045  0.62 25.66 ? 84   ARG A CA    1 
ATOM   688  C  C     . ARG A 1 87  ? 0.811   208.572 -4.886  1.00 26.10 ? 84   ARG A C     1 
ATOM   689  O  O     . ARG A 1 87  ? 1.249   207.437 -5.075  1.00 30.85 ? 84   ARG A O     1 
ATOM   690  C  CB    A ARG A 1 87  ? 1.030   208.883 -7.357  0.38 26.77 ? 84   ARG A CB    1 
ATOM   691  C  CB    B ARG A 1 87  ? 0.960   208.861 -7.316  0.62 26.74 ? 84   ARG A CB    1 
ATOM   692  C  CG    A ARG A 1 87  ? 0.797   209.740 -8.605  0.38 29.51 ? 84   ARG A CG    1 
ATOM   693  C  CG    B ARG A 1 87  ? 0.390   209.475 -8.564  0.62 29.82 ? 84   ARG A CG    1 
ATOM   694  C  CD    A ARG A 1 87  ? 1.427   209.130 -9.866  0.38 28.83 ? 84   ARG A CD    1 
ATOM   695  C  CD    B ARG A 1 87  ? 0.907   208.782 -9.803  0.62 28.72 ? 84   ARG A CD    1 
ATOM   696  N  NE    A ARG A 1 87  ? 2.082   210.148 -10.688 0.38 28.53 ? 84   ARG A NE    1 
ATOM   697  N  NE    B ARG A 1 87  ? 0.955   209.720 -10.917 0.62 28.98 ? 84   ARG A NE    1 
ATOM   698  C  CZ    A ARG A 1 87  ? 1.514   210.770 -11.717 0.38 28.69 ? 84   ARG A CZ    1 
ATOM   699  C  CZ    B ARG A 1 87  ? 1.867   210.689 -11.055 0.62 28.13 ? 84   ARG A CZ    1 
ATOM   700  N  NH1   A ARG A 1 87  ? 0.278   210.463 -12.076 0.38 27.28 ? 84   ARG A NH1   1 
ATOM   701  N  NH1   B ARG A 1 87  ? 2.831   210.885 -10.138 0.62 29.30 ? 84   ARG A NH1   1 
ATOM   702  N  NH2   A ARG A 1 87  ? 2.187   211.703 -12.386 0.38 33.38 ? 84   ARG A NH2   1 
ATOM   703  N  NH2   B ARG A 1 87  ? 1.786   211.497 -12.102 0.62 33.21 ? 84   ARG A NH2   1 
ATOM   704  N  N     . GLY A 1 88  ? 0.690   209.111 -3.671  1.00 24.48 ? 85   GLY A N     1 
ATOM   705  C  CA    . GLY A 1 88  ? 1.046   208.412 -2.451  1.00 27.23 ? 85   GLY A CA    1 
ATOM   706  C  C     . GLY A 1 88  ? 2.512   208.276 -2.152  1.00 25.38 ? 85   GLY A C     1 
ATOM   707  O  O     . GLY A 1 88  ? 2.919   207.522 -1.248  1.00 25.09 ? 85   GLY A O     1 
ATOM   708  N  N     . LYS A 1 89  ? 3.336   209.021 -2.882  1.00 19.44 ? 86   LYS A N     1 
ATOM   709  C  CA    . LYS A 1 89  ? 4.756   208.922 -2.632  1.00 18.23 ? 86   LYS A CA    1 
ATOM   710  C  C     . LYS A 1 89  ? 5.425   210.286 -2.667  1.00 16.34 ? 86   LYS A C     1 
ATOM   711  O  O     . LYS A 1 89  ? 4.967   211.225 -3.334  1.00 17.79 ? 86   LYS A O     1 
ATOM   712  C  CB    . LYS A 1 89  ? 5.452   208.007 -3.630  1.00 21.83 ? 86   LYS A CB    1 
ATOM   713  C  CG    . LYS A 1 89  ? 5.469   208.555 -5.001  1.00 21.19 ? 86   LYS A CG    1 
ATOM   714  C  CD    . LYS A 1 89  ? 6.134   207.533 -5.984  1.00 26.27 ? 86   LYS A CD    1 
ATOM   715  C  CE    . LYS A 1 89  ? 7.624   207.360 -5.705  1.00 21.52 ? 86   LYS A CE    1 
ATOM   716  N  NZ    . LYS A 1 89  ? 8.317   208.750 -6.004  1.00 20.66 ? 86   LYS A NZ    1 
ATOM   717  N  N     . ALA A 1 90  ? 6.589   210.323 -2.047  1.00 19.41 ? 87   ALA A N     1 
ATOM   718  C  CA    . ALA A 1 90  ? 7.393   211.538 -2.056  1.00 19.45 ? 87   ALA A CA    1 
ATOM   719  C  C     . ALA A 1 90  ? 7.773   211.859 -3.475  1.00 19.39 ? 87   ALA A C     1 
ATOM   720  O  O     . ALA A 1 90  ? 8.110   210.951 -4.264  1.00 20.65 ? 87   ALA A O     1 
ATOM   721  C  CB    . ALA A 1 90  ? 8.634   211.341 -1.174  1.00 19.76 ? 87   ALA A CB    1 
ATOM   722  N  N     . ASN A 1 91  ? 7.716   213.135 -3.814  1.00 16.80 ? 88   ASN A N     1 
ATOM   723  C  CA    A ASN A 1 91  ? 8.054   213.550 -5.159  0.50 18.25 ? 88   ASN A CA    1 
ATOM   724  C  CA    B ASN A 1 91  ? 8.006   213.595 -5.170  0.50 18.26 ? 88   ASN A CA    1 
ATOM   725  C  C     . ASN A 1 91  ? 9.077   214.637 -5.090  1.00 17.96 ? 88   ASN A C     1 
ATOM   726  O  O     . ASN A 1 91  ? 8.828   215.691 -4.508  1.00 16.84 ? 88   ASN A O     1 
ATOM   727  C  CB    A ASN A 1 91  ? 6.806   214.022 -5.887  0.50 19.23 ? 88   ASN A CB    1 
ATOM   728  C  CB    B ASN A 1 91  ? 6.722   214.156 -5.798  0.50 19.24 ? 88   ASN A CB    1 
ATOM   729  C  CG    A ASN A 1 91  ? 7.078   214.342 -7.333  0.50 19.65 ? 88   ASN A CG    1 
ATOM   730  C  CG    B ASN A 1 91  ? 6.939   214.774 -7.181  0.50 20.66 ? 88   ASN A CG    1 
ATOM   731  O  OD1   A ASN A 1 91  ? 7.795   215.291 -7.642  0.50 20.33 ? 88   ASN A OD1   1 
ATOM   732  O  OD1   B ASN A 1 91  ? 8.063   214.840 -7.697  0.50 19.48 ? 88   ASN A OD1   1 
ATOM   733  N  ND2   A ASN A 1 91  ? 6.490   213.566 -8.227  0.50 21.81 ? 88   ASN A ND2   1 
ATOM   734  N  ND2   B ASN A 1 91  ? 5.828   215.221 -7.794  0.50 22.05 ? 88   ASN A ND2   1 
ATOM   735  N  N     . LEU A 1 92  ? 10.236  214.344 -5.663  1.00 18.69 ? 89   LEU A N     1 
ATOM   736  C  CA    . LEU A 1 92  ? 11.413  215.223 -5.476  1.00 15.47 ? 89   LEU A CA    1 
ATOM   737  C  C     . LEU A 1 92  ? 11.621  216.233 -6.616  1.00 15.85 ? 89   LEU A C     1 
ATOM   738  O  O     . LEU A 1 92  ? 12.689  216.856 -6.713  1.00 15.98 ? 89   LEU A O     1 
ATOM   739  C  CB    . LEU A 1 92  ? 12.646  214.344 -5.303  1.00 17.39 ? 89   LEU A CB    1 
ATOM   740  C  CG    . LEU A 1 92  ? 12.563  213.416 -4.109  1.00 18.49 ? 89   LEU A CG    1 
ATOM   741  C  CD1   . LEU A 1 92  ? 13.763  212.553 -4.217  1.00 25.48 ? 89   LEU A CD1   1 
ATOM   742  C  CD2   . LEU A 1 92  ? 12.570  214.279 -2.807  1.00 18.51 ? 89   LEU A CD2   1 
ATOM   743  N  N     . THR A 1 93  ? 10.594  216.415 -7.443  1.00 15.94 ? 90   THR A N     1 
ATOM   744  C  CA    . THR A 1 93  ? 10.716  217.330 -8.587  1.00 14.86 ? 90   THR A CA    1 
ATOM   745  C  C     . THR A 1 93  ? 11.260  218.711 -8.303  1.00 15.56 ? 90   THR A C     1 
ATOM   746  O  O     . THR A 1 93  ? 12.104  219.196 -9.049  1.00 15.89 ? 90   THR A O     1 
ATOM   747  C  CB    . THR A 1 93  ? 9.375   217.443 -9.328  1.00 18.10 ? 90   THR A CB    1 
ATOM   748  O  OG1   . THR A 1 93  ? 9.026   216.130 -9.776  1.00 21.75 ? 90   THR A OG1   1 
ATOM   749  C  CG2   . THR A 1 93  ? 9.573   218.283 -10.559 1.00 20.28 ? 90   THR A CG2   1 
ATOM   750  N  N     . LYS A 1 94  ? 10.827  219.326 -7.210  1.00 13.14 ? 91   LYS A N     1 
ATOM   751  C  CA    . LYS A 1 94  ? 11.212  220.703 -6.960  1.00 15.43 ? 91   LYS A CA    1 
ATOM   752  C  C     . LYS A 1 94  ? 12.735  220.792 -6.792  1.00 14.68 ? 91   LYS A C     1 
ATOM   753  O  O     . LYS A 1 94  ? 13.353  221.752 -7.238  1.00 16.95 ? 91   LYS A O     1 
ATOM   754  C  CB    . LYS A 1 94  ? 10.490  221.236 -5.742  1.00 16.77 ? 91   LYS A CB    1 
ATOM   755  C  CG    . LYS A 1 94  ? 10.774  222.719 -5.427  1.00 17.31 ? 91   LYS A CG    1 
ATOM   756  C  CD    . LYS A 1 94  ? 10.336  223.062 -3.973  1.00 17.39 ? 91   LYS A CD    1 
ATOM   757  C  CE    . LYS A 1 94  ? 8.910   222.762 -3.786  1.00 20.07 ? 91   LYS A CE    1 
ATOM   758  N  NZ    . LYS A 1 94  ? 8.494   223.238 -2.395  1.00 16.45 ? 91   LYS A NZ    1 
ATOM   759  N  N     . TYR A 1 95  ? 13.294  219.778 -6.158  1.00 14.49 ? 92   TYR A N     1 
ATOM   760  C  CA    . TYR A 1 95  ? 14.736  219.787 -5.818  1.00 12.72 ? 92   TYR A CA    1 
ATOM   761  C  C     . TYR A 1 95  ? 15.528  219.411 -7.041  1.00 15.12 ? 92   TYR A C     1 
ATOM   762  O  O     . TYR A 1 95  ? 16.620  219.914 -7.233  1.00 16.40 ? 92   TYR A O     1 
ATOM   763  C  CB    . TYR A 1 95  ? 15.057  218.816 -4.637  1.00 14.60 ? 92   TYR A CB    1 
ATOM   764  C  CG    . TYR A 1 95  ? 14.074  219.039 -3.522  1.00 13.49 ? 92   TYR A CG    1 
ATOM   765  C  CD1   . TYR A 1 95  ? 13.106  218.096 -3.289  1.00 13.79 ? 92   TYR A CD1   1 
ATOM   766  C  CD2   . TYR A 1 95  ? 14.042  220.234 -2.812  1.00 13.67 ? 92   TYR A CD2   1 
ATOM   767  C  CE1   . TYR A 1 95  ? 12.092  218.316 -2.379  1.00 16.34 ? 92   TYR A CE1   1 
ATOM   768  C  CE2   . TYR A 1 95  ? 13.092  220.472 -1.874  1.00 13.10 ? 92   TYR A CE2   1 
ATOM   769  C  CZ    . TYR A 1 95  ? 12.097  219.499 -1.671  1.00 13.60 ? 92   TYR A CZ    1 
ATOM   770  O  OH    . TYR A 1 95  ? 11.107  219.703 -0.744  1.00 18.19 ? 92   TYR A OH    1 
ATOM   771  N  N     . ARG A 1 96  ? 14.979  218.515 -7.894  1.00 14.04 ? 93   ARG A N     1 
ATOM   772  C  CA    . ARG A 1 96  ? 15.692  218.226 -9.162  1.00 13.55 ? 93   ARG A CA    1 
ATOM   773  C  C     . ARG A 1 96  ? 15.723  219.456 -10.082 1.00 16.12 ? 93   ARG A C     1 
ATOM   774  O  O     . ARG A 1 96  ? 16.738  219.745 -10.767 1.00 17.16 ? 93   ARG A O     1 
ATOM   775  C  CB    . ARG A 1 96  ? 15.008  217.073 -9.932  1.00 15.96 ? 93   ARG A CB    1 
ATOM   776  C  CG    . ARG A 1 96  ? 15.170  215.767 -9.228  1.00 15.03 ? 93   ARG A CG    1 
ATOM   777  C  CD    . ARG A 1 96  ? 14.725  214.522 -10.114 1.00 18.69 ? 93   ARG A CD    1 
ATOM   778  N  NE    . ARG A 1 96  ? 14.812  213.288 -9.304  1.00 23.35 ? 93   ARG A NE    1 
ATOM   779  C  CZ    . ARG A 1 96  ? 13.759  212.678 -8.704  1.00 19.82 ? 93   ARG A CZ    1 
ATOM   780  N  NH1   . ARG A 1 96  ? 13.977  211.575 -7.948  1.00 20.93 ? 93   ARG A NH1   1 
ATOM   781  N  NH2   . ARG A 1 96  ? 12.525  213.122 -8.893  1.00 18.92 ? 93   ARG A NH2   1 
ATOM   782  N  N     . GLU A 1 97  ? 14.624  220.209 -10.093 1.00 15.12 ? 94   GLU A N     1 
ATOM   783  C  CA    . GLU A 1 97  ? 14.559  221.446 -10.914 1.00 17.13 ? 94   GLU A CA    1 
ATOM   784  C  C     . GLU A 1 97  ? 15.506  222.492 -10.350 1.00 17.00 ? 94   GLU A C     1 
ATOM   785  O  O     . GLU A 1 97  ? 16.185  223.172 -11.136 1.00 14.87 ? 94   GLU A O     1 
ATOM   786  C  CB    . GLU A 1 97  ? 13.130  221.962 -11.019 1.00 21.02 ? 94   GLU A CB    1 
ATOM   787  C  CG    . GLU A 1 97  ? 12.328  220.965 -11.820 1.00 21.58 ? 94   GLU A CG    1 
ATOM   788  C  CD    . GLU A 1 97  ? 10.896  221.381 -12.035 1.00 30.70 ? 94   GLU A CD    1 
ATOM   789  O  OE1   . GLU A 1 97  ? 10.416  222.327 -11.358 1.00 34.52 ? 94   GLU A OE1   1 
ATOM   790  O  OE2   . GLU A 1 97  ? 10.249  220.733 -12.928 1.00 34.82 ? 94   GLU A OE2   1 
ATOM   791  N  N     . ALA A 1 98  ? 15.618  222.561 -9.023  1.00 14.26 ? 95   ALA A N     1 
ATOM   792  C  CA    . ALA A 1 98  ? 16.539  223.537 -8.474  1.00 14.74 ? 95   ALA A CA    1 
ATOM   793  C  C     . ALA A 1 98  ? 17.996  223.119 -8.750  1.00 13.29 ? 95   ALA A C     1 
ATOM   794  O  O     . ALA A 1 98  ? 18.830  224.003 -8.979  1.00 15.52 ? 95   ALA A O     1 
ATOM   795  C  CB    . ALA A 1 98  ? 16.307  223.718 -6.949  1.00 15.66 ? 95   ALA A CB    1 
ATOM   796  N  N     . SER A 1 99  ? 18.266  221.836 -8.719  1.00 14.18 ? 96   SER A N     1 
ATOM   797  C  CA    . SER A 1 99  ? 19.578  221.309 -9.090  1.00 13.14 ? 96   SER A CA    1 
ATOM   798  C  C     . SER A 1 99  ? 19.940  221.731 -10.521 1.00 15.81 ? 96   SER A C     1 
ATOM   799  O  O     . SER A 1 99  ? 21.064  222.193 -10.799 1.00 15.74 ? 96   SER A O     1 
ATOM   800  C  CB    . SER A 1 99  ? 19.551  219.769 -8.956  1.00 15.04 ? 96   SER A CB    1 
ATOM   801  O  OG    . SER A 1 99  ? 20.794  219.217 -9.390  1.00 18.14 ? 96   SER A OG    1 
ATOM   802  N  N     . VAL A 1 100 ? 18.957  221.597 -11.425 1.00 14.03 ? 97   VAL A N     1 
ATOM   803  C  CA    . VAL A 1 100 ? 19.261  222.015 -12.801 1.00 17.73 ? 97   VAL A CA    1 
ATOM   804  C  C     . VAL A 1 100 ? 19.629  223.494 -12.887 1.00 15.90 ? 97   VAL A C     1 
ATOM   805  O  O     . VAL A 1 100 ? 20.551  223.900 -13.647 1.00 16.36 ? 97   VAL A O     1 
ATOM   806  C  CB    . VAL A 1 100 ? 18.054  221.679 -13.718 1.00 19.39 ? 97   VAL A CB    1 
ATOM   807  C  CG1   . VAL A 1 100 ? 18.160  222.448 -15.105 1.00 18.82 ? 97   VAL A CG1   1 
ATOM   808  C  CG2   . VAL A 1 100 ? 17.941  220.175 -13.881 1.00 21.96 ? 97   VAL A CG2   1 
ATOM   809  N  N     . GLU A 1 101 ? 18.996  224.352 -12.082 1.00 15.14 ? 98   GLU A N     1 
ATOM   810  C  CA    . GLU A 1 101 ? 19.385  225.785 -12.093 1.00 14.91 ? 98   GLU A CA    1 
ATOM   811  C  C     . GLU A 1 101 ? 20.861  225.992 -11.793 1.00 15.78 ? 98   GLU A C     1 
ATOM   812  O  O     . GLU A 1 101 ? 21.539  226.813 -12.429 1.00 17.94 ? 98   GLU A O     1 
ATOM   813  C  CB    . GLU A 1 101 ? 18.620  226.623 -11.061 1.00 15.25 ? 98   GLU A CB    1 
ATOM   814  C  CG    . GLU A 1 101 ? 17.052  226.790 -11.301 1.00 17.89 ? 98   GLU A CG    1 
ATOM   815  C  CD    . GLU A 1 101 ? 16.445  227.572 -10.160 1.00 17.80 ? 98   GLU A CD    1 
ATOM   816  O  OE1   . GLU A 1 101 ? 16.788  228.778 -10.006 1.00 17.62 ? 98   GLU A OE1   1 
ATOM   817  O  OE2   . GLU A 1 101 ? 15.618  226.984 -9.413  1.00 19.49 ? 98   GLU A OE2   1 
ATOM   818  N  N     . VAL A 1 102 ? 21.335  225.225 -10.808 1.00 14.03 ? 99   VAL A N     1 
ATOM   819  C  CA    . VAL A 1 102 ? 22.730  225.378 -10.375 1.00 15.19 ? 99   VAL A CA    1 
ATOM   820  C  C     . VAL A 1 102 ? 23.671  224.746 -11.363 1.00 14.33 ? 99   VAL A C     1 
ATOM   821  O  O     . VAL A 1 102 ? 24.717  225.368 -11.673 1.00 16.66 ? 99   VAL A O     1 
ATOM   822  C  CB    . VAL A 1 102 ? 22.991  224.751 -8.947  1.00 13.69 ? 99   VAL A CB    1 
ATOM   823  C  CG1   . VAL A 1 102 ? 24.488  224.760 -8.670  1.00 18.98 ? 99   VAL A CG1   1 
ATOM   824  C  CG2   . VAL A 1 102 ? 22.163  225.492 -7.891  1.00 14.98 ? 99   VAL A CG2   1 
ATOM   825  N  N     . MET A 1 103 ? 23.358  223.527 -11.816 1.00 13.79 ? 100  MET A N     1 
ATOM   826  C  CA    . MET A 1 103 ? 24.265  222.839 -12.742 1.00 15.04 ? 100  MET A CA    1 
ATOM   827  C  C     . MET A 1 103 ? 24.377  223.632 -14.058 1.00 17.20 ? 100  MET A C     1 
ATOM   828  O  O     . MET A 1 103 ? 25.477  223.696 -14.621 1.00 18.22 ? 100  MET A O     1 
ATOM   829  C  CB    . MET A 1 103 ? 23.802  221.426 -13.054 1.00 16.81 ? 100  MET A CB    1 
ATOM   830  C  CG    A MET A 1 103 ? 23.470  220.553 -11.806 0.29 19.05 ? 100  MET A CG    1 
ATOM   831  C  CG    B MET A 1 103 ? 23.528  220.556 -11.880 0.71 19.10 ? 100  MET A CG    1 
ATOM   832  S  SD    A MET A 1 103 ? 24.752  219.419 -11.157 0.29 16.34 ? 100  MET A SD    1 
ATOM   833  S  SD    B MET A 1 103 ? 25.106  220.382 -11.057 0.71 17.62 ? 100  MET A SD    1 
ATOM   834  C  CE    A MET A 1 103 ? 24.160  219.055 -9.513  0.29 17.04 ? 100  MET A CE    1 
ATOM   835  C  CE    B MET A 1 103 ? 24.627  219.515 -9.538  0.71 17.69 ? 100  MET A CE    1 
ATOM   836  N  N     . GLU A 1 104 ? 23.295  224.285 -14.519 1.00 16.16 ? 101  GLU A N     1 
ATOM   837  C  CA    . GLU A 1 104 ? 23.422  225.062 -15.768 1.00 18.95 ? 101  GLU A CA    1 
ATOM   838  C  C     . GLU A 1 104 ? 24.338  226.255 -15.588 1.00 18.43 ? 101  GLU A C     1 
ATOM   839  O  O     . GLU A 1 104 ? 25.122  226.576 -16.510 1.00 18.61 ? 101  GLU A O     1 
ATOM   840  C  CB    . GLU A 1 104 ? 22.017  225.471 -16.284 1.00 19.84 ? 101  GLU A CB    1 
ATOM   841  C  CG    . GLU A 1 104 ? 21.286  224.263 -16.839 1.00 22.52 ? 101  GLU A CG    1 
ATOM   842  C  CD    . GLU A 1 104 ? 19.914  224.590 -17.427 1.00 31.51 ? 101  GLU A CD    1 
ATOM   843  O  OE1   . GLU A 1 104 ? 19.409  225.723 -17.213 1.00 30.79 ? 101  GLU A OE1   1 
ATOM   844  O  OE2   . GLU A 1 104 ? 19.349  223.680 -18.064 1.00 37.74 ? 101  GLU A OE2   1 
ATOM   845  N  N     . ILE A 1 105 ? 24.289  226.921 -14.438 1.00 15.73 ? 102  ILE A N     1 
ATOM   846  C  CA    . ILE A 1 105 ? 25.246  228.029 -14.162 1.00 15.28 ? 102  ILE A CA    1 
ATOM   847  C  C     . ILE A 1 105 ? 26.716  227.502 -14.101 1.00 15.81 ? 102  ILE A C     1 
ATOM   848  O  O     . ILE A 1 105 ? 27.651  228.043 -14.775 1.00 17.79 ? 102  ILE A O     1 
ATOM   849  C  CB    . ILE A 1 105 ? 24.900  228.754 -12.853 1.00 16.75 ? 102  ILE A CB    1 
ATOM   850  C  CG1   . ILE A 1 105 ? 23.503  229.442 -12.967 1.00 15.07 ? 102  ILE A CG1   1 
ATOM   851  C  CG2   . ILE A 1 105 ? 25.978  229.789 -12.479 1.00 17.33 ? 102  ILE A CG2   1 
ATOM   852  C  CD1   . ILE A 1 105 ? 22.932  229.681 -11.557 1.00 15.93 ? 102  ILE A CD1   1 
ATOM   853  N  N     . MET A 1 106 ? 26.955  226.435 -13.374 1.00 16.39 ? 103  MET A N     1 
ATOM   854  C  CA    . MET A 1 106 ? 28.346  225.904 -13.310 1.00 16.02 ? 103  MET A CA    1 
ATOM   855  C  C     . MET A 1 106 ? 28.887  225.568 -14.706 1.00 18.03 ? 103  MET A C     1 
ATOM   856  O  O     . MET A 1 106 ? 30.085  225.776 -14.972 1.00 18.03 ? 103  MET A O     1 
ATOM   857  C  CB    . MET A 1 106 ? 28.367  224.621 -12.407 1.00 16.19 ? 103  MET A CB    1 
ATOM   858  C  CG    . MET A 1 106 ? 28.146  225.015 -10.940 1.00 16.19 ? 103  MET A CG    1 
ATOM   859  S  SD    . MET A 1 106 ? 28.400  223.558 -9.895  1.00 20.50 ? 103  MET A SD    1 
ATOM   860  C  CE    . MET A 1 106 ? 26.838  222.867 -10.125 1.00 29.95 ? 103  MET A CE    1 
ATOM   861  N  N     . SER A 1 107 ? 28.007  225.025 -15.546 1.00 16.11 ? 104  SER A N     1 
ATOM   862  C  CA    . SER A 1 107 ? 28.419  224.590 -16.889 1.00 19.35 ? 104  SER A CA    1 
ATOM   863  C  C     . SER A 1 107 ? 28.897  225.754 -17.755 1.00 20.97 ? 104  SER A C     1 
ATOM   864  O  O     . SER A 1 107 ? 29.511  225.477 -18.779 1.00 23.40 ? 104  SER A O     1 
ATOM   865  C  CB    . SER A 1 107 ? 27.264  223.873 -17.604 1.00 23.10 ? 104  SER A CB    1 
ATOM   866  O  OG    . SER A 1 107 ? 27.020  222.634 -16.975 1.00 27.69 ? 104  SER A OG    1 
ATOM   867  N  N     . ARG A 1 108 ? 28.559  227.007 -17.418 1.00 18.79 ? 105  ARG A N     1 
ATOM   868  C  CA    . ARG A 1 108 ? 29.056  228.163 -18.176 1.00 17.59 ? 105  ARG A CA    1 
ATOM   869  C  C     . ARG A 1 108 ? 30.557  228.297 -17.976 1.00 20.59 ? 105  ARG A C     1 
ATOM   870  O  O     . ARG A 1 108 ? 31.274  228.860 -18.825 1.00 23.13 ? 105  ARG A O     1 
ATOM   871  C  CB    . ARG A 1 108 ? 28.371  229.461 -17.769 1.00 20.58 ? 105  ARG A CB    1 
ATOM   872  C  CG    . ARG A 1 108 ? 26.874  229.438 -17.926 1.00 21.78 ? 105  ARG A CG    1 
ATOM   873  C  CD    . ARG A 1 108 ? 26.351  230.825 -18.060 1.00 27.57 ? 105  ARG A CD    1 
ATOM   874  N  NE    . ARG A 1 108 ? 26.803  231.780 -17.062 1.00 28.96 ? 105  ARG A NE    1 
ATOM   875  C  CZ    . ARG A 1 108 ? 26.020  232.215 -16.071 1.00 25.44 ? 105  ARG A CZ    1 
ATOM   876  N  NH1   . ARG A 1 108 ? 26.469  233.092 -15.203 1.00 27.33 ? 105  ARG A NH1   1 
ATOM   877  N  NH2   . ARG A 1 108 ? 24.785  231.766 -15.975 1.00 23.90 ? 105  ARG A NH2   1 
ATOM   878  N  N     . PHE A 1 109 ? 31.042  227.763 -16.866 1.00 21.57 ? 106  PHE A N     1 
ATOM   879  C  CA    . PHE A 1 109 ? 32.444  227.978 -16.513 1.00 21.47 ? 106  PHE A CA    1 
ATOM   880  C  C     . PHE A 1 109 ? 33.336  226.859 -16.998 1.00 22.69 ? 106  PHE A C     1 
ATOM   881  O  O     . PHE A 1 109 ? 34.516  227.110 -17.342 1.00 25.25 ? 106  PHE A O     1 
ATOM   882  C  CB    . PHE A 1 109 ? 32.614  228.140 -14.997 1.00 18.91 ? 106  PHE A CB    1 
ATOM   883  C  CG    . PHE A 1 109 ? 32.012  229.387 -14.467 1.00 21.97 ? 106  PHE A CG    1 
ATOM   884  C  CD1   . PHE A 1 109 ? 30.661  229.456 -14.235 1.00 19.11 ? 106  PHE A CD1   1 
ATOM   885  C  CD2   . PHE A 1 109 ? 32.789  230.513 -14.196 1.00 18.71 ? 106  PHE A CD2   1 
ATOM   886  C  CE1   . PHE A 1 109 ? 30.084  230.586 -13.726 1.00 19.80 ? 106  PHE A CE1   1 
ATOM   887  C  CE2   . PHE A 1 109 ? 32.208  231.669 -13.702 1.00 20.84 ? 106  PHE A CE2   1 
ATOM   888  C  CZ    . PHE A 1 109 ? 30.845  231.716 -13.489 1.00 19.60 ? 106  PHE A CZ    1 
ATOM   889  N  N     . ALA A 1 110 ? 32.820  225.638 -17.014 1.00 23.94 ? 107  ALA A N     1 
ATOM   890  C  CA    . ALA A 1 110 ? 33.601  224.473 -17.371 1.00 23.42 ? 107  ALA A CA    1 
ATOM   891  C  C     . ALA A 1 110 ? 32.689  223.286 -17.541 1.00 25.79 ? 107  ALA A C     1 
ATOM   892  O  O     . ALA A 1 110 ? 31.544  223.295 -17.128 1.00 25.27 ? 107  ALA A O     1 
ATOM   893  C  CB    . ALA A 1 110 ? 34.679  224.162 -16.277 1.00 22.66 ? 107  ALA A CB    1 
ATOM   894  N  N     . VAL A 1 111 ? 33.182  222.240 -18.166 1.00 25.94 ? 108  VAL A N     1 
ATOM   895  C  CA    . VAL A 1 111 ? 32.338  221.086 -18.350 1.00 29.89 ? 108  VAL A CA    1 
ATOM   896  C  C     . VAL A 1 111 ? 32.198  220.412 -16.952 1.00 27.16 ? 108  VAL A C     1 
ATOM   897  O  O     . VAL A 1 111 ? 33.184  220.287 -16.247 1.00 26.97 ? 108  VAL A O     1 
ATOM   898  C  CB    . VAL A 1 111 ? 32.916  220.138 -19.405 1.00 35.78 ? 108  VAL A CB    1 
ATOM   899  C  CG1   . VAL A 1 111 ? 32.134  218.840 -19.393 1.00 31.30 ? 108  VAL A CG1   1 
ATOM   900  C  CG2   . VAL A 1 111 ? 32.836  220.810 -20.795 1.00 34.33 ? 108  VAL A CG2   1 
ATOM   901  N  N     . ILE A 1 112 ? 30.967  220.073 -16.540 1.00 25.56 ? 109  ILE A N     1 
ATOM   902  C  CA    . ILE A 1 112 ? 30.848  219.482 -15.190 1.00 25.52 ? 109  ILE A CA    1 
ATOM   903  C  C     . ILE A 1 112 ? 30.612  218.011 -15.148 1.00 18.36 ? 109  ILE A C     1 
ATOM   904  O  O     . ILE A 1 112 ? 30.207  217.420 -16.130 1.00 20.09 ? 109  ILE A O     1 
ATOM   905  C  CB    . ILE A 1 112 ? 29.713  220.187 -14.379 1.00 20.73 ? 109  ILE A CB    1 
ATOM   906  C  CG1   . ILE A 1 112 ? 28.333  219.775 -14.853 1.00 26.83 ? 109  ILE A CG1   1 
ATOM   907  C  CG2   . ILE A 1 112 ? 29.978  221.703 -14.402 1.00 28.12 ? 109  ILE A CG2   1 
ATOM   908  C  CD1   . ILE A 1 112 ? 27.239  220.559 -14.104 1.00 24.46 ? 109  ILE A CD1   1 
ATOM   909  N  N     . GLU A 1 113 ? 30.929  217.400 -14.019 1.00 14.29 ? 110  GLU A N     1 
ATOM   910  C  CA    . GLU A 1 113 ? 30.453  216.066 -13.668 1.00 14.63 ? 110  GLU A CA    1 
ATOM   911  C  C     . GLU A 1 113 ? 29.448  216.145 -12.545 1.00 17.70 ? 110  GLU A C     1 
ATOM   912  O  O     . GLU A 1 113 ? 29.800  216.511 -11.435 1.00 17.05 ? 110  GLU A O     1 
ATOM   913  C  CB    . GLU A 1 113 ? 31.610  215.136 -13.216 1.00 18.23 ? 110  GLU A CB    1 
ATOM   914  C  CG    . GLU A 1 113 ? 31.074  213.727 -12.960 1.00 16.89 ? 110  GLU A CG    1 
ATOM   915  C  CD    . GLU A 1 113 ? 32.157  212.758 -12.472 1.00 23.27 ? 110  GLU A CD    1 
ATOM   916  O  OE1   . GLU A 1 113 ? 31.813  211.800 -11.767 1.00 26.57 ? 110  GLU A OE1   1 
ATOM   917  O  OE2   . GLU A 1 113 ? 33.336  212.985 -12.766 1.00 21.34 ? 110  GLU A OE2   1 
ATOM   918  N  N     . ARG A 1 114 ? 28.174  215.866 -12.837 1.00 17.65 ? 111  ARG A N     1 
ATOM   919  C  CA    . ARG A 1 114 ? 27.129  215.901 -11.829 1.00 16.63 ? 111  ARG A CA    1 
ATOM   920  C  C     . ARG A 1 114 ? 27.331  214.728 -10.927 1.00 17.86 ? 111  ARG A C     1 
ATOM   921  O  O     . ARG A 1 114 ? 27.166  213.565 -11.359 1.00 25.19 ? 111  ARG A O     1 
ATOM   922  C  CB    . ARG A 1 114 ? 25.744  215.817 -12.498 1.00 18.15 ? 111  ARG A CB    1 
ATOM   923  C  CG    . ARG A 1 114 ? 24.568  215.813 -11.457 1.00 20.47 ? 111  ARG A CG    1 
ATOM   924  C  CD    . ARG A 1 114 ? 23.299  215.171 -12.105 1.00 21.10 ? 111  ARG A CD    1 
ATOM   925  N  NE    . ARG A 1 114 ? 22.067  215.415 -11.357 1.00 23.36 ? 111  ARG A NE    1 
ATOM   926  C  CZ    . ARG A 1 114 ? 21.554  214.613 -10.411 1.00 26.54 ? 111  ARG A CZ    1 
ATOM   927  N  NH1   . ARG A 1 114 ? 22.160  213.476 -10.031 1.00 29.01 ? 111  ARG A NH1   1 
ATOM   928  N  NH2   . ARG A 1 114 ? 20.417  214.981 -9.818  1.00 26.29 ? 111  ARG A NH2   1 
ATOM   929  N  N     . ALA A 1 115 ? 27.623  214.963 -9.661  1.00 14.89 ? 112  ALA A N     1 
ATOM   930  C  CA    . ALA A 1 115 ? 27.952  213.885 -8.777  1.00 16.61 ? 112  ALA A CA    1 
ATOM   931  C  C     . ALA A 1 115 ? 26.810  213.519 -7.825  1.00 16.03 ? 112  ALA A C     1 
ATOM   932  O  O     . ALA A 1 115 ? 26.812  212.435 -7.200  1.00 18.95 ? 112  ALA A O     1 
ATOM   933  C  CB    . ALA A 1 115 ? 29.226  214.230 -8.010  1.00 18.34 ? 112  ALA A CB    1 
ATOM   934  N  N     . SER A 1 116 ? 25.886  214.461 -7.677  1.00 16.49 ? 113  SER A N     1 
ATOM   935  C  CA    . SER A 1 116 ? 24.685  214.199 -6.895  1.00 15.37 ? 113  SER A CA    1 
ATOM   936  C  C     . SER A 1 116 ? 23.670  215.283 -7.261  1.00 14.01 ? 113  SER A C     1 
ATOM   937  O  O     . SER A 1 116 ? 23.950  216.168 -8.043  1.00 15.86 ? 113  SER A O     1 
ATOM   938  C  CB    . SER A 1 116 ? 24.945  214.262 -5.389  1.00 17.54 ? 113  SER A CB    1 
ATOM   939  O  OG    . SER A 1 116 ? 25.051  215.626 -4.904  1.00 16.44 ? 113  SER A OG    1 
ATOM   940  N  N     . ILE A 1 117 ? 22.521  215.281 -6.567  1.00 15.27 ? 114  ILE A N     1 
ATOM   941  C  CA    . ILE A 1 117 ? 21.546  216.348 -6.844  1.00 15.51 ? 114  ILE A CA    1 
ATOM   942  C  C     . ILE A 1 117 ? 22.086  217.765 -6.477  1.00 12.08 ? 114  ILE A C     1 
ATOM   943  O  O     . ILE A 1 117 ? 21.598  218.772 -6.997  1.00 15.36 ? 114  ILE A O     1 
ATOM   944  C  CB    . ILE A 1 117 ? 20.224  216.052 -6.097  1.00 15.20 ? 114  ILE A CB    1 
ATOM   945  C  CG1   . ILE A 1 117 ? 19.082  216.851 -6.692  1.00 15.90 ? 114  ILE A CG1   1 
ATOM   946  C  CG2   . ILE A 1 117 ? 20.371  216.311 -4.581  1.00 15.33 ? 114  ILE A CG2   1 
ATOM   947  C  CD1   . ILE A 1 117 ? 17.717  216.302 -6.190  1.00 16.89 ? 114  ILE A CD1   1 
ATOM   948  N  N     . ASP A 1 118 ? 23.097  217.799 -5.587  1.00 14.59 ? 115  ASP A N     1 
ATOM   949  C  CA    . ASP A 1 118 ? 23.540  219.111 -5.144  1.00 14.14 ? 115  ASP A CA    1 
ATOM   950  C  C     . ASP A 1 118 ? 25.039  219.326 -5.256  1.00 14.52 ? 115  ASP A C     1 
ATOM   951  O  O     . ASP A 1 118 ? 25.552  220.275 -4.668  1.00 14.26 ? 115  ASP A O     1 
ATOM   952  C  CB    . ASP A 1 118 ? 23.057  219.398 -3.699  1.00 13.61 ? 115  ASP A CB    1 
ATOM   953  C  CG    . ASP A 1 118 ? 24.069  218.939 -2.625  1.00 14.87 ? 115  ASP A CG    1 
ATOM   954  O  OD1   . ASP A 1 118 ? 24.708  217.847 -2.763  1.00 16.61 ? 115  ASP A OD1   1 
ATOM   955  O  OD2   . ASP A 1 118 ? 24.297  219.768 -1.701  1.00 14.05 ? 115  ASP A OD2   1 
ATOM   956  N  N     . GLU A 1 119 ? 25.727  218.507 -6.054  1.00 14.03 ? 116  GLU A N     1 
ATOM   957  C  CA    . GLU A 1 119 ? 27.159  218.790 -6.235  1.00 15.43 ? 116  GLU A CA    1 
ATOM   958  C  C     . GLU A 1 119 ? 27.690  218.362 -7.551  1.00 13.27 ? 116  GLU A C     1 
ATOM   959  O  O     . GLU A 1 119 ? 27.119  217.470 -8.223  1.00 15.68 ? 116  GLU A O     1 
ATOM   960  C  CB    . GLU A 1 119 ? 27.997  218.173 -5.168  1.00 16.56 ? 116  GLU A CB    1 
ATOM   961  C  CG    . GLU A 1 119 ? 28.085  216.698 -5.204  1.00 14.19 ? 116  GLU A CG    1 
ATOM   962  C  CD    . GLU A 1 119 ? 28.225  216.134 -3.799  1.00 23.84 ? 116  GLU A CD    1 
ATOM   963  O  OE1   . GLU A 1 119 ? 27.214  216.060 -3.075  1.00 21.16 ? 116  GLU A OE1   1 
ATOM   964  O  OE2   . GLU A 1 119 ? 29.348  215.771 -3.375  1.00 23.04 ? 116  GLU A OE2   1 
ATOM   965  N  N     . ALA A 1 120 ? 28.759  219.054 -7.950  1.00 14.37 ? 117  ALA A N     1 
ATOM   966  C  CA    . ALA A 1 120 ? 29.394  218.722 -9.216  1.00 12.01 ? 117  ALA A CA    1 
ATOM   967  C  C     . ALA A 1 120 ? 30.879  218.991 -9.109  1.00 13.44 ? 117  ALA A C     1 
ATOM   968  O  O     . ALA A 1 120 ? 31.277  219.930 -8.423  1.00 14.32 ? 117  ALA A O     1 
ATOM   969  C  CB    . ALA A 1 120 ? 28.796  219.521 -10.347 1.00 17.51 ? 117  ALA A CB    1 
ATOM   970  N  N     . TYR A 1 121 ? 31.644  218.156 -9.832  1.00 14.30 ? 118  TYR A N     1 
ATOM   971  C  CA    . TYR A 1 121 ? 33.083  218.384 -10.007 1.00 14.04 ? 118  TYR A CA    1 
ATOM   972  C  C     . TYR A 1 121 ? 33.285  219.184 -11.231 1.00 16.28 ? 118  TYR A C     1 
ATOM   973  O  O     . TYR A 1 121 ? 32.552  219.000 -12.171 1.00 16.83 ? 118  TYR A O     1 
ATOM   974  C  CB    . TYR A 1 121 ? 33.828  217.037 -10.112 1.00 13.94 ? 118  TYR A CB    1 
ATOM   975  C  CG    . TYR A 1 121 ? 33.788  216.269 -8.844  1.00 13.46 ? 118  TYR A CG    1 
ATOM   976  C  CD1   . TYR A 1 121 ? 32.840  215.293 -8.633  1.00 14.85 ? 118  TYR A CD1   1 
ATOM   977  C  CD2   . TYR A 1 121 ? 34.717  216.542 -7.834  1.00 16.23 ? 118  TYR A CD2   1 
ATOM   978  C  CE1   . TYR A 1 121 ? 32.762  214.577 -7.442  1.00 20.23 ? 118  TYR A CE1   1 
ATOM   979  C  CE2   . TYR A 1 121 ? 34.697  215.808 -6.644  1.00 15.88 ? 118  TYR A CE2   1 
ATOM   980  C  CZ    . TYR A 1 121 ? 33.693  214.838 -6.444  1.00 19.99 ? 118  TYR A CZ    1 
ATOM   981  O  OH    . TYR A 1 121 ? 33.611  214.132 -5.278  1.00 18.34 ? 118  TYR A OH    1 
ATOM   982  N  N     . VAL A 1 122 ? 34.347  219.992 -11.222 1.00 14.43 ? 119  VAL A N     1 
ATOM   983  C  CA    . VAL A 1 122 ? 34.736  220.906 -12.300 1.00 17.65 ? 119  VAL A CA    1 
ATOM   984  C  C     . VAL A 1 122 ? 36.215  220.663 -12.601 1.00 20.65 ? 119  VAL A C     1 
ATOM   985  O  O     . VAL A 1 122 ? 36.983  220.654 -11.654 1.00 17.72 ? 119  VAL A O     1 
ATOM   986  C  CB    . VAL A 1 122 ? 34.532  222.401 -11.823 1.00 20.41 ? 119  VAL A CB    1 
ATOM   987  C  CG1   . VAL A 1 122 ? 34.378  223.228 -12.996 1.00 28.32 ? 119  VAL A CG1   1 
ATOM   988  C  CG2   . VAL A 1 122 ? 33.239  222.502 -10.855 1.00 28.64 ? 119  VAL A CG2   1 
ATOM   989  N  N     . ASP A 1 123 ? 36.647  220.473 -13.866 1.00 20.76 ? 120  ASP A N     1 
ATOM   990  C  CA    . ASP A 1 123 ? 38.102  220.434 -14.163 1.00 19.15 ? 120  ASP A CA    1 
ATOM   991  C  C     . ASP A 1 123 ? 38.408  221.786 -14.744 1.00 20.30 ? 120  ASP A C     1 
ATOM   992  O  O     . ASP A 1 123 ? 37.961  222.119 -15.839 1.00 21.34 ? 120  ASP A O     1 
ATOM   993  C  CB    . ASP A 1 123 ? 38.540  219.294 -15.128 1.00 22.36 ? 120  ASP A CB    1 
ATOM   994  C  CG    . ASP A 1 123 ? 40.073  219.257 -15.310 1.00 24.81 ? 120  ASP A CG    1 
ATOM   995  O  OD1   . ASP A 1 123 ? 40.632  220.319 -15.499 1.00 24.97 ? 120  ASP A OD1   1 
ATOM   996  O  OD2   . ASP A 1 123 ? 40.750  218.181 -15.218 1.00 28.53 ? 120  ASP A OD2   1 
ATOM   997  N  N     . LEU A 1 124 ? 39.088  222.598 -13.940 1.00 16.37 ? 121  LEU A N     1 
ATOM   998  C  CA    . LEU A 1 124 ? 39.420  223.963 -14.249 1.00 15.39 ? 121  LEU A CA    1 
ATOM   999  C  C     . LEU A 1 124 ? 40.819  224.141 -14.837 1.00 17.08 ? 121  LEU A C     1 
ATOM   1000 O  O     . LEU A 1 124 ? 41.235  225.288 -14.968 1.00 17.17 ? 121  LEU A O     1 
ATOM   1001 C  CB    . LEU A 1 124 ? 39.285  224.803 -12.988 1.00 18.27 ? 121  LEU A CB    1 
ATOM   1002 C  CG    . LEU A 1 124 ? 37.884  224.865 -12.374 1.00 17.82 ? 121  LEU A CG    1 
ATOM   1003 C  CD1   . LEU A 1 124 ? 37.904  225.516 -11.068 1.00 22.57 ? 121  LEU A CD1   1 
ATOM   1004 C  CD2   . LEU A 1 124 ? 37.020  225.654 -13.389 1.00 21.26 ? 121  LEU A CD2   1 
ATOM   1005 N  N     . THR A 1 125 ? 41.490  223.044 -15.145 1.00 18.86 ? 122  THR A N     1 
ATOM   1006 C  CA    . THR A 1 125 ? 42.860  223.125 -15.656 1.00 18.32 ? 122  THR A CA    1 
ATOM   1007 C  C     . THR A 1 125 ? 42.952  224.089 -16.866 1.00 20.47 ? 122  THR A C     1 
ATOM   1008 O  O     . THR A 1 125 ? 43.783  224.970 -16.854 1.00 21.98 ? 122  THR A O     1 
ATOM   1009 C  CB    . THR A 1 125 ? 43.348  221.770 -16.059 1.00 22.33 ? 122  THR A CB    1 
ATOM   1010 O  OG1   . THR A 1 125 ? 43.071  220.835 -15.011 1.00 20.75 ? 122  THR A OG1   1 
ATOM   1011 C  CG2   . THR A 1 125 ? 44.872  221.795 -16.359 1.00 22.15 ? 122  THR A CG2   1 
ATOM   1012 N  N     . SER A 1 126 ? 42.034  223.966 -17.836 1.00 21.36 ? 123  SER A N     1 
ATOM   1013 C  CA    . SER A 1 126 ? 42.083  224.839 -19.018 1.00 24.10 ? 123  SER A CA    1 
ATOM   1014 C  C     . SER A 1 126 ? 41.662  226.270 -18.726 1.00 24.95 ? 123  SER A C     1 
ATOM   1015 O  O     . SER A 1 126 ? 42.334  227.195 -19.162 1.00 24.69 ? 123  SER A O     1 
ATOM   1016 C  CB    . SER A 1 126 ? 41.218  224.277 -20.131 1.00 24.01 ? 123  SER A CB    1 
ATOM   1017 O  OG    A SER A 1 126 ? 41.781  223.109 -20.672 0.74 29.68 ? 123  SER A OG    1 
ATOM   1018 O  OG    B SER A 1 126 ? 39.870  224.100 -19.726 0.26 24.73 ? 123  SER A OG    1 
ATOM   1019 N  N     . ALA A 1 127 ? 40.607  226.478 -17.936 1.00 20.03 ? 124  ALA A N     1 
ATOM   1020 C  CA    . ALA A 1 127 ? 40.235  227.829 -17.563 1.00 22.02 ? 124  ALA A CA    1 
ATOM   1021 C  C     . ALA A 1 127 ? 41.345  228.563 -16.812 1.00 21.37 ? 124  ALA A C     1 
ATOM   1022 O  O     . ALA A 1 127 ? 41.512  229.775 -16.936 1.00 24.59 ? 124  ALA A O     1 
ATOM   1023 C  CB    . ALA A 1 127 ? 38.944  227.815 -16.701 1.00 22.45 ? 124  ALA A CB    1 
ATOM   1024 N  N     . VAL A 1 128 ? 42.092  227.801 -15.987 1.00 21.78 ? 125  VAL A N     1 
ATOM   1025 C  CA    . VAL A 1 128 ? 43.169  228.379 -15.232 1.00 20.99 ? 125  VAL A CA    1 
ATOM   1026 C  C     . VAL A 1 128 ? 44.319  228.810 -16.167 1.00 23.41 ? 125  VAL A C     1 
ATOM   1027 O  O     . VAL A 1 128 ? 44.874  229.882 -15.973 1.00 24.22 ? 125  VAL A O     1 
ATOM   1028 C  CB    . VAL A 1 128 ? 43.719  227.359 -14.171 1.00 20.10 ? 125  VAL A CB    1 
ATOM   1029 C  CG1   . VAL A 1 128 ? 45.159  227.735 -13.728 1.00 20.33 ? 125  VAL A CG1   1 
ATOM   1030 C  CG2   . VAL A 1 128 ? 42.773  227.349 -12.970 1.00 19.79 ? 125  VAL A CG2   1 
ATOM   1031 N  N     . GLN A 1 129 ? 44.627  227.958 -17.138 1.00 21.85 ? 126  GLN A N     1 
ATOM   1032 C  CA    . GLN A 1 129 ? 45.666  228.292 -18.128 1.00 29.54 ? 126  GLN A CA    1 
ATOM   1033 C  C     . GLN A 1 129 ? 45.321  229.594 -18.814 1.00 31.74 ? 126  GLN A C     1 
ATOM   1034 O  O     . GLN A 1 129 ? 46.145  230.511 -18.923 1.00 31.25 ? 126  GLN A O     1 
ATOM   1035 C  CB    . GLN A 1 129 ? 45.811  227.199 -19.166 1.00 28.28 ? 126  GLN A CB    1 
ATOM   1036 C  CG    . GLN A 1 129 ? 46.416  225.897 -18.658 1.00 29.17 ? 126  GLN A CG    1 
ATOM   1037 C  CD    . GLN A 1 129 ? 47.774  226.118 -18.027 1.00 41.16 ? 126  GLN A CD    1 
ATOM   1038 O  OE1   . GLN A 1 129 ? 47.983  225.845 -16.837 1.00 47.81 ? 126  GLN A OE1   1 
ATOM   1039 N  NE2   . GLN A 1 129 ? 48.711  226.640 -18.816 1.00 51.10 ? 126  GLN A NE2   1 
ATOM   1040 N  N     . GLU A 1 130 ? 44.077  229.702 -19.253 1.00 28.12 ? 127  GLU A N     1 
ATOM   1041 C  CA    . GLU A 1 130 ? 43.681  230.935 -19.929 1.00 32.86 ? 127  GLU A CA    1 
ATOM   1042 C  C     . GLU A 1 130 ? 43.670  232.171 -18.995 1.00 35.16 ? 127  GLU A C     1 
ATOM   1043 O  O     . GLU A 1 130 ? 44.133  233.231 -19.421 1.00 38.80 ? 127  GLU A O     1 
ATOM   1044 C  CB    . GLU A 1 130 ? 42.327  230.744 -20.637 1.00 34.92 ? 127  GLU A CB    1 
ATOM   1045 C  CG    . GLU A 1 130 ? 42.165  229.347 -21.184 1.00 38.78 ? 127  GLU A CG    1 
ATOM   1046 C  CD    . GLU A 1 130 ? 41.542  229.286 -22.578 1.00 60.16 ? 127  GLU A CD    1 
ATOM   1047 O  OE1   . GLU A 1 130 ? 42.315  229.079 -23.548 1.00 62.70 ? 127  GLU A OE1   1 
ATOM   1048 O  OE2   . GLU A 1 130 ? 40.299  229.455 -22.712 1.00 60.46 ? 127  GLU A OE2   1 
ATOM   1049 N  N     . ARG A 1 131 ? 43.201  232.059 -17.742 1.00 28.66 ? 128  ARG A N     1 
ATOM   1050 C  CA    . ARG A 1 131 ? 43.210  233.216 -16.854 1.00 31.85 ? 128  ARG A CA    1 
ATOM   1051 C  C     . ARG A 1 131 ? 44.657  233.631 -16.537 1.00 35.29 ? 128  ARG A C     1 
ATOM   1052 O  O     . ARG A 1 131 ? 44.938  234.819 -16.413 1.00 38.64 ? 128  ARG A O     1 
ATOM   1053 C  CB    . ARG A 1 131 ? 42.416  232.950 -15.552 1.00 27.51 ? 128  ARG A CB    1 
ATOM   1054 C  CG    . ARG A 1 131 ? 42.315  234.098 -14.519 1.00 31.55 ? 128  ARG A CG    1 
ATOM   1055 C  CD    . ARG A 1 131 ? 41.519  235.316 -15.040 1.00 30.85 ? 128  ARG A CD    1 
ATOM   1056 N  NE    . ARG A 1 131 ? 40.157  234.885 -15.252 1.00 33.83 ? 128  ARG A NE    1 
ATOM   1057 C  CZ    . ARG A 1 131 ? 39.250  234.865 -14.272 1.00 31.65 ? 128  ARG A CZ    1 
ATOM   1058 N  NH1   . ARG A 1 131 ? 38.021  234.424 -14.492 1.00 36.87 ? 128  ARG A NH1   1 
ATOM   1059 N  NH2   . ARG A 1 131 ? 39.577  235.328 -13.090 1.00 27.29 ? 128  ARG A NH2   1 
ATOM   1060 N  N     . LEU A 1 132 ? 45.561  232.656 -16.405 1.00 31.43 ? 129  LEU A N     1 
ATOM   1061 C  CA    . LEU A 1 132 ? 46.988  232.950 -16.143 1.00 31.18 ? 129  LEU A CA    1 
ATOM   1062 C  C     . LEU A 1 132 ? 47.610  233.807 -17.237 1.00 44.77 ? 129  LEU A C     1 
ATOM   1063 O  O     . LEU A 1 132 ? 48.412  234.691 -16.954 1.00 44.20 ? 129  LEU A O     1 
ATOM   1064 C  CB    . LEU A 1 132 ? 47.815  231.668 -15.989 1.00 32.47 ? 129  LEU A CB    1 
ATOM   1065 C  CG    . LEU A 1 132 ? 47.795  231.085 -14.559 1.00 29.31 ? 129  LEU A CG    1 
ATOM   1066 C  CD1   . LEU A 1 132 ? 48.384  229.651 -14.391 1.00 27.63 ? 129  LEU A CD1   1 
ATOM   1067 C  CD2   . LEU A 1 132 ? 48.442  232.056 -13.557 1.00 28.13 ? 129  LEU A CD2   1 
ATOM   1068 N  N     . GLN A 1 133 ? 47.252  233.532 -18.486 1.00 43.29 ? 130  GLN A N     1 
ATOM   1069 C  CA    . GLN A 1 133 ? 47.803  234.338 -19.583 1.00 46.75 ? 130  GLN A CA    1 
ATOM   1070 C  C     . GLN A 1 133 ? 47.199  235.735 -19.630 1.00 50.34 ? 130  GLN A C     1 
ATOM   1071 O  O     . GLN A 1 133 ? 47.915  236.713 -19.824 1.00 56.37 ? 130  GLN A O     1 
ATOM   1072 C  CB    . GLN A 1 133 ? 47.645  233.619 -20.916 1.00 46.75 ? 130  GLN A CB    1 
ATOM   1073 C  CG    . GLN A 1 133 ? 48.145  232.187 -20.850 1.00 49.18 ? 130  GLN A CG    1 
ATOM   1074 C  CD    . GLN A 1 133 ? 49.642  232.095 -21.203 1.00 60.85 ? 130  GLN A CD    1 
ATOM   1075 O  OE1   . GLN A 1 133 ? 50.295  233.125 -21.422 1.00 63.89 ? 130  GLN A OE1   1 
ATOM   1076 N  NE2   . GLN A 1 133 ? 50.193  230.875 -21.224 1.00 58.41 ? 130  GLN A NE2   1 
ATOM   1077 N  N     . LYS A 1 134 ? 45.901  235.845 -19.387 1.00 47.75 ? 131  LYS A N     1 
ATOM   1078 C  CA    . LYS A 1 134 ? 45.270  237.155 -19.320 1.00 53.63 ? 131  LYS A CA    1 
ATOM   1079 C  C     . LYS A 1 134 ? 45.846  237.986 -18.161 1.00 56.35 ? 131  LYS A C     1 
ATOM   1080 O  O     . LYS A 1 134 ? 45.831  239.214 -18.188 1.00 58.54 ? 131  LYS A O     1 
ATOM   1081 C  CB    . LYS A 1 134 ? 43.752  237.011 -19.171 1.00 51.25 ? 131  LYS A CB    1 
ATOM   1082 C  CG    . LYS A 1 134 ? 42.997  238.336 -19.147 1.00 58.10 ? 131  LYS A CG    1 
ATOM   1083 C  CD    . LYS A 1 134 ? 41.512  238.118 -18.973 1.00 55.32 ? 131  LYS A CD    1 
ATOM   1084 C  CE    . LYS A 1 134 ? 41.168  237.831 -17.514 1.00 51.52 ? 131  LYS A CE    1 
ATOM   1085 N  NZ    . LYS A 1 134 ? 39.714  237.611 -17.311 1.00 48.60 ? 131  LYS A NZ    1 
ATOM   1086 N  N     . LEU A 1 135 ? 46.362  237.297 -17.151 1.00 55.37 ? 132  LEU A N     1 
ATOM   1087 C  CA    . LEU A 1 135 ? 46.833  237.941 -15.936 1.00 57.33 ? 132  LEU A CA    1 
ATOM   1088 C  C     . LEU A 1 135 ? 48.237  238.515 -16.069 1.00 63.12 ? 132  LEU A C     1 
ATOM   1089 O  O     . LEU A 1 135 ? 48.826  238.909 -15.064 1.00 68.77 ? 132  LEU A O     1 
ATOM   1090 C  CB    . LEU A 1 135 ? 46.801  236.955 -14.760 1.00 55.70 ? 132  LEU A CB    1 
ATOM   1091 C  CG    . LEU A 1 135 ? 45.600  237.050 -13.805 1.00 55.38 ? 132  LEU A CG    1 
ATOM   1092 C  CD1   . LEU A 1 135 ? 45.862  236.233 -12.555 1.00 50.32 ? 132  LEU A CD1   1 
ATOM   1093 C  CD2   . LEU A 1 135 ? 45.299  238.503 -13.461 1.00 60.02 ? 132  LEU A CD2   1 
ATOM   1094 N  N     . GLN A 1 136 ? 48.783  238.542 -17.285 1.00 64.40 ? 133  GLN A N     1 
ATOM   1095 C  CA    . GLN A 1 136 ? 50.080  239.190 -17.524 1.00 68.15 ? 133  GLN A CA    1 
ATOM   1096 C  C     . GLN A 1 136 ? 51.197  238.503 -16.725 1.00 70.31 ? 133  GLN A C     1 
ATOM   1097 O  O     . GLN A 1 136 ? 52.056  237.822 -17.293 1.00 73.00 ? 133  GLN A O     1 
ATOM   1098 C  CB    . GLN A 1 136 ? 49.985  240.691 -17.182 1.00 68.92 ? 133  GLN A CB    1 
ATOM   1099 C  CG    . GLN A 1 136 ? 51.305  241.461 -17.055 1.00 75.06 ? 133  GLN A CG    1 
ATOM   1100 C  CD    . GLN A 1 136 ? 51.104  242.985 -17.038 1.00 76.55 ? 133  GLN A CD    1 
ATOM   1101 O  OE1   . GLN A 1 136 ? 51.526  243.690 -17.960 1.00 74.35 ? 133  GLN A OE1   1 
ATOM   1102 N  NE2   . GLN A 1 136 ? 50.434  243.488 -16.001 1.00 73.13 ? 133  GLN A NE2   1 
ATOM   1103 N  N     . GLY A 1 137 ? 51.173  238.675 -15.407 1.00 66.91 ? 134  GLY A N     1 
ATOM   1104 C  CA    . GLY A 1 137 ? 52.156  238.073 -14.522 1.00 61.90 ? 134  GLY A CA    1 
ATOM   1105 C  C     . GLY A 1 137 ? 51.994  238.766 -13.189 1.00 62.72 ? 134  GLY A C     1 
ATOM   1106 O  O     . GLY A 1 137 ? 52.838  238.648 -12.292 1.00 59.71 ? 134  GLY A O     1 
ATOM   1107 N  N     . GLN A 1 138 ? 50.877  239.486 -13.078 1.00 60.42 ? 135  GLN A N     1 
ATOM   1108 C  CA    . GLN A 1 138 ? 50.549  240.322 -11.926 1.00 58.32 ? 135  GLN A CA    1 
ATOM   1109 C  C     . GLN A 1 138 ? 49.998  239.526 -10.735 1.00 53.59 ? 135  GLN A C     1 
ATOM   1110 O  O     . GLN A 1 138 ? 49.344  238.490 -10.908 1.00 53.34 ? 135  GLN A O     1 
ATOM   1111 C  CB    . GLN A 1 138 ? 49.528  241.383 -12.338 1.00 59.93 ? 135  GLN A CB    1 
ATOM   1112 C  CG    . GLN A 1 138 ? 48.194  240.792 -12.748 1.00 63.32 ? 135  GLN A CG    1 
ATOM   1113 C  CD    . GLN A 1 138 ? 47.243  241.818 -13.332 1.00 68.73 ? 135  GLN A CD    1 
ATOM   1114 O  OE1   . GLN A 1 138 ? 47.016  242.877 -12.748 1.00 71.14 ? 135  GLN A OE1   1 
ATOM   1115 N  NE2   . GLN A 1 138 ? 46.679  241.503 -14.492 1.00 69.81 ? 135  GLN A NE2   1 
ATOM   1116 N  N     . PRO A 1 139 ? 50.262  240.022 -9.521  1.00 50.39 ? 136  PRO A N     1 
ATOM   1117 C  CA    . PRO A 1 139 ? 49.866  239.380 -8.271  1.00 46.64 ? 136  PRO A CA    1 
ATOM   1118 C  C     . PRO A 1 139 ? 48.368  239.168 -8.114  1.00 40.14 ? 136  PRO A C     1 
ATOM   1119 O  O     . PRO A 1 139 ? 47.514  239.887 -8.643  1.00 44.33 ? 136  PRO A O     1 
ATOM   1120 C  CB    . PRO A 1 139 ? 50.379  240.353 -7.198  1.00 46.28 ? 136  PRO A CB    1 
ATOM   1121 C  CG    . PRO A 1 139 ? 50.645  241.613 -7.906  1.00 51.51 ? 136  PRO A CG    1 
ATOM   1122 C  CD    . PRO A 1 139 ? 51.094  241.206 -9.265  1.00 53.06 ? 136  PRO A CD    1 
ATOM   1123 N  N     . ILE A 1 140 ? 48.068  238.129 -7.360  1.00 40.52 ? 137  ILE A N     1 
ATOM   1124 C  CA    . ILE A 1 140 ? 46.704  237.841 -6.999  1.00 30.09 ? 137  ILE A CA    1 
ATOM   1125 C  C     . ILE A 1 140 ? 46.403  238.491 -5.677  1.00 26.61 ? 137  ILE A C     1 
ATOM   1126 O  O     . ILE A 1 140 ? 47.010  238.186 -4.658  1.00 29.81 ? 137  ILE A O     1 
ATOM   1127 C  CB    . ILE A 1 140 ? 46.460  236.332 -6.943  1.00 29.44 ? 137  ILE A CB    1 
ATOM   1128 C  CG1   . ILE A 1 140 ? 46.866  235.730 -8.288  1.00 31.46 ? 137  ILE A CG1   1 
ATOM   1129 C  CG2   . ILE A 1 140 ? 45.008  236.068 -6.520  1.00 25.04 ? 137  ILE A CG2   1 
ATOM   1130 C  CD1   . ILE A 1 140 ? 46.911  234.204 -8.362  1.00 31.15 ? 137  ILE A CD1   1 
ATOM   1131 N  N     . SER A 1 141 ? 45.455  239.407 -5.707  1.00 25.38 ? 138  SER A N     1 
ATOM   1132 C  CA    . SER A 1 141 ? 45.031  240.133 -4.521  1.00 26.09 ? 138  SER A CA    1 
ATOM   1133 C  C     . SER A 1 141 ? 44.195  239.258 -3.566  1.00 26.91 ? 138  SER A C     1 
ATOM   1134 O  O     . SER A 1 141 ? 43.364  238.466 -4.057  1.00 26.39 ? 138  SER A O     1 
ATOM   1135 C  CB    . SER A 1 141 ? 44.216  241.356 -4.978  1.00 29.17 ? 138  SER A CB    1 
ATOM   1136 O  OG    . SER A 1 141 ? 43.631  242.022 -3.903  1.00 29.84 ? 138  SER A OG    1 
ATOM   1137 N  N     . ALA A 1 142 ? 44.332  239.433 -2.247  1.00 22.80 ? 139  ALA A N     1 
ATOM   1138 C  CA    . ALA A 1 142 ? 43.430  238.751 -1.309  1.00 23.72 ? 139  ALA A CA    1 
ATOM   1139 C  C     . ALA A 1 142 ? 41.961  239.107 -1.594  1.00 25.64 ? 139  ALA A C     1 
ATOM   1140 O  O     . ALA A 1 142 ? 41.058  238.348 -1.287  1.00 24.15 ? 139  ALA A O     1 
ATOM   1141 C  CB    . ALA A 1 142 ? 43.747  239.075 0.152   1.00 22.87 ? 139  ALA A CB    1 
ATOM   1142 N  N     . ASP A 1 143 ? 41.743  240.262 -2.212  1.00 22.26 ? 140  ASP A N     1 
ATOM   1143 C  CA    . ASP A 1 143 ? 40.379  240.693 -2.472  1.00 23.99 ? 140  ASP A CA    1 
ATOM   1144 C  C     . ASP A 1 143 ? 39.680  239.829 -3.492  1.00 23.98 ? 140  ASP A C     1 
ATOM   1145 O  O     . ASP A 1 143 ? 38.437  239.836 -3.552  1.00 23.45 ? 140  ASP A O     1 
ATOM   1146 C  CB    . ASP A 1 143 ? 40.365  242.155 -2.920  1.00 26.97 ? 140  ASP A CB    1 
ATOM   1147 C  CG    . ASP A 1 143 ? 40.756  243.113 -1.802  1.00 37.40 ? 140  ASP A CG    1 
ATOM   1148 O  OD1   . ASP A 1 143 ? 40.749  242.719 -0.602  1.00 33.91 ? 140  ASP A OD1   1 
ATOM   1149 O  OD2   . ASP A 1 143 ? 41.044  244.287 -2.135  1.00 44.30 ? 140  ASP A OD2   1 
ATOM   1150 N  N     . LEU A 1 144 ? 40.455  239.065 -4.262  1.00 20.54 ? 141  LEU A N     1 
ATOM   1151 C  CA    . LEU A 1 144 ? 39.872  238.166 -5.246  1.00 21.26 ? 141  LEU A CA    1 
ATOM   1152 C  C     . LEU A 1 144 ? 39.502  236.801 -4.593  1.00 16.46 ? 141  LEU A C     1 
ATOM   1153 O  O     . LEU A 1 144 ? 38.859  235.984 -5.229  1.00 19.76 ? 141  LEU A O     1 
ATOM   1154 C  CB    . LEU A 1 144 ? 40.803  237.943 -6.399  1.00 23.63 ? 141  LEU A CB    1 
ATOM   1155 C  CG    . LEU A 1 144 ? 41.122  239.161 -7.266  1.00 24.56 ? 141  LEU A CG    1 
ATOM   1156 C  CD1   . LEU A 1 144 ? 42.019  238.683 -8.348  1.00 25.39 ? 141  LEU A CD1   1 
ATOM   1157 C  CD2   . LEU A 1 144 ? 39.828  239.747 -7.820  1.00 27.87 ? 141  LEU A CD2   1 
ATOM   1158 N  N     . LEU A 1 145 ? 39.838  236.646 -3.311  1.00 17.32 ? 142  LEU A N     1 
ATOM   1159 C  CA    . LEU A 1 145 ? 39.593  235.357 -2.592  1.00 19.18 ? 142  LEU A CA    1 
ATOM   1160 C  C     . LEU A 1 145 ? 38.898  235.614 -1.254  1.00 17.01 ? 142  LEU A C     1 
ATOM   1161 O  O     . LEU A 1 145 ? 39.351  235.220 -0.206  1.00 17.48 ? 142  LEU A O     1 
ATOM   1162 C  CB    . LEU A 1 145 ? 40.945  234.647 -2.374  1.00 16.78 ? 142  LEU A CB    1 
ATOM   1163 C  CG    . LEU A 1 145 ? 41.560  234.177 -3.687  1.00 17.44 ? 142  LEU A CG    1 
ATOM   1164 C  CD1   . LEU A 1 145 ? 43.049  233.759 -3.476  1.00 19.89 ? 142  LEU A CD1   1 
ATOM   1165 C  CD2   . LEU A 1 145 ? 40.833  232.973 -4.332  1.00 18.82 ? 142  LEU A CD2   1 
ATOM   1166 N  N     . PRO A 1 146 ? 37.753  236.326 -1.273  1.00 16.97 ? 143  PRO A N     1 
ATOM   1167 C  CA    . PRO A 1 146 ? 37.103  236.770 -0.038  1.00 18.48 ? 143  PRO A CA    1 
ATOM   1168 C  C     . PRO A 1 146 ? 36.448  235.732 0.818   1.00 17.34 ? 143  PRO A C     1 
ATOM   1169 O  O     . PRO A 1 146 ? 36.092  236.048 1.940   1.00 20.99 ? 143  PRO A O     1 
ATOM   1170 C  CB    . PRO A 1 146 ? 36.007  237.731 -0.558  1.00 19.89 ? 143  PRO A CB    1 
ATOM   1171 C  CG    . PRO A 1 146 ? 35.625  237.181 -1.932  1.00 20.62 ? 143  PRO A CG    1 
ATOM   1172 C  CD    . PRO A 1 146 ? 36.980  236.622 -2.500  1.00 15.96 ? 143  PRO A CD    1 
ATOM   1173 N  N     . SER A 1 147 ? 36.314  234.495 0.315   1.00 16.63 ? 144  SER A N     1 
ATOM   1174 C  CA    . SER A 1 147 ? 35.704  233.451 1.124   1.00 14.65 ? 144  SER A CA    1 
ATOM   1175 C  C     . SER A 1 147 ? 36.521  232.154 1.093   1.00 13.81 ? 144  SER A C     1 
ATOM   1176 O  O     . SER A 1 147 ? 36.000  231.106 1.452   1.00 15.16 ? 144  SER A O     1 
ATOM   1177 C  CB    . SER A 1 147 ? 34.286  233.123 0.643   1.00 15.50 ? 144  SER A CB    1 
ATOM   1178 O  OG    . SER A 1 147 ? 34.257  232.588 -0.663  1.00 18.01 ? 144  SER A OG    1 
ATOM   1179 N  N     . THR A 1 148 ? 37.824  232.321 0.808   1.00 14.33 ? 145  THR A N     1 
ATOM   1180 C  CA    . THR A 1 148 ? 38.756  231.180 0.652   1.00 15.23 ? 145  THR A CA    1 
ATOM   1181 C  C     . THR A 1 148 ? 39.596  230.949 1.883   1.00 15.98 ? 145  THR A C     1 
