data_4O8M
# 
_entry.id   4O8M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4O8M         
RCSB  RCSB084179   
WWPDB D_1000084179 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          EFI-510004 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4O8M 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-12-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vetting, M.W.'                    1  
'Al Obaidi, N.F.'                  2  
'Morisco, L.L.'                    3  
'Wasserman, S.R.'                  4  
'Sojitra, S.'                      5  
'Stead, M.'                        6  
'Attonito, J.D.'                   7  
'Scott Glenn, A.'                  8  
'Chowdhury, S.'                    9  
'Evans, B.'                        10 
'Hillerich, B.'                    11 
'Love, J.'                         12 
'Seidel, R.D.'                     13 
'Imker, H.J.'                      14 
'Gerlt, J.A.'                      15 
'Almo, S.C.'                       16 
'Enzyme Function Initiative (EFI)' 17 
# 
_citation.id                        primary 
_citation.title                     
;Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            54 
_citation.page_first                909 
_citation.page_last                 931 
_citation.year                      2015 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25540822 
_citation.pdbx_database_id_DOI      10.1021/bi501388y 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vetting, M.W.'     1  
primary 'Al-Obaidi, N.'     2  
primary 'Zhao, S.'          3  
primary 'San Francisco, B.' 4  
primary 'Kim, J.'           5  
primary 'Wichelecki, D.J.'  6  
primary 'Bouvier, J.T.'     7  
primary 'Solbiati, J.O.'    8  
primary 'Vu, H.'            9  
primary 'Zhang, X.'         10 
primary 'Rodionov, D.A.'    11 
primary 'Love, J.D.'        12 
primary 'Hillerich, B.S.'   13 
primary 'Seidel, R.D.'      14 
primary 'Quinn, R.J.'       15 
primary 'Osterman, A.L.'    16 
primary 'Cronan, J.E.'      17 
primary 'Jacobson, M.P.'    18 
primary 'Gerlt, J.A.'       19 
primary 'Almo, S.C.'        20 
# 
_cell.length_a           97.233 
_cell.length_b           143.593 
_cell.length_c           97.458 
_cell.angle_alpha        90.000 
_cell.angle_beta         99.490 
_cell.angle_gamma        90.000 
_cell.entry_id           4O8M 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4O8M 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TRAP dicarboxylate transporter, DctP subunit' 38356.688 8    ? ? ? ? 
2 non-polymer syn 'CHLORIDE ION'                                 35.453    3    ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                  96.063    16   ? ? ? ? 
4 non-polymer man 'L-galactonic acid'                            196.155   8    ? ? ? ? 
5 water       nat water                                          18.015    3575 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKLLSKSIKAILSVGLLGLAINAQAETEIMVAYGNQPGEPIDKAMHFWADKVKEKSNGDIVFKLFPSSQLGSETEVLEQA
KFGANIITISDYGALMDIVPDLGVINAPYISQSFEKKSKLLHSDWFKDLSDKLDQHDIHIIVPDVIYGTRHLLTKKPVTK
PSDLKGMKVRVQHSRLFLQTINAMGGVPTPMSLSDVYPGLSEGIIDGLENPTVVLFGGKFFEVAKNLNLTAHTKHMSPFV
AGTAFWNNLTPEQQKIIVDASREMVTYGGGLIEQAENEALENLKKAGVTVNDVDLPAFEASVADVISTGFPEWSPNLYKN
VQEKLSQFAENLYFQGHHHHHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKLLSKSIKAILSVGLLGLAINAQAETEIMVAYGNQPGEPIDKAMHFWADKVKEKSNGDIVFKLFPSSQLGSETEVLEQA
KFGANIITISDYGALMDIVPDLGVINAPYISQSFEKKSKLLHSDWFKDLSDKLDQHDIHIIVPDVIYGTRHLLTKKPVTK
PSDLKGMKVRVQHSRLFLQTINAMGGVPTPMSLSDVYPGLSEGIIDGLENPTVVLFGGKFFEVAKNLNLTAHTKHMSPFV
AGTAFWNNLTPEQQKIIVDASREMVTYGGGLIEQAENEALENLKKAGVTVNDVDLPAFEASVADVISTGFPEWSPNLYKN
VQEKLSQFAENLYFQGHHHHHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         EFI-510004 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LEU n 
1 4   LEU n 
1 5   SER n 
1 6   LYS n 
1 7   SER n 
1 8   ILE n 
1 9   LYS n 
1 10  ALA n 
1 11  ILE n 
1 12  LEU n 
1 13  SER n 
1 14  VAL n 
1 15  GLY n 
1 16  LEU n 
1 17  LEU n 
1 18  GLY n 
1 19  LEU n 
1 20  ALA n 
1 21  ILE n 
1 22  ASN n 
1 23  ALA n 
1 24  GLN n 
1 25  ALA n 
1 26  GLU n 
1 27  THR n 
1 28  GLU n 
1 29  ILE n 
1 30  MET n 
1 31  VAL n 
1 32  ALA n 
1 33  TYR n 
1 34  GLY n 
1 35  ASN n 
1 36  GLN n 
1 37  PRO n 
1 38  GLY n 
1 39  GLU n 
1 40  PRO n 
1 41  ILE n 
1 42  ASP n 
1 43  LYS n 
1 44  ALA n 
1 45  MET n 
1 46  HIS n 
1 47  PHE n 
1 48  TRP n 
1 49  ALA n 
1 50  ASP n 
1 51  LYS n 
1 52  VAL n 
1 53  LYS n 
1 54  GLU n 
1 55  LYS n 
1 56  SER n 
1 57  ASN n 
1 58  GLY n 
1 59  ASP n 
1 60  ILE n 
1 61  VAL n 
1 62  PHE n 
1 63  LYS n 
1 64  LEU n 
1 65  PHE n 
1 66  PRO n 
1 67  SER n 
1 68  SER n 
1 69  GLN n 
1 70  LEU n 
1 71  GLY n 
1 72  SER n 
1 73  GLU n 
1 74  THR n 
1 75  GLU n 
1 76  VAL n 
1 77  LEU n 
1 78  GLU n 
1 79  GLN n 
1 80  ALA n 
1 81  LYS n 
1 82  PHE n 
1 83  GLY n 
1 84  ALA n 
1 85  ASN n 
1 86  ILE n 
1 87  ILE n 
1 88  THR n 
1 89  ILE n 
1 90  SER n 
1 91  ASP n 
1 92  TYR n 
1 93  GLY n 
1 94  ALA n 
1 95  LEU n 
1 96  MET n 
1 97  ASP n 
1 98  ILE n 
1 99  VAL n 
1 100 PRO n 
1 101 ASP n 
1 102 LEU n 
1 103 GLY n 
1 104 VAL n 
1 105 ILE n 
1 106 ASN n 
1 107 ALA n 
1 108 PRO n 
1 109 TYR n 
1 110 ILE n 
1 111 SER n 
1 112 GLN n 
1 113 SER n 
1 114 PHE n 
1 115 GLU n 
1 116 LYS n 
1 117 LYS n 
1 118 SER n 
1 119 LYS n 
1 120 LEU n 
1 121 LEU n 
1 122 HIS n 
1 123 SER n 
1 124 ASP n 
1 125 TRP n 
1 126 PHE n 
1 127 LYS n 
1 128 ASP n 
1 129 LEU n 
1 130 SER n 
1 131 ASP n 
1 132 LYS n 
1 133 LEU n 
1 134 ASP n 
1 135 GLN n 
1 136 HIS n 
1 137 ASP n 
1 138 ILE n 
1 139 HIS n 
1 140 ILE n 
1 141 ILE n 
1 142 VAL n 
1 143 PRO n 
1 144 ASP n 
1 145 VAL n 
1 146 ILE n 
1 147 TYR n 
1 148 GLY n 
1 149 THR n 
1 150 ARG n 
1 151 HIS n 
1 152 LEU n 
1 153 LEU n 
1 154 THR n 
1 155 LYS n 
1 156 LYS n 
1 157 PRO n 
1 158 VAL n 
1 159 THR n 
1 160 LYS n 
1 161 PRO n 
1 162 SER n 
1 163 ASP n 
1 164 LEU n 
1 165 LYS n 
1 166 GLY n 
1 167 MET n 
1 168 LYS n 
1 169 VAL n 
1 170 ARG n 
1 171 VAL n 
1 172 GLN n 
1 173 HIS n 
1 174 SER n 
1 175 ARG n 
1 176 LEU n 
1 177 PHE n 
1 178 LEU n 
1 179 GLN n 
1 180 THR n 
1 181 ILE n 
1 182 ASN n 
1 183 ALA n 
1 184 MET n 
1 185 GLY n 
1 186 GLY n 
1 187 VAL n 
1 188 PRO n 
1 189 THR n 
1 190 PRO n 
1 191 MET n 
1 192 SER n 
1 193 LEU n 
1 194 SER n 
1 195 ASP n 
1 196 VAL n 
1 197 TYR n 
1 198 PRO n 
1 199 GLY n 
1 200 LEU n 
1 201 SER n 
1 202 GLU n 
1 203 GLY n 
1 204 ILE n 
1 205 ILE n 
1 206 ASP n 
1 207 GLY n 
1 208 LEU n 
1 209 GLU n 
1 210 ASN n 
1 211 PRO n 
1 212 THR n 
1 213 VAL n 
1 214 VAL n 
1 215 LEU n 
1 216 PHE n 
1 217 GLY n 
1 218 GLY n 
1 219 LYS n 
1 220 PHE n 
1 221 PHE n 
1 222 GLU n 
1 223 VAL n 
1 224 ALA n 
1 225 LYS n 
1 226 ASN n 
1 227 LEU n 
1 228 ASN n 
1 229 LEU n 
1 230 THR n 
1 231 ALA n 
1 232 HIS n 
1 233 THR n 
1 234 LYS n 
1 235 HIS n 
1 236 MET n 
1 237 SER n 
1 238 PRO n 
1 239 PHE n 
1 240 VAL n 
1 241 ALA n 
1 242 GLY n 
1 243 THR n 
1 244 ALA n 
1 245 PHE n 
1 246 TRP n 
1 247 ASN n 
1 248 ASN n 
1 249 LEU n 
1 250 THR n 
1 251 PRO n 
1 252 GLU n 
1 253 GLN n 
1 254 GLN n 
1 255 LYS n 
1 256 ILE n 
1 257 ILE n 
1 258 VAL n 
1 259 ASP n 
1 260 ALA n 
1 261 SER n 
1 262 ARG n 
1 263 GLU n 
1 264 MET n 
1 265 VAL n 
1 266 THR n 
1 267 TYR n 
1 268 GLY n 
1 269 GLY n 
1 270 GLY n 
1 271 LEU n 
1 272 ILE n 
1 273 GLU n 
1 274 GLN n 
1 275 ALA n 
1 276 GLU n 
1 277 ASN n 
1 278 GLU n 
1 279 ALA n 
1 280 LEU n 
1 281 GLU n 
1 282 ASN n 
1 283 LEU n 
1 284 LYS n 
1 285 LYS n 
1 286 ALA n 
1 287 GLY n 
1 288 VAL n 
1 289 THR n 
1 290 VAL n 
1 291 ASN n 
1 292 ASP n 
1 293 VAL n 
1 294 ASP n 
1 295 LEU n 
1 296 PRO n 
1 297 ALA n 
1 298 PHE n 
1 299 GLU n 
1 300 ALA n 
1 301 SER n 
1 302 VAL n 
1 303 ALA n 
1 304 ASP n 
1 305 VAL n 
1 306 ILE n 
1 307 SER n 
1 308 THR n 
1 309 GLY n 
1 310 PHE n 
1 311 PRO n 
1 312 GLU n 
1 313 TRP n 
1 314 SER n 
1 315 PRO n 
1 316 ASN n 
1 317 LEU n 
1 318 TYR n 
1 319 LYS n 
1 320 ASN n 
1 321 VAL n 
1 322 GLN n 
1 323 GLU n 
1 324 LYS n 
1 325 LEU n 
1 326 SER n 
1 327 GLN n 
1 328 PHE n 
1 329 ALA n 
1 330 GLU n 
1 331 ASN n 
1 332 LEU n 
1 333 TYR n 
1 334 PHE n 
1 335 GLN n 
1 336 GLY n 
1 337 HIS n 
1 338 HIS n 
1 339 HIS n 
1 340 HIS n 
1 341 HIS n 
1 342 HIS n 
1 343 HIS n 
1 344 HIS n 
1 345 HIS n 
1 346 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Asuc_0158 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    130Z 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Actinobacillus succinogenes' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     339671 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A6VKP1_ACTSZ 
_struct_ref.pdbx_db_accession          A6VKP1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKLLSKSIKAILSVGLLGLAINAQAETEIMVAYGNQPGEPIDKAMHFWADKVKEKSNGDIVFKLFPSSQLGSETEVLEQA
KFGANIITISDYGALMDIVPDLGVINAPYISQSFEKKSKLLHSDWFKDLSDKLDQHDIHIIVPDVIYGTRHLLTKKPVTK
PSDLKGMKVRVQHSRLFLQTINAMGGVPTPMSLSDVYPGLSEGIIDGLENPTVVLFGGKFFEVAKNLNLTAHTKHMSPFV
AGTAFWNNLTPEQQKIIVDASREMVTYGGGLIEQAENEALENLKKAGVTVNDVDLPAFEASVADVISTGFPEWSPNLYKN
VQEKLSQF
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4O8M A 1 ? 328 ? A6VKP1 1 ? 328 ? 1 328 
2 1 4O8M B 1 ? 328 ? A6VKP1 1 ? 328 ? 1 328 
3 1 4O8M C 1 ? 328 ? A6VKP1 1 ? 328 ? 1 328 
4 1 4O8M D 1 ? 328 ? A6VKP1 1 ? 328 ? 1 328 
5 1 4O8M E 1 ? 328 ? A6VKP1 1 ? 328 ? 1 328 
6 1 4O8M F 1 ? 328 ? A6VKP1 1 ? 328 ? 1 328 
7 1 4O8M G 1 ? 328 ? A6VKP1 1 ? 328 ? 1 328 
8 1 4O8M H 1 ? 328 ? A6VKP1 1 ? 328 ? 1 328 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4O8M ALA A 329 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 329 1   
1 4O8M GLU A 330 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 330 2   
1 4O8M ASN A 331 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 331 3   
1 4O8M LEU A 332 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 332 4   
1 4O8M TYR A 333 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 333 5   
1 4O8M PHE A 334 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 334 6   
1 4O8M GLN A 335 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 335 7   
1 4O8M GLY A 336 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 336 8   
1 4O8M HIS A 337 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 337 9   
1 4O8M HIS A 338 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 338 10  
1 4O8M HIS A 339 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 339 11  
1 4O8M HIS A 340 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 340 12  
1 4O8M HIS A 341 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 341 13  
1 4O8M HIS A 342 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 342 14  
1 4O8M HIS A 343 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 343 15  
1 4O8M HIS A 344 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 344 16  
1 4O8M HIS A 345 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 345 17  
1 4O8M HIS A 346 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 346 18  
2 4O8M ALA B 329 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 329 19  
2 4O8M GLU B 330 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 330 20  
2 4O8M ASN B 331 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 331 21  
2 4O8M LEU B 332 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 332 22  
2 4O8M TYR B 333 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 333 23  
2 4O8M PHE B 334 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 334 24  
2 4O8M GLN B 335 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 335 25  
2 4O8M GLY B 336 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 336 26  
2 4O8M HIS B 337 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 337 27  
2 4O8M HIS B 338 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 338 28  
2 4O8M HIS B 339 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 339 29  
2 4O8M HIS B 340 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 340 30  
2 4O8M HIS B 341 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 341 31  
2 4O8M HIS B 342 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 342 32  
2 4O8M HIS B 343 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 343 33  
2 4O8M HIS B 344 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 344 34  
2 4O8M HIS B 345 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 345 35  
2 4O8M HIS B 346 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 346 36  
3 4O8M ALA C 329 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 329 37  
3 4O8M GLU C 330 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 330 38  
3 4O8M ASN C 331 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 331 39  
3 4O8M LEU C 332 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 332 40  
3 4O8M TYR C 333 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 333 41  
3 4O8M PHE C 334 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 334 42  
3 4O8M GLN C 335 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 335 43  
3 4O8M GLY C 336 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 336 44  
3 4O8M HIS C 337 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 337 45  
3 4O8M HIS C 338 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 338 46  
3 4O8M HIS C 339 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 339 47  
3 4O8M HIS C 340 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 340 48  
3 4O8M HIS C 341 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 341 49  
3 4O8M HIS C 342 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 342 50  
3 4O8M HIS C 343 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 343 51  
3 4O8M HIS C 344 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 344 52  
3 4O8M HIS C 345 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 345 53  
3 4O8M HIS C 346 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 346 54  
4 4O8M ALA D 329 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 329 55  
4 4O8M GLU D 330 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 330 56  
4 4O8M ASN D 331 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 331 57  
4 4O8M LEU D 332 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 332 58  