ATOM   1182 O  O     . THR A 1 148 ? 40.222  231.881 2.409   1.00 17.20 ? 145  THR A O     1 
ATOM   1183 C  CB    . THR A 1 148 ? 39.702  231.448 -0.530  1.00 13.80 ? 145  THR A CB    1 
ATOM   1184 O  OG1   . THR A 1 148 ? 38.894  231.439 -1.742  1.00 14.90 ? 145  THR A OG1   1 
ATOM   1185 C  CG2   . THR A 1 148 ? 40.778  230.294 -0.631  1.00 14.65 ? 145  THR A CG2   1 
ATOM   1186 N  N     . TYR A 1 149 ? 39.647  229.694 2.298   1.00 14.32 ? 146  TYR A N     1 
ATOM   1187 C  CA    . TYR A 1 149 ? 40.569  229.195 3.357   1.00 13.72 ? 146  TYR A CA    1 
ATOM   1188 C  C     . TYR A 1 149 ? 41.663  228.443 2.648   1.00 15.76 ? 146  TYR A C     1 
ATOM   1189 O  O     . TYR A 1 149 ? 41.416  227.688 1.680   1.00 15.68 ? 146  TYR A O     1 
ATOM   1190 C  CB    . TYR A 1 149 ? 39.854  228.199 4.286   1.00 14.54 ? 146  TYR A CB    1 
ATOM   1191 C  CG    . TYR A 1 149 ? 39.044  228.889 5.335   1.00 16.41 ? 146  TYR A CG    1 
ATOM   1192 C  CD1   . TYR A 1 149 ? 39.552  229.075 6.616   1.00 15.60 ? 146  TYR A CD1   1 
ATOM   1193 C  CD2   . TYR A 1 149 ? 37.755  229.387 5.016   1.00 16.22 ? 146  TYR A CD2   1 
ATOM   1194 C  CE1   . TYR A 1 149 ? 38.805  229.759 7.543   1.00 19.55 ? 146  TYR A CE1   1 
ATOM   1195 C  CE2   . TYR A 1 149 ? 37.007  230.066 5.970   1.00 19.27 ? 146  TYR A CE2   1 
ATOM   1196 C  CZ    . TYR A 1 149 ? 37.561  230.224 7.214   1.00 20.36 ? 146  TYR A CZ    1 
ATOM   1197 O  OH    . TYR A 1 149 ? 36.844  230.899 8.185   1.00 27.23 ? 146  TYR A OH    1 
ATOM   1198 N  N     . ILE A 1 150 ? 42.887  228.605 3.155   1.00 13.17 ? 147  ILE A N     1 
ATOM   1199 C  CA    . ILE A 1 150 ? 44.009  227.813 2.709   1.00 13.36 ? 147  ILE A CA    1 
ATOM   1200 C  C     . ILE A 1 150 ? 44.312  226.739 3.793   1.00 13.99 ? 147  ILE A C     1 
ATOM   1201 O  O     . ILE A 1 150 ? 44.777  227.061 4.913   1.00 15.40 ? 147  ILE A O     1 
ATOM   1202 C  CB    . ILE A 1 150 ? 45.253  228.678 2.498   1.00 14.44 ? 147  ILE A CB    1 
ATOM   1203 C  CG1   . ILE A 1 150 ? 44.987  229.916 1.626   1.00 15.58 ? 147  ILE A CG1   1 
ATOM   1204 C  CG2   . ILE A 1 150 ? 46.423  227.777 2.000   1.00 16.12 ? 147  ILE A CG2   1 
ATOM   1205 C  CD1   . ILE A 1 150 ? 44.531  229.566 0.151   1.00 17.19 ? 147  ILE A CD1   1 
ATOM   1206 N  N     . GLU A 1 151 ? 43.941  225.500 3.499   1.00 12.88 ? 148  GLU A N     1 
ATOM   1207 C  CA    . GLU A 1 151 ? 44.125  224.453 4.490   1.00 14.06 ? 148  GLU A CA    1 
ATOM   1208 C  C     . GLU A 1 151 ? 45.603  224.314 4.948   1.00 15.45 ? 148  GLU A C     1 
ATOM   1209 O  O     . GLU A 1 151 ? 46.482  224.268 4.109   1.00 15.65 ? 148  GLU A O     1 
ATOM   1210 C  CB    . GLU A 1 151 ? 43.645  223.114 3.898   1.00 14.74 ? 148  GLU A CB    1 
ATOM   1211 C  CG    . GLU A 1 151 ? 43.866  221.913 4.894   1.00 18.38 ? 148  GLU A CG    1 
ATOM   1212 C  CD    . GLU A 1 151 ? 43.227  222.065 6.286   1.00 21.10 ? 148  GLU A CD    1 
ATOM   1213 O  OE1   . GLU A 1 151 ? 43.722  221.422 7.240   1.00 22.80 ? 148  GLU A OE1   1 
ATOM   1214 O  OE2   . GLU A 1 151 ? 42.208  222.781 6.444   1.00 21.56 ? 148  GLU A OE2   1 
ATOM   1215 N  N     . GLY A 1 152 ? 45.788  224.280 6.275   1.00 15.73 ? 149  GLY A N     1 
ATOM   1216 C  CA    . GLY A 1 152 ? 47.088  224.226 6.949   1.00 18.51 ? 149  GLY A CA    1 
ATOM   1217 C  C     . GLY A 1 152 ? 47.683  225.569 7.350   1.00 19.74 ? 149  GLY A C     1 
ATOM   1218 O  O     . GLY A 1 152 ? 48.685  225.609 8.068   1.00 19.58 ? 149  GLY A O     1 
ATOM   1219 N  N     . LEU A 1 153 ? 47.096  226.661 6.904   1.00 16.67 ? 150  LEU A N     1 
ATOM   1220 C  CA    . LEU A 1 153 ? 47.571  228.016 7.247   1.00 18.04 ? 150  LEU A CA    1 
ATOM   1221 C  C     . LEU A 1 153 ? 46.498  228.760 8.051   1.00 20.46 ? 150  LEU A C     1 
ATOM   1222 O  O     . LEU A 1 153 ? 45.305  228.486 7.915   1.00 19.63 ? 150  LEU A O     1 
ATOM   1223 C  CB    . LEU A 1 153 ? 47.912  228.783 5.980   1.00 17.40 ? 150  LEU A CB    1 
ATOM   1224 C  CG    . LEU A 1 153 ? 49.037  228.162 5.162   1.00 17.98 ? 150  LEU A CG    1 
ATOM   1225 C  CD1   . LEU A 1 153 ? 49.266  228.981 3.902   1.00 18.63 ? 150  LEU A CD1   1 
ATOM   1226 C  CD2   . LEU A 1 153 ? 50.349  228.136 6.048   1.00 22.63 ? 150  LEU A CD2   1 
ATOM   1227 N  N     . PRO A 1 154 ? 46.907  229.714 8.912   1.00 18.58 ? 151  PRO A N     1 
ATOM   1228 C  CA    . PRO A 1 154 ? 48.300  230.155 9.129   1.00 20.36 ? 151  PRO A CA    1 
ATOM   1229 C  C     . PRO A 1 154 ? 49.099  229.175 9.971   1.00 22.46 ? 151  PRO A C     1 
ATOM   1230 O  O     . PRO A 1 154 ? 48.535  228.350 10.675  1.00 22.82 ? 151  PRO A O     1 
ATOM   1231 C  CB    . PRO A 1 154 ? 48.106  231.468 9.901   1.00 22.01 ? 151  PRO A CB    1 
ATOM   1232 C  CG    . PRO A 1 154 ? 46.872  231.231 10.718  1.00 24.76 ? 151  PRO A CG    1 
ATOM   1233 C  CD    . PRO A 1 154 ? 45.961  230.397 9.806   1.00 21.50 ? 151  PRO A CD    1 
ATOM   1234 N  N     . GLN A 1 155 ? 50.421  229.258 9.886   1.00 23.44 ? 152  GLN A N     1 
ATOM   1235 C  CA    A GLN A 1 155 ? 51.281  228.406 10.690  0.48 26.37 ? 152  GLN A CA    1 
ATOM   1236 C  CA    B GLN A 1 155 ? 51.306  228.372 10.637  0.52 26.38 ? 152  GLN A CA    1 
ATOM   1237 C  C     . GLN A 1 155 ? 52.536  229.185 11.038  1.00 33.50 ? 152  GLN A C     1 
ATOM   1238 O  O     . GLN A 1 155 ? 52.768  230.249 10.483  1.00 32.40 ? 152  GLN A O     1 
ATOM   1239 C  CB    A GLN A 1 155 ? 51.659  227.139 9.935   0.48 28.59 ? 152  GLN A CB    1 
ATOM   1240 C  CB    B GLN A 1 155 ? 51.722  227.140 9.799   0.52 28.57 ? 152  GLN A CB    1 
ATOM   1241 C  CG    A GLN A 1 155 ? 52.613  227.414 8.783   0.48 27.99 ? 152  GLN A CG    1 
ATOM   1242 C  CG    B GLN A 1 155 ? 50.945  225.846 10.096  0.52 31.10 ? 152  GLN A CG    1 
ATOM   1243 C  CD    A GLN A 1 155 ? 53.978  226.768 8.967   0.48 26.17 ? 152  GLN A CD    1 
ATOM   1244 C  CD    B GLN A 1 155 ? 51.457  224.578 9.363   0.52 26.57 ? 152  GLN A CD    1 
ATOM   1245 O  OE1   A GLN A 1 155 ? 54.137  225.893 9.815   0.48 30.30 ? 152  GLN A OE1   1 
ATOM   1246 O  OE1   B GLN A 1 155 ? 52.458  223.960 9.769   0.52 25.45 ? 152  GLN A OE1   1 
ATOM   1247 N  NE2   A GLN A 1 155 ? 54.948  227.142 8.119   0.48 22.89 ? 152  GLN A NE2   1 
ATOM   1248 N  NE2   B GLN A 1 155 ? 50.718  224.144 8.337   0.52 20.14 ? 152  GLN A NE2   1 
ATOM   1249 N  N     . GLY A 1 156 ? 53.327  228.672 11.977  1.00 34.65 ? 153  GLY A N     1 
ATOM   1250 C  CA    . GLY A 1 156 ? 54.620  229.298 12.280  1.00 35.67 ? 153  GLY A CA    1 
ATOM   1251 C  C     . GLY A 1 156 ? 54.542  230.511 13.199  1.00 40.10 ? 153  GLY A C     1 
ATOM   1252 O  O     . GLY A 1 156 ? 53.453  230.900 13.646  1.00 43.11 ? 153  GLY A O     1 
ATOM   1253 N  N     . PRO A 1 157 ? 55.718  231.124 13.481  1.00 45.93 ? 154  PRO A N     1 
ATOM   1254 C  CA    . PRO A 1 157 ? 55.966  232.194 14.464  1.00 45.28 ? 154  PRO A CA    1 
ATOM   1255 C  C     . PRO A 1 157 ? 55.465  233.599 14.091  1.00 40.93 ? 154  PRO A C     1 
ATOM   1256 O  O     . PRO A 1 157 ? 55.345  233.941 12.910  1.00 53.18 ? 154  PRO A O     1 
ATOM   1257 C  CB    . PRO A 1 157 ? 57.495  232.195 14.581  1.00 39.23 ? 154  PRO A CB    1 
ATOM   1258 C  CG    . PRO A 1 157 ? 57.970  231.734 13.220  1.00 33.48 ? 154  PRO A CG    1 
ATOM   1259 C  CD    . PRO A 1 157 ? 56.966  230.661 12.843  1.00 39.28 ? 154  PRO A CD    1 
ATOM   1260 N  N     . THR A 1 163 ? 45.417  236.120 16.430  1.00 53.80 ? 160  THR A N     1 
ATOM   1261 C  CA    . THR A 1 163 ? 43.999  236.493 16.298  1.00 53.32 ? 160  THR A CA    1 
ATOM   1262 C  C     . THR A 1 163 ? 43.134  235.433 16.941  1.00 47.89 ? 160  THR A C     1 
ATOM   1263 O  O     . THR A 1 163 ? 43.476  234.254 16.905  1.00 53.59 ? 160  THR A O     1 
ATOM   1264 C  CB    . THR A 1 163 ? 43.572  236.667 14.826  1.00 46.89 ? 160  THR A CB    1 
ATOM   1265 O  OG1   . THR A 1 163 ? 44.399  237.664 14.220  1.00 55.14 ? 160  THR A OG1   1 
ATOM   1266 C  CG2   . THR A 1 163 ? 42.115  237.109 14.721  1.00 41.12 ? 160  THR A CG2   1 
ATOM   1267 N  N     . VAL A 1 164 ? 42.019  235.839 17.529  1.00 43.05 ? 161  VAL A N     1 
ATOM   1268 C  CA    . VAL A 1 164 ? 41.194  234.855 18.181  1.00 43.36 ? 161  VAL A CA    1 
ATOM   1269 C  C     . VAL A 1 164 ? 39.827  234.678 17.484  1.00 44.09 ? 161  VAL A C     1 
ATOM   1270 O  O     . VAL A 1 164 ? 39.019  233.841 17.946  1.00 47.85 ? 161  VAL A O     1 
ATOM   1271 C  CB    . VAL A 1 164 ? 41.011  235.198 19.706  1.00 46.31 ? 161  VAL A CB    1 
ATOM   1272 C  CG1   . VAL A 1 164 ? 42.350  235.476 20.364  1.00 40.93 ? 161  VAL A CG1   1 
ATOM   1273 C  CG2   . VAL A 1 164 ? 40.033  236.321 19.863  1.00 43.43 ? 161  VAL A CG2   1 
ATOM   1274 N  N     . GLN A 1 165 ? 39.552  235.404 16.388  1.00 42.29 ? 162  GLN A N     1 
ATOM   1275 C  CA    . GLN A 1 165 ? 38.373  235.039 15.609  1.00 42.00 ? 162  GLN A CA    1 
ATOM   1276 C  C     . GLN A 1 165 ? 38.600  234.389 14.223  1.00 33.09 ? 162  GLN A C     1 
ATOM   1277 O  O     . GLN A 1 165 ? 39.709  234.410 13.648  1.00 35.31 ? 162  GLN A O     1 
ATOM   1278 C  CB    . GLN A 1 165 ? 37.429  236.165 15.336  1.00 40.45 ? 162  GLN A CB    1 
ATOM   1279 C  CG    . GLN A 1 165 ? 36.120  236.345 16.096  1.00 53.40 ? 162  GLN A CG    1 
ATOM   1280 C  CD    . GLN A 1 165 ? 35.807  235.442 17.302  1.00 53.28 ? 162  GLN A CD    1 
ATOM   1281 O  OE1   . GLN A 1 165 ? 35.896  234.196 17.250  1.00 54.18 ? 162  GLN A OE1   1 
ATOM   1282 N  NE2   . GLN A 1 165 ? 35.178  236.077 18.317  1.00 59.40 ? 162  GLN A NE2   1 
ATOM   1283 N  N     . LYS A 1 166 ? 37.522  233.736 13.768  1.00 36.92 ? 163  LYS A N     1 
ATOM   1284 C  CA    . LYS A 1 166 ? 37.552  232.850 12.599  1.00 35.37 ? 163  LYS A CA    1 
ATOM   1285 C  C     . LYS A 1 166 ? 37.985  233.607 11.351  1.00 27.08 ? 163  LYS A C     1 
ATOM   1286 O  O     . LYS A 1 166 ? 38.875  233.161 10.628  1.00 27.74 ? 163  LYS A O     1 
ATOM   1287 C  CB    . LYS A 1 166 ? 36.176  232.182 12.364  1.00 37.92 ? 163  LYS A CB    1 
ATOM   1288 C  CG    . LYS A 1 166 ? 35.643  231.333 13.506  1.00 43.82 ? 163  LYS A CG    1 
ATOM   1289 C  CD    . LYS A 1 166 ? 34.117  231.270 13.477  1.00 48.73 ? 163  LYS A CD    1 
ATOM   1290 C  CE    . LYS A 1 166 ? 33.461  231.040 14.853  1.00 43.41 ? 163  LYS A CE    1 
ATOM   1291 N  NZ    . LYS A 1 166 ? 33.413  229.624 15.297  1.00 47.50 ? 163  LYS A NZ    1 
ATOM   1292 N  N     . GLU A 1 167 ? 37.345  234.730 11.076  1.00 32.06 ? 164  GLU A N     1 
ATOM   1293 C  CA    . GLU A 1 167 ? 37.665  235.477 9.869   1.00 29.56 ? 164  GLU A CA    1 
ATOM   1294 C  C     . GLU A 1 167 ? 39.090  236.000 9.947   1.00 29.06 ? 164  GLU A C     1 
ATOM   1295 O  O     . GLU A 1 167 ? 39.774  236.101 8.939   1.00 26.50 ? 164  GLU A O     1 
ATOM   1296 C  CB    . GLU A 1 167 ? 36.664  236.629 9.654   1.00 33.45 ? 164  GLU A CB    1 
ATOM   1297 C  CG    . GLU A 1 167 ? 36.983  237.542 8.468   1.00 27.43 ? 164  GLU A CG    1 
ATOM   1298 C  CD    . GLU A 1 167 ? 37.031  236.823 7.091   1.00 29.33 ? 164  GLU A CD    1 
ATOM   1299 O  OE1   . GLU A 1 167 ? 37.542  237.471 6.145   1.00 29.32 ? 164  GLU A OE1   1 
ATOM   1300 O  OE2   . GLU A 1 167 ? 36.520  235.670 6.944   1.00 30.20 ? 164  GLU A OE2   1 
ATOM   1301 N  N     . GLY A 1 168 ? 39.534  236.336 11.151  1.00 32.52 ? 165  GLY A N     1 
ATOM   1302 C  CA    . GLY A 1 168 ? 40.892  236.797 11.336  1.00 31.80 ? 165  GLY A CA    1 
ATOM   1303 C  C     . GLY A 1 168 ? 41.887  235.735 10.931  1.00 25.06 ? 165  GLY A C     1 
ATOM   1304 O  O     . GLY A 1 168 ? 42.848  236.034 10.218  1.00 30.72 ? 165  GLY A O     1 
ATOM   1305 N  N     . MET A 1 169 ? 41.672  234.508 11.400  1.00 25.42 ? 166  MET A N     1 
ATOM   1306 C  CA    . MET A 1 169 ? 42.514  233.364 11.042  1.00 23.93 ? 166  MET A CA    1 
ATOM   1307 C  C     . MET A 1 169 ? 42.481  233.108 9.541   1.00 23.16 ? 166  MET A C     1 
ATOM   1308 O  O     . MET A 1 169 ? 43.531  232.897 8.928   1.00 21.72 ? 166  MET A O     1 
ATOM   1309 C  CB    . MET A 1 169 ? 42.065  232.124 11.785  1.00 31.29 ? 166  MET A CB    1 
ATOM   1310 C  CG    . MET A 1 169 ? 42.083  232.296 13.319  1.00 40.76 ? 166  MET A CG    1 
ATOM   1311 S  SD    . MET A 1 169 ? 43.769  232.144 13.966  1.00 55.40 ? 166  MET A SD    1 
ATOM   1312 C  CE    . MET A 1 169 ? 44.204  230.592 13.215  1.00 29.60 ? 166  MET A CE    1 
ATOM   1313 N  N     . ARG A 1 170 ? 41.287  233.143 8.941   1.00 23.47 ? 167  ARG A N     1 
ATOM   1314 C  CA    . ARG A 1 170 ? 41.184  232.937 7.488   1.00 21.98 ? 167  ARG A CA    1 
ATOM   1315 C  C     . ARG A 1 170 ? 42.103  233.884 6.750   1.00 19.28 ? 167  ARG A C     1 
ATOM   1316 O  O     . ARG A 1 170 ? 42.868  233.492 5.844   1.00 19.17 ? 167  ARG A O     1 
ATOM   1317 C  CB    . ARG A 1 170 ? 39.751  233.155 6.971   1.00 20.11 ? 167  ARG A CB    1 
ATOM   1318 C  CG    . ARG A 1 170 ? 39.596  232.792 5.498   1.00 18.67 ? 167  ARG A CG    1 
ATOM   1319 C  CD    . ARG A 1 170 ? 38.242  233.279 4.941   1.00 19.52 ? 167  ARG A CD    1 
ATOM   1320 N  NE    . ARG A 1 170 ? 38.255  234.753 4.742   1.00 19.60 ? 167  ARG A NE    1 
ATOM   1321 C  CZ    . ARG A 1 170 ? 38.823  235.360 3.695   1.00 19.36 ? 167  ARG A CZ    1 
ATOM   1322 N  NH1   . ARG A 1 170 ? 39.466  234.705 2.728   1.00 18.48 ? 167  ARG A NH1   1 
ATOM   1323 N  NH2   . ARG A 1 170 ? 38.761  236.672 3.600   1.00 23.08 ? 167  ARG A NH2   1 
ATOM   1324 N  N     . LYS A 1 171 ? 42.004  235.171 7.096   1.00 20.36 ? 168  LYS A N     1 
ATOM   1325 C  CA    . LYS A 1 171 ? 42.832  236.122 6.367   1.00 24.85 ? 168  LYS A CA    1 
ATOM   1326 C  C     . LYS A 1 171 ? 44.320  235.937 6.651   1.00 21.14 ? 168  LYS A C     1 
ATOM   1327 O  O     . LYS A 1 171 ? 45.126  236.096 5.734   1.00 22.28 ? 168  LYS A O     1 
ATOM   1328 C  CB    . LYS A 1 171 ? 42.420  237.561 6.693   1.00 29.55 ? 168  LYS A CB    1 
ATOM   1329 C  CG    . LYS A 1 171 ? 41.258  238.070 5.862   1.00 37.33 ? 168  LYS A CG    1 
ATOM   1330 C  CD    . LYS A 1 171 ? 41.175  239.623 5.949   1.00 43.47 ? 168  LYS A CD    1 
ATOM   1331 C  CE    . LYS A 1 171 ? 40.987  240.288 4.566   1.00 44.07 ? 168  LYS A CE    1 
ATOM   1332 N  NZ    . LYS A 1 171 ? 41.760  239.622 3.471   1.00 40.69 ? 168  LYS A NZ    1 
ATOM   1333 N  N     . GLN A 1 172 ? 44.685  235.628 7.898   1.00 20.20 ? 169  GLN A N     1 
ATOM   1334 C  CA    . GLN A 1 172 ? 46.108  235.406 8.193   1.00 24.93 ? 169  GLN A CA    1 
ATOM   1335 C  C     . GLN A 1 172 ? 46.649  234.270 7.328   1.00 19.98 ? 169  GLN A C     1 
ATOM   1336 O  O     . GLN A 1 172 ? 47.725  234.383 6.734   1.00 22.60 ? 169  GLN A O     1 
ATOM   1337 C  CB    . GLN A 1 172 ? 46.366  235.084 9.664   1.00 26.63 ? 169  GLN A CB    1 
ATOM   1338 C  CG    . GLN A 1 172 ? 47.795  235.441 10.093  1.00 39.18 ? 169  GLN A CG    1 
ATOM   1339 C  CD    . GLN A 1 172 ? 48.247  234.795 11.416  1.00 40.70 ? 169  GLN A CD    1 
ATOM   1340 O  OE1   . GLN A 1 172 ? 47.453  234.192 12.134  1.00 46.66 ? 169  GLN A OE1   1 
ATOM   1341 N  NE2   . GLN A 1 172 ? 49.534  234.923 11.725  1.00 47.06 ? 169  GLN A NE2   1 
ATOM   1342 N  N     . GLY A 1 173 ? 45.912  233.167 7.230   1.00 21.18 ? 170  GLY A N     1 
ATOM   1343 C  CA    . GLY A 1 173 ? 46.365  232.088 6.398   1.00 19.41 ? 170  GLY A CA    1 
ATOM   1344 C  C     . GLY A 1 173 ? 46.455  232.416 4.918   1.00 18.12 ? 170  GLY A C     1 
ATOM   1345 O  O     . GLY A 1 173 ? 47.393  232.022 4.217   1.00 18.32 ? 170  GLY A O     1 
ATOM   1346 N  N     . LEU A 1 174 ? 45.451  233.137 4.415   1.00 16.99 ? 171  LEU A N     1 
ATOM   1347 C  CA    . LEU A 1 174 ? 45.454  233.559 3.057   1.00 18.66 ? 171  LEU A CA    1 
ATOM   1348 C  C     . LEU A 1 174 ? 46.614  234.494 2.740   1.00 20.67 ? 171  LEU A C     1 
ATOM   1349 O  O     . LEU A 1 174 ? 47.270  234.359 1.719   1.00 19.26 ? 171  LEU A O     1 
ATOM   1350 C  CB    . LEU A 1 174 ? 44.080  234.225 2.719   1.00 17.98 ? 171  LEU A CB    1 
ATOM   1351 C  CG    . LEU A 1 174 ? 43.998  234.720 1.290   1.00 17.96 ? 171  LEU A CG    1 
ATOM   1352 C  CD1   . LEU A 1 174 ? 44.059  233.548 0.274   1.00 19.28 ? 171  LEU A CD1   1 
ATOM   1353 C  CD2   . LEU A 1 174 ? 42.730  235.510 1.147   1.00 22.07 ? 171  LEU A CD2   1 
ATOM   1354 N  N     . PHE A 1 175 ? 46.874  235.438 3.650   1.00 19.83 ? 172  PHE A N     1 
ATOM   1355 C  CA    . PHE A 1 175 ? 48.041  236.309 3.525   1.00 23.05 ? 172  PHE A CA    1 
ATOM   1356 C  C     . PHE A 1 175 ? 49.352  235.499 3.451   1.00 22.71 ? 172  PHE A C     1 
ATOM   1357 O  O     . PHE A 1 175 ? 50.161  235.759 2.560   1.00 24.07 ? 172  PHE A O     1 
ATOM   1358 C  CB    . PHE A 1 175 ? 48.082  237.256 4.682   1.00 21.49 ? 172  PHE A CB    1 
ATOM   1359 C  CG    . PHE A 1 175 ? 46.996  238.296 4.673   1.00 32.91 ? 172  PHE A CG    1 
ATOM   1360 C  CD1   . PHE A 1 175 ? 46.390  238.687 3.491   1.00 36.20 ? 172  PHE A CD1   1 
ATOM   1361 C  CD2   . PHE A 1 175 ? 46.576  238.891 5.868   1.00 33.58 ? 172  PHE A CD2   1 
ATOM   1362 C  CE1   . PHE A 1 175 ? 45.391  239.683 3.490   1.00 39.48 ? 172  PHE A CE1   1 
ATOM   1363 C  CE2   . PHE A 1 175 ? 45.583  239.891 5.875   1.00 41.16 ? 172  PHE A CE2   1 
ATOM   1364 C  CZ    . PHE A 1 175 ? 44.993  240.274 4.680   1.00 42.70 ? 172  PHE A CZ    1 
ATOM   1365 N  N     . GLN A 1 176 ? 49.546  234.506 4.334   1.00 22.87 ? 173  GLN A N     1 
ATOM   1366 C  CA    . GLN A 1 176 ? 50.793  233.690 4.297   1.00 20.73 ? 173  GLN A CA    1 
ATOM   1367 C  C     . GLN A 1 176 ? 50.933  232.980 2.962   1.00 23.92 ? 173  GLN A C     1 
ATOM   1368 O  O     . GLN A 1 176 ? 52.008  232.918 2.359   1.00 22.64 ? 173  GLN A O     1 
ATOM   1369 C  CB    . GLN A 1 176 ? 50.866  232.640 5.441   1.00 21.24 ? 173  GLN A CB    1 
ATOM   1370 C  CG    . GLN A 1 176 ? 50.962  233.294 6.819   1.00 25.80 ? 173  GLN A CG    1 
ATOM   1371 C  CD    . GLN A 1 176 ? 51.155  232.272 7.922   1.00 26.52 ? 173  GLN A CD    1 
ATOM   1372 O  OE1   . GLN A 1 176 ? 51.043  231.069 7.692   1.00 29.12 ? 173  GLN A OE1   1 
ATOM   1373 N  NE2   . GLN A 1 176 ? 51.494  232.750 9.123   1.00 30.70 ? 173  GLN A NE2   1 
ATOM   1374 N  N     . TRP A 1 177 ? 49.814  232.434 2.462   1.00 19.60 ? 174  TRP A N     1 
ATOM   1375 C  CA    . TRP A 1 177 ? 49.819  231.781 1.201   1.00 17.37 ? 174  TRP A CA    1 
ATOM   1376 C  C     . TRP A 1 177 ? 50.194  232.709 0.038   1.00 18.07 ? 174  TRP A C     1 
ATOM   1377 O  O     . TRP A 1 177 ? 51.067  232.391 -0.765  1.00 22.92 ? 174  TRP A O     1 
ATOM   1378 C  CB    . TRP A 1 177 ? 48.412  231.195 0.963   1.00 16.95 ? 174  TRP A CB    1 
ATOM   1379 C  CG    . TRP A 1 177 ? 48.209  230.507 -0.347  1.00 18.43 ? 174  TRP A CG    1 
ATOM   1380 C  CD1   . TRP A 1 177 ? 47.526  231.003 -1.433  1.00 17.23 ? 174  TRP A CD1   1 
ATOM   1381 C  CD2   . TRP A 1 177 ? 48.649  229.195 -0.717  1.00 16.37 ? 174  TRP A CD2   1 
ATOM   1382 N  NE1   . TRP A 1 177 ? 47.558  230.103 -2.449  1.00 17.53 ? 174  TRP A NE1   1 
ATOM   1383 C  CE2   . TRP A 1 177 ? 48.232  228.977 -2.037  1.00 18.02 ? 174  TRP A CE2   1 
ATOM   1384 C  CE3   . TRP A 1 177 ? 49.375  228.195 -0.067  1.00 18.10 ? 174  TRP A CE3   1 
ATOM   1385 C  CZ2   . TRP A 1 177 ? 48.486  227.802 -2.717  1.00 17.48 ? 174  TRP A CZ2   1 
ATOM   1386 C  CZ3   . TRP A 1 177 ? 49.659  227.012 -0.739  1.00 17.64 ? 174  TRP A CZ3   1 
ATOM   1387 C  CH2   . TRP A 1 177 ? 49.204  226.803 -2.044  1.00 19.09 ? 174  TRP A CH2   1 
ATOM   1388 N  N     . LEU A 1 178 ? 49.490  233.835 -0.053  1.00 19.86 ? 175  LEU A N     1 
ATOM   1389 C  CA    . LEU A 1 178 ? 49.713  234.714 -1.179  1.00 18.85 ? 175  LEU A CA    1 
ATOM   1390 C  C     . LEU A 1 178 ? 51.118  235.295 -1.121  1.00 29.49 ? 175  LEU A C     1 
ATOM   1391 O  O     . LEU A 1 178 ? 51.760  235.456 -2.163  1.00 32.38 ? 175  LEU A O     1 
ATOM   1392 C  CB    . LEU A 1 178 ? 48.696  235.836 -1.198  1.00 20.59 ? 175  LEU A CB    1 
ATOM   1393 C  CG    . LEU A 1 178 ? 47.268  235.354 -1.507  1.00 23.25 ? 175  LEU A CG    1 
ATOM   1394 C  CD1   . LEU A 1 178 ? 46.281  236.503 -1.340  1.00 25.71 ? 175  LEU A CD1   1 
ATOM   1395 C  CD2   . LEU A 1 178 ? 47.153  234.697 -2.887  1.00 18.58 ? 175  LEU A CD2   1 
ATOM   1396 N  N     . ASP A 1 179 ? 51.580  235.565 0.090   1.00 27.38 ? 176  ASP A N     1 
ATOM   1397 C  CA    . ASP A 1 179 ? 52.878  236.243 0.246   1.00 30.13 ? 176  ASP A CA    1 
ATOM   1398 C  C     . ASP A 1 179 ? 53.976  235.385 -0.277  1.00 32.83 ? 176  ASP A C     1 
ATOM   1399 O  O     . ASP A 1 179 ? 54.970  235.916 -0.788  1.00 35.40 ? 176  ASP A O     1 
ATOM   1400 C  CB    . ASP A 1 179 ? 53.175  236.585 1.696   1.00 30.98 ? 176  ASP A CB    1 
ATOM   1401 C  CG    . ASP A 1 179 ? 52.483  237.827 2.127   1.00 31.54 ? 176  ASP A CG    1 
ATOM   1402 O  OD1   . ASP A 1 179 ? 51.972  238.557 1.242   1.00 42.18 ? 176  ASP A OD1   1 
ATOM   1403 O  OD2   . ASP A 1 179 ? 52.415  238.082 3.346   1.00 44.56 ? 176  ASP A OD2   1 
ATOM   1404 N  N     . SER A 1 180 ? 53.813  234.063 -0.155  1.00 27.79 ? 177  SER A N     1 
ATOM   1405 C  CA    . SER A 1 180 ? 54.816  233.133 -0.638  1.00 27.64 ? 177  SER A CA    1 
ATOM   1406 C  C     . SER A 1 180 ? 54.612  232.580 -2.060  1.00 35.76 ? 177  SER A C     1 
ATOM   1407 O  O     . SER A 1 180 ? 55.411  231.769 -2.546  1.00 36.28 ? 177  SER A O     1 
ATOM   1408 C  CB    . SER A 1 180 ? 54.951  231.959 0.357   1.00 33.89 ? 177  SER A CB    1 
ATOM   1409 O  OG    . SER A 1 180 ? 53.735  231.299 0.602   1.00 37.91 ? 177  SER A OG    1 
ATOM   1410 N  N     . LEU A 1 181 ? 53.559  233.003 -2.744  1.00 26.91 ? 178  LEU A N     1 
ATOM   1411 C  CA    . LEU A 1 181 ? 53.354  232.502 -4.102  1.00 25.45 ? 178  LEU A CA    1 
ATOM   1412 C  C     . LEU A 1 181 ? 54.308  233.034 -5.183  1.00 35.97 ? 178  LEU A C     1 
ATOM   1413 O  O     . LEU A 1 181 ? 54.521  234.228 -5.288  1.00 37.96 ? 178  LEU A O     1 
ATOM   1414 C  CB    . LEU A 1 181 ? 51.944  232.846 -4.578  1.00 30.37 ? 178  LEU A CB    1 
ATOM   1415 C  CG    . LEU A 1 181 ? 50.755  231.939 -4.439  1.00 31.65 ? 178  LEU A CG    1 
ATOM   1416 C  CD1   . LEU A 1 181 ? 49.658  232.607 -5.323  1.00 22.54 ? 178  LEU A CD1   1 
ATOM   1417 C  CD2   . LEU A 1 181 ? 51.048  230.522 -4.864  1.00 29.40 ? 178  LEU A CD2   1 
ATOM   1418 N  N     . GLN A 1 182 ? 54.778  232.121 -6.022  1.00 37.49 ? 179  GLN A N     1 
ATOM   1419 C  CA    . GLN A 1 182 ? 55.583  232.359 -7.216  1.00 42.33 ? 179  GLN A CA    1 
ATOM   1420 C  C     . GLN A 1 182 ? 54.825  232.746 -8.514  1.00 41.95 ? 179  GLN A C     1 
ATOM   1421 O  O     . GLN A 1 182 ? 54.736  231.931 -9.446  1.00 46.58 ? 179  GLN A O     1 
ATOM   1422 C  CB    . GLN A 1 182 ? 56.387  231.083 -7.484  1.00 43.56 ? 179  GLN A CB    1 
ATOM   1423 C  CG    . GLN A 1 182 ? 55.485  229.837 -7.657  1.00 46.61 ? 179  GLN A CG    1 
ATOM   1424 C  CD    . GLN A 1 182 ? 54.706  229.432 -6.395  1.00 44.06 ? 179  GLN A CD    1 
ATOM   1425 O  OE1   . GLN A 1 182 ? 55.073  229.788 -5.262  1.00 48.00 ? 179  GLN A OE1   1 
ATOM   1426 N  NE2   . GLN A 1 182 ? 53.586  228.774 -6.599  1.00 37.81 ? 179  GLN A NE2   1 
ATOM   1427 N  N     . ILE A 1 183 ? 54.338  233.983 -8.624  1.00 40.39 ? 180  ILE A N     1 
ATOM   1428 C  CA    . ILE A 1 183 ? 53.456  234.334 -9.753  1.00 47.59 ? 180  ILE A CA    1 
ATOM   1429 C  C     . ILE A 1 183 ? 54.097  234.362 -11.149 1.00 48.60 ? 180  ILE A C     1 
ATOM   1430 O  O     . ILE A 1 183 ? 53.390  234.339 -12.163 1.00 45.71 ? 180  ILE A O     1 
ATOM   1431 C  CB    . ILE A 1 183 ? 52.767  235.714 -9.536  1.00 46.00 ? 180  ILE A CB    1 
ATOM   1432 C  CG1   . ILE A 1 183 ? 53.719  236.708 -8.862  1.00 53.36 ? 180  ILE A CG1   1 
ATOM   1433 C  CG2   . ILE A 1 183 ? 51.487  235.537 -8.721  1.00 45.83 ? 180  ILE A CG2   1 
ATOM   1434 C  CD1   . ILE A 1 183 ? 54.783  237.287 -9.770  1.00 50.53 ? 180  ILE A CD1   1 
ATOM   1435 N  N     . ASP A 1 184 ? 55.420  234.423 -11.218 1.00 49.13 ? 181  ASP A N     1 
ATOM   1436 C  CA    . ASP A 1 184 ? 56.074  234.505 -12.520 1.00 51.79 ? 181  ASP A CA    1 
ATOM   1437 C  C     . ASP A 1 184 ? 56.185  233.135 -13.179 1.00 51.21 ? 181  ASP A C     1 
ATOM   1438 O  O     . ASP A 1 184 ? 56.652  233.014 -14.312 1.00 49.06 ? 181  ASP A O     1 
ATOM   1439 C  CB    . ASP A 1 184 ? 57.462  235.122 -12.375 1.00 53.65 ? 181  ASP A CB    1 
ATOM   1440 C  CG    . ASP A 1 184 ? 58.350  234.315 -11.453 1.00 57.32 ? 181  ASP A CG    1 
ATOM   1441 O  OD1   . ASP A 1 184 ? 57.900  233.988 -10.324 1.00 58.19 ? 181  ASP A OD1   1 
ATOM   1442 O  OD2   . ASP A 1 184 ? 59.488  233.988 -11.854 1.00 64.00 ? 181  ASP A OD2   1 
ATOM   1443 N  N     . ASN A 1 185 ? 55.773  232.092 -12.465 1.00 46.08 ? 182  ASN A N     1 
ATOM   1444 C  CA    . ASN A 1 185 ? 55.914  230.750 -12.999 1.00 46.68 ? 182  ASN A CA    1 
ATOM   1445 C  C     . ASN A 1 185 ? 54.550  230.139 -13.341 1.00 42.88 ? 182  ASN A C     1 
ATOM   1446 O  O     . ASN A 1 185 ? 53.869  229.589 -12.473 1.00 41.63 ? 182  ASN A O     1 
ATOM   1447 C  CB    . ASN A 1 185 ? 56.688  229.890 -11.996 1.00 41.71 ? 182  ASN A CB    1 
ATOM   1448 C  CG    . ASN A 1 185 ? 56.828  228.453 -12.425 1.00 39.79 ? 182  ASN A CG    1 
ATOM   1449 O  OD1   . ASN A 1 185 ? 56.506  228.062 -13.567 1.00 41.41 ? 182  ASN A OD1   1 
ATOM   1450 N  ND2   . ASN A 1 185 ? 57.320  227.630 -11.495 1.00 45.78 ? 182  ASN A ND2   1 
ATOM   1451 N  N     . LEU A 1 186 ? 54.171  230.204 -14.615 1.00 41.21 ? 183  LEU A N     1 
ATOM   1452 C  CA    . LEU A 1 186 ? 52.827  229.800 -15.043 1.00 40.83 ? 183  LEU A CA    1 
ATOM   1453 C  C     . LEU A 1 186 ? 52.558  228.297 -14.894 1.00 40.24 ? 183  LEU A C     1 
ATOM   1454 O  O     . LEU A 1 186 ? 51.407  227.852 -14.981 1.00 43.57 ? 183  LEU A O     1 
ATOM   1455 C  CB    . LEU A 1 186 ? 52.590  230.249 -16.486 1.00 43.06 ? 183  LEU A CB    1 
ATOM   1456 C  CG    . LEU A 1 186 ? 52.027  231.684 -16.576 1.00 46.48 ? 183  LEU A CG    1 
ATOM   1457 C  CD1   . LEU A 1 186 ? 52.888  232.757 -15.875 1.00 52.14 ? 183  LEU A CD1   1 
ATOM   1458 C  CD2   . LEU A 1 186 ? 51.732  232.072 -18.020 1.00 45.94 ? 183  LEU A CD2   1 
ATOM   1459 N  N     . THR A 1 187 ? 53.608  227.513 -14.663 1.00 36.47 ? 184  THR A N     1 
ATOM   1460 C  CA    . THR A 1 187 ? 53.444  226.089 -14.396 1.00 37.91 ? 184  THR A CA    1 
ATOM   1461 C  C     . THR A 1 187 ? 53.456  225.694 -12.907 1.00 32.05 ? 184  THR A C     1 
ATOM   1462 O  O     . THR A 1 187 ? 53.430  224.515 -12.623 1.00 35.10 ? 184  THR A O     1 
ATOM   1463 C  CB    . THR A 1 187 ? 54.554  225.258 -15.089 1.00 41.78 ? 184  THR A CB    1 
ATOM   1464 O  OG1   . THR A 1 187 ? 55.841  225.624 -14.550 1.00 41.16 ? 184  THR A OG1   1 
ATOM   1465 C  CG2   . THR A 1 187 ? 54.535  225.500 -16.593 1.00 45.28 ? 184  THR A CG2   1 
ATOM   1466 N  N     . SER A 1 188 ? 53.561  226.638 -11.977 1.00 29.56 ? 185  SER A N     1 
ATOM   1467 C  CA    . SER A 1 188 ? 53.516  226.304 -10.540 1.00 23.79 ? 185  SER A CA    1 
ATOM   1468 C  C     . SER A 1 188 ? 52.153  225.736 -10.139 1.00 22.79 ? 185  SER A C     1 
ATOM   1469 O  O     . SER A 1 188 ? 51.147  226.396 -10.266 1.00 19.43 ? 185  SER A O     1 
ATOM   1470 C  CB    . SER A 1 188 ? 53.784  227.511 -9.646  1.00 27.86 ? 185  SER A CB    1 
ATOM   1471 O  OG    . SER A 1 188 ? 53.483  227.209 -8.244  1.00 27.98 ? 185  SER A OG    1 
ATOM   1472 N  N     . PRO A 1 189 ? 52.138  224.527 -9.619  1.00 17.76 ? 186  PRO A N     1 
ATOM   1473 C  CA    . PRO A 1 189 ? 50.820  223.965 -9.237  1.00 16.08 ? 186  PRO A CA    1 
ATOM   1474 C  C     . PRO A 1 189 ? 50.117  224.829 -8.185  1.00 16.99 ? 186  PRO A C     1 
ATOM   1475 O  O     . PRO A 1 189 ? 48.875  224.928 -8.241  1.00 16.06 ? 186  PRO A O     1 
ATOM   1476 C  CB    . PRO A 1 189 ? 51.165  222.609 -8.655  1.00 21.42 ? 186  PRO A CB    1 
ATOM   1477 C  CG    . PRO A 1 189 ? 52.506  222.258 -9.339  1.00 22.62 ? 186  PRO A CG    1 
ATOM   1478 C  CD    . PRO A 1 189 ? 53.228  223.532 -9.521  1.00 19.15 ? 186  PRO A CD    1 
ATOM   1479 N  N     . ASP A 1 190 ? 50.827  225.381 -7.199  1.00 16.83 ? 187  ASP A N     1 
ATOM   1480 C  CA    . ASP A 1 190 ? 50.169  226.185 -6.163  1.00 13.28 ? 187  ASP A CA    1 
ATOM   1481 C  C     . ASP A 1 190 ? 49.542  227.427 -6.796  1.00 15.01 ? 187  ASP A C     1 
ATOM   1482 O  O     . ASP A 1 190 ? 48.457  227.822 -6.361  1.00 15.98 ? 187  ASP A O     1 
ATOM   1483 C  CB    . ASP A 1 190 ? 51.145  226.647 -5.051  1.00 16.90 ? 187  ASP A CB    1 
ATOM   1484 C  CG    . ASP A 1 190 ? 51.598  225.524 -4.169  1.00 21.08 ? 187  ASP A CG    1 
ATOM   1485 O  OD1   . ASP A 1 190 ? 51.002  224.462 -4.170  1.00 17.01 ? 187  ASP A OD1   1 
ATOM   1486 O  OD2   . ASP A 1 190 ? 52.600  225.727 -3.459  1.00 23.20 ? 187  ASP A OD2   1 
ATOM   1487 N  N     . LEU A 1 191 ? 50.220  228.057 -7.774  1.00 16.68 ? 188  LEU A N     1 
ATOM   1488 C  CA    . LEU A 1 191 ? 49.666  229.196 -8.475  1.00 18.42 ? 188  LEU A CA    1 
ATOM   1489 C  C     . LEU A 1 191 ? 48.432  228.767 -9.256  1.00 16.40 ? 188  LEU A C     1 
ATOM   1490 O  O     . LEU A 1 191 ? 47.411  229.504 -9.198  1.00 15.94 ? 188  LEU A O     1 
ATOM   1491 C  CB    . LEU A 1 191 ? 50.735  229.779 -9.442  1.00 19.07 ? 188  LEU A CB    1 
ATOM   1492 C  CG    . LEU A 1 191 ? 50.172  230.938 -10.297 1.00 20.45 ? 188  LEU A CG    1 
ATOM   1493 C  CD1   . LEU A 1 191 ? 49.719  232.075 -9.438  1.00 20.21 ? 188  LEU A CD1   1 
ATOM   1494 C  CD2   . LEU A 1 191 ? 51.317  231.388 -11.241 1.00 23.32 ? 188  LEU A CD2   1 
ATOM   1495 N  N     . GLN A 1 192 ? 48.490  227.573 -9.859  1.00 15.97 ? 189  GLN A N     1 
ATOM   1496 C  CA    . GLN A 1 192 ? 47.338  227.070 -10.665 1.00 16.24 ? 189  GLN A CA    1 
ATOM   1497 C  C     . GLN A 1 192 ? 46.148  226.902 -9.711  1.00 15.98 ? 189  GLN A C     1 
ATOM   1498 O  O     . GLN A 1 192 ? 45.023  227.324 -10.028 1.00 14.75 ? 189  GLN A O     1 
ATOM   1499 C  CB    . GLN A 1 192 ? 47.661  225.786 -11.399 1.00 18.30 ? 189  GLN A CB    1 
ATOM   1500 C  CG    . GLN A 1 192 ? 48.706  226.096 -12.497 1.00 19.66 ? 189  GLN A CG    1 
ATOM   1501 C  CD    . GLN A 1 192 ? 49.363  224.881 -13.045 1.00 29.49 ? 189  GLN A CD    1 
ATOM   1502 O  OE1   . GLN A 1 192 ? 49.134  223.751 -12.595 1.00 32.76 ? 189  GLN A OE1   1 
ATOM   1503 N  NE2   . GLN A 1 192 ? 50.240  225.101 -14.036 1.00 35.78 ? 189  GLN A NE2   1 
ATOM   1504 N  N     . LEU A 1 193 ? 46.378  226.303 -8.542  1.00 15.21 ? 190  LEU A N     1 
ATOM   1505 C  CA    . LEU A 1 193 ? 45.252  226.138 -7.583  1.00 14.11 ? 190  LEU A CA    1 
ATOM   1506 C  C     . LEU A 1 193 ? 44.673  227.468 -7.164  1.00 15.92 ? 190  LEU A C     1 
ATOM   1507 O  O     . LEU A 1 193 ? 43.477  227.576 -6.935  1.00 15.52 ? 190  LEU A O     1 
ATOM   1508 C  CB    . LEU A 1 193 ? 45.748  225.386 -6.333  1.00 15.45 ? 190  LEU A CB    1 
ATOM   1509 C  CG    . LEU A 1 193 ? 46.154  223.942 -6.463  1.00 14.05 ? 190  LEU A CG    1 
ATOM   1510 C  CD1   . LEU A 1 193 ? 46.440  223.379 -5.071  1.00 16.02 ? 190  LEU A CD1   1 
ATOM   1511 C  CD2   . LEU A 1 193 ? 45.017  223.100 -7.094  1.00 13.99 ? 190  LEU A CD2   1 
ATOM   1512 N  N     . THR A 1 194 ? 45.519  228.481 -6.970  1.00 15.22 ? 191  THR A N     1 
ATOM   1513 C  CA    . THR A 1 194 ? 45.081  229.782 -6.516  1.00 14.98 ? 191  THR A CA    1 
ATOM   1514 C  C     . THR A 1 194 ? 44.196  230.439 -7.565  1.00 16.40 ? 191  THR A C     1 
ATOM   1515 O  O     . THR A 1 194 ? 43.154  231.020 -7.222  1.00 16.87 ? 191  THR A O     1 
ATOM   1516 C  CB    . THR A 1 194 ? 46.287  230.698 -6.216  1.00 15.33 ? 191  THR A CB    1 
ATOM   1517 O  OG1   . THR A 1 194 ? 47.118  230.047 -5.249  1.00 16.99 ? 191  THR A OG1   1 
ATOM   1518 C  CG2   . THR A 1 194 ? 45.860  232.055 -5.605  1.00 17.20 ? 191  THR A CG2   1 
ATOM   1519 N  N     . VAL A 1 195 ? 44.643  230.348 -8.813  1.00 15.04 ? 192  VAL A N     1 
ATOM   1520 C  CA    . VAL A 1 195 ? 43.797  230.889 -9.881  1.00 17.15 ? 192  VAL A CA    1 
ATOM   1521 C  C     . VAL A 1 195 ? 42.508  230.070 -9.960  1.00 16.88 ? 192  VAL A C     1 
ATOM   1522 O  O     . VAL A 1 195 ? 41.402  230.668 -10.171 1.00 16.11 ? 192  VAL A O     1 
ATOM   1523 C  CB    . VAL A 1 195 ? 44.529  230.876 -11.200 1.00 14.55 ? 192  VAL A CB    1 
ATOM   1524 C  CG1   . VAL A 1 195 ? 43.590  231.385 -12.275 1.00 17.17 ? 192  VAL A CG1   1 
ATOM   1525 C  CG2   . VAL A 1 195 ? 45.687  231.893 -11.101 1.00 17.54 ? 192  VAL A CG2   1 
ATOM   1526 N  N     . GLY A 1 196 ? 42.598  228.751 -9.757  1.00 14.75 ? 193  GLY A N     1 
ATOM   1527 C  CA    . GLY A 1 196 ? 41.366  227.924 -9.742  1.00 13.81 ? 193  GLY A CA    1 
ATOM   1528 C  C     . GLY A 1 196 ? 40.434  228.460 -8.654  1.00 16.93 ? 193  GLY A C     1 
ATOM   1529 O  O     . GLY A 1 196 ? 39.207  228.597 -8.868  1.00 15.56 ? 193  GLY A O     1 
ATOM   1530 N  N     . ALA A 1 197 ? 40.974  228.783 -7.482  1.00 15.23 ? 194  ALA A N     1 
ATOM   1531 C  CA    . ALA A 1 197 ? 40.139  229.324 -6.409  1.00 12.91 ? 194  ALA A CA    1 
ATOM   1532 C  C     . ALA A 1 197 ? 39.494  230.682 -6.752  1.00 15.15 ? 194  ALA A C     1 
ATOM   1533 O  O     . ALA A 1 197 ? 38.353  230.913 -6.346  1.00 15.28 ? 194  ALA A O     1 
ATOM   1534 C  CB    . ALA A 1 197 ? 40.946  229.434 -5.103  1.00 14.37 ? 194  ALA A CB    1 
ATOM   1535 N  N     . VAL A 1 198 ? 40.238  231.546 -7.454  1.00 14.86 ? 195  VAL A N     1 
ATOM   1536 C  CA    . VAL A 1 198 ? 39.646  232.805 -7.968  1.00 14.27 ? 195  VAL A CA    1 
ATOM   1537 C  C     . VAL A 1 198 ? 38.420  232.515 -8.872  1.00 16.49 ? 195  VAL A C     1 
ATOM   1538 O  O     . VAL A 1 198 ? 37.329  233.142 -8.694  1.00 17.44 ? 195  VAL A O     1 
ATOM   1539 C  CB    . VAL A 1 198 ? 40.666  233.593 -8.737  1.00 17.32 ? 195  VAL A CB    1 
ATOM   1540 C  CG1   . VAL A 1 198 ? 39.991  234.848 -9.410  1.00 20.75 ? 195  VAL A CG1   1 
ATOM   1541 C  CG2   . VAL A 1 198 ? 41.799  234.019 -7.795  1.00 19.11 ? 195  VAL A CG2   1 
ATOM   1542 N  N     . ILE A 1 199 ? 38.579  231.549 -9.767  1.00 13.77 ? 196  ILE A N     1 
ATOM   1543 C  CA    . ILE A 1 199 ? 37.471  231.189 -10.673 1.00 15.60 ? 196  ILE A CA    1 
ATOM   1544 C  C     . ILE A 1 199 ? 36.288  230.626 -9.847  1.00 17.76 ? 196  ILE A C     1 
ATOM   1545 O  O     . ILE A 1 199 ? 35.136  230.965 -10.099 1.00 15.72 ? 196  ILE A O     1 
ATOM   1546 C  CB    . ILE A 1 199 ? 37.882  230.240 -11.748 1.00 17.98 ? 196  ILE A CB    1 
ATOM   1547 C  CG1   . ILE A 1 199 ? 38.888  230.953 -12.687 1.00 17.70 ? 196  ILE A CG1   1 
ATOM   1548 C  CG2   . ILE A 1 199 ? 36.645  229.725 -12.554 1.00 17.57 ? 196  ILE A CG2   1 
ATOM   1549 C  CD1   . ILE A 1 199 ? 39.644  229.991 -13.551 1.00 18.04 ? 196  ILE A CD1   1 
ATOM   1550 N  N     . VAL A 1 200 ? 36.570  229.786 -8.847  1.00 16.59 ? 197  VAL A N     1 
ATOM   1551 C  CA    . VAL A 1 200 ? 35.490  229.208 -8.061  1.00 13.38 ? 197  VAL A CA    1 
ATOM   1552 C  C     . VAL A 1 200 ? 34.786  230.288 -7.238  1.00 15.98 ? 197  VAL A C     1 
ATOM   1553 O  O     . VAL A 1 200 ? 33.558  230.215 -7.013  1.00 15.00 ? 197  VAL A O     1 
ATOM   1554 C  CB    . VAL A 1 200 ? 36.070  228.077 -7.206  1.00 12.48 ? 197  VAL A CB    1 
ATOM   1555 C  CG1   . VAL A 1 200 ? 34.998  227.531 -6.238  1.00 14.48 ? 197  VAL A CG1   1 
ATOM   1556 C  CG2   . VAL A 1 200 ? 36.528  226.953 -8.137  1.00 13.83 ? 197  VAL A CG2   1 
ATOM   1557 N  N     . GLU A 1 201 ? 35.500  231.312 -6.761  1.00 14.29 ? 198  GLU A N     1 
ATOM   1558 C  CA    . GLU A 1 201 ? 34.815  232.428 -6.137  1.00 15.11 ? 198  GLU A CA    1 
ATOM   1559 C  C     . GLU A 1 201 ? 33.800  233.036 -7.103  1.00 16.71 ? 198  GLU A C     1 
ATOM   1560 O  O     . GLU A 1 201 ? 32.680  233.367 -6.670  1.00 15.79 ? 198  GLU A O     1 
ATOM   1561 C  CB    . GLU A 1 201 ? 35.797  233.572 -5.729  1.00 15.21 ? 198  GLU A CB    1 
ATOM   1562 C  CG    . GLU A 1 201 ? 36.756  233.230 -4.553  1.00 16.87 ? 198  GLU A CG    1 
ATOM   1563 C  CD    . GLU A 1 201 ? 36.191  233.408 -3.136  1.00 17.36 ? 198  GLU A CD    1 
ATOM   1564 O  OE1   . GLU A 1 201 ? 34.985  233.721 -2.952  1.00 19.62 ? 198  GLU A OE1   1 
ATOM   1565 O  OE2   . GLU A 1 201 ? 36.975  233.240 -2.144  1.00 15.93 ? 198  GLU A OE2   1 
ATOM   1566 N  N     . GLU A 1 202 ? 34.218  233.206 -8.354  1.00 14.93 ? 199  GLU A N     1 
ATOM   1567 C  CA    . GLU A 1 202 ? 33.321  233.792 -9.360  1.00 15.46 ? 199  GLU A CA    1 
ATOM   1568 C  C     . GLU A 1 202 ? 32.115  232.905 -9.582  1.00 17.12 ? 199  GLU A C     1 
ATOM   1569 O  O     . GLU A 1 202 ? 30.981  233.391 -9.694  1.00 16.25 ? 199  GLU A O     1 
ATOM   1570 C  CB    . GLU A 1 202 ? 34.067  234.006 -10.692 1.00 17.99 ? 199  GLU A CB    1 
ATOM   1571 C  CG    . GLU A 1 202 ? 35.240  235.056 -10.516 1.00 19.42 ? 199  GLU A CG    1 
ATOM   1572 C  CD    . GLU A 1 202 ? 36.329  235.004 -11.644 1.00 19.85 ? 199  GLU A CD    1 
ATOM   1573 O  OE1   . GLU A 1 202 ? 37.212  235.882 -11.603 1.00 27.16 ? 199  GLU A OE1   1 
ATOM   1574 O  OE2   . GLU A 1 202 ? 36.216  234.200 -12.582 1.00 28.35 ? 199  GLU A OE2   1 
ATOM   1575 N  N     . MET A 1 203 ? 32.387  231.604 -9.719  1.00 15.30 ? 200  MET A N     1 
ATOM   1576 C  CA    . MET A 1 203 ? 31.318  230.615 -9.921  1.00 14.79 ? 200  MET A CA    1 
ATOM   1577 C  C     . MET A 1 203 ? 30.334  230.623 -8.781  1.00 14.76 ? 200  MET A C     1 
ATOM   1578 O  O     . MET A 1 203 ? 29.087  230.588 -8.996  1.00 14.95 ? 200  MET A O     1 
ATOM   1579 C  CB    . MET A 1 203 ? 31.894  229.211 -10.063 1.00 15.87 ? 200  MET A CB    1 
ATOM   1580 C  CG    A MET A 1 203 ? 30.907  228.238 -10.408 0.40 16.03 ? 200  MET A CG    1 
ATOM   1581 C  CG    B MET A 1 203 ? 32.868  229.034 -11.165 0.60 16.56 ? 200  MET A CG    1 
ATOM   1582 S  SD    A MET A 1 203 ? 31.604  226.599 -10.666 0.40 22.21 ? 200  MET A SD    1 
ATOM   1583 S  SD    B MET A 1 203 ? 33.423  227.329 -11.203 0.60 21.23 ? 200  MET A SD    1 
ATOM   1584 C  CE    A MET A 1 203 ? 33.113  226.963 -11.558 0.40 20.11 ? 200  MET A CE    1 
ATOM   1585 C  CE    B MET A 1 203 ? 31.896  226.474 -11.573 0.60 13.71 ? 200  MET A CE    1 
ATOM   1586 N  N     . ARG A 1 204 ? 30.828  230.639 -7.547  1.00 13.59 ? 201  ARG A N     1 
ATOM   1587 C  CA    . ARG A 1 204 ? 29.943  230.633 -6.396  1.00 14.27 ? 201  ARG A CA    1 
ATOM   1588 C  C     . ARG A 1 204 ? 29.146  231.931 -6.278  1.00 16.30 ? 201  ARG A C     1 
ATOM   1589 O  O     . ARG A 1 204 ? 27.999  231.895 -5.858  1.00 15.67 ? 201  ARG A O     1 
ATOM   1590 C  CB    . ARG A 1 204 ? 30.780  230.383 -5.125  1.00 16.42 ? 201  ARG A CB    1 
ATOM   1591 C  CG    . ARG A 1 204 ? 31.231  228.884 -5.124  1.00 14.87 ? 201  ARG A CG    1 
ATOM   1592 C  CD    . ARG A 1 204 ? 32.061  228.613 -3.881  1.00 14.52 ? 201  ARG A CD    1 
ATOM   1593 N  NE    . ARG A 1 204 ? 31.377  229.010 -2.678  1.00 15.79 ? 201  ARG A NE    1 
ATOM   1594 C  CZ    . ARG A 1 204 ? 31.764  229.996 -1.872  1.00 16.16 ? 201  ARG A CZ    1 
ATOM   1595 N  NH1   . ARG A 1 204 ? 31.006  230.360 -0.857  1.00 15.94 ? 201  ARG A NH1   1 
ATOM   1596 N  NH2   . ARG A 1 204 ? 32.901  230.614 -2.082  1.00 19.32 ? 201  ARG A NH2   1 
ATOM   1597 N  N     . ALA A 1 205 ? 29.760  233.063 -6.663  1.00 17.15 ? 202  ALA A N     1 
ATOM   1598 C  CA    . ALA A 1 205 ? 29.049  234.341 -6.625  1.00 17.62 ? 202  ALA A CA    1 
ATOM   1599 C  C     . ALA A 1 205 ? 27.912  234.279 -7.665  1.00 15.32 ? 202  ALA A C     1 
ATOM   1600 O  O     . ALA A 1 205 ? 26.803  234.747 -7.394  1.00 16.90 ? 202  ALA A O     1 
ATOM   1601 C  CB    . ALA A 1 205 ? 29.983  235.474 -6.943  1.00 16.57 ? 202  ALA A CB    1 
ATOM   1602 N  N     . ALA A 1 206 ? 28.204  233.671 -8.822  1.00 15.13 ? 203  ALA A N     1 
ATOM   1603 C  CA    . ALA A 1 206 ? 27.171  233.593 -9.882  1.00 15.20 ? 203  ALA A CA    1 
ATOM   1604 C  C     . ALA A 1 206 ? 26.045  232.706 -9.405  1.00 15.22 ? 203  ALA A C     1 
ATOM   1605 O  O     . ALA A 1 206 ? 24.883  233.004 -9.658  1.00 15.95 ? 203  ALA A O     1 
ATOM   1606 C  CB    . ALA A 1 206 ? 27.744  233.071 -11.180 1.00 17.03 ? 203  ALA A CB    1 
ATOM   1607 N  N     . ILE A 1 207 ? 26.353  231.590 -8.743  1.00 13.27 ? 204  ILE A N     1 
ATOM   1608 C  CA    . ILE A 1 207 ? 25.250  230.723 -8.288  1.00 14.32 ? 204  ILE A CA    1 
ATOM   1609 C  C     . ILE A 1 207 ? 24.411  231.518 -7.312  1.00 15.59 ? 204  ILE A C     1 
ATOM   1610 O  O     . ILE A 1 207 ? 23.146  231.454 -7.375  1.00 14.37 ? 204  ILE A O     1 
ATOM   1611 C  CB    . ILE A 1 207 ? 25.804  229.463 -7.636  1.00 12.62 ? 204  ILE A CB    1 
ATOM   1612 C  CG1   . ILE A 1 207 ? 26.438  228.650 -8.718  1.00 13.47 ? 204  ILE A CG1   1 
ATOM   1613 C  CG2   . ILE A 1 207 ? 24.681  228.674 -6.922  1.00 13.39 ? 204  ILE A CG2   1 
ATOM   1614 C  CD1   . ILE A 1 207 ? 27.387  227.445 -8.115  1.00 15.07 ? 204  ILE A CD1   1 
ATOM   1615 N  N     . GLU A 1 208 ? 25.026  232.180 -6.352  1.00 15.63 ? 205  GLU A N     1 
ATOM   1616 C  CA    . GLU A 1 208 ? 24.213  232.857 -5.310  1.00 12.79 ? 205  GLU A CA    1 
ATOM   1617 C  C     . GLU A 1 208 ? 23.421  234.022 -5.912  1.00 13.82 ? 205  GLU A C     1 
ATOM   1618 O  O     . GLU A 1 208 ? 22.241  234.164 -5.643  1.00 16.58 ? 205  GLU A O     1 
ATOM   1619 C  CB    . GLU A 1 208 ? 25.068  233.330 -4.166  1.00 17.25 ? 205  GLU A CB    1 
ATOM   1620 C  CG    . GLU A 1 208 ? 24.211  233.867 -3.058  1.00 16.17 ? 205  GLU A CG    1 
ATOM   1621 C  CD    . GLU A 1 208 ? 24.996  234.337 -1.858  1.00 21.20 ? 205  GLU A CD    1 
ATOM   1622 O  OE1   . GLU A 1 208 ? 24.343  234.723 -0.879  1.00 24.79 ? 205  GLU A OE1   1 
ATOM   1623 O  OE2   . GLU A 1 208 ? 26.263  234.361 -1.919  1.00 22.93 ? 205  GLU A OE2   1 
ATOM   1624 N  N     . ARG A 1 209 ? 24.056  234.798 -6.783  1.00 14.29 ? 206  ARG A N     1 
ATOM   1625 C  CA    A ARG A 1 209 ? 23.370  235.915 -7.479  0.60 16.04 ? 206  ARG A CA    1 
ATOM   1626 C  CA    B ARG A 1 209 ? 23.314  235.916 -7.375  0.40 16.06 ? 206  ARG A CA    1 
ATOM   1627 C  C     . ARG A 1 209 ? 22.145  235.424 -8.236  1.00 16.41 ? 206  ARG A C     1 
ATOM   1628 O  O     . ARG A 1 209 ? 21.068  236.038 -8.164  1.00 17.96 ? 206  ARG A O     1 
ATOM   1629 C  CB    A ARG A 1 209 ? 24.314  236.640 -8.491  0.60 17.88 ? 206  ARG A CB    1 
ATOM   1630 C  CB    B ARG A 1 209 ? 24.220  236.843 -8.213  0.40 18.53 ? 206  ARG A CB    1 
ATOM   1631 C  CG    A ARG A 1 209 ? 23.560  237.806 -9.222  0.60 19.77 ? 206  ARG A CG    1 
ATOM   1632 C  CG    B ARG A 1 209 ? 23.540  238.217 -8.387  0.40 19.36 ? 206  ARG A CG    1 
ATOM   1633 C  CD    A ARG A 1 209 ? 24.453  238.616 -10.179 0.60 22.39 ? 206  ARG A CD    1 
ATOM   1634 C  CD    B ARG A 1 209 ? 24.167  239.086 -9.447  0.40 20.89 ? 206  ARG A CD    1 
ATOM   1635 N  NE    A ARG A 1 209 ? 24.464  238.063 -11.536 0.60 24.31 ? 206  ARG A NE    1 
ATOM   1636 N  NE    B ARG A 1 209 ? 23.398  239.260 -10.673 0.40 23.28 ? 206  ARG A NE    1 
ATOM   1637 C  CZ    A ARG A 1 209 ? 23.455  238.135 -12.405 0.60 22.51 ? 206  ARG A CZ    1 
ATOM   1638 C  CZ    B ARG A 1 209 ? 22.219  239.878 -10.816 0.40 20.48 ? 206  ARG A CZ    1 
ATOM   1639 N  NH1   A ARG A 1 209 ? 23.588  237.576 -13.620 0.60 19.21 ? 206  ARG A NH1   1 
ATOM   1640 N  NH1   B ARG A 1 209 ? 21.763  239.944 -12.056 0.40 22.68 ? 206  ARG A NH1   1 
ATOM   1641 N  NH2   A ARG A 1 209 ? 22.312  238.703 -12.041 0.60 16.97 ? 206  ARG A NH2   1 
ATOM   1642 N  NH2   B ARG A 1 209 ? 21.475  240.371 -9.789  0.40 9.27  ? 206  ARG A NH2   1 
ATOM   1643 N  N     . GLU A 1 210 ? 22.320  234.354 -9.012  1.00 14.05 ? 207  GLU A N     1 
ATOM   1644 C  CA    . GLU A 1 210 ? 21.297  233.933 -9.982  1.00 14.58 ? 207  GLU A CA    1 
ATOM   1645 C  C     . GLU A 1 210 ? 20.250  232.968 -9.438  1.00 12.92 ? 207  GLU A C     1 
ATOM   1646 O  O     . GLU A 1 210 ? 19.175  232.755 -10.087 1.00 13.97 ? 207  GLU A O     1 
ATOM   1647 C  CB    . GLU A 1 210 ? 21.946  233.303 -11.203 1.00 14.58 ? 207  GLU A CB    1 
ATOM   1648 C  CG    . GLU A 1 210 ? 22.846  234.298 -11.896 1.00 14.23 ? 207  GLU A CG    1 
ATOM   1649 C  CD    . GLU A 1 210 ? 23.567  233.764 -13.121 1.00 23.29 ? 207  GLU A CD    1 
ATOM   1650 O  OE1   . GLU A 1 210 ? 23.050  232.856 -13.808 1.00 22.73 ? 207  GLU A OE1   1 
ATOM   1651 O  OE2   . GLU A 1 210 ? 24.673  234.284 -13.407 1.00 28.08 ? 207  GLU A OE2   1 
ATOM   1652 N  N     . THR A 1 211 ? 20.548  232.370 -8.273  1.00 13.62 ? 208  THR A N     1 
ATOM   1653 C  CA    . THR A 1 211 ? 19.561  231.448 -7.694  1.00 12.39 ? 208  THR A CA    1 
ATOM   1654 C  C     . THR A 1 211 ? 19.133  231.772 -6.305  1.00 14.65 ? 208  THR A C     1 
ATOM   1655 O  O     . THR A 1 211 ? 18.107  231.246 -5.854  1.00 15.61 ? 208  THR A O     1 
ATOM   1656 C  CB    . THR A 1 211 ? 20.070  229.969 -7.653  1.00 13.75 ? 208  THR A CB    1 
ATOM   1657 O  OG1   . THR A 1 211 ? 21.152  229.845 -6.710  1.00 15.08 ? 208  THR A OG1   1 
ATOM   1658 C  CG2   . THR A 1 211 ? 20.551  229.516 -9.023  1.00 15.25 ? 208  THR A CG2   1 
ATOM   1659 N  N     . GLY A 1 212 ? 19.960  232.485 -5.551  1.00 13.62 ? 209  GLY A N     1 
ATOM   1660 C  CA    . GLY A 1 212 ? 19.686  232.708 -4.134  1.00 14.38 ? 209  GLY A CA    1 
ATOM   1661 C  C     . GLY A 1 212 ? 20.362  231.677 -3.246  1.00 19.48 ? 209  GLY A C     1 
ATOM   1662 O  O     . GLY A 1 212 ? 20.314  231.812 -2.037  1.00 23.05 ? 209  GLY A O     1 
ATOM   1663 N  N     . PHE A 1 213 ? 20.962  230.656 -3.841  1.00 14.33 ? 210  PHE A N     1 
ATOM   1664 C  CA    . PHE A 1 213 ? 21.457  229.538 -3.021  1.00 13.18 ? 210  PHE A CA    1 
ATOM   1665 C  C     . PHE A 1 213 ? 22.938  229.744 -2.713  1.00 16.05 ? 210  PHE A C     1 
ATOM   1666 O  O     . PHE A 1 213 ? 23.700  230.077 -3.604  1.00 16.84 ? 210  PHE A O     1 
ATOM   1667 C  CB    . PHE A 1 213 ? 21.302  228.205 -3.769  1.00 13.92 ? 210  PHE A CB    1 
ATOM   1668 C  CG    . PHE A 1 213 ? 19.886  227.883 -4.169  1.00 13.16 ? 210  PHE A CG    1 
ATOM   1669 C  CD1   . PHE A 1 213 ? 19.632  227.245 -5.394  1.00 13.27 ? 210  PHE A CD1   1 
ATOM   1670 C  CD2   . PHE A 1 213 ? 18.805  228.190 -3.311  1.00 13.53 ? 210  PHE A CD2   1 
ATOM   1671 C  CE1   . PHE A 1 213 ? 18.321  226.901 -5.787  1.00 13.57 ? 210  PHE A CE1   1 
ATOM   1672 C  CE2   . PHE A 1 213 ? 17.495  227.838 -3.721  1.00 12.97 ? 210  PHE A CE2   1 
ATOM   1673 C  CZ    . PHE A 1 213 ? 17.295  227.183 -4.910  1.00 10.91 ? 210  PHE A CZ    1 
ATOM   1674 N  N     . GLN A 1 214 ? 23.324  229.491 -1.469  1.00 14.28 ? 211  GLN A N     1 
ATOM   1675 C  CA    . GLN A 1 214 ? 24.758  229.468 -1.084  1.00 14.90 ? 211  GLN A CA    1 
ATOM   1676 C  C     . GLN A 1 214 ? 25.339  228.058 -1.204  1.00 13.79 ? 211  GLN A C     1 