4 4O8M TYR D 333 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 333 59  
4 4O8M PHE D 334 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 334 60  
4 4O8M GLN D 335 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 335 61  
4 4O8M GLY D 336 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 336 62  
4 4O8M HIS D 337 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 337 63  
4 4O8M HIS D 338 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 338 64  
4 4O8M HIS D 339 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 339 65  
4 4O8M HIS D 340 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 340 66  
4 4O8M HIS D 341 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 341 67  
4 4O8M HIS D 342 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 342 68  
4 4O8M HIS D 343 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 343 69  
4 4O8M HIS D 344 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 344 70  
4 4O8M HIS D 345 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 345 71  
4 4O8M HIS D 346 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 346 72  
5 4O8M ALA E 329 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 329 73  
5 4O8M GLU E 330 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 330 74  
5 4O8M ASN E 331 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 331 75  
5 4O8M LEU E 332 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 332 76  
5 4O8M TYR E 333 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 333 77  
5 4O8M PHE E 334 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 334 78  
5 4O8M GLN E 335 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 335 79  
5 4O8M GLY E 336 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 336 80  
5 4O8M HIS E 337 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 337 81  
5 4O8M HIS E 338 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 338 82  
5 4O8M HIS E 339 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 339 83  
5 4O8M HIS E 340 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 340 84  
5 4O8M HIS E 341 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 341 85  
5 4O8M HIS E 342 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 342 86  
5 4O8M HIS E 343 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 343 87  
5 4O8M HIS E 344 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 344 88  
5 4O8M HIS E 345 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 345 89  
5 4O8M HIS E 346 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 346 90  
6 4O8M ALA F 329 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 329 91  
6 4O8M GLU F 330 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 330 92  
6 4O8M ASN F 331 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 331 93  
6 4O8M LEU F 332 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 332 94  
6 4O8M TYR F 333 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 333 95  
6 4O8M PHE F 334 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 334 96  
6 4O8M GLN F 335 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 335 97  
6 4O8M GLY F 336 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 336 98  
6 4O8M HIS F 337 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 337 99  
6 4O8M HIS F 338 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 338 100 
6 4O8M HIS F 339 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 339 101 
6 4O8M HIS F 340 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 340 102 
6 4O8M HIS F 341 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 341 103 
6 4O8M HIS F 342 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 342 104 
6 4O8M HIS F 343 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 343 105 
6 4O8M HIS F 344 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 344 106 
6 4O8M HIS F 345 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 345 107 
6 4O8M HIS F 346 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 346 108 
7 4O8M ALA G 329 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 329 109 
7 4O8M GLU G 330 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 330 110 
7 4O8M ASN G 331 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 331 111 
7 4O8M LEU G 332 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 332 112 
7 4O8M TYR G 333 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 333 113 
7 4O8M PHE G 334 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 334 114 
7 4O8M GLN G 335 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 335 115 
7 4O8M GLY G 336 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 336 116 
7 4O8M HIS G 337 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 337 117 
7 4O8M HIS G 338 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 338 118 
7 4O8M HIS G 339 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 339 119 
7 4O8M HIS G 340 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 340 120 
7 4O8M HIS G 341 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 341 121 
7 4O8M HIS G 342 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 342 122 
7 4O8M HIS G 343 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 343 123 
7 4O8M HIS G 344 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 344 124 
7 4O8M HIS G 345 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 345 125 
7 4O8M HIS G 346 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 346 126 
8 4O8M ALA H 329 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 329 127 
8 4O8M GLU H 330 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 330 128 
8 4O8M ASN H 331 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 331 129 
8 4O8M LEU H 332 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 332 130 
8 4O8M TYR H 333 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 333 131 
8 4O8M PHE H 334 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 334 132 
8 4O8M GLN H 335 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 335 133 
8 4O8M GLY H 336 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 336 134 
8 4O8M HIS H 337 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 337 135 
8 4O8M HIS H 338 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 338 136 
8 4O8M HIS H 339 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 339 137 
8 4O8M HIS H 340 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 340 138 
8 4O8M HIS H 341 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 341 139 
8 4O8M HIS H 342 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 342 140 
8 4O8M HIS H 343 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 343 141 
8 4O8M HIS H 344 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 344 142 
8 4O8M HIS H 345 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 345 143 
8 4O8M HIS H 346 ? UNP A6VKP1 ? ? 'EXPRESSION TAG' 346 144 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2Q2 non-polymer         . 'L-galactonic acid' ? 'C6 H12 O7'      196.155 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'      ? 'Cl -1'          35.453  
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'       ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4O8M 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.19 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   43.75 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
;Protein (39.2 mg/ml, 10 mM HEPES pH 7.5, 5 mM DTT, 1 mM L-Galactonate); Reservoir (2.0 M Ammonium Sulfate, 0.1 M Bis-Tris pH 6.5); Cryoprotection (80% Concentrated Lithium Sulfate, 20% Reservoir), VAPOR DIFFUSION, SITTING DROP, temperature 298K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2013-10-09 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
# 
_reflns.entry_id                     4O8M 
_reflns.d_resolution_high            1.700 
_reflns.d_resolution_low             143.593 
_reflns.number_all                   287096 
_reflns.number_obs                   287096 
_reflns.pdbx_netI_over_sigmaI        8.700 
_reflns.pdbx_Rsym_value              0.114 
_reflns.pdbx_redundancy              3.600 
_reflns.percent_possible_obs         99.500 
_reflns.B_iso_Wilson_estimate        13.700 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.pdbx_Rmerge_I_obs            0.114 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.700 1.790   ? 140641 ? 0.757 1.000  0.757 ? 3.400 ? 41572 98.900 1  1 
1.790 1.900   ? 138050 ? 0.681 1.100  0.681 ? 3.500 ? 39520 99.300 2  1 
1.900 2.030   ? 133378 ? 0.324 2.300  0.324 ? 3.600 ? 37326 99.700 3  1 
2.030 2.190   ? 128210 ? 0.221 3.400  0.221 ? 3.700 ? 34799 99.900 4  1 
2.190 2.400   ? 117074 ? 0.199 3.600  0.199 ? 3.700 ? 31755 99.200 5  1 
2.400 2.690   ? 110033 ? 0.114 6.500  0.114 ? 3.800 ? 29033 99.900 6  1 
2.690 3.100   ? 96912  ? 0.078 9.200  0.078 ? 3.800 ? 25604 99.900 7  1 
3.100 3.800   ? 80254  ? 0.056 12.100 0.056 ? 3.700 ? 21545 99.500 8  1 
3.800 5.380   ? 62617  ? 0.036 17.300 0.036 ? 3.700 ? 16756 99.700 9  1 
5.380 143.593 ? 33990  ? 0.034 17.000 0.034 ? 3.700 ? 9186  98.800 10 1 
# 
_refine.entry_id                                 4O8M 
_refine.ls_d_res_high                            1.7000 
_refine.ls_d_res_low                             31.2040 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.2000 
_refine.ls_number_reflns_obs                     286219 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1908 
_refine.ls_R_factor_R_work                       0.1884 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2358 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0600 
_refine.ls_number_reflns_R_free                  14489 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               18.3691 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2200 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'pdb entry 4OVT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8344 
_refine.B_iso_max                                73.750 
_refine.B_iso_min                                3.390 
_refine.pdbx_overall_phase_error                 23.9800 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.330 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18838 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         187 
_refine_hist.number_atoms_solvent             3575 
_refine_hist.number_atoms_total               22600 
_refine_hist.d_res_high                       1.7000 
_refine_hist.d_res_low                        31.2040 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           19509 0.011  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          26491 1.234  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     2994  0.074  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      3404  0.007  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 7266  14.219 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.7000 1.7193  30 99.0000  8934 . 0.2600 0.2969 . 487 . 9421 . . 'X-RAY DIFFRACTION' 
1.7193 1.7395  30 99.0000  8991 . 0.2635 0.3201 . 504 . 9495 . . 'X-RAY DIFFRACTION' 
1.7395 1.7608  30 99.0000  8942 . 0.2435 0.2957 . 486 . 9428 . . 'X-RAY DIFFRACTION' 
1.7608 1.7830  30 99.0000  9067 . 0.2284 0.2870 . 457 . 9524 . . 'X-RAY DIFFRACTION' 
1.7830 1.8065  30 99.0000  9049 . 0.2238 0.2783 . 474 . 9523 . . 'X-RAY DIFFRACTION' 
1.8065 1.8312  30 99.0000  9042 . 0.2236 0.3056 . 473 . 9515 . . 'X-RAY DIFFRACTION' 
1.8312 1.8574  30 99.0000  8989 . 0.2140 0.2702 . 473 . 9462 . . 'X-RAY DIFFRACTION' 
1.8574 1.8851  30 99.0000  8989 . 0.2803 0.3451 . 520 . 9509 . . 'X-RAY DIFFRACTION' 
1.8851 1.9146  30 98.0000  8966 . 0.4291 0.4718 . 484 . 9450 . . 'X-RAY DIFFRACTION' 
1.9146 1.9460  30 100.0000 9117 . 0.2766 0.3281 . 483 . 9600 . . 'X-RAY DIFFRACTION' 
1.9460 1.9795  30 100.0000 8971 . 0.1829 0.2451 . 500 . 9471 . . 'X-RAY DIFFRACTION' 
1.9795 2.0155  30 100.0000 9091 . 0.1784 0.2429 . 514 . 9605 . . 'X-RAY DIFFRACTION' 
2.0155 2.0543  30 100.0000 9033 . 0.1690 0.2166 . 527 . 9560 . . 'X-RAY DIFFRACTION' 
2.0543 2.0962  30 100.0000 9130 . 0.1545 0.2150 . 486 . 9616 . . 'X-RAY DIFFRACTION' 
2.0962 2.1417  30 100.0000 9178 . 0.1576 0.2150 . 463 . 9641 . . 'X-RAY DIFFRACTION' 
2.1417 2.1916  30 100.0000 9012 . 0.1739 0.2365 . 499 . 9511 . . 'X-RAY DIFFRACTION' 
2.1916 2.2464  30 96.0000  8820 . 0.3528 0.3930 . 443 . 9263 . . 'X-RAY DIFFRACTION' 
2.2464 2.3071  30 98.0000  8933 . 0.2549 0.3248 . 467 . 9400 . . 'X-RAY DIFFRACTION' 
2.3071 2.3749  30 100.0000 9158 . 0.1510 0.2107 . 504 . 9662 . . 'X-RAY DIFFRACTION' 
2.3749 2.4516  30 100.0000 9057 . 0.1453 0.1972 . 463 . 9520 . . 'X-RAY DIFFRACTION' 
2.4516 2.5391  30 100.0000 9098 . 0.1495 0.2053 . 506 . 9604 . . 'X-RAY DIFFRACTION' 
2.5391 2.6408  30 100.0000 9193 . 0.1564 0.2240 . 460 . 9653 . . 'X-RAY DIFFRACTION' 
2.6408 2.7609  30 100.0000 9172 . 0.1556 0.2113 . 440 . 9612 . . 'X-RAY DIFFRACTION' 
2.7609 2.9063  30 100.0000 9121 . 0.1575 0.2070 . 466 . 9587 . . 'X-RAY DIFFRACTION' 
2.9063 3.0883  30 100.0000 9148 . 0.1499 0.1862 . 459 . 9607 . . 'X-RAY DIFFRACTION' 
3.0883 3.3265  30 100.0000 9153 . 0.1586 0.1991 . 501 . 9654 . . 'X-RAY DIFFRACTION' 
3.3265 3.6608  30 99.0000  9017 . 0.1678 0.1953 . 492 . 9509 . . 'X-RAY DIFFRACTION' 
3.6608 4.1894  30 98.0000  9068 . 0.1532 0.1880 . 448 . 9516 . . 'X-RAY DIFFRACTION' 
4.1894 5.2741  30 100.0000 9154 . 0.1359 0.1707 . 492 . 9646 . . 'X-RAY DIFFRACTION' 
5.2741 31.2091 30 99.0000  9137 . 0.2042 0.2289 . 518 . 9655 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4O8M 
_struct.title                     
;Crystal structure of a trap periplasmic solute binding protein actinobacillus succinogenes 130z, target EFI-510004, with bound L-galactonate
;
_struct.pdbx_descriptor           'TRAP PERIPLASMIC SOLUTE BINDING PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4O8M 
_struct_keywords.text            
'TRAP PERIPLASMIC SOLUTE BINDING FAMILY, ENZYME FUNCTION INITIATIVE, EFI, Structural Genomics, transport protein' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 4 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 4 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 4 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 4 ? 