ATOM   1677 O  O     . GLN A 1 214 ? 24.622  227.050 -1.105  1.00 13.29 ? 211  GLN A O     1 
ATOM   1678 C  CB    . GLN A 1 214 ? 24.936  229.984 0.346   1.00 14.95 ? 211  GLN A CB    1 
ATOM   1679 C  CG    . GLN A 1 214 ? 24.685  231.528 0.353   1.00 16.82 ? 211  GLN A CG    1 
ATOM   1680 C  CD    . GLN A 1 214 ? 24.862  232.132 1.731   1.00 19.29 ? 211  GLN A CD    1 
ATOM   1681 O  OE1   . GLN A 1 214 ? 24.996  231.416 2.731   1.00 18.47 ? 211  GLN A OE1   1 
ATOM   1682 N  NE2   . GLN A 1 214 ? 24.916  233.472 1.769   1.00 20.17 ? 211  GLN A NE2   1 
ATOM   1683 N  N     . CYS A 1 215 ? 26.665  228.028 -1.369  1.00 13.62 ? 212  CYS A N     1 
ATOM   1684 C  CA    . CYS A 1 215 ? 27.323  226.715 -1.502  1.00 13.29 ? 212  CYS A CA    1 
ATOM   1685 C  C     . CYS A 1 215 ? 28.714  226.848 -0.970  1.00 13.49 ? 212  CYS A C     1 
ATOM   1686 O  O     . CYS A 1 215 ? 29.233  227.981 -0.722  1.00 15.26 ? 212  CYS A O     1 
ATOM   1687 C  CB    . CYS A 1 215 ? 27.322  226.235 -2.975  1.00 13.66 ? 212  CYS A CB    1 
ATOM   1688 S  SG    . CYS A 1 215 ? 28.302  227.313 -4.021  1.00 19.39 ? 212  CYS A SG    1 
ATOM   1689 N  N     . SER A 1 216 ? 29.311  225.701 -0.788  1.00 12.72 ? 213  SER A N     1 
ATOM   1690 C  CA    A SER A 1 216 ? 30.738  225.608 -0.430  0.90 14.12 ? 213  SER A CA    1 
ATOM   1691 C  CA    B SER A 1 216 ? 30.731  225.674 -0.455  0.10 14.14 ? 213  SER A CA    1 
ATOM   1692 C  C     . SER A 1 216 ? 31.501  224.947 -1.549  1.00 15.50 ? 213  SER A C     1 
ATOM   1693 O  O     . SER A 1 216 ? 30.915  224.372 -2.435  1.00 13.95 ? 213  SER A O     1 
ATOM   1694 C  CB    A SER A 1 216 ? 30.888  224.823 0.830   0.90 14.92 ? 213  SER A CB    1 
ATOM   1695 C  CB    B SER A 1 216 ? 30.962  225.018 0.899   0.10 15.02 ? 213  SER A CB    1 
ATOM   1696 O  OG    A SER A 1 216 ? 30.266  225.565 1.885   0.90 15.45 ? 213  SER A OG    1 
ATOM   1697 O  OG    B SER A 1 216 ? 30.661  223.646 0.855   0.10 14.45 ? 213  SER A OG    1 
ATOM   1698 N  N     . ALA A 1 217 ? 32.823  225.040 -1.525  1.00 13.11 ? 214  ALA A N     1 
ATOM   1699 C  CA    . ALA A 1 217 ? 33.586  224.329 -2.524  1.00 10.76 ? 214  ALA A CA    1 
ATOM   1700 C  C     . ALA A 1 217 ? 34.947  223.932 -2.022  1.00 13.88 ? 214  ALA A C     1 
ATOM   1701 O  O     . ALA A 1 217 ? 35.472  224.568 -1.142  1.00 12.91 ? 214  ALA A O     1 
ATOM   1702 C  CB    . ALA A 1 217 ? 33.774  225.183 -3.826  1.00 14.50 ? 214  ALA A CB    1 
ATOM   1703 N  N     . GLY A 1 218 ? 35.518  222.922 -2.671  1.00 13.28 ? 215  GLY A N     1 
ATOM   1704 C  CA    . GLY A 1 218 ? 36.934  222.547 -2.452  1.00 13.41 ? 215  GLY A CA    1 
ATOM   1705 C  C     . GLY A 1 218 ? 37.694  222.737 -3.746  1.00 14.04 ? 215  GLY A C     1 
ATOM   1706 O  O     . GLY A 1 218 ? 37.171  222.400 -4.826  1.00 13.76 ? 215  GLY A O     1 
ATOM   1707 N  N     . ILE A 1 219 ? 38.974  223.173 -3.677  1.00 12.16 ? 216  ILE A N     1 
ATOM   1708 C  CA    . ILE A 1 219 ? 39.814  223.288 -4.856  1.00 11.39 ? 216  ILE A CA    1 
ATOM   1709 C  C     . ILE A 1 219 ? 41.090  222.510 -4.540  1.00 12.06 ? 216  ILE A C     1 
ATOM   1710 O  O     . ILE A 1 219 ? 41.750  222.798 -3.542  1.00 12.49 ? 216  ILE A O     1 
ATOM   1711 C  CB    . ILE A 1 219 ? 40.183  224.755 -5.170  1.00 12.75 ? 216  ILE A CB    1 
ATOM   1712 C  CG1   . ILE A 1 219 ? 38.916  225.621 -5.391  1.00 14.19 ? 216  ILE A CG1   1 
ATOM   1713 C  CG2   . ILE A 1 219 ? 41.056  224.830 -6.426  1.00 14.53 ? 216  ILE A CG2   1 
ATOM   1714 C  CD1   . ILE A 1 219 ? 38.460  226.354 -4.140  1.00 17.85 ? 216  ILE A CD1   1 
ATOM   1715 N  N     . SER A 1 220 ? 41.410  221.541 -5.383  1.00 12.55 ? 217  SER A N     1 
ATOM   1716 C  CA    . SER A 1 220 ? 42.660  220.801 -5.241  1.00 10.86 ? 217  SER A CA    1 
ATOM   1717 C  C     . SER A 1 220 ? 43.084  220.214 -6.562  1.00 13.23 ? 217  SER A C     1 
ATOM   1718 O  O     . SER A 1 220 ? 42.694  220.763 -7.609  1.00 13.75 ? 217  SER A O     1 
ATOM   1719 C  CB    . SER A 1 220 ? 42.495  219.738 -4.136  1.00 14.36 ? 217  SER A CB    1 
ATOM   1720 O  OG    . SER A 1 220 ? 43.786  219.211 -3.787  1.00 14.63 ? 217  SER A OG    1 
ATOM   1721 N  N     . HIS A 1 221 ? 43.906  219.165 -6.547  1.00 12.80 ? 218  HIS A N     1 
ATOM   1722 C  CA    . HIS A 1 221 ? 44.407  218.568 -7.760  1.00 12.78 ? 218  HIS A CA    1 
ATOM   1723 C  C     . HIS A 1 221 ? 43.620  217.343 -8.215  1.00 14.45 ? 218  HIS A C     1 
ATOM   1724 O  O     . HIS A 1 221 ? 43.956  216.765 -9.250  1.00 14.71 ? 218  HIS A O     1 
ATOM   1725 C  CB    . HIS A 1 221 ? 45.909  218.218 -7.555  1.00 14.36 ? 218  HIS A CB    1 
ATOM   1726 C  CG    . HIS A 1 221 ? 46.789  219.427 -7.468  1.00 16.23 ? 218  HIS A CG    1 
ATOM   1727 N  ND1   . HIS A 1 221 ? 46.914  220.331 -8.509  1.00 14.84 ? 218  HIS A ND1   1 
ATOM   1728 C  CD2   . HIS A 1 221 ? 47.617  219.876 -6.471  1.00 14.89 ? 218  HIS A CD2   1 
ATOM   1729 C  CE1   . HIS A 1 221 ? 47.746  221.298 -8.143  1.00 15.76 ? 218  HIS A CE1   1 
ATOM   1730 N  NE2   . HIS A 1 221 ? 48.176  221.054 -6.912  1.00 16.65 ? 218  HIS A NE2   1 
ATOM   1731 N  N     . ASN A 1 222 ? 42.615  216.910 -7.452  1.00 13.05 ? 219  ASN A N     1 
ATOM   1732 C  CA    . ASN A 1 222 ? 41.865  215.707 -7.840  1.00 13.46 ? 219  ASN A CA    1 
ATOM   1733 C  C     . ASN A 1 222 ? 40.548  215.714 -7.057  1.00 13.45 ? 219  ASN A C     1 
ATOM   1734 O  O     . ASN A 1 222 ? 40.299  216.602 -6.186  1.00 15.08 ? 219  ASN A O     1 
ATOM   1735 C  CB    . ASN A 1 222 ? 42.659  214.415 -7.573  1.00 13.22 ? 219  ASN A CB    1 
ATOM   1736 C  CG    . ASN A 1 222 ? 43.163  214.342 -6.117  1.00 16.94 ? 219  ASN A CG    1 
ATOM   1737 O  OD1   . ASN A 1 222 ? 42.376  214.330 -5.189  1.00 16.80 ? 219  ASN A OD1   1 
ATOM   1738 N  ND2   . ASN A 1 222 ? 44.471  214.262 -5.924  1.00 14.79 ? 219  ASN A ND2   1 
ATOM   1739 N  N     . LYS A 1 223 ? 39.667  214.818 -7.477  1.00 14.77 ? 220  LYS A N     1 
ATOM   1740 C  CA    . LYS A 1 223 ? 38.326  214.747 -6.909  1.00 14.06 ? 220  LYS A CA    1 
ATOM   1741 C  C     . LYS A 1 223 ? 38.290  214.475 -5.426  1.00 15.91 ? 220  LYS A C     1 
ATOM   1742 O  O     . LYS A 1 223 ? 37.493  215.105 -4.707  1.00 13.62 ? 220  LYS A O     1 
ATOM   1743 C  CB    . LYS A 1 223 ? 37.492  213.697 -7.679  1.00 17.85 ? 220  LYS A CB    1 
ATOM   1744 C  CG    . LYS A 1 223 ? 37.184  214.137 -9.109  1.00 16.27 ? 220  LYS A CG    1 
ATOM   1745 C  CD    . LYS A 1 223 ? 36.649  212.926 -9.951  1.00 26.10 ? 220  LYS A CD    1 
ATOM   1746 C  CE    . LYS A 1 223 ? 35.237  212.672 -9.934  1.00 33.80 ? 220  LYS A CE    1 
ATOM   1747 N  NZ    . LYS A 1 223 ? 35.005  211.587 -11.000 1.00 22.01 ? 220  LYS A NZ    1 
ATOM   1748 N  N     . VAL A 1 224 ? 39.036  213.489 -4.944  1.00 14.05 ? 221  VAL A N     1 
ATOM   1749 C  CA    . VAL A 1 224 ? 39.015  213.139 -3.529  1.00 13.96 ? 221  VAL A CA    1 
ATOM   1750 C  C     . VAL A 1 224 ? 39.474  214.280 -2.655  1.00 13.19 ? 221  VAL A C     1 
ATOM   1751 O  O     . VAL A 1 224 ? 38.791  214.632 -1.679  1.00 14.78 ? 221  VAL A O     1 
ATOM   1752 C  CB    . VAL A 1 224 ? 39.898  211.911 -3.231  1.00 15.91 ? 221  VAL A CB    1 
ATOM   1753 C  CG1   . VAL A 1 224 ? 40.212  211.827 -1.744  1.00 16.94 ? 221  VAL A CG1   1 
ATOM   1754 C  CG2   . VAL A 1 224 ? 39.146  210.669 -3.783  1.00 18.57 ? 221  VAL A CG2   1 
ATOM   1755 N  N     . LEU A 1 225 ? 40.564  214.955 -3.051  1.00 12.95 ? 222  LEU A N     1 
ATOM   1756 C  CA    . LEU A 1 225 ? 40.997  216.080 -2.236  1.00 13.95 ? 222  LEU A CA    1 
ATOM   1757 C  C     . LEU A 1 225 ? 40.033  217.293 -2.359  1.00 13.14 ? 222  LEU A C     1 
ATOM   1758 O  O     . LEU A 1 225 ? 39.833  217.994 -1.368  1.00 12.96 ? 222  LEU A O     1 
ATOM   1759 C  CB    . LEU A 1 225 ? 42.409  216.565 -2.576  1.00 12.25 ? 222  LEU A CB    1 
ATOM   1760 C  CG    . LEU A 1 225 ? 43.432  215.464 -2.221  1.00 12.42 ? 222  LEU A CG    1 
ATOM   1761 C  CD1   . LEU A 1 225 ? 44.818  216.025 -2.676  1.00 14.38 ? 222  LEU A CD1   1 
ATOM   1762 C  CD2   . LEU A 1 225 ? 43.503  215.201 -0.731  1.00 14.59 ? 222  LEU A CD2   1 
ATOM   1763 N  N     . ALA A 1 226 ? 39.392  217.463 -3.535  1.00 12.06 ? 223  ALA A N     1 
ATOM   1764 C  CA    . ALA A 1 226 ? 38.491  218.607 -3.638  1.00 10.76 ? 223  ALA A CA    1 
ATOM   1765 C  C     . ALA A 1 226 ? 37.267  218.363 -2.783  1.00 13.75 ? 223  ALA A C     1 
ATOM   1766 O  O     . ALA A 1 226 ? 36.736  219.323 -2.215  1.00 12.61 ? 223  ALA A O     1 
ATOM   1767 C  CB    . ALA A 1 226 ? 38.113  218.818 -5.092  1.00 14.12 ? 223  ALA A CB    1 
ATOM   1768 N  N     . LYS A 1 227 ? 36.774  217.120 -2.739  1.00 13.27 ? 224  LYS A N     1 
ATOM   1769 C  CA    . LYS A 1 227 ? 35.595  216.795 -1.957  1.00 14.01 ? 224  LYS A CA    1 
ATOM   1770 C  C     . LYS A 1 227 ? 35.904  216.962 -0.473  1.00 14.36 ? 224  LYS A C     1 
ATOM   1771 O  O     . LYS A 1 227 ? 35.107  217.539 0.257   1.00 15.41 ? 224  LYS A O     1 
ATOM   1772 C  CB    . LYS A 1 227 ? 35.119  215.352 -2.245  1.00 12.94 ? 224  LYS A CB    1 
ATOM   1773 C  CG    . LYS A 1 227 ? 33.947  214.893 -1.375  1.00 15.11 ? 224  LYS A CG    1 
ATOM   1774 C  CD    . LYS A 1 227 ? 32.683  215.783 -1.621  1.00 22.12 ? 224  LYS A CD    1 
ATOM   1775 C  CE    . LYS A 1 227 ? 31.440  215.063 -0.962  1.00 23.18 ? 224  LYS A CE    1 
ATOM   1776 N  NZ    . LYS A 1 227 ? 30.151  215.825 -0.750  1.00 22.38 ? 224  LYS A NZ    1 
ATOM   1777 N  N     . LEU A 1 228 ? 37.088  216.476 -0.055  1.00 13.92 ? 225  LEU A N     1 
ATOM   1778 C  CA    . LEU A 1 228 ? 37.460  216.554 1.330   1.00 13.88 ? 225  LEU A CA    1 
ATOM   1779 C  C     . LEU A 1 228 ? 37.608  218.020 1.733   1.00 14.79 ? 225  LEU A C     1 
ATOM   1780 O  O     . LEU A 1 228 ? 37.100  218.471 2.797   1.00 16.88 ? 225  LEU A O     1 
ATOM   1781 C  CB    . LEU A 1 228 ? 38.767  215.788 1.530   1.00 17.26 ? 225  LEU A CB    1 
ATOM   1782 C  CG    . LEU A 1 228 ? 39.174  215.695 2.982   1.00 22.84 ? 225  LEU A CG    1 
ATOM   1783 C  CD1   . LEU A 1 228 ? 38.144  214.769 3.726   1.00 22.36 ? 225  LEU A CD1   1 
ATOM   1784 C  CD2   . LEU A 1 228 ? 40.553  215.095 3.043   1.00 18.52 ? 225  LEU A CD2   1 
ATOM   1785 N  N     . ALA A 1 229 ? 38.244  218.786 0.841   1.00 13.35 ? 226  ALA A N     1 
ATOM   1786 C  CA    . ALA A 1 229 ? 38.468  220.225 1.024   1.00 13.40 ? 226  ALA A CA    1 
ATOM   1787 C  C     . ALA A 1 229 ? 37.124  220.967 1.216   1.00 14.20 ? 226  ALA A C     1 
ATOM   1788 O  O     . ALA A 1 229 ? 37.005  221.841 2.071   1.00 16.43 ? 226  ALA A O     1 
ATOM   1789 C  CB    . ALA A 1 229 ? 39.248  220.826 -0.181  1.00 13.26 ? 226  ALA A CB    1 
ATOM   1790 N  N     . CYS A 1 230 ? 36.125  220.639 0.386   1.00 13.86 ? 227  CYS A N     1 
ATOM   1791 C  CA    . CYS A 1 230 ? 34.856  221.352 0.448   1.00 12.55 ? 227  CYS A CA    1 
ATOM   1792 C  C     . CYS A 1 230 ? 34.215  221.318 1.842   1.00 14.16 ? 227  CYS A C     1 
ATOM   1793 O  O     . CYS A 1 230 ? 33.717  222.334 2.372   1.00 16.06 ? 227  CYS A O     1 
ATOM   1794 C  CB    . CYS A 1 230 ? 33.938  220.664 -0.598  1.00 12.01 ? 227  CYS A CB    1 
ATOM   1795 S  SG    . CYS A 1 230 ? 32.306  221.459 -0.701  1.00 15.73 ? 227  CYS A SG    1 
ATOM   1796 N  N     . GLY A 1 231 ? 34.294  220.145 2.460   1.00 14.63 ? 228  GLY A N     1 
ATOM   1797 C  CA    . GLY A 1 231 ? 33.636  220.024 3.764   1.00 15.57 ? 228  GLY A CA    1 
ATOM   1798 C  C     . GLY A 1 231 ? 34.414  220.668 4.913   1.00 19.06 ? 228  GLY A C     1 
ATOM   1799 O  O     . GLY A 1 231 ? 33.880  220.809 6.021   1.00 19.25 ? 228  GLY A O     1 
ATOM   1800 N  N     . LEU A 1 232 ? 35.637  221.122 4.687   1.00 15.47 ? 229  LEU A N     1 
ATOM   1801 C  CA    . LEU A 1 232 ? 36.427  221.566 5.827   1.00 14.96 ? 229  LEU A CA    1 
ATOM   1802 C  C     . LEU A 1 232 ? 35.922  222.894 6.374   1.00 18.47 ? 229  LEU A C     1 
ATOM   1803 O  O     . LEU A 1 232 ? 36.149  223.205 7.561   1.00 17.50 ? 229  LEU A O     1 
ATOM   1804 C  CB    . LEU A 1 232 ? 37.897  221.704 5.446   1.00 17.23 ? 229  LEU A CB    1 
ATOM   1805 C  CG    . LEU A 1 232 ? 38.617  220.380 5.127   1.00 21.05 ? 229  LEU A CG    1 
ATOM   1806 C  CD1   . LEU A 1 232 ? 40.052  220.610 4.678   1.00 18.87 ? 229  LEU A CD1   1 
ATOM   1807 C  CD2   . LEU A 1 232 ? 38.509  219.389 6.328   1.00 23.68 ? 229  LEU A CD2   1 
ATOM   1808 N  N     . ASN A 1 233 ? 35.310  223.712 5.509   1.00 15.64 ? 230  ASN A N     1 
ATOM   1809 C  CA    . ASN A 1 233 ? 34.838  224.989 5.991   1.00 14.70 ? 230  ASN A CA    1 
ATOM   1810 C  C     . ASN A 1 233 ? 33.439  225.389 5.565   1.00 16.48 ? 230  ASN A C     1 
ATOM   1811 O  O     . ASN A 1 233 ? 33.074  226.571 5.681   1.00 19.21 ? 230  ASN A O     1 
ATOM   1812 C  CB    . ASN A 1 233 ? 35.773  226.112 5.594   1.00 16.81 ? 230  ASN A CB    1 
ATOM   1813 C  CG    . ASN A 1 233 ? 37.171  225.974 6.265   1.00 16.29 ? 230  ASN A CG    1 
ATOM   1814 O  OD1   . ASN A 1 233 ? 38.171  225.490 5.643   1.00 19.61 ? 230  ASN A OD1   1 
ATOM   1815 N  ND2   . ASN A 1 233 ? 37.268  226.434 7.485   1.00 15.00 ? 230  ASN A ND2   1 
ATOM   1816 N  N     . LYS A 1 234 ? 32.631  224.391 5.359   1.00 20.05 ? 231  LYS A N     1 
ATOM   1817 C  CA    . LYS A 1 234 ? 31.210  224.571 5.085   1.00 19.34 ? 231  LYS A CA    1 
ATOM   1818 C  C     . LYS A 1 234 ? 30.580  225.179 6.337   1.00 19.35 ? 231  LYS A C     1 
ATOM   1819 O  O     . LYS A 1 234 ? 30.960  224.752 7.457   1.00 24.82 ? 231  LYS A O     1 
ATOM   1820 C  CB    . LYS A 1 234 ? 30.639  223.178 4.759   1.00 22.87 ? 231  LYS A CB    1 
ATOM   1821 C  CG    . LYS A 1 234 ? 29.550  223.062 3.829   1.00 24.04 ? 231  LYS A CG    1 
ATOM   1822 C  CD    . LYS A 1 234 ? 29.223  221.630 3.579   1.00 19.80 ? 231  LYS A CD    1 
ATOM   1823 C  CE    . LYS A 1 234 ? 28.998  221.435 2.067   1.00 19.22 ? 231  LYS A CE    1 
ATOM   1824 N  NZ    . LYS A 1 234 ? 27.804  222.255 1.526   1.00 14.23 ? 231  LYS A NZ    1 
ATOM   1825 N  N     . PRO A 1 235 ? 29.578  226.091 6.232   1.00 17.94 ? 232  PRO A N     1 
ATOM   1826 C  CA    . PRO A 1 235 ? 28.913  226.513 4.982   1.00 17.42 ? 232  PRO A CA    1 
ATOM   1827 C  C     . PRO A 1 235 ? 29.437  227.849 4.442   1.00 16.06 ? 232  PRO A C     1 
ATOM   1828 O  O     . PRO A 1 235 ? 30.112  228.646 5.139   1.00 17.31 ? 232  PRO A O     1 
ATOM   1829 C  CB    . PRO A 1 235 ? 27.438  226.683 5.403   1.00 19.66 ? 232  PRO A CB    1 
ATOM   1830 C  CG    . PRO A 1 235 ? 27.562  227.323 6.834   1.00 20.70 ? 232  PRO A CG    1 
ATOM   1831 C  CD    . PRO A 1 235 ? 28.865  226.628 7.414   1.00 21.15 ? 232  PRO A CD    1 
ATOM   1832 N  N     . ASN A 1 236 ? 29.071  228.106 3.195   1.00 14.51 ? 233  ASN A N     1 
ATOM   1833 C  CA    . ASN A 1 236 ? 29.325  229.384 2.521   1.00 13.76 ? 233  ASN A CA    1 
ATOM   1834 C  C     . ASN A 1 236 ? 30.804  229.781 2.482   1.00 14.15 ? 233  ASN A C     1 
ATOM   1835 O  O     . ASN A 1 236 ? 31.115  230.959 2.522   1.00 15.81 ? 233  ASN A O     1 
ATOM   1836 C  CB    . ASN A 1 236 ? 28.509  230.519 3.168   1.00 16.19 ? 233  ASN A CB    1 
ATOM   1837 C  CG    . ASN A 1 236 ? 28.384  231.723 2.230   1.00 16.27 ? 233  ASN A CG    1 
ATOM   1838 O  OD1   . ASN A 1 236 ? 28.396  231.579 1.022   1.00 20.33 ? 233  ASN A OD1   1 
ATOM   1839 N  ND2   . ASN A 1 236 ? 28.328  232.924 2.819   1.00 23.29 ? 233  ASN A ND2   1 
ATOM   1840 N  N     . ARG A 1 237 ? 31.702  228.802 2.345   1.00 12.91 ? 234  ARG A N     1 
ATOM   1841 C  CA    . ARG A 1 237 ? 33.126  229.108 2.216   1.00 14.06 ? 234  ARG A CA    1 
ATOM   1842 C  C     . ARG A 1 237 ? 33.757  228.136 1.265   1.00 13.56 ? 234  ARG A C     1 
ATOM   1843 O  O     . ARG A 1 237 ? 33.189  227.062 1.025   1.00 14.86 ? 234  ARG A O     1 
ATOM   1844 C  CB    . ARG A 1 237 ? 33.885  228.992 3.581   1.00 14.86 ? 234  ARG A CB    1 
ATOM   1845 C  CG    . ARG A 1 237 ? 33.430  229.958 4.632   1.00 14.95 ? 234  ARG A CG    1 
ATOM   1846 C  CD    . ARG A 1 237 ? 33.734  231.405 4.202   1.00 18.66 ? 234  ARG A CD    1 
ATOM   1847 N  NE    . ARG A 1 237 ? 33.463  232.376 5.282   1.00 22.88 ? 234  ARG A NE    1 
ATOM   1848 C  CZ    . ARG A 1 237 ? 32.334  233.089 5.383   1.00 30.22 ? 234  ARG A CZ    1 
ATOM   1849 N  NH1   . ARG A 1 237 ? 31.349  232.933 4.507   1.00 30.17 ? 234  ARG A NH1   1 
ATOM   1850 N  NH2   . ARG A 1 237 ? 32.181  233.984 6.375   1.00 32.04 ? 234  ARG A NH2   1 
ATOM   1851 N  N     . GLN A 1 238 ? 34.950  228.423 0.801   1.00 13.88 ? 235  GLN A N     1 
ATOM   1852 C  CA    . GLN A 1 238 ? 35.646  227.440 -0.047  1.00 13.27 ? 235  GLN A CA    1 
ATOM   1853 C  C     . GLN A 1 238 ? 37.047  227.241 0.493   1.00 14.38 ? 235  GLN A C     1 
ATOM   1854 O  O     . GLN A 1 238 ? 37.596  228.143 1.146   1.00 13.88 ? 235  GLN A O     1 
ATOM   1855 C  CB    . GLN A 1 238 ? 35.706  227.916 -1.500  1.00 14.21 ? 235  GLN A CB    1 
ATOM   1856 C  CG    . GLN A 1 238 ? 36.315  229.338 -1.679  1.00 15.74 ? 235  GLN A CG    1 
ATOM   1857 C  CD    . GLN A 1 238 ? 36.248  229.768 -3.126  1.00 15.76 ? 235  GLN A CD    1 
ATOM   1858 O  OE1   . GLN A 1 238 ? 35.141  229.874 -3.711  1.00 17.49 ? 235  GLN A OE1   1 
ATOM   1859 N  NE2   . GLN A 1 238 ? 37.398  229.950 -3.771  1.00 14.27 ? 235  GLN A NE2   1 
ATOM   1860 N  N     . THR A 1 239 ? 37.613  226.090 0.187   1.00 13.28 ? 236  THR A N     1 
ATOM   1861 C  CA    . THR A 1 239 ? 38.888  225.678 0.797   1.00 11.59 ? 236  THR A CA    1 
ATOM   1862 C  C     . THR A 1 239 ? 39.813  225.149 -0.262  1.00 12.21 ? 236  THR A C     1 
ATOM   1863 O  O     . THR A 1 239 ? 39.434  224.267 -1.042  1.00 14.65 ? 236  THR A O     1 
ATOM   1864 C  CB    . THR A 1 239 ? 38.628  224.616 1.831   1.00 14.24 ? 236  THR A CB    1 
ATOM   1865 O  OG1   . THR A 1 239 ? 37.740  225.121 2.814   1.00 14.36 ? 236  THR A OG1   1 
ATOM   1866 C  CG2   . THR A 1 239 ? 39.918  224.194 2.619   1.00 16.07 ? 236  THR A CG2   1 
ATOM   1867 N  N     . LEU A 1 240 ? 41.063  225.653 -0.255  1.00 12.36 ? 237  LEU A N     1 
ATOM   1868 C  CA    . LEU A 1 240 ? 42.113  225.206 -1.152  1.00 13.02 ? 237  LEU A CA    1 
ATOM   1869 C  C     . LEU A 1 240 ? 42.987  224.211 -0.376  1.00 13.21 ? 237  LEU A C     1 
ATOM   1870 O  O     . LEU A 1 240 ? 43.559  224.592 0.688   1.00 13.66 ? 237  LEU A O     1 
ATOM   1871 C  CB    . LEU A 1 240 ? 42.948  226.428 -1.634  1.00 13.57 ? 237  LEU A CB    1 
ATOM   1872 C  CG    . LEU A 1 240 ? 43.993  226.236 -2.729  1.00 13.92 ? 237  LEU A CG    1 
ATOM   1873 C  CD1   . LEU A 1 240 ? 44.311  227.611 -3.345  1.00 13.78 ? 237  LEU A CD1   1 
ATOM   1874 C  CD2   . LEU A 1 240 ? 45.309  225.594 -2.209  1.00 15.39 ? 237  LEU A CD2   1 
ATOM   1875 N  N     . VAL A 1 241 ? 43.131  222.988 -0.913  1.00 12.65 ? 238  VAL A N     1 
ATOM   1876 C  CA    . VAL A 1 241 ? 44.027  221.953 -0.326  1.00 12.17 ? 238  VAL A CA    1 
ATOM   1877 C  C     . VAL A 1 241 ? 45.145  221.762 -1.350  1.00 13.30 ? 238  VAL A C     1 
ATOM   1878 O  O     . VAL A 1 241 ? 44.942  221.247 -2.440  1.00 14.61 ? 238  VAL A O     1 
ATOM   1879 C  CB    . VAL A 1 241 ? 43.276  220.690 -0.020  1.00 12.18 ? 238  VAL A CB    1 
ATOM   1880 C  CG1   . VAL A 1 241 ? 44.226  219.465 0.180   1.00 13.51 ? 238  VAL A CG1   1 
ATOM   1881 C  CG2   . VAL A 1 241 ? 42.469  220.934 1.243   1.00 12.76 ? 238  VAL A CG2   1 
ATOM   1882 N  N     . SER A 1 242 ? 46.336  222.239 -0.982  1.00 12.95 ? 239  SER A N     1 
ATOM   1883 C  CA    . SER A 1 242 ? 47.472  222.128 -1.882  1.00 13.50 ? 239  SER A CA    1 
ATOM   1884 C  C     . SER A 1 242 ? 48.104  220.743 -1.753  1.00 12.27 ? 239  SER A C     1 
ATOM   1885 O  O     . SER A 1 242 ? 47.870  220.010 -0.807  1.00 13.20 ? 239  SER A O     1 
ATOM   1886 C  CB    . SER A 1 242 ? 48.551  223.198 -1.567  1.00 16.85 ? 239  SER A CB    1 
ATOM   1887 O  OG    . SER A 1 242 ? 49.008  222.940 -0.238  1.00 18.79 ? 239  SER A OG    1 
ATOM   1888 N  N     . HIS A 1 243 ? 48.963  220.393 -2.696  1.00 13.33 ? 240  HIS A N     1 
ATOM   1889 C  CA    . HIS A 1 243 ? 49.649  219.115 -2.565  1.00 13.93 ? 240  HIS A CA    1 
ATOM   1890 C  C     . HIS A 1 243 ? 50.501  219.095 -1.271  1.00 13.92 ? 240  HIS A C     1 
ATOM   1891 O  O     . HIS A 1 243 ? 50.546  218.063 -0.564  1.00 13.96 ? 240  HIS A O     1 
ATOM   1892 C  CB    . HIS A 1 243 ? 50.535  218.896 -3.802  1.00 15.57 ? 240  HIS A CB    1 
ATOM   1893 C  CG    . HIS A 1 243 ? 51.284  217.604 -3.773  1.00 15.41 ? 240  HIS A CG    1 
ATOM   1894 N  ND1   . HIS A 1 243 ? 50.683  216.390 -4.012  1.00 19.55 ? 240  HIS A ND1   1 
ATOM   1895 C  CD2   . HIS A 1 243 ? 52.583  217.347 -3.488  1.00 20.71 ? 240  HIS A CD2   1 
ATOM   1896 C  CE1   . HIS A 1 243 ? 51.587  215.428 -3.878  1.00 21.34 ? 240  HIS A CE1   1 
ATOM   1897 N  NE2   . HIS A 1 243 ? 52.746  215.984 -3.577  1.00 19.66 ? 240  HIS A NE2   1 
ATOM   1898 N  N     . GLY A 1 244 ? 51.133  220.243 -0.994  1.00 15.14 ? 241  GLY A N     1 
ATOM   1899 C  CA    . GLY A 1 244 ? 52.023  220.311 0.173   1.00 15.37 ? 241  GLY A CA    1 
ATOM   1900 C  C     . GLY A 1 244 ? 51.281  220.194 1.498   1.00 15.02 ? 241  GLY A C     1 
ATOM   1901 O  O     . GLY A 1 244 ? 51.867  219.776 2.505   1.00 15.54 ? 241  GLY A O     1 
ATOM   1902 N  N     . SER A 1 245 ? 49.987  220.532 1.525   1.00 13.65 ? 242  SER A N     1 
ATOM   1903 C  CA    . SER A 1 245 ? 49.178  220.391 2.732   1.00 14.20 ? 242  SER A CA    1 
ATOM   1904 C  C     . SER A 1 245 ? 48.825  218.924 3.081   1.00 12.79 ? 242  SER A C     1 
ATOM   1905 O  O     . SER A 1 245 ? 48.377  218.653 4.207   1.00 15.20 ? 242  SER A O     1 
ATOM   1906 C  CB    . SER A 1 245 ? 47.865  221.199 2.630   1.00 15.95 ? 242  SER A CB    1 
ATOM   1907 O  OG    . SER A 1 245 ? 46.927  220.499 1.795   1.00 14.94 ? 242  SER A OG    1 
ATOM   1908 N  N     . VAL A 1 246 ? 49.053  217.996 2.171   1.00 12.63 ? 243  VAL A N     1 
ATOM   1909 C  CA    . VAL A 1 246 ? 48.542  216.644 2.367   1.00 12.21 ? 243  VAL A CA    1 
ATOM   1910 C  C     . VAL A 1 246 ? 49.163  215.867 3.560   1.00 14.22 ? 243  VAL A C     1 
ATOM   1911 O  O     . VAL A 1 246 ? 48.436  215.265 4.348   1.00 13.71 ? 243  VAL A O     1 
ATOM   1912 C  CB    . VAL A 1 246 ? 48.615  215.891 1.065   1.00 13.34 ? 243  VAL A CB    1 
ATOM   1913 C  CG1   . VAL A 1 246 ? 48.316  214.390 1.264   1.00 15.52 ? 243  VAL A CG1   1 
ATOM   1914 C  CG2   . VAL A 1 246 ? 47.580  216.542 0.136   1.00 13.38 ? 243  VAL A CG2   1 
ATOM   1915 N  N     . PRO A 1 247 ? 50.500  215.913 3.733   1.00 13.69 ? 244  PRO A N     1 
ATOM   1916 C  CA    . PRO A 1 247 ? 51.004  215.093 4.845   1.00 13.82 ? 244  PRO A CA    1 
ATOM   1917 C  C     . PRO A 1 247 ? 50.406  215.489 6.180   1.00 12.04 ? 244  PRO A C     1 
ATOM   1918 O  O     . PRO A 1 247 ? 50.034  214.603 6.973   1.00 13.60 ? 244  PRO A O     1 
ATOM   1919 C  CB    . PRO A 1 247 ? 52.532  215.376 4.815   1.00 13.36 ? 244  PRO A CB    1 
ATOM   1920 C  CG    . PRO A 1 247 ? 52.795  215.537 3.308   1.00 14.45 ? 244  PRO A CG    1 
ATOM   1921 C  CD    . PRO A 1 247 ? 51.579  216.444 2.866   1.00 12.76 ? 244  PRO A CD    1 
ATOM   1922 N  N     . GLN A 1 248 ? 50.363  216.772 6.500   1.00 13.18 ? 245  GLN A N     1 
ATOM   1923 C  CA    . GLN A 1 248 ? 49.781  217.101 7.767   1.00 13.70 ? 245  GLN A CA    1 
ATOM   1924 C  C     . GLN A 1 248 ? 48.289  216.822 7.831   1.00 15.04 ? 245  GLN A C     1 
ATOM   1925 O  O     . GLN A 1 248 ? 47.789  216.310 8.852   1.00 14.43 ? 245  GLN A O     1 
ATOM   1926 C  CB    . GLN A 1 248 ? 50.050  218.571 8.061   1.00 17.82 ? 245  GLN A CB    1 
ATOM   1927 C  CG    . GLN A 1 248 ? 51.490  218.676 8.429   1.00 23.92 ? 245  GLN A CG    1 
ATOM   1928 C  CD    . GLN A 1 248 ? 51.646  218.732 9.917   1.00 34.41 ? 245  GLN A CD    1 
ATOM   1929 O  OE1   . GLN A 1 248 ? 51.626  217.685 10.637  1.00 34.06 ? 245  GLN A OE1   1 
ATOM   1930 N  NE2   . GLN A 1 248 ? 51.753  219.981 10.421  1.00 29.69 ? 245  GLN A NE2   1 
ATOM   1931 N  N     . LEU A 1 249 ? 47.583  217.169 6.744   1.00 13.28 ? 246  LEU A N     1 
ATOM   1932 C  CA    . LEU A 1 249 ? 46.134  216.939 6.739   1.00 11.96 ? 246  LEU A CA    1 
ATOM   1933 C  C     . LEU A 1 249 ? 45.813  215.476 6.926   1.00 11.99 ? 246  LEU A C     1 
ATOM   1934 O  O     . LEU A 1 249 ? 44.875  215.100 7.695   1.00 14.97 ? 246  LEU A O     1 
ATOM   1935 C  CB    . LEU A 1 249 ? 45.563  217.439 5.395   1.00 13.68 ? 246  LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1 249 ? 44.050  217.195 5.217   1.00 13.65 ? 246  LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1 249 ? 43.301  218.068 6.239   1.00 15.91 ? 246  LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1 249 ? 43.735  217.590 3.742   1.00 17.99 ? 246  LEU A CD2   1 
ATOM   1939 N  N     . PHE A 1 250 ? 46.577  214.629 6.273   1.00 12.03 ? 247  PHE A N     1 
ATOM   1940 C  CA    . PHE A 1 250 ? 46.253  213.205 6.329   1.00 12.87 ? 247  PHE A CA    1 
ATOM   1941 C  C     . PHE A 1 250 ? 46.770  212.534 7.587   1.00 13.42 ? 247  PHE A C     1 
ATOM   1942 O  O     . PHE A 1 250 ? 46.378  211.407 7.913   1.00 13.87 ? 247  PHE A O     1 
ATOM   1943 C  CB    . PHE A 1 250 ? 46.816  212.494 5.088   1.00 14.99 ? 247  PHE A CB    1 
ATOM   1944 C  CG    . PHE A 1 250 ? 45.907  212.535 3.868   1.00 11.39 ? 247  PHE A CG    1 
ATOM   1945 C  CD1   . PHE A 1 250 ? 46.215  211.726 2.789   1.00 13.63 ? 247  PHE A CD1   1 
ATOM   1946 C  CD2   . PHE A 1 250 ? 44.780  213.383 3.796   1.00 14.64 ? 247  PHE A CD2   1 
ATOM   1947 C  CE1   . PHE A 1 250 ? 45.443  211.690 1.679   1.00 13.24 ? 247  PHE A CE1   1 
ATOM   1948 C  CE2   . PHE A 1 250 ? 43.976  213.343 2.678   1.00 14.36 ? 247  PHE A CE2   1 
ATOM   1949 C  CZ    . PHE A 1 250 ? 44.316  212.506 1.607   1.00 15.59 ? 247  PHE A CZ    1 
ATOM   1950 N  N     . SER A 1 251 ? 47.670  213.223 8.305   1.00 13.19 ? 248  SER A N     1 
ATOM   1951 C  CA    . SER A 1 251 ? 48.277  212.595 9.470   1.00 13.85 ? 248  SER A CA    1 
ATOM   1952 C  C     . SER A 1 251 ? 47.301  212.309 10.593  1.00 13.50 ? 248  SER A C     1 
ATOM   1953 O  O     . SER A 1 251 ? 47.559  211.424 11.388  1.00 13.40 ? 248  SER A O     1 
ATOM   1954 C  CB    . SER A 1 251 ? 49.438  213.484 9.982   1.00 12.71 ? 248  SER A CB    1 
ATOM   1955 O  OG    . SER A 1 251 ? 48.989  214.624 10.683  1.00 14.54 ? 248  SER A OG    1 
ATOM   1956 N  N     . GLN A 1 252 ? 46.166  213.031 10.645  1.00 12.93 ? 249  GLN A N     1 
ATOM   1957 C  CA    . GLN A 1 252 ? 45.156  212.804 11.672  1.00 15.28 ? 249  GLN A CA    1 
ATOM   1958 C  C     . GLN A 1 252 ? 43.786  212.598 11.032  1.00 15.27 ? 249  GLN A C     1 
ATOM   1959 O  O     . GLN A 1 252 ? 42.777  212.809 11.730  1.00 17.65 ? 249  GLN A O     1 
ATOM   1960 C  CB    . GLN A 1 252 ? 45.079  213.981 12.628  1.00 20.55 ? 249  GLN A CB    1 
ATOM   1961 C  CG    . GLN A 1 252 ? 46.386  214.205 13.391  1.00 21.36 ? 249  GLN A CG    1 
ATOM   1962 C  CD    . GLN A 1 252 ? 46.155  215.232 14.497  1.00 20.34 ? 249  GLN A CD    1 
ATOM   1963 O  OE1   . GLN A 1 252 ? 45.761  214.869 15.622  1.00 26.10 ? 249  GLN A OE1   1 
ATOM   1964 N  NE2   . GLN A 1 252 ? 46.254  216.504 14.142  1.00 24.14 ? 249  GLN A NE2   1 
ATOM   1965 N  N     . MET A 1 253 ? 43.756  212.284 9.733   1.00 14.08 ? 250  MET A N     1 
ATOM   1966 C  CA    . MET A 1 253 ? 42.509  212.159 8.989   1.00 13.64 ? 250  MET A CA    1 
ATOM   1967 C  C     . MET A 1 253 ? 42.008  210.741 9.068   1.00 13.86 ? 250  MET A C     1 
ATOM   1968 O  O     . MET A 1 253 ? 42.615  209.867 8.487   1.00 14.79 ? 250  MET A O     1 
ATOM   1969 C  CB    . MET A 1 253 ? 42.719  212.580 7.490   1.00 15.13 ? 250  MET A CB    1 
ATOM   1970 C  CG    . MET A 1 253 ? 41.388  212.540 6.660   1.00 17.06 ? 250  MET A CG    1 
ATOM   1971 S  SD    . MET A 1 253 ? 40.163  213.684 7.271   1.00 18.31 ? 250  MET A SD    1 
ATOM   1972 C  CE    . MET A 1 253 ? 41.001  215.305 7.029   1.00 18.63 ? 250  MET A CE    1 
ATOM   1973 N  N     . PRO A 1 254 ? 40.858  210.517 9.715   1.00 14.97 ? 251  PRO A N     1 
ATOM   1974 C  CA    . PRO A 1 254 ? 40.374  209.120 9.724   1.00 14.68 ? 251  PRO A CA    1 
ATOM   1975 C  C     . PRO A 1 254 ? 40.161  208.614 8.317   1.00 15.67 ? 251  PRO A C     1 
ATOM   1976 O  O     . PRO A 1 254 ? 39.635  209.332 7.472   1.00 15.19 ? 251  PRO A O     1 
ATOM   1977 C  CB    . PRO A 1 254 ? 39.022  209.216 10.500  1.00 16.17 ? 251  PRO A CB    1 
ATOM   1978 C  CG    . PRO A 1 254 ? 39.229  210.416 11.400  1.00 16.66 ? 251  PRO A CG    1 
ATOM   1979 C  CD    . PRO A 1 254 ? 39.965  211.436 10.426  1.00 15.86 ? 251  PRO A CD    1 
ATOM   1980 N  N     . ILE A 1 255 ? 40.504  207.343 8.094   1.00 14.14 ? 252  ILE A N     1 
ATOM   1981 C  CA    . ILE A 1 255 ? 40.405  206.703 6.778   1.00 15.35 ? 252  ILE A CA    1 
ATOM   1982 C  C     . ILE A 1 255 ? 38.973  206.806 6.217   1.00 15.16 ? 252  ILE A C     1 
ATOM   1983 O  O     . ILE A 1 255 ? 38.828  207.049 5.044   1.00 14.78 ? 252  ILE A O     1 
ATOM   1984 C  CB    . ILE A 1 255 ? 40.902  205.256 6.874   1.00 16.65 ? 252  ILE A CB    1 
ATOM   1985 C  CG1   . ILE A 1 255 ? 42.469  205.313 7.030   1.00 19.65 ? 252  ILE A CG1   1 
ATOM   1986 C  CG2   . ILE A 1 255 ? 40.450  204.351 5.662   1.00 17.87 ? 252  ILE A CG2   1 
ATOM   1987 C  CD1   . ILE A 1 255 ? 43.110  204.043 7.597   1.00 20.90 ? 252  ILE A CD1   1 
ATOM   1988 N  N     . ARG A 1 256 ? 37.952  206.713 7.086   1.00 15.22 ? 253  ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 256 ? 36.587  206.667 6.596   1.00 15.20 ? 253  ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 256 ? 36.123  208.004 6.013   1.00 17.33 ? 253  ARG A C     1 
ATOM   1991 O  O     . ARG A 1 256 ? 35.068  208.088 5.403   1.00 18.50 ? 253  ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 256 ? 35.629  206.280 7.732   1.00 17.47 ? 253  ARG A CB    1 
ATOM   1993 C  CG    . ARG A 1 256 ? 35.532  207.342 8.805   1.00 18.19 ? 253  ARG A CG    1 
ATOM   1994 C  CD    . ARG A 1 256 ? 34.533  206.955 9.938   1.00 20.97 ? 253  ARG A CD    1 
ATOM   1995 N  NE    . ARG A 1 256 ? 34.592  207.976 11.016  1.00 23.83 ? 253  ARG A NE    1 
ATOM   1996 C  CZ    . ARG A 1 256 ? 35.478  208.000 12.024  1.00 23.53 ? 253  ARG A CZ    1 
ATOM   1997 N  NH1   . ARG A 1 256 ? 36.415  207.029 12.186  1.00 22.34 ? 253  ARG A NH1   1 
ATOM   1998 N  NH2   . ARG A 1 256 ? 35.390  209.000 12.930  1.00 23.49 ? 253  ARG A NH2   1 
ATOM   1999 N  N     . LYS A 1 257 ? 36.908  209.081 6.205   1.00 14.67 ? 254  LYS A N     1 
ATOM   2000 C  CA    . LYS A 1 257 ? 36.479  210.364 5.632   1.00 15.68 ? 254  LYS A CA    1 
ATOM   2001 C  C     . LYS A 1 257 ? 36.784  210.526 4.181   1.00 17.95 ? 254  LYS A C     1 
ATOM   2002 O  O     . LYS A 1 257 ? 36.309  211.511 3.574   1.00 18.26 ? 254  LYS A O     1 
ATOM   2003 C  CB    . LYS A 1 257 ? 37.175  211.529 6.368   1.00 15.31 ? 254  LYS A CB    1 
ATOM   2004 C  CG    . LYS A 1 257 ? 36.906  211.560 7.829   1.00 21.99 ? 254  LYS A CG    1 
ATOM   2005 C  CD    . LYS A 1 257 ? 35.484  211.650 8.195   1.00 23.23 ? 254  LYS A CD    1 
ATOM   2006 C  CE    . LYS A 1 257 ? 35.318  211.592 9.759   1.00 27.63 ? 254  LYS A CE    1 
ATOM   2007 N  NZ    . LYS A 1 257 ? 33.882  211.887 10.170  1.00 31.66 ? 254  LYS A NZ    1 
ATOM   2008 N  N     . ILE A 1 258 ? 37.616  209.651 3.618   1.00 15.38 ? 255  ILE A N     1 
ATOM   2009 C  CA    . ILE A 1 258 ? 37.978  209.765 2.211   1.00 15.64 ? 255  ILE A CA    1 
ATOM   2010 C  C     . ILE A 1 258 ? 36.932  209.089 1.353   1.00 16.96 ? 255  ILE A C     1 
ATOM   2011 O  O     . ILE A 1 258 ? 36.542  207.984 1.666   1.00 16.14 ? 255  ILE A O     1 
ATOM   2012 C  CB    . ILE A 1 258 ? 39.341  209.077 1.918   1.00 13.87 ? 255  ILE A CB    1 
ATOM   2013 C  CG1   . ILE A 1 258 ? 40.512  210.013 2.306   1.00 21.85 ? 255  ILE A CG1   1 
ATOM   2014 C  CG2   . ILE A 1 258 ? 39.528  208.764 0.451   1.00 17.73 ? 255  ILE A CG2   1 
ATOM   2015 C  CD1   . ILE A 1 258 ? 40.404  210.589 3.632   1.00 25.69 ? 255  ILE A CD1   1 
ATOM   2016 N  N     . ARG A 1 259 ? 36.508  209.734 0.271   1.00 17.36 ? 256  ARG A N     1 
ATOM   2017 C  CA    . ARG A 1 259 ? 35.424  209.149 -0.516  1.00 19.72 ? 256  ARG A CA    1 
ATOM   2018 C  C     . ARG A 1 259 ? 35.783  207.780 -1.095  1.00 20.04 ? 256  ARG A C     1 
ATOM   2019 O  O     . ARG A 1 259 ? 36.870  207.586 -1.681  1.00 20.21 ? 256  ARG A O     1 
ATOM   2020 C  CB    . ARG A 1 259 ? 35.062  210.105 -1.639  1.00 19.60 ? 256  ARG A CB    1 
ATOM   2021 C  CG    . ARG A 1 259 ? 33.664  209.846 -2.242  1.00 24.52 ? 256  ARG A CG    1 
ATOM   2022 C  CD    . ARG A 1 259 ? 33.848  210.003 -3.697  1.00 35.31 ? 256  ARG A CD    1 
ATOM   2023 N  NE    . ARG A 1 259 ? 34.839  208.974 -3.944  1.00 39.01 ? 256  ARG A NE    1 
ATOM   2024 C  CZ    . ARG A 1 259 ? 35.802  209.029 -4.846  1.00 39.31 ? 256  ARG A CZ    1 
ATOM   2025 N  NH1   . ARG A 1 259 ? 36.666  208.034 -4.898  1.00 32.18 ? 256  ARG A NH1   1 
ATOM   2026 N  NH2   . ARG A 1 259 ? 35.908  210.063 -5.672  1.00 38.70 ? 256  ARG A NH2   1 
ATOM   2027 N  N     . SER A 1 260 ? 34.872  206.843 -0.838  1.00 19.10 ? 257  SER A N     1 
ATOM   2028 C  CA    . SER A 1 260 ? 34.883  205.414 -1.226  1.00 18.69 ? 257  SER A CA    1 
ATOM   2029 C  C     . SER A 1 260 ? 35.403  204.564 -0.078  1.00 18.35 ? 257  SER A C     1 
ATOM   2030 O  O     . SER A 1 260 ? 35.302  203.329 -0.111  1.00 17.71 ? 257  SER A O     1 
ATOM   2031 C  CB    . SER A 1 260 ? 35.691  205.118 -2.520  1.00 20.58 ? 257  SER A CB    1 
ATOM   2032 O  OG    . SER A 1 260 ? 37.090  205.126 -2.285  1.00 19.68 ? 257  SER A OG    1 
ATOM   2033 N  N     . LEU A 1 261 ? 35.974  205.202 0.952   1.00 15.52 ? 258  LEU A N     1 
ATOM   2034 C  CA    . LEU A 1 261 ? 36.450  204.428 2.116   1.00 15.76 ? 258  LEU A CA    1 
ATOM   2035 C  C     . LEU A 1 261 ? 35.545  204.482 3.361   1.00 16.79 ? 258  LEU A C     1 
ATOM   2036 O  O     . LEU A 1 261 ? 35.936  204.051 4.485   1.00 16.61 ? 258  LEU A O     1 
ATOM   2037 C  CB    . LEU A 1 261 ? 37.870  204.899 2.506   1.00 15.20 ? 258  LEU A CB    1 
ATOM   2038 C  CG    . LEU A 1 261 ? 38.914  204.781 1.371   1.00 15.29 ? 258  LEU A CG    1 
ATOM   2039 C  CD1   . LEU A 1 261 ? 40.254  205.125 1.946   1.00 14.01 ? 258  LEU A CD1   1 
ATOM   2040 C  CD2   . LEU A 1 261 ? 38.971  203.356 0.732   1.00 19.14 ? 258  LEU A CD2   1 
ATOM   2041 N  N     . GLY A 1 262 ? 34.324  205.011 3.192   1.00 16.82 ? 259  GLY A N     1 
ATOM   2042 C  CA    . GLY A 1 262 ? 33.431  205.141 4.317   1.00 15.54 ? 259  GLY A CA    1 
ATOM   2043 C  C     . GLY A 1 262 ? 32.645  203.892 4.682   1.00 19.41 ? 259  GLY A C     1 
ATOM   2044 O  O     . GLY A 1 262 ? 31.857  203.930 5.640   1.00 18.91 ? 259  GLY A O     1 
ATOM   2045 N  N     . GLY A 1 263 ? 32.910  202.792 3.964   1.00 16.80 ? 260  GLY A N     1 
ATOM   2046 C  CA    . GLY A 1 263 ? 32.160  201.547 4.097   1.00 18.39 ? 260  GLY A CA    1 
ATOM   2047 C  C     . GLY A 1 263 ? 33.038  200.364 4.481   1.00 19.00 ? 260  GLY A C     1 
ATOM   2048 O  O     . GLY A 1 263 ? 34.013  200.497 5.272   1.00 19.27 ? 260  GLY A O     1 
ATOM   2049 N  N     . LYS A 1 264 ? 32.712  199.178 3.952   1.00 17.30 ? 261  LYS A N     1 
ATOM   2050 C  CA    . LYS A 1 264 ? 33.402  197.950 4.404   1.00 17.53 ? 261  LYS A CA    1 
ATOM   2051 C  C     . LYS A 1 264 ? 34.899  197.958 3.982   1.00 17.80 ? 261  LYS A C     1 
ATOM   2052 O  O     . LYS A 1 264 ? 35.769  197.414 4.703   1.00 20.21 ? 261  LYS A O     1 
ATOM   2053 C  CB    . LYS A 1 264 ? 32.728  196.686 3.801   1.00 20.60 ? 261  LYS A CB    1 
ATOM   2054 C  CG    . LYS A 1 264 ? 31.248  196.557 4.214   1.00 24.86 ? 261  LYS A CG    1 
ATOM   2055 C  CD    . LYS A 1 264 ? 30.565  195.391 3.410   1.00 29.67 ? 261  LYS A CD    1 
ATOM   2056 C  CE    . LYS A 1 264 ? 29.113  195.219 3.850   1.00 35.91 ? 261  LYS A CE    1 
ATOM   2057 N  NZ    . LYS A 1 264 ? 28.629  193.842 3.488   1.00 39.68 ? 261  LYS A NZ    1 
ATOM   2058 N  N     . LEU A 1 265 ? 35.210  198.504 2.797   1.00 17.80 ? 262  LEU A N     1 
ATOM   2059 C  CA    . LEU A 1 265 ? 36.643  198.523 2.402   1.00 17.46 ? 262  LEU A CA    1 
ATOM   2060 C  C     . LEU A 1 265 ? 37.450  199.355 3.393   1.00 18.80 ? 262  LEU A C     1 
ATOM   2061 O  O     . LEU A 1 265 ? 38.469  198.887 3.896   1.00 19.28 ? 262  LEU A O     1 
ATOM   2062 C  CB    . LEU A 1 265 ? 36.877  199.093 1.001   1.00 17.28 ? 262  LEU A CB    1 
ATOM   2063 C  CG    . LEU A 1 265 ? 38.348  199.287 0.541   1.00 18.15 ? 262  LEU A CG    1 
ATOM   2064 C  CD1   . LEU A 1 265 ? 39.118  197.952 0.488   1.00 21.55 ? 262  LEU A CD1   1 
ATOM   2065 C  CD2   . LEU A 1 265 ? 38.358  199.953 -0.778  1.00 17.53 ? 262  LEU A CD2   1 
ATOM   2066 N  N     . GLY A 1 266 ? 36.976  200.551 3.729   1.00 16.61 ? 263  GLY A N     1 
ATOM   2067 C  CA    . GLY A 1 266 ? 37.705  201.352 4.716   1.00 15.86 ? 263  GLY A CA    1 
ATOM   2068 C  C     . GLY A 1 266 ? 37.839  200.671 6.066   1.00 21.16 ? 263  GLY A C     1 
ATOM   2069 O  O     . GLY A 1 266 ? 38.908  200.716 6.694   1.00 17.62 ? 263  GLY A O     1 
ATOM   2070 N  N     . ALA A 1 267 ? 36.756  199.978 6.509   1.00 18.72 ? 264  ALA A N     1 
ATOM   2071 C  CA    . ALA A 1 267 ? 36.844  199.227 7.747   1.00 20.84 ? 264  ALA A CA    1 
ATOM   2072 C  C     . ALA A 1 267 ? 37.875  198.134 7.670   1.00 18.63 ? 264  ALA A C     1 
ATOM   2073 O  O     . ALA A 1 267 ? 38.595  197.895 8.620   1.00 21.06 ? 264  ALA A O     1 
ATOM   2074 C  CB    . ALA A 1 267 ? 35.456  198.652 8.113   1.00 20.76 ? 264  ALA A CB    1 
ATOM   2075 N  N     . SER A 1 268 ? 37.996  197.485 6.514   1.00 16.81 ? 265  SER A N     1 
ATOM   2076 C  CA    A SER A 1 268 ? 38.994  196.431 6.377   0.60 20.30 ? 265  SER A CA    1 
ATOM   2077 C  CA    B SER A 1 268 ? 39.001  196.450 6.274   0.40 20.30 ? 265  SER A CA    1 
ATOM   2078 C  C     . SER A 1 268 ? 40.416  197.002 6.314   1.00 17.51 ? 265  SER A C     1 
ATOM   2079 O  O     . SER A 1 268 ? 41.329  196.354 6.789   1.00 18.79 ? 265  SER A O     1 
ATOM   2080 C  CB    A SER A 1 268 ? 38.722  195.530 5.154   0.60 21.54 ? 265  SER A CB    1 
ATOM   2081 C  CB    B SER A 1 268 ? 38.787  195.789 4.915   0.40 21.17 ? 265  SER A CB    1 
ATOM   2082 O  OG    A SER A 1 268 ? 38.925  196.144 3.893   0.60 20.47 ? 265  SER A OG    1 
ATOM   2083 O  OG    B SER A 1 268 ? 37.526  195.165 4.822   0.40 22.89 ? 265  SER A OG    1 
ATOM   2084 N  N     . VAL A 1 269 ? 40.594  198.192 5.750   1.00 16.21 ? 266  VAL A N     1 
ATOM   2085 C  CA    . VAL A 1 269 ? 41.930  198.806 5.750   1.00 16.70 ? 266  VAL A CA    1 
ATOM   2086 C  C     . VAL A 1 269 ? 42.381  199.003 7.218   1.00 18.26 ? 266  VAL A C     1 
ATOM   2087 O  O     . VAL A 1 269 ? 43.526  198.676 7.623   1.00 17.23 ? 266  VAL A O     1 
ATOM   2088 C  CB    . VAL A 1 269 ? 41.924  200.156 5.002   1.00 16.51 ? 266  VAL A CB    1 
ATOM   2089 C  CG1   . VAL A 1 269 ? 43.233  200.958 5.260   1.00 19.91 ? 266  VAL A CG1   1 
ATOM   2090 C  CG2   . VAL A 1 269 ? 41.701  199.960 3.445   1.00 17.62 ? 266  VAL A CG2   1 
ATOM   2091 N  N     . ILE A 1 270 ? 41.452  199.529 8.032   1.00 16.86 ? 267  ILE A N     1 
ATOM   2092 C  CA    . ILE A 1 270 ? 41.717  199.811 9.451   1.00 16.87 ? 267  ILE A CA    1 
ATOM   2093 C  C     . ILE A 1 270 ? 42.020  198.507 10.197  1.00 17.49 ? 267  ILE A C     1 
ATOM   2094 O  O     . ILE A 1 270 ? 43.045  198.415 10.897  1.00 23.05 ? 267  ILE A O     1 
ATOM   2095 C  CB    . ILE A 1 270 ? 40.495  200.511 10.051  1.00 17.40 ? 267  ILE A CB    1 
ATOM   2096 C  CG1   . ILE A 1 270 ? 40.465  201.953 9.544   1.00 19.66 ? 267  ILE A CG1   1 
ATOM   2097 C  CG2   . ILE A 1 270 ? 40.490  200.468 11.576  1.00 22.15 ? 267  ILE A CG2   1 
ATOM   2098 C  CD1   . ILE A 1 270 ? 39.090  202.612 9.751   1.00 21.83 ? 267  ILE A CD1   1 
ATOM   2099 N  N     . GLU A 1 271 ? 41.176  197.473 9.985   1.00 19.20 ? 268  GLU A N     1 
ATOM   2100 C  CA    . GLU A 1 271 ? 41.343  196.202 10.685  1.00 20.86 ? 268  GLU A CA    1 
ATOM   2101 C  C     . GLU A 1 271 ? 42.531  195.393 10.269  1.00 21.78 ? 268  GLU A C     1 
ATOM   2102 O  O     . GLU A 1 271 ? 43.278  194.905 11.123  1.00 24.29 ? 268  GLU A O     1 
ATOM   2103 C  CB    . GLU A 1 271 ? 40.099  195.327 10.522  1.00 27.12 ? 268  GLU A CB    1 
ATOM   2104 C  CG    . GLU A 1 271 ? 38.940  195.778 11.402  1.00 38.60 ? 268  GLU A CG    1 
ATOM   2105 C  CD    . GLU A 1 271 ? 39.358  196.316 12.801  1.00 41.96 ? 268  GLU A CD    1 
ATOM   2106 O  OE1   . GLU A 1 271 ? 40.095  195.610 13.541  1.00 45.81 ? 268  GLU A OE1   1 
ATOM   2107 O  OE2   . GLU A 1 271 ? 38.931  197.445 13.174  1.00 40.82 ? 268  GLU A OE2   1 
ATOM   2108 N  N     . ILE A 1 272 ? 42.765  195.290 8.967   1.00 18.95 ? 269  ILE A N     1 
ATOM   2109 C  CA    . ILE A 1 272 ? 43.831  194.435 8.496   1.00 17.97 ? 269  ILE A CA    1 
ATOM   2110 C  C     . ILE A 1 272 ? 45.173  195.076 8.763   1.00 20.44 ? 269  ILE A C     1 
ATOM   2111 O  O     . ILE A 1 272 ? 46.125  194.380 9.128   1.00 23.38 ? 269  ILE A O     1 
ATOM   2112 C  CB    . ILE A 1 272 ? 43.663  194.116 6.981   1.00 18.11 ? 269  ILE A CB    1 
ATOM   2113 C  CG1   . ILE A 1 272 ? 42.444  193.230 6.754   1.00 26.27 ? 269  ILE A CG1   1 
ATOM   2114 C  CG2   . ILE A 1 272 ? 44.875  193.365 6.437   1.00 21.08 ? 269  ILE A CG2   1 
ATOM   2115 C  CD1   . ILE A 1 272 ? 42.174  192.958 5.292   1.00 26.89 ? 269  ILE A CD1   1 
ATOM   2116 N  N     . LEU A 1 273 ? 45.268  196.404 8.610   1.00 19.14 ? 270  LEU A N     1 
ATOM   2117 C  CA    . LEU A 1 273 ? 46.609  197.039 8.743   1.00 15.48 ? 270  LEU A CA    1 
ATOM   2118 C  C     . LEU A 1 273 ? 46.866  197.535 10.144  1.00 21.44 ? 270  LEU A C     1 
ATOM   2119 O  O     . LEU A 1 273 ? 48.000  197.847 10.489  1.00 22.00 ? 270  LEU A O     1 
ATOM   2120 C  CB    . LEU A 1 273 ? 46.750  198.164 7.742   1.00 17.27 ? 270  LEU A CB    1 
ATOM   2121 C  CG    . LEU A 1 273 ? 46.645  197.735 6.282   1.00 19.25 ? 270  LEU A CG    1 
ATOM   2122 C  CD1   . LEU A 1 273 ? 46.773  198.904 5.346   1.00 19.18 ? 270  LEU A CD1   1 
ATOM   2123 C  CD2   . LEU A 1 273 ? 47.781  196.670 5.960   1.00 19.42 ? 270  LEU A CD2   1 
ATOM   2124 N  N     . GLY A 1 274 ? 45.811  197.641 10.945  1.00 16.79 ? 271  GLY A N     1 
ATOM   2125 C  CA    . GLY A 1 274 ? 45.930  198.139 12.310  1.00 17.44 ? 271  GLY A CA    1 
ATOM   2126 C  C     . GLY A 1 274 ? 46.275  199.607 12.349  1.00 22.18 ? 271  GLY A C     1 
ATOM   2127 O  O     . GLY A 1 274 ? 47.083  200.039 13.189  1.00 25.07 ? 271  GLY A O     1 
ATOM   2128 N  N     . ILE A 1 275 ? 45.633  200.398 11.484  1.00 18.63 ? 272  ILE A N     1 
ATOM   2129 C  CA    . ILE A 1 275 ? 45.922  201.830 11.421  1.00 16.48 ? 272  ILE A CA    1 
ATOM   2130 C  C     . ILE A 1 275 ? 44.640  202.613 11.548  1.00 17.84 ? 272  ILE A C     1 
ATOM   2131 O  O     . ILE A 1 275 ? 43.577  202.035 11.468  1.00 18.15 ? 272  ILE A O     1 
ATOM   2132 C  CB    . ILE A 1 275 ? 46.591  202.234 10.080  1.00 17.29 ? 272  ILE A CB    1 
ATOM   2133 C  CG1   . ILE A 1 275 ? 45.665  201.974 8.874   1.00 16.80 ? 272  ILE A CG1   1 
ATOM   2134 C  CG2   . ILE A 1 275 ? 47.997  201.561 9.994   1.00 17.85 ? 272  ILE A CG2   1 
ATOM   2135 C  CD1   . ILE A 1 275 ? 46.447  202.337 7.488   1.00 19.38 ? 272  ILE A CD1   1 
ATOM   2136 N  N     . GLU A 1 276 ? 44.724  203.922 11.725  1.00 16.42 ? 273  GLU A N     1 
ATOM   2137 C  CA    . GLU A 1 276 ? 43.514  204.749 11.857  1.00 16.47 ? 273  GLU A CA    1 
ATOM   2138 C  C     . GLU A 1 276 ? 43.430  205.861 10.825  1.00 15.74 ? 273  GLU A C     1 
ATOM   2139 O  O     . GLU A 1 276 ? 42.317  206.309 10.453  1.00 15.99 ? 273  GLU A O     1 
ATOM   2140 C  CB    . GLU A 1 276 ? 43.500  205.378 13.250  1.00 16.66 ? 273  GLU A CB    1 
ATOM   2141 C  CG    . GLU A 1 276 ? 43.251  204.347 14.302  1.00 23.14 ? 273  GLU A CG    1 
ATOM   2142 C  CD    . GLU A 1 276 ? 43.394  204.873 15.747  1.00 31.80 ? 273  GLU A CD    1 
ATOM   2143 O  OE1   . GLU A 1 276 ? 43.872  204.089 16.604  1.00 37.65 ? 273  GLU A OE1   1 
ATOM   2144 O  OE2   . GLU A 1 276 ? 42.998  206.025 16.027  1.00 33.81 ? 273  GLU A OE2   1 
ATOM   2145 N  N     . TYR A 1 277 ? 44.579  206.385 10.416  1.00 16.14 ? 274  TYR A N     1 
ATOM   2146 C  CA    . TYR A 1 277 ? 44.594  207.638 9.654   1.00 15.15 ? 274  TYR A CA    1 
ATOM   2147 C  C     . TYR A 1 277 ? 45.133  207.429 8.246   1.00 13.75 ? 274  TYR A C     1 
ATOM   2148 O  O     . TYR A 1 277 ? 45.974  206.576 8.017   1.00 14.60 ? 274  TYR A O     1 
ATOM   2149 C  CB    . TYR A 1 277 ? 45.494  208.667 10.342  1.00 14.70 ? 274  TYR A CB    1 
ATOM   2150 C  CG    . TYR A 1 277 ? 45.074  208.926 11.758  1.00 14.01 ? 274  TYR A CG    1 
ATOM   2151 C  CD1   . TYR A 1 277 ? 45.943  208.714 12.828  1.00 17.24 ? 274  TYR A CD1   1 
ATOM   2152 C  CD2   . TYR A 1 277 ? 43.784  209.379 12.005  1.00 15.85 ? 274  TYR A CD2   1 
ATOM   2153 C  CE1   . TYR A 1 277 ? 45.528  208.944 14.144  1.00 16.38 ? 274  TYR A CE1   1 
ATOM   2154 C  CE2   . TYR A 1 277 ? 43.342  209.601 13.309  1.00 18.75 ? 274  TYR A CE2   1 
ATOM   2155 C  CZ    . TYR A 1 277 ? 44.238  209.379 14.368  1.00 20.28 ? 274  TYR A CZ    1 
ATOM   2156 O  OH    . TYR A 1 277 ? 43.828  209.615 15.660  1.00 22.69 ? 274  TYR A OH    1 
ATOM   2157 N  N     . MET A 1 278 ? 44.679  208.260 7.326   1.00 12.15 ? 275  MET A N     1 
ATOM   2158 C  CA    . MET A 1 278 ? 45.051  208.069 5.932   1.00 14.36 ? 275  MET A CA    1 
ATOM   2159 C  C     . MET A 1 278 ? 46.549  208.110 5.708   1.00 14.49 ? 275  MET A C     1 
ATOM   2160 O  O     . MET A 1 278 ? 47.098  207.358 4.920   1.00 15.21 ? 275  MET A O     1 
ATOM   2161 C  CB    . MET A 1 278 ? 44.368  209.153 5.110   1.00 16.05 ? 275  MET A CB    1 
ATOM   2162 C  CG    A MET A 1 278 ? 44.243  208.930 3.653   0.67 13.57 ? 275  MET A CG    1 
ATOM   2163 C  CG    B MET A 1 278 ? 42.983  208.950 4.814   0.33 15.53 ? 275  MET A CG    1 
ATOM   2164 S  SD    A MET A 1 278 ? 43.299  207.462 3.155   0.67 15.52 ? 275  MET A SD    1 
ATOM   2165 S  SD    B MET A 1 278 ? 42.764  207.602 3.660   0.33 15.88 ? 275  MET A SD    1 
ATOM   2166 C  CE    A MET A 1 278 ? 43.670  207.276 1.409   0.67 16.13 ? 275  MET A CE    1 
ATOM   2167 C  CE    B MET A 1 278 ? 44.023  207.888 2.411   0.33 14.30 ? 275  MET A CE    1 
ATOM   2168 N  N     . GLY A 1 279 ? 47.225  208.977 6.451   1.00 14.60 ? 276  GLY A N     1 
ATOM   2169 C  CA    . GLY A 1 279 ? 48.659  209.162 6.257   1.00 15.21 ? 276  GLY A CA    1 
ATOM   2170 C  C     . GLY A 1 279 ? 49.440  207.884 6.577   1.00 15.90 ? 276  GLY A C     1 
ATOM   2171 O  O     . GLY A 1 279 ? 50.509  207.612 5.982   1.00 15.11 ? 276  GLY A O     1 
ATOM   2172 N  N     . GLU A 1 280 ? 48.918  207.102 7.530   1.00 14.86 ? 277  GLU A N     1 
ATOM   2173 C  CA    . GLU A 1 280 ? 49.607  205.904 7.886   1.00 12.95 ? 277  GLU A CA    1 
ATOM   2174 C  C     . GLU A 1 280 ? 49.717  204.904 6.742   1.00 12.86 ? 277  GLU A C     1 
ATOM   2175 O  O     . GLU A 1 280 ? 50.582  203.990 6.806   1.00 14.38 ? 277  GLU A O     1 
ATOM   2176 C  CB    . GLU A 1 280 ? 48.937  205.218 9.081   1.00 15.63 ? 277  GLU A CB    1 
ATOM   2177 C  CG    . GLU A 1 280 ? 48.970  206.025 10.345  1.00 13.32 ? 277  GLU A CG    1 
ATOM   2178 C  CD    . GLU A 1 280 ? 48.247  205.285 11.452  1.00 17.93 ? 277  GLU A CD    1 
ATOM   2179 O  OE1   . GLU A 1 280 ? 47.081  205.578 11.605  1.00 17.17 ? 277  GLU A OE1   1 
ATOM   2180 O  OE2   . GLU A 1 280 ? 48.844  204.395 12.145  1.00 21.96 ? 277  GLU A OE2   1 
ATOM   2181 N  N     . LEU A 1 281 ? 48.876  205.028 5.730   1.00 13.76 ? 278  LEU A N     1 
ATOM   2182 C  CA    . LEU A 1 281 ? 49.038  204.172 4.554   1.00 13.69 ? 278  LEU A CA    1 
ATOM   2183 C  C     . LEU A 1 281 ? 50.380  204.281 3.832   1.00 13.22 ? 278  LEU A C     1 
ATOM   2184 O  O     . LEU A 1 281 ? 50.716  203.363 3.071   1.00 14.13 ? 278  LEU A O     1 
ATOM   2185 C  CB    . LEU A 1 281 ? 47.898  204.452 3.562   1.00 13.56 ? 278  LEU A CB    1 
ATOM   2186 C  CG    . LEU A 1 281 ? 46.591  203.750 4.001   1.00 16.18 ? 278  LEU A CG    1 
ATOM   2187 C  CD1   . LEU A 1 281 ? 45.399  204.403 3.245   1.00 16.40 ? 278  LEU A CD1   1 
ATOM   2188 C  CD2   . LEU A 1 281 ? 46.641  202.226 3.687   1.00 16.22 ? 278  LEU A CD2   1 
ATOM   2189 N  N     . THR A 1 282 ? 51.092  205.403 3.996   1.00 15.12 ? 279  THR A N     1 
ATOM   2190 C  CA    . THR A 1 282 ? 52.334  205.585 3.229   1.00 13.89 ? 279  THR A CA    1 
ATOM   2191 C  C     . THR A 1 282 ? 53.366  204.511 3.602   1.00 15.67 ? 279  THR A C     1 
ATOM   2192 O  O     . THR A 1 282 ? 54.295  204.330 2.844   1.00 16.25 ? 279  THR A O     1 
ATOM   2193 C  CB    . THR A 1 282 ? 52.963  206.971 3.428   1.00 16.16 ? 279  THR A CB    1 
ATOM   2194 O  OG1   . THR A 1 282 ? 53.353  207.146 4.821   1.00 16.28 ? 279  THR A OG1   1 
ATOM   2195 C  CG2   . THR A 1 282 ? 51.944  208.080 3.008   1.00 13.60 ? 279  THR A CG2   1 
ATOM   2196 N  N     . GLN A 1 283 ? 53.208  203.868 4.756   1.00 15.02 ? 280  GLN A N     1 
ATOM   2197 C  CA    A GLN A 1 283 ? 54.269  202.930 5.151   0.53 17.36 ? 280  GLN A CA    1 
ATOM   2198 C  CA    B GLN A 1 283 ? 54.150  202.855 5.272   0.47 17.46 ? 280  GLN A CA    1 
ATOM   2199 C  C     . GLN A 1 283 ? 54.142  201.527 4.527   1.00 20.53 ? 280  GLN A C     1 
ATOM   2200 O  O     . GLN A 1 283 ? 54.944  200.642 4.847   1.00 25.64 ? 280  GLN A O     1 
ATOM   2201 C  CB    A GLN A 1 283 ? 54.324  202.866 6.680   0.53 16.91 ? 280  GLN A CB    1 
ATOM   2202 C  CB    B GLN A 1 283 ? 53.839  202.514 6.738   0.47 17.25 ? 280  GLN A CB    1 
ATOM   2203 C  CG    A GLN A 1 283 ? 54.727  204.229 7.199   0.53 14.71 ? 280  GLN A CG    1 
ATOM   2204 C  CG    B GLN A 1 283 ? 53.934  203.609 7.724   0.47 17.98 ? 280  GLN A CG    1 
ATOM   2205 C  CD    A GLN A 1 283 ? 55.989  204.684 6.463   0.53 18.66 ? 280  GLN A CD    1 
ATOM   2206 C  CD    B GLN A 1 283 ? 53.381  203.120 9.038   0.47 19.81 ? 280  GLN A CD    1 
ATOM   2207 O  OE1   A GLN A 1 283 ? 57.032  204.044 6.578   0.53 20.69 ? 280  GLN A OE1   1 
ATOM   2208 O  OE1   B GLN A 1 283 ? 52.161  203.198 9.292   0.47 18.95 ? 280  GLN A OE1   1 
ATOM   2209 N  NE2   A GLN A 1 283 ? 55.867  205.711 5.613   0.53 17.65 ? 280  GLN A NE2   1 
ATOM   2210 N  NE2   B GLN A 1 283 ? 54.253  202.496 9.843   0.47 19.50 ? 280  GLN A NE2   1 
ATOM   2211 N  N     . PHE A 1 284 ? 53.219  201.334 3.598   1.00 14.62 ? 281  PHE A N     1 
ATOM   2212 C  CA    . PHE A 1 284 ? 53.040  200.032 2.954   1.00 15.24 ? 281  PHE A CA    1 
ATOM   2213 C  C     . PHE A 1 284 ? 53.498  200.131 1.510   1.00 18.12 ? 281  PHE A C     1 
ATOM   2214 O  O     . PHE A 1 284 ? 53.388  201.190 0.872   1.00 18.64 ? 281  PHE A O     1 
ATOM   2215 C  CB    . PHE A 1 284 ? 51.573  199.596 3.068   1.00 15.17 ? 281  PHE A CB    1 
ATOM   2216 C  CG    . PHE A 1 284 ? 51.134  199.451 4.525   1.00 15.01 ? 281  PHE A CG    1 
ATOM   2217 C  CD1   . PHE A 1 284 ? 51.433  198.295 5.223   1.00 18.84 ? 281  PHE A CD1   1 
ATOM   2218 C  CD2   . PHE A 1 284 ? 50.591  200.521 5.229   1.00 16.36 ? 281  PHE A CD2   1 
ATOM   2219 C  CE1   . PHE A 1 284 ? 51.041  198.115 6.563   1.00 21.92 ? 281  PHE A CE1   1 
ATOM   2220 C  CE2   . PHE A 1 284 ? 50.222  200.356 6.572   1.00 16.00 ? 281  PHE A CE2   1 
ATOM   2221 C  CZ    . PHE A 1 284 ? 50.480  199.171 7.269   1.00 23.06 ? 281  PHE A CZ    1 
ATOM   2222 N  N     . THR A 1 285 ? 54.050  199.060 0.980   1.00 16.15 ? 282  THR A N     1 
ATOM   2223 C  CA    . THR A 1 285 ? 54.398  199.091 -0.439  1.00 16.01 ? 282  THR A CA    1 
ATOM   2224 C  C     . THR A 1 285 ? 53.144  198.911 -1.253  1.00 14.02 ? 282  THR A C     1 
ATOM   2225 O  O     . THR A 1 285 ? 52.111  198.492 -0.735  1.00 16.20 ? 282  THR A O     1 
ATOM   2226 C  CB    . THR A 1 285 ? 55.376  197.988 -0.844  1.00 15.98 ? 282  THR A CB    1 
ATOM   2227 O  OG1   . THR A 1 285 ? 54.731  196.731 -0.726  1.00 16.92 ? 282  THR A OG1   1 
ATOM   2228 C  CG2   . THR A 1 285 ? 56.607  198.046 0.034   1.00 19.55 ? 282  THR A CG2   1 
ATOM   2229 N  N     . GLU A 1 286 ? 53.225  199.294 -2.523  1.00 16.44 ? 283  GLU A N     1 
ATOM   2230 C  CA    . GLU A 1 286 ? 52.067  199.139 -3.391  1.00 15.75 ? 283  GLU A CA    1 
ATOM   2231 C  C     . GLU A 1 286 ? 51.643  197.655 -3.469  1.00 15.66 ? 283  GLU A C     1 
ATOM   2232 O  O     . GLU A 1 286 ? 50.459  197.341 -3.400  1.00 15.89 ? 283  GLU A O     1 
ATOM   2233 C  CB    . GLU A 1 286 ? 52.381  199.724 -4.762  1.00 15.88 ? 283  GLU A CB    1 
ATOM   2234 C  CG    . GLU A 1 286 ? 51.142  199.715 -5.633  1.00 17.45 ? 283  GLU A CG    1 
ATOM   2235 C  CD    . GLU A 1 286 ? 51.381  200.342 -7.006  1.00 26.10 ? 283  GLU A CD    1 
ATOM   2236 O  OE1   . GLU A 1 286 ? 52.527  200.665 -7.333  1.00 26.34 ? 283  GLU A OE1   1 
ATOM   2237 O  OE2   . GLU A 1 286 ? 50.389  200.490 -7.773  1.00 24.86 ? 283  GLU A OE2   1 
ATOM   2238 N  N     A SER A 1 287 ? 52.644  196.756 -3.568  0.79 17.80 ? 284  SER A N     1 
ATOM   2239 N  N     B SER A 1 287 ? 52.618  196.749 -3.575  0.21 17.79 ? 284  SER A N     1 
ATOM   2240 C  CA    A SER A 1 287 ? 52.324  195.349 -3.609  0.79 17.69 ? 284  SER A CA    1 
ATOM   2241 C  CA    B SER A 1 287 ? 52.280  195.335 -3.641  0.21 17.71 ? 284  SER A CA    1 
ATOM   2242 C  C     A SER A 1 287 ? 51.628  194.863 -2.343  0.79 16.19 ? 284  SER A C     1 
ATOM   2243 C  C     B SER A 1 287 ? 51.661  194.832 -2.333  0.21 16.28 ? 284  SER A C     1 
ATOM   2244 O  O     A SER A 1 287 ? 50.749  193.973 -2.376  0.79 17.50 ? 284  SER A O     1 
ATOM   2245 O  O     B SER A 1 287 ? 50.819  193.927 -2.356  0.21 17.48 ? 284  SER A O     1 
ATOM   2246 C  CB    A SER A 1 287 ? 53.609  194.492 -3.850  0.79 17.28 ? 284  SER A CB    1 
ATOM   2247 C  CB    B SER A 1 287 ? 53.513  194.482 -4.002  0.21 17.49 ? 284  SER A CB    1 
ATOM   2248 O  OG    A SER A 1 287 ? 54.239  194.938 -5.035  0.79 19.70 ? 284  SER A OG    1 
ATOM   2249 O  OG    B SER A 1 287 ? 54.595  194.762 -3.141  0.21 18.20 ? 284  SER A OG    1 
ATOM   2250 N  N     . GLN A 1 288 ? 52.069  195.396 -1.191  1.00 14.84 ? 285  GLN A N     1 
ATOM   2251 C  CA    . GLN A 1 288 ? 51.453  195.001 0.046   1.00 14.50 ? 285  GLN A CA    1 
ATOM   2252 C  C     . GLN A 1 288 ? 49.971  195.432 0.038   1.00 16.58 ? 285  GLN A C     1 
ATOM   2253 O  O     . GLN A 1 288 ? 49.072  194.665 0.393   1.00 15.76 ? 285  GLN A O     1 
ATOM   2254 C  CB    . GLN A 1 288 ? 52.208  195.611 1.252   1.00 14.48 ? 285  GLN A CB    1 
ATOM   2255 C  CG    . GLN A 1 288 ? 53.542  195.004 1.591   1.00 17.97 ? 285  GLN A CG    1 
ATOM   2256 C  CD    . GLN A 1 288 ? 54.147  195.680 2.813   1.00 23.72 ? 285  GLN A CD    1 
ATOM   2257 O  OE1   . GLN A 1 288 ? 54.257  196.910 2.905   1.00 19.77 ? 285  GLN A OE1   1 
ATOM   2258 N  NE2   . GLN A 1 288 ? 54.555  194.854 3.772   1.00 27.13 ? 285  GLN A NE2   1 
ATOM   2259 N  N     . LEU A 1 289 ? 49.712  196.654 -0.404  1.00 16.90 ? 286  LEU A N     1 
ATOM   2260 C  CA    . LEU A 1 289 ? 48.296  197.088 -0.392  1.00 14.29 ? 286  LEU A CA    1 
ATOM   2261 C  C     . LEU A 1 289 ? 47.485  196.291 -1.410  1.00 17.78 ? 286  LEU A C     1 
ATOM   2262 O  O     . LEU A 1 289 ? 46.342  195.909 -1.120  1.00 18.61 ? 286  LEU A O     1 
ATOM   2263 C  CB    . LEU A 1 289 ? 48.197  198.591 -0.681  1.00 13.65 ? 286  LEU A CB    1 
ATOM   2264 C  CG    . LEU A 1 289 ? 48.890  199.439 0.402   1.00 15.51 ? 286  LEU A CG    1 
ATOM   2265 C  CD1   . LEU A 1 289 ? 48.886  200.929 -0.049  1.00 14.34 ? 286  LEU A CD1   1 
ATOM   2266 C  CD2   . LEU A 1 289 ? 48.183  199.275 1.753   1.00 17.20 ? 286  LEU A CD2   1 
ATOM   2267 N  N     . GLN A 1 290 ? 48.088  195.995 -2.554  1.00 17.96 ? 287  GLN A N     1 
ATOM   2268 C  CA    . GLN A 1 290 ? 47.366  195.176 -3.542  1.00 17.01 ? 287  GLN A CA    1 
ATOM   2269 C  C     . GLN A 1 290 ? 47.133  193.762 -3.035  1.00 17.92 ? 287  GLN A C     1 
ATOM   2270 O  O     . GLN A 1 290 ? 46.089  193.159 -3.316  1.00 20.58 ? 287  GLN A O     1 
ATOM   2271 C  CB    . GLN A 1 290 ? 48.159  195.131 -4.857  1.00 19.94 ? 287  GLN A CB    1 
ATOM   2272 C  CG    . GLN A 1 290 ? 48.173  196.442 -5.625  1.00 18.70 ? 287  GLN A CG    1 
ATOM   2273 C  CD    . GLN A 1 290 ? 49.116  196.365 -6.798  1.00 22.59 ? 287  GLN A CD    1 
ATOM   2274 O  OE1   . GLN A 1 290 ? 50.200  195.730 -6.707  1.00 21.60 ? 287  GLN A OE1   1 
ATOM   2275 N  NE2   . GLN A 1 290 ? 48.728  197.010 -7.918  1.00 25.42 ? 287  GLN A NE2   1 
ATOM   2276 N  N     . SER A 1 291 ? 48.051  193.237 -2.250  1.00 16.47 ? 288  SER A N     1 
ATOM   2277 C  CA    . SER A 1 291 ? 47.845  191.922 -1.675  1.00 17.07 ? 288  SER A CA    1 
ATOM   2278 C  C     . SER A 1 291 ? 46.612  191.861 -0.740  1.00 22.22 ? 288  SER A C     1 
ATOM   2279 O  O     . SER A 1 291 ? 45.883  190.869 -0.726  1.00 25.69 ? 288  SER A O     1 
ATOM   2280 C  CB    . SER A 1 291 ? 49.082  191.425 -0.918  1.00 17.06 ? 288  SER A CB    1 
ATOM   2281 O  OG    A SER A 1 291 ? 49.145  191.964 0.432   0.56 18.30 ? 288  SER A OG    1 
ATOM   2282 O  OG    B SER A 1 291 ? 48.814  190.081 -0.635  0.44 17.99 ? 288  SER A OG    1 
ATOM   2283 N  N     . HIS A 1 292 ? 46.380  192.910 0.047   1.00 17.70 ? 289  HIS A N     1 
ATOM   2284 C  CA    . HIS A 1 292 ? 45.228  192.911 0.926   1.00 19.18 ? 289  HIS A CA    1 
ATOM   2285 C  C     . HIS A 1 292 ? 43.911  193.310 0.283   1.00 21.55 ? 289  HIS A C     1 
ATOM   2286 O  O     . HIS A 1 292 ? 42.867  192.732 0.598   1.00 24.95 ? 289  HIS A O     1 
ATOM   2287 C  CB    . HIS A 1 292 ? 45.499  193.853 2.075   1.00 23.43 ? 289  HIS A CB    1 
ATOM   2288 C  CG    . HIS A 1 292 ? 46.623  193.437 2.960   1.00 22.02 ? 289  HIS A CG    1 
ATOM   2289 N  ND1   . HIS A 1 292 ? 46.622  192.248 3.668   1.00 29.72 ? 289  HIS A ND1   1 
ATOM   2290 C  CD2   . HIS A 1 292 ? 47.783  194.069 3.274   1.00 24.27 ? 289  HIS A CD2   1 
ATOM   2291 C  CE1   . HIS A 1 292 ? 47.727  192.177 4.389   1.00 24.53 ? 289  HIS A CE1   1 
ATOM   2292 N  NE2   . HIS A 1 292 ? 48.447  193.264 4.175   1.00 26.86 ? 289  HIS A NE2   1 
ATOM   2293 N  N     . PHE A 1 293 ? 43.953  194.287 -0.611  1.00 18.66 ? 290  PHE A N     1 
ATOM   2294 C  CA    . PHE A 1 293 ? 42.733  194.914 -1.093  1.00 18.08 ? 290  PHE A CA    1 
ATOM   2295 C  C     . PHE A 1 293 ? 42.483  194.765 -2.596  1.00 19.81 ? 290  PHE A C     1 
ATOM   2296 O  O     . PHE A 1 293 ? 41.518  195.343 -3.130  1.00 22.52 ? 290  PHE A O     1 
ATOM   2297 C  CB    . PHE A 1 293 ? 42.793  196.414 -0.678  1.00 17.44 ? 290  PHE A CB    1 
ATOM   2298 C  CG    . PHE A 1 293 ? 43.139  196.587 0.776   1.00 19.99 ? 290  PHE A CG    1 
ATOM   2299 C  CD1   . PHE A 1 293 ? 42.307  196.089 1.793   1.00 16.33 ? 290  PHE A CD1   1 
ATOM   2300 C  CD2   . PHE A 1 293 ? 44.342  197.221 1.143   1.00 16.97 ? 290  PHE A CD2   1 
ATOM   2301 C  CE1   . PHE A 1 293 ? 42.708  196.160 3.126   1.00 18.57 ? 290  PHE A CE1   1 
ATOM   2302 C  CE2   . PHE A 1 293 ? 44.741  197.312 2.469   1.00 17.73 ? 290  PHE A CE2   1 
ATOM   2303 C  CZ    . PHE A 1 293 ? 43.917  196.800 3.469   1.00 19.42 ? 290  PHE A CZ    1 
ATOM   2304 N  N     . GLY A 1 294 ? 43.352  194.017 -3.295  1.00 19.26 ? 291  GLY A N     1 
ATOM   2305 C  CA    . GLY A 1 294 ? 43.203  193.874 -4.747  1.00 20.51 ? 291  GLY A CA    1 
ATOM   2306 C  C     . GLY A 1 294 ? 44.050  194.827 -5.534  1.00 23.43 ? 291  GLY A C     1 
ATOM   2307 O  O     . GLY A 1 294 ? 44.490  195.880 -5.028  1.00 17.66 ? 291  GLY A O     1 
ATOM   2308 N  N     . GLU A 1 295 ? 44.302  194.482 -6.792  1.00 18.20 ? 292  GLU A N     1 
ATOM   2309 C  CA    . GLU A 1 295 ? 45.162  195.241 -7.650  1.00 19.54 ? 292  GLU A CA    1 
ATOM   2310 C  C     . GLU A 1 295 ? 44.673  196.716 -7.751  1.00 19.69 ? 292  GLU A C     1 
ATOM   2311 O  O     . GLU A 1 295 ? 45.468  197.648 -7.585  1.00 19.87 ? 292  GLU A O     1 
ATOM   2312 C  CB    . GLU A 1 295 ? 45.205  194.578 -9.031  1.00 23.20 ? 292  GLU A CB    1 
ATOM   2313 C  CG    . GLU A 1 295 ? 46.070  195.261 -10.023 1.00 26.52 ? 292  GLU A CG    1 
ATOM   2314 C  CD    . GLU A 1 295 ? 46.003  194.581 -11.389 1.00 36.19 ? 292  GLU A CD    1 
ATOM   2315 O  OE1   . GLU A 1 295 ? 45.921  193.332 -11.434 1.00 32.57 ? 292  GLU A OE1   1 
ATOM   2316 O  OE2   . GLU A 1 295 ? 45.999  195.301 -12.408 1.00 40.82 ? 292  GLU A OE2   1 
ATOM   2317 N  N     . LYS A 1 296 ? 43.373  196.901 -8.002  1.00 20.09 ? 293  LYS A N     1 
ATOM   2318 C  CA    . LYS A 1 296 ? 42.873  198.241 -8.313  1.00 19.37 ? 293  LYS A CA    1 
ATOM   2319 C  C     . LYS A 1 296 ? 42.857  199.035 -7.004  1.00 18.60 ? 293  LYS A C     1 
ATOM   2320 O  O     . LYS A 1 296 ? 43.380  200.186 -6.931  1.00 18.79 ? 293  LYS A O     1 
ATOM   2321 C  CB    . LYS A 1 296 ? 41.482  198.194 -9.002  1.00 26.17 ? 293  LYS A CB    1 
ATOM   2322 C  CG    . LYS A 1 296 ? 41.591  197.634 -10.461 1.00 32.52 ? 293  LYS A CG    1 
ATOM   2323 C  CD    . LYS A 1 296 ? 43.059  197.558 -10.994 1.00 40.70 ? 293  LYS A CD    1 
ATOM   2324 C  CE    . LYS A 1 296 ? 43.215  197.890 -12.486 1.00 46.37 ? 293  LYS A CE    1 
ATOM   2325 N  NZ    . LYS A 1 296 ? 44.674  197.875 -12.828 1.00 48.84 ? 293  LYS A NZ    1 
ATOM   2326 N  N     . ASN A 1 297 ? 42.298  198.438 -5.977  1.00 18.95 ? 294  ASN A N     1 
ATOM   2327 C  CA    . ASN A 1 297 ? 42.182  199.198 -4.721  1.00 19.39 ? 294  ASN A CA    1 
ATOM   2328 C  C     . ASN A 1 297 ? 43.575  199.468 -4.156  1.00 17.84 ? 294  ASN A C     1 
ATOM   2329 O  O     . ASN A 1 297 ? 43.784  200.514 -3.531  1.00 16.95 ? 294  ASN A O     1 
ATOM   2330 C  CB    . ASN A 1 297 ? 41.377  198.465 -3.649  1.00 20.74 ? 294  ASN A CB    1 
ATOM   2331 C  CG    . ASN A 1 297 ? 39.888  198.408 -3.949  1.00 23.98 ? 294  ASN A CG    1 
ATOM   2332 O  OD1   . ASN A 1 297 ? 39.359  199.288 -4.634  1.00 24.70 ? 294  ASN A OD1   1 
ATOM   2333 N  ND2   . ASN A 1 297 ? 39.205  197.356 -3.459  1.00 23.00 ? 294  ASN A ND2   1 
ATOM   2334 N  N     . GLY A 1 298 ? 44.455  198.465 -4.244  1.00 19.15 ? 295  GLY A N     1 
ATOM   2335 C  CA    . GLY A 1 298 ? 45.777  198.621 -3.628  1.00 17.53 ? 295  GLY A CA    1 
ATOM   2336 C  C     . GLY A 1 298 ? 46.539  199.780 -4.317  1.00 15.50 ? 295  GLY A C     1 
ATOM   2337 O  O     . GLY A 1 298 ? 47.197  200.630 -3.656  1.00 16.14 ? 295  GLY A O     1 
ATOM   2338 N  N     . SER A 1 299 ? 46.500  199.833 -5.665  1.00 14.51 ? 296  SER A N     1 
ATOM   2339 C  CA    . SER A 1 299 ? 47.158  200.915 -6.393  1.00 14.74 ? 296  SER A CA    1 
ATOM   2340 C  C     . SER A 1 299 ? 46.488  202.263 -6.048  1.00 14.37 ? 296  SER A C     1 
ATOM   2341 O  O     . SER A 1 299 ? 47.178  203.281 -5.909  1.00 16.98 ? 296  SER A O     1 
ATOM   2342 C  CB    . SER A 1 299 ? 47.039  200.679 -7.904  1.00 21.13 ? 296  SER A CB    1 
ATOM   2343 O  OG    . SER A 1 299 ? 47.944  199.659 -8.297  1.00 24.55 ? 296  SER A OG    1 
ATOM   2344 N  N     . TRP A 1 300 ? 45.155  202.243 -5.947  1.00 15.85 ? 297  TRP A N     1 
ATOM   2345 C  CA    . TRP A 1 300 ? 44.452  203.512 -5.625  1.00 13.71 ? 297  TRP A CA    1 
ATOM   2346 C  C     . TRP A 1 300 ? 44.832  204.027 -4.256  1.00 14.38 ? 297  TRP A C     1 
ATOM   2347 O  O     . TRP A 1 300 ? 45.162  205.214 -4.139  1.00 14.93 ? 297  TRP A O     1 
ATOM   2348 C  CB    . TRP A 1 300 ? 42.952  203.258 -5.728  1.00 16.16 ? 297  TRP A CB    1 
ATOM   2349 C  CG    . TRP A 1 300 ? 42.152  204.519 -5.636  1.00 16.43 ? 297  TRP A CG    1 
ATOM   2350 C  CD1   . TRP A 1 300 ? 41.739  205.286 -6.678  1.00 21.39 ? 297  TRP A CD1   1 
ATOM   2351 C  CD2   . TRP A 1 300 ? 41.582  205.082 -4.466  1.00 16.86 ? 297  TRP A CD2   1 
ATOM   2352 N  NE1   . TRP A 1 300 ? 40.986  206.344 -6.238  1.00 22.94 ? 297  TRP A NE1   1 
ATOM   2353 C  CE2   . TRP A 1 300 ? 40.898  206.264 -4.872  1.00 20.60 ? 297  TRP A CE2   1 
ATOM   2354 C  CE3   . TRP A 1 300 ? 41.619  204.747 -3.121  1.00 18.44 ? 297  TRP A CE3   1 
ATOM   2355 C  CZ2   . TRP A 1 300 ? 40.180  207.072 -3.970  1.00 20.88 ? 297  TRP A CZ2   1 
ATOM   2356 C  CZ3   . TRP A 1 300 ? 40.913  205.622 -2.208  1.00 20.82 ? 297  TRP A CZ3   1 
ATOM   2357 C  CH2   . TRP A 1 300 ? 40.231  206.730 -2.667  1.00 18.36 ? 297  TRP A CH2   1 
ATOM   2358 N  N     . LEU A 1 301 ? 44.889  203.123 -3.286  1.00 13.19 ? 298  LEU A N     1 
ATOM   2359 C  CA    . LEU A 1 301 ? 45.268  203.532 -1.918  1.00 14.43 ? 298  LEU A CA    1 
ATOM   2360 C  C     . LEU A 1 301 ? 46.709  204.007 -1.871  1.00 15.81 ? 298  LEU A C     1 
ATOM   2361 O  O     . LEU A 1 301 ? 47.017  204.973 -1.156  1.00 14.63 ? 298  LEU A O     1 
ATOM   2362 C  CB    . LEU A 1 301 ? 45.106  202.403 -0.928  1.00 13.01 ? 298  LEU A CB    1 
ATOM   2363 C  CG    . LEU A 1 301 ? 43.642  201.949 -0.720  1.00 14.72 ? 298  LEU A CG    1 
ATOM   2364 C  CD1   . LEU A 1 301 ? 43.585  200.612 0.047   1.00 16.06 ? 298  LEU A CD1   1 
ATOM   2365 C  CD2   . LEU A 1 301 ? 42.960  203.051 0.142   1.00 17.89 ? 298  LEU A CD2   1 
ATOM   2366 N  N     . TYR A 1 302 ? 47.603  203.338 -2.602  1.00 14.87 ? 299  TYR A N     1 
ATOM   2367 C  CA    . TYR A 1 302 ? 49.043  203.732 -2.544  1.00 13.29 ? 299  TYR A CA    1 
ATOM   2368 C  C     . TYR A 1 302 ? 49.214  205.150 -3.034  1.00 14.94 ? 299  TYR A C     1 
ATOM   2369 O  O     . TYR A 1 302 ? 49.939  205.978 -2.431  1.00 15.38 ? 299  TYR A O     1 
ATOM   2370 C  CB    . TYR A 1 302 ? 49.870  202.707 -3.404  1.00 15.88 ? 299  TYR A CB    1 
ATOM   2371 C  CG    . TYR A 1 302 ? 51.343  203.058 -3.440  1.00 16.79 ? 299  TYR A CG    1 
ATOM   2372 C  CD1   . TYR A 1 302 ? 52.170  202.573 -2.454  1.00 17.64 ? 299  TYR A CD1   1 
ATOM   2373 C  CD2   . TYR A 1 302 ? 51.854  203.899 -4.416  1.00 18.55 ? 299  TYR A CD2   1 
ATOM   2374 C  CE1   . TYR A 1 302 ? 53.563  202.878 -2.448  1.00 16.25 ? 299  TYR A CE1   1 
ATOM   2375 C  CE2   . TYR A 1 302 ? 53.222  204.259 -4.404  1.00 21.42 ? 299  TYR A CE2   1 
ATOM   2376 C  CZ    . TYR A 1 302 ? 54.033  203.718 -3.399  1.00 21.94 ? 299  TYR A CZ    1 
ATOM   2377 O  OH    . TYR A 1 302 ? 55.364  204.029 -3.338  1.00 25.92 ? 299  TYR A OH    1 
ATOM   2378 N  N     . ALA A 1 303 ? 48.539  205.475 -4.135  1.00 14.26 ? 300  ALA A N     1 
ATOM   2379 C  CA    . ALA A 1 303 ? 48.598  206.847 -4.639  1.00 14.21 ? 300  ALA A CA    1 
ATOM   2380 C  C     . ALA A 1 303 ? 47.774  207.839 -3.779  1.00 12.61 ? 300  ALA A C     1 
ATOM   2381 O  O     . ALA A 1 303 ? 48.264  208.955 -3.470  1.00 13.14 ? 300  ALA A O     1 
ATOM   2382 C  CB    . ALA A 1 303 ? 48.085  206.874 -6.100  1.00 17.09 ? 300  ALA A CB    1 
ATOM   2383 N  N     . MET A 1 304 ? 46.577  207.418 -3.333  1.00 13.18 ? 301  MET A N     1 
ATOM   2384 C  CA    . MET A 1 304 ? 45.730  208.372 -2.646  1.00 12.73 ? 301  MET A CA    1 
ATOM   2385 C  C     . MET A 1 304 ? 46.304  208.848 -1.329  1.00 13.35 ? 301  MET A C     1 
ATOM   2386 O  O     . MET A 1 304 ? 46.129  210.044 -0.989  1.00 13.72 ? 301  MET A O     1 
ATOM   2387 C  CB    . MET A 1 304 ? 44.329  207.804 -2.398  1.00 15.51 ? 301  MET A CB    1 
ATOM   2388 C  CG    . MET A 1 304 ? 43.261  208.837 -1.971  1.00 17.01 ? 301  MET A CG    1 
ATOM   2389 S  SD    . MET A 1 304 ? 42.877  209.900 -3.328  1.00 17.12 ? 301  MET A SD    1 
ATOM   2390 C  CE    . MET A 1 304 ? 43.712  211.468 -2.890  1.00 16.98 ? 301  MET A CE    1 
ATOM   2391 N  N     . CYS A 1 305 ? 47.004  207.954 -0.623  1.00 12.73 ? 302  CYS A N     1 
ATOM   2392 C  CA    . CYS A 1 305 ? 47.534  208.407 0.694   1.00 14.96 ? 302  CYS A CA    1 
ATOM   2393 C  C     . CYS A 1 305 ? 48.677  209.384 0.536   1.00 13.14 ? 302  CYS A C     1 
ATOM   2394 O  O     . CYS A 1 305 ? 49.028  210.035 1.505   1.00 14.60 ? 302  CYS A O     1 
ATOM   2395 C  CB    . CYS A 1 305 ? 48.004  207.238 1.563   1.00 13.65 ? 302  CYS A CB    1 
ATOM   2396 S  SG    . CYS A 1 305 ? 49.479  206.382 0.927   1.00 14.53 ? 302  CYS A SG    1 
ATOM   2397 N  N     . ARG A 1 306 ? 49.193  209.538 -0.673  1.00 12.97 ? 303  ARG A N     1 
ATOM   2398 C  CA    . ARG A 1 306 ? 50.193  210.564 -0.999  1.00 12.50 ? 303  ARG A CA    1 
ATOM   2399 C  C     . ARG A 1 306 ? 49.546  211.805 -1.696  1.00 15.91 ? 303  ARG A C     1 
ATOM   2400 O  O     . ARG A 1 306 ? 50.271  212.737 -2.118  1.00 17.60 ? 303  ARG A O     1 
ATOM   2401 C  CB    . ARG A 1 306 ? 51.299  209.982 -1.917  1.00 15.10 ? 303  ARG A CB    1 
ATOM   2402 C  CG    . ARG A 1 306 ? 52.129  208.861 -1.253  1.00 14.28 ? 303  ARG A CG    1 
ATOM   2403 C  CD    . ARG A 1 306 ? 52.905  207.985 -2.255  1.00 16.66 ? 303  ARG A CD    1 
ATOM   2404 N  NE    . ARG A 1 306 ? 53.833  207.202 -1.440  1.00 19.42 ? 303  ARG A NE    1 
ATOM   2405 C  CZ    . ARG A 1 306 ? 53.504  206.164 -0.709  1.00 17.55 ? 303  ARG A CZ    1 
ATOM   2406 N  NH1   . ARG A 1 306 ? 54.443  205.563 0.036   1.00 15.81 ? 303  ARG A NH1   1 
ATOM   2407 N  NH2   . ARG A 1 306 ? 52.288  205.615 -0.781  1.00 14.35 ? 303  ARG A NH2   1 
ATOM   2408 N  N     . GLY A 1 307 ? 48.215  211.850 -1.749  1.00 14.28 ? 304  GLY A N     1 
ATOM   2409 C  CA    . GLY A 1 307 ? 47.505  212.960 -2.332  1.00 15.69 ? 304  GLY A CA    1 
ATOM   2410 C  C     . GLY A 1 307 ? 47.318  212.878 -3.832  1.00 15.50 ? 304  GLY A C     1 
ATOM   2411 O  O     . GLY A 1 307 ? 46.983  213.863 -4.477  1.00 15.90 ? 304  GLY A O     1 
ATOM   2412 N  N     . ILE A 1 308 ? 47.514  211.703 -4.392  1.00 13.74 ? 305  ILE A N     1 
ATOM   2413 C  CA    . ILE A 1 308 ? 47.516  211.487 -5.835  1.00 14.91 ? 305  ILE A CA    1 
ATOM   2414 C  C     . ILE A 1 308 ? 46.357  210.602 -6.261  1.00 16.02 ? 305  ILE A C     1 
ATOM   2415 O  O     . ILE A 1 308 ? 46.147  209.532 -5.719  1.00 15.18 ? 305  ILE A O     1 
ATOM   2416 C  CB    . ILE A 1 308 ? 48.826  210.811 -6.281  1.00 16.14 ? 305  ILE A CB    1 
ATOM   2417 C  CG1   . ILE A 1 308 ? 50.016  211.724 -5.881  1.00 17.51 ? 305  ILE A CG1   1 
ATOM   2418 C  CG2   . ILE A 1 308 ? 48.786  210.457 -7.781  1.00 17.80 ? 305  ILE A CG2   1 
ATOM   2419 C  CD1   . ILE A 1 308 ? 51.392  211.112 -6.263  1.00 22.72 ? 305  ILE A CD1   1 
ATOM   2420 N  N     . GLU A 1 309 ? 45.597  211.066 -7.249  1.00 13.52 ? 306  GLU A N     1 
ATOM   2421 C  CA    . GLU A 1 309 ? 44.458  210.299 -7.705  1.00 16.97 ? 306  GLU A CA    1 
ATOM   2422 C  C     . GLU A 1 309 ? 44.214  210.655 -9.169  1.00 22.92 ? 306  GLU A C     1 
ATOM   2423 O  O     . GLU A 1 309 ? 44.399  211.814 -9.531  1.00 23.51 ? 306  GLU A O     1 
ATOM   2424 C  CB    . GLU A 1 309 ? 43.234  210.662 -6.861  1.00 22.33 ? 306  GLU A CB    1 
ATOM   2425 C  CG    . GLU A 1 309 ? 42.127  209.691 -7.099  1.00 24.88 ? 306  GLU A CG    1 
ATOM   2426 C  CD    . GLU A 1 309 ? 40.741  210.241 -6.879  1.00 26.13 ? 306  GLU A CD    1 
ATOM   2427 O  OE1   . GLU A 1 309 ? 40.537  211.459 -6.793  1.00 26.04 ? 306  GLU A OE1   1 
ATOM   2428 O  OE2   . GLU A 1 309 ? 39.843  209.419 -6.782  1.00 31.39 ? 306  GLU A OE2   1 
ATOM   2429 N  N     . HIS A 1 310 ? 43.811  209.708 -10.015 1.00 24.07 ? 307  HIS A N     1 
ATOM   2430 C  CA    . HIS A 1 310 ? 43.694  210.123 -11.424 1.00 25.46 ? 307  HIS A CA    1 
ATOM   2431 C  C     . HIS A 1 310 ? 42.264  210.124 -12.000 1.00 24.32 ? 307  HIS A C     1 
ATOM   2432 O  O     . HIS A 1 310 ? 42.073  210.477 -13.174 1.00 30.22 ? 307  HIS A O     1 
ATOM   2433 C  CB    . HIS A 1 310 ? 44.634  209.272 -12.289 1.00 27.26 ? 307  HIS A CB    1 
ATOM   2434 C  CG    . HIS A 1 310 ? 46.079  209.436 -11.909 1.00 33.98 ? 307  HIS A CG    1 
ATOM   2435 N  ND1   . HIS A 1 310 ? 46.714  210.665 -11.911 1.00 38.32 ? 307  HIS A ND1   1 
ATOM   2436 C  CD2   . HIS A 1 310 ? 46.983  208.547 -11.439 1.00 36.22 ? 307  HIS A CD2   1 
ATOM   2437 C  CE1   . HIS A 1 310 ? 47.965  210.514 -11.509 1.00 36.73 ? 307  HIS A CE1   1 
ATOM   2438 N  NE2   . HIS A 1 310 ? 48.155  209.237 -11.220 1.00 35.71 ? 307  HIS A NE2   1 
ATOM   2439 N  N     . ASP A 1 311 ? 41.298  209.760 -11.186 1.00 19.69 ? 308  ASP A N     1 
ATOM   2440 C  CA    . ASP A 1 311 ? 39.898  209.636 -11.627 1.00 19.12 ? 308  ASP A CA    1 
ATOM   2441 C  C     . ASP A 1 311 ? 39.471  210.927 -12.321 1.00 20.85 ? 308  ASP A C     1 
ATOM   2442 O  O     . ASP A 1 311 ? 39.381  211.985 -11.698 1.00 18.70 ? 308  ASP A O     1 
ATOM   2443 C  CB    . ASP A 1 311 ? 39.044  209.333 -10.400 1.00 21.57 ? 308  ASP A CB    1 
ATOM   2444 C  CG    . ASP A 1 311 ? 37.544  209.139 -10.709 1.00 32.85 ? 308  ASP A CG    1 
ATOM   2445 O  OD1   . ASP A 1 311 ? 36.760  209.165 -9.730  1.00 41.32 ? 308  ASP A OD1   1 
ATOM   2446 O  OD2   . ASP A 1 311 ? 37.110  208.946 -11.870 1.00 37.95 ? 308  ASP A OD2   1 
ATOM   2447 N  N     . PRO A 1 312 ? 39.132  210.872 -13.626 1.00 18.86 ? 309  PRO A N     1 
ATOM   2448 C  CA    . PRO A 1 312 ? 38.842  212.109 -14.344 1.00 20.76 ? 309  PRO A CA    1 
ATOM   2449 C  C     . PRO A 1 312 ? 37.504  212.695 -13.967 1.00 16.85 ? 309  PRO A C     1 
ATOM   2450 O  O     . PRO A 1 312 ? 36.591  211.958 -13.533 1.00 18.49 ? 309  PRO A O     1 
ATOM   2451 C  CB    . PRO A 1 312 ? 38.816  211.661 -15.827 1.00 22.34 ? 309  PRO A CB    1 
ATOM   2452 C  CG    . PRO A 1 312 ? 38.399  210.247 -15.744 1.00 22.59 ? 309  PRO A CG    1 
ATOM   2453 C  CD    . PRO A 1 312 ? 39.090  209.694 -14.512 1.00 22.80 ? 309  PRO A CD    1 
ATOM   2454 N  N     . VAL A 1 313 ? 37.426  214.006 -14.113 1.00 18.77 ? 310  VAL A N     1 
ATOM   2455 C  CA    . VAL A 1 313 ? 36.115  214.688 -14.104 1.00 16.98 ? 310  VAL A CA    1 
ATOM   2456 C  C     . VAL A 1 313 ? 35.423  214.281 -15.409 1.00 17.48 ? 310  VAL A C     1 
ATOM   2457 O  O     . VAL A 1 313 ? 35.881  214.652 -16.498 1.00 19.80 ? 310  VAL A O     1 
ATOM   2458 C  CB    . VAL A 1 313 ? 36.280  216.185 -14.010 1.00 17.14 ? 310  VAL A CB    1 
ATOM   2459 C  CG1   . VAL A 1 313 ? 34.884  216.921 -14.054 1.00 17.82 ? 310  VAL A CG1   1 
ATOM   2460 C  CG2   . VAL A 1 313 ? 36.995  216.509 -12.740 1.00 18.57 ? 310  VAL A CG2   1 
ATOM   2461 N  N     . LYS A 1 314 ? 34.370  213.485 -15.284 1.00 20.00 ? 311  LYS A N     1 
ATOM   2462 C  CA    . LYS A 1 314 ? 33.669  212.986 -16.485 1.00 19.66 ? 311  LYS A CA    1 
ATOM   2463 C  C     . LYS A 1 314 ? 32.692  214.028 -17.014 1.00 19.39 ? 311  LYS A C     1 
ATOM   2464 O  O     . LYS A 1 314 ? 31.968  214.687 -16.267 1.00 19.73 ? 311  LYS A O     1 
ATOM   2465 C  CB    . LYS A 1 314 ? 32.938  211.699 -16.137 1.00 19.17 ? 311  LYS A CB    1 
ATOM   2466 C  CG    . LYS A 1 314 ? 33.897  210.600 -15.658 1.00 22.05 ? 311  LYS A CG    1 
ATOM   2467 C  CD    . LYS A 1 314 ? 33.110  209.436 -15.173 1.00 26.69 ? 311  LYS A CD    1 
ATOM   2468 C  CE    . LYS A 1 314 ? 33.981  208.276 -14.711 1.00 34.04 ? 311  LYS A CE    1 
ATOM   2469 N  NZ    . LYS A 1 314 ? 33.067  207.095 -14.571 1.00 36.12 ? 311  LYS A NZ    1 
ATOM   2470 N  N     . PRO A 1 315 ? 32.672  214.212 -18.324 1.00 18.37 ? 312  PRO A N     1 
ATOM   2471 C  CA    . PRO A 1 315 ? 31.755  215.160 -18.914 1.00 18.95 ? 312  PRO A CA    1 
ATOM   2472 C  C     . PRO A 1 315 ? 30.323  214.585 -18.896 1.00 20.96 ? 312  PRO A C     1 
ATOM   2473 O  O     . PRO A 1 315 ? 29.877  213.918 -19.863 1.00 22.82 ? 312  PRO A O     1 
ATOM   2474 C  CB    . PRO A 1 315 ? 32.303  215.305 -20.343 1.00 20.93 ? 312  PRO A CB    1 
ATOM   2475 C  CG    . PRO A 1 315 ? 32.913  213.931 -20.647 1.00 22.61 ? 312  PRO A CG    1 
ATOM   2476 C  CD    . PRO A 1 315 ? 33.560  213.574 -19.333 1.00 18.01 ? 312  PRO A CD    1 
ATOM   2477 N  N     . ARG A 1 316 ? 29.581  214.839 -17.812 1.00 18.75 ? 313  ARG A N     1 
ATOM   2478 C  CA    . ARG A 1 316 ? 28.232  214.267 -17.676 1.00 19.61 ? 313  ARG A CA    1 
ATOM   2479 C  C     . ARG A 1 316 ? 27.433  215.141 -16.742 1.00 23.51 ? 313  ARG A C     1 
ATOM   2480 O  O     . ARG A 1 316 ? 27.666  215.141 -15.539 1.00 20.49 ? 313  ARG A O     1 
ATOM   2481 C  CB    A ARG A 1 316 ? 28.335  212.834 -17.136 0.46 23.05 ? 313  ARG A CB    1 
ATOM   2482 C  CB    B ARG A 1 316 ? 28.265  212.836 -17.165 0.54 23.07 ? 313  ARG A CB    1 
ATOM   2483 C  CG    A ARG A 1 316 ? 27.070  211.978 -17.254 0.46 24.37 ? 313  ARG A CG    1 
ATOM   2484 C  CG    B ARG A 1 316 ? 26.870  212.207 -17.230 0.54 24.30 ? 313  ARG A CG    1 
ATOM   2485 C  CD    A ARG A 1 316 ? 27.194  210.717 -16.399 0.46 24.92 ? 313  ARG A CD    1 
ATOM   2486 C  CD    B ARG A 1 316 ? 26.828  210.818 -16.629 0.54 24.57 ? 313  ARG A CD    1 
ATOM   2487 N  NE    A ARG A 1 316 ? 27.225  211.029 -14.969 0.46 25.15 ? 313  ARG A NE    1 
ATOM   2488 N  NE    B ARG A 1 316 ? 27.294  210.814 -15.248 0.54 24.98 ? 313  ARG A NE    1 
ATOM   2489 C  CZ    A ARG A 1 316 ? 28.232  210.752 -14.136 0.46 26.34 ? 313  ARG A CZ    1 
ATOM   2490 C  CZ    B ARG A 1 316 ? 26.617  211.299 -14.205 0.54 25.21 ? 313  ARG A CZ    1 
ATOM   2491 N  NH1   A ARG A 1 316 ? 28.139  211.100 -12.861 0.46 25.30 ? 313  ARG A NH1   1 
ATOM   2492 N  NH1   B ARG A 1 316 ? 27.159  211.234 -12.993 0.54 24.42 ? 313  ARG A NH1   1 
ATOM   2493 N  NH2   A ARG A 1 316 ? 29.331  210.146 -14.569 0.46 27.58 ? 313  ARG A NH2   1 
ATOM   2494 N  NH2   B ARG A 1 316 ? 25.418  211.873 -14.360 0.54 23.04 ? 313  ARG A NH2   1 
ATOM   2495 N  N     . GLN A 1 317 ? 26.464  215.852 -17.295 1.00 22.54 ? 314  GLN A N     1 
ATOM   2496 C  CA    . GLN A 1 317 ? 25.662  216.837 -16.558 1.00 22.97 ? 314  GLN A CA    1 
ATOM   2497 C  C     . GLN A 1 317 ? 24.307  216.261 -16.135 1.00 28.93 ? 314  GLN A C     1 
ATOM   2498 O  O     . GLN A 1 317 ? 23.642  216.754 -15.215 1.00 27.35 ? 314  GLN A O     1 
ATOM   2499 C  CB    . GLN A 1 317 ? 25.469  218.077 -17.430 1.00 31.61 ? 314  GLN A CB    1 
ATOM   2500 C  CG    . GLN A 1 317 ? 24.694  219.165 -16.774 1.00 32.31 ? 314  GLN A CG    1 
ATOM   2501 C  CD    . GLN A 1 317 ? 24.737  220.488 -17.523 1.00 32.76 ? 314  GLN A CD    1 
ATOM   2502 O  OE1   . GLN A 1 317 ? 25.445  220.640 -18.539 1.00 38.95 ? 314  GLN A OE1   1 
ATOM   2503 N  NE2   . GLN A 1 317 ? 23.990  221.464 -17.014 1.00 32.89 ? 314  GLN A NE2   1 
ATOM   2504 N  N     . LEU A 1 318 ? 23.927  215.207 -16.822 1.00 23.68 ? 315  LEU A N     1 
ATOM   2505 C  CA    . LEU A 1 318 ? 22.615  214.590 -16.710 1.00 27.82 ? 315  LEU A CA    1 
ATOM   2506 C  C     . LEU A 1 318 ? 22.709  213.261 -16.009 1.00 25.02 ? 315  LEU A C     1 
ATOM   2507 O  O     . LEU A 1 318 ? 23.591  212.455 -16.290 1.00 24.08 ? 315  LEU A O     1 
ATOM   2508 C  CB    . LEU A 1 318 ? 22.007  214.314 -18.099 1.00 24.52 ? 315  LEU A CB    1 
ATOM   2509 C  CG    . LEU A 1 318 ? 21.740  215.587 -18.924 1.00 26.95 ? 315  LEU A CG    1 
ATOM   2510 C  CD1   . LEU A 1 318 ? 21.144  215.109 -20.250 1.00 25.62 ? 315  LEU A CD1   1 
ATOM   2511 C  CD2   . LEU A 1 318 ? 20.803  216.569 -18.204 1.00 25.90 ? 315  LEU A CD2   1 
ATOM   2512 N  N     . PRO A 1 319 ? 21.714  212.967 -15.165 1.00 22.63 ? 316  PRO A N     1 
ATOM   2513 C  CA    . PRO A 1 319 ? 21.663  211.587 -14.641 1.00 25.70 ? 316  PRO A CA    1 
ATOM   2514 C  C     . PRO A 1 319 ? 21.601  210.529 -15.742 1.00 23.34 ? 316  PRO A C     1 
ATOM   2515 O  O     . PRO A 1 319 ? 21.065  210.816 -16.761 1.00 27.69 ? 316  PRO A O     1 
ATOM   2516 C  CB    . PRO A 1 319 ? 20.373  211.569 -13.816 1.00 24.66 ? 316  PRO A CB    1 
ATOM   2517 C  CG    . PRO A 1 319 ? 19.996  213.029 -13.632 1.00 29.34 ? 316  PRO A CG    1 
ATOM   2518 C  CD    . PRO A 1 319 ? 20.548  213.779 -14.789 1.00 24.01 ? 316  PRO A CD    1 
ATOM   2519 N  N     . LYS A 1 320 ? 22.165  209.337 -15.527 1.00 23.72 ? 317  LYS A N     1 
ATOM   2520 C  CA    . LYS A 1 320 ? 22.159  208.188 -16.466 1.00 19.86 ? 317  LYS A CA    1 
ATOM   2521 C  C     . LYS A 1 320 ? 20.939  207.230 -16.340 1.00 27.00 ? 317  LYS A C     1 
ATOM   2522 O  O     . LYS A 1 320 ? 20.783  206.315 -17.139 1.00 25.34 ? 317  LYS A O     1 
ATOM   2523 C  CB    . LYS A 1 320 ? 23.390  207.285 -16.230 1.00 31.21 ? 317  LYS A CB    1 
ATOM   2524 C  CG    . LYS A 1 320 ? 24.694  207.781 -16.711 1.00 34.49 ? 317  LYS A CG    1 
ATOM   2525 C  CD    . LYS A 1 320 ? 25.770  206.683 -16.477 1.00 32.38 ? 317  LYS A CD    1 
ATOM   2526 C  CE    . LYS A 1 320 ? 26.861  206.811 -17.495 1.00 35.07 ? 317  LYS A CE    1 
ATOM   2527 N  NZ    . LYS A 1 320 ? 27.995  205.993 -17.075 1.00 39.23 ? 317  LYS A NZ    1 
ATOM   2528 N  N     . THR A 1 321 ? 20.167  207.382 -15.262 1.00 26.71 ? 318  THR A N     1 
ATOM   2529 C  CA    . THR A 1 321 ? 19.013  206.521 -14.996 1.00 24.59 ? 318  THR A CA    1 
ATOM   2530 C  C     . THR A 1 321 ? 17.971  207.472 -14.441 1.00 21.98 ? 318  THR A C     1 
ATOM   2531 O  O     . THR A 1 321 ? 18.290  208.565 -13.961 1.00 22.62 ? 318  THR A O     1 
ATOM   2532 C  CB    . THR A 1 321 ? 19.330  205.330 -13.978 1.00 23.03 ? 318  THR A CB    1 
ATOM   2533 O  OG1   . THR A 1 321 ? 19.800  205.905 -12.756 1.00 23.21 ? 318  THR A OG1   1 
ATOM   2534 C  CG2   . THR A 1 321 ? 20.378  204.364 -14.496 1.00 23.03 ? 318  THR A CG2   1 
ATOM   2535 N  N     . ILE A 1 322 ? 16.691  207.067 -14.545 1.00 18.51 ? 319  ILE A N     1 
ATOM   2536 C  CA    . ILE A 1 322 ? 15.605  207.805 -13.981 1.00 20.08 ? 319  ILE A CA    1 
ATOM   2537 C  C     . ILE A 1 322 ? 14.753  206.761 -13.292 1.00 18.59 ? 319  ILE A C     1 
ATOM   2538 O  O     . ILE A 1 322 ? 14.307  205.836 -13.944 1.00 20.55 ? 319  ILE A O     1 
ATOM   2539 C  CB    . ILE A 1 322 ? 14.817  208.536 -15.077 1.00 18.83 ? 319  ILE A CB    1 
ATOM   2540 C  CG1   . ILE A 1 322 ? 15.703  209.647 -15.689 1.00 24.18 ? 319  ILE A CG1   1 
ATOM   2541 C  CG2   . ILE A 1 322 ? 13.586  209.165 -14.499 1.00 21.24 ? 319  ILE A CG2   1 
ATOM   2542 C  CD1   . ILE A 1 322 ? 14.951  210.529 -16.726 1.00 22.61 ? 319  ILE A CD1   1 
ATOM   2543 N  N     . GLY A 1 323 ? 14.598  206.888 -11.986 1.00 17.37 ? 320  GLY A N     1 
ATOM   2544 C  CA    . GLY A 1 323 ? 13.992  205.819 -11.210 1.00 20.65 ? 320  GLY A CA    1 
ATOM   2545 C  C     . GLY A 1 323 ? 12.979  206.343 -10.210 1.00 19.01 ? 320  GLY A C     1 
ATOM   2546 O  O     . GLY A 1 323 ? 12.996  207.499 -9.832  1.00 19.92 ? 320  GLY A O     1 
ATOM   2547 N  N     . CYS A 1 324 ? 12.079  205.436 -9.845  1.00 18.75 ? 321  CYS A N     1 
ATOM   2548 C  CA    A CYS A 1 324 ? 10.953  205.684 -8.961  0.22 19.54 ? 321  CYS A CA    1 
ATOM   2549 C  CA    B CYS A 1 324 ? 10.950  205.715 -8.913  0.78 19.48 ? 321  CYS A CA    1 
ATOM   2550 C  C     . CYS A 1 324 ? 10.916  204.560 -7.942  1.00 21.03 ? 321  CYS A C     1 
ATOM   2551 O  O     . CYS A 1 324 ? 10.871  203.446 -8.350  1.00 21.79 ? 321  CYS A O     1 
ATOM   2552 C  CB    A CYS A 1 324 ? 9.647   205.676 -9.772  0.22 18.42 ? 321  CYS A CB    1 
ATOM   2553 C  CB    B CYS A 1 324 ? 9.545   205.776 -9.653  0.78 18.08 ? 321  CYS A CB    1 
ATOM   2554 S  SG    A CYS A 1 324 ? 8.440   206.780 -9.165  0.22 22.28 ? 321  CYS A SG    1 
ATOM   2555 S  SG    B CYS A 1 324 ? 9.446   207.199 -10.743 0.78 26.45 ? 321  CYS A SG    1 
ATOM   2556 N  N     . SER A 1 325 ? 10.948  204.844 -6.655  1.00 18.47 ? 322  SER A N     1 
ATOM   2557 C  CA    A SER A 1 325 ? 10.869  203.743 -5.692  0.49 18.82 ? 322  SER A CA    1 
ATOM   2558 C  CA    B SER A 1 325 ? 11.023  203.804 -5.618  0.51 18.78 ? 322  SER A CA    1 
ATOM   2559 C  C     . SER A 1 325 ? 10.029  204.091 -4.484  1.00 19.23 ? 322  SER A C     1 
ATOM   2560 O  O     . SER A 1 325 ? 9.897   205.268 -4.066  1.00 20.99 ? 322  SER A O     1 
ATOM   2561 C  CB    A SER A 1 325 ? 12.255  203.286 -5.227  0.49 21.15 ? 322  SER A CB    1 
ATOM   2562 C  CB    B SER A 1 325 ? 12.456  203.742 -5.078  0.51 20.87 ? 322  SER A CB    1 
ATOM   2563 O  OG    A SER A 1 325 ? 12.973  204.266 -4.491  0.49 19.96 ? 322  SER A OG    1 
ATOM   2564 O  OG    B SER A 1 325 ? 12.596  202.955 -3.903  0.51 21.04 ? 322  SER A OG    1 
ATOM   2565 N  N     . LYS A 1 326 ? 9.410   203.031 -3.934  1.00 18.39 ? 323  LYS A N     1 
ATOM   2566 C  CA    . LYS A 1 326 ? 8.664   203.229 -2.683  1.00 19.88 ? 323  LYS A CA    1 
ATOM   2567 C  C     . LYS A 1 326 ? 8.816   202.032 -1.746  1.00 20.39 ? 323  LYS A C     1 
ATOM   2568 O  O     . LYS A 1 326 ? 8.671   200.909 -2.168  1.00 19.85 ? 323  LYS A O     1 
ATOM   2569 C  CB    . LYS A 1 326 ? 7.178   203.476 -2.950  1.00 19.97 ? 323  LYS A CB    1 
ATOM   2570 C  CG    . LYS A 1 326 ? 6.414   203.890 -1.632  1.00 21.21 ? 323  LYS A CG    1 
ATOM   2571 C  CD    . LYS A 1 326 ? 5.042   204.395 -1.942  1.00 22.54 ? 323  LYS A CD    1 
ATOM   2572 C  CE    . LYS A 1 326 ? 4.241   204.471 -0.649  1.00 26.77 ? 323  LYS A CE    1 
ATOM   2573 N  NZ    . LYS A 1 326 ? 4.935   205.470 0.207   1.00 28.77 ? 323  LYS A NZ    1 
ATOM   2574 N  N     . ASN A 1 327 ? 9.123   202.286 -0.480  1.00 18.96 ? 324  ASN A N     1 
ATOM   2575 C  CA    . ASN A 1 327 ? 9.067   201.275 0.563   1.00 22.24 ? 324  ASN A CA    1 
ATOM   2576 C  C     . ASN A 1 327 ? 7.676   201.123 1.180   1.00 23.39 ? 324  ASN A C     1 
ATOM   2577 O  O     . ASN A 1 327 ? 6.895   202.068 1.220   1.00 20.67 ? 324  ASN A O     1 
ATOM   2578 C  CB    . ASN A 1 327 ? 10.005  201.598 1.712   1.00 21.17 ? 324  ASN A CB    1 
ATOM   2579 C  CG    . ASN A 1 327 ? 11.465  201.544 1.354   1.00 25.44 ? 324  ASN A CG    1 
ATOM   2580 O  OD1   . ASN A 1 327 ? 11.874  201.120 0.275   1.00 30.53 ? 324  ASN A OD1   1 
ATOM   2581 N  ND2   . ASN A 1 327 ? 12.281  201.954 2.303   1.00 29.11 ? 324  ASN A ND2   1 
ATOM   2582 N  N     . PHE A 1 328 ? 7.446   199.926 1.725   1.00 23.12 ? 325  PHE A N     1 
ATOM   2583 C  CA    . PHE A 1 328 ? 6.212   199.564 2.407   1.00 25.16 ? 325  PHE A CA    1 
ATOM   2584 C  C     . PHE A 1 328 ? 6.591   198.846 3.701   1.00 27.32 ? 325  PHE A C     1 
ATOM   2585 O  O     . PHE A 1 328 ? 6.638   197.612 3.747   1.00 26.69 ? 325  PHE A O     1 
ATOM   2586 C  CB    . PHE A 1 328 ? 5.373   198.683 1.486   1.00 25.02 ? 325  PHE A CB    1 
ATOM   2587 C  CG    . PHE A 1 328 ? 5.088   199.334 0.159   1.00 22.57 ? 325  PHE A CG    1 
ATOM   2588 C  CD1   . PHE A 1 328 ? 5.922   199.096 -0.931  1.00 23.06 ? 325  PHE A CD1   1 
ATOM   2589 C  CD2   . PHE A 1 328 ? 4.043   200.204 0.011   1.00 21.91 ? 325  PHE A CD2   1 
ATOM   2590 C  CE1   . PHE A 1 328 ? 5.674   199.709 -2.143  1.00 21.26 ? 325  PHE A CE1   1 
ATOM   2591 C  CE2   . PHE A 1 328 ? 3.775   200.814 -1.191  1.00 21.88 ? 325  PHE A CE2   1 
ATOM   2592 C  CZ    . PHE A 1 328 ? 4.630   200.581 -2.293  1.00 24.04 ? 325  PHE A CZ    1 
ATOM   2593 N  N     . PRO A 1 329 ? 6.917   199.617 4.743   1.00 27.85 ? 326  PRO A N     1 
ATOM   2594 C  CA    . PRO A 1 329 ? 7.577   199.069 5.941   1.00 32.09 ? 326  PRO A CA    1 
ATOM   2595 C  C     . PRO A 1 329 ? 6.589   198.403 6.894   1.00 30.50 ? 326  PRO A C     1 
ATOM   2596 O  O     . PRO A 1 329 ? 5.395   198.738 6.894   1.00 29.94 ? 326  PRO A O     1 
ATOM   2597 C  CB    . PRO A 1 329 ? 8.213   200.304 6.589   1.00 34.88 ? 326  PRO A CB    1 
ATOM   2598 C  CG    . PRO A 1 329 ? 7.361   201.443 6.111   1.00 34.72 ? 326  PRO A CG    1 
ATOM   2599 C  CD    . PRO A 1 329 ? 6.986   201.087 4.701   1.00 31.86 ? 326  PRO A CD    1 
ATOM   2600 N  N     . GLY A 1 330 ? 7.094   197.448 7.666   1.00 37.19 ? 327  GLY A N     1 
ATOM   2601 C  CA    . GLY A 1 330 ? 6.339   196.874 8.760   1.00 33.72 ? 327  GLY A CA    1 
ATOM   2602 C  C     . GLY A 1 330 ? 5.027   196.294 8.302   1.00 37.83 ? 327  GLY A C     1 
ATOM   2603 O  O     . GLY A 1 330 ? 4.992   195.420 7.422   1.00 32.14 ? 327  GLY A O     1 
ATOM   2604 N  N     . LYS A 1 331 ? 3.948   196.806 8.898   1.00 35.32 ? 328  LYS A N     1 
ATOM   2605 C  CA    . LYS A 1 331 ? 2.628   196.256 8.667   1.00 38.92 ? 328  LYS A CA    1 
ATOM   2606 C  C     . LYS A 1 331 ? 2.056   196.730 7.336   1.00 36.26 ? 328  LYS A C     1 
ATOM   2607 O  O     . LYS A 1 331 ? 1.063   196.188 6.873   1.00 42.09 ? 328  LYS A O     1 
ATOM   2608 C  CB    . LYS A 1 331 ? 1.691   196.606 9.847   1.00 36.25 ? 328  LYS A CB    1 
ATOM   2609 C  CG    . LYS A 1 331 ? 0.881   195.405 10.315  1.00 49.44 ? 328  LYS A CG    1 
ATOM   2610 C  CD    . LYS A 1 331 ? -0.058  195.732 11.474  1.00 45.64 ? 328  LYS A CD    1 
ATOM   2611 C  CE    . LYS A 1 331 ? -0.881  194.505 11.896  1.00 52.94 ? 328  LYS A CE    1 
ATOM   2612 N  NZ    . LYS A 1 331 ? -1.159  193.543 10.796  1.00 57.43 ? 328  LYS A NZ    1 
ATOM   2613 N  N     . THR A 1 332 ? 2.704   197.688 6.673   1.00 32.08 ? 329  THR A N     1 
ATOM   2614 C  CA    . THR A 1 332 ? 2.183   198.184 5.399   1.00 32.81 ? 329  THR A CA    1 
ATOM   2615 C  C     . THR A 1 332 ? 2.668   197.383 4.180   1.00 28.50 ? 329  THR A C     1 
ATOM   2616 O  O     . THR A 1 332 ? 2.275   197.704 3.075   1.00 28.20 ? 329  THR A O     1 
ATOM   2617 C  CB    . THR A 1 332 ? 2.564   199.670 5.138   1.00 35.33 ? 329  THR A CB    1 
ATOM   2618 O  OG1   . THR A 1 332 ? 3.957   199.751 4.845   1.00 32.88 ? 329  THR A OG1   1 
ATOM   2619 C  CG2   . THR A 1 332 ? 2.248   200.582 6.344   1.00 36.00 ? 329  THR A CG2   1 
ATOM   2620 N  N     . ALA A 1 333 ? 3.494   196.359 4.393   1.00 31.40 ? 330  ALA A N     1 
ATOM   2621 C  CA    . ALA A 1 333 ? 4.029   195.513 3.297   1.00 29.17 ? 330  ALA A CA    1 
ATOM   2622 C  C     . ALA A 1 333 ? 2.905   194.973 2.438   1.00 35.19 ? 330  ALA A C     1 
ATOM   2623 O  O     . ALA A 1 333 ? 1.866   194.569 2.961   1.00 35.59 ? 330  ALA A O     1 
ATOM   2624 C  CB    . ALA A 1 333 ? 4.914   194.369 3.875   1.00 30.74 ? 330  ALA A CB    1 
ATOM   2625 N  N     . LEU A 1 334 ? 3.094   194.967 1.117   1.00 29.61 ? 331  LEU A N     1 
ATOM   2626 C  CA    . LEU A 1 334 ? 2.031   194.652 0.184   1.00 31.54 ? 331  LEU A CA    1 
ATOM   2627 C  C     . LEU A 1 334 ? 1.733   193.137 0.164   1.00 33.72 ? 331  LEU A C     1 
ATOM   2628 O  O     . LEU A 1 334 ? 2.629   192.333 -0.079  1.00 34.39 ? 331  LEU A O     1 
ATOM   2629 C  CB    . LEU A 1 334 ? 2.405   195.128 -1.233  1.00 29.57 ? 331  LEU A CB    1 
ATOM   2630 C  CG    . LEU A 1 334 ? 2.912   196.583 -1.320  1.00 24.81 ? 331  LEU A CG    1 
ATOM   2631 C  CD1   . LEU A 1 334 ? 3.056   196.912 -2.810  1.00 24.28 ? 331  LEU A CD1   1 
ATOM   2632 C  CD2   . LEU A 1 334 ? 1.877   197.478 -0.688  1.00 24.84 ? 331  LEU A CD2   1 
ATOM   2633 N  N     . ALA A 1 335 ? 0.479   192.765 0.386   1.00 37.91 ? 332  ALA A N     1 
ATOM   2634 C  CA    . ALA A 1 335 ? 0.140   191.342 0.636   1.00 38.37 ? 332  ALA A CA    1 
ATOM   2635 C  C     . ALA A 1 335 ? -0.818  190.755 -0.376  1.00 42.77 ? 332  ALA A C     1 
ATOM   2636 O  O     . ALA A 1 335 ? -1.123  189.553 -0.324  1.00 41.69 ? 332  ALA A O     1 
ATOM   2637 C  CB    . ALA A 1 335 ? -0.439  191.186 2.033   1.00 37.77 ? 332  ALA A CB    1 
ATOM   2638 N  N     . THR A 1 336 ? -1.332  191.592 -1.273  1.00 34.75 ? 333  THR A N     1 
ATOM   2639 C  CA    . THR A 1 336 ? -2.220  191.115 -2.321  1.00 41.44 ? 333  THR A CA    1 
ATOM   2640 C  C     . THR A 1 336 ? -1.711  191.509 -3.695  1.00 44.62 ? 333  THR A C     1 
ATOM   2641 O  O     . THR A 1 336 ? -0.999  192.512 -3.839  1.00 38.94 ? 333  THR A O     1 
ATOM   2642 C  CB    . THR A 1 336 ? -3.634  191.649 -2.177  1.00 41.07 ? 333  THR A CB    1 
ATOM   2643 O  OG1   . THR A 1 336 ? -3.676  193.040 -2.506  1.00 36.48 ? 333  THR A OG1   1 
ATOM   2644 C  CG2   . THR A 1 336 ? -4.185  191.398 -0.756  1.00 37.89 ? 333  THR A CG2   1 
ATOM   2645 N  N     . ARG A 1 337 ? -2.106  190.728 -4.699  1.00 41.33 ? 334  ARG A N     1 
ATOM   2646 C  CA    . ARG A 1 337 ? -1.715  190.993 -6.076  1.00 42.63 ? 334  ARG A CA    1 
ATOM   2647 C  C     . ARG A 1 337 ? -2.188  192.350 -6.549  1.00 40.30 ? 334  ARG A C     1 
ATOM   2648 O  O     . ARG A 1 337 ? -1.501  193.018 -7.336  1.00 38.05 ? 334  ARG A O     1 
ATOM   2649 C  CB    . ARG A 1 337 ? -2.258  189.913 -7.018  1.00 48.46 ? 334  ARG A CB    1 
ATOM   2650 C  CG    . ARG A 1 337 ? -1.936  190.191 -8.500  1.00 50.04 ? 334  ARG A CG    1 
ATOM   2651 C  CD    . ARG A 1 337 ? -2.521  189.151 -9.473  1.00 56.15 ? 334  ARG A CD    1 
ATOM   2652 N  NE    . ARG A 1 337 ? -3.945  188.907 -9.248  1.00 64.10 ? 334  ARG A NE    1 
ATOM   2653 C  CZ    . ARG A 1 337 ? -4.925  189.727 -9.630  1.00 63.59 ? 334  ARG A CZ    1 
ATOM   2654 N  NH1   . ARG A 1 337 ? -4.646  190.865 -10.255 1.00 58.63 ? 334  ARG A NH1   1 
ATOM   2655 N  NH2   . ARG A 1 337 ? -6.191  189.413 -9.376  1.00 69.41 ? 334  ARG A NH2   1 
ATOM   2656 N  N     . GLU A 1 338 ? -3.354  192.790 -6.098  1.00 39.06 ? 335  GLU A N     1 
ATOM   2657 C  CA    . GLU A 1 338 ? -3.875  194.028 -6.675  1.00 41.68 ? 335  GLU A CA    1 
ATOM   2658 C  C     . GLU A 1 338 ? -3.296  195.278 -5.971  1.00 38.88 ? 335  GLU A C     1 
ATOM   2659 O  O     . GLU A 1 338 ? -3.320  196.386 -6.534  1.00 38.53 ? 335  GLU A O     1 
ATOM   2660 C  CB    . GLU A 1 338 ? -5.394  194.055 -6.649  1.00 47.55 ? 335  GLU A CB    1 
ATOM   2661 C  CG    . GLU A 1 338 ? -5.947  195.124 -7.583  1.00 50.37 ? 335  GLU A CG    1 
ATOM   2662 C  CD    . GLU A 1 338 ? -7.407  195.443 -7.369  1.00 58.23 ? 335  GLU A CD    1 
ATOM   2663 O  OE1   . GLU A 1 338 ? -8.067  194.772 -6.546  1.00 61.26 ? 335  GLU A OE1   1 
ATOM   2664 O  OE2   . GLU A 1 338 ? -7.896  196.389 -8.033  1.00 62.10 ? 335  GLU A OE2   1 