JA N N 5 ? 
KA N N 5 ? 
LA N N 5 ? 
MA N N 5 ? 
NA N N 5 ? 
OA N N 5 ? 
PA N N 5 ? 
QA N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'POSSIBLE DIMER, ASSUMED MONOMER' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLU A 39  ? SER A 56  ? GLU A 39  SER A 56  1 ? 18 
HELX_P HELX_P2   2   SER A 72  ? PHE A 82  ? SER A 72  PHE A 82  1 ? 11 
HELX_P HELX_P3   3   ASP A 91  ? MET A 96  ? ASP A 91  MET A 96  1 ? 6  
HELX_P HELX_P4   4   ASP A 97  ? ILE A 98  ? ASP A 97  ILE A 98  5 ? 2  
HELX_P HELX_P5   5   VAL A 99  ? ALA A 107 ? VAL A 99  ALA A 107 5 ? 9  
HELX_P HELX_P6   6   SER A 113 ? LEU A 121 ? SER A 113 LEU A 121 1 ? 9  
HELX_P HELX_P7   7   SER A 123 ? HIS A 136 ? SER A 123 HIS A 136 1 ? 14 
HELX_P HELX_P8   8   LYS A 160 ? LYS A 165 ? LYS A 160 LYS A 165 5 ? 6  
HELX_P HELX_P9   9   SER A 174 ? GLY A 185 ? SER A 174 GLY A 185 1 ? 12 
HELX_P HELX_P10  10  SER A 192 ? SER A 194 ? SER A 192 SER A 194 5 ? 3  
HELX_P HELX_P11  11  ASP A 195 ? GLU A 202 ? ASP A 195 GLU A 202 1 ? 8  
HELX_P HELX_P12  12  PRO A 211 ? GLY A 218 ? PRO A 211 GLY A 218 1 ? 8  
HELX_P HELX_P13  13  LYS A 219 ? VAL A 223 ? LYS A 219 VAL A 223 5 ? 5  
HELX_P HELX_P14  14  THR A 243 ? ASN A 247 ? THR A 243 ASN A 247 1 ? 5  
HELX_P HELX_P15  15  THR A 250 ? ALA A 286 ? THR A 250 ALA A 286 1 ? 37 
HELX_P HELX_P16  16  ASP A 294 ? VAL A 302 ? ASP A 294 VAL A 302 1 ? 9  
HELX_P HELX_P17  17  VAL A 302 ? GLY A 309 ? VAL A 302 GLY A 309 1 ? 8  
HELX_P HELX_P18  18  ASN A 316 ? PHE A 328 ? ASN A 316 PHE A 328 1 ? 13 
HELX_P HELX_P19  19  GLU B 39  ? SER B 56  ? GLU B 39  SER B 56  1 ? 18 
HELX_P HELX_P20  20  SER B 72  ? PHE B 82  ? SER B 72  PHE B 82  1 ? 11 
HELX_P HELX_P21  21  ASP B 91  ? MET B 96  ? ASP B 91  MET B 96  1 ? 6  
HELX_P HELX_P22  22  ASP B 97  ? ILE B 98  ? ASP B 97  ILE B 98  5 ? 2  
HELX_P HELX_P23  23  VAL B 99  ? ALA B 107 ? VAL B 99  ALA B 107 5 ? 9  
HELX_P HELX_P24  24  SER B 113 ? LEU B 121 ? SER B 113 LEU B 121 1 ? 9  
HELX_P HELX_P25  25  SER B 123 ? GLN B 135 ? SER B 123 GLN B 135 1 ? 13 
HELX_P HELX_P26  26  LYS B 160 ? LYS B 165 ? LYS B 160 LYS B 165 5 ? 6  
HELX_P HELX_P27  27  SER B 174 ? GLY B 185 ? SER B 174 GLY B 185 1 ? 12 
HELX_P HELX_P28  28  SER B 192 ? SER B 194 ? SER B 192 SER B 194 5 ? 3  
HELX_P HELX_P29  29  ASP B 195 ? GLU B 202 ? ASP B 195 GLU B 202 1 ? 8  
HELX_P HELX_P30  30  PRO B 211 ? GLY B 218 ? PRO B 211 GLY B 218 1 ? 8  
HELX_P HELX_P31  31  LYS B 219 ? VAL B 223 ? LYS B 219 VAL B 223 5 ? 5  
HELX_P HELX_P32  32  THR B 243 ? LEU B 249 ? THR B 243 LEU B 249 1 ? 7  
HELX_P HELX_P33  33  THR B 250 ? ALA B 286 ? THR B 250 ALA B 286 1 ? 37 
HELX_P HELX_P34  34  ASP B 294 ? VAL B 302 ? ASP B 294 VAL B 302 1 ? 9  
HELX_P HELX_P35  35  VAL B 302 ? GLY B 309 ? VAL B 302 GLY B 309 1 ? 8  
HELX_P HELX_P36  36  ASN B 316 ? PHE B 328 ? ASN B 316 PHE B 328 1 ? 13 
HELX_P HELX_P37  37  GLU C 39  ? SER C 56  ? GLU C 39  SER C 56  1 ? 18 
HELX_P HELX_P38  38  SER C 72  ? PHE C 82  ? SER C 72  PHE C 82  1 ? 11 
HELX_P HELX_P39  39  ASP C 91  ? MET C 96  ? ASP C 91  MET C 96  1 ? 6  
HELX_P HELX_P40  40  ASP C 97  ? ILE C 98  ? ASP C 97  ILE C 98  5 ? 2  
HELX_P HELX_P41  41  VAL C 99  ? ILE C 105 ? VAL C 99  ILE C 105 5 ? 7  
HELX_P HELX_P42  42  SER C 113 ? LEU C 121 ? SER C 113 LEU C 121 1 ? 9  
HELX_P HELX_P43  43  SER C 123 ? GLN C 135 ? SER C 123 GLN C 135 1 ? 13 
HELX_P HELX_P44  44  LYS C 160 ? LYS C 165 ? LYS C 160 LYS C 165 5 ? 6  
HELX_P HELX_P45  45  SER C 174 ? GLY C 185 ? SER C 174 GLY C 185 1 ? 12 
HELX_P HELX_P46  46  SER C 192 ? SER C 194 ? SER C 192 SER C 194 5 ? 3  
HELX_P HELX_P47  47  ASP C 195 ? GLU C 202 ? ASP C 195 GLU C 202 1 ? 8  
HELX_P HELX_P48  48  THR C 212 ? GLY C 218 ? THR C 212 GLY C 218 1 ? 7  
HELX_P HELX_P49  49  LYS C 219 ? VAL C 223 ? LYS C 219 VAL C 223 5 ? 5  
HELX_P HELX_P50  50  THR C 243 ? ASN C 247 ? THR C 243 ASN C 247 1 ? 5  
HELX_P HELX_P51  51  THR C 250 ? ALA C 286 ? THR C 250 ALA C 286 1 ? 37 
HELX_P HELX_P52  52  ASP C 294 ? VAL C 302 ? ASP C 294 VAL C 302 1 ? 9  
HELX_P HELX_P53  53  ASN C 316 ? LEU C 325 ? ASN C 316 LEU C 325 1 ? 10 
HELX_P HELX_P54  54  GLU D 39  ? SER D 56  ? GLU D 39  SER D 56  1 ? 18 
HELX_P HELX_P55  55  SER D 72  ? PHE D 82  ? SER D 72  PHE D 82  1 ? 11 
HELX_P HELX_P56  56  ASP D 91  ? MET D 96  ? ASP D 91  MET D 96  1 ? 6  
HELX_P HELX_P57  57  ASP D 97  ? ILE D 98  ? ASP D 97  ILE D 98  5 ? 2  
HELX_P HELX_P58  58  VAL D 99  ? ILE D 105 ? VAL D 99  ILE D 105 5 ? 7  
HELX_P HELX_P59  59  SER D 113 ? LEU D 121 ? SER D 113 LEU D 121 1 ? 9  
HELX_P HELX_P60  60  SER D 123 ? GLN D 135 ? SER D 123 GLN D 135 1 ? 13 
HELX_P HELX_P61  61  LYS D 160 ? LYS D 165 ? LYS D 160 LYS D 165 5 ? 6  
HELX_P HELX_P62  62  SER D 174 ? GLY D 185 ? SER D 174 GLY D 185 1 ? 12 
HELX_P HELX_P63  63  SER D 192 ? SER D 194 ? SER D 192 SER D 194 5 ? 3  
HELX_P HELX_P64  64  ASP D 195 ? GLU D 202 ? ASP D 195 GLU D 202 1 ? 8  
HELX_P HELX_P65  65  PRO D 211 ? GLY D 218 ? PRO D 211 GLY D 218 1 ? 8  
HELX_P HELX_P66  66  LYS D 219 ? VAL D 223 ? LYS D 219 VAL D 223 5 ? 5  
HELX_P HELX_P67  67  THR D 243 ? ASN D 247 ? THR D 243 ASN D 247 1 ? 5  
HELX_P HELX_P68  68  THR D 250 ? ALA D 286 ? THR D 250 ALA D 286 1 ? 37 
HELX_P HELX_P69  69  ASP D 294 ? VAL D 302 ? ASP D 294 VAL D 302 1 ? 9  
HELX_P HELX_P70  70  ASN D 316 ? LEU D 325 ? ASN D 316 LEU D 325 1 ? 10 
HELX_P HELX_P71  71  GLU E 39  ? SER E 56  ? GLU E 39  SER E 56  1 ? 18 
HELX_P HELX_P72  72  SER E 72  ? PHE E 82  ? SER E 72  PHE E 82  1 ? 11 
HELX_P HELX_P73  73  ASP E 91  ? MET E 96  ? ASP E 91  MET E 96  1 ? 6  
HELX_P HELX_P74  74  ASP E 97  ? ILE E 98  ? ASP E 97  ILE E 98  5 ? 2  
HELX_P HELX_P75  75  VAL E 99  ? ALA E 107 ? VAL E 99  ALA E 107 5 ? 9  
HELX_P HELX_P76  76  SER E 113 ? LEU E 121 ? SER E 113 LEU E 121 1 ? 9  
HELX_P HELX_P77  77  SER E 123 ? GLN E 135 ? SER E 123 GLN E 135 1 ? 13 
HELX_P HELX_P78  78  LYS E 160 ? LYS E 165 ? LYS E 160 LYS E 165 5 ? 6  
HELX_P HELX_P79  79  SER E 174 ? GLY E 185 ? SER E 174 GLY E 185 1 ? 12 
HELX_P HELX_P80  80  SER E 192 ? SER E 194 ? SER E 192 SER E 194 5 ? 3  
HELX_P HELX_P81  81  ASP E 195 ? GLU E 202 ? ASP E 195 GLU E 202 1 ? 8  
HELX_P HELX_P82  82  THR E 212 ? GLY E 218 ? THR E 212 GLY E 218 1 ? 7  
HELX_P HELX_P83  83  LYS E 219 ? VAL E 223 ? LYS E 219 VAL E 223 5 ? 5  
HELX_P HELX_P84  84  THR E 243 ? LEU E 249 ? THR E 243 LEU E 249 1 ? 7  
HELX_P HELX_P85  85  THR E 250 ? ALA E 286 ? THR E 250 ALA E 286 1 ? 37 
HELX_P HELX_P86  86  ASP E 294 ? VAL E 302 ? ASP E 294 VAL E 302 1 ? 9  
HELX_P HELX_P87  87  VAL E 302 ? GLY E 309 ? VAL E 302 GLY E 309 1 ? 8  
HELX_P HELX_P88  88  ASN E 316 ? GLN E 327 ? ASN E 316 GLN E 327 1 ? 12 
HELX_P HELX_P89  89  GLU F 39  ? SER F 56  ? GLU F 39  SER F 56  1 ? 18 
HELX_P HELX_P90  90  SER F 72  ? PHE F 82  ? SER F 72  PHE F 82  1 ? 11 
HELX_P HELX_P91  91  ASP F 91  ? MET F 96  ? ASP F 91  MET F 96  1 ? 6  
HELX_P HELX_P92  92  ASP F 97  ? ILE F 98  ? ASP F 97  ILE F 98  5 ? 2  
HELX_P HELX_P93  93  VAL F 99  ? ALA F 107 ? VAL F 99  ALA F 107 5 ? 9  
HELX_P HELX_P94  94  SER F 113 ? LEU F 121 ? SER F 113 LEU F 121 1 ? 9  
HELX_P HELX_P95  95  SER F 123 ? HIS F 136 ? SER F 123 HIS F 136 1 ? 14 
HELX_P HELX_P96  96  LYS F 160 ? LYS F 165 ? LYS F 160 LYS F 165 5 ? 6  
HELX_P HELX_P97  97  SER F 174 ? GLY F 185 ? SER F 174 GLY F 185 1 ? 12 
HELX_P HELX_P98  98  SER F 192 ? SER F 194 ? SER F 192 SER F 194 5 ? 3  
HELX_P HELX_P99  99  ASP F 195 ? GLU F 202 ? ASP F 195 GLU F 202 1 ? 8  
HELX_P HELX_P100 100 PRO F 211 ? GLY F 218 ? PRO F 211 GLY F 218 1 ? 8  
HELX_P HELX_P101 101 LYS F 219 ? VAL F 223 ? LYS F 219 VAL F 223 5 ? 5  
HELX_P HELX_P102 102 THR F 243 ? LEU F 249 ? THR F 243 LEU F 249 1 ? 7  
HELX_P HELX_P103 103 THR F 250 ? ALA F 286 ? THR F 250 ALA F 286 1 ? 37 
HELX_P HELX_P104 104 ASP F 294 ? VAL F 302 ? ASP F 294 VAL F 302 1 ? 9  
HELX_P HELX_P105 105 VAL F 302 ? GLY F 309 ? VAL F 302 GLY F 309 1 ? 8  