ATOM   2665 N  N     . GLN A 1 339 ? -2.801  195.101 -4.748  1.00 34.93 ? 336  GLN A N     1 
ATOM   2666 C  CA    . GLN A 1 339 ? -1.998  196.151 -4.108  1.00 36.85 ? 336  GLN A CA    1 
ATOM   2667 C  C     . GLN A 1 339 ? -0.743  196.347 -4.960  1.00 35.16 ? 336  GLN A C     1 
ATOM   2668 O  O     . GLN A 1 339 ? -0.368  197.484 -5.305  1.00 33.24 ? 336  GLN A O     1 
ATOM   2669 C  CB    . GLN A 1 339 ? -1.589  195.768 -2.697  1.00 36.57 ? 336  GLN A CB    1 
ATOM   2670 C  CG    . GLN A 1 339 ? -2.352  196.417 -1.561  1.00 34.63 ? 336  GLN A CG    1 
ATOM   2671 C  CD    . GLN A 1 339 ? -1.785  195.960 -0.255  1.00 31.40 ? 336  GLN A CD    1 
ATOM   2672 O  OE1   . GLN A 1 339 ? -1.538  194.783 -0.084  1.00 31.87 ? 336  GLN A OE1   1 
ATOM   2673 N  NE2   . GLN A 1 339 ? -1.524  196.894 0.666   1.00 26.71 ? 336  GLN A NE2   1 
ATOM   2674 N  N     . VAL A 1 340 ? -0.107  195.225 -5.287  1.00 33.18 ? 337  VAL A N     1 
ATOM   2675 C  CA    . VAL A 1 340 ? 1.152   195.237 -6.010  1.00 32.47 ? 337  VAL A CA    1 
ATOM   2676 C  C     . VAL A 1 340 ? 0.935   195.938 -7.355  1.00 30.34 ? 337  VAL A C     1 
ATOM   2677 O  O     . VAL A 1 340 ? 1.729   196.787 -7.779  1.00 28.61 ? 337  VAL A O     1 
ATOM   2678 C  CB    . VAL A 1 340 ? 1.710   193.815 -6.210  1.00 36.68 ? 337  VAL A CB    1 
ATOM   2679 C  CG1   . VAL A 1 340 ? 2.834   193.838 -7.188  1.00 29.13 ? 337  VAL A CG1   1 
ATOM   2680 C  CG2   . VAL A 1 340 ? 2.201   193.216 -4.873  1.00 31.39 ? 337  VAL A CG2   1 
ATOM   2681 N  N     . GLN A 1 341 ? -0.161  195.634 -8.013  1.00 31.87 ? 338  GLN A N     1 
ATOM   2682 C  CA    . GLN A 1 341 ? -0.403  196.219 -9.323  1.00 31.75 ? 338  GLN A CA    1 
ATOM   2683 C  C     . GLN A 1 341 ? -0.712  197.698 -9.270  1.00 31.56 ? 338  GLN A C     1 
ATOM   2684 O  O     . GLN A 1 341 ? -0.297  198.465 -10.147 1.00 31.24 ? 338  GLN A O     1 
ATOM   2685 C  CB    . GLN A 1 341 ? -1.538  195.483 -10.033 1.00 35.81 ? 338  GLN A CB    1 
ATOM   2686 C  CG    . GLN A 1 341 ? -1.131  194.054 -10.364 1.00 40.16 ? 338  GLN A CG    1 
ATOM   2687 C  CD    . GLN A 1 341 ? -2.267  193.281 -11.012 1.00 45.45 ? 338  GLN A CD    1 
ATOM   2688 O  OE1   . GLN A 1 341 ? -3.435  193.544 -10.745 1.00 45.45 ? 338  GLN A OE1   1 
ATOM   2689 N  NE2   . GLN A 1 341 ? -1.923  192.333 -11.884 1.00 45.02 ? 338  GLN A NE2   1 
ATOM   2690 N  N     . TRP A 1 342 ? -1.464  198.099 -8.255  1.00 28.79 ? 339  TRP A N     1 
ATOM   2691 C  CA    . TRP A 1 342 ? -1.814  199.486 -8.099  1.00 27.82 ? 339  TRP A CA    1 
ATOM   2692 C  C     . TRP A 1 342 ? -0.550  200.346 -7.827  1.00 23.09 ? 339  TRP A C     1 
ATOM   2693 O  O     . TRP A 1 342 ? -0.381  201.409 -8.395  1.00 23.23 ? 339  TRP A O     1 
ATOM   2694 C  CB    . TRP A 1 342 ? -2.797  199.659 -6.948  1.00 27.87 ? 339  TRP A CB    1 
ATOM   2695 C  CG    . TRP A 1 342 ? -3.351  201.020 -6.937  1.00 29.68 ? 339  TRP A CG    1 
ATOM   2696 C  CD1   . TRP A 1 342 ? -4.309  201.533 -7.788  1.00 26.75 ? 339  TRP A CD1   1 
ATOM   2697 C  CD2   . TRP A 1 342 ? -2.973  202.089 -6.074  1.00 27.51 ? 339  TRP A CD2   1 
ATOM   2698 N  NE1   . TRP A 1 342 ? -4.562  202.821 -7.469  1.00 31.13 ? 339  TRP A NE1   1 
ATOM   2699 C  CE2   . TRP A 1 342 ? -3.759  203.198 -6.422  1.00 25.34 ? 339  TRP A CE2   1 
ATOM   2700 C  CE3   . TRP A 1 342 ? -2.042  202.212 -5.038  1.00 25.25 ? 339  TRP A CE3   1 
ATOM   2701 C  CZ2   . TRP A 1 342 ? -3.637  204.434 -5.796  1.00 29.84 ? 339  TRP A CZ2   1 
ATOM   2702 C  CZ3   . TRP A 1 342 ? -1.943  203.432 -4.388  1.00 27.89 ? 339  TRP A CZ3   1 
ATOM   2703 C  CH2   . TRP A 1 342 ? -2.730  204.528 -4.772  1.00 29.74 ? 339  TRP A CH2   1 
ATOM   2704 N  N     . TRP A 1 343 ? 0.283   199.911 -6.916  1.00 25.33 ? 340  TRP A N     1 
ATOM   2705 C  CA    . TRP A 1 343 ? 1.504   200.690 -6.683  1.00 21.96 ? 340  TRP A CA    1 
ATOM   2706 C  C     . TRP A 1 343 ? 2.508   200.665 -7.831  1.00 21.59 ? 340  TRP A C     1 
ATOM   2707 O  O     . TRP A 1 343 ? 3.156   201.696 -8.090  1.00 22.17 ? 340  TRP A O     1 
ATOM   2708 C  CB    . TRP A 1 343 ? 2.179   200.218 -5.423  1.00 23.98 ? 340  TRP A CB    1 
ATOM   2709 C  CG    . TRP A 1 343 ? 1.460   200.729 -4.185  1.00 21.25 ? 340  TRP A CG    1 
ATOM   2710 C  CD1   . TRP A 1 343 ? 0.730   199.993 -3.295  1.00 25.08 ? 340  TRP A CD1   1 
ATOM   2711 C  CD2   . TRP A 1 343 ? 1.441   202.100 -3.692  1.00 22.65 ? 340  TRP A CD2   1 
ATOM   2712 N  NE1   . TRP A 1 343 ? 0.239   200.839 -2.288  1.00 28.48 ? 340  TRP A NE1   1 
ATOM   2713 C  CE2   . TRP A 1 343 ? 0.681   202.118 -2.514  1.00 26.68 ? 340  TRP A CE2   1 
ATOM   2714 C  CE3   . TRP A 1 343 ? 2.034   203.297 -4.128  1.00 27.90 ? 340  TRP A CE3   1 
ATOM   2715 C  CZ2   . TRP A 1 343 ? 0.480   203.296 -1.764  1.00 26.85 ? 340  TRP A CZ2   1 
ATOM   2716 C  CZ3   . TRP A 1 343 ? 1.801   204.454 -3.399  1.00 25.97 ? 340  TRP A CZ3   1 
ATOM   2717 C  CH2   . TRP A 1 343 ? 1.041   204.445 -2.230  1.00 28.93 ? 340  TRP A CH2   1 
ATOM   2718 N  N     . LEU A 1 344 ? 2.625   199.554 -8.535  1.00 22.01 ? 341  LEU A N     1 
ATOM   2719 C  CA    . LEU A 1 344 ? 3.505   199.551 -9.740  1.00 22.95 ? 341  LEU A CA    1 
ATOM   2720 C  C     . LEU A 1 344 ? 2.974   200.596 -10.672 1.00 24.06 ? 341  LEU A C     1 
ATOM   2721 O  O     . LEU A 1 344 ? 3.746   201.340 -11.320 1.00 23.81 ? 341  LEU A O     1 
ATOM   2722 C  CB    . LEU A 1 344 ? 3.549   198.216 -10.486 1.00 22.18 ? 341  LEU A CB    1 
ATOM   2723 C  CG    . LEU A 1 344 ? 4.348   197.129 -9.789  1.00 26.04 ? 341  LEU A CG    1 
ATOM   2724 C  CD1   . LEU A 1 344 ? 4.025   195.747 -10.449 1.00 27.13 ? 341  LEU A CD1   1 
ATOM   2725 C  CD2   . LEU A 1 344 ? 5.822   197.416 -9.843  1.00 24.50 ? 341  LEU A CD2   1 
ATOM   2726 N  N     . LEU A 1 345 ? 1.659   200.657 -10.788 1.00 21.05 ? 342  LEU A N     1 
ATOM   2727 C  CA    . LEU A 1 345 ? 1.070   201.671 -11.629 1.00 17.61 ? 342  LEU A CA    1 
ATOM   2728 C  C     . LEU A 1 345 ? 1.391   203.139 -11.158 1.00 23.05 ? 342  LEU A C     1 
ATOM   2729 O  O     . LEU A 1 345 ? 1.691   204.013 -11.978 1.00 23.33 ? 342  LEU A O     1 
ATOM   2730 C  CB    . LEU A 1 345 ? -0.457  201.465 -11.749 1.00 24.93 ? 342  LEU A CB    1 
ATOM   2731 C  CG    . LEU A 1 345 ? -1.102  202.567 -12.576 1.00 23.02 ? 342  LEU A CG    1 
ATOM   2732 C  CD1   . LEU A 1 345 ? -0.557  202.609 -14.031 1.00 27.40 ? 342  LEU A CD1   1 
ATOM   2733 C  CD2   . LEU A 1 345 ? -2.654  202.402 -12.650 1.00 28.32 ? 342  LEU A CD2   1 
ATOM   2734 N  N     . GLN A 1 346 ? 1.306   203.408 -9.857  1.00 20.50 ? 343  GLN A N     1 
ATOM   2735 C  CA    . GLN A 1 346 ? 1.661   204.734 -9.382  1.00 21.10 ? 343  GLN A CA    1 
ATOM   2736 C  C     . GLN A 1 346 ? 3.105   205.108 -9.730  1.00 19.67 ? 343  GLN A C     1 
ATOM   2737 O  O     . GLN A 1 346 ? 3.331   206.247 -10.185 1.00 19.85 ? 343  GLN A O     1 
ATOM   2738 C  CB    . GLN A 1 346 ? 1.520   204.843 -7.869  1.00 19.36 ? 343  GLN A CB    1 
ATOM   2739 C  CG    . GLN A 1 346 ? 0.062   204.521 -7.346  1.00 22.32 ? 343  GLN A CG    1 
ATOM   2740 C  CD    . GLN A 1 346 ? -1.048  205.074 -8.209  1.00 23.76 ? 343  GLN A CD    1 
ATOM   2741 O  OE1   . GLN A 1 346 ? -1.294  206.271 -8.251  1.00 24.27 ? 343  GLN A OE1   1 
ATOM   2742 N  NE2   . GLN A 1 346 ? -1.760  204.170 -8.895  1.00 25.29 ? 343  GLN A NE2   1 
ATOM   2743 N  N     . LEU A 1 347 ? 3.996   204.144 -9.508  1.00 22.05 ? 344  LEU A N     1 
ATOM   2744 C  CA    . LEU A 1 347 ? 5.431   204.349 -9.794  1.00 19.98 ? 344  LEU A CA    1 
ATOM   2745 C  C     . LEU A 1 347 ? 5.565   204.611 -11.293 1.00 18.22 ? 344  LEU A C     1 
ATOM   2746 O  O     . LEU A 1 347 ? 6.298   205.546 -11.729 1.00 18.01 ? 344  LEU A O     1 
ATOM   2747 C  CB    . LEU A 1 347 ? 6.267   203.139 -9.373  1.00 19.28 ? 344  LEU A CB    1 
ATOM   2748 C  CG    . LEU A 1 347 ? 6.321   202.965 -7.880  1.00 22.73 ? 344  LEU A CG    1 
ATOM   2749 C  CD1   . LEU A 1 347 ? 7.166   201.713 -7.497  1.00 24.25 ? 344  LEU A CD1   1 
ATOM   2750 C  CD2   . LEU A 1 347 ? 6.951   204.146 -7.323  1.00 21.88 ? 344  LEU A CD2   1 
ATOM   2751 N  N     . ALA A 1 348 ? 4.908   203.753 -12.090 1.00 19.73 ? 345  ALA A N     1 
ATOM   2752 C  CA    . ALA A 1 348 ? 5.050   203.872 -13.531 1.00 20.05 ? 345  ALA A CA    1 
ATOM   2753 C  C     . ALA A 1 348 ? 4.507   205.193 -14.050 1.00 19.79 ? 345  ALA A C     1 
ATOM   2754 O  O     . ALA A 1 348 ? 4.993   205.756 -15.043 1.00 20.03 ? 345  ALA A O     1 
ATOM   2755 C  CB    . ALA A 1 348 ? 4.326   202.686 -14.241 1.00 20.29 ? 345  ALA A CB    1 
ATOM   2756 N  N     . GLN A 1 349 ? 3.481   205.739 -13.390 1.00 18.44 ? 346  GLN A N     1 
ATOM   2757 C  CA    . GLN A 1 349 ? 2.953   207.000 -13.831 1.00 18.30 ? 346  GLN A CA    1 
ATOM   2758 C  C     . GLN A 1 349 ? 3.932   208.185 -13.585 1.00 19.09 ? 346  GLN A C     1 
ATOM   2759 O  O     . GLN A 1 349 ? 4.073   209.072 -14.416 1.00 19.91 ? 346  GLN A O     1 
ATOM   2760 C  CB    . GLN A 1 349 ? 1.640   207.302 -13.133 1.00 24.14 ? 346  GLN A CB    1 
ATOM   2761 C  CG    . GLN A 1 349 ? 0.505   206.381 -13.633 1.00 25.16 ? 346  GLN A CG    1 
ATOM   2762 C  CD    . GLN A 1 349 ? -0.837  206.697 -12.948 1.00 30.08 ? 346  GLN A CD    1 
ATOM   2763 O  OE1   . GLN A 1 349 ? -0.881  207.446 -11.992 1.00 34.44 ? 346  GLN A OE1   1 
ATOM   2764 N  NE2   . GLN A 1 349 ? -1.913  206.162 -13.480 1.00 35.15 ? 346  GLN A NE2   1 
ATOM   2765 N  N     . GLU A 1 350 ? 4.537   208.183 -12.412 1.00 17.77 ? 347  GLU A N     1 
ATOM   2766 C  CA    . GLU A 1 350 ? 5.561   209.190 -12.133 1.00 22.25 ? 347  GLU A CA    1 
ATOM   2767 C  C     . GLU A 1 350 ? 6.742   209.008 -13.096 1.00 16.70 ? 347  GLU A C     1 
ATOM   2768 O  O     . GLU A 1 350 ? 7.253   209.994 -13.616 1.00 20.50 ? 347  GLU A O     1 
ATOM   2769 C  CB    . GLU A 1 350 ? 6.075   209.128 -10.710 1.00 19.30 ? 347  GLU A CB    1 
ATOM   2770 C  CG    . GLU A 1 350 ? 7.207   210.146 -10.490 1.00 19.84 ? 347  GLU A CG    1 
ATOM   2771 C  CD    . GLU A 1 350 ? 7.734   210.157 -9.090  1.00 26.73 ? 347  GLU A CD    1 
ATOM   2772 O  OE1   . GLU A 1 350 ? 7.036   209.717 -8.153  1.00 28.69 ? 347  GLU A OE1   1 
ATOM   2773 O  OE2   . GLU A 1 350 ? 8.873   210.587 -8.932  1.00 24.02 ? 347  GLU A OE2   1 
ATOM   2774 N  N     . LEU A 1 351 ? 7.126   207.778 -13.314 1.00 17.23 ? 348  LEU A N     1 
ATOM   2775 C  CA    . LEU A 1 351 ? 8.259   207.499 -14.222 1.00 16.64 ? 348  LEU A CA    1 
ATOM   2776 C  C     . LEU A 1 351 ? 7.931   207.994 -15.603 1.00 18.73 ? 348  LEU A C     1 
ATOM   2777 O  O     . LEU A 1 351 ? 8.739   208.659 -16.262 1.00 19.08 ? 348  LEU A O     1 
ATOM   2778 C  CB    . LEU A 1 351 ? 8.569   206.028 -14.224 1.00 18.03 ? 348  LEU A CB    1 
ATOM   2779 C  CG    . LEU A 1 351 ? 9.808   205.597 -15.026 1.00 18.59 ? 348  LEU A CG    1 
ATOM   2780 C  CD1   . LEU A 1 351 ? 11.058  206.373 -14.475 1.00 24.70 ? 348  LEU A CD1   1 
ATOM   2781 C  CD2   . LEU A 1 351 ? 10.002  204.074 -15.020 1.00 22.35 ? 348  LEU A CD2   1 
ATOM   2782 N  N     . GLU A 1 352 ? 6.739   207.660 -16.105 1.00 16.85 ? 349  GLU A N     1 
ATOM   2783 C  CA    . GLU A 1 352 ? 6.379   208.218 -17.425 1.00 18.07 ? 349  GLU A CA    1 
ATOM   2784 C  C     . GLU A 1 352 ? 6.467   209.748 -17.543 1.00 19.82 ? 349  GLU A C     1 
ATOM   2785 O  O     . GLU A 1 352 ? 6.985   210.318 -18.543 1.00 20.46 ? 349  GLU A O     1 
ATOM   2786 C  CB    . GLU A 1 352 ? 4.921   207.766 -17.772 1.00 20.39 ? 349  GLU A CB    1 
ATOM   2787 C  CG    . GLU A 1 352 ? 4.428   208.330 -19.098 1.00 23.95 ? 349  GLU A CG    1 
ATOM   2788 C  CD    . GLU A 1 352 ? 2.913   208.206 -19.263 1.00 35.95 ? 349  GLU A CD    1 
ATOM   2789 O  OE1   . GLU A 1 352 ? 2.318   209.179 -19.770 1.00 45.59 ? 349  GLU A OE1   1 
ATOM   2790 O  OE2   . GLU A 1 352 ? 2.319   207.146 -18.913 1.00 36.68 ? 349  GLU A OE2   1 
ATOM   2791 N  N     . GLU A 1 353 ? 5.993   210.434 -16.516 1.00 18.71 ? 350  GLU A N     1 
ATOM   2792 C  CA    . GLU A 1 353 ? 6.020   211.878 -16.475 1.00 18.80 ? 350  GLU A CA    1 
ATOM   2793 C  C     . GLU A 1 353 ? 7.464   212.361 -16.580 1.00 22.02 ? 350  GLU A C     1 
ATOM   2794 O  O     . GLU A 1 353 ? 7.774   213.305 -17.327 1.00 21.04 ? 350  GLU A O     1 
ATOM   2795 C  CB    . GLU A 1 353 ? 5.396   212.352 -15.178 1.00 25.89 ? 350  GLU A CB    1 
ATOM   2796 C  CG    . GLU A 1 353 ? 5.247   213.802 -15.016 1.00 30.36 ? 350  GLU A CG    1 
ATOM   2797 C  CD    . GLU A 1 353 ? 4.328   214.098 -13.847 1.00 45.28 ? 350  GLU A CD    1 
ATOM   2798 O  OE1   . GLU A 1 353 ? 3.361   213.307 -13.632 1.00 40.41 ? 350  GLU A OE1   1 
ATOM   2799 O  OE2   . GLU A 1 353 ? 4.594   215.094 -13.135 1.00 53.92 ? 350  GLU A OE2   1 
ATOM   2800 N  N     . ARG A 1 354 ? 8.338   211.688 -15.836 1.00 17.86 ? 351  ARG A N     1 
ATOM   2801 C  CA    . ARG A 1 354 ? 9.747   212.161 -15.822 1.00 19.25 ? 351  ARG A CA    1 
ATOM   2802 C  C     . ARG A 1 354 ? 10.406  211.816 -17.116 1.00 19.42 ? 351  ARG A C     1 
ATOM   2803 O  O     . ARG A 1 354 ? 11.224  212.621 -17.614 1.00 20.03 ? 351  ARG A O     1 
ATOM   2804 C  CB    . ARG A 1 354 ? 10.521  211.571 -14.621 1.00 17.24 ? 351  ARG A CB    1 
ATOM   2805 C  CG    A ARG A 1 354 ? 10.094  212.400 -13.345 0.63 19.62 ? 351  ARG A CG    1 
ATOM   2806 C  CG    B ARG A 1 354 ? 10.096  211.991 -13.245 0.37 20.31 ? 351  ARG A CG    1 
ATOM   2807 C  CD    A ARG A 1 354 ? 10.400  211.690 -12.008 0.63 19.66 ? 351  ARG A CD    1 
ATOM   2808 C  CD    B ARG A 1 354 ? 11.051  211.321 -12.235 0.37 20.86 ? 351  ARG A CD    1 
ATOM   2809 N  NE    A ARG A 1 354 ? 11.830  211.458 -11.893 0.63 18.90 ? 351  ARG A NE    1 
ATOM   2810 N  NE    B ARG A 1 354 ? 12.426  211.780 -12.457 0.37 18.02 ? 351  ARG A NE    1 
ATOM   2811 C  CZ    A ARG A 1 354 ? 12.392  210.608 -11.043 0.63 19.92 ? 351  ARG A CZ    1 
ATOM   2812 C  CZ    B ARG A 1 354 ? 13.517  211.254 -11.896 0.37 18.91 ? 351  ARG A CZ    1 
ATOM   2813 N  NH1   A ARG A 1 354 ? 11.656  209.895 -10.146 0.63 16.87 ? 351  ARG A NH1   1 
ATOM   2814 N  NH1   B ARG A 1 354 ? 13.428  210.191 -11.120 0.37 18.62 ? 351  ARG A NH1   1 
ATOM   2815 N  NH2   A ARG A 1 354 ? 13.719  210.530 -11.079 0.63 17.81 ? 351  ARG A NH2   1 
ATOM   2816 N  NH2   B ARG A 1 354 ? 14.709  211.755 -12.177 0.37 18.73 ? 351  ARG A NH2   1 
ATOM   2817 N  N     . LEU A 1 355 ? 10.107  210.634 -17.647 1.00 18.97 ? 352  LEU A N     1 
ATOM   2818 C  CA    . LEU A 1 355 ? 10.734  210.189 -18.908 1.00 18.07 ? 352  LEU A CA    1 
ATOM   2819 C  C     . LEU A 1 355 ? 10.311  211.103 -20.069 1.00 20.70 ? 352  LEU A C     1 
ATOM   2820 O  O     . LEU A 1 355 ? 11.126  211.452 -20.917 1.00 22.32 ? 352  LEU A O     1 
ATOM   2821 C  CB    . LEU A 1 355 ? 10.369  208.757 -19.232 1.00 20.28 ? 352  LEU A CB    1 
ATOM   2822 C  CG    . LEU A 1 355 ? 11.110  207.746 -18.394 1.00 20.14 ? 352  LEU A CG    1 
ATOM   2823 C  CD1   . LEU A 1 355 ? 10.568  206.358 -18.692 1.00 20.93 ? 352  LEU A CD1   1 
ATOM   2824 C  CD2   . LEU A 1 355 ? 12.623  207.824 -18.642 1.00 20.94 ? 352  LEU A CD2   1 
ATOM   2825 N  N     . THR A 1 356 ? 9.023   211.436 -20.130 1.00 21.80 ? 353  THR A N     1 
ATOM   2826 C  CA    . THR A 1 356 ? 8.555   212.269 -21.213 1.00 19.81 ? 353  THR A CA    1 
ATOM   2827 C  C     . THR A 1 356 ? 9.212   213.651 -21.188 1.00 20.87 ? 353  THR A C     1 
ATOM   2828 O  O     . THR A 1 356 ? 9.625   214.184 -22.239 1.00 23.28 ? 353  THR A O     1 
ATOM   2829 C  CB    . THR A 1 356 ? 7.009   212.401 -21.138 1.00 24.41 ? 353  THR A CB    1 
ATOM   2830 O  OG1   . THR A 1 356 ? 6.449   211.103 -21.274 1.00 24.48 ? 353  THR A OG1   1 
ATOM   2831 C  CG2   . THR A 1 356 ? 6.516   213.328 -22.209 1.00 23.72 ? 353  THR A CG2   1 
ATOM   2832 N  N     . LYS A 1 357 ? 9.322   214.235 -19.994 1.00 22.25 ? 354  LYS A N     1 
ATOM   2833 C  CA    . LYS A 1 357 ? 9.981   215.516 -19.803 1.00 21.75 ? 354  LYS A CA    1 
ATOM   2834 C  C     . LYS A 1 357 ? 11.437  215.372 -20.233 1.00 22.09 ? 354  LYS A C     1 
ATOM   2835 O  O     . LYS A 1 357 ? 12.002  216.208 -20.954 1.00 22.18 ? 354  LYS A O     1 
ATOM   2836 C  CB    . LYS A 1 357 ? 9.886   215.964 -18.340 1.00 24.41 ? 354  LYS A CB    1 
ATOM   2837 C  CG    . LYS A 1 357 ? 10.764  217.176 -17.943 1.00 32.14 ? 354  LYS A CG    1 
ATOM   2838 C  CD    . LYS A 1 357 ? 10.263  218.516 -18.488 1.00 42.35 ? 354  LYS A CD    1 
ATOM   2839 C  CE    . LYS A 1 357 ? 10.845  219.706 -17.675 1.00 36.49 ? 354  LYS A CE    1 
ATOM   2840 N  NZ    . LYS A 1 357 ? 12.255  219.445 -17.294 1.00 38.30 ? 354  LYS A NZ    1 
ATOM   2841 N  N     . ASP A 1 358 ? 12.053  214.264 -19.841 1.00 22.07 ? 355  ASP A N     1 
ATOM   2842 C  CA    . ASP A 1 358 ? 13.473  214.073 -20.151 1.00 21.46 ? 355  ASP A CA    1 
ATOM   2843 C  C     . ASP A 1 358 ? 13.701  213.961 -21.640 1.00 24.63 ? 355  ASP A C     1 
ATOM   2844 O  O     . ASP A 1 358 ? 14.639  214.553 -22.153 1.00 22.82 ? 355  ASP A O     1 
ATOM   2845 C  CB    . ASP A 1 358 ? 13.994  212.821 -19.428 1.00 20.80 ? 355  ASP A CB    1 
ATOM   2846 C  CG    . ASP A 1 358 ? 15.452  212.554 -19.712 1.00 24.87 ? 355  ASP A CG    1 
ATOM   2847 O  OD1   . ASP A 1 358 ? 16.265  213.224 -19.054 1.00 21.86 ? 355  ASP A OD1   1 
ATOM   2848 O  OD2   . ASP A 1 358 ? 15.773  211.734 -20.602 1.00 25.24 ? 355  ASP A OD2   1 
ATOM   2849 N  N     . ARG A 1 359 ? 12.809  213.265 -22.352 1.00 20.60 ? 356  ARG A N     1 
ATOM   2850 C  CA    . ARG A 1 359 ? 12.946  213.085 -23.803 1.00 21.23 ? 356  ARG A CA    1 
ATOM   2851 C  C     . ARG A 1 359 ? 12.819  214.443 -24.533 1.00 21.30 ? 356  ARG A C     1 
ATOM   2852 O  O     . ARG A 1 359 ? 13.589  214.730 -25.469 1.00 23.71 ? 356  ARG A O     1 
ATOM   2853 C  CB    . ARG A 1 359 ? 11.877  212.095 -24.319 1.00 24.92 ? 356  ARG A CB    1 
ATOM   2854 C  CG    . ARG A 1 359 ? 11.999  211.774 -25.812 1.00 26.37 ? 356  ARG A CG    1 
ATOM   2855 C  CD    . ARG A 1 359 ? 10.881  210.821 -26.301 1.00 26.98 ? 356  ARG A CD    1 
ATOM   2856 N  NE    . ARG A 1 359 ? 9.589   211.482 -26.164 1.00 30.25 ? 356  ARG A NE    1 
ATOM   2857 C  CZ    . ARG A 1 359 ? 8.417   210.876 -25.967 1.00 35.93 ? 356  ARG A CZ    1 
ATOM   2858 N  NH1   . ARG A 1 359 ? 8.342   209.551 -25.885 1.00 34.65 ? 356  ARG A NH1   1 
ATOM   2859 N  NH2   . ARG A 1 359 ? 7.314   211.618 -25.864 1.00 30.88 ? 356  ARG A NH2   1 
ATOM   2860 N  N     . ASN A 1 360 ? 11.899  215.308 -24.080 1.00 21.33 ? 357  ASN A N     1 
ATOM   2861 C  CA    . ASN A 1 360 ? 11.740  216.639 -24.667 1.00 20.75 ? 357  ASN A CA    1 
ATOM   2862 C  C     . ASN A 1 360 ? 12.910  217.597 -24.364 1.00 22.21 ? 357  ASN A C     1 
ATOM   2863 O  O     . ASN A 1 360 ? 13.331  218.404 -25.205 1.00 24.55 ? 357  ASN A O     1 
ATOM   2864 C  CB    . ASN A 1 360 ? 10.471  217.290 -24.143 1.00 22.53 ? 357  ASN A CB    1 
ATOM   2865 C  CG    . ASN A 1 360 ? 9.234   216.684 -24.735 1.00 28.19 ? 357  ASN A CG    1 
ATOM   2866 O  OD1   . ASN A 1 360 ? 9.266   216.087 -25.817 1.00 28.69 ? 357  ASN A OD1   1 
ATOM   2867 N  ND2   . ASN A 1 360 ? 8.130   216.828 -24.029 1.00 24.51 ? 357  ASN A ND2   1 
ATOM   2868 N  N     . ASP A 1 361 ? 13.388  217.550 -23.118 1.00 23.41 ? 358  ASP A N     1 
ATOM   2869 C  CA    . ASP A 1 361 ? 14.511  218.392 -22.696 1.00 23.75 ? 358  ASP A CA    1 
ATOM   2870 C  C     . ASP A 1 361 ? 15.844  217.952 -23.261 1.00 24.05 ? 358  ASP A C     1 
ATOM   2871 O  O     . ASP A 1 361 ? 16.674  218.783 -23.659 1.00 23.55 ? 358  ASP A O     1 
ATOM   2872 C  CB    . ASP A 1 361 ? 14.632  218.403 -21.157 1.00 21.87 ? 358  ASP A CB    1 
ATOM   2873 C  CG    . ASP A 1 361 ? 13.520  219.152 -20.504 1.00 33.01 ? 358  ASP A CG    1 
ATOM   2874 O  OD1   . ASP A 1 361 ? 12.756  219.834 -21.230 1.00 29.33 ? 358  ASP A OD1   1 
ATOM   2875 O  OD2   . ASP A 1 361 ? 13.410  219.046 -19.267 1.00 38.36 ? 358  ASP A OD2   1 
ATOM   2876 N  N     . ASN A 1 362 ? 16.097  216.663 -23.241 1.00 22.08 ? 359  ASN A N     1 
ATOM   2877 C  CA    . ASN A 1 362 ? 17.469  216.201 -23.427 1.00 23.45 ? 359  ASN A CA    1 
ATOM   2878 C  C     . ASN A 1 362 ? 17.704  215.339 -24.648 1.00 24.13 ? 359  ASN A C     1 
ATOM   2879 O  O     . ASN A 1 362 ? 18.789  214.824 -24.788 1.00 25.06 ? 359  ASN A O     1 
ATOM   2880 C  CB    . ASN A 1 362 ? 17.904  215.441 -22.160 1.00 21.23 ? 359  ASN A CB    1 
ATOM   2881 C  CG    . ASN A 1 362 ? 17.844  216.329 -20.917 1.00 25.66 ? 359  ASN A CG    1 
ATOM   2882 O  OD1   . ASN A 1 362 ? 18.323  217.464 -20.953 1.00 23.01 ? 359  ASN A OD1   1 
ATOM   2883 N  ND2   . ASN A 1 362 ? 17.334  215.795 -19.783 1.00 22.32 ? 359  ASN A ND2   1 
ATOM   2884 N  N     . ASP A 1 363 ? 16.713  215.196 -25.537 1.00 21.21 ? 360  ASP A N     1 
ATOM   2885 C  CA    . ASP A 1 363 ? 16.875  214.453 -26.783 1.00 23.47 ? 360  ASP A CA    1 
ATOM   2886 C  C     . ASP A 1 363 ? 17.454  213.076 -26.587 1.00 28.77 ? 360  ASP A C     1 
ATOM   2887 O  O     . ASP A 1 363 ? 18.435  212.700 -27.233 1.00 25.13 ? 360  ASP A O     1 
ATOM   2888 C  CB    . ASP A 1 363 ? 17.787  215.233 -27.751 1.00 25.84 ? 360  ASP A CB    1 
ATOM   2889 C  CG    . ASP A 1 363 ? 17.270  216.620 -28.021 1.00 31.11 ? 360  ASP A CG    1 
ATOM   2890 O  OD1   . ASP A 1 363 ? 16.111  216.737 -28.476 1.00 27.72 ? 360  ASP A OD1   1 
ATOM   2891 O  OD2   . ASP A 1 363 ? 17.990  217.603 -27.730 1.00 35.10 ? 360  ASP A OD2   1 
ATOM   2892 N  N     . ARG A 1 364 ? 16.817  212.284 -25.733 1.00 24.13 ? 361  ARG A N     1 
ATOM   2893 C  CA    . ARG A 1 364 ? 17.207  210.880 -25.566 1.00 26.26 ? 361  ARG A CA    1 
ATOM   2894 C  C     . ARG A 1 364 ? 15.976  210.135 -25.133 1.00 26.62 ? 361  ARG A C     1 
ATOM   2895 O  O     . ARG A 1 364 ? 15.026  210.764 -24.637 1.00 25.61 ? 361  ARG A O     1 
ATOM   2896 C  CB    . ARG A 1 364 ? 18.300  210.738 -24.519 1.00 26.27 ? 361  ARG A CB    1 
ATOM   2897 C  CG    . ARG A 1 364 ? 17.972  211.528 -23.226 1.00 26.73 ? 361  ARG A CG    1 
ATOM   2898 C  CD    . ARG A 1 364 ? 19.052  211.297 -22.129 1.00 23.21 ? 361  ARG A CD    1 
ATOM   2899 N  NE    . ARG A 1 364 ? 18.606  211.667 -20.789 1.00 25.78 ? 361  ARG A NE    1 
ATOM   2900 C  CZ    . ARG A 1 364 ? 19.336  211.507 -19.677 1.00 27.49 ? 361  ARG A CZ    1 
ATOM   2901 N  NH1   . ARG A 1 364 ? 18.857  211.878 -18.485 1.00 22.24 ? 361  ARG A NH1   1 
ATOM   2902 N  NH2   . ARG A 1 364 ? 20.569  211.040 -19.756 1.00 27.68 ? 361  ARG A NH2   1 
ATOM   2903 N  N     . VAL A 1 365 ? 16.031  208.822 -25.306 1.00 23.11 ? 362  VAL A N     1 
ATOM   2904 C  CA    . VAL A 1 365 ? 15.043  207.855 -24.828 1.00 24.38 ? 362  VAL A CA    1 
ATOM   2905 C  C     . VAL A 1 365 ? 15.681  206.696 -24.067 1.00 28.05 ? 362  VAL A C     1 
ATOM   2906 O  O     . VAL A 1 365 ? 16.688  206.140 -24.474 1.00 23.30 ? 362  VAL A O     1 
ATOM   2907 C  CB    . VAL A 1 365 ? 14.206  207.228 -25.973 1.00 31.01 ? 362  VAL A CB    1 
ATOM   2908 C  CG1   . VAL A 1 365 ? 13.204  208.229 -26.513 1.00 30.64 ? 362  VAL A CG1   1 
ATOM   2909 C  CG2   . VAL A 1 365 ? 15.087  206.693 -27.091 1.00 34.90 ? 362  VAL A CG2   1 
ATOM   2910 N  N     . ALA A 1 366 ? 15.054  206.300 -22.981 1.00 22.89 ? 363  ALA A N     1 
ATOM   2911 C  CA    . ALA A 1 366 ? 15.459  205.116 -22.260 1.00 24.93 ? 363  ALA A CA    1 
ATOM   2912 C  C     . ALA A 1 366 ? 14.958  203.861 -23.001 1.00 24.77 ? 363  ALA A C     1 
ATOM   2913 O  O     . ALA A 1 366 ? 13.835  203.867 -23.598 1.00 26.31 ? 363  ALA A O     1 
ATOM   2914 C  CB    . ALA A 1 366 ? 14.885  205.184 -20.843 1.00 21.38 ? 363  ALA A CB    1 
ATOM   2915 N  N     . THR A 1 367 ? 15.748  202.791 -22.958 1.00 22.02 ? 364  THR A N     1 
ATOM   2916 C  CA    . THR A 1 367 ? 15.405  201.571 -23.657 1.00 22.33 ? 364  THR A CA    1 
ATOM   2917 C  C     . THR A 1 367 ? 15.278  200.331 -22.804 1.00 25.01 ? 364  THR A C     1 
ATOM   2918 O  O     . THR A 1 367 ? 14.947  199.255 -23.290 1.00 24.26 ? 364  THR A O     1 
ATOM   2919 C  CB    . THR A 1 367 ? 16.460  201.302 -24.770 1.00 26.64 ? 364  THR A CB    1 
ATOM   2920 O  OG1   . THR A 1 367 ? 17.746  201.085 -24.168 1.00 26.89 ? 364  THR A OG1   1 
ATOM   2921 C  CG2   . THR A 1 367 ? 16.543  202.548 -25.667 1.00 25.60 ? 364  THR A CG2   1 
ATOM   2922 N  N     . GLN A 1 368 ? 15.588  200.443 -21.527 1.00 23.24 ? 365  GLN A N     1 
ATOM   2923 C  CA    . GLN A 1 368 ? 15.497  199.295 -20.675 1.00 24.22 ? 365  GLN A CA    1 
ATOM   2924 C  C     . GLN A 1 368 ? 14.780  199.702 -19.394 1.00 23.07 ? 365  GLN A C     1 
ATOM   2925 O  O     . GLN A 1 368 ? 15.019  200.761 -18.865 1.00 25.40 ? 365  GLN A O     1 
ATOM   2926 C  CB    . GLN A 1 368 ? 16.874  198.753 -20.327 1.00 26.25 ? 365  GLN A CB    1 
ATOM   2927 C  CG    . GLN A 1 368 ? 16.865  197.606 -19.348 1.00 32.76 ? 365  GLN A CG    1 
ATOM   2928 C  CD    . GLN A 1 368 ? 18.246  196.975 -19.193 1.00 33.21 ? 365  GLN A CD    1 
ATOM   2929 O  OE1   . GLN A 1 368 ? 19.107  197.502 -18.492 1.00 43.07 ? 365  GLN A OE1   1 
ATOM   2930 N  NE2   . GLN A 1 368 ? 18.456  195.853 -19.847 1.00 40.14 ? 365  GLN A NE2   1 
ATOM   2931 N  N     . LEU A 1 369 ? 13.874  198.852 -18.945 1.00 23.38 ? 366  LEU A N     1 
ATOM   2932 C  CA    . LEU A 1 369 ? 13.199  199.071 -17.648 1.00 22.70 ? 366  LEU A CA    1 
ATOM   2933 C  C     . LEU A 1 369 ? 13.679  198.026 -16.648 1.00 26.29 ? 366  LEU A C     1 
ATOM   2934 O  O     . LEU A 1 369 ? 13.653  196.827 -16.927 1.00 27.13 ? 366  LEU A O     1 
ATOM   2935 C  CB    . LEU A 1 369 ? 11.673  198.969 -17.836 1.00 23.81 ? 366  LEU A CB    1 
ATOM   2936 C  CG    . LEU A 1 369 ? 10.771  199.137 -16.589 1.00 25.48 ? 366  LEU A CG    1 
ATOM   2937 C  CD1   . LEU A 1 369 ? 10.859  200.571 -16.087 1.00 26.64 ? 366  LEU A CD1   1 
ATOM   2938 C  CD2   . LEU A 1 369 ? 9.310   198.685 -16.892 1.00 29.16 ? 366  LEU A CD2   1 
ATOM   2939 N  N     . VAL A 1 370 ? 14.170  198.469 -15.500 1.00 22.29 ? 367  VAL A N     1 
ATOM   2940 C  CA    . VAL A 1 370 ? 14.621  197.564 -14.474 1.00 20.50 ? 367  VAL A CA    1 
ATOM   2941 C  C     . VAL A 1 370 ? 13.573  197.609 -13.356 1.00 24.35 ? 367  VAL A C     1 
ATOM   2942 O  O     . VAL A 1 370 ? 13.167  198.711 -12.915 1.00 25.23 ? 367  VAL A O     1 
ATOM   2943 C  CB    . VAL A 1 370 ? 16.010  197.989 -13.943 1.00 22.74 ? 367  VAL A CB    1 
ATOM   2944 C  CG1   . VAL A 1 370 ? 16.398  197.149 -12.738 1.00 28.49 ? 367  VAL A CG1   1 
ATOM   2945 C  CG2   . VAL A 1 370 ? 17.042  197.953 -15.119 1.00 24.08 ? 367  VAL A CG2   1 
ATOM   2946 N  N     . VAL A 1 371 ? 13.159  196.428 -12.922 1.00 21.18 ? 368  VAL A N     1 
ATOM   2947 C  CA    . VAL A 1 371 ? 12.177  196.274 -11.845 1.00 25.00 ? 368  VAL A CA    1 
ATOM   2948 C  C     . VAL A 1 371 ? 12.867  195.632 -10.656 1.00 27.09 ? 368  VAL A C     1 
ATOM   2949 O  O     . VAL A 1 371 ? 13.526  194.603 -10.799 1.00 25.52 ? 368  VAL A O     1 
ATOM   2950 C  CB    . VAL A 1 371 ? 10.991  195.454 -12.325 1.00 27.11 ? 368  VAL A CB    1 
ATOM   2951 C  CG1   . VAL A 1 371 ? 9.866   195.405 -11.253 1.00 24.42 ? 368  VAL A CG1   1 
ATOM   2952 C  CG2   . VAL A 1 371 ? 10.461  196.056 -13.627 1.00 27.61 ? 368  VAL A CG2   1 
ATOM   2953 N  N     . SER A 1 372 ? 12.802  196.273 -9.484  1.00 24.30 ? 369  SER A N     1 
ATOM   2954 C  CA    . SER A 1 372 ? 13.436  195.688 -8.308  1.00 25.49 ? 369  SER A CA    1 
ATOM   2955 C  C     . SER A 1 372 ? 12.390  195.577 -7.182  1.00 24.65 ? 369  SER A C     1 
ATOM   2956 O  O     . SER A 1 372 ? 11.456  196.422 -7.079  1.00 24.82 ? 369  SER A O     1 
ATOM   2957 C  CB    . SER A 1 372 ? 14.641  196.501 -7.866  1.00 25.92 ? 369  SER A CB    1 
ATOM   2958 O  OG    . SER A 1 372 ? 15.188  195.943 -6.680  1.00 36.25 ? 369  SER A OG    1 
ATOM   2959 N  N     . ILE A 1 373 ? 12.471  194.499 -6.414  1.00 26.00 ? 370  ILE A N     1 
ATOM   2960 C  CA    . ILE A 1 373 ? 11.587  194.346 -5.258  1.00 25.44 ? 370  ILE A CA    1 
ATOM   2961 C  C     . ILE A 1 373 ? 12.359  193.914 -4.008  1.00 31.13 ? 370  ILE A C     1 
ATOM   2962 O  O     . ILE A 1 373 ? 13.526  193.440 -4.060  1.00 28.10 ? 370  ILE A O     1 
ATOM   2963 C  CB    . ILE A 1 373 ? 10.429  193.334 -5.489  1.00 27.53 ? 370  ILE A CB    1 
ATOM   2964 C  CG1   . ILE A 1 373 ? 10.983  191.913 -5.664  1.00 32.86 ? 370  ILE A CG1   1 
ATOM   2965 C  CG2   . ILE A 1 373 ? 9.524   193.773 -6.648  1.00 25.71 ? 370  ILE A CG2   1 
ATOM   2966 C  CD1   . ILE A 1 373 ? 9.875   190.893 -5.810  1.00 39.96 ? 370  ILE A CD1   1 
ATOM   2967 N  N     . ARG A 1 374 ? 11.679  194.113 -2.872  1.00 31.54 ? 371  ARG A N     1 
ATOM   2968 C  CA    . ARG A 1 374 ? 12.163  193.677 -1.570  1.00 34.89 ? 371  ARG A CA    1 
ATOM   2969 C  C     . ARG A 1 374 ? 11.080  192.825 -0.964  1.00 37.32 ? 371  ARG A C     1 
ATOM   2970 O  O     . ARG A 1 374 ? 9.880   193.147 -1.073  1.00 31.01 ? 371  ARG A O     1 
ATOM   2971 C  CB    . ARG A 1 374 ? 12.452  194.846 -0.668  1.00 38.59 ? 371  ARG A CB    1 
ATOM   2972 C  CG    . ARG A 1 374 ? 13.870  195.100 -0.438  1.00 41.14 ? 371  ARG A CG    1 
ATOM   2973 C  CD    . ARG A 1 374 ? 14.377  194.279 0.693   1.00 45.17 ? 371  ARG A CD    1 
ATOM   2974 N  NE    . ARG A 1 374 ? 13.843  194.783 1.947   1.00 48.73 ? 371  ARG A NE    1 
ATOM   2975 C  CZ    . ARG A 1 374 ? 14.188  194.338 3.157   1.00 58.26 ? 371  ARG A CZ    1 
ATOM   2976 N  NH1   . ARG A 1 374 ? 15.177  193.468 3.286   1.00 58.30 ? 371  ARG A NH1   1 
ATOM   2977 N  NH2   . ARG A 1 374 ? 13.608  194.839 4.250   1.00 58.31 ? 371  ARG A NH2   1 
ATOM   2978 N  N     . VAL A 1 375 ? 11.488  191.696 -0.383  1.00 40.05 ? 372  VAL A N     1 
ATOM   2979 C  CA    . VAL A 1 375 ? 10.523  190.840 0.300   1.00 41.70 ? 372  VAL A CA    1 
ATOM   2980 C  C     . VAL A 1 375 ? 10.706  190.950 1.810   1.00 38.47 ? 372  VAL A C     1 
ATOM   2981 O  O     . VAL A 1 375 ? 11.809  191.146 2.314   1.00 38.23 ? 372  VAL A O     1 
ATOM   2982 C  CB    . VAL A 1 375 ? 10.656  189.383 -0.125  1.00 46.24 ? 372  VAL A CB    1 
ATOM   2983 C  CG1   . VAL A 1 375 ? 10.387  189.253 -1.596  1.00 45.61 ? 372  VAL A CG1   1 
ATOM   2984 C  CG2   . VAL A 1 375 ? 12.021  188.869 0.226   1.00 46.91 ? 372  VAL A CG2   1 
ATOM   2985 N  N     . GLN A 1 376 ? 9.595   190.888 2.523   1.00 41.21 ? 373  GLN A N     1 
ATOM   2986 C  CA    . GLN A 1 376 ? 9.639   190.866 3.976   1.00 44.50 ? 373  GLN A CA    1 
ATOM   2987 C  C     . GLN A 1 376 ? 10.389  189.641 4.436   1.00 48.91 ? 373  GLN A C     1 
ATOM   2988 O  O     . GLN A 1 376 ? 10.012  188.529 4.090   1.00 54.08 ? 373  GLN A O     1 
ATOM   2989 C  CB    . GLN A 1 376 ? 8.236   190.844 4.550   1.00 41.91 ? 373  GLN A CB    1 
ATOM   2990 C  CG    . GLN A 1 376 ? 8.147   191.297 5.995   1.00 44.70 ? 373  GLN A CG    1 
ATOM   2991 C  CD    . GLN A 1 376 ? 6.803   191.915 6.276   1.00 45.11 ? 373  GLN A CD    1 
ATOM   2992 O  OE1   . GLN A 1 376 ? 5.783   191.232 6.188   1.00 47.64 ? 373  GLN A OE1   1 
ATOM   2993 N  NE2   . GLN A 1 376 ? 6.779   193.231 6.549   1.00 44.27 ? 373  GLN A NE2   1 
ATOM   2994 N  N     . GLY A 1 377 ? 11.438  189.839 5.213   1.00 50.27 ? 374  GLY A N     1 
ATOM   2995 C  CA    . GLY A 1 377 ? 12.227  188.722 5.683   1.00 55.48 ? 374  GLY A CA    1 
ATOM   2996 C  C     . GLY A 1 377 ? 13.643  188.816 5.156   1.00 63.03 ? 374  GLY A C     1 
ATOM   2997 O  O     . GLY A 1 377 ? 14.572  188.248 5.736   1.00 67.01 ? 374  GLY A O     1 
ATOM   2998 N  N     . ASP A 1 378 ? 13.822  189.552 4.063   1.00 60.86 ? 375  ASP A N     1 
ATOM   2999 C  CA    . ASP A 1 378 ? 15.142  189.662 3.469   1.00 60.20 ? 375  ASP A CA    1 
ATOM   3000 C  C     . ASP A 1 378 ? 15.837  190.794 4.218   1.00 65.01 ? 375  ASP A C     1 
ATOM   3001 O  O     . ASP A 1 378 ? 15.239  191.430 5.080   1.00 69.20 ? 375  ASP A O     1 
ATOM   3002 C  CB    . ASP A 1 378 ? 15.058  189.902 1.948   1.00 57.79 ? 375  ASP A CB    1 
ATOM   3003 C  CG    . ASP A 1 378 ? 16.446  190.075 1.271   1.00 59.60 ? 375  ASP A CG    1 
ATOM   3004 O  OD1   . ASP A 1 378 ? 17.433  190.527 1.899   1.00 61.63 ? 375  ASP A OD1   1 
ATOM   3005 O  OD2   . ASP A 1 378 ? 16.562  189.707 0.085   1.00 54.07 ? 375  ASP A OD2   1 
ATOM   3006 N  N     . LYS A 1 379 ? 17.098  191.031 3.878   1.00 69.03 ? 376  LYS A N     1 
ATOM   3007 C  CA    . LYS A 1 379 ? 18.017  191.849 4.646   1.00 67.79 ? 376  LYS A CA    1 
ATOM   3008 C  C     . LYS A 1 379 ? 18.393  193.139 3.871   1.00 71.70 ? 376  LYS A C     1 
ATOM   3009 O  O     . LYS A 1 379 ? 18.595  194.205 4.463   1.00 72.25 ? 376  LYS A O     1 
ATOM   3010 C  CB    . LYS A 1 379 ? 19.302  191.040 4.940   1.00 69.73 ? 376  LYS A CB    1 
ATOM   3011 C  CG    . LYS A 1 379 ? 19.201  189.508 5.263   1.00 68.86 ? 376  LYS A CG    1 
ATOM   3012 C  CD    . LYS A 1 379 ? 17.940  188.998 5.963   1.00 71.38 ? 376  LYS A CD    1 
ATOM   3013 C  CE    . LYS A 1 379 ? 17.861  187.461 5.987   1.00 64.60 ? 376  LYS A CE    1 
ATOM   3014 N  NZ    . LYS A 1 379 ? 17.228  186.961 4.726   1.00 67.62 ? 376  LYS A NZ    1 
ATOM   3015 N  N     . ARG A 1 380 ? 18.493  193.022 2.543   1.00 66.38 ? 377  ARG A N     1 
ATOM   3016 C  CA    . ARG A 1 380 ? 19.270  193.949 1.692   1.00 63.12 ? 377  ARG A CA    1 
ATOM   3017 C  C     . ARG A 1 380 ? 18.452  195.034 0.972   1.00 59.09 ? 377  ARG A C     1 
ATOM   3018 O  O     . ARG A 1 380 ? 17.228  194.951 0.909   1.00 56.12 ? 377  ARG A O     1 
ATOM   3019 C  CB    . ARG A 1 380 ? 20.025  193.112 0.659   1.00 62.05 ? 377  ARG A CB    1 
ATOM   3020 C  CG    . ARG A 1 380 ? 21.024  192.175 1.306   1.00 60.57 ? 377  ARG A CG    1 
ATOM   3021 C  CD    . ARG A 1 380 ? 21.494  191.147 0.328   1.00 61.13 ? 377  ARG A CD    1 
ATOM   3022 N  NE    . ARG A 1 380 ? 20.346  190.415 -0.225  1.00 58.76 ? 377  ARG A NE    1 
ATOM   3023 C  CZ    . ARG A 1 380 ? 20.432  189.337 -0.997  1.00 57.28 ? 377  ARG A CZ    1 
ATOM   3024 N  NH1   . ARG A 1 380 ? 21.614  188.758 -1.203  1.00 61.04 ? 377  ARG A NH1   1 
ATOM   3025 N  NH2   . ARG A 1 380 ? 19.322  188.786 -1.476  1.00 53.76 ? 377  ARG A NH2   1 
ATOM   3026 N  N     . LEU A 1 381 ? 19.132  196.042 0.422   1.00 54.42 ? 378  LEU A N     1 
ATOM   3027 C  CA    . LEU A 1 381 ? 18.460  197.102 -0.334  1.00 50.73 ? 378  LEU A CA    1 
ATOM   3028 C  C     . LEU A 1 381 ? 17.508  196.538 -1.392  1.00 48.97 ? 378  LEU A C     1 
ATOM   3029 O  O     . LEU A 1 381 ? 16.328  196.885 -1.443  1.00 44.32 ? 378  LEU A O     1 
ATOM   3030 C  CB    . LEU A 1 381 ? 19.487  198.027 -1.002  1.00 53.20 ? 378  LEU A CB    1 
ATOM   3031 C  CG    . LEU A 1 381 ? 19.014  199.352 -1.631  1.00 49.11 ? 378  LEU A CG    1 
ATOM   3032 C  CD1   . LEU A 1 381 ? 17.950  200.095 -0.801  1.00 47.89 ? 378  LEU A CD1   1 
ATOM   3033 C  CD2   . LEU A 1 381 ? 20.202  200.255 -1.901  1.00 41.73 ? 378  LEU A CD2   1 
ATOM   3034 N  N     . SER A 1 382 ? 18.020  195.676 -2.254  1.00 49.45 ? 379  SER A N     1 
ATOM   3035 C  CA    . SER A 1 382 ? 17.171  194.990 -3.219  1.00 41.74 ? 379  SER A CA    1 
ATOM   3036 C  C     . SER A 1 382 ? 17.208  193.526 -2.891  1.00 36.09 ? 379  SER A C     1 
ATOM   3037 O  O     . SER A 1 382 ? 18.249  193.010 -2.509  1.00 41.59 ? 379  SER A O     1 
ATOM   3038 C  CB    . SER A 1 382 ? 17.640  195.204 -4.662  1.00 35.26 ? 379  SER A CB    1 
ATOM   3039 O  OG    . SER A 1 382 ? 17.042  194.247 -5.518  1.00 39.75 ? 379  SER A OG    1 
ATOM   3040 N  N     . SER A 1 383 ? 16.091  192.846 -3.081  1.00 35.42 ? 380  SER A N     1 
ATOM   3041 C  CA    . SER A 1 383 ? 16.090  191.405 -2.944  1.00 35.00 ? 380  SER A CA    1 
ATOM   3042 C  C     . SER A 1 383 ? 16.292  190.751 -4.295  1.00 39.14 ? 380  SER A C     1 
ATOM   3043 O  O     . SER A 1 383 ? 16.779  189.624 -4.384  1.00 35.92 ? 380  SER A O     1 
ATOM   3044 C  CB    . SER A 1 383 ? 14.767  190.919 -2.323  1.00 42.01 ? 380  SER A CB    1 
ATOM   3045 O  OG    . SER A 1 383 ? 14.670  191.281 -0.947  1.00 40.13 ? 380  SER A OG    1 
ATOM   3046 N  N     . LEU A 1 384 ? 15.903  191.479 -5.339  1.00 35.67 ? 381  LEU A N     1 
ATOM   3047 C  CA    . LEU A 1 384 ? 15.704  190.910 -6.657  1.00 34.13 ? 381  LEU A CA    1 
ATOM   3048 C  C     . LEU A 1 384 ? 15.449  191.946 -7.741  1.00 35.44 ? 381  LEU A C     1 
ATOM   3049 O  O     . LEU A 1 384 ? 14.539  192.798 -7.596  1.00 31.73 ? 381  LEU A O     1 
ATOM   3050 C  CB    . LEU A 1 384 ? 14.529  189.958 -6.620  1.00 29.22 ? 381  LEU A CB    1 
ATOM   3051 C  CG    . LEU A 1 384 ? 14.305  189.223 -7.936  1.00 40.09 ? 381  LEU A CG    1 
ATOM   3052 C  CD1   . LEU A 1 384 ? 14.031  187.752 -7.628  1.00 46.74 ? 381  LEU A CD1   1 
ATOM   3053 C  CD2   . LEU A 1 384 ? 13.109  189.785 -8.663  1.00 36.40 ? 381  LEU A CD2   1 
ATOM   3054 N  N     . ARG A 1 385 ? 16.210  191.823 -8.833  1.00 31.26 ? 382  ARG A N     1 
ATOM   3055 C  CA    . ARG A 1 385 ? 16.186  192.763 -9.952  1.00 26.89 ? 382  ARG A CA    1 
ATOM   3056 C  C     . ARG A 1 385 ? 15.946  191.999 -11.243 1.00 29.01 ? 382  ARG A C     1 
ATOM   3057 O  O     . ARG A 1 385 ? 16.552  190.949 -11.460 1.00 27.27 ? 382  ARG A O     1 
ATOM   3058 C  CB    . ARG A 1 385 ? 17.511  193.505 -10.069 1.00 32.82 ? 382  ARG A CB    1 
ATOM   3059 C  CG    . ARG A 1 385 ? 17.513  194.922 -9.594  1.00 38.55 ? 382  ARG A CG    1 
ATOM   3060 C  CD    . ARG A 1 385 ? 18.949  195.416 -9.451  1.00 35.53 ? 382  ARG A CD    1 
ATOM   3061 N  NE    . ARG A 1 385 ? 19.616  194.815 -8.299  1.00 34.69 ? 382  ARG A NE    1 
ATOM   3062 C  CZ    . ARG A 1 385 ? 20.758  195.269 -7.776  1.00 36.73 ? 382  ARG A CZ    1 
ATOM   3063 N  NH1   . ARG A 1 385 ? 21.375  196.323 -8.319  1.00 31.63 ? 382  ARG A NH1   1 
ATOM   3064 N  NH2   . ARG A 1 385 ? 21.292  194.661 -6.732  1.00 35.65 ? 382  ARG A NH2   1 
ATOM   3065 N  N     . ARG A 1 386 ? 15.036  192.485 -12.066 1.00 23.31 ? 383  ARG A N     1 
ATOM   3066 C  CA    . ARG A 1 386 ? 14.777  191.894 -13.375 1.00 28.10 ? 383  ARG A CA    1 
ATOM   3067 C  C     . ARG A 1 386 ? 14.606  193.015 -14.390 1.00 30.08 ? 383  ARG A C     1 
ATOM   3068 O  O     . ARG A 1 386 ? 14.055  194.068 -14.081 1.00 24.23 ? 383  ARG A O     1 
ATOM   3069 C  CB    . ARG A 1 386 ? 13.536  191.016 -13.358 1.00 27.04 ? 383  ARG A CB    1 
ATOM   3070 C  CG    . ARG A 1 386 ? 13.658  189.799 -12.466 1.00 30.14 ? 383  ARG A CG    1 
ATOM   3071 C  CD    . ARG A 1 386 ? 14.492  188.770 -13.159 1.00 26.65 ? 383  ARG A CD    1 
ATOM   3072 N  NE    . ARG A 1 386 ? 14.432  187.496 -12.493 1.00 27.72 ? 383  ARG A NE    1 
ATOM   3073 C  CZ    . ARG A 1 386 ? 15.281  187.116 -11.552 1.00 31.94 ? 383  ARG A CZ    1 
ATOM   3074 N  NH1   . ARG A 1 386 ? 16.265  187.941 -11.130 1.00 33.41 ? 383  ARG A NH1   1 
ATOM   3075 N  NH2   . ARG A 1 386 ? 15.144  185.908 -11.024 1.00 33.27 ? 383  ARG A NH2   1 
ATOM   3076 N  N     . CYS A 1 387 ? 15.077  192.820 -15.606 1.00 33.40 ? 384  CYS A N     1 
ATOM   3077 C  CA    . CYS A 1 387 ? 14.805  193.830 -16.625 1.00 30.91 ? 384  CYS A CA    1 
ATOM   3078 C  C     . CYS A 1 387 ? 13.888  193.359 -17.722 1.00 33.72 ? 384  CYS A C     1 
ATOM   3079 O  O     . CYS A 1 387 ? 13.700  192.160 -17.927 1.00 36.04 ? 384  CYS A O     1 
ATOM   3080 C  CB    . CYS A 1 387 ? 16.113  194.310 -17.261 1.00 33.56 ? 384  CYS A CB    1 
ATOM   3081 S  SG    A CYS A 1 387 ? 17.105  192.987 -18.050 0.67 39.81 ? 384  CYS A SG    1 
ATOM   3082 S  SG    B CYS A 1 387 ? 17.313  194.632 -16.086 0.33 33.26 ? 384  CYS A SG    1 
ATOM   3083 N  N     . CYS A 1 388 ? 13.334  194.318 -18.451 1.00 30.49 ? 385  CYS A N     1 
ATOM   3084 C  CA    . CYS A 1 388 ? 12.688  194.016 -19.722 1.00 38.24 ? 385  CYS A CA    1 
ATOM   3085 C  C     . CYS A 1 388 ? 12.841  195.196 -20.658 1.00 35.70 ? 385  CYS A C     1 
ATOM   3086 O  O     . CYS A 1 388 ? 13.470  196.194 -20.300 1.00 30.11 ? 385  CYS A O     1 
ATOM   3087 C  CB    . CYS A 1 388 ? 11.220  193.688 -19.523 1.00 32.95 ? 385  CYS A CB    1 
ATOM   3088 S  SG    . CYS A 1 388 ? 10.312  195.072 -18.797 1.00 39.39 ? 385  CYS A SG    1 
ATOM   3089 N  N     . ALA A 1 389 ? 12.273  195.109 -21.858 1.00 35.63 ? 386  ALA A N     1 
ATOM   3090 C  CA    . ALA A 1 389 ? 12.435  196.215 -22.801 1.00 30.92 ? 386  ALA A CA    1 
ATOM   3091 C  C     . ALA A 1 389 ? 11.549  197.389 -22.472 1.00 30.67 ? 386  ALA A C     1 
ATOM   3092 O  O     . ALA A 1 389 ? 10.380  197.231 -22.131 1.00 34.20 ? 386  ALA A O     1 
ATOM   3093 C  CB    . ALA A 1 389 ? 12.166  195.764 -24.251 1.00 36.27 ? 386  ALA A CB    1 
ATOM   3094 N  N     . LEU A 1 390 ? 12.092  198.590 -22.585 1.00 26.85 ? 387  LEU A N     1 
ATOM   3095 C  CA    . LEU A 1 390 ? 11.305  199.784 -22.443 1.00 27.91 ? 387  LEU A CA    1 
ATOM   3096 C  C     . LEU A 1 390 ? 11.099  200.351 -23.836 1.00 29.81 ? 387  LEU A C     1 
ATOM   3097 O  O     . LEU A 1 390 ? 11.971  201.037 -24.372 1.00 31.59 ? 387  LEU A O     1 
ATOM   3098 C  CB    . LEU A 1 390 ? 12.000  200.813 -21.546 1.00 27.74 ? 387  LEU A CB    1 
ATOM   3099 C  CG    . LEU A 1 390 ? 11.076  201.714 -20.739 1.00 26.03 ? 387  LEU A CG    1 
ATOM   3100 C  CD1   . LEU A 1 390 ? 11.950  202.575 -19.827 1.00 24.29 ? 387  LEU A CD1   1 
ATOM   3101 C  CD2   . LEU A 1 390 ? 10.177  202.575 -21.594 1.00 26.76 ? 387  LEU A CD2   1 
ATOM   3102 N  N     . THR A 1 391 ? 9.954   200.066 -24.425 1.00 29.99 ? 388  THR A N     1 
ATOM   3103 C  CA    . THR A 1 391 ? 9.725   200.412 -25.810 1.00 32.37 ? 388  THR A CA    1 
ATOM   3104 C  C     . THR A 1 391 ? 8.702   201.543 -26.015 1.00 36.13 ? 388  THR A C     1 
ATOM   3105 O  O     . THR A 1 391 ? 8.579   202.086 -27.115 1.00 35.83 ? 388  THR A O     1 
ATOM   3106 C  CB    . THR A 1 391 ? 9.250   199.169 -26.585 1.00 35.76 ? 388  THR A CB    1 
ATOM   3107 O  OG1   . THR A 1 391 ? 7.996   198.752 -26.040 1.00 36.13 ? 388  THR A OG1   1 
ATOM   3108 C  CG2   . THR A 1 391 ? 10.217  197.989 -26.422 1.00 31.29 ? 388  THR A CG2   1 
ATOM   3109 N  N     . ARG A 1 392 ? 7.945   201.868 -24.968 1.00 29.22 ? 389  ARG A N     1 
ATOM   3110 C  CA    . ARG A 1 392 ? 6.916   202.887 -25.032 1.00 30.52 ? 389  ARG A CA    1 
ATOM   3111 C  C     . ARG A 1 392 ? 6.785   203.600 -23.680 1.00 26.44 ? 389  ARG A C     1 
ATOM   3112 O  O     . ARG A 1 392 ? 6.727   202.986 -22.633 1.00 34.23 ? 389  ARG A O     1 
ATOM   3113 C  CB    . ARG A 1 392 ? 5.560   202.277 -25.454 1.00 36.79 ? 389  ARG A CB    1 
ATOM   3114 C  CG    . ARG A 1 392 ? 5.322   202.242 -26.980 1.00 31.96 ? 389  ARG A CG    1 
ATOM   3115 C  CD    . ARG A 1 392 ? 4.301   201.152 -27.395 1.00 44.93 ? 389  ARG A CD    1 
ATOM   3116 N  NE    . ARG A 1 392 ? 3.210   201.671 -28.239 1.00 48.31 ? 389  ARG A NE    1 
ATOM   3117 C  CZ    . ARG A 1 392 ? 2.841   201.191 -29.437 1.00 36.45 ? 389  ARG A CZ    1 
ATOM   3118 N  NH1   . ARG A 1 392 ? 1.835   201.762 -30.091 1.00 38.03 ? 389  ARG A NH1   1 
ATOM   3119 N  NH2   . ARG A 1 392 ? 3.454   200.149 -29.991 1.00 36.30 ? 389  ARG A NH2   1 
ATOM   3120 N  N     . TYR A 1 393 ? 6.757   204.897 -23.733 1.00 24.62 ? 390  TYR A N     1 
ATOM   3121 C  CA    . TYR A 1 393 ? 6.564   205.711 -22.540 1.00 29.66 ? 390  TYR A CA    1 
ATOM   3122 C  C     . TYR A 1 393 ? 5.066   205.685 -22.212 1.00 31.05 ? 390  TYR A C     1 
ATOM   3123 O  O     . TYR A 1 393 ? 4.329   206.651 -22.470 1.00 29.91 ? 390  TYR A O     1 
ATOM   3124 C  CB    . TYR A 1 393 ? 7.061   207.130 -22.771 1.00 27.09 ? 390  TYR A CB    1 
ATOM   3125 C  CG    . TYR A 1 393 ? 8.597   207.333 -22.731 1.00 22.21 ? 390  TYR A CG    1 
ATOM   3126 C  CD1   . TYR A 1 393 ? 9.133   208.597 -22.739 1.00 23.42 ? 390  TYR A CD1   1 
ATOM   3127 C  CD2   . TYR A 1 393 ? 9.452   206.244 -22.648 1.00 29.15 ? 390  TYR A CD2   1 
ATOM   3128 C  CE1   . TYR A 1 393 ? 10.530  208.783 -22.694 1.00 19.47 ? 390  TYR A CE1   1 
ATOM   3129 C  CE2   . TYR A 1 393 ? 10.830  206.410 -22.566 1.00 25.81 ? 390  TYR A CE2   1 
ATOM   3130 C  CZ    . TYR A 1 393 ? 11.353  207.679 -22.605 1.00 23.45 ? 390  TYR A CZ    1 
ATOM   3131 O  OH    . TYR A 1 393 ? 12.743  207.884 -22.507 1.00 24.57 ? 390  TYR A OH    1 
ATOM   3132 N  N     . ASP A 1 394 ? 4.624   204.554 -21.680 1.00 27.44 ? 391  ASP A N     1 
ATOM   3133 C  CA    . ASP A 1 394 ? 3.219   204.414 -21.336 1.00 27.83 ? 391  ASP A CA    1 
ATOM   3134 C  C     . ASP A 1 394 ? 3.143   203.770 -19.985 1.00 22.90 ? 391  ASP A C     1 
ATOM   3135 O  O     . ASP A 1 394 ? 3.706   202.677 -19.798 1.00 27.85 ? 391  ASP A O     1 
ATOM   3136 C  CB    . ASP A 1 394 ? 2.512   203.590 -22.400 1.00 28.42 ? 391  ASP A CB    1 
ATOM   3137 C  CG    . ASP A 1 394 ? 1.027   203.512 -22.157 1.00 35.46 ? 391  ASP A CG    1 
ATOM   3138 O  OD1   . ASP A 1 394 ? 0.652   202.823 -21.187 1.00 32.74 ? 391  ASP A OD1   1 
ATOM   3139 O  OD2   . ASP A 1 394 ? 0.261   204.157 -22.905 1.00 43.20 ? 391  ASP A OD2   1 
ATOM   3140 N  N     . ALA A 1 395 ? 2.475   204.415 -19.032 1.00 25.26 ? 392  ALA A N     1 
ATOM   3141 C  CA    . ALA A 1 395 ? 2.549   203.922 -17.661 1.00 24.86 ? 392  ALA A CA    1 
ATOM   3142 C  C     . ALA A 1 395 ? 1.803   202.593 -17.476 1.00 23.46 ? 392  ALA A C     1 
ATOM   3143 O  O     . ALA A 1 395 ? 2.254   201.738 -16.739 1.00 23.94 ? 392  ALA A O     1 
ATOM   3144 C  CB    . ALA A 1 395 ? 2.044   205.003 -16.658 1.00 22.06 ? 392  ALA A CB    1 
ATOM   3145 N  N     . HIS A 1 396 ? 0.684   202.412 -18.169 1.00 27.02 ? 393  HIS A N     1 
ATOM   3146 C  CA    . HIS A 1 396 ? 0.016   201.132 -18.048 1.00 32.91 ? 393  HIS A CA    1 
ATOM   3147 C  C     . HIS A 1 396 ? 0.855   200.043 -18.652 1.00 28.18 ? 393  HIS A C     1 
ATOM   3148 O  O     . HIS A 1 396 ? 0.944   198.960 -18.086 1.00 30.83 ? 393  HIS A O     1 
ATOM   3149 C  CB    . HIS A 1 396 ? -1.371  201.183 -18.683 1.00 31.14 ? 393  HIS A CB    1 
ATOM   3150 C  CG    . HIS A 1 396 ? -2.395  201.828 -17.802 1.00 38.80 ? 393  HIS A CG    1 
ATOM   3151 N  ND1   . HIS A 1 396 ? -2.714  203.171 -17.870 1.00 38.42 ? 393  HIS A ND1   1 
ATOM   3152 C  CD2   . HIS A 1 396 ? -3.158  201.308 -16.811 1.00 38.33 ? 393  HIS A CD2   1 
ATOM   3153 C  CE1   . HIS A 1 396 ? -3.640  203.446 -16.966 1.00 39.28 ? 393  HIS A CE1   1 
ATOM   3154 N  NE2   . HIS A 1 396 ? -3.933  202.330 -16.318 1.00 42.04 ? 393  HIS A NE2   1 
ATOM   3155 N  N     . LYS A 1 397 ? 1.541   200.306 -19.764 1.00 26.93 ? 394  LYS A N     1 
ATOM   3156 C  CA    . LYS A 1 397 ? 2.427   199.246 -20.253 1.00 28.63 ? 394  LYS A CA    1 
ATOM   3157 C  C     . LYS A 1 397 ? 3.657   198.963 -19.378 1.00 26.50 ? 394  LYS A C     1 
ATOM   3158 O  O     . LYS A 1 397 ? 4.050   197.792 -19.168 1.00 28.09 ? 394  LYS A O     1 
ATOM   3159 C  CB    . LYS A 1 397 ? 2.887   199.546 -21.674 1.00 32.44 ? 394  LYS A CB    1 