HELX_P HELX_P106 106 ASN F 316 ? PHE F 328 ? ASN F 316 PHE F 328 1 ? 13 
HELX_P HELX_P107 107 GLU G 39  ? SER G 56  ? GLU G 39  SER G 56  1 ? 18 
HELX_P HELX_P108 108 SER G 72  ? PHE G 82  ? SER G 72  PHE G 82  1 ? 11 
HELX_P HELX_P109 109 ASP G 91  ? MET G 96  ? ASP G 91  MET G 96  1 ? 6  
HELX_P HELX_P110 110 ASP G 97  ? ILE G 98  ? ASP G 97  ILE G 98  5 ? 2  
HELX_P HELX_P111 111 VAL G 99  ? ILE G 105 ? VAL G 99  ILE G 105 5 ? 7  
HELX_P HELX_P112 112 SER G 113 ? LEU G 121 ? SER G 113 LEU G 121 1 ? 9  
HELX_P HELX_P113 113 SER G 123 ? GLN G 135 ? SER G 123 GLN G 135 1 ? 13 
HELX_P HELX_P114 114 LYS G 160 ? LYS G 165 ? LYS G 160 LYS G 165 1 ? 6  
HELX_P HELX_P115 115 SER G 174 ? GLY G 185 ? SER G 174 GLY G 185 1 ? 12 
HELX_P HELX_P116 116 SER G 192 ? SER G 194 ? SER G 192 SER G 194 5 ? 3  
HELX_P HELX_P117 117 ASP G 195 ? GLU G 202 ? ASP G 195 GLU G 202 1 ? 8  
HELX_P HELX_P118 118 PRO G 211 ? GLY G 218 ? PRO G 211 GLY G 218 1 ? 8  
HELX_P HELX_P119 119 LYS G 219 ? VAL G 223 ? LYS G 219 VAL G 223 5 ? 5  
HELX_P HELX_P120 120 THR G 243 ? ASN G 247 ? THR G 243 ASN G 247 1 ? 5  
HELX_P HELX_P121 121 THR G 250 ? ALA G 286 ? THR G 250 ALA G 286 1 ? 37 
HELX_P HELX_P122 122 ASP G 294 ? VAL G 302 ? ASP G 294 VAL G 302 1 ? 9  
HELX_P HELX_P123 123 ASP G 304 ? GLY G 309 ? ASP G 304 GLY G 309 1 ? 6  
HELX_P HELX_P124 124 ASN G 316 ? SER G 326 ? ASN G 316 SER G 326 1 ? 11 
HELX_P HELX_P125 125 GLU H 39  ? SER H 56  ? GLU H 39  SER H 56  1 ? 18 
HELX_P HELX_P126 126 SER H 72  ? PHE H 82  ? SER H 72  PHE H 82  1 ? 11 
HELX_P HELX_P127 127 ASP H 91  ? MET H 96  ? ASP H 91  MET H 96  1 ? 6  
HELX_P HELX_P128 128 ASP H 97  ? ILE H 98  ? ASP H 97  ILE H 98  5 ? 2  
HELX_P HELX_P129 129 VAL H 99  ? ILE H 105 ? VAL H 99  ILE H 105 5 ? 7  
HELX_P HELX_P130 130 SER H 113 ? LEU H 121 ? SER H 113 LEU H 121 1 ? 9  
HELX_P HELX_P131 131 SER H 123 ? GLN H 135 ? SER H 123 GLN H 135 1 ? 13 
HELX_P HELX_P132 132 LYS H 160 ? LYS H 165 ? LYS H 160 LYS H 165 5 ? 6  
HELX_P HELX_P133 133 SER H 174 ? GLY H 185 ? SER H 174 GLY H 185 1 ? 12 
HELX_P HELX_P134 134 SER H 192 ? SER H 194 ? SER H 192 SER H 194 5 ? 3  
HELX_P HELX_P135 135 ASP H 195 ? GLU H 202 ? ASP H 195 GLU H 202 1 ? 8  
HELX_P HELX_P136 136 PRO H 211 ? GLY H 218 ? PRO H 211 GLY H 218 1 ? 8  
HELX_P HELX_P137 137 LYS H 219 ? VAL H 223 ? LYS H 219 VAL H 223 5 ? 5  
HELX_P HELX_P138 138 THR H 243 ? ASN H 247 ? THR H 243 ASN H 247 1 ? 5  
HELX_P HELX_P139 139 THR H 250 ? ALA H 286 ? THR H 250 ALA H 286 1 ? 37 
HELX_P HELX_P140 140 ASP H 294 ? VAL H 302 ? ASP H 294 VAL H 302 1 ? 9  
HELX_P HELX_P141 141 VAL H 302 ? GLY H 309 ? VAL H 302 GLY H 309 1 ? 8  
HELX_P HELX_P142 142 ASN H 316 ? GLN H 327 ? ASN H 316 GLN H 327 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 2 ? 
D ? 6 ? 
E ? 5 ? 
F ? 2 ? 
G ? 6 ? 
H ? 5 ? 
I ? 2 ? 
J ? 6 ? 
K ? 5 ? 
L ? 2 ? 
M ? 6 ? 
N ? 5 ? 
O ? 2 ? 
P ? 6 ? 
Q ? 5 ? 
R ? 2 ? 
S ? 6 ? 
T ? 5 ? 
U ? 2 ? 
V ? 6 ? 
W ? 5 ? 
X ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? parallel      
F 1 2 ? parallel      
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? parallel      
I 1 2 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? anti-parallel 
K 4 5 ? parallel      
L 1 2 ? parallel      
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
M 5 6 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? anti-parallel 
N 4 5 ? parallel      
O 1 2 ? parallel      
P 1 2 ? parallel      
P 2 3 ? parallel      
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
P 5 6 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? parallel      
Q 3 4 ? anti-parallel 
Q 4 5 ? parallel      
R 1 2 ? parallel      
S 1 2 ? parallel      
S 2 3 ? parallel      
S 3 4 ? anti-parallel 
S 4 5 ? anti-parallel 
S 5 6 ? anti-parallel 
T 1 2 ? parallel      
T 2 3 ? parallel      
T 3 4 ? anti-parallel 
T 4 5 ? parallel      
U 1 2 ? parallel      
V 1 2 ? parallel      
V 2 3 ? parallel      
V 3 4 ? anti-parallel 
V 4 5 ? anti-parallel 
V 5 6 ? anti-parallel 
W 1 2 ? parallel      
W 2 3 ? parallel      
W 3 4 ? anti-parallel 
W 4 5 ? parallel      
X 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 60  ? PHE A 65  ? ILE A 60  PHE A 65  
A 2 THR A 27  ? ALA A 32  ? THR A 27  ALA A 32  
A 3 ILE A 86  ? ILE A 89  ? ILE A 86  ILE A 89  
A 4 ASN A 226 ? GLY A 242 ? ASN A 226 GLY A 242 
A 5 ILE A 138 ? THR A 154 ? ILE A 138 THR A 154 
A 6 GLY A 207 ? ASN A 210 ? GLY A 207 ASN A 210 
B 1 ILE A 60  ? PHE A 65  ? ILE A 60  PHE A 65  
B 2 THR A 27  ? ALA A 32  ? THR A 27  ALA A 32  
B 3 ILE A 86  ? ILE A 89  ? ILE A 86  ILE A 89  
B 4 ASN A 226 ? GLY A 242 ? ASN A 226 GLY A 242 
B 5 THR A 289 ? ASN A 291 ? THR A 289 ASN A 291 
C 1 LYS A 168 ? VAL A 171 ? LYS A 168 VAL A 171 
C 2 VAL A 187 ? PRO A 190 ? VAL A 187 PRO A 190 
D 1 ILE B 60  ? PHE B 65  ? ILE B 60  PHE B 65  
D 2 THR B 27  ? ALA B 32  ? THR B 27  ALA B 32  
D 3 ILE B 86  ? ILE B 89  ? ILE B 86  ILE B 89  
D 4 ASN B 226 ? GLY B 242 ? ASN B 226 GLY B 242 
D 5 ILE B 138 ? THR B 154 ? ILE B 138 THR B 154 
D 6 GLY B 207 ? ASN B 210 ? GLY B 207 ASN B 210 
E 1 ILE B 60  ? PHE B 65  ? ILE B 60  PHE B 65  
E 2 THR B 27  ? ALA B 32  ? THR B 27  ALA B 32  
E 3 ILE B 86  ? ILE B 89  ? ILE B 86  ILE B 89  
E 4 ASN B 226 ? GLY B 242 ? ASN B 226 GLY B 242 
E 5 THR B 289 ? ASN B 291 ? THR B 289 ASN B 291 
F 1 LYS B 168 ? VAL B 171 ? LYS B 168 VAL B 171 
F 2 VAL B 187 ? PRO B 190 ? VAL B 187 PRO B 190 
G 1 ILE C 60  ? PHE C 65  ? ILE C 60  PHE C 65  
G 2 THR C 27  ? ALA C 32  ? THR C 27  ALA C 32  
G 3 ILE C 86  ? ILE C 89  ? ILE C 86  ILE C 89  
G 4 ASN C 226 ? GLY C 242 ? ASN C 226 GLY C 242 
G 5 ILE C 138 ? THR C 154 ? ILE C 138 THR C 154 
G 6 GLY C 207 ? PRO C 211 ? GLY C 207 PRO C 211 
H 1 ILE C 60  ? PHE C 65  ? ILE C 60  PHE C 65  
H 2 THR C 27  ? ALA C 32  ? THR C 27  ALA C 32  
H 3 ILE C 86  ? ILE C 89  ? ILE C 86  ILE C 89  
H 4 ASN C 226 ? GLY C 242 ? ASN C 226 GLY C 242 
H 5 THR C 289 ? ASN C 291 ? THR C 289 ASN C 291 
I 1 LYS C 168 ? VAL C 171 ? LYS C 168 VAL C 171 
I 2 VAL C 187 ? PRO C 190 ? VAL C 187 PRO C 190 
J 1 ILE D 60  ? PHE D 65  ? ILE D 60  PHE D 65  
J 2 THR D 27  ? ALA D 32  ? THR D 27  ALA D 32  
J 3 ILE D 86  ? ILE D 89  ? ILE D 86  ILE D 89  
J 4 ASN D 226 ? GLY D 242 ? ASN D 226 GLY D 242 
J 5 ILE D 138 ? THR D 154 ? ILE D 138 THR D 154 
J 6 GLY D 207 ? ASN D 210 ? GLY D 207 ASN D 210 
K 1 ILE D 60  ? PHE D 65  ? ILE D 60  PHE D 65  
K 2 THR D 27  ? ALA D 32  ? THR D 27  ALA D 32  
K 3 ILE D 86  ? ILE D 89  ? ILE D 86  ILE D 89  
K 4 ASN D 226 ? GLY D 242 ? ASN D 226 GLY D 242 
K 5 THR D 289 ? ASN D 291 ? THR D 289 ASN D 291 
L 1 LYS D 168 ? VAL D 171 ? LYS D 168 VAL D 171 
L 2 VAL D 187 ? PRO D 190 ? VAL D 187 PRO D 190 
M 1 ILE E 60  ? PHE E 65  ? ILE E 60  PHE E 65  
M 2 THR E 27  ? ALA E 32  ? THR E 27  ALA E 32  
M 3 ILE E 86  ? ILE E 89  ? ILE E 86  ILE E 89  
M 4 ASN E 226 ? GLY E 242 ? ASN E 226 GLY E 242 
M 5 ILE E 138 ? THR E 154 ? ILE E 138 THR E 154 
M 6 GLY E 207 ? PRO E 211 ? GLY E 207 PRO E 211 
N 1 ILE E 60  ? PHE E 65  ? ILE E 60  PHE E 65  
N 2 THR E 27  ? ALA E 32  ? THR E 27  ALA E 32  
N 3 ILE E 86  ? ILE E 89  ? ILE E 86  ILE E 89  
N 4 ASN E 226 ? GLY E 242 ? ASN E 226 GLY E 242 
N 5 THR E 289 ? ASN E 291 ? THR E 289 ASN E 291 
O 1 LYS E 168 ? VAL E 171 ? LYS E 168 VAL E 171 
O 2 VAL E 187 ? PRO E 190 ? VAL E 187 PRO E 190 
P 1 ILE F 60  ? PHE F 65  ? ILE F 60  PHE F 65  
P 2 THR F 27  ? ALA F 32  ? THR F 27  ALA F 32  
P 3 ILE F 86  ? ILE F 89  ? ILE F 86  ILE F 89  
P 4 ASN F 226 ? GLY F 242 ? ASN F 226 GLY F 242 
P 5 ILE F 138 ? THR F 154 ? ILE F 138 THR F 154 
P 6 GLY F 207 ? ASN F 210 ? GLY F 207 ASN F 210 
Q 1 ILE F 60  ? PHE F 65  ? ILE F 60  PHE F 65  
Q 2 THR F 27  ? ALA F 32  ? THR F 27  ALA F 32  
Q 3 ILE F 86  ? ILE F 89  ? ILE F 86  ILE F 89  
Q 4 ASN F 226 ? GLY F 242 ? ASN F 226 GLY F 242 
Q 5 THR F 289 ? ASN F 291 ? THR F 289 ASN F 291 
R 1 LYS F 168 ? VAL F 171 ? LYS F 168 VAL F 171 