ATOM   3160 C  CG    . LYS A 1 397 ? 3.878   198.488 -22.180 1.00 34.73 ? 394  LYS A CG    1 
ATOM   3161 C  CD    . LYS A 1 397 ? 4.230   198.640 -23.662 1.00 35.76 ? 394  LYS A CD    1 
ATOM   3162 C  CE    . LYS A 1 397 ? 5.400   197.719 -23.999 1.00 32.82 ? 394  LYS A CE    1 
ATOM   3163 N  NZ    . LYS A 1 397 ? 5.093   196.275 -23.722 1.00 36.52 ? 394  LYS A NZ    1 
ATOM   3164 N  N     . MET A 1 398 ? 4.307   200.016 -18.879 1.00 25.41 ? 395  MET A N     1 
ATOM   3165 C  CA    . MET A 1 398 ? 5.446   199.750 -18.025 1.00 25.56 ? 395  MET A CA    1 
ATOM   3166 C  C     . MET A 1 398 ? 5.068   198.949 -16.774 1.00 23.23 ? 395  MET A C     1 
ATOM   3167 O  O     . MET A 1 398 ? 5.808   198.060 -16.363 1.00 26.39 ? 395  MET A O     1 
ATOM   3168 C  CB    . MET A 1 398 ? 6.152   201.066 -17.642 1.00 22.01 ? 395  MET A CB    1 
ATOM   3169 C  CG    . MET A 1 398 ? 6.851   201.707 -18.835 1.00 23.44 ? 395  MET A CG    1 
ATOM   3170 S  SD    . MET A 1 398 ? 7.945   203.093 -18.427 1.00 27.62 ? 395  MET A SD    1 
ATOM   3171 C  CE    . MET A 1 398 ? 6.643   204.280 -18.158 1.00 24.90 ? 395  MET A CE    1 
ATOM   3172 N  N     . SER A 1 399 ? 3.908   199.270 -16.196 1.00 24.28 ? 396  SER A N     1 
ATOM   3173 C  CA    . SER A 1 399 ? 3.498   198.626 -14.938 1.00 24.58 ? 396  SER A CA    1 
ATOM   3174 C  C     . SER A 1 399 ? 3.010   197.193 -15.181 1.00 26.54 ? 396  SER A C     1 
ATOM   3175 O  O     . SER A 1 399 ? 3.273   196.292 -14.382 1.00 26.69 ? 396  SER A O     1 
ATOM   3176 C  CB    . SER A 1 399 ? 2.412   199.461 -14.215 1.00 26.79 ? 396  SER A CB    1 
ATOM   3177 O  OG    . SER A 1 399 ? 1.209   199.636 -14.934 1.00 30.11 ? 396  SER A OG    1 
ATOM   3178 N  N     . HIS A 1 400 ? 2.371   197.003 -16.325 1.00 28.66 ? 397  HIS A N     1 
ATOM   3179 C  CA    . HIS A 1 400 ? 1.991   195.649 -16.734 1.00 30.55 ? 397  HIS A CA    1 
ATOM   3180 C  C     . HIS A 1 400 ? 3.237   194.793 -16.989 1.00 28.67 ? 397  HIS A C     1 
ATOM   3181 O  O     . HIS A 1 400 ? 3.336   193.657 -16.542 1.00 31.26 ? 397  HIS A O     1 
ATOM   3182 C  CB    . HIS A 1 400 ? 1.106   195.713 -17.984 1.00 34.12 ? 397  HIS A CB    1 
ATOM   3183 C  CG    . HIS A 1 400 ? 0.614   194.369 -18.424 1.00 39.49 ? 397  HIS A CG    1 
ATOM   3184 N  ND1   . HIS A 1 400 ? 1.406   193.476 -19.116 1.00 42.18 ? 397  HIS A ND1   1 
ATOM   3185 C  CD2   . HIS A 1 400 ? -0.577  193.754 -18.243 1.00 42.55 ? 397  HIS A CD2   1 
ATOM   3186 C  CE1   . HIS A 1 400 ? 0.721   192.371 -19.350 1.00 42.04 ? 397  HIS A CE1   1 
ATOM   3187 N  NE2   . HIS A 1 400 ? -0.485  192.516 -18.831 1.00 48.20 ? 397  HIS A NE2   1 
ATOM   3188 N  N     . ASP A 1 401 ? 4.222   195.364 -17.693 1.00 31.33 ? 398  ASP A N     1 
ATOM   3189 C  CA    . ASP A 1 401 ? 5.486   194.675 -17.933 1.00 28.31 ? 398  ASP A CA    1 
ATOM   3190 C  C     . ASP A 1 401 ? 6.279   194.377 -16.651 1.00 28.78 ? 398  ASP A C     1 
ATOM   3191 O  O     . ASP A 1 401 ? 6.890   193.325 -16.504 1.00 32.03 ? 398  ASP A O     1 
ATOM   3192 C  CB    . ASP A 1 401 ? 6.371   195.482 -18.870 1.00 30.75 ? 398  ASP A CB    1 
ATOM   3193 C  CG    . ASP A 1 401 ? 5.865   195.475 -20.303 1.00 37.14 ? 398  ASP A CG    1 
ATOM   3194 O  OD1   . ASP A 1 401 ? 4.909   194.717 -20.592 1.00 31.41 ? 398  ASP A OD1   1 
ATOM   3195 O  OD2   . ASP A 1 401 ? 6.418   196.224 -21.141 1.00 32.73 ? 398  ASP A OD2   1 
ATOM   3196 N  N     . ALA A 1 402 ? 6.304   195.336 -15.721 1.00 27.05 ? 399  ALA A N     1 
ATOM   3197 C  CA    . ALA A 1 402 ? 7.027   195.107 -14.488 1.00 27.14 ? 399  ALA A CA    1 
ATOM   3198 C  C     . ALA A 1 402 ? 6.396   193.976 -13.697 1.00 24.72 ? 399  ALA A C     1 
ATOM   3199 O  O     . ALA A 1 402 ? 7.101   193.155 -13.107 1.00 28.98 ? 399  ALA A O     1 
ATOM   3200 C  CB    . ALA A 1 402 ? 7.062   196.412 -13.656 1.00 27.78 ? 399  ALA A CB    1 
ATOM   3201 N  N     . PHE A 1 403 ? 5.071   193.946 -13.687 1.00 30.19 ? 400  PHE A N     1 
ATOM   3202 C  CA    . PHE A 1 403 ? 4.408   192.861 -13.006 1.00 33.46 ? 400  PHE A CA    1 
ATOM   3203 C  C     . PHE A 1 403 ? 4.757   191.537 -13.677 1.00 34.75 ? 400  PHE A C     1 
ATOM   3204 O  O     . PHE A 1 403 ? 5.100   190.575 -13.006 1.00 35.82 ? 400  PHE A O     1 
ATOM   3205 C  CB    . PHE A 1 403 ? 2.908   193.046 -12.988 1.00 29.39 ? 400  PHE A CB    1 
ATOM   3206 C  CG    . PHE A 1 403 ? 2.211   191.983 -12.189 1.00 40.30 ? 400  PHE A CG    1 
ATOM   3207 C  CD1   . PHE A 1 403 ? 1.524   190.958 -12.820 1.00 38.38 ? 400  PHE A CD1   1 
ATOM   3208 C  CD2   . PHE A 1 403 ? 2.300   191.980 -10.806 1.00 37.20 ? 400  PHE A CD2   1 
ATOM   3209 C  CE1   . PHE A 1 403 ? 0.906   189.966 -12.081 1.00 43.23 ? 400  PHE A CE1   1 
ATOM   3210 C  CE2   . PHE A 1 403 ? 1.682   190.990 -10.055 1.00 43.64 ? 400  PHE A CE2   1 
ATOM   3211 C  CZ    . PHE A 1 403 ? 0.983   189.982 -10.695 1.00 41.77 ? 400  PHE A CZ    1 
ATOM   3212 N  N     . THR A 1 404 ? 4.727   191.512 -15.002 1.00 33.55 ? 401  THR A N     1 
ATOM   3213 C  CA    . THR A 1 404 ? 5.085   190.286 -15.702 1.00 31.37 ? 401  THR A CA    1 
ATOM   3214 C  C     . THR A 1 404 ? 6.434   189.714 -15.298 1.00 35.94 ? 401  THR A C     1 
ATOM   3215 O  O     . THR A 1 404 ? 6.551   188.507 -15.071 1.00 37.63 ? 401  THR A O     1 
ATOM   3216 C  CB    . THR A 1 404 ? 5.058   190.493 -17.221 1.00 31.06 ? 401  THR A CB    1 
ATOM   3217 O  OG1   . THR A 1 404 ? 3.716   190.805 -17.628 1.00 34.43 ? 401  THR A OG1   1 
ATOM   3218 C  CG2   . THR A 1 404 ? 5.552   189.242 -17.953 1.00 35.66 ? 401  THR A CG2   1 
ATOM   3219 N  N     . VAL A 1 405 ? 7.461   190.547 -15.183 1.00 31.94 ? 402  VAL A N     1 
ATOM   3220 C  CA    . VAL A 1 405 ? 8.775   190.004 -14.900 1.00 35.49 ? 402  VAL A CA    1 
ATOM   3221 C  C     . VAL A 1 405 ? 8.998   189.657 -13.424 1.00 33.96 ? 402  VAL A C     1 
ATOM   3222 O  O     . VAL A 1 405 ? 9.967   188.961 -13.121 1.00 32.59 ? 402  VAL A O     1 
ATOM   3223 C  CB    . VAL A 1 405 ? 9.898   190.967 -15.400 1.00 37.79 ? 402  VAL A CB    1 
ATOM   3224 C  CG1   . VAL A 1 405 ? 9.785   191.120 -16.909 1.00 33.99 ? 402  VAL A CG1   1 
ATOM   3225 C  CG2   . VAL A 1 405 ? 9.804   192.309 -14.728 1.00 33.61 ? 402  VAL A CG2   1 
ATOM   3226 N  N     . ILE A 1 406 ? 8.112   190.107 -12.527 1.00 35.10 ? 403  ILE A N     1 
ATOM   3227 C  CA    . ILE A 1 406 ? 8.236   189.789 -11.097 1.00 37.43 ? 403  ILE A CA    1 
ATOM   3228 C  C     . ILE A 1 406 ? 7.169   188.822 -10.551 1.00 40.99 ? 403  ILE A C     1 
ATOM   3229 O  O     . ILE A 1 406 ? 7.346   188.249 -9.472  1.00 41.79 ? 403  ILE A O     1 
ATOM   3230 C  CB    . ILE A 1 406 ? 8.168   191.066 -10.183 1.00 35.67 ? 403  ILE A CB    1 
ATOM   3231 C  CG1   . ILE A 1 406 ? 6.748   191.647 -10.189 1.00 36.39 ? 403  ILE A CG1   1 
ATOM   3232 C  CG2   . ILE A 1 406 ? 9.248   192.045 -10.552 1.00 37.12 ? 403  ILE A CG2   1 
ATOM   3233 C  CD1   . ILE A 1 406 ? 6.455   192.543 -8.994  1.00 37.53 ? 403  ILE A CD1   1 
ATOM   3234 N  N     . LYS A 1 407 ? 6.070   188.660 -11.275 1.00 37.07 ? 404  LYS A N     1 
ATOM   3235 C  CA    . LYS A 1 407 ? 4.922   187.914 -10.773 1.00 41.51 ? 404  LYS A CA    1 
ATOM   3236 C  C     . LYS A 1 407 ? 5.173   186.464 -10.301 1.00 46.20 ? 404  LYS A C     1 
ATOM   3237 O  O     . LYS A 1 407 ? 4.315   185.889 -9.638  1.00 48.91 ? 404  LYS A O     1 
ATOM   3238 C  CB    . LYS A 1 407 ? 3.835   187.887 -11.842 1.00 43.53 ? 404  LYS A CB    1 
ATOM   3239 C  CG    . LYS A 1 407 ? 4.206   187.063 -13.066 1.00 42.80 ? 404  LYS A CG    1 
ATOM   3240 C  CD    . LYS A 1 407 ? 3.165   187.264 -14.151 1.00 43.97 ? 404  LYS A CD    1 
ATOM   3241 C  CE    . LYS A 1 407 ? 3.270   186.188 -15.222 1.00 45.19 ? 404  LYS A CE    1 
ATOM   3242 N  NZ    . LYS A 1 407 ? 4.655   186.068 -15.754 1.00 51.68 ? 404  LYS A NZ    1 
ATOM   3243 N  N     . ASN A 1 408 ? 6.311   185.872 -10.635 1.00 45.77 ? 405  ASN A N     1 
ATOM   3244 C  CA    . ASN A 1 408 ? 6.613   184.521 -10.165 1.00 49.60 ? 405  ASN A CA    1 
ATOM   3245 C  C     . ASN A 1 408 ? 7.503   184.529 -8.930  1.00 49.83 ? 405  ASN A C     1 
ATOM   3246 O  O     . ASN A 1 408 ? 7.944   183.485 -8.464  1.00 48.04 ? 405  ASN A O     1 
ATOM   3247 C  CB    . ASN A 1 408 ? 7.263   183.684 -11.276 1.00 51.06 ? 405  ASN A CB    1 
ATOM   3248 C  CG    . ASN A 1 408 ? 6.310   183.413 -12.436 1.00 57.50 ? 405  ASN A CG    1 
ATOM   3249 O  OD1   . ASN A 1 408 ? 6.649   183.617 -13.607 1.00 58.49 ? 405  ASN A OD1   1 
ATOM   3250 N  ND2   . ASN A 1 408 ? 5.103   182.942 -12.108 1.00 58.55 ? 405  ASN A ND2   1 
ATOM   3251 N  N     . CYS A 1 409 ? 7.760   185.711 -8.385  1.00 47.69 ? 406  CYS A N     1 
ATOM   3252 C  CA    . CYS A 1 409 ? 8.497   185.792 -7.135  1.00 45.94 ? 406  CYS A CA    1 
ATOM   3253 C  C     . CYS A 1 409 ? 7.521   185.438 -6.045  1.00 45.56 ? 406  CYS A C     1 
ATOM   3254 O  O     . CYS A 1 409 ? 7.895   185.131 -4.919  1.00 50.28 ? 406  CYS A O     1 
ATOM   3255 C  CB    . CYS A 1 409 ? 9.082   187.184 -6.918  1.00 43.89 ? 406  CYS A CB    1 
ATOM   3256 S  SG    . CYS A 1 409 ? 10.499  187.489 -7.968  1.00 60.36 ? 406  CYS A SG    1 
ATOM   3257 N  N     . ASN A 1 410 ? 6.251   185.485 -6.412  1.00 45.85 ? 407  ASN A N     1 
ATOM   3258 C  CA    . ASN A 1 410 ? 5.175   185.161 -5.510  1.00 46.05 ? 407  ASN A CA    1 
ATOM   3259 C  C     . ASN A 1 410 ? 5.139   183.657 -5.162  1.00 49.54 ? 407  ASN A C     1 
ATOM   3260 O  O     . ASN A 1 410 ? 4.805   182.818 -5.996  1.00 48.73 ? 407  ASN A O     1 
ATOM   3261 C  CB    . ASN A 1 410 ? 3.864   185.597 -6.125  1.00 41.50 ? 407  ASN A CB    1 
ATOM   3262 C  CG    . ASN A 1 410 ? 2.745   185.562 -5.138  1.00 43.79 ? 407  ASN A CG    1 
ATOM   3263 O  OD1   . ASN A 1 410 ? 2.966   185.224 -3.976  1.00 43.89 ? 407  ASN A OD1   1 
ATOM   3264 N  ND2   . ASN A 1 410 ? 1.542   185.936 -5.570  1.00 42.73 ? 407  ASN A ND2   1 
ATOM   3265 N  N     . THR A 1 411 ? 5.488   183.335 -3.923  1.00 49.72 ? 408  THR A N     1 
ATOM   3266 C  CA    . THR A 1 411 ? 5.508   181.948 -3.468  1.00 52.20 ? 408  THR A CA    1 
ATOM   3267 C  C     . THR A 1 411 ? 4.105   181.459 -3.118  1.00 55.88 ? 408  THR A C     1 
ATOM   3268 O  O     . THR A 1 411 ? 3.891   180.257 -2.967  1.00 58.90 ? 408  THR A O     1 
ATOM   3269 C  CB    . THR A 1 411 ? 6.446   181.773 -2.250  1.00 53.60 ? 408  THR A CB    1 
ATOM   3270 O  OG1   . THR A 1 411 ? 6.874   180.406 -2.156  1.00 64.76 ? 408  THR A OG1   1 
ATOM   3271 C  CG2   . THR A 1 411 ? 5.767   182.211 -0.955  1.00 51.25 ? 408  THR A CG2   1 
ATOM   3272 N  N     . SER A 1 412 ? 3.152   182.385 -3.014  1.00 53.62 ? 409  SER A N     1 
ATOM   3273 C  CA    . SER A 1 412 ? 1.781   182.051 -2.615  1.00 60.46 ? 409  SER A CA    1 
ATOM   3274 C  C     . SER A 1 412 ? 1.120   181.113 -3.615  1.00 62.76 ? 409  SER A C     1 
ATOM   3275 O  O     . SER A 1 412 ? 1.333   181.233 -4.814  1.00 65.20 ? 409  SER A O     1 
ATOM   3276 C  CB    . SER A 1 412 ? 0.934   183.319 -2.460  1.00 58.18 ? 409  SER A CB    1 
ATOM   3277 O  OG    . SER A 1 412 ? -0.452  183.035 -2.584  1.00 62.84 ? 409  SER A OG    1 
ATOM   3278 N  N     . GLY A 1 413 ? 0.323   180.177 -3.111  1.00 70.55 ? 410  GLY A N     1 
ATOM   3279 C  CA    . GLY A 1 413 ? -0.372  179.225 -3.964  1.00 71.94 ? 410  GLY A CA    1 
ATOM   3280 C  C     . GLY A 1 413 ? -1.719  179.758 -4.419  1.00 72.57 ? 410  GLY A C     1 
ATOM   3281 O  O     . GLY A 1 413 ? -2.366  179.189 -5.297  1.00 72.86 ? 410  GLY A O     1 
ATOM   3282 N  N     . ILE A 1 414 ? -2.140  180.857 -3.804  1.00 73.12 ? 411  ILE A N     1 
ATOM   3283 C  CA    . ILE A 1 414 ? -3.360  181.547 -4.196  1.00 70.38 ? 411  ILE A CA    1 
ATOM   3284 C  C     . ILE A 1 414 ? -3.009  182.457 -5.374  1.00 74.38 ? 411  ILE A C     1 
ATOM   3285 O  O     . ILE A 1 414 ? -1.832  182.639 -5.683  1.00 77.31 ? 411  ILE A O     1 
ATOM   3286 C  CB    . ILE A 1 414 ? -3.961  182.385 -3.027  1.00 72.25 ? 411  ILE A CB    1 
ATOM   3287 C  CG1   . ILE A 1 414 ? -3.717  181.722 -1.661  1.00 70.25 ? 411  ILE A CG1   1 
ATOM   3288 C  CG2   . ILE A 1 414 ? -5.463  182.629 -3.231  1.00 66.65 ? 411  ILE A CG2   1 
ATOM   3289 C  CD1   . ILE A 1 414 ? -4.081  180.253 -1.570  1.00 68.21 ? 411  ILE A CD1   1 
ATOM   3290 N  N     . GLN A 1 415 ? -4.011  183.021 -6.042  1.00 75.14 ? 412  GLN A N     1 
ATOM   3291 C  CA    . GLN A 1 415 ? -3.741  183.975 -7.116  1.00 74.49 ? 412  GLN A CA    1 
ATOM   3292 C  C     . GLN A 1 415 ? -3.812  185.398 -6.572  1.00 68.65 ? 412  GLN A C     1 
ATOM   3293 O  O     . GLN A 1 415 ? -2.916  186.217 -6.820  1.00 66.93 ? 412  GLN A O     1 
ATOM   3294 C  CB    . GLN A 1 415 ? -4.734  183.798 -8.274  1.00 75.75 ? 412  GLN A CB    1 
ATOM   3295 C  CG    . GLN A 1 415 ? -4.136  183.207 -9.557  1.00 80.89 ? 412  GLN A CG    1 
ATOM   3296 C  CD    . GLN A 1 415 ? -2.820  183.861 -9.982  1.00 82.16 ? 412  GLN A CD    1 
ATOM   3297 O  OE1   . GLN A 1 415 ? -1.829  183.174 -10.244 1.00 85.38 ? 412  GLN A OE1   1 
ATOM   3298 N  NE2   . GLN A 1 415 ? -2.817  185.190 -10.081 1.00 83.90 ? 412  GLN A NE2   1 
ATOM   3299 N  N     . THR A 1 416 ? -4.877  185.669 -5.819  1.00 63.50 ? 413  THR A N     1 
ATOM   3300 C  CA    . THR A 1 416 ? -5.180  187.013 -5.331  1.00 60.71 ? 413  THR A CA    1 
ATOM   3301 C  C     . THR A 1 416 ? -4.251  187.512 -4.211  1.00 56.07 ? 413  THR A C     1 
ATOM   3302 O  O     . THR A 1 416 ? -4.261  188.698 -3.888  1.00 53.58 ? 413  THR A O     1 
ATOM   3303 C  CB    . THR A 1 416 ? -6.631  187.082 -4.826  1.00 59.94 ? 413  THR A CB    1 
ATOM   3304 O  OG1   . THR A 1 416 ? -7.045  188.450 -4.733  1.00 62.18 ? 413  THR A OG1   1 
ATOM   3305 C  CG2   . THR A 1 416 ? -6.754  186.404 -3.474  1.00 58.49 ? 413  THR A CG2   1 
ATOM   3306 N  N     . GLU A 1 417 ? -3.459  186.617 -3.625  1.00 55.41 ? 414  GLU A N     1 
ATOM   3307 C  CA    . GLU A 1 417 ? -2.542  186.989 -2.553  1.00 50.78 ? 414  GLU A CA    1 
ATOM   3308 C  C     . GLU A 1 417 ? -1.104  187.078 -3.040  1.00 52.44 ? 414  GLU A C     1 
ATOM   3309 O  O     . GLU A 1 417 ? -0.724  186.484 -4.058  1.00 51.56 ? 414  GLU A O     1 
ATOM   3310 C  CB    . GLU A 1 417 ? -2.607  185.986 -1.394  1.00 52.63 ? 414  GLU A CB    1 
ATOM   3311 C  CG    . GLU A 1 417 ? -3.946  185.914 -0.697  1.00 55.48 ? 414  GLU A CG    1 
ATOM   3312 C  CD    . GLU A 1 417 ? -4.360  187.212 -0.051  1.00 53.20 ? 414  GLU A CD    1 
ATOM   3313 O  OE1   . GLU A 1 417 ? -3.543  187.847 0.660   1.00 62.63 ? 414  GLU A OE1   1 
ATOM   3314 O  OE2   . GLU A 1 417 ? -5.494  187.625 -0.336  1.00 51.30 ? 414  GLU A OE2   1 
ATOM   3315 N  N     . TRP A 1 418 ? -0.300  187.799 -2.268  1.00 44.16 ? 415  TRP A N     1 
ATOM   3316 C  CA    . TRP A 1 418 ? 1.118   187.897 -2.503  1.00 41.77 ? 415  TRP A CA    1 
ATOM   3317 C  C     . TRP A 1 418 ? 1.891   187.478 -1.268  1.00 46.03 ? 415  TRP A C     1 
ATOM   3318 O  O     . TRP A 1 418 ? 1.739   188.067 -0.194  1.00 44.79 ? 415  TRP A O     1 
ATOM   3319 C  CB    . TRP A 1 418 ? 1.520   189.335 -2.903  1.00 41.36 ? 415  TRP A CB    1 
ATOM   3320 C  CG    . TRP A 1 418 ? 2.852   189.328 -3.555  1.00 37.07 ? 415  TRP A CG    1 
ATOM   3321 C  CD1   . TRP A 1 418 ? 4.066   189.177 -2.958  1.00 38.66 ? 415  TRP A CD1   1 
ATOM   3322 C  CD2   . TRP A 1 418 ? 3.089   189.351 -4.958  1.00 34.76 ? 415  TRP A CD2   1 
ATOM   3323 N  NE1   . TRP A 1 418 ? 5.059   189.148 -3.917  1.00 38.69 ? 415  TRP A NE1   1 
ATOM   3324 C  CE2   . TRP A 1 418 ? 4.474   189.264 -5.150  1.00 34.66 ? 415  TRP A CE2   1 
ATOM   3325 C  CE3   . TRP A 1 418 ? 2.259   189.496 -6.068  1.00 38.83 ? 415  TRP A CE3   1 
ATOM   3326 C  CZ2   . TRP A 1 418 ? 5.054   189.294 -6.418  1.00 39.66 ? 415  TRP A CZ2   1 
ATOM   3327 C  CZ3   . TRP A 1 418 ? 2.837   189.531 -7.327  1.00 40.33 ? 415  TRP A CZ3   1 
ATOM   3328 C  CH2   . TRP A 1 418 ? 4.211   189.427 -7.490  1.00 35.23 ? 415  TRP A CH2   1 
ATOM   3329 N  N     . SER A 1 419 ? 2.756   186.483 -1.419  1.00 46.49 ? 416  SER A N     1 
ATOM   3330 C  CA    . SER A 1 419 ? 3.680   186.143 -0.344  1.00 47.30 ? 416  SER A CA    1 
ATOM   3331 C  C     . SER A 1 419 ? 5.036   185.798 -0.960  1.00 48.51 ? 416  SER A C     1 
ATOM   3332 O  O     . SER A 1 419 ? 5.071   185.329 -2.102  1.00 49.32 ? 416  SER A O     1 
ATOM   3333 C  CB    . SER A 1 419 ? 3.131   184.980 0.493   1.00 51.46 ? 416  SER A CB    1 
ATOM   3334 O  OG    . SER A 1 419 ? 3.549   185.084 1.845   1.00 56.67 ? 416  SER A OG    1 
ATOM   3335 N  N     . PRO A 1 420 ? 6.153   186.081 -0.244  1.00 42.96 ? 417  PRO A N     1 
ATOM   3336 C  CA    . PRO A 1 420 ? 6.187   186.859 1.004   1.00 49.92 ? 417  PRO A CA    1 
ATOM   3337 C  C     . PRO A 1 420 ? 5.874   188.322 0.697   1.00 46.03 ? 417  PRO A C     1 
ATOM   3338 O  O     . PRO A 1 420 ? 6.252   188.763 -0.394  1.00 45.09 ? 417  PRO A O     1 
ATOM   3339 C  CB    . PRO A 1 420 ? 7.625   186.681 1.492   1.00 50.83 ? 417  PRO A CB    1 
ATOM   3340 C  CG    . PRO A 1 420 ? 8.409   186.459 0.253   1.00 49.38 ? 417  PRO A CG    1 
ATOM   3341 C  CD    . PRO A 1 420 ? 7.508   185.681 -0.669  1.00 48.73 ? 417  PRO A CD    1 
ATOM   3342 N  N     . PRO A 1 421 ? 5.178   189.040 1.609   1.00 47.57 ? 418  PRO A N     1 
ATOM   3343 C  CA    . PRO A 1 421 ? 4.693   190.398 1.291   1.00 41.38 ? 418  PRO A CA    1 
ATOM   3344 C  C     . PRO A 1 421 ? 5.842   191.302 0.856   1.00 33.86 ? 418  PRO A C     1 
ATOM   3345 O  O     . PRO A 1 421 ? 6.960   191.031 1.260   1.00 32.49 ? 418  PRO A O     1 
ATOM   3346 C  CB    . PRO A 1 421 ? 4.081   190.882 2.614   1.00 41.55 ? 418  PRO A CB    1 
ATOM   3347 C  CG    . PRO A 1 421 ? 3.831   189.628 3.420   1.00 41.37 ? 418  PRO A CG    1 
ATOM   3348 C  CD    . PRO A 1 421 ? 4.877   188.643 3.002   1.00 44.75 ? 418  PRO A CD    1 
ATOM   3349 N  N     . LEU A 1 422 ? 5.557   192.354 0.075   1.00 34.06 ? 419  LEU A N     1 
ATOM   3350 C  CA    . LEU A 1 422 ? 6.609   193.175 -0.546  1.00 31.75 ? 419  LEU A CA    1 
ATOM   3351 C  C     . LEU A 1 422 ? 6.874   194.427 0.268   1.00 25.34 ? 419  LEU A C     1 
ATOM   3352 O  O     . LEU A 1 422 ? 5.933   195.151 0.544   1.00 31.29 ? 419  LEU A O     1 
ATOM   3353 C  CB    . LEU A 1 422 ? 6.208   193.567 -1.982  1.00 30.26 ? 419  LEU A CB    1 
ATOM   3354 C  CG    . LEU A 1 422 ? 6.187   192.383 -2.972  1.00 32.23 ? 419  LEU A CG    1 
ATOM   3355 C  CD1   . LEU A 1 422 ? 5.917   192.880 -4.412  1.00 35.27 ? 419  LEU A CD1   1 
ATOM   3356 C  CD2   . LEU A 1 422 ? 7.465   191.558 -2.860  1.00 38.20 ? 419  LEU A CD2   1 
ATOM   3357 N  N     . THR A 1 423 ? 8.129   194.676 0.620   1.00 28.15 ? 420  THR A N     1 
ATOM   3358 C  CA    . THR A 1 423 ? 8.451   195.843 1.449   1.00 27.35 ? 420  THR A CA    1 
ATOM   3359 C  C     . THR A 1 423 ? 9.066   196.963 0.599   1.00 25.59 ? 420  THR A C     1 
ATOM   3360 O  O     . THR A 1 423 ? 9.396   198.012 1.129   1.00 24.68 ? 420  THR A O     1 
ATOM   3361 C  CB    . THR A 1 423 ? 9.392   195.451 2.563   1.00 32.40 ? 420  THR A CB    1 
ATOM   3362 O  OG1   . THR A 1 423 ? 10.491  194.732 1.992   1.00 33.46 ? 420  THR A OG1   1 
ATOM   3363 C  CG2   . THR A 1 423 ? 8.664   194.504 3.531   1.00 37.22 ? 420  THR A CG2   1 
ATOM   3364 N  N     . MET A 1 424 ? 9.251   196.739 -0.713  1.00 23.92 ? 421  MET A N     1 
ATOM   3365 C  CA    A MET A 1 424 ? 9.786   197.782 -1.585  0.78 23.55 ? 421  MET A CA    1 
ATOM   3366 C  CA    B MET A 1 424 ? 9.717   197.812 -1.592  0.22 23.65 ? 421  MET A CA    1 
ATOM   3367 C  C     . MET A 1 424 ? 9.487   197.454 -3.045  1.00 28.23 ? 421  MET A C     1 
ATOM   3368 O  O     . MET A 1 424 ? 9.605   196.290 -3.426  1.00 24.42 ? 421  MET A O     1 
ATOM   3369 C  CB    A MET A 1 424 ? 11.296  197.907 -1.401  0.78 25.75 ? 421  MET A CB    1 
ATOM   3370 C  CB    B MET A 1 424 ? 11.205  198.119 -1.387  0.22 25.94 ? 421  MET A CB    1 
ATOM   3371 C  CG    A MET A 1 424 ? 11.991  198.977 -2.265  0.78 26.67 ? 421  MET A CG    1 
ATOM   3372 C  CG    B MET A 1 424 ? 11.737  199.241 -2.313  0.22 25.61 ? 421  MET A CG    1 
ATOM   3373 S  SD    A MET A 1 424 ? 12.295  198.404 -3.981  0.78 24.68 ? 421  MET A SD    1 
ATOM   3374 S  SD    B MET A 1 424 ? 13.523  199.499 -2.243  0.22 29.12 ? 421  MET A SD    1 
ATOM   3375 C  CE    A MET A 1 424 ? 13.550  197.139 -3.732  0.78 28.97 ? 421  MET A CE    1 
ATOM   3376 C  CE    B MET A 1 424 ? 13.920  200.289 -3.797  0.22 25.39 ? 421  MET A CE    1 
ATOM   3377 N  N     . LEU A 1 425 ? 9.137   198.469 -3.842  1.00 21.82 ? 422  LEU A N     1 
ATOM   3378 C  CA    . LEU A 1 425 ? 9.011   198.384 -5.281  1.00 19.64 ? 422  LEU A CA    1 
ATOM   3379 C  C     . LEU A 1 425 ? 9.872   199.478 -5.896  1.00 22.35 ? 422  LEU A C     1 
ATOM   3380 O  O     . LEU A 1 425 ? 9.965   200.599 -5.352  1.00 21.69 ? 422  LEU A O     1 
ATOM   3381 C  CB    . LEU A 1 425 ? 7.600   198.605 -5.753  1.00 20.80 ? 422  LEU A CB    1 
ATOM   3382 C  CG    . LEU A 1 425 ? 6.525   197.573 -5.424  1.00 25.35 ? 422  LEU A CG    1 
ATOM   3383 C  CD1   . LEU A 1 425 ? 5.182   198.130 -5.898  1.00 26.91 ? 422  LEU A CD1   1 
ATOM   3384 C  CD2   . LEU A 1 425 ? 6.859   196.229 -6.032  1.00 26.12 ? 422  LEU A CD2   1 
ATOM   3385 N  N     . PHE A 1 426 ? 10.443  199.213 -7.066  1.00 20.86 ? 423  PHE A N     1 
ATOM   3386 C  CA    . PHE A 1 426 ? 11.359  200.168 -7.658  1.00 20.96 ? 423  PHE A CA    1 
ATOM   3387 C  C     . PHE A 1 426 ? 11.269  199.962 -9.146  1.00 25.73 ? 423  PHE A C     1 
ATOM   3388 O  O     . PHE A 1 426 ? 11.240  198.793 -9.595  1.00 25.94 ? 423  PHE A O     1 
ATOM   3389 C  CB    . PHE A 1 426 ? 12.761  199.908 -7.120  1.00 24.04 ? 423  PHE A CB    1 
ATOM   3390 C  CG    . PHE A 1 426 ? 13.836  200.562 -7.886  1.00 27.83 ? 423  PHE A CG    1 
ATOM   3391 C  CD1   . PHE A 1 426 ? 14.659  199.803 -8.714  1.00 33.70 ? 423  PHE A CD1   1 
ATOM   3392 C  CD2   . PHE A 1 426 ? 14.028  201.933 -7.799  1.00 26.31 ? 423  PHE A CD2   1 
ATOM   3393 C  CE1   . PHE A 1 426 ? 15.702  200.411 -9.399  1.00 37.36 ? 423  PHE A CE1   1 
ATOM   3394 C  CE2   . PHE A 1 426 ? 15.073  202.564 -8.466  1.00 31.38 ? 423  PHE A CE2   1 
ATOM   3395 C  CZ    . PHE A 1 426 ? 15.917  201.784 -9.257  1.00 33.53 ? 423  PHE A CZ    1 
ATOM   3396 N  N     . LEU A 1 427 ? 11.093  201.045 -9.887  1.00 18.84 ? 424  LEU A N     1 
ATOM   3397 C  CA    . LEU A 1 427 ? 11.165  201.014 -11.365 1.00 20.57 ? 424  LEU A CA    1 
ATOM   3398 C  C     . LEU A 1 427 ? 12.275  201.908 -11.782 1.00 19.75 ? 424  LEU A C     1 
ATOM   3399 O  O     . LEU A 1 427 ? 12.368  203.018 -11.312 1.00 22.88 ? 424  LEU A O     1 
ATOM   3400 C  CB    . LEU A 1 427 ? 9.884   201.468 -12.025 1.00 21.10 ? 424  LEU A CB    1 
ATOM   3401 C  CG    . LEU A 1 427 ? 8.643   200.631 -11.764 1.00 23.93 ? 424  LEU A CG    1 
ATOM   3402 C  CD1   . LEU A 1 427 ? 7.440   201.286 -12.453 1.00 23.22 ? 424  LEU A CD1   1 
ATOM   3403 C  CD2   . LEU A 1 427 ? 8.865   199.168 -12.179 1.00 23.68 ? 424  LEU A CD2   1 
ATOM   3404 N  N     . CYS A 1 428 ? 13.121  201.473 -12.710 1.00 20.36 ? 425  CYS A N     1 
ATOM   3405 C  CA    . CYS A 1 428 ? 14.210  202.366 -13.113 1.00 22.36 ? 425  CYS A CA    1 
ATOM   3406 C  C     . CYS A 1 428 ? 14.383  202.308 -14.632 1.00 20.79 ? 425  CYS A C     1 
ATOM   3407 O  O     . CYS A 1 428 ? 14.451  201.209 -15.179 1.00 24.49 ? 425  CYS A O     1 
ATOM   3408 C  CB    . CYS A 1 428 ? 15.498  201.953 -12.408 1.00 23.57 ? 425  CYS A CB    1 
ATOM   3409 S  SG    . CYS A 1 428 ? 16.939  203.028 -12.758 1.00 29.46 ? 425  CYS A SG    1 
ATOM   3410 N  N     . ALA A 1 429 ? 14.358  203.475 -15.266 1.00 18.32 ? 426  ALA A N     1 
ATOM   3411 C  CA    . ALA A 1 429 ? 14.565  203.531 -16.721 1.00 19.83 ? 426  ALA A CA    1 
ATOM   3412 C  C     . ALA A 1 429 ? 16.076  203.743 -16.981 1.00 19.60 ? 426  ALA A C     1 
ATOM   3413 O  O     . ALA A 1 429 ? 16.710  204.651 -16.391 1.00 20.77 ? 426  ALA A O     1 
ATOM   3414 C  CB    . ALA A 1 429 ? 13.782  204.626 -17.318 1.00 20.16 ? 426  ALA A CB    1 
ATOM   3415 N  N     . THR A 1 430 ? 16.614  202.948 -17.895 1.00 20.59 ? 427  THR A N     1 
ATOM   3416 C  CA    . THR A 1 430 ? 18.069  202.962 -18.105 1.00 21.53 ? 427  THR A CA    1 
ATOM   3417 C  C     . THR A 1 430 ? 18.395  202.775 -19.592 1.00 24.28 ? 427  THR A C     1 
ATOM   3418 O  O     . THR A 1 430 ? 17.501  202.658 -20.396 1.00 22.28 ? 427  THR A O     1 
ATOM   3419 C  CB    . THR A 1 430 ? 18.761  201.822 -17.325 1.00 22.63 ? 427  THR A CB    1 
ATOM   3420 O  OG1   . THR A 1 430 ? 18.373  200.571 -17.898 1.00 29.68 ? 427  THR A OG1   1 
ATOM   3421 C  CG2   . THR A 1 430 ? 18.352  201.759 -15.850 1.00 26.44 ? 427  THR A CG2   1 
ATOM   3422 N  N     . LYS A 1 431 ? 19.693  202.704 -19.910 1.00 23.52 ? 428  LYS A N     1 
ATOM   3423 C  CA    . LYS A 1 431 ? 20.188  202.502 -21.289 1.00 21.68 ? 428  LYS A CA    1 
ATOM   3424 C  C     . LYS A 1 431 ? 19.632  203.552 -22.271 1.00 21.03 ? 428  LYS A C     1 
ATOM   3425 O  O     . LYS A 1 431 ? 18.896  203.218 -23.209 1.00 23.69 ? 428  LYS A O     1 
ATOM   3426 C  CB    . LYS A 1 431 ? 19.877  201.096 -21.764 1.00 25.38 ? 428  LYS A CB    1 
ATOM   3427 C  CG    . LYS A 1 431 ? 20.639  200.086 -20.935 1.00 33.08 ? 428  LYS A CG    1 
ATOM   3428 C  CD    . LYS A 1 431 ? 20.706  198.695 -21.553 1.00 35.39 ? 428  LYS A CD    1 
ATOM   3429 C  CE    . LYS A 1 431 ? 21.360  197.730 -20.558 1.00 44.98 ? 428  LYS A CE    1 
ATOM   3430 N  NZ    . LYS A 1 431 ? 22.517  198.345 -19.837 1.00 50.54 ? 428  LYS A NZ    1 
ATOM   3431 N  N     . PHE A 1 432 ? 19.944  204.814 -22.037 1.00 22.17 ? 429  PHE A N     1 
ATOM   3432 C  CA    . PHE A 1 432 ? 19.482  205.882 -22.915 1.00 20.13 ? 429  PHE A CA    1 
ATOM   3433 C  C     . PHE A 1 432 ? 20.183  205.859 -24.262 1.00 27.82 ? 429  PHE A C     1 
ATOM   3434 O  O     . PHE A 1 432 ? 21.376  205.524 -24.355 1.00 27.15 ? 429  PHE A O     1 
ATOM   3435 C  CB    . PHE A 1 432 ? 19.656  207.239 -22.249 1.00 23.46 ? 429  PHE A CB    1 
ATOM   3436 C  CG    . PHE A 1 432 ? 18.641  207.487 -21.159 1.00 24.15 ? 429  PHE A CG    1 
ATOM   3437 C  CD1   . PHE A 1 432 ? 17.429  208.099 -21.440 1.00 23.64 ? 429  PHE A CD1   1 
ATOM   3438 C  CD2   . PHE A 1 432 ? 18.892  207.067 -19.855 1.00 31.81 ? 429  PHE A CD2   1 
ATOM   3439 C  CE1   . PHE A 1 432 ? 16.495  208.294 -20.442 1.00 23.17 ? 429  PHE A CE1   1 
ATOM   3440 C  CE2   . PHE A 1 432 ? 17.951  207.273 -18.829 1.00 28.20 ? 429  PHE A CE2   1 
ATOM   3441 C  CZ    . PHE A 1 432 ? 16.764  207.903 -19.112 1.00 27.53 ? 429  PHE A CZ    1 
ATOM   3442 N  N     . SER A 1 433 ? 19.386  206.169 -25.291 1.00 24.51 ? 430  SER A N     1 
ATOM   3443 C  CA    . SER A 1 433 ? 19.827  206.345 -26.669 1.00 25.37 ? 430  SER A CA    1 
ATOM   3444 C  C     . SER A 1 433 ? 19.404  207.696 -27.190 1.00 28.12 ? 430  SER A C     1 
ATOM   3445 O  O     . SER A 1 433 ? 18.376  208.236 -26.791 1.00 27.78 ? 430  SER A O     1 
ATOM   3446 C  CB    . SER A 1 433 ? 19.231  205.255 -27.550 1.00 29.01 ? 430  SER A CB    1 
ATOM   3447 O  OG    . SER A 1 433 ? 19.694  203.982 -27.156 1.00 40.18 ? 430  SER A OG    1 
ATOM   3448 N  N     . ALA A 1 434 ? 20.167  208.235 -28.122 1.00 26.70 ? 431  ALA A N     1 
ATOM   3449 C  CA    . ALA A 1 434 ? 19.840  209.555 -28.648 1.00 26.45 ? 431  ALA A CA    1 
ATOM   3450 C  C     . ALA A 1 434 ? 18.514  209.540 -29.400 1.00 33.69 ? 431  ALA A C     1 
ATOM   3451 O  O     . ALA A 1 434 ? 18.142  208.521 -30.008 1.00 31.40 ? 431  ALA A O     1 
ATOM   3452 C  CB    . ALA A 1 434 ? 20.933  210.049 -29.556 1.00 34.05 ? 431  ALA A CB    1 
ATOM   3453 N  N     . SER A 1 435 ? 17.795  210.668 -29.331 1.00 29.10 ? 432  SER A N     1 
ATOM   3454 C  CA    . SER A 1 435 ? 16.472  210.782 -29.954 1.00 33.53 ? 432  SER A CA    1 
ATOM   3455 C  C     . SER A 1 435 ? 16.240  212.199 -30.457 1.00 35.64 ? 432  SER A C     1 
ATOM   3456 O  O     . SER A 1 435 ? 15.216  212.477 -31.040 1.00 36.23 ? 432  SER A O     1 
ATOM   3457 C  CB    . SER A 1 435 ? 15.362  210.393 -28.967 1.00 34.20 ? 432  SER A CB    1 
ATOM   3458 O  OG    . SER A 1 435 ? 14.083  210.469 -29.562 1.00 45.96 ? 432  SER A OG    1 
ATOM   3459 O  OXT   . SER A 1 435 ? 17.043  213.114 -30.302 1.00 39.60 ? 432  SER A OXT   1 
ATOM   3460 O  "O3'" . DC  B 2 1   ? 10.099  197.250 7.973   1.00 49.09 ? 1    DC  T "O3'" 1 
ATOM   3461 P  P     . DA  B 2 2   ? 10.765  197.347 9.444   1.00 76.34 ? 2    DA  T P     1 
ATOM   3462 O  OP1   . DA  B 2 2   ? 12.159  196.809 9.399   1.00 63.75 ? 2    DA  T OP1   1 
ATOM   3463 O  OP2   . DA  B 2 2   ? 9.782   196.765 10.402  1.00 66.91 ? 2    DA  T OP2   1 
ATOM   3464 O  "O5'" . DA  B 2 2   ? 10.834  198.927 9.724   1.00 57.08 ? 2    DA  T "O5'" 1 
ATOM   3465 C  "C5'" . DA  B 2 2   ? 11.720  199.752 8.976   1.00 55.62 ? 2    DA  T "C5'" 1 
ATOM   3466 C  "C4'" . DA  B 2 2   ? 11.695  201.177 9.507   1.00 52.75 ? 2    DA  T "C4'" 1 
ATOM   3467 O  "O4'" . DA  B 2 2   ? 10.411  201.782 9.218   1.00 48.80 ? 2    DA  T "O4'" 1 
ATOM   3468 C  "C3'" . DA  B 2 2   ? 11.861  201.313 11.020  1.00 53.92 ? 2    DA  T "C3'" 1 
ATOM   3469 O  "O3'" . DA  B 2 2   ? 12.441  202.566 11.310  1.00 54.29 ? 2    DA  T "O3'" 1 
ATOM   3470 C  "C2'" . DA  B 2 2   ? 10.424  201.268 11.509  1.00 52.10 ? 2    DA  T "C2'" 1 
ATOM   3471 C  "C1'" . DA  B 2 2   ? 9.754   202.096 10.428  1.00 48.10 ? 2    DA  T "C1'" 1 
ATOM   3472 N  N9    . DA  B 2 2   ? 8.349   201.802 10.271  1.00 44.04 ? 2    DA  T N9    1 
ATOM   3473 C  C8    . DA  B 2 2   ? 7.663   200.704 10.739  1.00 46.87 ? 2    DA  T C8    1 
ATOM   3474 N  N7    . DA  B 2 2   ? 6.379   200.717 10.438  1.00 40.62 ? 2    DA  T N7    1 
ATOM   3475 C  C5    . DA  B 2 2   ? 6.227   201.910 9.735   1.00 43.29 ? 2    DA  T C5    1 
ATOM   3476 C  C6    . DA  B 2 2   ? 5.110   202.522 9.141   1.00 42.99 ? 2    DA  T C6    1 
ATOM   3477 N  N6    . DA  B 2 2   ? 3.877   201.994 9.176   1.00 39.52 ? 2    DA  T N6    1 
ATOM   3478 N  N1    . DA  B 2 2   ? 5.306   203.707 8.514   1.00 44.06 ? 2    DA  T N1    1 
ATOM   3479 C  C2    . DA  B 2 2   ? 6.541   204.229 8.476   1.00 40.03 ? 2    DA  T C2    1 
ATOM   3480 N  N3    . DA  B 2 2   ? 7.670   203.746 8.998   1.00 42.43 ? 2    DA  T N3    1 
ATOM   3481 C  C4    . DA  B 2 2   ? 7.436   202.579 9.625   1.00 43.91 ? 2    DA  T C4    1 
ATOM   3482 P  P     . DT  B 2 3   ? 14.018  202.671 11.561  1.00 54.03 ? 3    DT  T P     1 
ATOM   3483 O  OP1   . DT  B 2 3   ? 14.614  201.314 11.603  1.00 52.03 ? 3    DT  T OP1   1 
ATOM   3484 O  OP2   . DT  B 2 3   ? 14.152  203.669 12.658  1.00 50.01 ? 3    DT  T OP2   1 
ATOM   3485 O  "O5'" . DT  B 2 3   ? 14.604  203.301 10.231  1.00 49.39 ? 3    DT  T "O5'" 1 
ATOM   3486 C  "C5'" . DT  B 2 3   ? 14.987  204.659 10.209  1.00 53.11 ? 3    DT  T "C5'" 1 
ATOM   3487 C  "C4'" . DT  B 2 3   ? 14.212  205.344 9.130   1.00 45.88 ? 3    DT  T "C4'" 1 
ATOM   3488 O  "O4'" . DT  B 2 3   ? 14.755  206.650 8.848   1.00 51.43 ? 3    DT  T "O4'" 1 
ATOM   3489 C  "C3'" . DT  B 2 3   ? 14.218  204.599 7.779   1.00 49.28 ? 3    DT  T "C3'" 1 
ATOM   3490 O  "O3'" . DT  B 2 3   ? 12.926  204.242 7.431   1.00 50.48 ? 3    DT  T "O3'" 1 
ATOM   3491 C  "C2'" . DT  B 2 3   ? 14.757  205.628 6.794   1.00 43.17 ? 3    DT  T "C2'" 1 
ATOM   3492 C  "C1'" . DT  B 2 3   ? 14.372  206.902 7.514   1.00 48.14 ? 3    DT  T "C1'" 1 
ATOM   3493 N  N1    . DT  B 2 3   ? 15.066  208.059 7.016   1.00 48.08 ? 3    DT  T N1    1 
ATOM   3494 C  C2    . DT  B 2 3   ? 14.326  209.137 6.564   1.00 41.63 ? 3    DT  T C2    1 
ATOM   3495 O  O2    . DT  B 2 3   ? 13.077  209.186 6.595   1.00 37.95 ? 3    DT  T O2    1 
ATOM   3496 N  N3    . DT  B 2 3   ? 15.082  210.144 6.090   1.00 35.94 ? 3    DT  T N3    1 
ATOM   3497 C  C4    . DT  B 2 3   ? 16.477  210.182 5.997   1.00 31.32 ? 3    DT  T C4    1 
ATOM   3498 O  O4    . DT  B 2 3   ? 17.075  211.147 5.549   1.00 43.78 ? 3    DT  T O4    1 
ATOM   3499 C  C5    . DT  B 2 3   ? 17.179  209.023 6.460   1.00 43.74 ? 3    DT  T C5    1 
ATOM   3500 C  C7    . DT  B 2 3   ? 18.688  208.970 6.397   1.00 39.82 ? 3    DT  T C7    1 
ATOM   3501 C  C6    . DT  B 2 3   ? 16.447  208.016 6.938   1.00 45.15 ? 3    DT  T C6    1 
ATOM   3502 P  P     . DG  B 2 4   ? 12.680  203.633 5.978   1.00 51.54 ? 4    DG  T P     1 
ATOM   3503 O  OP1   . DG  B 2 4   ? 11.325  203.050 5.959   1.00 43.52 ? 4    DG  T OP1   1 
ATOM   3504 O  OP2   . DG  B 2 4   ? 13.953  203.043 5.506   1.00 40.91 ? 4    DG  T OP2   1 
ATOM   3505 O  "O5'" . DG  B 2 4   ? 12.569  204.899 5.016   1.00 33.44 ? 4    DG  T "O5'" 1 
ATOM   3506 C  "C5'" . DG  B 2 4   ? 11.450  205.723 5.030   1.00 28.26 ? 4    DG  T "C5'" 1 
ATOM   3507 C  "C4'" . DG  B 2 4   ? 11.447  206.511 3.727   1.00 23.33 ? 4    DG  T "C4'" 1 
ATOM   3508 O  "O4'" . DG  B 2 4   ? 12.683  207.298 3.573   1.00 21.88 ? 4    DG  T "O4'" 1 
ATOM   3509 C  "C3'" . DG  B 2 4   ? 11.357  205.670 2.478   1.00 19.04 ? 4    DG  T "C3'" 1 
ATOM   3510 O  "O3'" . DG  B 2 4   ? 10.590  206.428 1.547   1.00 18.92 ? 4    DG  T "O3'" 1 
ATOM   3511 C  "C2'" . DG  B 2 4   ? 12.808  205.521 2.042   1.00 18.40 ? 4    DG  T "C2'" 1 
ATOM   3512 C  "C1'" . DG  B 2 4   ? 13.349  206.918 2.394   1.00 18.43 ? 4    DG  T "C1'" 1 
ATOM   3513 N  N9    . DG  B 2 4   ? 14.754  206.944 2.715   1.00 22.64 ? 4    DG  T N9    1 
ATOM   3514 C  C8    . DG  B 2 4   ? 15.530  206.016 3.357   1.00 21.97 ? 4    DG  T C8    1 
ATOM   3515 N  N7    . DG  B 2 4   ? 16.781  206.416 3.527   1.00 23.01 ? 4    DG  T N7    1 
ATOM   3516 C  C5    . DG  B 2 4   ? 16.792  207.696 2.948   1.00 21.47 ? 4    DG  T C5    1 
ATOM   3517 C  C6    . DG  B 2 4   ? 17.823  208.639 2.846   1.00 21.43 ? 4    DG  T C6    1 
ATOM   3518 O  O6    . DG  B 2 4   ? 19.009  208.524 3.193   1.00 21.69 ? 4    DG  T O6    1 
ATOM   3519 N  N1    . DG  B 2 4   ? 17.379  209.813 2.209   1.00 17.42 ? 4    DG  T N1    1 
ATOM   3520 C  C2    . DG  B 2 4   ? 16.101  210.037 1.746   1.00 20.12 ? 4    DG  T C2    1 
ATOM   3521 N  N2    . DG  B 2 4   ? 15.869  211.233 1.124   1.00 18.67 ? 4    DG  T N2    1 
ATOM   3522 N  N3    . DG  B 2 4   ? 15.110  209.157 1.863   1.00 19.87 ? 4    DG  T N3    1 
ATOM   3523 C  C4    . DG  B 2 4   ? 15.535  208.028 2.495   1.00 18.93 ? 4    DG  T C4    1 
ATOM   3524 P  P     . DA  B 2 5   ? 10.221  205.939 0.075   1.00 19.86 ? 5    DA  T P     1 
ATOM   3525 O  OP1   . DA  B 2 5   ? 8.822   206.265 -0.136  1.00 21.03 ? 5    DA  T OP1   1 
ATOM   3526 O  OP2   . DA  B 2 5   ? 10.680  204.535 -0.091  1.00 20.69 ? 5    DA  T OP2   1 
ATOM   3527 O  "O5'" . DA  B 2 5   ? 11.202  206.787 -0.871  1.00 17.93 ? 5    DA  T "O5'" 1 
ATOM   3528 C  "C5'" . DA  B 2 5   ? 10.951  208.171 -1.029  1.00 16.05 ? 5    DA  T "C5'" 1 
ATOM   3529 C  "C4'" . DA  B 2 5   ? 11.933  208.737 -2.023  1.00 19.47 ? 5    DA  T "C4'" 1 
ATOM   3530 O  "O4'" . DA  B 2 5   ? 13.239  208.723 -1.410  1.00 20.25 ? 5    DA  T "O4'" 1 
ATOM   3531 C  "C3'" . DA  B 2 5   ? 12.043  207.995 -3.345  1.00 19.67 ? 5    DA  T "C3'" 1 
ATOM   3532 O  "O3'" . DA  B 2 5   ? 12.251  208.959 -4.368  1.00 18.34 ? 5    DA  T "O3'" 1 
ATOM   3533 C  "C2'" . DA  B 2 5   ? 13.306  207.143 -3.151  1.00 21.68 ? 5    DA  T "C2'" 1 
ATOM   3534 C  "C1'" . DA  B 2 5   ? 14.157  208.124 -2.295  1.00 21.43 ? 5    DA  T "C1'" 1 
ATOM   3535 N  N9    . DA  B 2 5   ? 15.219  207.506 -1.521  1.00 17.54 ? 5    DA  T N9    1 
ATOM   3536 C  C8    . DA  B 2 5   ? 15.191  206.298 -0.860  1.00 19.78 ? 5    DA  T C8    1 
ATOM   3537 N  N7    . DA  B 2 5   ? 16.310  205.992 -0.266  1.00 17.96 ? 5    DA  T N7    1 
ATOM   3538 C  C5    . DA  B 2 5   ? 17.129  207.093 -0.500  1.00 18.42 ? 5    DA  T C5    1 
ATOM   3539 C  C6    . DA  B 2 5   ? 18.457  207.327 -0.184  1.00 19.70 ? 5    DA  T C6    1 
ATOM   3540 N  N6    . DA  B 2 5   ? 19.217  206.479 0.549   1.00 19.19 ? 5    DA  T N6    1 
ATOM   3541 N  N1    . DA  B 2 5   ? 18.977  208.502 -0.610  1.00 19.99 ? 5    DA  T N1    1 
ATOM   3542 C  C2    . DA  B 2 5   ? 18.233  209.318 -1.358  1.00 19.30 ? 5    DA  T C2    1 
ATOM   3543 N  N3    . DA  B 2 5   ? 16.979  209.184 -1.750  1.00 17.70 ? 5    DA  T N3    1 
ATOM   3544 C  C4    . DA  B 2 5   ? 16.494  208.011 -1.303  1.00 17.88 ? 5    DA  T C4    1 
ATOM   3545 P  P     . DT  B 2 6   ? 12.105  208.558 -5.883  1.00 19.12 ? 6    DT  T P     1 
ATOM   3546 O  OP1   . DT  B 2 6   ? 12.184  209.789 -6.687  1.00 23.19 ? 6    DT  T OP1   1 
ATOM   3547 O  OP2   . DT  B 2 6   ? 10.839  207.809 -5.988  1.00 21.86 ? 6    DT  T OP2   1 
ATOM   3548 O  "O5'" . DT  B 2 6   ? 13.300  207.511 -6.096  1.00 25.03 ? 6    DT  T "O5'" 1 
ATOM   3549 C  "C5'" . DT  B 2 6   ? 14.341  207.769 -7.001  1.00 25.50 ? 6    DT  T "C5'" 1 
ATOM   3550 C  "C4'" . DT  B 2 6   ? 15.496  208.549 -6.373  1.00 25.03 ? 6    DT  T "C4'" 1 
ATOM   3551 O  "O4'" . DT  B 2 6   ? 15.929  207.944 -5.147  1.00 25.98 ? 6    DT  T "O4'" 1 
ATOM   3552 C  "C3'" . DT  B 2 6   ? 16.674  208.506 -7.290  1.00 24.22 ? 6    DT  T "C3'" 1 
ATOM   3553 O  "O3'" . DT  B 2 6   ? 16.624  209.647 -8.065  1.00 21.88 ? 6    DT  T "O3'" 1 
ATOM   3554 C  "C2'" . DT  B 2 6   ? 17.904  208.484 -6.364  1.00 24.37 ? 6    DT  T "C2'" 1 
ATOM   3555 C  "C1'" . DT  B 2 6   ? 17.301  208.174 -4.998  1.00 27.23 ? 6    DT  T "C1'" 1 
ATOM   3556 N  N1    . DT  B 2 6   ? 17.867  207.039 -4.330  1.00 23.69 ? 6    DT  T N1    1 
ATOM   3557 C  C2    . DT  B 2 6   ? 19.172  207.114 -3.919  1.00 19.97 ? 6    DT  T C2    1 
ATOM   3558 O  O2    . DT  B 2 6   ? 19.864  208.062 -4.155  1.00 23.33 ? 6    DT  T O2    1 
ATOM   3559 N  N3    . DT  B 2 6   ? 19.596  206.055 -3.147  1.00 21.81 ? 6    DT  T N3    1 
ATOM   3560 C  C4    . DT  B 2 6   ? 18.877  204.947 -2.797  1.00 22.51 ? 6    DT  T C4    1 
ATOM   3561 O  O4    . DT  B 2 6   ? 19.339  204.036 -2.112  1.00 23.08 ? 6    DT  T O4    1 
ATOM   3562 C  C5    . DT  B 2 6   ? 17.495  204.955 -3.245  1.00 23.24 ? 6    DT  T C5    1 
ATOM   3563 C  C7    . DT  B 2 6   ? 16.601  203.803 -2.921  1.00 24.53 ? 6    DT  T C7    1 
ATOM   3564 C  C6    . DT  B 2 6   ? 17.078  205.985 -3.979  1.00 22.51 ? 6    DT  T C6    1 
ATOM   3565 P  P     . DG  B 2 7   ? 17.037  209.558 -9.595  1.00 22.63 ? 7    DG  T P     1 
ATOM   3566 O  OP1   . DG  B 2 7   ? 16.983  210.961 -10.087 1.00 24.95 ? 7    DG  T OP1   1 
ATOM   3567 O  OP2   . DG  B 2 7   ? 16.436  208.521 -10.319 1.00 20.97 ? 7    DG  T OP2   1 
ATOM   3568 O  "O5'" . DG  B 2 7   ? 18.585  209.057 -9.529  1.00 24.31 ? 7    DG  T "O5'" 1 
ATOM   3569 C  "C5'" . DG  B 2 7   ? 19.607  209.936 -9.483  1.00 29.10 ? 7    DG  T "C5'" 1 
ATOM   3570 C  "C4'" . DG  B 2 7   ? 20.915  209.150 -9.318  1.00 19.49 ? 7    DG  T "C4'" 1 
ATOM   3571 O  "O4'" . DG  B 2 7   ? 20.854  208.352 -8.158  1.00 19.94 ? 7    DG  T "O4'" 1 
ATOM   3572 C  "C3'" . DG  B 2 7   ? 21.282  208.180 -10.453 1.00 26.81 ? 7    DG  T "C3'" 1 
ATOM   3573 O  "O3'" . DG  B 2 7   ? 22.353  208.694 -11.130 1.00 27.73 ? 7    DG  T "O3'" 1 
ATOM   3574 C  "C2'" . DG  B 2 7   ? 21.688  206.910 -9.714  1.00 27.33 ? 7    DG  T "C2'" 1 
ATOM   3575 C  "C1'" . DG  B 2 7   ? 21.838  207.387 -8.283  1.00 25.88 ? 7    DG  T "C1'" 1 
ATOM   3576 N  N9    . DG  B 2 7   ? 21.615  206.326 -7.315  1.00 22.35 ? 7    DG  T N9    1 
ATOM   3577 C  C8    . DG  B 2 7   ? 20.461  205.596 -7.109  1.00 23.29 ? 7    DG  T C8    1 
ATOM   3578 N  N7    . DG  B 2 7   ? 20.582  204.687 -6.192  1.00 22.36 ? 7    DG  T N7    1 
ATOM   3579 C  C5    . DG  B 2 7   ? 21.929  204.791 -5.796  1.00 20.45 ? 7    DG  T C5    1 
ATOM   3580 C  C6    . DG  B 2 7   ? 22.647  204.034 -4.856  1.00 20.34 ? 7    DG  T C6    1 
ATOM   3581 O  O6    . DG  B 2 7   ? 22.227  203.108 -4.148  1.00 23.04 ? 7    DG  T O6    1 
ATOM   3582 N  N1    . DG  B 2 7   ? 24.002  204.452 -4.788  1.00 17.46 ? 7    DG  T N1    1 
ATOM   3583 C  C2    . DG  B 2 7   ? 24.539  205.478 -5.485  1.00 18.85 ? 7    DG  T C2    1 
ATOM   3584 N  N2    . DG  B 2 7   ? 25.838  205.719 -5.289  1.00 19.88 ? 7    DG  T N2    1 
ATOM   3585 N  N3    . DG  B 2 7   ? 23.871  206.197 -6.399  1.00 22.63 ? 7    DG  T N3    1 
ATOM   3586 C  C4    . DG  B 2 7   ? 22.569  205.787 -6.473  1.00 19.28 ? 7    DG  T C4    1 
ATOM   3587 P  P     . DA  B 2 8   ? 22.996  207.947 -12.413 1.00 25.28 ? 8    DA  T P     1 
ATOM   3588 O  OP1   . DA  B 2 8   ? 23.339  208.972 -13.350 1.00 25.83 ? 8    DA  T OP1   1 
ATOM   3589 O  OP2   . DA  B 2 8   ? 22.277  206.689 -12.871 1.00 25.33 ? 8    DA  T OP2   1 
ATOM   3590 O  "O5'" . DA  B 2 8   ? 24.470  207.549 -11.847 1.00 24.49 ? 8    DA  T "O5'" 1 
ATOM   3591 C  "C5'" . DA  B 2 8   ? 25.314  208.550 -11.248 1.00 24.27 ? 8    DA  T "C5'" 1 
ATOM   3592 C  "C4'" . DA  B 2 8   ? 26.660  207.905 -10.891 1.00 24.06 ? 8    DA  T "C4'" 1 
ATOM   3593 O  "O4'" . DA  B 2 8   ? 26.453  207.027 -9.769  1.00 24.43 ? 8    DA  T "O4'" 1 
ATOM   3594 C  "C3'" . DA  B 2 8   ? 27.248  207.050 -12.013 1.00 24.10 ? 8    DA  T "C3'" 1 
ATOM   3595 O  "O3'" . DA  B 2 8   ? 28.674  207.214 -12.061 1.00 26.61 ? 8    DA  T "O3'" 1 
ATOM   3596 C  "C2'" . DA  B 2 8   ? 26.870  205.622 -11.612 1.00 23.77 ? 8    DA  T "C2'" 1 
ATOM   3597 C  "C1'" . DA  B 2 8   ? 26.853  205.695 -10.091 1.00 24.60 ? 8    DA  T "C1'" 1 
ATOM   3598 N  N9    . DA  B 2 8   ? 25.895  204.778 -9.508  1.00 22.19 ? 8    DA  T N9    1 
ATOM   3599 C  C8    . DA  B 2 8   ? 24.572  204.615 -9.871  1.00 21.50 ? 8    DA  T C8    1 
ATOM   3600 N  N7    . DA  B 2 8   ? 23.955  203.707 -9.168  1.00 18.77 ? 8    DA  T N7    1 
ATOM   3601 C  C5    . DA  B 2 8   ? 24.898  203.260 -8.272  1.00 21.76 ? 8    DA  T C5    1 
ATOM   3602 C  C6    . DA  B 2 8   ? 24.842  202.305 -7.267  1.00 20.93 ? 8    DA  T C6    1 
ATOM   3603 N  N6    . DA  B 2 8   ? 23.733  201.584 -6.988  1.00 20.91 ? 8    DA  T N6    1 
ATOM   3604 N  N1    . DA  B 2 8   ? 25.978  202.084 -6.533  1.00 20.43 ? 8    DA  T N1    1 
ATOM   3605 C  C2    . DA  B 2 8   ? 27.044  202.793 -6.807  1.00 17.15 ? 8    DA  T C2    1 
ATOM   3606 N  N3    . DA  B 2 8   ? 27.234  203.744 -7.733  1.00 19.36 ? 8    DA  T N3    1 
ATOM   3607 C  C4    . DA  B 2 8   ? 26.097  203.901 -8.475  1.00 18.34 ? 8    DA  T C4    1 
ATOM   3608 P  P     . DC  B 2 9   ? 29.567  206.562 -13.240 1.00 25.90 ? 9    DC  T P     1 
ATOM   3609 O  OP1   . DC  B 2 9   ? 30.685  207.504 -13.401 1.00 28.02 ? 9    DC  T OP1   1 
ATOM   3610 O  OP2   . DC  B 2 9   ? 28.795  206.207 -14.419 1.00 27.35 ? 9    DC  T OP2   1 
ATOM   3611 O  "O5'" . DC  B 2 9   ? 30.109  205.187 -12.583 1.00 23.60 ? 9    DC  T "O5'" 1 
ATOM   3612 C  "C5'" . DC  B 2 9   ? 30.878  205.255 -11.416 1.00 23.59 ? 9    DC  T "C5'" 1 
ATOM   3613 C  "C4'" . DC  B 2 9   ? 31.073  203.874 -10.889 1.00 26.71 ? 9    DC  T "C4'" 1 
ATOM   3614 O  "O4'" . DC  B 2 9   ? 29.844  203.385 -10.319 1.00 24.67 ? 9    DC  T "O4'" 1 
ATOM   3615 C  "C3'" . DC  B 2 9   ? 31.472  202.834 -11.939 1.00 29.25 ? 9    DC  T "C3'" 1 
ATOM   3616 O  "O3'" . DC  B 2 9   ? 32.471  202.059 -11.374 1.00 35.76 ? 9    DC  T "O3'" 1 
ATOM   3617 C  "C2'" . DC  B 2 9   ? 30.208  201.984 -12.115 1.00 23.53 ? 9    DC  T "C2'" 1 
ATOM   3618 C  "C1'" . DC  B 2 9   ? 29.704  202.018 -10.692 1.00 25.10 ? 9    DC  T "C1'" 1 
ATOM   3619 N  N1    . DC  B 2 9   ? 28.300  201.565 -10.559 1.00 23.80 ? 9    DC  T N1    1 
ATOM   3620 C  C2    . DC  B 2 9   ? 27.972  200.702 -9.519  1.00 23.68 ? 9    DC  T C2    1 
ATOM   3621 O  O2    . DC  B 2 9   ? 28.848  200.409 -8.699  1.00 22.44 ? 9    DC  T O2    1 
ATOM   3622 N  N3    . DC  B 2 9   ? 26.729  200.240 -9.411  1.00 24.47 ? 9    DC  T N3    1 
ATOM   3623 C  C4    . DC  B 2 9   ? 25.794  200.582 -10.317 1.00 23.76 ? 9    DC  T C4    1 
ATOM   3624 N  N4    . DC  B 2 9   ? 24.569  200.069 -10.168 1.00 22.67 ? 9    DC  T N4    1 
ATOM   3625 C  C5    . DC  B 2 9   ? 26.099  201.449 -11.388 1.00 23.95 ? 9    DC  T C5    1 
ATOM   3626 C  C6    . DC  B 2 9   ? 27.368  201.896 -11.493 1.00 26.44 ? 9    DC  T C6    1 
ATOM   3627 P  P     . DG  B 2 10  ? 33.516  201.268 -12.286 1.00 33.52 ? 10   DG  T P     1 
ATOM   3628 O  OP1   . DG  B 2 10  ? 34.724  202.070 -12.373 1.00 37.84 ? 10   DG  T OP1   1 
ATOM   3629 O  OP2   . DG  B 2 10  ? 32.916  200.698 -13.495 1.00 32.56 ? 10   DG  T OP2   1 
ATOM   3630 O  "O5'" . DG  B 2 10  ? 33.832  200.057 -11.333 1.00 32.40 ? 10   DG  T "O5'" 1 
ATOM   3631 C  "C5'" . DG  B 2 10  ? 34.058  200.299 -9.989  1.00 29.18 ? 10   DG  T "C5'" 1 
ATOM   3632 C  "C4'" . DG  B 2 10  ? 34.057  198.994 -9.276  1.00 28.82 ? 10   DG  T "C4'" 1 
ATOM   3633 O  "O4'" . DG  B 2 10  ? 32.700  198.626 -9.013  1.00 30.75 ? 10   DG  T "O4'" 1 
ATOM   3634 C  "C3'" . DG  B 2 10  ? 34.672  197.853 -10.109 1.00 30.80 ? 10   DG  T "C3'" 1 
ATOM   3635 O  "O3'" . DG  B 2 10  ? 35.414  197.006 -9.224  1.00 28.16 ? 10   DG  T "O3'" 1 
ATOM   3636 C  "C2'" . DG  B 2 10  ? 33.442  197.161 -10.716 1.00 30.43 ? 10   DG  T "C2'" 1 
ATOM   3637 C  "C1'" . DG  B 2 10  ? 32.371  197.426 -9.666  1.00 27.29 ? 10   DG  T "C1'" 1 
ATOM   3638 N  N9    . DG  B 2 10  ? 31.011  197.565 -10.214 1.00 26.68 ? 10   DG  T N9    1 
ATOM   3639 C  C8    . DG  B 2 10  ? 30.578  198.457 -11.175 1.00 27.08 ? 10   DG  T C8    1 
ATOM   3640 N  N7    . DG  B 2 10  ? 29.312  198.306 -11.483 1.00 24.99 ? 10   DG  T N7    1 
ATOM   3641 C  C5    . DG  B 2 10  ? 28.888  197.262 -10.680 1.00 22.77 ? 10   DG  T C5    1 
ATOM   3642 C  C6    . DG  B 2 10  ? 27.619  196.672 -10.559 1.00 21.29 ? 10   DG  T C6    1 
ATOM   3643 O  O6    . DG  B 2 10  ? 26.582  196.961 -11.178 1.00 24.71 ? 10   DG  T O6    1 
ATOM   3644 N  N1    . DG  B 2 10  ? 27.604  195.617 -9.619  1.00 25.57 ? 10   DG  T N1    1 
ATOM   3645 C  C2    . DG  B 2 10  ? 28.701  195.211 -8.888  1.00 24.65 ? 10   DG  T C2    1 
ATOM   3646 N  N2    . DG  B 2 10  ? 28.517  194.148 -8.060  1.00 28.07 ? 10   DG  T N2    1 
ATOM   3647 N  N3    . DG  B 2 10  ? 29.913  195.777 -8.986  1.00 25.25 ? 10   DG  T N3    1 
ATOM   3648 C  C4    . DG  B 2 10  ? 29.926  196.798 -9.892  1.00 23.12 ? 10   DG  T C4    1 
ATOM   3649 P  P     . DC  B 2 11  ? 36.214  195.714 -9.773  1.00 29.63 ? 11   DC  T P     1 
ATOM   3650 O  OP1   . DC  B 2 11  ? 37.450  195.639 -8.936  1.00 32.33 ? 11   DC  T OP1   1 
ATOM   3651 O  OP2   . DC  B 2 11  ? 36.406  195.772 -11.225 1.00 31.59 ? 11   DC  T OP2   1 
ATOM   3652 O  "O5'" . DC  B 2 11  ? 35.164  194.545 -9.475  1.00 29.79 ? 11   DC  T "O5'" 1 
ATOM   3653 C  "C5'" . DC  B 2 11  ? 34.816  194.149 -8.174  1.00 28.94 ? 11   DC  T "C5'" 1 