R 2 VAL F 187 ? PRO F 190 ? VAL F 187 PRO F 190 
S 1 VAL G 61  ? PHE G 65  ? VAL G 61  PHE G 65  
S 2 GLU G 28  ? ALA G 32  ? GLU G 28  ALA G 32  
S 3 ILE G 86  ? ILE G 89  ? ILE G 86  ILE G 89  
S 4 ASN G 226 ? GLY G 242 ? ASN G 226 GLY G 242 
S 5 ILE G 138 ? THR G 154 ? ILE G 138 THR G 154 
S 6 GLY G 207 ? ASN G 210 ? GLY G 207 ASN G 210 
T 1 VAL G 61  ? PHE G 65  ? VAL G 61  PHE G 65  
T 2 GLU G 28  ? ALA G 32  ? GLU G 28  ALA G 32  
T 3 ILE G 86  ? ILE G 89  ? ILE G 86  ILE G 89  
T 4 ASN G 226 ? GLY G 242 ? ASN G 226 GLY G 242 
T 5 THR G 289 ? ASN G 291 ? THR G 289 ASN G 291 
U 1 LYS G 168 ? VAL G 171 ? LYS G 168 VAL G 171 
U 2 VAL G 187 ? PRO G 190 ? VAL G 187 PRO G 190 
V 1 VAL H 61  ? PHE H 65  ? VAL H 61  PHE H 65  
V 2 GLU H 28  ? ALA H 32  ? GLU H 28  ALA H 32  
V 3 ILE H 86  ? ILE H 89  ? ILE H 86  ILE H 89  
V 4 ASN H 226 ? GLY H 242 ? ASN H 226 GLY H 242 
V 5 ILE H 138 ? THR H 154 ? ILE H 138 THR H 154 
V 6 GLY H 207 ? ASN H 210 ? GLY H 207 ASN H 210 
W 1 VAL H 61  ? PHE H 65  ? VAL H 61  PHE H 65  
W 2 GLU H 28  ? ALA H 32  ? GLU H 28  ALA H 32  
W 3 ILE H 86  ? ILE H 89  ? ILE H 86  ILE H 89  
W 4 ASN H 226 ? GLY H 242 ? ASN H 226 GLY H 242 
W 5 THR H 289 ? ASN H 291 ? THR H 289 ASN H 291 
X 1 LYS H 168 ? VAL H 171 ? LYS H 168 VAL H 171 
X 2 VAL H 187 ? PRO H 190 ? VAL H 187 PRO H 190 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 63  ? O LYS A 63  N VAL A 31  ? N VAL A 31  
A 2 3 N MET A 30  ? N MET A 30  O ILE A 87  ? O ILE A 87  
A 3 4 N THR A 88  ? N THR A 88  O VAL A 240 ? O VAL A 240 
A 4 5 O ALA A 241 ? O ALA A 241 N HIS A 139 ? N HIS A 139 
A 5 6 N LEU A 153 ? N LEU A 153 O LEU A 208 ? O LEU A 208 
B 1 2 O LYS A 63  ? O LYS A 63  N VAL A 31  ? N VAL A 31  
B 2 3 N MET A 30  ? N MET A 30  O ILE A 87  ? O ILE A 87  
B 3 4 N THR A 88  ? N THR A 88  O VAL A 240 ? O VAL A 240 
B 4 5 N LEU A 227 ? N LEU A 227 O ASN A 291 ? O ASN A 291 
C 1 2 N VAL A 169 ? N VAL A 169 O THR A 189 ? O THR A 189 
D 1 2 O PHE B 65  ? O PHE B 65  N VAL B 31  ? N VAL B 31  
D 2 3 N MET B 30  ? N MET B 30  O ILE B 87  ? O ILE B 87  
D 3 4 N THR B 88  ? N THR B 88  O VAL B 240 ? O VAL B 240 
D 4 5 O ALA B 241 ? O ALA B 241 N HIS B 139 ? N HIS B 139 
D 5 6 N LEU B 153 ? N LEU B 153 O LEU B 208 ? O LEU B 208 
E 1 2 O PHE B 65  ? O PHE B 65  N VAL B 31  ? N VAL B 31  
E 2 3 N MET B 30  ? N MET B 30  O ILE B 87  ? O ILE B 87  
E 3 4 N THR B 88  ? N THR B 88  O VAL B 240 ? O VAL B 240 
E 4 5 N LEU B 227 ? N LEU B 227 O ASN B 291 ? O ASN B 291 
F 1 2 N VAL B 169 ? N VAL B 169 O THR B 189 ? O THR B 189 
G 1 2 O LYS C 63  ? O LYS C 63  N VAL C 31  ? N VAL C 31  
G 2 3 N MET C 30  ? N MET C 30  O ILE C 87  ? O ILE C 87  
G 3 4 N THR C 88  ? N THR C 88  O VAL C 240 ? O VAL C 240 
G 4 5 O SER C 237 ? O SER C 237 N VAL C 145 ? N VAL C 145 
G 5 6 N LEU C 153 ? N LEU C 153 O LEU C 208 ? O LEU C 208 
H 1 2 O LYS C 63  ? O LYS C 63  N VAL C 31  ? N VAL C 31  
H 2 3 N MET C 30  ? N MET C 30  O ILE C 87  ? O ILE C 87  
H 3 4 N THR C 88  ? N THR C 88  O VAL C 240 ? O VAL C 240 
H 4 5 N LEU C 227 ? N LEU C 227 O ASN C 291 ? O ASN C 291 
I 1 2 N VAL C 169 ? N VAL C 169 O THR C 189 ? O THR C 189 
J 1 2 O LYS D 63  ? O LYS D 63  N VAL D 31  ? N VAL D 31  
J 2 3 N MET D 30  ? N MET D 30  O ILE D 87  ? O ILE D 87  
J 3 4 N THR D 88  ? N THR D 88  O VAL D 240 ? O VAL D 240 
J 4 5 O ASN D 226 ? O ASN D 226 N THR D 154 ? N THR D 154 
J 5 6 N LEU D 153 ? N LEU D 153 O LEU D 208 ? O LEU D 208 
K 1 2 O LYS D 63  ? O LYS D 63  N VAL D 31  ? N VAL D 31  
K 2 3 N MET D 30  ? N MET D 30  O ILE D 87  ? O ILE D 87  
K 3 4 N THR D 88  ? N THR D 88  O VAL D 240 ? O VAL D 240 
K 4 5 N LEU D 227 ? N LEU D 227 O ASN D 291 ? O ASN D 291 
L 1 2 N VAL D 169 ? N VAL D 169 O THR D 189 ? O THR D 189 
M 1 2 O LYS E 63  ? O LYS E 63  N VAL E 31  ? N VAL E 31  
M 2 3 N MET E 30  ? N MET E 30  O ILE E 87  ? O ILE E 87  
M 3 4 N THR E 88  ? N THR E 88  O VAL E 240 ? O VAL E 240 
M 4 5 O ALA E 241 ? O ALA E 241 N HIS E 139 ? N HIS E 139 
M 5 6 N LEU E 153 ? N LEU E 153 O LEU E 208 ? O LEU E 208 
N 1 2 O LYS E 63  ? O LYS E 63  N VAL E 31  ? N VAL E 31  
N 2 3 N MET E 30  ? N MET E 30  O ILE E 87  ? O ILE E 87  
N 3 4 N THR E 88  ? N THR E 88  O VAL E 240 ? O VAL E 240 
N 4 5 N LEU E 227 ? N LEU E 227 O ASN E 291 ? O ASN E 291 
O 1 2 N VAL E 169 ? N VAL E 169 O THR E 189 ? O THR E 189 
P 1 2 O LYS F 63  ? O LYS F 63  N VAL F 31  ? N VAL F 31  
P 2 3 N MET F 30  ? N MET F 30  O ILE F 87  ? O ILE F 87  
P 3 4 N THR F 88  ? N THR F 88  O VAL F 240 ? O VAL F 240 
P 4 5 O ALA F 241 ? O ALA F 241 N HIS F 139 ? N HIS F 139 
P 5 6 N LEU F 153 ? N LEU F 153 O LEU F 208 ? O LEU F 208 
Q 1 2 O LYS F 63  ? O LYS F 63  N VAL F 31  ? N VAL F 31  
Q 2 3 N MET F 30  ? N MET F 30  O ILE F 87  ? O ILE F 87  
Q 3 4 N THR F 88  ? N THR F 88  O VAL F 240 ? O VAL F 240 
Q 4 5 N LEU F 227 ? N LEU F 227 O ASN F 291 ? O ASN F 291 
R 1 2 N VAL F 169 ? N VAL F 169 O THR F 189 ? O THR F 189 
S 1 2 O LYS G 63  ? O LYS G 63  N ILE G 29  ? N ILE G 29  
S 2 3 N MET G 30  ? N MET G 30  O ILE G 87  ? O ILE G 87  
S 3 4 N THR G 88  ? N THR G 88  O VAL G 240 ? O VAL G 240 
S 4 5 O ALA G 241 ? O ALA G 241 N HIS G 139 ? N HIS G 139 
S 5 6 N LEU G 153 ? N LEU G 153 O LEU G 208 ? O LEU G 208 
T 1 2 O LYS G 63  ? O LYS G 63  N ILE G 29  ? N ILE G 29  
T 2 3 N MET G 30  ? N MET G 30  O ILE G 87  ? O ILE G 87  
T 3 4 N THR G 88  ? N THR G 88  O VAL G 240 ? O VAL G 240 
T 4 5 N LEU G 227 ? N LEU G 227 O ASN G 291 ? O ASN G 291 
U 1 2 N VAL G 169 ? N VAL G 169 O THR G 189 ? O THR G 189 
V 1 2 O PHE H 65  ? O PHE H 65  N VAL H 31  ? N VAL H 31  
V 2 3 N MET H 30  ? N MET H 30  O ILE H 87  ? O ILE H 87  
V 3 4 N THR H 88  ? N THR H 88  O VAL H 240 ? O VAL H 240 
V 4 5 O ALA H 241 ? O ALA H 241 N HIS H 139 ? N HIS H 139 
V 5 6 N LEU H 153 ? N LEU H 153 O LEU H 208 ? O LEU H 208 
W 1 2 O PHE H 65  ? O PHE H 65  N VAL H 31  ? N VAL H 31  
W 2 3 N MET H 30  ? N MET H 30  O ILE H 87  ? O ILE H 87  
W 3 4 N THR H 88  ? N THR H 88  O VAL H 240 ? O VAL H 240 
W 4 5 N LEU H 227 ? N LEU H 227 O ASN H 291 ? O ASN H 291 
X 1 2 N VAL H 169 ? N VAL H 169 O THR H 189 ? O THR H 189 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 401'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 402' 
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 2Q2 A 403' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL B 401'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 402' 
AC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 2Q2 B 403' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 C 401' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 402' 
AC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 2Q2 C 403' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL D 401'  
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 D 402' 
BC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SO4 D 403' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 D 404' 
BC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 2Q2 D 405' 
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 E 401' 
BC7 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 2Q2 E 402' 
BC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 F 401' 
BC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 402' 
CC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 2Q2 F 403' 
CC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 G 401' 
CC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 G 402' 
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 G 403' 
CC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 G 404' 
CC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 2Q2 G 405' 
CC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 H 401' 
CC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 H 402' 
CC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 2Q2 H 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 3  THR A  74  ? THR A 74  . ? 1_555 ? 
2   AC1 3  HIS A  173 ? HIS A 173 . ? 1_555 ? 
3   AC1 3  HOH JA .   ? HOH A 819 . ? 1_555 ? 
4   AC2 7  SER A  111 ? SER A 111 . ? 1_555 ? 
5   AC2 7  GLN A  112 ? GLN A 112 . ? 1_555 ? 
6   AC2 7  SER A  113 ? SER A 113 . ? 1_555 ? 
7   AC2 7  LYS A  116 ? LYS A 116 . ? 1_555 ? 
8   AC2 7  HOH JA .   ? HOH A 829 . ? 1_555 ? 
9   AC2 7  HOH JA .   ? HOH A 880 . ? 1_555 ? 
10  AC2 7  HOH LA .   ? HOH C 814 . ? 1_555 ? 
11  AC3 14 GLU A  73  ? GLU A 73  . ? 1_555 ? 
12  AC3 14 ILE A  89  ? ILE A 89  . ? 1_555 ? 
13  AC3 14 SER A  90  ? SER A 90  . ? 1_555 ? 
14  AC3 14 ASP A  91  ? ASP A 91  . ? 1_555 ? 
15  AC3 14 TYR A  147 ? TYR A 147 . ? 1_555 ? 
16  AC3 14 ARG A  150 ? ARG A 150 . ? 1_555 ? 
17  AC3 14 ARG A  170 ? ARG A 170 . ? 1_555 ? 
18  AC3 14 GLN A  172 ? GLN A 172 . ? 1_555 ? 
19  AC3 14 LEU A  193 ? LEU A 193 . ? 1_555 ? 
20  AC3 14 ASN A  210 ? ASN A 210 . ? 1_555 ? 
21  AC3 14 HIS A  235 ? HIS A 235 . ? 1_555 ? 
22  AC3 14 SER A  237 ? SER A 237 . ? 1_555 ? 
23  AC3 14 HOH JA .   ? HOH A 555 . ? 1_555 ? 
24  AC3 14 HOH JA .   ? HOH A 586 . ? 1_555 ? 
25  AC4 3  THR B  74  ? THR B 74  . ? 1_555 ? 
26  AC4 3  HIS B  173 ? HIS B 173 . ? 1_555 ? 
27  AC4 3  SER B  192 ? SER B 192 . ? 1_555 ? 
28  AC5 5  SER B  111 ? SER B 111 . ? 1_555 ? 
29  AC5 5  GLN B  112 ? GLN B 112 . ? 1_555 ? 
30  AC5 5  LYS B  116 ? LYS B 116 . ? 1_555 ? 
31  AC5 5  HOH KA .   ? HOH B 863 . ? 1_555 ? 
32  AC5 5  HOH KA .   ? HOH B 954 . ? 1_555 ? 
33  AC6 14 GLU B  73  ? GLU B 73  . ? 1_555 ? 
34  AC6 14 ILE B  89  ? ILE B 89  . ? 1_555 ? 
35  AC6 14 SER B  90  ? SER B 90  . ? 1_555 ? 
36  AC6 14 ASP B  91  ? ASP B 91  . ? 1_555 ? 
37  AC6 14 TYR B  147 ? TYR B 147 . ? 1_555 ? 
38  AC6 14 ARG B  150 ? ARG B 150 . ? 1_555 ? 
39  AC6 14 ARG B  170 ? ARG B 170 . ? 1_555 ? 
40  AC6 14 GLN B  172 ? GLN B 172 . ? 1_555 ? 
41  AC6 14 LEU B  193 ? LEU B 193 . ? 1_555 ? 
42  AC6 14 ASN B  210 ? ASN B 210 . ? 1_555 ? 
43  AC6 14 HIS B  235 ? HIS B 235 . ? 1_555 ? 
44  AC6 14 SER B  237 ? SER B 237 . ? 1_555 ? 
45  AC6 14 HOH KA .   ? HOH B 528 . ? 1_555 ? 
46  AC6 14 HOH KA .   ? HOH B 604 . ? 1_555 ? 
47  AC7 9  SER C  72  ? SER C 72  . ? 1_555 ? 
48  AC7 9  GLU C  73  ? GLU C 73  . ? 1_555 ? 
49  AC7 9  THR C  74  ? THR C 74  . ? 1_555 ? 
50  AC7 9  GLN C  172 ? GLN C 172 . ? 1_555 ? 
51  AC7 9  HIS C  173 ? HIS C 173 . ? 1_555 ? 
52  AC7 9  SER C  192 ? SER C 192 . ? 1_555 ? 
53  AC7 9  LEU C  193 ? LEU C 193 . ? 1_555 ? 
54  AC7 9  HOH LA .   ? HOH C 589 . ? 1_555 ? 
55  AC7 9  HOH LA .   ? HOH C 859 . ? 1_555 ? 
56  AC8 5  SER C  111 ? SER C 111 . ? 1_555 ? 
57  AC8 5  GLN C  112 ? GLN C 112 . ? 1_555 ? 
58  AC8 5  SER C  113 ? SER C 113 . ? 1_555 ? 
59  AC8 5  LYS C  116 ? LYS C 116 . ? 1_555 ? 
60  AC8 5  HOH LA .   ? HOH C 646 . ? 1_555 ? 
61  AC9 14 GLU C  73  ? GLU C 73  . ? 1_555 ? 
62  AC9 14 ILE C  89  ? ILE C 89  . ? 1_555 ? 
63  AC9 14 SER C  90  ? SER C 90  . ? 1_555 ? 
64  AC9 14 ASP C  91  ? ASP C 91  . ? 1_555 ? 
65  AC9 14 TYR C  147 ? TYR C 147 . ? 1_555 ? 
66  AC9 14 ARG C  150 ? ARG C 150 . ? 1_555 ? 
67  AC9 14 ARG C  170 ? ARG C 170 . ? 1_555 ? 
68  AC9 14 GLN C  172 ? GLN C 172 . ? 1_555 ? 
69  AC9 14 LEU C  193 ? LEU C 193 . ? 1_555 ? 
70  AC9 14 ASN C  210 ? ASN C 210 . ? 1_555 ? 
71  AC9 14 HIS C  235 ? HIS C 235 . ? 1_555 ? 
72  AC9 14 SER C  237 ? SER C 237 . ? 1_555 ? 
73  AC9 14 HOH LA .   ? HOH C 544 . ? 1_555 ? 
74  AC9 14 HOH LA .   ? HOH C 643 . ? 1_555 ? 
75  BC1 5  ASP D  91  ? ASP D 91  . ? 1_555 ? 
76  BC1 5  GLY D  93  ? GLY D 93  . ? 1_555 ? 
77  BC1 5  SER D  174 ? SER D 174 . ? 1_555 ? 
78  BC1 5  PHE D  177 ? PHE D 177 . ? 1_555 ? 
79  BC1 5  HOH MA .   ? HOH D 518 . ? 1_555 ? 
80  BC2 6  THR A  289 ? THR A 289 . ? 1_555 ? 
81  BC2 6  HIS D  122 ? HIS D 122 . ? 1_555 ? 
82  BC2 6  LYS D  127 ? LYS D 127 . ? 1_555 ? 
83  BC2 6  HOH MA .   ? HOH D 660 . ? 1_555 ? 
84  BC2 6  HOH MA .   ? HOH D 889 . ? 1_555 ? 
85  BC2 6  HOH MA .   ? HOH D 933 . ? 1_555 ? 
86  BC3 11 SER D  72  ? SER D 72  . ? 1_555 ? 
87  BC3 11 GLU D  73  ? GLU D 73  . ? 1_555 ? 
88  BC3 11 THR D  74  ? THR D 74  . ? 1_555 ? 
89  BC3 11 GLN D  172 ? GLN D 172 . ? 1_555 ? 
90  BC3 11 HIS D  173 ? HIS D 173 . ? 1_555 ? 
91  BC3 11 MET D  191 ? MET D 191 . ? 1_555 ? 
92  BC3 11 SER D  192 ? SER D 192 . ? 1_555 ? 
93  BC3 11 LEU D  193 ? LEU D 193 . ? 1_555 ? 
94  BC3 11 HOH MA .   ? HOH D 546 . ? 1_555 ? 
95  BC3 11 HOH MA .   ? HOH D 576 . ? 1_555 ? 
96  BC3 11 HOH MA .   ? HOH D 650 . ? 1_555 ? 
97  BC4 6  SER D  111 ? SER D 111 . ? 1_555 ? 
98  BC4 6  GLN D  112 ? GLN D 112 . ? 1_555 ? 
99  BC4 6  SER D  113 ? SER D 113 . ? 1_555 ? 
100 BC4 6  LYS D  116 ? LYS D 116 . ? 1_555 ? 
101 BC4 6  HOH MA .   ? HOH D 560 . ? 1_555 ? 
102 BC4 6  HOH MA .   ? HOH D 750 . ? 1_555 ? 
103 BC5 13 GLU D  73  ? GLU D 73  . ? 1_555 ? 
104 BC5 13 ILE D  89  ? ILE D 89  . ? 1_555 ? 
105 BC5 13 SER D  90  ? SER D 90  . ? 1_555 ? 
106 BC5 13 ASP D  91  ? ASP D 91  . ? 1_555 ? 
107 BC5 13 TYR D  147 ? TYR D 147 . ? 1_555 ? 
108 BC5 13 ARG D  150 ? ARG D 150 . ? 1_555 ? 
109 BC5 13 ARG D  170 ? ARG D 170 . ? 1_555 ? 
110 BC5 13 GLN D  172 ? GLN D 172 . ? 1_555 ? 
111 BC5 13 ASN D  210 ? ASN D 210 . ? 1_555 ? 
112 BC5 13 HIS D  235 ? HIS D 235 . ? 1_555 ? 
113 BC5 13 SER D  237 ? SER D 237 . ? 1_555 ? 
114 BC5 13 HOH MA .   ? HOH D 548 . ? 1_555 ? 
115 BC5 13 HOH MA .   ? HOH D 784 . ? 1_555 ? 
116 BC6 6  SER E  111 ? SER E 111 . ? 1_555 ? 
117 BC6 6  GLN E  112 ? GLN E 112 . ? 1_555 ? 
118 BC6 6  SER E  113 ? SER E 113 . ? 1_555 ? 
119 BC6 6  LYS E  116 ? LYS E 116 . ? 1_555 ? 
120 BC6 6  HOH NA .   ? HOH E 883 . ? 1_555 ? 
121 BC6 6  HOH NA .   ? HOH E 951 . ? 1_555 ? 
122 BC7 15 GLU E  73  ? GLU E 73  . ? 1_555 ? 
123 BC7 15 ILE E  89  ? ILE E 89  . ? 1_555 ? 
124 BC7 15 SER E  90  ? SER E 90  . ? 1_555 ? 
125 BC7 15 ASP E  91  ? ASP E 91  . ? 1_555 ? 
126 BC7 15 TYR E  147 ? TYR E 147 . ? 1_555 ? 
127 BC7 15 ARG E  150 ? ARG E 150 . ? 1_555 ? 
128 BC7 15 ARG E  170 ? ARG E 170 . ? 1_555 ? 
129 BC7 15 GLN E  172 ? GLN E 172 . ? 1_555 ? 
130 BC7 15 LEU E  193 ? LEU E 193 . ? 1_555 ? 
131 BC7 15 ASN E  210 ? ASN E 210 . ? 1_555 ? 
132 BC7 15 HIS E  235 ? HIS E 235 . ? 1_555 ? 
133 BC7 15 SER E  237 ? SER E 237 . ? 1_555 ? 
134 BC7 15 HOH NA .   ? HOH E 508 . ? 1_555 ? 
135 BC7 15 HOH NA .   ? HOH E 642 . ? 1_555 ? 
136 BC7 15 HOH NA .   ? HOH E 829 . ? 1_555 ? 
137 BC8 8  SER F  72  ? SER F 72  . ? 1_555 ? 
138 BC8 8  GLU F  73  ? GLU F 73  . ? 1_555 ? 
139 BC8 8  THR F  74  ? THR F 74  . ? 1_555 ? 
140 BC8 8  HIS F  173 ? HIS F 173 . ? 1_555 ? 
141 BC8 8  SER F  192 ? SER F 192 . ? 1_555 ? 
142 BC8 8  HOH OA .   ? HOH F 521 . ? 1_555 ? 
143 BC8 8  HOH OA .   ? HOH F 575 . ? 1_555 ? 
144 BC8 8  HOH OA .   ? HOH F 759 . ? 1_555 ? 
145 BC9 4  SER F  111 ? SER F 111 . ? 1_555 ? 
146 BC9 4  GLN F  112 ? GLN F 112 . ? 1_555 ? 
147 BC9 4  LYS F  116 ? LYS F 116 . ? 1_555 ? 
148 BC9 4  HOH OA .   ? HOH F 643 . ? 1_555 ? 
149 CC1 14 GLU F  73  ? GLU F 73  . ? 1_555 ? 
150 CC1 14 ILE F  89  ? ILE F 89  . ? 1_555 ? 
151 CC1 14 SER F  90  ? SER F 90  . ? 1_555 ? 
152 CC1 14 ASP F  91  ? ASP F 91  . ? 1_555 ? 
153 CC1 14 TYR F  147 ? TYR F 147 . ? 1_555 ? 
154 CC1 14 ARG F  150 ? ARG F 150 . ? 1_555 ? 
155 CC1 14 ARG F  170 ? ARG F 170 . ? 1_555 ? 
156 CC1 14 GLN F  172 ? GLN F 172 . ? 1_555 ? 
157 CC1 14 LEU F  193 ? LEU F 193 . ? 1_555 ? 
158 CC1 14 ASN F  210 ? ASN F 210 . ? 1_555 ? 
159 CC1 14 HIS F  235 ? HIS F 235 . ? 1_555 ? 
160 CC1 14 SER F  237 ? SER F 237 . ? 1_555 ? 
161 CC1 14 HOH OA .   ? HOH F 529 . ? 1_555 ? 
162 CC1 14 HOH OA .   ? HOH F 622 . ? 1_555 ? 
163 CC2 3  HIS G  136 ? HIS G 136 . ? 1_555 ? 
164 CC2 3  HOH PA .   ? HOH G 713 . ? 1_555 ? 
165 CC2 3  HOH PA .   ? HOH G 723 . ? 1_555 ? 
166 CC3 10 SER G  72  ? SER G 72  . ? 1_555 ? 
167 CC3 10 GLU G  73  ? GLU G 73  . ? 1_555 ? 
168 CC3 10 THR G  74  ? THR G 74  . ? 1_555 ? 
169 CC3 10 GLN G  172 ? GLN G 172 . ? 1_555 ? 
170 CC3 10 HIS G  173 ? HIS G 173 . ? 1_555 ? 
171 CC3 10 MET G  191 ? MET G 191 . ? 1_555 ? 
172 CC3 10 SER G  192 ? SER G 192 . ? 1_555 ? 
173 CC3 10 HOH PA .   ? HOH G 546 . ? 1_555 ? 
174 CC3 10 HOH PA .   ? HOH G 561 . ? 1_555 ? 
175 CC3 10 HOH PA .   ? HOH G 683 . ? 1_555 ? 
176 CC4 6  SER G  111 ? SER G 111 . ? 1_555 ? 