ATOM   3654 C  "C4'" . DC  B 2 11  ? 33.961  192.877 -8.240  1.00 27.62 ? 11   DC  T "C4'" 1 
ATOM   3655 O  "O4'" . DC  B 2 11  ? 32.667  193.178 -8.813  1.00 24.96 ? 11   DC  T "O4'" 1 
ATOM   3656 C  "C3'" . DC  B 2 11  ? 34.519  191.707 -9.080  1.00 23.84 ? 11   DC  T "C3'" 1 
ATOM   3657 O  "O3'" . DC  B 2 11  ? 34.409  190.506 -8.289  1.00 23.35 ? 11   DC  T "O3'" 1 
ATOM   3658 C  "C2'" . DC  B 2 11  ? 33.606  191.687 -10.346 1.00 24.39 ? 11   DC  T "C2'" 1 
ATOM   3659 C  "C1'" . DC  B 2 11  ? 32.288  192.191 -9.770  1.00 23.91 ? 11   DC  T "C1'" 1 
ATOM   3660 N  N1    . DC  B 2 11  ? 31.384  192.885 -10.737 1.00 23.17 ? 11   DC  T N1    1 
ATOM   3661 C  C2    . DC  B 2 11  ? 30.044  192.498 -10.853 1.00 22.42 ? 11   DC  T C2    1 
ATOM   3662 O  O2    . DC  B 2 11  ? 29.611  191.544 -10.193 1.00 24.28 ? 11   DC  T O2    1 
ATOM   3663 N  N3    . DC  B 2 11  ? 29.236  193.191 -11.722 1.00 22.57 ? 11   DC  T N3    1 
ATOM   3664 C  C4    . DC  B 2 11  ? 29.711  194.197 -12.419 1.00 23.41 ? 11   DC  T C4    1 
ATOM   3665 N  N4    . DC  B 2 11  ? 28.867  194.840 -13.240 1.00 22.27 ? 11   DC  T N4    1 
ATOM   3666 C  C5    . DC  B 2 11  ? 31.076  194.629 -12.296 1.00 20.18 ? 11   DC  T C5    1 
ATOM   3667 C  C6    . DC  B 2 11  ? 31.859  193.938 -11.454 1.00 22.74 ? 11   DC  T C6    1 
ATOM   3668 P  P     . DT  B 2 12  ? 35.171  189.158 -8.790  1.00 23.56 ? 12   DT  T P     1 
ATOM   3669 O  OP1   . DT  B 2 12  ? 35.521  188.392 -7.584  1.00 22.45 ? 12   DT  T OP1   1 
ATOM   3670 O  OP2   . DT  B 2 12  ? 36.164  189.584 -9.750  1.00 23.62 ? 12   DT  T OP2   1 
ATOM   3671 O  "O5'" . DT  B 2 12  ? 34.022  188.403 -9.633  1.00 23.62 ? 12   DT  T "O5'" 1 
ATOM   3672 C  "C5'" . DT  B 2 12  ? 33.017  187.729 -8.987  1.00 22.10 ? 12   DT  T "C5'" 1 
ATOM   3673 C  "C4'" . DT  B 2 12  ? 31.901  187.391 -9.977  1.00 26.55 ? 12   DT  T "C4'" 1 
ATOM   3674 O  "O4'" . DT  B 2 12  ? 31.359  188.592 -10.538 1.00 28.15 ? 12   DT  T "O4'" 1 
ATOM   3675 C  "C3'" . DT  B 2 12  ? 32.368  186.600 -11.183 1.00 33.36 ? 12   DT  T "C3'" 1 
ATOM   3676 O  "O3'" . DT  B 2 12  ? 32.059  185.226 -10.990 1.00 29.31 ? 12   DT  T "O3'" 1 
ATOM   3677 C  "C2'" . DT  B 2 12  ? 31.577  187.206 -12.366 1.00 29.97 ? 12   DT  T "C2'" 1 
ATOM   3678 C  "C1'" . DT  B 2 12  ? 30.695  188.253 -11.743 1.00 35.44 ? 12   DT  T "C1'" 1 
ATOM   3679 N  N1    . DT  B 2 12  ? 30.468  189.451 -12.676 1.00 30.96 ? 12   DT  T N1    1 
ATOM   3680 C  C2    . DT  B 2 12  ? 29.203  189.728 -13.151 1.00 31.71 ? 12   DT  T C2    1 
ATOM   3681 O  O2    . DT  B 2 12  ? 28.201  189.112 -12.794 1.00 36.78 ? 12   DT  T O2    1 
ATOM   3682 N  N3    . DT  B 2 12  ? 29.129  190.804 -14.021 1.00 28.93 ? 12   DT  T N3    1 
ATOM   3683 C  C4    . DT  B 2 12  ? 30.199  191.579 -14.485 1.00 27.17 ? 12   DT  T C4    1 
ATOM   3684 O  O4    . DT  B 2 12  ? 30.056  192.503 -15.269 1.00 30.46 ? 12   DT  T O4    1 
ATOM   3685 C  C5    . DT  B 2 12  ? 31.478  191.215 -13.959 1.00 23.53 ? 12   DT  T C5    1 
ATOM   3686 C  C7    . DT  B 2 12  ? 32.710  191.958 -14.390 1.00 30.40 ? 12   DT  T C7    1 
ATOM   3687 C  C6    . DT  B 2 12  ? 31.561  190.172 -13.130 1.00 32.57 ? 12   DT  T C6    1 
ATOM   3688 O  "O5'" . DA  C 3 1   ? 21.439  191.664 -19.372 1.00 42.24 ? 1    DA  P "O5'" 1 
ATOM   3689 C  "C5'" . DA  C 3 1   ? 20.340  190.819 -19.296 1.00 42.96 ? 1    DA  P "C5'" 1 
ATOM   3690 C  "C4'" . DA  C 3 1   ? 20.575  189.732 -18.270 1.00 44.07 ? 1    DA  P "C4'" 1 
ATOM   3691 O  "O4'" . DA  C 3 1   ? 21.996  189.512 -18.122 1.00 43.27 ? 1    DA  P "O4'" 1 
ATOM   3692 C  "C3'" . DA  C 3 1   ? 20.014  190.020 -16.868 1.00 35.60 ? 1    DA  P "C3'" 1 
ATOM   3693 O  "O3'" . DA  C 3 1   ? 19.376  188.855 -16.359 1.00 37.54 ? 1    DA  P "O3'" 1 
ATOM   3694 C  "C2'" . DA  C 3 1   ? 21.236  190.412 -16.042 1.00 38.28 ? 1    DA  P "C2'" 1 
ATOM   3695 C  "C1'" . DA  C 3 1   ? 22.411  189.797 -16.812 1.00 38.93 ? 1    DA  P "C1'" 1 
ATOM   3696 N  N9    . DA  C 3 1   ? 23.538  190.698 -16.910 1.00 36.84 ? 1    DA  P N9    1 
ATOM   3697 C  C8    . DA  C 3 1   ? 23.689  191.777 -17.748 1.00 33.51 ? 1    DA  P C8    1 
ATOM   3698 N  N7    . DA  C 3 1   ? 24.837  192.412 -17.580 1.00 37.36 ? 1    DA  P N7    1 
ATOM   3699 C  C5    . DA  C 3 1   ? 25.443  191.691 -16.562 1.00 31.48 ? 1    DA  P C5    1 
ATOM   3700 C  C6    . DA  C 3 1   ? 26.687  191.798 -15.933 1.00 32.10 ? 1    DA  P C6    1 
ATOM   3701 N  N6    . DA  C 3 1   ? 27.579  192.748 -16.217 1.00 32.62 ? 1    DA  P N6    1 
ATOM   3702 N  N1    . DA  C 3 1   ? 26.988  190.888 -14.988 1.00 33.48 ? 1    DA  P N1    1 
ATOM   3703 C  C2    . DA  C 3 1   ? 26.113  189.929 -14.697 1.00 28.81 ? 1    DA  P C2    1 
ATOM   3704 N  N3    . DA  C 3 1   ? 24.926  189.708 -15.220 1.00 31.28 ? 1    DA  P N3    1 
ATOM   3705 C  C4    . DA  C 3 1   ? 24.649  190.634 -16.163 1.00 31.93 ? 1    DA  P C4    1 
ATOM   3706 P  P     . DG  C 3 2   ? 18.194  188.985 -15.261 1.00 34.42 ? 2    DG  P P     1 
ATOM   3707 O  OP1   . DG  C 3 2   ? 17.377  187.752 -15.205 1.00 37.00 ? 2    DG  P OP1   1 
ATOM   3708 O  OP2   . DG  C 3 2   ? 17.568  190.309 -15.554 1.00 37.48 ? 2    DG  P OP2   1 
ATOM   3709 O  "O5'" . DG  C 3 2   ? 19.017  189.211 -13.900 1.00 30.77 ? 2    DG  P "O5'" 1 
ATOM   3710 C  "C5'" . DG  C 3 2   ? 19.439  188.119 -13.203 1.00 32.90 ? 2    DG  P "C5'" 1 
ATOM   3711 C  "C4'" . DG  C 3 2   ? 20.359  188.573 -12.120 1.00 26.88 ? 2    DG  P "C4'" 1 
ATOM   3712 O  "O4'" . DG  C 3 2   ? 21.456  189.321 -12.665 1.00 28.72 ? 2    DG  P "O4'" 1 
ATOM   3713 C  "C3'" . DG  C 3 2   ? 19.693  189.470 -11.049 1.00 25.12 ? 2    DG  P "C3'" 1 
ATOM   3714 O  "O3'" . DG  C 3 2   ? 19.851  188.779 -9.914  1.00 28.58 ? 2    DG  P "O3'" 1 
ATOM   3715 C  "C2'" . DG  C 3 2   ? 20.523  190.754 -11.073 1.00 26.58 ? 2    DG  P "C2'" 1 
ATOM   3716 C  "C1'" . DG  C 3 2   ? 21.831  190.274 -11.719 1.00 25.19 ? 2    DG  P "C1'" 1 
ATOM   3717 N  N9    . DG  C 3 2   ? 22.637  191.321 -12.337 1.00 29.03 ? 2    DG  P N9    1 
ATOM   3718 C  C8    . DG  C 3 2   ? 22.225  192.300 -13.251 1.00 26.16 ? 2    DG  P C8    1 
ATOM   3719 N  N7    . DG  C 3 2   ? 23.199  193.108 -13.610 1.00 28.20 ? 2    DG  P N7    1 
ATOM   3720 C  C5    . DG  C 3 2   ? 24.313  192.641 -12.883 1.00 27.87 ? 2    DG  P C5    1 
ATOM   3721 C  C6    . DG  C 3 2   ? 25.644  193.125 -12.832 1.00 24.18 ? 2    DG  P C6    1 
ATOM   3722 O  O6    . DG  C 3 2   ? 26.152  194.095 -13.457 1.00 24.98 ? 2    DG  P O6    1 
ATOM   3723 N  N1    . DG  C 3 2   ? 26.430  192.370 -11.963 1.00 25.43 ? 2    DG  P N1    1 
ATOM   3724 C  C2    . DG  C 3 2   ? 25.995  191.294 -11.256 1.00 24.24 ? 2    DG  P C2    1 
ATOM   3725 N  N2    . DG  C 3 2   ? 26.910  190.654 -10.479 1.00 25.06 ? 2    DG  P N2    1 
ATOM   3726 N  N3    . DG  C 3 2   ? 24.769  190.811 -11.312 1.00 25.58 ? 2    DG  P N3    1 
ATOM   3727 C  C4    . DG  C 3 2   ? 23.969  191.549 -12.121 1.00 25.69 ? 2    DG  P C4    1 
ATOM   3728 P  P     . DC  C 3 3   ? 19.381  189.295 -8.478  1.00 31.20 ? 3    DC  P P     1 
ATOM   3729 O  OP1   . DC  C 3 3   ? 18.867  188.109 -7.781  1.00 34.15 ? 3    DC  P OP1   1 
ATOM   3730 O  OP2   . DC  C 3 3   ? 18.732  190.614 -8.404  1.00 31.21 ? 3    DC  P OP2   1 
ATOM   3731 O  "O5'" . DC  C 3 3   ? 20.809  189.628 -7.809  1.00 36.48 ? 3    DC  P "O5'" 1 
ATOM   3732 C  "C5'" . DC  C 3 3   ? 21.827  188.616 -7.675  1.00 36.36 ? 3    DC  P "C5'" 1 
ATOM   3733 C  "C4'" . DC  C 3 3   ? 23.043  189.199 -6.975  1.00 35.30 ? 3    DC  P "C4'" 1 
ATOM   3734 O  "O4'" . DC  C 3 3   ? 23.743  190.070 -7.895  1.00 31.24 ? 3    DC  P "O4'" 1 
ATOM   3735 C  "C3'" . DC  C 3 3   ? 22.727  190.035 -5.728  1.00 34.22 ? 3    DC  P "C3'" 1 
ATOM   3736 O  "O3'" . DC  C 3 3   ? 23.535  189.646 -4.661  1.00 36.70 ? 3    DC  P "O3'" 1 
ATOM   3737 C  "C2'" . DC  C 3 3   ? 23.044  191.478 -6.149  1.00 36.06 ? 3    DC  P "C2'" 1 
ATOM   3738 C  "C1'" . DC  C 3 3   ? 24.093  191.273 -7.240  1.00 33.83 ? 3    DC  P "C1'" 1 
ATOM   3739 N  N1    . DC  C 3 3   ? 24.059  192.375 -8.213  1.00 31.01 ? 3    DC  P N1    1 
ATOM   3740 C  C2    . DC  C 3 3   ? 25.188  193.130 -8.411  1.00 23.02 ? 3    DC  P C2    1 
ATOM   3741 O  O2    . DC  C 3 3   ? 26.214  192.812 -7.827  1.00 32.09 ? 3    DC  P O2    1 
ATOM   3742 N  N3    . DC  C 3 3   ? 25.133  194.191 -9.256  1.00 29.44 ? 3    DC  P N3    1 
ATOM   3743 C  C4    . DC  C 3 3   ? 23.987  194.504 -9.846  1.00 28.36 ? 3    DC  P C4    1 
ATOM   3744 N  N4    . DC  C 3 3   ? 23.976  195.551 -10.689 1.00 28.38 ? 3    DC  P N4    1 
ATOM   3745 C  C5    . DC  C 3 3   ? 22.810  193.723 -9.656  1.00 30.65 ? 3    DC  P C5    1 
ATOM   3746 C  C6    . DC  C 3 3   ? 22.880  192.700 -8.815  1.00 29.23 ? 3    DC  P C6    1 
ATOM   3747 P  P     . DG  C 3 4   ? 23.386  190.403 -3.255  1.00 38.16 ? 4    DG  P P     1 
ATOM   3748 O  OP1   . DG  C 3 4   ? 23.720  189.404 -2.199  1.00 47.10 ? 4    DG  P OP1   1 
ATOM   3749 O  OP2   . DG  C 3 4   ? 22.208  191.297 -3.179  1.00 35.29 ? 4    DG  P OP2   1 
ATOM   3750 O  "O5'" . DG  C 3 4   ? 24.599  191.456 -3.267  1.00 33.83 ? 4    DG  P "O5'" 1 
ATOM   3751 C  "C5'" . DG  C 3 4   ? 25.910  190.966 -3.428  1.00 33.46 ? 4    DG  P "C5'" 1 
ATOM   3752 C  "C4'" . DG  C 3 4   ? 26.892  192.115 -3.341  1.00 34.55 ? 4    DG  P "C4'" 1 
ATOM   3753 O  "O4'" . DG  C 3 4   ? 26.710  192.980 -4.508  1.00 36.08 ? 4    DG  P "O4'" 1 
ATOM   3754 C  "C3'" . DG  C 3 4   ? 26.697  192.994 -2.098  1.00 34.23 ? 4    DG  P "C3'" 1 
ATOM   3755 O  "O3'" . DG  C 3 4   ? 27.954  193.090 -1.378  1.00 38.37 ? 4    DG  P "O3'" 1 
ATOM   3756 C  "C2'" . DG  C 3 4   ? 26.194  194.334 -2.660  1.00 30.81 ? 4    DG  P "C2'" 1 
ATOM   3757 C  "C1'" . DG  C 3 4   ? 26.685  194.346 -4.097  1.00 29.07 ? 4    DG  P "C1'" 1 
ATOM   3758 N  N9    . DG  C 3 4   ? 25.798  195.082 -5.017  1.00 28.62 ? 4    DG  P N9    1 
ATOM   3759 C  C8    . DG  C 3 4   ? 24.462  194.847 -5.269  1.00 27.76 ? 4    DG  P C8    1 
ATOM   3760 N  N7    . DG  C 3 4   ? 23.953  195.654 -6.160  1.00 26.48 ? 4    DG  P N7    1 
ATOM   3761 C  C5    . DG  C 3 4   ? 25.018  196.483 -6.537  1.00 25.18 ? 4    DG  P C5    1 
ATOM   3762 C  C6    . DG  C 3 4   ? 25.064  197.545 -7.456  1.00 22.91 ? 4    DG  P C6    1 
ATOM   3763 O  O6    . DG  C 3 4   ? 24.143  198.024 -8.171  1.00 26.86 ? 4    DG  P O6    1 
ATOM   3764 N  N1    . DG  C 3 4   ? 26.365  198.106 -7.536  1.00 21.60 ? 4    DG  P N1    1 
ATOM   3765 C  C2    . DG  C 3 4   ? 27.433  197.679 -6.802  1.00 21.76 ? 4    DG  P C2    1 
ATOM   3766 N  N2    . DG  C 3 4   ? 28.596  198.340 -6.995  1.00 21.69 ? 4    DG  P N2    1 
ATOM   3767 N  N3    . DG  C 3 4   ? 27.384  196.679 -5.942  1.00 22.84 ? 4    DG  P N3    1 
ATOM   3768 C  C4    . DG  C 3 4   ? 26.155  196.123 -5.868  1.00 22.68 ? 4    DG  P C4    1 
ATOM   3769 P  P     . DT  C 3 5   ? 28.112  193.962 -0.026  1.00 34.07 ? 5    DT  P P     1 
ATOM   3770 O  OP1   . DT  C 3 5   ? 29.224  193.320 0.699   1.00 34.60 ? 5    DT  P OP1   1 
ATOM   3771 O  OP2   . DT  C 3 5   ? 26.823  194.304 0.586   1.00 35.30 ? 5    DT  P OP2   1 
ATOM   3772 O  "O5'" . DT  C 3 5   ? 28.644  195.373 -0.620  1.00 30.48 ? 5    DT  P "O5'" 1 
ATOM   3773 C  "C5'" . DT  C 3 5   ? 29.749  195.353 -1.427  1.00 23.39 ? 5    DT  P "C5'" 1 
ATOM   3774 C  "C4'" . DT  C 3 5   ? 30.216  196.755 -1.776  1.00 22.34 ? 5    DT  P "C4'" 1 
ATOM   3775 O  "O4'" . DT  C 3 5   ? 29.356  197.309 -2.798  1.00 21.67 ? 5    DT  P "O4'" 1 
ATOM   3776 C  "C3'" . DT  C 3 5   ? 30.203  197.719 -0.620  1.00 23.51 ? 5    DT  P "C3'" 1 
ATOM   3777 O  "O3'" . DT  C 3 5   ? 31.476  198.409 -0.588  1.00 20.15 ? 5    DT  P "O3'" 1 
ATOM   3778 C  "C2'" . DT  C 3 5   ? 29.068  198.688 -0.948  1.00 21.49 ? 5    DT  P "C2'" 1 
ATOM   3779 C  "C1'" . DT  C 3 5   ? 29.054  198.667 -2.455  1.00 21.16 ? 5    DT  P "C1'" 1 
ATOM   3780 N  N1    . DT  C 3 5   ? 27.752  198.944 -3.059  1.00 21.28 ? 5    DT  P N1    1 
ATOM   3781 C  C2    . DT  C 3 5   ? 27.630  199.947 -4.013  1.00 20.62 ? 5    DT  P C2    1 
ATOM   3782 O  O2    . DT  C 3 5   ? 28.539  200.667 -4.368  1.00 19.74 ? 5    DT  P O2    1 
ATOM   3783 N  N3    . DT  C 3 5   ? 26.381  200.097 -4.552  1.00 19.56 ? 5    DT  P N3    1 
ATOM   3784 C  C4    . DT  C 3 5   ? 25.256  199.357 -4.247  1.00 19.53 ? 5    DT  P C4    1 
ATOM   3785 O  O4    . DT  C 3 5   ? 24.166  199.561 -4.837  1.00 21.10 ? 5    DT  P O4    1 
ATOM   3786 C  C5    . DT  C 3 5   ? 25.435  198.319 -3.218  1.00 22.78 ? 5    DT  P C5    1 
ATOM   3787 C  C7    . DT  C 3 5   ? 24.283  197.456 -2.764  1.00 24.55 ? 5    DT  P C7    1 
ATOM   3788 C  C6    . DT  C 3 5   ? 26.656  198.178 -2.663  1.00 19.81 ? 5    DT  P C6    1 
ATOM   3789 P  P     . DC  C 3 6   ? 31.811  199.376 0.657   1.00 18.96 ? 6    DC  P P     1 
ATOM   3790 O  OP1   . DC  C 3 6   ? 33.312  199.374 0.713   1.00 18.91 ? 6    DC  P OP1   1 
ATOM   3791 O  OP2   . DC  C 3 6   ? 31.036  199.043 1.816   1.00 17.97 ? 6    DC  P OP2   1 
ATOM   3792 O  "O5'" . DC  C 3 6   ? 31.361  200.822 0.191   1.00 17.76 ? 6    DC  P "O5'" 1 
ATOM   3793 C  "C5'" . DC  C 3 6   ? 31.998  201.459 -0.858  1.00 18.75 ? 6    DC  P "C5'" 1 
ATOM   3794 C  "C4'" . DC  C 3 6   ? 31.217  202.689 -1.166  1.00 21.40 ? 6    DC  P "C4'" 1 
ATOM   3795 O  "O4'" . DC  C 3 6   ? 29.953  202.303 -1.772  1.00 20.83 ? 6    DC  P "O4'" 1 
ATOM   3796 C  "C3'" . DC  C 3 6   ? 30.852  203.521 0.053   1.00 18.55 ? 6    DC  P "C3'" 1 
ATOM   3797 O  "O3'" . DC  C 3 6   ? 31.697  204.696 -0.002  1.00 19.14 ? 6    DC  P "O3'" 1 
ATOM   3798 C  "C2'" . DC  C 3 6   ? 29.347  203.872 -0.174  1.00 19.91 ? 6    DC  P "C2'" 1 
ATOM   3799 C  "C1'" . DC  C 3 6   ? 29.099  203.380 -1.622  1.00 18.88 ? 6    DC  P "C1'" 1 
ATOM   3800 N  N1    . DC  C 3 6   ? 27.750  202.909 -1.826  1.00 18.06 ? 6    DC  P N1    1 
ATOM   3801 C  C2    . DC  C 3 6   ? 26.971  203.448 -2.865  1.00 16.06 ? 6    DC  P C2    1 
ATOM   3802 O  O2    . DC  C 3 6   ? 27.443  204.292 -3.624  1.00 19.05 ? 6    DC  P O2    1 
ATOM   3803 N  N3    . DC  C 3 6   ? 25.705  203.014 -2.997  1.00 17.77 ? 6    DC  P N3    1 
ATOM   3804 C  C4    . DC  C 3 6   ? 25.220  202.104 -2.146  1.00 20.07 ? 6    DC  P C4    1 
ATOM   3805 N  N4    . DC  C 3 6   ? 23.960  201.739 -2.315  1.00 21.02 ? 6    DC  P N4    1 
ATOM   3806 C  C5    . DC  C 3 6   ? 25.989  201.529 -1.089  1.00 20.53 ? 6    DC  P C5    1 
ATOM   3807 C  C6    . DC  C 3 6   ? 27.255  201.938 -0.983  1.00 18.10 ? 6    DC  P C6    1 
ATOM   3808 P  P     . DA  C 3 7   ? 31.485  205.911 1.018   1.00 18.33 ? 7    DA  P P     1 
ATOM   3809 O  OP1   . DA  C 3 7   ? 32.790  206.589 1.107   1.00 19.18 ? 7    DA  P OP1   1 
ATOM   3810 O  OP2   . DA  C 3 7   ? 30.825  205.520 2.247   1.00 19.51 ? 7    DA  P OP2   1 
ATOM   3811 O  "O5'" . DA  C 3 7   ? 30.424  206.901 0.302   1.00 20.57 ? 7    DA  P "O5'" 1 
ATOM   3812 C  "C5'" . DA  C 3 7   ? 30.656  207.383 -0.958  1.00 23.12 ? 7    DA  P "C5'" 1 
ATOM   3813 C  "C4'" . DA  C 3 7   ? 29.347  207.943 -1.542  1.00 22.19 ? 7    DA  P "C4'" 1 
ATOM   3814 O  "O4'" . DA  C 3 7   ? 28.431  206.869 -1.712  1.00 19.40 ? 7    DA  P "O4'" 1 
ATOM   3815 C  "C3'" . DA  C 3 7   ? 28.507  208.853 -0.635  1.00 23.12 ? 7    DA  P "C3'" 1 
ATOM   3816 O  "O3'" . DA  C 3 7   ? 29.085  210.157 -0.445  1.00 27.69 ? 7    DA  P "O3'" 1 
ATOM   3817 C  "C2'" . DA  C 3 7   ? 27.188  208.871 -1.372  1.00 20.02 ? 7    DA  P "C2'" 1 
ATOM   3818 C  "C1'" . DA  C 3 7   ? 27.155  207.487 -1.944  1.00 22.95 ? 7    DA  P "C1'" 1 
ATOM   3819 N  N9    . DA  C 3 7   ? 26.123  206.664 -1.398  1.00 20.01 ? 7    DA  P N9    1 
ATOM   3820 C  C8    . DA  C 3 7   ? 26.215  205.708 -0.434  1.00 20.51 ? 7    DA  P C8    1 
ATOM   3821 N  N7    . DA  C 3 7   ? 25.104  205.053 -0.224  1.00 19.88 ? 7    DA  P N7    1 
ATOM   3822 C  C5    . DA  C 3 7   ? 24.209  205.650 -1.109  1.00 19.41 ? 7    DA  P C5    1 
ATOM   3823 C  C6    . DA  C 3 7   ? 22.860  205.432 -1.368  1.00 20.75 ? 7    DA  P C6    1 
ATOM   3824 N  N6    . DA  C 3 7   ? 22.146  204.502 -0.765  1.00 21.91 ? 7    DA  P N6    1 
ATOM   3825 N  N1    . DA  C 3 7   ? 22.289  206.211 -2.307  1.00 18.26 ? 7    DA  P N1    1 
ATOM   3826 C  C2    . DA  C 3 7   ? 23.001  207.170 -2.897  1.00 18.31 ? 7    DA  P C2    1 
ATOM   3827 N  N3    . DA  C 3 7   ? 24.299  207.460 -2.736  1.00 18.16 ? 7    DA  P N3    1 
ATOM   3828 C  C4    . DA  C 3 7   ? 24.822  206.676 -1.806  1.00 19.30 ? 7    DA  P C4    1 
ATOM   3829 P  P     A DT  C 3 8   ? 28.348  211.219 0.503   0.65 23.30 ? 8    DT  P P     1 
ATOM   3830 P  P     B DT  C 3 8   ? 29.249  211.354 -1.548  0.35 23.77 ? 8    DT  P P     1 
ATOM   3831 O  OP1   A DT  C 3 8   ? 29.356  212.306 0.542   0.65 24.83 ? 8    DT  P OP1   1 
ATOM   3832 O  OP1   B DT  C 3 8   ? 29.422  210.715 -2.877  0.35 30.48 ? 8    DT  P OP1   1 
ATOM   3833 O  OP2   A DT  C 3 8   ? 27.821  210.559 1.729   0.65 23.51 ? 8    DT  P OP2   1 
ATOM   3834 O  OP2   B DT  C 3 8   ? 30.252  212.199 -0.914  0.35 25.65 ? 8    DT  P OP2   1 
ATOM   3835 O  "O5'" A DT  C 3 8   ? 27.084  211.748 -0.310  0.65 21.97 ? 8    DT  P "O5'" 1 
ATOM   3836 O  "O5'" B DT  C 3 8   ? 27.843  212.131 -1.493  0.35 22.29 ? 8    DT  P "O5'" 1 
ATOM   3837 C  "C5'" A DT  C 3 8   ? 27.239  212.422 -1.516  0.65 21.65 ? 8    DT  P "C5'" 1 
ATOM   3838 C  "C5'" B DT  C 3 8   ? 27.203  212.561 -2.670  0.35 19.94 ? 8    DT  P "C5'" 1 
ATOM   3839 C  "C4'" A DT  C 3 8   ? 25.886  212.894 -1.930  0.65 19.09 ? 8    DT  P "C4'" 1 
ATOM   3840 C  "C4'" B DT  C 3 8   ? 25.762  213.002 -2.364  0.35 18.77 ? 8    DT  P "C4'" 1 
ATOM   3841 O  "O4'" A DT  C 3 8   ? 25.029  211.743 -1.911  0.65 19.13 ? 8    DT  P "O4'" 1 
ATOM   3842 O  "O4'" B DT  C 3 8   ? 24.935  211.846 -2.173  0.35 19.56 ? 8    DT  P "O4'" 1 
ATOM   3843 C  "C3'" A DT  C 3 8   ? 25.283  213.917 -0.971  0.65 19.81 ? 8    DT  P "C3'" 1 
ATOM   3844 C  "C3'" B DT  C 3 8   ? 25.582  213.864 -1.104  0.35 19.81 ? 8    DT  P "C3'" 1 
ATOM   3845 O  "O3'" A DT  C 3 8   ? 24.762  215.025 -1.737  0.65 17.83 ? 8    DT  P "O3'" 1 
ATOM   3846 O  "O3'" B DT  C 3 8   ? 25.179  215.206 -1.490  0.35 17.07 ? 8    DT  P "O3'" 1 
ATOM   3847 C  "C2'" A DT  C 3 8   ? 24.193  213.129 -0.226  0.65 19.56 ? 8    DT  P "C2'" 1 
ATOM   3848 C  "C2'" B DT  C 3 8   ? 24.479  213.137 -0.294  0.35 19.44 ? 8    DT  P "C2'" 1 
ATOM   3849 C  "C1'" A DT  C 3 8   ? 23.828  212.047 -1.219  0.65 19.76 ? 8    DT  P "C1'" 1 
ATOM   3850 C  "C1'" B DT  C 3 8   ? 23.865  212.198 -1.325  0.35 19.67 ? 8    DT  P "C1'" 1 
ATOM   3851 N  N1    A DT  C 3 8   ? 23.353  210.800 -0.576  0.65 17.54 ? 8    DT  P N1    1 
ATOM   3852 N  N1    B DT  C 3 8   ? 23.293  210.949 -0.740  0.35 18.02 ? 8    DT  P N1    1 
ATOM   3853 C  C2    A DT  C 3 8   ? 22.074  210.362 -0.850  0.65 17.88 ? 8    DT  P C2    1 
ATOM   3854 C  C2    B DT  C 3 8   ? 22.005  210.576 -1.074  0.35 18.12 ? 8    DT  P C2    1 
ATOM   3855 O  O2    A DT  C 3 8   ? 21.302  210.975 -1.561  0.65 19.54 ? 8    DT  P O2    1 
ATOM   3856 O  O2    B DT  C 3 8   ? 21.287  211.232 -1.819  0.35 19.35 ? 8    DT  P O2    1 
ATOM   3857 N  N3    A DT  C 3 8   ? 21.730  209.185 -0.238  0.65 17.88 ? 8    DT  P N3    1 
ATOM   3858 N  N3    B DT  C 3 8   ? 21.582  209.404 -0.495  0.35 18.21 ? 8    DT  P N3    1 
ATOM   3859 C  C4    A DT  C 3 8   ? 22.524  208.438 0.609   0.65 18.50 ? 8    DT  P C4    1 
ATOM   3860 C  C4    B DT  C 3 8   ? 22.297  208.602 0.371   0.35 18.52 ? 8    DT  P C4    1 
ATOM   3861 O  O4    A DT  C 3 8   ? 22.137  207.401 1.129   0.65 17.90 ? 8    DT  P O4    1 
ATOM   3862 O  O4    B DT  C 3 8   ? 21.834  207.573 0.844   0.35 18.01 ? 8    DT  P O4    1 
ATOM   3863 C  C5    A DT  C 3 8   ? 23.829  208.972 0.866   0.65 18.63 ? 8    DT  P C5    1 
ATOM   3864 C  C5    B DT  C 3 8   ? 23.625  209.059 0.687   0.35 18.71 ? 8    DT  P C5    1 
ATOM   3865 C  C7    A DT  C 3 8   ? 24.770  208.228 1.756   0.65 20.25 ? 8    DT  P C7    1 
ATOM   3866 C  C7    B DT  C 3 8   ? 24.490  208.258 1.612   0.35 20.02 ? 8    DT  P C7    1 
ATOM   3867 C  C6    A DT  C 3 8   ? 24.177  210.112 0.257   0.65 16.60 ? 8    DT  P C6    1 
ATOM   3868 C  C6    B DT  C 3 8   ? 24.054  210.197 0.120   0.35 16.74 ? 8    DT  P C6    1 
HETATM 3869 P  PG    . 0KX D 4 .   ? 25.487  220.355 3.594   1.00 14.59 ? 501  0KX A PG    1 
HETATM 3870 O  O1G   . 0KX D 4 .   ? 25.972  219.904 2.242   1.00 14.78 ? 501  0KX A O1G   1 
HETATM 3871 O  O2G   . 0KX D 4 .   ? 26.153  219.558 4.736   1.00 15.15 ? 501  0KX A O2G   1 
HETATM 3872 O  O3G   . 0KX D 4 .   ? 25.568  221.824 3.790   1.00 14.74 ? 501  0KX A O3G   1 
HETATM 3873 P  PB    . 0KX D 4 .   ? 23.045  219.217 2.508   1.00 13.23 ? 501  0KX A PB    1 
HETATM 3874 O  O1B   . 0KX D 4 .   ? 23.249  219.890 1.169   1.00 13.25 ? 501  0KX A O1B   1 
HETATM 3875 O  O2B   . 0KX D 4 .   ? 21.634  219.197 3.032   1.00 12.59 ? 501  0KX A O2B   1 
HETATM 3876 O  O3B   . 0KX D 4 .   ? 23.895  219.968 3.616   1.00 13.65 ? 501  0KX A O3B   1 
HETATM 3877 P  PA    . 0KX D 4 .   ? 24.223  216.830 1.183   1.00 15.18 ? 501  0KX A PA    1 
HETATM 3878 O  O1A   . 0KX D 4 .   ? 24.782  215.526 1.728   1.00 19.81 ? 501  0KX A O1A   1 
HETATM 3879 O  O2A   . 0KX D 4 .   ? 25.090  217.599 0.292   1.00 15.41 ? 501  0KX A O2A   1 
HETATM 3880 N  N3A   . 0KX D 4 .   ? 23.671  217.669 2.545   1.00 13.84 ? 501  0KX A N3A   1 
HETATM 3881 O  "O5'" . 0KX D 4 .   ? 22.903  216.367 0.424   1.00 14.54 ? 501  0KX A "O5'" 1 
HETATM 3882 C  "C5'" . 0KX D 4 .   ? 22.198  217.233 -0.497  1.00 13.37 ? 501  0KX A "C5'" 1 
HETATM 3883 C  "C4'" . 0KX D 4 .   ? 20.749  217.069 -0.412  1.00 14.49 ? 501  0KX A "C4'" 1 
HETATM 3884 O  "O4'" . 0KX D 4 .   ? 20.416  215.608 -0.757  1.00 15.24 ? 501  0KX A "O4'" 1 
HETATM 3885 C  "C3'" . 0KX D 4 .   ? 20.101  217.215 0.982   1.00 13.13 ? 501  0KX A "C3'" 1 
HETATM 3886 O  "O3'" . 0KX D 4 .   ? 19.754  218.629 1.213   1.00 14.41 ? 501  0KX A "O3'" 1 
HETATM 3887 C  "C2'" . 0KX D 4 .   ? 18.971  216.405 0.945   1.00 16.10 ? 501  0KX A "C2'" 1 
HETATM 3888 C  "C1'" . 0KX D 4 .   ? 19.391  215.174 0.001   1.00 15.17 ? 501  0KX A "C1'" 1 
HETATM 3889 N  N1    . 0KX D 4 .   ? 19.815  214.041 0.759   1.00 14.64 ? 501  0KX A N1    1 
HETATM 3890 C  C2    . 0KX D 4 .   ? 18.891  212.977 0.908   1.00 16.50 ? 501  0KX A C2    1 
HETATM 3891 N  N3    . 0KX D 4 .   ? 19.355  211.834 1.605   1.00 17.31 ? 501  0KX A N3    1 
HETATM 3892 C  C4    . 0KX D 4 .   ? 20.644  211.749 2.117   1.00 15.30 ? 501  0KX A C4    1 
HETATM 3893 C  C5    . 0KX D 4 .   ? 21.589  212.806 1.924   1.00 19.21 ? 501  0KX A C5    1 
HETATM 3894 C  C6    . 0KX D 4 .   ? 21.127  213.957 1.215   1.00 16.54 ? 501  0KX A C6    1 
HETATM 3895 O  O2    . 0KX D 4 .   ? 17.711  213.100 0.494   1.00 16.94 ? 501  0KX A O2    1 
HETATM 3896 N  N4    . 0KX D 4 .   ? 21.008  210.559 2.780   1.00 17.22 ? 501  0KX A N4    1 
HETATM 3897 MG MG    . MG  E 5 .   ? 25.185  219.822 0.227   1.00 11.01 ? 502  MG  A MG    1 
HETATM 3898 MG MG    . MG  F 5 .   ? 26.227  216.964 -1.514  1.00 16.23 ? 503  MG  A MG    1 
HETATM 3899 C  C1    . GOL G 6 .   ? 51.686  210.708 8.682   1.00 14.14 ? 504  GOL A C1    1 
HETATM 3900 O  O1    . GOL G 6 .   ? 51.092  209.444 8.539   1.00 18.43 ? 504  GOL A O1    1 
HETATM 3901 C  C2    . GOL G 6 .   ? 51.688  211.541 7.370   1.00 16.62 ? 504  GOL A C2    1 
HETATM 3902 O  O2    . GOL G 6 .   ? 50.326  211.866 7.011   1.00 15.67 ? 504  GOL A O2    1 
HETATM 3903 C  C3    . GOL G 6 .   ? 52.333  210.861 6.132   1.00 17.55 ? 504  GOL A C3    1 
HETATM 3904 O  O3    . GOL G 6 .   ? 52.375  211.805 5.024   1.00 18.31 ? 504  GOL A O3    1 
HETATM 3905 O  O     . HOH H 7 .   ? 7.058   225.223 9.566   1.00 20.81 ? 601  HOH A O     1 
HETATM 3906 O  O     . HOH H 7 .   ? 8.840   226.404 1.288   1.00 20.26 ? 602  HOH A O     1 
HETATM 3907 O  O     . HOH H 7 .   ? 27.425  216.220 0.116   1.00 20.19 ? 603  HOH A O     1 
HETATM 3908 O  O     . HOH H 7 .   ? 28.047  218.088 2.039   1.00 20.97 ? 604  HOH A O     1 
HETATM 3909 O  O     . HOH H 7 .   ? 30.554  218.374 0.313   1.00 29.14 ? 605  HOH A O     1 
HETATM 3910 O  O     . HOH H 7 .   ? 20.994  218.821 5.563   1.00 17.31 ? 606  HOH A O     1 
HETATM 3911 O  O     . HOH H 7 .   ? 21.684  213.179 -4.694  1.00 20.49 ? 607  HOH A O     1 
HETATM 3912 O  O     . HOH H 7 .   ? 31.028  213.800 -4.461  1.00 24.65 ? 608  HOH A O     1 
HETATM 3913 O  O     . HOH H 7 .   ? 23.628  210.850 4.079   1.00 24.58 ? 609  HOH A O     1 
HETATM 3914 O  O     . HOH H 7 .   ? 13.724  208.945 9.995   1.00 32.82 ? 610  HOH A O     1 
HETATM 3915 O  O     . HOH H 7 .   ? 12.849  203.982 -1.651  1.00 21.27 ? 611  HOH A O     1 
HETATM 3916 O  O     . HOH H 7 .   ? 20.733  197.314 -16.370 1.00 45.16 ? 612  HOH A O     1 
HETATM 3917 O  O     . HOH H 7 .   ? 35.222  201.585 -2.387  1.00 23.61 ? 613  HOH A O     1 
HETATM 3918 O  O     . HOH H 7 .   ? 37.173  201.074 -4.073  1.00 32.28 ? 614  HOH A O     1 
HETATM 3919 O  O     . HOH H 7 .   ? 36.005  196.507 -5.095  1.00 39.60 ? 615  HOH A O     1 
HETATM 3920 O  O     . HOH H 7 .   ? 36.303  196.998 -2.762  1.00 33.82 ? 616  HOH A O     1 
HETATM 3921 O  O     . HOH H 7 .   ? 40.691  196.061 -6.175  1.00 23.00 ? 617  HOH A O     1 
HETATM 3922 O  O     . HOH H 7 .   ? 41.486  194.746 -8.575  1.00 26.04 ? 618  HOH A O     1 
HETATM 3923 O  O     . HOH H 7 .   ? 25.085  217.240 5.520   1.00 24.75 ? 619  HOH A O     1 
HETATM 3924 O  O     . HOH H 7 .   ? 34.140  215.212 2.920   1.00 24.46 ? 620  HOH A O     1 
HETATM 3925 O  O     . HOH H 7 .   ? 35.396  213.184 1.774   1.00 24.10 ? 621  HOH A O     1 
HETATM 3926 O  O     . HOH H 7 .   ? 33.112  211.463 1.029   1.00 29.99 ? 622  HOH A O     1 
HETATM 3927 O  O     . HOH H 7 .   ? 34.091  213.106 4.910   1.00 35.65 ? 623  HOH A O     1 
HETATM 3928 O  O     . HOH H 7 .   ? 35.355  217.406 4.484   1.00 23.31 ? 624  HOH A O     1 
HETATM 3929 O  O     . HOH H 7 .   ? 33.458  208.737 3.050   1.00 27.79 ? 625  HOH A O     1 
HETATM 3930 O  O     . HOH H 7 .   ? 31.614  206.006 7.423   1.00 30.69 ? 626  HOH A O     1 
HETATM 3931 O  O     . HOH H 7 .   ? 32.670  208.445 6.710   1.00 30.44 ? 627  HOH A O     1 
HETATM 3932 O  O     . HOH H 7 .   ? 32.634  209.608 9.045   1.00 31.31 ? 628  HOH A O     1 
HETATM 3933 O  O     . HOH H 7 .   ? 30.371  208.313 10.185  1.00 50.01 ? 629  HOH A O     1 
HETATM 3934 O  O     . HOH H 7 .   ? 34.870  202.813 6.716   1.00 21.19 ? 630  HOH A O     1 
HETATM 3935 O  O     . HOH H 7 .   ? 34.556  201.625 1.942   1.00 17.51 ? 631  HOH A O     1 
HETATM 3936 O  O     . HOH H 7 .   ? 37.986  205.726 9.911   1.00 23.10 ? 632  HOH A O     1 
HETATM 3937 O  O     . HOH H 7 .   ? 40.040  205.864 11.772  1.00 20.42 ? 633  HOH A O     1 
HETATM 3938 O  O     . HOH H 7 .   ? 36.207  204.151 11.045  1.00 30.83 ? 634  HOH A O     1 
HETATM 3939 O  O     . HOH H 7 .   ? 37.685  206.464 14.767  1.00 33.45 ? 635  HOH A O     1 
HETATM 3940 O  O     . HOH H 7 .   ? 39.442  203.925 13.613  1.00 32.75 ? 636  HOH A O     1 
HETATM 3941 O  O     . HOH H 7 .   ? 13.564  211.355 -0.488  1.00 18.64 ? 637  HOH A O     1 
HETATM 3942 O  O     . HOH H 7 .   ? 5.953   214.359 2.394   1.00 27.57 ? 638  HOH A O     1 
HETATM 3943 O  O     . HOH H 7 .   ? 9.046   218.389 -5.126  1.00 17.99 ? 639  HOH A O     1 
HETATM 3944 O  O     . HOH H 7 .   ? 8.743   219.310 -2.429  1.00 17.94 ? 640  HOH A O     1 
HETATM 3945 O  O     . HOH H 7 .   ? 6.598   221.114 -2.196  1.00 26.73 ? 641  HOH A O     1 
HETATM 3946 O  O     . HOH H 7 .   ? 4.805   220.391 0.172   1.00 30.67 ? 642  HOH A O     1 
HETATM 3947 O  O     . HOH H 7 .   ? 7.244   222.520 1.106   1.00 26.49 ? 643  HOH A O     1 
HETATM 3948 O  O     . HOH H 7 .   ? 5.601   222.308 3.709   1.00 25.54 ? 644  HOH A O     1 
HETATM 3949 O  O     . HOH H 7 .   ? 5.715   223.866 -0.689  1.00 32.53 ? 645  HOH A O     1 
HETATM 3950 O  O     . HOH H 7 .   ? 7.114   219.605 -7.046  1.00 32.43 ? 646  HOH A O     1 
HETATM 3951 O  O     . HOH H 7 .   ? 11.233  214.637 -10.825 1.00 22.65 ? 647  HOH A O     1 
HETATM 3952 O  O     . HOH H 7 .   ? 4.782   210.899 -7.718  1.00 30.22 ? 648  HOH A O     1 
HETATM 3953 O  O     . HOH H 7 .   ? 54.255  232.905 3.660   1.00 33.82 ? 649  HOH A O     1 
HETATM 3954 O  O     . HOH H 7 .   ? 46.360  224.123 1.388   1.00 15.33 ? 650  HOH A O     1 
HETATM 3955 O  O     . HOH H 7 .   ? 50.115  222.446 5.927   1.00 19.60 ? 651  HOH A O     1 
HETATM 3956 O  O     . HOH H 7 .   ? 48.022  220.784 6.031   1.00 17.97 ? 652  HOH A O     1 
HETATM 3957 O  O     . HOH H 7 .   ? 46.072  220.361 7.890   1.00 22.17 ? 653  HOH A O     1 
HETATM 3958 O  O     . HOH H 7 .   ? 51.901  222.565 -2.432  1.00 19.65 ? 654  HOH A O     1 
HETATM 3959 O  O     . HOH H 7 .   ? 49.917  221.967 -4.959  1.00 16.45 ? 655  HOH A O     1 
HETATM 3960 O  O     . HOH H 7 .   ? 48.173  216.202 -5.238  1.00 19.51 ? 656  HOH A O     1 
HETATM 3961 O  O     . HOH H 7 .   ? 52.719  216.208 -0.383  1.00 17.75 ? 657  HOH A O     1 
HETATM 3962 O  O     . HOH H 7 .   ? 54.598  217.708 0.939   1.00 18.43 ? 658  HOH A O     1 
HETATM 3963 O  O     . HOH H 7 .   ? 58.639  217.194 -0.154  1.00 22.08 ? 659  HOH A O     1 
HETATM 3964 O  O     . HOH H 7 .   ? 56.554  215.835 1.465   1.00 24.20 ? 660  HOH A O     1 
HETATM 3965 O  O     . HOH H 7 .   ? 56.130  214.102 -0.569  1.00 29.68 ? 661  HOH A O     1 
HETATM 3966 O  O     . HOH H 7 .   ? 55.466  214.889 -3.052  1.00 31.74 ? 662  HOH A O     1 
HETATM 3967 O  O     . HOH H 7 .   ? 14.421  201.948 -0.423  1.00 28.28 ? 663  HOH A O     1 
HETATM 3968 O  O     . HOH H 7 .   ? 14.503  209.983 15.488  1.00 25.19 ? 664  HOH A O     1 
HETATM 3969 O  O     . HOH H 7 .   ? 26.715  215.215 5.153   1.00 42.18 ? 665  HOH A O     1 
HETATM 3970 O  O     . HOH H 7 .   ? 20.976  215.814 4.292   1.00 27.68 ? 666  HOH A O     1 
HETATM 3971 O  O     . HOH H 7 .   ? 18.682  229.338 7.736   1.00 27.48 ? 667  HOH A O     1 
HETATM 3972 O  O     . HOH H 7 .   ? 24.999  228.749 3.462   1.00 17.51 ? 668  HOH A O     1 
HETATM 3973 O  O     . HOH H 7 .   ? 18.043  231.322 4.995   1.00 27.88 ? 669  HOH A O     1 
HETATM 3974 O  O     . HOH H 7 .   ? 20.113  228.087 5.001   1.00 21.40 ? 670  HOH A O     1 
HETATM 3975 O  O     . HOH H 7 .   ? 21.471  227.395 7.280   1.00 17.51 ? 671  HOH A O     1 
HETATM 3976 O  O     . HOH H 7 .   ? 23.913  228.460 6.231   1.00 31.28 ? 672  HOH A O     1 
HETATM 3977 O  O     . HOH H 7 .   ? 17.285  232.580 -1.127  1.00 29.29 ? 673  HOH A O     1 
HETATM 3978 O  O     . HOH H 7 .   ? 21.582  233.909 -0.459  1.00 27.45 ? 674  HOH A O     1 
HETATM 3979 O  O     . HOH H 7 .   ? 25.728  232.128 5.313   1.00 31.87 ? 675  HOH A O     1 
HETATM 3980 O  O     . HOH H 7 .   ? 18.412  234.904 3.769   1.00 39.42 ? 676  HOH A O     1 
HETATM 3981 O  O     . HOH H 7 .   ? 17.528  232.550 2.282   1.00 35.38 ? 677  HOH A O     1 
HETATM 3982 O  O     . HOH H 7 .   ? 21.166  231.329 2.077   1.00 38.47 ? 678  HOH A O     1 
HETATM 3983 O  O     . HOH H 7 .   ? 25.351  235.204 4.043   1.00 42.81 ? 679  HOH A O     1 
HETATM 3984 O  O     . HOH H 7 .   ? 17.727  230.196 -0.268  1.00 33.02 ? 680  HOH A O     1 
HETATM 3985 O  O     . HOH H 7 .   ? 26.681  230.156 -4.081  1.00 22.33 ? 681  HOH A O     1 
HETATM 3986 O  O     . HOH H 7 .   ? 30.958  233.150 0.301   1.00 23.17 ? 682  HOH A O     1 
HETATM 3987 O  O     . HOH H 7 .   ? 27.854  230.666 -1.417  1.00 24.00 ? 683  HOH A O     1 
HETATM 3988 O  O     . HOH H 7 .   ? 28.086  234.770 0.167   1.00 35.97 ? 684  HOH A O     1 
HETATM 3989 O  O     . HOH H 7 .   ? 30.262  235.910 3.634   1.00 35.79 ? 685  HOH A O     1 
HETATM 3990 O  O     . HOH H 7 .   ? 32.832  236.946 -4.779  1.00 33.30 ? 686  HOH A O     1 
HETATM 3991 O  O     . HOH H 7 .   ? 32.661  234.329 -4.012  1.00 22.37 ? 687  HOH A O     1 
HETATM 3992 O  O     . HOH H 7 .   ? 30.420  233.646 -2.596  1.00 33.91 ? 688  HOH A O     1 
HETATM 3993 O  O     . HOH H 7 .   ? 36.662  241.250 -2.130  1.00 39.08 ? 689  HOH A O     1 
HETATM 3994 O  O     . HOH H 7 .   ? 40.084  238.073 1.522   1.00 23.00 ? 690  HOH A O     1 
HETATM 3995 O  O     . HOH H 7 .   ? 36.077  238.459 3.060   1.00 32.88 ? 691  HOH A O     1 
HETATM 3996 O  O     . HOH H 7 .   ? 34.930  235.395 4.377   1.00 32.20 ? 692  HOH A O     1 
HETATM 3997 O  O     . HOH H 7 .   ? 42.507  242.576 -8.057  1.00 43.40 ? 693  HOH A O     1 
HETATM 3998 O  O     . HOH H 7 .   ? 46.686  240.817 -1.201  1.00 33.95 ? 694  HOH A O     1 
HETATM 3999 O  O     . HOH H 7 .   ? 51.102  239.910 4.226   1.00 42.98 ? 695  HOH A O     1 
HETATM 4000 O  O     . HOH H 7 .   ? 43.603  201.875 -9.261  1.00 29.03 ? 696  HOH A O     1 
HETATM 4001 O  O     . HOH H 7 .   ? 47.489  198.726 -10.852 1.00 34.17 ? 697  HOH A O     1 
HETATM 4002 O  O     . HOH H 7 .   ? 49.475  203.472 -7.422  1.00 27.38 ? 698  HOH A O     1 
HETATM 4003 O  O     . HOH H 7 .   ? 44.101  206.903 -8.645  1.00 28.57 ? 699  HOH A O     1 
HETATM 4004 O  O     . HOH H 7 .   ? 44.431  207.290 -6.130  1.00 18.94 ? 700  HOH A O     1 
HETATM 4005 O  O     . HOH H 7 .   ? 51.330  205.786 -7.591  1.00 38.24 ? 701  HOH A O     1 
HETATM 4006 O  O     . HOH H 7 .   ? 56.142  206.598 -4.478  1.00 39.51 ? 702  HOH A O     1 
HETATM 4007 O  O     . HOH H 7 .   ? 54.230  208.101 -5.903  1.00 39.27 ? 703  HOH A O     1 
HETATM 4008 O  O     . HOH H 7 .   ? 55.427  197.330 -4.285  1.00 22.38 ? 704  HOH A O     1 
HETATM 4009 O  O     . HOH H 7 .   ? 55.651  200.206 -3.825  1.00 25.62 ? 705  HOH A O     1 
HETATM 4010 O  O     . HOH H 7 .   ? 53.329  195.813 -7.118  1.00 34.80 ? 706  HOH A O     1 
HETATM 4011 O  O     . HOH H 7 .   ? 51.635  203.301 0.550   1.00 16.42 ? 707  HOH A O     1 
HETATM 4012 O  O     . HOH H 7 .   ? 56.597  202.994 1.275   1.00 35.57 ? 708  HOH A O     1 
HETATM 4013 O  O     . HOH H 7 .   ? 56.491  198.107 4.010   1.00 32.37 ? 709  HOH A O     1 
HETATM 4014 O  O     . HOH H 7 .   ? 51.085  194.191 4.977   1.00 37.81 ? 710  HOH A O     1 
HETATM 4015 O  O     . HOH H 7 .   ? 54.901  196.204 6.603   1.00 40.75 ? 711  HOH A O     1 
HETATM 4016 O  O     . HOH H 7 .   ? 50.310  196.429 9.678   1.00 37.52 ? 712  HOH A O     1 
HETATM 4017 O  O     . HOH H 7 .   ? 37.573  198.226 11.210  1.00 30.67 ? 713  HOH A O     1 
HETATM 4018 O  O     . HOH H 7 .   ? 41.181  201.869 14.806  1.00 34.20 ? 714  HOH A O     1 
HETATM 4019 O  O     . HOH H 7 .   ? 40.510  198.137 14.861  1.00 40.90 ? 715  HOH A O     1 
HETATM 4020 O  O     . HOH H 7 .   ? 36.838  194.606 8.594   1.00 35.62 ? 716  HOH A O     1 
HETATM 4021 O  O     . HOH H 7 .   ? 34.930  195.381 6.659   1.00 29.36 ? 717  HOH A O     1 
HETATM 4022 O  O     . HOH H 7 .   ? 45.096  201.478 15.644  1.00 35.51 ? 718  HOH A O     1 
HETATM 4023 O  O     . HOH H 7 .   ? 44.805  212.520 16.112  1.00 25.30 ? 719  HOH A O     1 
HETATM 4024 O  O     . HOH H 7 .   ? 42.387  212.665 14.441  1.00 28.69 ? 720  HOH A O     1 
HETATM 4025 O  O     . HOH H 7 .   ? 35.390  227.445 9.058   1.00 32.37 ? 721  HOH A O     1 
HETATM 4026 O  O     . HOH H 7 .   ? 39.481  226.189 9.007   1.00 29.50 ? 722  HOH A O     1 
HETATM 4027 O  O     . HOH H 7 .   ? 42.379  221.153 9.339   1.00 42.90 ? 723  HOH A O     1 
HETATM 4028 O  O     . HOH H 7 .   ? 41.120  218.940 9.450   1.00 44.16 ? 724  HOH A O     1 
HETATM 4029 O  O     . HOH H 7 .   ? 40.968  225.319 6.153   1.00 25.50 ? 725  HOH A O     1 
HETATM 4030 O  O     . HOH H 7 .   ? 41.332  228.639 10.005  1.00 34.19 ? 726  HOH A O     1 
HETATM 4031 O  O     . HOH H 7 .   ? 42.929  229.622 7.968   1.00 22.16 ? 727  HOH A O     1 
HETATM 4032 O  O     . HOH H 7 .   ? 43.166  230.625 5.230   1.00 18.14 ? 728  HOH A O     1 
HETATM 4033 O  O     . HOH H 7 .   ? 34.972  224.836 2.402   1.00 14.88 ? 729  HOH A O     1 
HETATM 4034 O  O     . HOH H 7 .   ? 46.583  217.401 11.364  1.00 31.88 ? 730  HOH A O     1 
HETATM 4035 O  O     . HOH H 7 .   ? 51.681  219.054 5.173   1.00 15.58 ? 731  HOH A O     1 
HETATM 4036 O  O     . HOH H 7 .   ? 33.081  210.833 -8.791  1.00 31.32 ? 732  HOH A O     1 
HETATM 4037 O  O     . HOH H 7 .   ? 34.623  211.226 -6.744  1.00 33.67 ? 733  HOH A O     1 
HETATM 4038 O  O     . HOH H 7 .   ? 37.208  210.335 -7.412  1.00 33.80 ? 734  HOH A O     1 
HETATM 4039 O  O     . HOH H 7 .   ? 32.868  209.155 -11.983 1.00 31.93 ? 735  HOH A O     1 
HETATM 4040 O  O     . HOH H 7 .   ? 37.204  212.582 -0.208  1.00 17.55 ? 736  HOH A O     1 
HETATM 4041 O  O     . HOH H 7 .   ? 40.351  212.789 -9.373  1.00 18.37 ? 737  HOH A O     1 
HETATM 4042 O  O     . HOH H 7 .   ? 39.886  215.511 -14.990 1.00 21.07 ? 738  HOH A O     1 
HETATM 4043 O  O     . HOH H 7 .   ? 35.566  219.845 -16.392 1.00 30.43 ? 739  HOH A O     1 
HETATM 4044 O  O     . HOH H 7 .   ? 37.133  216.816 -17.602 1.00 30.18 ? 740  HOH A O     1 
HETATM 4045 O  O     . HOH H 7 .   ? 28.048  216.648 -20.729 1.00 42.85 ? 741  HOH A O     1 
HETATM 4046 O  O     . HOH H 7 .   ? 28.507  220.816 -18.401 1.00 32.77 ? 742  HOH A O     1 
HETATM 4047 O  O     . HOH H 7 .   ? 28.855  218.241 -18.466 1.00 30.89 ? 743  HOH A O     1 
HETATM 4048 O  O     . HOH H 7 .   ? 20.375  220.994 -18.354 1.00 33.12 ? 744  HOH A O     1 
HETATM 4049 O  O     . HOH H 7 .   ? 21.710  220.571 -15.950 1.00 31.17 ? 745  HOH A O     1 
HETATM 4050 O  O     . HOH H 7 .   ? 21.835  220.377 -20.438 1.00 44.17 ? 746  HOH A O     1 
HETATM 4051 O  O     . HOH H 7 .   ? 21.424  218.087 -14.495 1.00 26.34 ? 747  HOH A O     1 
HETATM 4052 O  O     . HOH H 7 .   ? 20.809  217.959 -11.879 1.00 24.32 ? 748  HOH A O     1 
HETATM 4053 O  O     . HOH H 7 .   ? 23.936  223.655 -19.389 1.00 36.09 ? 749  HOH A O     1 
HETATM 4054 O  O     . HOH H 7 .   ? 17.532  217.821 -17.148 1.00 32.02 ? 750  HOH A O     1 
HETATM 4055 O  O     . HOH H 7 .   ? 18.755  216.646 -15.372 1.00 27.74 ? 751  HOH A O     1 
HETATM 4056 O  O     . HOH H 7 .   ? 14.778  218.110 -13.159 1.00 35.92 ? 752  HOH A O     1 
HETATM 4057 O  O     . HOH H 7 .   ? 15.130  224.200 -13.425 1.00 22.19 ? 753  HOH A O     1 
HETATM 4058 O  O     . HOH H 7 .   ? 14.314  222.015 -15.009 1.00 36.28 ? 754  HOH A O     1 
HETATM 4059 O  O     . HOH H 7 .   ? 20.650  231.855 -14.303 1.00 28.41 ? 755  HOH A O     1 
HETATM 4060 O  O     . HOH H 7 .   ? 26.178  236.114 -12.153 1.00 28.15 ? 756  HOH A O     1 
HETATM 4061 O  O     . HOH H 7 .   ? 23.148  229.532 -17.194 1.00 33.06 ? 757  HOH A O     1 
HETATM 4062 O  O     . HOH H 7 .   ? 46.258  213.922 -8.246  1.00 16.40 ? 758  HOH A O     1 
HETATM 4063 O  O     . HOH H 7 .   ? 22.743  217.231 6.896   1.00 25.10 ? 759  HOH A O     1 
HETATM 4064 O  O     . HOH H 7 .   ? 38.669  224.417 -17.470 1.00 24.63 ? 760  HOH A O     1 
HETATM 4065 O  O     . HOH H 7 .   ? 40.293  221.640 -18.075 1.00 25.23 ? 761  HOH A O     1 
HETATM 4066 O  O     . HOH H 7 .   ? 36.622  225.666 -18.654 1.00 28.79 ? 762  HOH A O     1 
HETATM 4067 O  O     . HOH H 7 .   ? 56.241  194.469 -1.012  1.00 25.48 ? 763  HOH A O     1 
HETATM 4068 O  O     . HOH H 7 .   ? 56.739  192.454 0.960   1.00 32.26 ? 764  HOH A O     1 
HETATM 4069 O  O     . HOH H 7 .   ? 13.374  213.530 -13.628 1.00 26.27 ? 765  HOH A O     1 
HETATM 4070 O  O     . HOH H 7 .   ? 12.475  214.480 -15.976 1.00 27.71 ? 766  HOH A O     1 
HETATM 4071 O  O     . HOH H 7 .   ? 17.093  216.166 -13.201 1.00 28.84 ? 767  HOH A O     1 
HETATM 4072 O  O     . HOH H 7 .   ? 18.388  217.200 -11.371 1.00 29.10 ? 768  HOH A O     1 
HETATM 4073 O  O     . HOH H 7 .   ? 16.105  213.605 -13.886 1.00 28.46 ? 769  HOH A O     1 
HETATM 4074 O  O     . HOH H 7 .   ? 20.861  228.040 16.087  1.00 27.85 ? 770  HOH A O     1 
HETATM 4075 O  O     . HOH H 7 .   ? 51.031  203.071 11.659  1.00 25.58 ? 771  HOH A O     1 
HETATM 4076 O  O     . HOH H 7 .   ? 51.289  201.179 12.481  1.00 36.38 ? 772  HOH A O     1 
HETATM 4077 O  O     . HOH H 7 .   ? 47.711  203.295 14.221  1.00 28.47 ? 773  HOH A O     1 
HETATM 4078 O  O     . HOH H 7 .   ? 43.326  207.097 18.406  1.00 30.96 ? 774  HOH A O     1 
HETATM 4079 O  O     . HOH H 7 .   ? 23.678  211.160 -18.697 1.00 29.95 ? 775  HOH A O     1 
HETATM 4080 O  O     . HOH H 7 .   ? 22.131  209.947 -22.149 1.00 30.31 ? 776  HOH A O     1 
HETATM 4081 O  O     . HOH H 7 .   ? 22.838  207.165 -28.560 1.00 29.42 ? 777  HOH A O     1 
HETATM 4082 O  O     . HOH H 7 .   ? 23.923  206.893 -23.532 1.00 34.20 ? 778  HOH A O     1 
HETATM 4083 O  O     . HOH H 7 .   ? 21.916  205.342 -19.795 1.00 27.77 ? 779  HOH A O     1 
HETATM 4084 O  O     . HOH H 7 .   ? 23.868  202.984 -21.469 1.00 33.82 ? 780  HOH A O     1 
HETATM 4085 O  O     . HOH H 7 .   ? 22.579  202.941 -23.557 1.00 31.12 ? 781  HOH A O     1 
HETATM 4086 O  O     . HOH H 7 .   ? 24.240  207.530 -20.967 1.00 45.69 ? 782  HOH A O     1 
HETATM 4087 O  O     . HOH H 7 .   ? 27.819  209.451 -19.658 1.00 33.58 ? 783  HOH A O     1 
HETATM 4088 O  O     . HOH H 7 .   ? 27.712  212.504 -20.729 1.00 27.00 ? 784  HOH A O     1 
HETATM 4089 O  O     . HOH H 7 .   ? 27.081  212.351 -23.333 1.00 28.01 ? 785  HOH A O     1 
HETATM 4090 O  O     . HOH H 7 .   ? 24.956  212.480 -24.385 1.00 36.67 ? 786  HOH A O     1 
HETATM 4091 O  O     . HOH H 7 .   ? 22.359  215.396 9.550   1.00 26.34 ? 787  HOH A O     1 
HETATM 4092 O  O     . HOH H 7 .   ? 13.963  210.222 -22.137 1.00 23.19 ? 788  HOH A O     1 
HETATM 4093 O  O     . HOH H 7 .   ? 6.986   226.329 3.288   1.00 26.93 ? 789  HOH A O     1 
HETATM 4094 O  O     . HOH H 7 .   ? 51.213  221.984 -13.365 1.00 39.92 ? 790  HOH A O     1 
HETATM 4095 O  O     . HOH H 7 .   ? 52.962  219.528 -12.357 1.00 40.77 ? 791  HOH A O     1 
HETATM 4096 O  O     . HOH H 7 .   ? 52.142  216.557 -11.711 1.00 29.25 ? 792  HOH A O     1 
HETATM 4097 O  O     . HOH H 7 .   ? 46.051  224.609 -14.909 1.00 31.28 ? 793  HOH A O     1 
HETATM 4098 O  O     . HOH H 7 .   ? 46.663  222.613 -13.665 1.00 28.76 ? 794  HOH A O     1 
HETATM 4099 O  O     . HOH H 7 .   ? 47.918  222.163 -11.264 1.00 29.42 ? 795  HOH A O     1 
HETATM 4100 O  O     . HOH H 7 .   ? 25.518  224.870 12.961  1.00 28.30 ? 796  HOH A O     1 
HETATM 4101 O  O     . HOH H 7 .   ? 13.737  230.511 16.203  1.00 38.35 ? 797  HOH A O     1 
HETATM 4102 O  O     . HOH H 7 .   ? 11.966  229.097 14.538  1.00 28.40 ? 798  HOH A O     1 
HETATM 4103 O  O     . HOH H 7 .   ? 46.158  216.701 -10.802 1.00 27.95 ? 799  HOH A O     1 
HETATM 4104 O  O     . HOH H 7 .   ? 45.596  214.534 -10.860 1.00 30.41 ? 800  HOH A O     1 
HETATM 4105 O  O     . HOH H 7 .   ? 7.666   215.980 19.887  1.00 29.92 ? 801  HOH A O     1 
HETATM 4106 O  O     . HOH H 7 .   ? 44.026  225.263 8.424   1.00 32.24 ? 802  HOH A O     1 
HETATM 4107 O  O     . HOH H 7 .   ? 42.691  227.073 6.806   1.00 31.64 ? 803  HOH A O     1 
HETATM 4108 O  O     . HOH H 7 .   ? 23.292  205.112 -26.385 1.00 31.25 ? 804  HOH A O     1 
HETATM 4109 O  O     . HOH H 7 .   ? 27.092  220.131 9.420   1.00 30.73 ? 805  HOH A O     1 
HETATM 4110 O  O     . HOH H 7 .   ? 28.681  220.570 6.974   1.00 34.19 ? 806  HOH A O     1 
HETATM 4111 O  O     . HOH H 7 .   ? 32.705  217.654 1.725   1.00 28.87 ? 807  HOH A O     1 
HETATM 4112 O  O     . HOH H 7 .   ? 2.072   217.391 -1.257  1.00 27.80 ? 808  HOH A O     1 
HETATM 4113 O  O     . HOH H 7 .   ? 3.432   216.979 1.230   1.00 31.12 ? 809  HOH A O     1 
HETATM 4114 O  O     . HOH H 7 .   ? -1.333  212.535 -5.951  1.00 36.59 ? 810  HOH A O     1 
HETATM 4115 O  O     . HOH H 7 .   ? 5.944   233.452 2.926   1.00 24.45 ? 811  HOH A O     1 
HETATM 4116 O  O     . HOH H 7 .   ? 37.094  236.862 -7.161  1.00 31.03 ? 812  HOH A O     1 
HETATM 4117 O  O     . HOH H 7 .   ? 28.263  232.666 -2.983  1.00 29.82 ? 813  HOH A O     1 
HETATM 4118 O  O     . HOH H 7 .   ? 8.007   218.426 -21.545 1.00 32.54 ? 814  HOH A O     1 
HETATM 4119 O  O     . HOH H 7 .   ? 45.501  208.858 17.449  1.00 28.19 ? 815  HOH A O     1 
HETATM 4120 O  O     . HOH H 7 .   ? 45.191  211.231 18.387  1.00 31.02 ? 816  HOH A O     1 
HETATM 4121 O  O     . HOH H 7 .   ? 38.181  203.670 -5.192  1.00 35.88 ? 817  HOH A O     1 
HETATM 4122 O  O     . HOH H 7 .   ? 7.976   198.314 -20.634 1.00 30.61 ? 818  HOH A O     1 
HETATM 4123 O  O     . HOH H 7 .   ? 7.378   200.208 -22.474 1.00 29.90 ? 819  HOH A O     1 
HETATM 4124 O  O     . HOH H 7 .   ? 6.048   215.081 -18.400 1.00 27.90 ? 820  HOH A O     1 
HETATM 4125 O  O     . HOH H 7 .   ? 6.510   216.830 -20.473 1.00 35.47 ? 821  HOH A O     1 
HETATM 4126 O  O     . HOH H 7 .   ? 35.090  232.687 7.619   1.00 32.81 ? 822  HOH A O     1 
HETATM 4127 O  O     . HOH H 7 .   ? 41.460  213.901 -16.447 1.00 32.49 ? 823  HOH A O     1 
HETATM 4128 O  O     . HOH H 7 .   ? 42.926  212.140 -14.793 1.00 32.87 ? 824  HOH A O     1 
HETATM 4129 O  O     . HOH H 7 .   ? 48.972  217.582 11.964  1.00 27.05 ? 825  HOH A O     1 
HETATM 4130 O  O     . HOH H 7 .   ? 3.996   214.558 4.204   1.00 34.15 ? 826  HOH A O     1 
HETATM 4131 O  O     . HOH H 7 .   ? 14.117  225.935 19.457  1.00 33.58 ? 827  HOH A O     1 
HETATM 4132 O  O     . HOH H 7 .   ? 0.163   200.274 1.685   1.00 37.65 ? 828  HOH A O     1 
HETATM 4133 O  O     . HOH H 7 .   ? 7.614   209.543 8.249   1.00 29.47 ? 829  HOH A O     1 
HETATM 4134 O  O     . HOH H 7 .   ? 9.123   208.332 6.530   1.00 34.20 ? 830  HOH A O     1 
HETATM 4135 O  O     . HOH H 7 .   ? 20.887  230.073 -15.963 1.00 33.16 ? 831  HOH A O     1 
HETATM 4136 O  O     . HOH H 7 .   ? 15.992  213.093 -1.362  1.00 29.25 ? 832  HOH A O     1 
HETATM 4137 O  O     . HOH H 7 .   ? 12.482  234.331 8.335   1.00 31.44 ? 833  HOH A O     1 
HETATM 4138 O  O     . HOH H 7 .   ? 62.887  210.052 -9.484  1.00 35.20 ? 834  HOH A O     1 
HETATM 4139 O  O     . HOH H 7 .   ? 43.127  200.328 13.811  1.00 28.97 ? 835  HOH A O     1 
HETATM 4140 O  O     . HOH H 7 .   ? 7.409   211.245 20.470  1.00 36.93 ? 836  HOH A O     1 
HETATM 4141 O  O     . HOH H 7 .   ? -0.307  197.807 -12.686 1.00 36.49 ? 837  HOH A O     1 
HETATM 4142 O  O     . HOH H 7 .   ? 18.125  219.730 -19.136 1.00 38.49 ? 838  HOH A O     1 
HETATM 4143 O  O     . HOH H 7 .   ? 40.582  202.917 -9.060  1.00 39.65 ? 839  HOH A O     1 
HETATM 4144 O  O     . HOH H 7 .   ? 39.550  201.907 -6.092  1.00 33.41 ? 840  HOH A O     1 
HETATM 4145 O  O     . HOH H 7 .   ? -5.174  207.880 -8.437  1.00 45.80 ? 841  HOH A O     1 
HETATM 4146 O  O     . HOH H 7 .   ? -2.667  208.182 -10.209 1.00 35.48 ? 842  HOH A O     1 
HETATM 4147 O  O     . HOH H 7 .   ? -2.852  210.901 -9.005  1.00 45.39 ? 843  HOH A O     1 
HETATM 4148 O  O     . HOH H 7 .   ? -3.269  208.471 -6.793  1.00 37.14 ? 844  HOH A O     1 