177 CC4 6  GLN G  112 ? GLN G 112 . ? 1_555 ? 
178 CC4 6  SER G  113 ? SER G 113 . ? 1_555 ? 
179 CC4 6  LYS G  116 ? LYS G 116 . ? 1_555 ? 
180 CC4 6  HOH PA .   ? HOH G 577 . ? 1_555 ? 
181 CC4 6  HOH PA .   ? HOH G 799 . ? 1_555 ? 
182 CC5 6  HIS G  122 ? HIS G 122 . ? 1_555 ? 
183 CC5 6  ARG G  262 ? ARG G 262 . ? 1_555 ? 
184 CC5 6  HOH PA .   ? HOH G 649 . ? 1_555 ? 
185 CC5 6  HOH PA .   ? HOH G 724 . ? 1_555 ? 
186 CC5 6  HOH PA .   ? HOH G 821 . ? 1_555 ? 
187 CC5 6  HOH PA .   ? HOH G 932 . ? 1_555 ? 
188 CC6 13 GLU G  73  ? GLU G 73  . ? 1_555 ? 
189 CC6 13 ILE G  89  ? ILE G 89  . ? 1_555 ? 
190 CC6 13 SER G  90  ? SER G 90  . ? 1_555 ? 
191 CC6 13 ASP G  91  ? ASP G 91  . ? 1_555 ? 
192 CC6 13 TYR G  147 ? TYR G 147 . ? 1_555 ? 
193 CC6 13 ARG G  150 ? ARG G 150 . ? 1_555 ? 
194 CC6 13 ARG G  170 ? ARG G 170 . ? 1_555 ? 
195 CC6 13 GLN G  172 ? GLN G 172 . ? 1_555 ? 
196 CC6 13 ASN G  210 ? ASN G 210 . ? 1_555 ? 
197 CC6 13 HIS G  235 ? HIS G 235 . ? 1_555 ? 
198 CC6 13 SER G  237 ? SER G 237 . ? 1_555 ? 
199 CC6 13 HOH PA .   ? HOH G 559 . ? 1_555 ? 
200 CC6 13 HOH PA .   ? HOH G 702 . ? 1_555 ? 
201 CC7 10 SER H  72  ? SER H 72  . ? 1_555 ? 
202 CC7 10 GLU H  73  ? GLU H 73  . ? 1_555 ? 
203 CC7 10 THR H  74  ? THR H 74  . ? 1_555 ? 
204 CC7 10 ARG H  170 ? ARG H 170 . ? 1_555 ? 
205 CC7 10 GLN H  172 ? GLN H 172 . ? 1_555 ? 
206 CC7 10 HIS H  173 ? HIS H 173 . ? 1_555 ? 
207 CC7 10 SER H  192 ? SER H 192 . ? 1_555 ? 
208 CC7 10 LEU H  193 ? LEU H 193 . ? 1_555 ? 
209 CC7 10 HOH QA .   ? HOH H 585 . ? 1_555 ? 
210 CC7 10 HOH QA .   ? HOH H 587 . ? 1_555 ? 
211 CC8 8  SER H  111 ? SER H 111 . ? 1_555 ? 
212 CC8 8  GLN H  112 ? GLN H 112 . ? 1_555 ? 
213 CC8 8  SER H  113 ? SER H 113 . ? 1_555 ? 
214 CC8 8  LYS H  116 ? LYS H 116 . ? 1_555 ? 
215 CC8 8  HOH QA .   ? HOH H 625 . ? 1_555 ? 
216 CC8 8  HOH QA .   ? HOH H 697 . ? 1_555 ? 
217 CC8 8  HOH QA .   ? HOH H 790 . ? 1_555 ? 
218 CC8 8  HOH QA .   ? HOH H 857 . ? 1_555 ? 
219 CC9 14 GLU H  73  ? GLU H 73  . ? 1_555 ? 
220 CC9 14 ILE H  89  ? ILE H 89  . ? 1_555 ? 
221 CC9 14 SER H  90  ? SER H 90  . ? 1_555 ? 
222 CC9 14 ASP H  91  ? ASP H 91  . ? 1_555 ? 
223 CC9 14 TYR H  147 ? TYR H 147 . ? 1_555 ? 
224 CC9 14 ARG H  150 ? ARG H 150 . ? 1_555 ? 
225 CC9 14 ARG H  170 ? ARG H 170 . ? 1_555 ? 
226 CC9 14 GLN H  172 ? GLN H 172 . ? 1_555 ? 
227 CC9 14 LEU H  193 ? LEU H 193 . ? 1_555 ? 
228 CC9 14 ASN H  210 ? ASN H 210 . ? 1_555 ? 
229 CC9 14 HIS H  235 ? HIS H 235 . ? 1_555 ? 
230 CC9 14 SER H  237 ? SER H 237 . ? 1_555 ? 
231 CC9 14 HOH QA .   ? HOH H 520 . ? 1_555 ? 
232 CC9 14 HOH QA .   ? HOH H 933 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4O8M 
_atom_sites.fract_transf_matrix[1][1]   0.010285 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001718 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006964 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010403 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLU A  1 26  ? 107.391 127.026 74.770  1.00 29.33 ? 26  GLU A N    1 
ATOM   2     C  CA   . GLU A  1 26  ? 106.230 127.124 73.892  1.00 30.97 ? 26  GLU A CA   1 
ATOM   3     C  C    . GLU A  1 26  ? 105.748 125.739 73.488  1.00 29.24 ? 26  GLU A C    1 
ATOM   4     O  O    . GLU A  1 26  ? 106.483 124.756 73.580  1.00 25.61 ? 26  GLU A O    1 
ATOM   5     C  CB   . GLU A  1 26  ? 106.557 127.949 72.641  1.00 32.07 ? 26  GLU A CB   1 
ATOM   6     C  CG   . GLU A  1 26  ? 107.456 127.241 71.638  1.00 36.68 ? 26  GLU A CG   1 
ATOM   7     C  CD   . GLU A  1 26  ? 107.838 128.111 70.455  1.00 33.90 ? 26  GLU A CD   1 
ATOM   8     O  OE1  . GLU A  1 26  ? 107.695 129.353 70.538  1.00 36.06 ? 26  GLU A OE1  1 
ATOM   9     O  OE2  . GLU A  1 26  ? 108.291 127.548 69.441  1.00 27.54 ? 26  GLU A OE2  1 
ATOM   10    H  HA   . GLU A  1 26  ? 105.502 127.572 74.371  1.00 37.16 ? 26  GLU A HA   1 
ATOM   11    H  HB2  . GLU A  1 26  ? 105.727 128.170 72.189  1.00 38.48 ? 26  GLU A HB2  1 
ATOM   12    H  HB3  . GLU A  1 26  ? 107.006 128.764 72.916  1.00 38.48 ? 26  GLU A HB3  1 
ATOM   13    H  HG2  . GLU A  1 26  ? 108.273 126.970 72.085  1.00 44.01 ? 26  GLU A HG2  1 
ATOM   14    H  HG3  . GLU A  1 26  ? 106.993 126.460 71.297  1.00 44.01 ? 26  GLU A HG3  1 
ATOM   15    N  N    . THR A  1 27  ? 104.499 125.676 73.045  1.00 28.44 ? 27  THR A N    1 
ATOM   16    C  CA   . THR A  1 27  ? 103.893 124.426 72.594  1.00 25.15 ? 27  THR A CA   1 
ATOM   17    C  C    . THR A  1 27  ? 103.786 124.437 71.082  1.00 23.82 ? 27  THR A C    1 
ATOM   18    O  O    . THR A  1 27  ? 103.008 125.198 70.531  1.00 18.94 ? 27  THR A O    1 
ATOM   19    C  CB   . THR A  1 27  ? 102.492 124.251 73.222  1.00 22.78 ? 27  THR A CB   1 
ATOM   20    O  OG1  . THR A  1 27  ? 102.639 124.016 74.627  1.00 24.33 ? 27  THR A OG1  1 
ATOM   21    C  CG2  . THR A  1 27  ? 101.749 123.076 72.587  1.00 32.51 ? 27  THR A CG2  1 
ATOM   22    H  H    . THR A  1 27  ? 103.972 126.354 72.994  1.00 34.12 ? 27  THR A H    1 
ATOM   23    H  HA   . THR A  1 27  ? 104.455 123.670 72.864  1.00 30.18 ? 27  THR A HA   1 
ATOM   24    H  HB   . THR A  1 27  ? 101.971 125.057 73.082  1.00 27.34 ? 27  THR A HB   1 
ATOM   25    H  HG1  . THR A  1 27  ? 103.020 124.651 74.979  1.00 29.20 ? 27  THR A HG1  1 
ATOM   26    H  HG21 . THR A  1 27  ? 100.881 122.981 72.988  1.00 39.01 ? 27  THR A HG21 1 
ATOM   27    H  HG22 . THR A  1 27  ? 101.642 123.226 71.645  1.00 39.01 ? 27  THR A HG22 1 
ATOM   28    H  HG23 . THR A  1 27  ? 102.244 122.264 72.720  1.00 39.01 ? 27  THR A HG23 1 
ATOM   29    N  N    . GLU A  1 28  ? 104.587 123.611 70.415  1.00 23.32 ? 28  GLU A N    1 
ATOM   30    C  CA   . GLU A  1 28  ? 104.576 123.576 68.962  1.00 20.90 ? 28  GLU A CA   1 
ATOM   31    C  C    . GLU A  1 28  ? 103.650 122.473 68.474  1.00 17.85 ? 28  GLU A C    1 
ATOM   32    O  O    . GLU A  1 28  ? 103.678 121.339 68.971  1.00 21.99 ? 28  GLU A O    1 
ATOM   33    C  CB   . GLU A  1 28  ? 105.982 123.383 68.402  1.00 26.27 ? 28  GLU A CB   1 
ATOM   34    C  CG   . GLU A  1 28  ? 105.996 123.117 66.915  1.00 32.73 ? 28  GLU A CG   1 
ATOM   35    C  CD   . GLU A  1 28  ? 107.389 123.168 66.311  1.00 38.20 ? 28  GLU A CD   1 
ATOM   36    O  OE1  . GLU A  1 28  ? 107.793 122.178 65.661  1.00 42.72 ? 28  GLU A OE1  1 
ATOM   37    O  OE2  . GLU A  1 28  ? 108.068 124.204 66.470  1.00 34.58 ? 28  GLU A OE2  1 
ATOM   38    H  H    . GLU A  1 28  ? 105.142 123.065 70.781  1.00 27.98 ? 28  GLU A H    1 
ATOM   39    H  HA   . GLU A  1 28  ? 104.231 124.429 68.626  1.00 25.08 ? 28  GLU A HA   1 
ATOM   40    H  HB2  . GLU A  1 28  ? 106.499 124.188 68.567  1.00 31.52 ? 28  GLU A HB2  1 
ATOM   41    H  HB3  . GLU A  1 28  ? 106.397 122.627 68.846  1.00 31.52 ? 28  GLU A HB3  1 
ATOM   42    H  HG2  . GLU A  1 28  ? 105.632 122.233 66.751  1.00 39.28 ? 28  GLU A HG2  1 
ATOM   43    H  HG3  . GLU A  1 28  ? 105.453 123.787 66.471  1.00 39.28 ? 28  GLU A HG3  1 
ATOM   44    N  N    . ILE A  1 29  ? 102.810 122.826 67.515  1.00 21.75 ? 29  ILE A N    1 
ATOM   45    C  CA   . ILE A  1 29  ? 101.890 121.878 66.917  1.00 16.25 ? 29  ILE A CA   1 
ATOM   46    C  C    . ILE A  1 29  ? 102.087 121.920 65.417  1.00 12.95 ? 29  ILE A C    1 
ATOM   47    O  O    . ILE A  1 29  ? 102.141 123.002 64.816  1.00 15.38 ? 29  ILE A O    1 
ATOM   48    C  CB   . ILE A  1 29  ? 100.439 122.210 67.297  1.00 14.93 ? 29  ILE A CB   1 
ATOM   49    C  CG1  . ILE A  1 29  ? 100.311 122.213 68.823  1.00 19.11 ? 29  ILE A CG1  1 
ATOM   50    C  CG2  . ILE A  1 29  ? 99.473  121.194 66.678  1.00 12.18 ? 29  ILE A CG2  1 
ATOM   51    C  CD1  . ILE A  1 29  ? 99.053  122.825 69.336  1.00 22.24 ? 29  ILE A CD1  1 
ATOM   52    H  H    . ILE A  1 29  ? 102.754 123.620 67.190  1.00 26.10 ? 29  ILE A H    1 
ATOM   53    H  HA   . ILE A  1 29  ? 102.097 120.974 67.235  1.00 19.50 ? 29  ILE A HA   1 
ATOM   54    H  HB   . ILE A  1 29  ? 100.222 123.094 66.962  1.00 17.91 ? 29  ILE A HB   1 
ATOM   55    H  HG12 . ILE A  1 29  ? 100.342 121.296 69.139  1.00 22.94 ? 29  ILE A HG12 1 
ATOM   56    H  HG13 . ILE A  1 29  ? 101.054 122.712 69.196  1.00 22.94 ? 29  ILE A HG13 1 