HETATM 4149 O  O     . HOH H 7 .   ? 42.586  218.244 -17.146 1.00 36.02 ? 845  HOH A O     1 
HETATM 4150 O  O     . HOH H 7 .   ? 3.587   214.565 14.441  1.00 33.25 ? 846  HOH A O     1 
HETATM 4151 O  O     . HOH H 7 .   ? 25.185  213.973 -19.730 1.00 31.91 ? 847  HOH A O     1 
HETATM 4152 O  O     . HOH H 7 .   ? 9.002   228.666 16.909  1.00 35.94 ? 848  HOH A O     1 
HETATM 4153 O  O     . HOH H 7 .   ? 6.689   225.403 5.430   1.00 30.82 ? 849  HOH A O     1 
HETATM 4154 O  O     . HOH H 7 .   ? 30.724  211.388 -9.244  1.00 35.98 ? 850  HOH A O     1 
HETATM 4155 O  O     . HOH H 7 .   ? 31.566  199.044 7.435   1.00 36.96 ? 851  HOH A O     1 
HETATM 4156 O  O     . HOH H 7 .   ? 51.248  212.867 -11.368 1.00 37.64 ? 852  HOH A O     1 
HETATM 4157 O  O     . HOH H 7 .   ? 30.562  235.852 -10.935 1.00 24.26 ? 853  HOH A O     1 
HETATM 4158 O  O     . HOH H 7 .   ? 28.061  237.350 -10.482 1.00 35.77 ? 854  HOH A O     1 
HETATM 4159 O  O     . HOH H 7 .   ? 52.993  212.011 1.316   1.00 30.81 ? 855  HOH A O     1 
HETATM 4160 O  O     . HOH H 7 .   ? 51.210  193.379 -6.451  1.00 32.15 ? 856  HOH A O     1 
HETATM 4161 O  O     . HOH H 7 .   ? 37.542  237.629 -9.746  1.00 32.70 ? 857  HOH A O     1 
HETATM 4162 O  O     . HOH H 7 .   ? 55.227  209.772 0.992   1.00 32.38 ? 858  HOH A O     1 
HETATM 4163 O  O     . HOH H 7 .   ? 57.092  206.957 -0.077  1.00 35.58 ? 859  HOH A O     1 
HETATM 4164 O  O     . HOH H 7 .   ? 58.833  205.604 -1.625  1.00 45.33 ? 860  HOH A O     1 
HETATM 4165 O  O     . HOH H 7 .   ? 52.322  221.425 8.733   1.00 30.63 ? 861  HOH A O     1 
HETATM 4166 O  O     . HOH H 7 .   ? 18.441  213.175 -8.446  1.00 33.46 ? 862  HOH A O     1 
HETATM 4167 O  O     . HOH H 7 .   ? 21.577  212.079 -7.759  1.00 36.96 ? 863  HOH A O     1 
HETATM 4168 O  O     . HOH H 7 .   ? 23.828  211.458 -12.190 1.00 30.73 ? 864  HOH A O     1 
HETATM 4169 O  O     . HOH H 7 .   ? 13.410  200.715 -27.209 1.00 38.26 ? 865  HOH A O     1 
HETATM 4170 O  O     . HOH H 7 .   ? 9.751   205.352 -26.202 1.00 43.05 ? 866  HOH A O     1 
HETATM 4171 O  O     . HOH H 7 .   ? 12.050  203.601 -25.493 1.00 36.98 ? 867  HOH A O     1 
HETATM 4172 O  O     . HOH H 7 .   ? 55.076  209.105 4.568   1.00 29.47 ? 868  HOH A O     1 
HETATM 4173 O  O     . HOH H 7 .   ? 52.226  213.682 -0.533  1.00 30.76 ? 869  HOH A O     1 
HETATM 4174 O  O     . HOH H 7 .   ? 43.616  195.839 13.749  1.00 33.38 ? 870  HOH A O     1 
HETATM 4175 O  O     . HOH H 7 .   ? 46.828  204.761 14.936  1.00 35.80 ? 871  HOH A O     1 
HETATM 4176 O  O     . HOH H 7 .   ? 9.869   219.442 -27.101 1.00 32.33 ? 872  HOH A O     1 
HETATM 4177 O  O     . HOH H 7 .   ? 6.397   221.447 -5.962  1.00 34.86 ? 873  HOH A O     1 
HETATM 4178 O  O     . HOH H 7 .   ? 54.119  230.145 5.143   1.00 35.96 ? 874  HOH A O     1 
HETATM 4179 O  O     . HOH H 7 .   ? 57.728  194.107 -2.942  1.00 32.45 ? 875  HOH A O     1 
HETATM 4180 O  O     . HOH H 7 .   ? 34.578  234.532 8.239   1.00 39.83 ? 876  HOH A O     1 
HETATM 4181 O  O     . HOH H 7 .   ? 9.182   219.654 21.939  1.00 35.91 ? 877  HOH A O     1 
HETATM 4182 O  O     . HOH H 7 .   ? 20.363  218.314 -22.587 1.00 35.60 ? 878  HOH A O     1 
HETATM 4183 O  O     . HOH H 7 .   ? 0.687   195.646 -13.079 1.00 35.35 ? 879  HOH A O     1 
HETATM 4184 O  O     . HOH H 7 .   ? 14.701  197.334 1.331   1.00 52.75 ? 880  HOH A O     1 
HETATM 4185 O  O     . HOH H 7 .   ? 8.329   221.780 -8.362  1.00 34.63 ? 881  HOH A O     1 
HETATM 4186 O  O     . HOH H 7 .   ? 17.130  197.743 -6.583  1.00 43.92 ? 882  HOH A O     1 
HETATM 4187 O  O     . HOH H 7 .   ? 11.469  198.246 2.968   1.00 38.94 ? 883  HOH A O     1 
HETATM 4188 O  O     . HOH H 7 .   ? 34.158  236.787 -6.717  1.00 40.28 ? 884  HOH A O     1 
HETATM 4189 O  O     . HOH H 7 .   ? 51.065  205.053 14.045  1.00 30.42 ? 885  HOH A O     1 
HETATM 4190 O  O     . HOH H 7 .   ? 6.776   210.251 17.923  1.00 35.08 ? 886  HOH A O     1 
HETATM 4191 O  O     . HOH H 7 .   ? 14.128  219.532 -15.026 1.00 37.70 ? 887  HOH A O     1 
HETATM 4192 O  O     . HOH H 7 .   ? 38.832  206.037 -12.623 1.00 39.02 ? 888  HOH A O     1 
HETATM 4193 O  O     . HOH H 7 .   ? 5.374   220.116 8.861   1.00 32.41 ? 889  HOH A O     1 
HETATM 4194 O  O     . HOH H 7 .   ? 5.420   221.196 7.111   1.00 35.23 ? 890  HOH A O     1 
HETATM 4195 O  O     . HOH H 7 .   ? 36.785  207.136 -16.381 1.00 34.43 ? 891  HOH A O     1 
HETATM 4196 O  O     . HOH H 7 .   ? 20.223  231.056 5.574   1.00 41.97 ? 892  HOH A O     1 
HETATM 4197 O  O     . HOH H 7 .   ? 35.577  229.549 -17.475 1.00 35.09 ? 893  HOH A O     1 
HETATM 4198 O  O     . HOH H 7 .   ? -0.726  196.235 3.027   1.00 40.09 ? 894  HOH A O     1 
HETATM 4199 O  O     . HOH H 7 .   ? 18.708  229.947 15.683  1.00 34.75 ? 895  HOH A O     1 
HETATM 4200 O  O     . HOH H 7 .   ? 44.623  240.978 -8.072  1.00 37.55 ? 896  HOH A O     1 
HETATM 4201 O  O     . HOH H 7 .   ? 45.130  203.878 -9.216  1.00 38.21 ? 897  HOH A O     1 
HETATM 4202 O  O     . HOH H 7 .   ? 44.006  238.771 10.190  1.00 41.78 ? 898  HOH A O     1 
HETATM 4203 O  O     . HOH H 7 .   ? 35.978  245.868 0.514   1.00 53.37 ? 899  HOH A O     1 
HETATM 4204 O  O     . HOH H 7 .   ? 17.416  213.373 -3.294  1.00 36.69 ? 900  HOH A O     1 
HETATM 4205 O  O     . HOH H 7 .   ? 24.603  226.335 -19.218 1.00 37.85 ? 901  HOH A O     1 
HETATM 4206 O  O     . HOH H 7 .   ? 24.147  228.582 12.584  1.00 35.79 ? 902  HOH A O     1 
HETATM 4207 O  O     . HOH H 7 .   ? 35.511  202.966 9.176   1.00 39.63 ? 903  HOH A O     1 
HETATM 4208 O  O     . HOH H 7 .   ? 55.052  201.216 -6.388  1.00 35.98 ? 904  HOH A O     1 
HETATM 4209 O  O     . HOH H 7 .   ? 23.207  229.074 14.771  1.00 34.58 ? 905  HOH A O     1 
HETATM 4210 O  O     . HOH H 7 .   ? 35.985  194.902 1.975   1.00 37.57 ? 906  HOH A O     1 
HETATM 4211 O  O     . HOH H 7 .   ? 56.894  224.596 -9.891  1.00 42.85 ? 907  HOH A O     1 
HETATM 4212 O  O     . HOH H 7 .   ? 9.488   220.693 24.374  1.00 37.22 ? 908  HOH A O     1 
HETATM 4213 O  O     . HOH H 7 .   ? 24.648  227.751 19.125  1.00 43.91 ? 909  HOH A O     1 
HETATM 4214 O  O     . HOH H 7 .   ? 32.153  228.223 7.461   1.00 32.34 ? 910  HOH A O     1 
HETATM 4215 O  O     . HOH H 7 .   ? 5.361   218.802 17.190  1.00 39.62 ? 911  HOH A O     1 
HETATM 4216 O  O     . HOH H 7 .   ? 22.058  228.463 3.221   1.00 34.98 ? 912  HOH A O     1 
HETATM 4217 O  O     . HOH H 7 .   ? 12.578  212.526 -29.623 1.00 41.35 ? 913  HOH A O     1 
HETATM 4218 O  O     . HOH H 7 .   ? 44.505  243.964 11.051  1.00 46.48 ? 914  HOH A O     1 
HETATM 4219 O  O     . HOH H 7 .   ? 60.601  211.846 -15.839 1.00 40.39 ? 915  HOH A O     1 
HETATM 4220 O  O     . HOH H 7 .   ? 19.521  195.365 -12.465 1.00 45.04 ? 916  HOH A O     1 
HETATM 4221 O  O     . HOH H 7 .   ? 28.539  210.293 -8.923  1.00 37.88 ? 917  HOH A O     1 
HETATM 4222 O  O     . HOH H 7 .   ? 15.343  237.520 3.366   1.00 35.32 ? 918  HOH A O     1 
HETATM 4223 O  O     . HOH H 7 .   ? 5.541   222.573 -4.335  1.00 34.58 ? 919  HOH A O     1 
HETATM 4224 O  O     . HOH H 7 .   ? 31.403  204.897 9.539   1.00 40.22 ? 920  HOH A O     1 
HETATM 4225 O  O     . HOH H 7 .   ? 16.117  210.136 17.713  1.00 41.02 ? 921  HOH A O     1 
HETATM 4226 O  O     . HOH H 7 .   ? 8.509   217.418 22.440  1.00 37.07 ? 922  HOH A O     1 
HETATM 4227 O  O     . HOH H 7 .   ? 46.498  243.463 -7.291  1.00 49.88 ? 923  HOH A O     1 
HETATM 4228 O  O     . HOH H 7 .   ? 57.020  216.957 -4.328  1.00 35.38 ? 924  HOH A O     1 
HETATM 4229 O  O     . HOH H 7 .   ? 11.022  215.744 -13.714 1.00 35.47 ? 925  HOH A O     1 
HETATM 4230 O  O     . HOH H 7 .   ? 20.498  217.535 -26.590 1.00 42.41 ? 926  HOH A O     1 
HETATM 4231 O  O     . HOH H 7 .   ? -1.466  212.993 -7.942  1.00 43.19 ? 927  HOH A O     1 
HETATM 4232 O  O     . HOH H 7 .   ? 13.326  214.299 -28.230 1.00 36.01 ? 928  HOH A O     1 
HETATM 4233 O  O     . HOH H 7 .   ? 6.757   217.125 14.349  1.00 34.00 ? 929  HOH A O     1 
HETATM 4234 O  O     . HOH H 7 .   ? 5.011   223.287 5.778   1.00 34.16 ? 930  HOH A O     1 
HETATM 4235 O  O     . HOH H 7 .   ? 39.419  231.264 -17.744 1.00 32.31 ? 931  HOH A O     1 
HETATM 4236 O  O     . HOH H 7 .   ? 40.553  222.537 8.693   1.00 37.56 ? 932  HOH A O     1 
HETATM 4237 O  O     . HOH H 7 .   ? -0.193  211.914 -2.774  1.00 32.66 ? 933  HOH A O     1 
HETATM 4238 O  O     . HOH H 7 .   ? 53.001  212.955 -3.325  1.00 34.35 ? 934  HOH A O     1 
HETATM 4239 O  O     . HOH H 7 .   ? 32.494  225.267 -20.503 1.00 39.56 ? 935  HOH A O     1 
HETATM 4240 O  O     . HOH H 7 .   ? 38.898  192.712 7.404   1.00 38.81 ? 936  HOH A O     1 
HETATM 4241 O  O     . HOH H 7 .   ? 53.979  220.821 -2.950  1.00 33.65 ? 937  HOH A O     1 
HETATM 4242 O  O     . HOH H 7 .   ? 50.270  236.638 -4.782  1.00 39.66 ? 938  HOH A O     1 
HETATM 4243 O  O     . HOH H 7 .   ? 56.885  202.863 -1.234  1.00 36.01 ? 939  HOH A O     1 
HETATM 4244 O  O     . HOH H 7 .   ? 32.053  203.805 -16.052 1.00 46.47 ? 940  HOH A O     1 
HETATM 4245 O  O     . HOH H 7 .   ? 32.092  215.393 1.891   1.00 37.34 ? 941  HOH A O     1 
HETATM 4246 O  O     . HOH H 7 .   ? 18.420  228.722 22.305  1.00 54.27 ? 942  HOH A O     1 
HETATM 4247 O  O     . HOH H 7 .   ? 51.861  199.414 10.941  1.00 44.53 ? 943  HOH A O     1 
HETATM 4248 O  O     . HOH H 7 .   ? 56.277  216.557 -10.133 1.00 48.55 ? 944  HOH A O     1 
HETATM 4249 O  O     . HOH H 7 .   ? 16.307  226.183 -14.935 1.00 32.06 ? 945  HOH A O     1 
HETATM 4250 O  O     . HOH H 7 .   ? 18.313  226.738 -15.423 1.00 36.05 ? 946  HOH A O     1 
HETATM 4251 O  O     . HOH H 7 .   ? 44.701  215.900 10.013  1.00 33.35 ? 947  HOH A O     1 
HETATM 4252 O  O     . HOH H 7 .   ? 43.060  226.405 -22.570 1.00 54.05 ? 948  HOH A O     1 
HETATM 4253 O  O     . HOH H 7 .   ? 38.410  227.002 -20.876 1.00 42.70 ? 949  HOH A O     1 
HETATM 4254 O  O     . HOH H 7 .   ? 35.803  222.855 -19.137 1.00 37.09 ? 950  HOH A O     1 
HETATM 4255 O  O     . HOH H 7 .   ? 8.567   207.203 -2.863  1.00 30.75 ? 951  HOH A O     1 
HETATM 4256 O  O     . HOH H 7 .   ? 10.007  214.073 -27.482 1.00 33.21 ? 952  HOH A O     1 
HETATM 4257 O  O     . HOH H 7 .   ? 6.163   218.339 19.602  1.00 39.50 ? 953  HOH A O     1 
HETATM 4258 O  O     . HOH H 7 .   ? 4.709   231.184 2.169   1.00 35.48 ? 954  HOH A O     1 
HETATM 4259 O  O     . HOH H 7 .   ? 10.016  220.051 -21.171 1.00 34.76 ? 955  HOH A O     1 
HETATM 4260 O  O     . HOH H 7 .   ? 49.955  236.148 -12.258 1.00 50.37 ? 956  HOH A O     1 
HETATM 4261 O  O     . HOH H 7 .   ? 30.814  232.214 -17.294 1.00 34.12 ? 957  HOH A O     1 
HETATM 4262 O  O     . HOH H 7 .   ? 38.556  202.424 -3.676  1.00 38.36 ? 958  HOH A O     1 
HETATM 4263 O  O     . HOH H 7 .   ? 50.293  196.998 -10.186 1.00 39.26 ? 959  HOH A O     1 
HETATM 4264 O  O     . HOH H 7 .   ? 21.023  211.405 14.852  1.00 37.02 ? 960  HOH A O     1 
HETATM 4265 O  O     . HOH H 7 .   ? 22.566  211.842 10.510  1.00 40.47 ? 961  HOH A O     1 
HETATM 4266 O  O     . HOH H 7 .   ? 49.389  230.386 13.398  1.00 46.89 ? 962  HOH A O     1 
HETATM 4267 O  O     . HOH H 7 .   ? 20.914  213.037 -27.518 1.00 39.54 ? 963  HOH A O     1 
HETATM 4268 O  O     . HOH H 7 .   ? 10.364  236.950 6.282   1.00 38.46 ? 964  HOH A O     1 
HETATM 4269 O  O     . HOH H 7 .   ? 2.196   209.487 -16.477 1.00 36.10 ? 965  HOH A O     1 
HETATM 4270 O  O     . HOH H 7 .   ? 54.531  211.054 -3.978  1.00 37.41 ? 966  HOH A O     1 
HETATM 4271 O  O     . HOH H 7 .   ? 52.933  203.395 -8.622  1.00 41.05 ? 967  HOH A O     1 
HETATM 4272 O  O     . HOH H 7 .   ? 30.716  218.282 4.137   1.00 36.26 ? 968  HOH A O     1 
HETATM 4273 O  O     . HOH H 7 .   ? 12.607  237.357 4.715   1.00 41.00 ? 969  HOH A O     1 
HETATM 4274 O  O     . HOH H 7 .   ? 39.226  205.094 -9.483  1.00 42.86 ? 970  HOH A O     1 
HETATM 4275 O  O     . HOH H 7 .   ? -3.110  208.551 -4.355  1.00 41.65 ? 971  HOH A O     1 
HETATM 4276 O  O     . HOH H 7 .   ? 53.916  228.464 6.428   1.00 36.17 ? 972  HOH A O     1 
HETATM 4277 O  O     . HOH H 7 .   ? 19.398  230.797 0.829   1.00 35.13 ? 973  HOH A O     1 
HETATM 4278 O  O     . HOH H 7 .   ? 38.817  224.306 8.998   1.00 37.85 ? 974  HOH A O     1 
HETATM 4279 O  O     . HOH H 7 .   ? 53.654  230.424 7.210   1.00 36.71 ? 975  HOH A O     1 
HETATM 4280 O  O     . HOH H 7 .   ? 53.666  228.188 -3.048  1.00 33.84 ? 976  HOH A O     1 
HETATM 4281 O  O     . HOH H 7 .   ? 22.507  216.780 8.618   1.00 34.79 ? 977  HOH A O     1 
HETATM 4282 O  O     . HOH H 7 .   ? 8.585   211.868 -29.653 1.00 40.58 ? 978  HOH A O     1 
HETATM 4283 O  O     . HOH H 7 .   ? 39.163  194.494 -1.068  1.00 39.37 ? 979  HOH A O     1 
HETATM 4284 O  O     . HOH H 7 .   ? 15.419  214.365 -16.951 1.00 34.50 ? 980  HOH A O     1 
HETATM 4285 O  O     . HOH H 7 .   ? 37.979  222.170 9.367   1.00 36.35 ? 981  HOH A O     1 
HETATM 4286 O  O     . HOH H 7 .   ? 35.208  217.330 7.140   1.00 39.95 ? 982  HOH A O     1 
HETATM 4287 O  O     . HOH H 7 .   ? 28.189  232.824 5.941   1.00 33.74 ? 983  HOH A O     1 
HETATM 4288 O  O     . HOH H 7 .   ? 57.556  235.930 -0.919  1.00 41.41 ? 984  HOH A O     1 
HETATM 4289 O  O     . HOH H 7 .   ? 59.605  234.544 -4.181  1.00 40.37 ? 985  HOH A O     1 
HETATM 4290 O  O     . HOH H 7 .   ? 59.630  232.284 -0.676  1.00 33.77 ? 986  HOH A O     1 
HETATM 4291 O  O     . HOH H 7 .   ? 58.516  230.414 0.082   1.00 40.38 ? 987  HOH A O     1 
HETATM 4292 O  O     . HOH H 7 .   ? 57.689  228.099 -1.520  1.00 38.96 ? 988  HOH A O     1 
HETATM 4293 O  O     . HOH H 7 .   ? 29.337  233.161 -17.969 1.00 32.23 ? 989  HOH A O     1 
HETATM 4294 O  O     . HOH H 7 .   ? 53.644  224.732 -6.384  1.00 27.70 ? 990  HOH A O     1 
HETATM 4295 O  O     . HOH H 7 .   ? 55.937  236.104 -3.730  1.00 44.65 ? 991  HOH A O     1 
HETATM 4296 O  O     . HOH H 7 .   ? 59.583  235.780 -0.903  1.00 41.57 ? 992  HOH A O     1 
HETATM 4297 O  O     . HOH H 7 .   ? 49.237  238.237 -3.899  1.00 42.08 ? 993  HOH A O     1 
HETATM 4298 O  O     . HOH H 7 .   ? 11.937  193.276 6.751   1.00 48.43 ? 994  HOH A O     1 
HETATM 4299 O  O     . HOH H 7 .   ? 1.457   193.385 5.358   1.00 39.63 ? 995  HOH A O     1 
HETATM 4300 O  O     . HOH H 7 .   ? -10.317 184.650 -7.307  1.00 52.64 ? 996  HOH A O     1 
HETATM 4301 O  O     . HOH H 7 .   ? 5.166   208.050 18.440  1.00 47.29 ? 997  HOH A O     1 
HETATM 4302 O  O     . HOH H 7 .   ? 3.696   206.766 15.929  1.00 46.77 ? 998  HOH A O     1 
HETATM 4303 O  O     . HOH H 7 .   ? 49.277  209.371 10.529  1.00 13.72 ? 999  HOH A O     1 
HETATM 4304 O  O     . HOH H 7 .   ? 50.718  211.861 2.817   1.00 18.86 ? 1000 HOH A O     1 
HETATM 4305 O  O     . HOH H 7 .   ? 52.817  207.522 7.679   1.00 20.12 ? 1001 HOH A O     1 
HETATM 4306 O  O     . HOH H 7 .   ? 10.049  226.864 -5.108  1.00 20.13 ? 1002 HOH A O     1 
HETATM 4307 O  O     . HOH H 7 .   ? 13.631  229.658 -10.238 1.00 23.47 ? 1003 HOH A O     1 
HETATM 4308 O  O     . HOH H 7 .   ? 12.034  226.311 -6.759  1.00 22.84 ? 1004 HOH A O     1 
HETATM 4309 O  O     . HOH H 7 .   ? 12.539  224.145 -8.178  1.00 20.34 ? 1005 HOH A O     1 
HETATM 4310 O  O     . HOH H 7 .   ? 58.126  205.991 4.262   1.00 31.69 ? 1006 HOH A O     1 
HETATM 4311 O  O     . HOH H 7 .   ? 12.745  227.816 -4.253  1.00 16.85 ? 1007 HOH A O     1 
HETATM 4312 O  O     . HOH H 7 .   ? 13.824  225.266 -10.323 1.00 22.20 ? 1008 HOH A O     1 
HETATM 4313 O  O     . HOH H 7 .   ? 12.912  225.862 -12.687 1.00 32.03 ? 1009 HOH A O     1 
HETATM 4314 O  O     . HOH H 7 .   ? 56.438  208.037 2.519   1.00 38.85 ? 1010 HOH A O     1 
HETATM 4315 O  O     . HOH H 7 .   ? 55.977  209.913 -1.562  1.00 40.42 ? 1011 HOH A O     1 
HETATM 4316 O  O     . HOH I 7 .   ? 20.427  206.035 4.346   1.00 43.07 ? 101  HOH T O     1 
HETATM 4317 O  O     . HOH I 7 .   ? 18.861  204.765 4.207   1.00 37.41 ? 102  HOH T O     1 
HETATM 4318 O  O     . HOH I 7 .   ? 16.165  203.497 1.028   1.00 30.75 ? 103  HOH T O     1 
HETATM 4319 O  O     . HOH I 7 .   ? 19.588  201.924 -4.553  1.00 38.10 ? 104  HOH T O     1 
HETATM 4320 O  O     . HOH I 7 .   ? 21.591  203.194 -10.063 1.00 37.23 ? 105  HOH T O     1 
HETATM 4321 O  O     . HOH I 7 .   ? 20.945  201.352 -7.854  1.00 35.41 ? 106  HOH T O     1 
HETATM 4322 O  O     . HOH I 7 .   ? 22.581  201.816 -12.225 1.00 40.59 ? 107  HOH T O     1 
HETATM 4323 O  O     . HOH I 7 .   ? 27.470  203.584 -14.237 1.00 35.98 ? 108  HOH T O     1 
HETATM 4324 O  O     . HOH I 7 .   ? 25.996  197.984 -13.640 1.00 40.87 ? 109  HOH T O     1 
HETATM 4325 O  O     . HOH I 7 .   ? 28.124  199.110 -13.636 1.00 32.90 ? 110  HOH T O     1 
HETATM 4326 O  O     . HOH I 7 .   ? 29.888  197.135 -14.828 1.00 33.02 ? 111  HOH T O     1 
HETATM 4327 O  O     . HOH I 7 .   ? 27.513  207.977 -6.999  1.00 34.52 ? 112  HOH T O     1 
HETATM 4328 O  O     . HOH I 7 .   ? 29.668  204.949 -7.402  1.00 27.80 ? 113  HOH T O     1 
HETATM 4329 O  O     . HOH I 7 .   ? 31.256  207.195 -8.114  1.00 37.25 ? 114  HOH T O     1 
HETATM 4330 O  O     . HOH I 7 .   ? 10.548  211.852 -7.083  1.00 19.38 ? 115  HOH T O     1 
HETATM 4331 O  O     . HOH I 7 .   ? 7.239   204.787 1.475   1.00 22.73 ? 116  HOH T O     1 
HETATM 4332 O  O     . HOH I 7 .   ? 17.155  211.063 -12.538 1.00 25.76 ? 117  HOH T O     1 
HETATM 4333 O  O     . HOH I 7 .   ? 12.551  204.167 14.205  1.00 42.32 ? 118  HOH T O     1 
HETATM 4334 O  O     . HOH I 7 .   ? 24.777  208.954 -6.939  1.00 33.69 ? 119  HOH T O     1 
HETATM 4335 O  O     . HOH I 7 .   ? 29.850  189.690 -8.087  1.00 34.03 ? 120  HOH T O     1 
HETATM 4336 O  O     . HOH I 7 .   ? 38.182  196.803 -6.912  1.00 32.99 ? 121  HOH T O     1 
HETATM 4337 O  O     . HOH I 7 .   ? 23.686  204.307 -13.134 1.00 31.97 ? 122  HOH T O     1 
HETATM 4338 O  O     . HOH I 7 .   ? 38.529  191.138 -9.237  1.00 35.32 ? 123  HOH T O     1 
HETATM 4339 O  O     . HOH I 7 .   ? 16.955  212.632 -6.437  1.00 36.39 ? 124  HOH T O     1 
HETATM 4340 O  O     . HOH I 7 .   ? 6.457   205.391 5.183   1.00 43.71 ? 125  HOH T O     1 
HETATM 4341 O  O     . HOH I 7 .   ? 15.563  211.080 -2.734  1.00 31.76 ? 126  HOH T O     1 
HETATM 4342 O  O     . HOH I 7 .   ? 10.283  204.089 7.787   1.00 43.68 ? 127  HOH T O     1 
HETATM 4343 O  O     . HOH I 7 .   ? 15.475  202.608 3.597   1.00 41.46 ? 128  HOH T O     1 
HETATM 4344 O  O     . HOH I 7 .   ? 34.938  194.515 -12.551 1.00 35.75 ? 129  HOH T O     1 
HETATM 4345 O  O     . HOH I 7 .   ? 33.715  195.862 -14.690 1.00 42.64 ? 130  HOH T O     1 
HETATM 4346 O  O     . HOH I 7 .   ? 37.939  192.982 -7.256  1.00 37.58 ? 131  HOH T O     1 
HETATM 4347 O  O     . HOH I 7 .   ? 17.498  206.058 -10.892 1.00 32.34 ? 132  HOH T O     1 
HETATM 4348 O  O     . HOH I 7 .   ? 3.958   205.593 7.314   1.00 39.11 ? 133  HOH T O     1 
HETATM 4349 O  O     . HOH I 7 .   ? 18.432  203.258 -6.319  1.00 36.01 ? 134  HOH T O     1 
HETATM 4350 O  O     . HOH I 7 .   ? 22.072  210.490 -5.285  1.00 35.78 ? 135  HOH T O     1 
HETATM 4351 O  O     . HOH I 7 .   ? 21.590  199.026 -11.660 1.00 44.99 ? 136  HOH T O     1 
HETATM 4352 O  O     . HOH I 7 .   ? 38.928  193.528 -13.832 1.00 42.95 ? 137  HOH T O     1 
HETATM 4353 O  O     . HOH I 7 .   ? 19.626  202.661 -9.163  1.00 45.62 ? 138  HOH T O     1 
HETATM 4354 O  O     . HOH I 7 .   ? 29.687  205.423 -4.811  1.00 28.93 ? 139  HOH T O     1 
HETATM 4355 O  O     . HOH I 7 .   ? 32.206  205.275 -3.725  1.00 28.46 ? 140  HOH T O     1 
HETATM 4356 O  O     . HOH J 7 .   ? 19.774  212.975 -2.636  1.00 27.26 ? 101  HOH P O     1 
HETATM 4357 O  O     . HOH J 7 .   ? 22.589  214.750 -2.440  1.00 20.54 ? 102  HOH P O     1 
HETATM 4358 O  O     . HOH J 7 .   ? 25.195  209.654 -4.165  1.00 27.38 ? 103  HOH P O     1 
HETATM 4359 O  O     . HOH J 7 .   ? 25.000  196.043 -14.916 1.00 36.51 ? 104  HOH P O     1 
HETATM 4360 O  O     . HOH J 7 .   ? 22.823  194.995 -15.525 1.00 39.03 ? 105  HOH P O     1 
HETATM 4361 O  O     . HOH J 7 .   ? 31.114  201.370 -4.847  1.00 32.45 ? 106  HOH P O     1 
HETATM 4362 O  O     . HOH J 7 .   ? 33.274  202.722 -4.023  1.00 28.69 ? 107  HOH P O     1 
HETATM 4363 O  O     . HOH J 7 .   ? 32.500  198.531 -3.831  1.00 31.54 ? 108  HOH P O     1 
HETATM 4364 O  O     . HOH J 7 .   ? 34.520  198.985 -1.838  1.00 25.44 ? 109  HOH P O     1 
HETATM 4365 O  O     . HOH J 7 .   ? 29.195  203.519 3.401   1.00 26.52 ? 110  HOH P O     1 
HETATM 4366 O  O     . HOH J 7 .   ? 24.718  203.209 1.943   1.00 35.70 ? 111  HOH P O     1 
HETATM 4367 O  O     . HOH J 7 .   ? 22.397  205.658 2.908   1.00 40.43 ? 112  HOH P O     1 
HETATM 4368 O  O     . HOH J 7 .   ? 24.138  187.327 -14.208 1.00 29.58 ? 113  HOH P O     1 
HETATM 4369 O  O     . HOH J 7 .   ? 18.645  192.171 -14.701 1.00 43.26 ? 114  HOH P O     1 
HETATM 4370 O  O     . HOH J 7 .   ? 22.680  200.197 -0.356  1.00 34.10 ? 115  HOH P O     1 
HETATM 4371 O  O     . HOH J 7 .   ? 18.962  192.366 -6.608  1.00 35.79 ? 116  HOH P O     1 
HETATM 4372 O  O     . HOH J 7 .   ? 30.357  209.074 -5.146  1.00 40.58 ? 117  HOH P O     1 
HETATM 4373 O  O     . HOH J 7 .   ? 28.594  198.800 2.735   1.00 36.46 ? 118  HOH P O     1 
HETATM 4374 O  O     . HOH J 7 .   ? 22.970  202.195 1.284   1.00 43.95 ? 119  HOH P O     1 
HETATM 4375 O  O     . HOH J 7 .   ? 21.142  194.415 -16.824 1.00 46.69 ? 120  HOH P O     1 
HETATM 4376 O  O     . HOH J 7 .   ? 28.309  201.107 2.335   1.00 34.67 ? 121  HOH P O     1 
HETATM 4377 O  O     . HOH J 7 .   ? 27.991  208.737 3.358   1.00 39.98 ? 122  HOH P O     1 
HETATM 4378 O  O     . HOH J 7 .   ? 25.983  211.514 3.186   1.00 35.84 ? 123  HOH P O     1 
HETATM 4379 O  O     . HOH J 7 .   ? 29.473  214.079 1.822   1.00 33.63 ? 124  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DG  4   4   4   DG  DG  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4670  ? 
1 MORE         -44   ? 
1 'SSA (A^2)'  21920 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 167.8 ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 86.1  ? 
3  "O3'" B C DT  8   ? P DT  8   ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 82.9  ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? H HOH .   ? A HOH 603 ? 1_555 87.7  ? 
5  "O3'" B C DT  8   ? P DT  8   ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? H HOH .   ? A HOH 603 ? 1_555 88.8  ? 
6  OE1   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? H HOH .   ? A HOH 603 ? 1_555 98.9  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 96.2  ? 
8  "O3'" B C DT  8   ? P DT  8   ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 89.9  ? 
9  OE1   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 94.5  ? 
10 O     ? H HOH .   ? A HOH 603 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 166.2 ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 102.0 ? 
12 "O3'" B C DT  8   ? P DT  8   ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 88.5  ? 
13 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 170.5 ? 
14 O     ? H HOH .   ? A HOH 603 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 76.6  ? 
15 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 89.6  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 168.1 ? 
17 "O3'" B C DT  8   ? P DT  8   ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 8.6   ? 
18 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 82.5  ? 
19 O     ? H HOH .   ? A HOH 603 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 97.4  ? 
20 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 81.3  ? 
21 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 89.7  ? 
22 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 97.4  ? 
23 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 167.3 ? 
24 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 91.3  ? 
25 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 85.9  ? 
26 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 176.5 ? 
27 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 85.3  ? 
28 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 83.5  ? 
29 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 85.7  ? 
30 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 88.0  ? 
31 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 93.6  ? 
32 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 100.4 ? 
33 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 89.0  ? 
34 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 88.9  ? 
35 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 91.5  ? 
36 O     ? A MET 17  ? A MET 14  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 173.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-04-30 
2 'Structure model' 1 1 2014-07-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MD2      'data collection' 'diffractometer software from EMBL' ? 1 
PHASER   phasing           '(MR)'                              ? 2 
PHENIX   refinement        '(phenix.refine: dev_1516)'         ? 3 
HKL-2000 'data reduction'  .                                   ? 4 
HKL-2000 'data scaling'    .                                   ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 787 ? ? O A HOH 977 ? ? 1.68 
2  1 O   A HOH 759 ? ? O A HOH 977 ? ? 1.80 
3  1 O   A HOH 773 ? ? O A HOH 871 ? ? 1.85 
4  1 O   A HOH 957 ? ? O A HOH 989 ? ? 1.88 
5  1 O   A HOH 614 ? ? O A HOH 958 ? ? 1.97 
6  1 O   A HOH 722 ? ? O A HOH 974 ? ? 2.00 
7  1 O   A HOH 817 ? ? O A HOH 958 ? ? 2.00 
8  1 O   A HOH 822 ? ? O A HOH 876 ? ? 2.01 
9  1 O   T HOH 101 ? ? O T HOH 102 ? ? 2.02 
10 1 O   A HOH 984 ? ? O A HOH 992 ? ? 2.03 
11 1 NH2 A ARG 256 ? ? O A HOH 733 ? ? 2.04 
12 1 O   A HOH 810 ? ? O A HOH 927 ? ? 2.05 
13 1 O   A HOH 889 ? ? O A HOH 890 ? ? 2.06 
14 1 O   A HOH 771 ? ? O A HOH 772 ? ? 2.08 
15 1 O   A HOH 680 ? ? O A HOH 973 ? ? 2.09 
16 1 O   A HOH 938 ? ? O A HOH 993 ? ? 2.10 
17 1 O   P HOH 111 ? ? O P HOH 119 ? ? 2.13 
18 1 O   A HOH 874 ? ? O A HOH 972 ? ? 2.13 
19 1 O   A HOH 972 ? ? O A HOH 975 ? ? 2.13 
20 1 O   A HOH 874 ? ? O A HOH 975 ? ? 2.14 
21 1 O   A HOH 945 ? ? O A HOH 946 ? ? 2.14 
22 1 O   A HOH 873 ? ? O A HOH 919 ? ? 2.16 
23 1 NH2 A ARG 256 ? ? O A HOH 734 ? ? 2.19 
24 1 OP1 P DT  8   ? A O P HOH 124 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 849 ? ? 1_555 O A HOH 856 ? ? 6_765 2.13 
2 1 O A HOH 871 ? ? 1_555 O A HOH 954 ? ? 6_865 2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB    A CYS 384 ? ? SG    A CYS 384 ? B 1.710 1.812 -0.102 0.016 N 
2 1 "O3'" T DT  6   ? ? "C3'" T DT  6   ? ? 1.380 1.419 -0.039 0.006 N 
3 1 "O3'" T DG  7   ? ? "C3'" T DG  7   ? ? 1.367 1.419 -0.052 0.006 N 
4 1 "O3'" P DG  2   ? ? "C3'" P DG  2   ? ? 1.338 1.419 -0.081 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE    A ARG 167 ? ? CZ    A ARG 167 ? ? NH1   A ARG 167 ? ? 123.36 120.30 3.06  0.50 N 
2  1 NE    A ARG 206 ? B CZ    A ARG 206 ? B NH1   A ARG 206 ? B 115.26 120.30 -5.04 0.50 N 
3  1 NE    A ARG 206 ? B CZ    A ARG 206 ? B NH2   A ARG 206 ? B 124.62 120.30 4.32  0.50 N 
4  1 NE    A ARG 351 ? A CZ    A ARG 351 ? A NH2   A ARG 351 ? A 116.29 120.30 -4.01 0.50 N 
5  1 OP1   T DG  4   ? ? P     T DG  4   ? ? OP2   T DG  4   ? ? 128.92 119.60 9.32  1.50 N 
6  1 "O4'" T DC  9   ? ? "C1'" T DC  9   ? ? N1    T DC  9   ? ? 111.30 108.30 3.00  0.30 N 
7  1 "O4'" T DT  12  ? ? "C1'" T DT  12  ? ? N1    T DT  12  ? ? 113.54 108.30 5.24  0.30 N 
8  1 "O4'" P DG  2   ? ? "C1'" P DG  2   ? ? N9    P DG  2   ? ? 110.60 108.30 2.30  0.30 N 
9  1 "O3'" P DG  2   ? ? P     P DC  3   ? ? OP2   P DC  3   ? ? 117.69 110.50 7.19  1.10 Y 
10 1 "O4'" P DA  7   ? ? "C4'" P DA  7   ? ? "C3'" P DA  7   ? ? 99.55  104.50 -4.95 0.40 N 
11 1 "C3'" P DA  7   ? ? "O3'" P DA  7   ? ? P     P DT  8   ? B 127.90 119.70 8.20  1.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 25.34   64.09   
2 1 TYR A 39  ? ? 63.06   80.80   
3 1 SER A 62  ? ? 77.13   -8.48   
4 1 GLN A 133 ? ? 62.15   -70.40  
5 1 SER A 217 ? ? -155.56 -157.40 
6 1 SER A 257 ? ? 97.08   -11.62  
7 1 LEU A 381 ? ? -171.95 129.74  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4O3N 'double helix'        
4O3N 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 -0.075 -0.115 -0.264 -0.785 -4.707  2.924  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.043 -0.122 0.177  -0.782 -12.553 3.636  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.123 -0.175 -0.362 -6.887 -2.952  -0.626 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.206  -0.087 -0.034 4.758  -2.460  0.871  4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.231  -0.144 -0.367 11.805 -4.876  1.654  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.244 -0.125 0.081  2.896  -3.439  2.317  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.098  -0.102 0.023  -0.663 -1.773  -1.594 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 0.121  -0.572 -0.250 16.047 -6.994  4.434  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.967  -1.061 3.354 -4.261 4.760  27.591 -3.245 -2.942 2.953 9.814  8.786 
28.307 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.512 -1.218 3.482 5.190  7.698  28.564 -3.944 2.062  2.926 15.106 
-10.185 30.005 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.656 -0.416 3.126 -1.241 0.851  34.729 -0.821 0.916  3.136 1.425  2.078 
34.761 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.621  -0.674 3.281 2.933  0.630  29.474 -1.453 -0.589 3.311 1.234  -5.745 
29.623 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.542 -0.601 3.600 -6.601 4.655  34.905 -1.719 -0.168 3.534 7.634  10.826 
35.799 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.360 -0.714 3.511 -0.246 0.498  37.596 -1.177 0.525  3.504 0.773  0.382 
37.600 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.493  -0.492 3.027 -1.790 -0.095 27.499 -1.013 -1.438 2.991 -0.199 3.760 
27.556 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" 0KX 
5 'MAGNESIUM ION'                                                                             MG  
6 GLYCEROL                                                                                    GOL 
7 water                                                                                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 0KX 1   501  1   0KX 0KX A . 
E 5 MG  1   502  1   MG  MG  A . 
F 5 MG  1   503  2   MG  MG  A . 
G 6 GOL 1   504  1   GOL GOL A . 
H 7 HOH 1   601  1   HOH HOH A . 
H 7 HOH 2   602  2   HOH HOH A . 
H 7 HOH 3   603  15  HOH HOH A . 
H 7 HOH 4   604  16  HOH HOH A . 
H 7 HOH 5   605  17  HOH HOH A . 
H 7 HOH 6   606  18  HOH HOH A . 
H 7 HOH 7   607  23  HOH HOH A . 
H 7 HOH 8   608  25  HOH HOH A . 
H 7 HOH 9   609  26  HOH HOH A . 
H 7 HOH 10  610  27  HOH HOH A . 
H 7 HOH 11  611  31  HOH HOH A . 
H 7 HOH 12  612  42  HOH HOH A . 
H 7 HOH 13  613  50  HOH HOH A . 
H 7 HOH 14  614  53  HOH HOH A . 
H 7 HOH 15  615  54  HOH HOH A . 
H 7 HOH 16  616  55  HOH HOH A . 
H 7 HOH 17  617  56  HOH HOH A . 
H 7 HOH 18  618  57  HOH HOH A . 
H 7 HOH 19  619  58  HOH HOH A . 
H 7 HOH 20  620  59  HOH HOH A . 
H 7 HOH 21  621  60  HOH HOH A . 
H 7 HOH 22  622  61  HOH HOH A . 
H 7 HOH 23  623  62  HOH HOH A . 
H 7 HOH 24  624  63  HOH HOH A . 
H 7 HOH 25  625  64  HOH HOH A . 
H 7 HOH 26  626  65  HOH HOH A . 
H 7 HOH 27  627  66  HOH HOH A . 
H 7 HOH 28  628  67  HOH HOH A . 
H 7 HOH 29  629  68  HOH HOH A . 
H 7 HOH 30  630  69  HOH HOH A . 
H 7 HOH 31  631  71  HOH HOH A . 
H 7 HOH 32  632  72  HOH HOH A . 
H 7 HOH 33  633  73  HOH HOH A . 
H 7 HOH 34  634  74  HOH HOH A . 
H 7 HOH 35  635  75  HOH HOH A . 
H 7 HOH 36  636  76  HOH HOH A . 
H 7 HOH 37  637  79  HOH HOH A . 
H 7 HOH 38  638  80  HOH HOH A . 
H 7 HOH 39  639  81  HOH HOH A . 
H 7 HOH 40  640  82  HOH HOH A . 
H 7 HOH 41  641  83  HOH HOH A . 
H 7 HOH 42  642  84  HOH HOH A . 
H 7 HOH 43  643  85  HOH HOH A . 
H 7 HOH 44  644  86  HOH HOH A . 
H 7 HOH 45  645  87  HOH HOH A . 
H 7 HOH 46  646  88  HOH HOH A . 
H 7 HOH 47  647  89  HOH HOH A . 
H 7 HOH 48  648  91  HOH HOH A . 
H 7 HOH 49  649  92  HOH HOH A . 
H 7 HOH 50  650  93  HOH HOH A . 
H 7 HOH 51  651  94  HOH HOH A . 
H 7 HOH 52  652  95  HOH HOH A . 
H 7 HOH 53  653  96  HOH HOH A . 
H 7 HOH 54  654  97  HOH HOH A . 
H 7 HOH 55  655  98  HOH HOH A . 
H 7 HOH 56  656  99  HOH HOH A . 
H 7 HOH 57  657  100 HOH HOH A . 
H 7 HOH 58  658  101 HOH HOH A . 
H 7 HOH 59  659  102 HOH HOH A . 
H 7 HOH 60  660  103 HOH HOH A . 
H 7 HOH 61  661  104 HOH HOH A . 
H 7 HOH 62  662  105 HOH HOH A . 
H 7 HOH 63  663  106 HOH HOH A . 
H 7 HOH 64  664  108 HOH HOH A . 
H 7 HOH 65  665  109 HOH HOH A . 
H 7 HOH 66  666  110 HOH HOH A . 
H 7 HOH 67  667  111 HOH HOH A . 
H 7 HOH 68  668  112 HOH HOH A . 
H 7 HOH 69  669  113 HOH HOH A . 
H 7 HOH 70  670  114 HOH HOH A . 
H 7 HOH 71  671  115 HOH HOH A . 
H 7 HOH 72  672  116 HOH HOH A . 
H 7 HOH 73  673  117 HOH HOH A . 
H 7 HOH 74  674  118 HOH HOH A . 
H 7 HOH 75  675  119 HOH HOH A . 
H 7 HOH 76  676  120 HOH HOH A . 
H 7 HOH 77  677  121 HOH HOH A . 
H 7 HOH 78  678  122 HOH HOH A . 
H 7 HOH 79  679  123 HOH HOH A . 
H 7 HOH 80  680  124 HOH HOH A . 
H 7 HOH 81  681  125 HOH HOH A . 
H 7 HOH 82  682  126 HOH HOH A . 
H 7 HOH 83  683  127 HOH HOH A . 
H 7 HOH 84  684  128 HOH HOH A . 
H 7 HOH 85  685  129 HOH HOH A . 
H 7 HOH 86  686  130 HOH HOH A . 
H 7 HOH 87  687  131 HOH HOH A . 
H 7 HOH 88  688  132 HOH HOH A . 
H 7 HOH 89  689  133 HOH HOH A . 
H 7 HOH 90  690  134 HOH HOH A . 
H 7 HOH 91  691  135 HOH HOH A . 
H 7 HOH 92  692  136 HOH HOH A . 
H 7 HOH 93  693  137 HOH HOH A . 
H 7 HOH 94  694  138 HOH HOH A . 
H 7 HOH 95  695  139 HOH HOH A . 
H 7 HOH 96  696  140 HOH HOH A . 
H 7 HOH 97  697  141 HOH HOH A . 
H 7 HOH 98  698  142 HOH HOH A . 
H 7 HOH 99  699  143 HOH HOH A . 
H 7 HOH 100 700  144 HOH HOH A . 
H 7 HOH 101 701  145 HOH HOH A . 
H 7 HOH 102 702  146 HOH HOH A . 
H 7 HOH 103 703  147 HOH HOH A . 
H 7 HOH 104 704  148 HOH HOH A . 
H 7 HOH 105 705  149 HOH HOH A . 
H 7 HOH 106 706  150 HOH HOH A . 
H 7 HOH 107 707  151 HOH HOH A . 
H 7 HOH 108 708  152 HOH HOH A . 
H 7 HOH 109 709  153 HOH HOH A . 
H 7 HOH 110 710  154 HOH HOH A . 
H 7 HOH 111 711  155 HOH HOH A . 
H 7 HOH 112 712  156 HOH HOH A . 
H 7 HOH 113 713  157 HOH HOH A . 
H 7 HOH 114 714  158 HOH HOH A . 
H 7 HOH 115 715  159 HOH HOH A . 
H 7 HOH 116 716  160 HOH HOH A . 
H 7 HOH 117 717  161 HOH HOH A . 
H 7 HOH 118 718  162 HOH HOH A . 
H 7 HOH 119 719  163 HOH HOH A . 
H 7 HOH 120 720  164 HOH HOH A . 
H 7 HOH 121 721  165 HOH HOH A . 
H 7 HOH 122 722  166 HOH HOH A . 
H 7 HOH 123 723  167 HOH HOH A . 
H 7 HOH 124 724  168 HOH HOH A . 
H 7 HOH 125 725  169 HOH HOH A . 
H 7 HOH 126 726  170 HOH HOH A . 
H 7 HOH 127 727  171 HOH HOH A . 
H 7 HOH 128 728  172 HOH HOH A . 
H 7 HOH 129 729  173 HOH HOH A . 
H 7 HOH 130 730  174 HOH HOH A . 
H 7 HOH 131 731  175 HOH HOH A . 
H 7 HOH 132 732  176 HOH HOH A . 
H 7 HOH 133 733  177 HOH HOH A . 
H 7 HOH 134 734  178 HOH HOH A . 
H 7 HOH 135 735  179 HOH HOH A . 
H 7 HOH 136 736  180 HOH HOH A . 
H 7 HOH 137 737  181 HOH HOH A . 
H 7 HOH 138 738  182 HOH HOH A . 
H 7 HOH 139 739  183 HOH HOH A . 
H 7 HOH 140 740  184 HOH HOH A . 
H 7 HOH 141 741  185 HOH HOH A . 
H 7 HOH 142 742  186 HOH HOH A . 
H 7 HOH 143 743  187 HOH HOH A . 
H 7 HOH 144 744  188 HOH HOH A . 
H 7 HOH 145 745  189 HOH HOH A . 
H 7 HOH 146 746  190 HOH HOH A . 
H 7 HOH 147 747  191 HOH HOH A . 
H 7 HOH 148 748  192 HOH HOH A . 
H 7 HOH 149 749  193 HOH HOH A . 
H 7 HOH 150 750  194 HOH HOH A . 
H 7 HOH 151 751  195 HOH HOH A . 
H 7 HOH 152 752  196 HOH HOH A . 
H 7 HOH 153 753  197 HOH HOH A . 
H 7 HOH 154 754  198 HOH HOH A . 
H 7 HOH 155 755  199 HOH HOH A . 
H 7 HOH 156 756  200 HOH HOH A . 
H 7 HOH 157 757  201 HOH HOH A . 
H 7 HOH 158 758  202 HOH HOH A . 
H 7 HOH 159 759  203 HOH HOH A . 
H 7 HOH 160 760  204 HOH HOH A . 
H 7 HOH 161 761  205 HOH HOH A . 
H 7 HOH 162 762  206 HOH HOH A . 
H 7 HOH 163 763  207 HOH HOH A . 
H 7 HOH 164 764  208 HOH HOH A . 
H 7 HOH 165 765  209 HOH HOH A . 
H 7 HOH 166 766  210 HOH HOH A . 
H 7 HOH 167 767  211 HOH HOH A . 
H 7 HOH 168 768  212 HOH HOH A . 
H 7 HOH 169 769  213 HOH HOH A . 
H 7 HOH 170 770  215 HOH HOH A . 
H 7 HOH 171 771  216 HOH HOH A . 
H 7 HOH 172 772  217 HOH HOH A . 
H 7 HOH 173 773  218 HOH HOH A . 
H 7 HOH 174 774  219 HOH HOH A . 
H 7 HOH 175 775  220 HOH HOH A . 
H 7 HOH 176 776  221 HOH HOH A . 
H 7 HOH 177 777  222 HOH HOH A . 
H 7 HOH 178 778  223 HOH HOH A . 
H 7 HOH 179 779  224 HOH HOH A . 
H 7 HOH 180 780  225 HOH HOH A . 
H 7 HOH 181 781  226 HOH HOH A . 
H 7 HOH 182 782  227 HOH HOH A . 
H 7 HOH 183 783  228 HOH HOH A . 
H 7 HOH 184 784  229 HOH HOH A . 
H 7 HOH 185 785  230 HOH HOH A . 
H 7 HOH 186 786  231 HOH HOH A . 
H 7 HOH 187 787  232 HOH HOH A . 
H 7 HOH 188 788  233 HOH HOH A . 
H 7 HOH 189 789  234 HOH HOH A . 
H 7 HOH 190 790  235 HOH HOH A . 
H 7 HOH 191 791  236 HOH HOH A . 
H 7 HOH 192 792  237 HOH HOH A . 
H 7 HOH 193 793  238 HOH HOH A . 
H 7 HOH 194 794  239 HOH HOH A . 
H 7 HOH 195 795  240 HOH HOH A . 
H 7 HOH 196 796  241 HOH HOH A . 
H 7 HOH 197 797  242 HOH HOH A . 
H 7 HOH 198 798  243 HOH HOH A . 
H 7 HOH 199 799  244 HOH HOH A . 
H 7 HOH 200 800  245 HOH HOH A . 
H 7 HOH 201 801  246 HOH HOH A . 
H 7 HOH 202 802  247 HOH HOH A . 
H 7 HOH 203 803  248 HOH HOH A . 
H 7 HOH 204 804  249 HOH HOH A . 
H 7 HOH 205 805  250 HOH HOH A . 
H 7 HOH 206 806  251 HOH HOH A . 
H 7 HOH 207 807  252 HOH HOH A . 
H 7 HOH 208 808  253 HOH HOH A . 
H 7 HOH 209 809  254 HOH HOH A . 
H 7 HOH 210 810  255 HOH HOH A . 
H 7 HOH 211 811  256 HOH HOH A . 
H 7 HOH 212 812  257 HOH HOH A . 
H 7 HOH 213 813  258 HOH HOH A . 
H 7 HOH 214 814  259 HOH HOH A . 
H 7 HOH 215 815  260 HOH HOH A . 
H 7 HOH 216 816  261 HOH HOH A . 
H 7 HOH 217 817  262 HOH HOH A . 
H 7 HOH 218 818  263 HOH HOH A . 
H 7 HOH 219 819  264 HOH HOH A . 
H 7 HOH 220 820  265 HOH HOH A . 
H 7 HOH 221 821  266 HOH HOH A . 
H 7 HOH 222 822  267 HOH HOH A . 
H 7 HOH 223 823  268 HOH HOH A . 
H 7 HOH 224 824  269 HOH HOH A . 
H 7 HOH 225 825  272 HOH HOH A . 
H 7 HOH 226 826  273 HOH HOH A . 
H 7 HOH 227 827  274 HOH HOH A . 
H 7 HOH 228 828  275 HOH HOH A . 
H 7 HOH 229 829  276 HOH HOH A . 
H 7 HOH 230 830  277 HOH HOH A . 
H 7 HOH 231 831  278 HOH HOH A . 
H 7 HOH 232 832  279 HOH HOH A . 
H 7 HOH 233 833  280 HOH HOH A . 
H 7 HOH 234 834  281 HOH HOH A . 
H 7 HOH 235 835  282 HOH HOH A . 
H 7 HOH 236 836  283 HOH HOH A . 
H 7 HOH 237 837  284 HOH HOH A . 
H 7 HOH 238 838  285 HOH HOH A . 
H 7 HOH 239 839  287 HOH HOH A . 
H 7 HOH 240 840  288 HOH HOH A . 
H 7 HOH 241 841  289 HOH HOH A . 
H 7 HOH 242 842  290 HOH HOH A . 
H 7 HOH 243 843  291 HOH HOH A . 
H 7 HOH 244 844  292 HOH HOH A . 
H 7 HOH 245 845  293 HOH HOH A . 
H 7 HOH 246 846  294 HOH HOH A . 
H 7 HOH 247 847  295 HOH HOH A . 
H 7 HOH 248 848  296 HOH HOH A . 
H 7 HOH 249 849  297 HOH HOH A . 
H 7 HOH 250 850  299 HOH HOH A . 
H 7 HOH 251 851  300 HOH HOH A . 
H 7 HOH 252 852  301 HOH HOH A . 
H 7 HOH 253 853  302 HOH HOH A . 
H 7 HOH 254 854  303 HOH HOH A . 
H 7 HOH 255 855  304 HOH HOH A . 
H 7 HOH 256 856  307 HOH HOH A . 
H 7 HOH 257 857  308 HOH HOH A . 
H 7 HOH 258 858  310 HOH HOH A . 
H 7 HOH 259 859  311 HOH HOH A . 
H 7 HOH 260 860  312 HOH HOH A . 
H 7 HOH 261 861  313 HOH HOH A . 
H 7 HOH 262 862  315 HOH HOH A . 
H 7 HOH 263 863  316 HOH HOH A . 
H 7 HOH 264 864  317 HOH HOH A . 
H 7 HOH 265 865  318 HOH HOH A . 
H 7 HOH 266 866  319 HOH HOH A . 
H 7 HOH 267 867  320 HOH HOH A . 
H 7 HOH 268 868  321 HOH HOH A . 
H 7 HOH 269 869  322 HOH HOH A . 
H 7 HOH 270 870  323 HOH HOH A . 
H 7 HOH 271 871  325 HOH HOH A . 
H 7 HOH 272 872  326 HOH HOH A . 
H 7 HOH 273 873  327 HOH HOH A . 
H 7 HOH 274 874  328 HOH HOH A . 
H 7 HOH 275 875  329 HOH HOH A . 
H 7 HOH 276 876  330 HOH HOH A . 
H 7 HOH 277 877  332 HOH HOH A . 
H 7 HOH 278 878  333 HOH HOH A . 
H 7 HOH 279 879  335 HOH HOH A . 
H 7 HOH 280 880  336 HOH HOH A . 
H 7 HOH 281 881  339 HOH HOH A . 
H 7 HOH 282 882  341 HOH HOH A . 
H 7 HOH 283 883  345 HOH HOH A . 
H 7 HOH 284 884  348 HOH HOH A . 
H 7 HOH 285 885  349 HOH HOH A . 
H 7 HOH 286 886  350 HOH HOH A . 
H 7 HOH 287 887  351 HOH HOH A . 
H 7 HOH 288 888  352 HOH HOH A . 
H 7 HOH 289 889  353 HOH HOH A . 
H 7 HOH 290 890  354 HOH HOH A . 
H 7 HOH 291 891  355 HOH HOH A . 
H 7 HOH 292 892  356 HOH HOH A . 
H 7 HOH 293 893  357 HOH HOH A . 
H 7 HOH 294 894  358 HOH HOH A . 
H 7 HOH 295 895  359 HOH HOH A . 
H 7 HOH 296 896  360 HOH HOH A . 
H 7 HOH 297 897  361 HOH HOH A . 
H 7 HOH 298 898  363 HOH HOH A . 
H 7 HOH 299 899  364 HOH HOH A . 
H 7 HOH 300 900  365 HOH HOH A . 
H 7 HOH 301 901  367 HOH HOH A . 
H 7 HOH 302 902  368 HOH HOH A . 
H 7 HOH 303 903  369 HOH HOH A . 
H 7 HOH 304 904  370 HOH HOH A . 
H 7 HOH 305 905  372 HOH HOH A . 
H 7 HOH 306 906  373 HOH HOH A . 
H 7 HOH 307 907  374 HOH HOH A . 
H 7 HOH 308 908  375 HOH HOH A . 
H 7 HOH 309 909  377 HOH HOH A . 
H 7 HOH 310 910  380 HOH HOH A . 
H 7 HOH 311 911  381 HOH HOH A . 
H 7 HOH 312 912  382 HOH HOH A . 
H 7 HOH 313 913  384 HOH HOH A . 
H 7 HOH 314 914  385 HOH HOH A . 
H 7 HOH 315 915  386 HOH HOH A . 
H 7 HOH 316 916  388 HOH HOH A . 
H 7 HOH 317 917  389 HOH HOH A . 
H 7 HOH 318 918  390 HOH HOH A . 
H 7 HOH 319 919  391 HOH HOH A . 
H 7 HOH 320 920  393 HOH HOH A . 
H 7 HOH 321 921  394 HOH HOH A . 
H 7 HOH 322 922  395 HOH HOH A . 
H 7 HOH 323 923  396 HOH HOH A . 
H 7 HOH 324 924  397 HOH HOH A . 
H 7 HOH 325 925  398 HOH HOH A . 
H 7 HOH 326 926  399 HOH HOH A . 
H 7 HOH 327 927  400 HOH HOH A . 
H 7 HOH 328 928  401 HOH HOH A . 
H 7 HOH 329 929  403 HOH HOH A . 
H 7 HOH 330 930  404 HOH HOH A . 
H 7 HOH 331 931  405 HOH HOH A . 
H 7 HOH 332 932  406 HOH HOH A . 
H 7 HOH 333 933  407 HOH HOH A . 
H 7 HOH 334 934  408 HOH HOH A . 
H 7 HOH 335 935  409 HOH HOH A . 
H 7 HOH 336 936  410 HOH HOH A . 
H 7 HOH 337 937  411 HOH HOH A . 
H 7 HOH 338 938  412 HOH HOH A . 
H 7 HOH 339 939  413 HOH HOH A . 
H 7 HOH 340 940  415 HOH HOH A . 
H 7 HOH 341 941  417 HOH HOH A . 
H 7 HOH 342 942  418 HOH HOH A . 
H 7 HOH 343 943  419 HOH HOH A . 
H 7 HOH 344 944  420 HOH HOH A . 
H 7 HOH 345 945  421 HOH HOH A . 
H 7 HOH 346 946  422 HOH HOH A . 
H 7 HOH 347 947  423 HOH HOH A . 
H 7 HOH 348 948  424 HOH HOH A . 
H 7 HOH 349 949  425 HOH HOH A . 
H 7 HOH 350 950  426 HOH HOH A . 
H 7 HOH 351 951  427 HOH HOH A . 
H 7 HOH 352 952  428 HOH HOH A . 
H 7 HOH 353 953  429 HOH HOH A . 
H 7 HOH 354 954  430 HOH HOH A . 
H 7 HOH 355 955  431 HOH HOH A . 
H 7 HOH 356 956  432 HOH HOH A . 
H 7 HOH 357 957  433 HOH HOH A . 
H 7 HOH 358 958  434 HOH HOH A . 
H 7 HOH 359 959  435 HOH HOH A . 
H 7 HOH 360 960  436 HOH HOH A . 
H 7 HOH 361 961  437 HOH HOH A . 
H 7 HOH 362 962  438 HOH HOH A . 
H 7 HOH 363 963  441 HOH HOH A . 
H 7 HOH 364 964  442 HOH HOH A . 
H 7 HOH 365 965  443 HOH HOH A . 
H 7 HOH 366 966  445 HOH HOH A . 
H 7 HOH 367 967  446 HOH HOH A . 
H 7 HOH 368 968  447 HOH HOH A . 
H 7 HOH 369 969  448 HOH HOH A . 
H 7 HOH 370 970  449 HOH HOH A . 
H 7 HOH 371 971  451 HOH HOH A . 
H 7 HOH 372 972  452 HOH HOH A . 
H 7 HOH 373 973  453 HOH HOH A . 
H 7 HOH 374 974  454 HOH HOH A . 
H 7 HOH 375 975  455 HOH HOH A . 
H 7 HOH 376 976  456 HOH HOH A . 
H 7 HOH 377 977  457 HOH HOH A . 
H 7 HOH 378 978  458 HOH HOH A . 
H 7 HOH 379 979  459 HOH HOH A . 
H 7 HOH 380 980  460 HOH HOH A . 
H 7 HOH 381 981  461 HOH HOH A . 
H 7 HOH 382 982  462 HOH HOH A . 
H 7 HOH 383 983  464 HOH HOH A . 
H 7 HOH 384 984  466 HOH HOH A . 
H 7 HOH 385 985  467 HOH HOH A . 
H 7 HOH 386 986  468 HOH HOH A . 
H 7 HOH 387 987  469 HOH HOH A . 
H 7 HOH 388 988  470 HOH HOH A . 
H 7 HOH 389 989  471 HOH HOH A . 
H 7 HOH 390 990  472 HOH HOH A . 
H 7 HOH 391 991  473 HOH HOH A . 
H 7 HOH 392 992  474 HOH HOH A . 
H 7 HOH 393 993  475 HOH HOH A . 
H 7 HOH 394 994  476 HOH HOH A . 
H 7 HOH 395 995  477 HOH HOH A . 
H 7 HOH 396 996  478 HOH HOH A . 
H 7 HOH 397 997  479 HOH HOH A . 
H 7 HOH 398 998  480 HOH HOH A . 
H 7 HOH 399 999  3   HOH HOH A . 
H 7 HOH 400 1000 4   HOH HOH A . 
H 7 HOH 401 1001 5   HOH HOH A . 
H 7 HOH 402 1002 6   HOH HOH A . 
H 7 HOH 403 1003 7   HOH HOH A . 
H 7 HOH 404 1004 8   HOH HOH A . 
H 7 HOH 405 1005 9   HOH HOH A . 
H 7 HOH 406 1006 11  HOH HOH A . 
H 7 HOH 407 1007 12  HOH HOH A . 
H 7 HOH 408 1008 13  HOH HOH A . 
H 7 HOH 409 1009 14  HOH HOH A . 
H 7 HOH 410 1010 362 HOH HOH A . 
H 7 HOH 411 1011 450 HOH HOH A . 
I 7 HOH 1   101  28  HOH HOH T . 
I 7 HOH 2   102  29  HOH HOH T . 
I 7 HOH 3   103  30  HOH HOH T . 
I 7 HOH 4   104  32  HOH HOH T . 
I 7 HOH 5   105  33  HOH HOH T . 
I 7 HOH 6   106  34  HOH HOH T . 
I 7 HOH 7   107  35  HOH HOH T . 
I 7 HOH 8   108  36  HOH HOH T . 
I 7 HOH 9   109  37  HOH HOH T . 
I 7 HOH 10  110  38  HOH HOH T . 
I 7 HOH 11  111  39  HOH HOH T . 
I 7 HOH 12  112  43  HOH HOH T . 
I 7 HOH 13  113  45  HOH HOH T . 
I 7 HOH 14  114  46  HOH HOH T . 
I 7 HOH 15  115  90  HOH HOH T . 
I 7 HOH 16  116  107 HOH HOH T . 
I 7 HOH 17  117  214 HOH HOH T . 
I 7 HOH 18  118  271 HOH HOH T . 
I 7 HOH 19  119  286 HOH HOH T . 
I 7 HOH 20  120  298 HOH HOH T . 
I 7 HOH 21  121  305 HOH HOH T . 
I 7 HOH 22  122  306 HOH HOH T . 
I 7 HOH 23  123  309 HOH HOH T . 
I 7 HOH 24  124  314 HOH HOH T . 
I 7 HOH 25  125  331 HOH HOH T . 
I 7 HOH 26  126  338 HOH HOH T . 
I 7 HOH 27  127  340 HOH HOH T . 
I 7 HOH 28  128  343 HOH HOH T . 
I 7 HOH 29  129  346 HOH HOH T . 
I 7 HOH 30  130  347 HOH HOH T . 
I 7 HOH 31  131  376 HOH HOH T . 
I 7 HOH 32  132  379 HOH HOH T . 
I 7 HOH 33  133  383 HOH HOH T . 
I 7 HOH 34  134  402 HOH HOH T . 
I 7 HOH 35  135  440 HOH HOH T . 
I 7 HOH 36  136  444 HOH HOH T . 
I 7 HOH 37  137  463 HOH HOH T . 
I 7 HOH 38  138  465 HOH HOH T . 
I 7 HOH 39  139  44  HOH HOH T . 
I 7 HOH 40  140  48  HOH HOH T . 
J 7 HOH 1   101  21  HOH HOH P . 
J 7 HOH 2   102  22  HOH HOH P . 
J 7 HOH 3   103  24  HOH HOH P . 
J 7 HOH 4   104  40  HOH HOH P . 
J 7 HOH 5   105  41  HOH HOH P . 
J 7 HOH 6   106  47  HOH HOH P . 
J 7 HOH 7   107  49  HOH HOH P . 
J 7 HOH 8   108  51  HOH HOH P . 
J 7 HOH 9   109  52  HOH HOH P . 
J 7 HOH 10  110  70  HOH HOH P . 
J 7 HOH 11  111  77  HOH HOH P . 
J 7 HOH 12  112  78  HOH HOH P . 
J 7 HOH 13  113  270 HOH HOH P . 
J 7 HOH 14  114  324 HOH HOH P . 
J 7 HOH 15  115  334 HOH HOH P . 
J 7 HOH 16  116  337 HOH HOH P . 
J 7 HOH 17  117  344 HOH HOH P . 
J 7 HOH 18  118  366 HOH HOH P . 
J 7 HOH 19  119  371 HOH HOH P . 
J 7 HOH 20  120  378 HOH HOH P . 
J 7 HOH 21  121  387 HOH HOH P . 
J 7 HOH 22  122  414 HOH HOH P . 
J 7 HOH 23  123  416 HOH HOH P . 
J 7 HOH 24  124  439 HOH HOH P . 
#