ATOM   57    H  HG21 . ILE A  1 29  ? 98.575  121.424 66.930  1.00 14.61 ? 29  ILE A HG21 1 
ATOM   58    H  HG22 . ILE A  1 29  ? 99.562  121.220 65.722  1.00 14.61 ? 29  ILE A HG22 1 
ATOM   59    H  HG23 . ILE A  1 29  ? 99.690  120.318 67.004  1.00 14.61 ? 29  ILE A HG23 1 
ATOM   60    H  HD11 . ILE A  1 29  ? 99.055  122.785 70.295  1.00 26.68 ? 29  ILE A HD11 1 
ATOM   61    H  HD12 . ILE A  1 29  ? 99.010  123.739 69.046  1.00 26.68 ? 29  ILE A HD12 1 
ATOM   62    H  HD13 . ILE A  1 29  ? 98.304  122.335 68.989  1.00 26.68 ? 29  ILE A HD13 1 
ATOM   63    N  N    . MET A  1 30  ? 102.196 120.736 64.821  1.00 14.17 ? 30  MET A N    1 
ATOM   64    C  CA   . MET A  1 30  ? 102.381 120.618 63.382  1.00 15.95 ? 30  MET A CA   1 
ATOM   65    C  C    . MET A  1 30  ? 101.014 120.540 62.726  1.00 16.76 ? 30  MET A C    1 
ATOM   66    O  O    . MET A  1 30  ? 100.167 119.735 63.122  1.00 17.99 ? 30  MET A O    1 
ATOM   67    C  CB   . MET A  1 30  ? 103.162 119.354 63.052  1.00 14.20 ? 30  MET A CB   1 
ATOM   68    C  CG   . MET A  1 30  ? 104.459 119.236 63.829  1.00 17.38 ? 30  MET A CG   1 
ATOM   69    S  SD   . MET A  1 30  ? 105.552 117.928 63.281  1.00 26.03 ? 30  MET A SD   1 
ATOM   70    C  CE   . MET A  1 30  ? 104.654 116.460 63.774  1.00 32.34 ? 30  MET A CE   1 
ATOM   71    H  H    . MET A  1 30  ? 102.166 119.982 65.232  1.00 17.01 ? 30  MET A H    1 
ATOM   72    H  HA   . MET A  1 30  ? 102.873 121.395 63.042  1.00 19.14 ? 30  MET A HA   1 
ATOM   73    H  HB2  . MET A  1 30  ? 102.614 118.582 63.265  1.00 17.04 ? 30  MET A HB2  1 
ATOM   74    H  HB3  . MET A  1 30  ? 103.379 119.355 62.107  1.00 17.04 ? 30  MET A HB3  1 
ATOM   75    H  HG2  . MET A  1 30  ? 104.942 120.073 63.751  1.00 20.85 ? 30  MET A HG2  1 
ATOM   76    H  HG3  . MET A  1 30  ? 104.246 119.069 64.761  1.00 20.85 ? 30  MET A HG3  1 
ATOM   77    H  HE1  . MET A  1 30  ? 105.161 115.685 63.522  1.00 38.81 ? 30  MET A HE1  1 
ATOM   78    H  HE2  . MET A  1 30  ? 104.529 116.476 64.725  1.00 38.81 ? 30  MET A HE2  1 
ATOM   79    H  HE3  . MET A  1 30  ? 103.802 116.452 63.331  1.00 38.81 ? 30  MET A HE3  1 
ATOM   80    N  N    . VAL A  1 31  ? 100.802 121.364 61.711  1.00 15.19 ? 31  VAL A N    1 
ATOM   81    C  CA   . VAL A  1 31  ? 99.529  121.352 60.990  1.00 14.22 ? 31  VAL A CA   1 
ATOM   82    C  C    . VAL A  1 31  ? 99.718  120.741 59.593  1.00 16.29 ? 31  VAL A C    1 
ATOM   83    O  O    . VAL A  1 31  ? 100.548 121.195 58.821  1.00 14.92 ? 31  VAL A O    1 
ATOM   84    C  CB   . VAL A  1 31  ? 98.956  122.766 60.880  1.00 10.48 ? 31  VAL A CB   1 
ATOM   85    C  CG1  . VAL A  1 31  ? 97.563  122.730 60.207  1.00 10.06 ? 31  VAL A CG1  1 
ATOM   86    C  CG2  . VAL A  1 31  ? 98.902  123.426 62.251  1.00 15.83 ? 31  VAL A CG2  1 
ATOM   87    H  H    . VAL A  1 31  ? 101.372 121.938 61.418  1.00 18.22 ? 31  VAL A H    1 
ATOM   88    H  HA   . VAL A  1 31  ? 98.887  120.799 61.481  1.00 17.07 ? 31  VAL A HA   1 
ATOM   89    H  HB   . VAL A  1 31  ? 99.548  123.303 60.313  1.00 12.57 ? 31  VAL A HB   1 
ATOM   90    H  HG11 . VAL A  1 31  ? 97.221  123.625 60.148  1.00 12.08 ? 31  VAL A HG11 1 
ATOM   91    H  HG12 . VAL A  1 31  ? 97.651  122.354 59.328  1.00 12.08 ? 31  VAL A HG12 1 
ATOM   92    H  HG13 . VAL A  1 31  ? 96.974  122.189 60.737  1.00 12.08 ? 31  VAL A HG13 1 
ATOM   93    H  HG21 . VAL A  1 31  ? 98.540  124.310 62.157  1.00 19.00 ? 31  VAL A HG21 1 
ATOM   94    H  HG22 . VAL A  1 31  ? 98.342  122.902 62.828  1.00 19.00 ? 31  VAL A HG22 1 
ATOM   95    H  HG23 . VAL A  1 31  ? 99.791  123.472 62.610  1.00 19.00 ? 31  VAL A HG23 1 
ATOM   96    N  N    . ALA A  1 32  ? 98.952  119.696 59.300  1.00 13.16 ? 32  ALA A N    1 
ATOM   97    C  CA   . ALA A  1 32  ? 99.165  118.863 58.101  1.00 14.01 ? 32  ALA A CA   1 
ATOM   98    C  C    . ALA A  1 32  ? 97.977  118.966 57.165  1.00 11.23 ? 32  ALA A C    1 
ATOM   99    O  O    . ALA A  1 32  ? 96.819  118.932 57.605  1.00 11.55 ? 32  ALA A O    1 
ATOM   100   C  CB   . ALA A  1 32  ? 99.393  117.408 58.517  1.00 13.36 ? 32  ALA A CB   1 
ATOM   101   H  H    . ALA A  1 32  ? 98.289  119.439 59.783  1.00 15.79 ? 32  ALA A H    1 
ATOM   102   H  HA   . ALA A  1 32  ? 99.961  119.177 57.625  1.00 16.82 ? 32  ALA A HA   1 
ATOM   103   H  HB1  . ALA A  1 32  ? 99.529  116.876 57.729  1.00 16.03 ? 32  ALA A HB1  1 
ATOM   104   H  HB2  . ALA A  1 32  ? 100.167 117.362 59.082  1.00 16.03 ? 32  ALA A HB2  1 
ATOM   105   H  HB3  . ALA A  1 32  ? 98.620  117.095 58.993  1.00 16.03 ? 32  ALA A HB3  1 
ATOM   106   N  N    . TYR A  1 33  ? 98.259  119.139 55.872  1.00 11.35 ? 33  TYR A N    1 
ATOM   107   C  CA   . TYR A  1 33  ? 97.220  119.109 54.850  1.00 15.07 ? 33  TYR A CA   1 
ATOM   108   C  C    . TYR A  1 33  ? 97.855  118.800 53.497  1.00 9.26  ? 33  TYR A C    1 
ATOM   109   O  O    . TYR A  1 33  ? 99.088  118.794 53.373  1.00 10.61 ? 33  TYR A O    1 
ATOM   110   C  CB   . TYR A  1 33  ? 96.434  120.436 54.821  1.00 14.18 ? 33  TYR A CB   1 
ATOM   111   C  CG   . TYR A  1 33  ? 97.301  121.672 54.925  1.00 9.75  ? 33  TYR A CG   1 
ATOM   112   C  CD1  . TYR A  1 33  ? 97.909  122.020 56.134  1.00 15.24 ? 33  TYR A CD1  1 
ATOM   113   C  CD2  . TYR A  1 33  ? 97.499  122.510 53.831  1.00 14.27 ? 33  TYR A CD2  1 
ATOM   114   C  CE1  . TYR A  1 33  ? 98.707  123.153 56.241  1.00 12.51 ? 33  TYR A CE1  1 
ATOM   115   C  CE2  . TYR A  1 33  ? 98.286  123.660 53.932  1.00 9.93  ? 33  TYR A CE2  1 
ATOM   116   C  CZ   . TYR A  1 33  ? 98.890  123.969 55.126  1.00 14.79 ? 33  TYR A CZ   1 
ATOM   117   O  OH   . TYR A  1 33  ? 99.682  125.091 55.220  1.00 17.38 ? 33  TYR A OH   1 
ATOM   118   H  H    . TYR A  1 33  ? 99.050  119.277 55.563  1.00 13.62 ? 33  TYR A H    1 
ATOM   119   H  HA   . TYR A  1 33  ? 96.589  118.389 55.059  1.00 18.08 ? 33  TYR A HA   1 
ATOM   120   H  HB2  . TYR A  1 33  ? 95.943  120.489 53.986  1.00 17.01 ? 33  TYR A HB2  1 
ATOM   121   H  HB3  . TYR A  1 33  ? 95.814  120.446 55.567  1.00 17.01 ? 33  TYR A HB3  1 
ATOM   122   H  HD1  . TYR A  1 33  ? 97.792  121.473 56.877  1.00 18.29 ? 33  TYR A HD1  1 
ATOM   123   H  HD2  . TYR A  1 33  ? 97.097  122.303 53.018  1.00 17.12 ? 33  TYR A HD2  1 
ATOM   124   H  HE1  . TYR A  1 33  ? 99.112  123.367 57.050  1.00 15.01 ? 33  TYR A HE1  1 
ATOM   125   H  HE2  . TYR A  1 33  ? 98.418  124.202 53.188  1.00 11.91 ? 33  TYR A HE2  1 
ATOM   126   H  HH   . TYR A  1 33  ? 99.242  125.760 55.046  1.00 20.86 ? 33  TYR A HH   1 
ATOM   127   N  N    . GLY A  1 34  ? 97.029  118.571 52.482  1.00 11.73 ? 34  GLY A N    1 
ATOM   128   C  CA   . GLY A  1 34  ? 97.530  118.138 51.188  1.00 13.26 ? 34  GLY A CA   1 
ATOM   129   C  C    . GLY A  1 34  ? 97.655  119.275 50.174  1.00 9.37  ? 34  GLY A C    1 
ATOM   130   O  O    . GLY A  1 34  ? 98.288  119.113 49.119  1.00 11.19 ? 34  GLY A O    1 
ATOM   131   H  H    . GLY A  1 34  ? 96.174  118.659 52.518  1.00 14.07 ? 34  GLY A H    1 
ATOM   132   H  HA2  . GLY A  1 34  ? 98.405  117.736 51.302  1.00 15.91 ? 34  GLY A HA2  1 
ATOM   133   H  HA3  . GLY A  1 34  ? 96.932  117.468 50.821  1.00 15.91 ? 34  GLY A HA3  1 
ATOM   134   N  N    . ASN A  1 35  ? 97.055  120.420 50.495  1.00 9.26  ? 35  ASN A N    1 
ATOM   135   C  CA   . ASN A  1 35  ? 97.010  121.562 49.583  1.00 9.95  ? 35  ASN A CA   1 
ATOM   136   C  C    . ASN A  1 35  ? 98.351  122.266 49.403  1.00 10.48 ? 35  ASN A C    1 
ATOM   137   O  O    . ASN A  1 35  ? 99.202  122.256 50.292  1.00 14.79 ? 35  ASN A O    1 
ATOM   138   C  CB   . ASN A  1 35  ? 95.903  122.512 50.013  1.00 10.24 ? 35  ASN A CB   1 
ATOM   139   C  CG   . ASN A  1 35  ? 94.599  121.778 50.216  1.00 12.22 ? 35  ASN A CG   1 
ATOM   140   O  OD1  . ASN A  1 35  ? 94.334  121.247 51.313  1.00 13.58 ? 35  ASN A OD1  1 
ATOM   141   N  ND2  . ASN A  1 35  ? 93.824  121.647 49.146  1.00 8.50  ? 35  ASN A ND2  1 
ATOM   142   H  H    . ASN A  1 35  ? 96.661  120.562 51.246  1.00 11.12 ? 35  ASN A H    1 
ATOM   143   H  HA   . ASN A  1 35  ? 96.757  121.222 48.699  1.00 11.94 ? 35  ASN A HA   1 
ATOM   144   H  HB2  . ASN A  1 35  ? 96.149  122.934 50.851  1.00 12.29 ? 35  ASN A HB2  1 
ATOM   145   H  HB3  . ASN A  1 35  ? 95.770  123.183 49.325  1.00 12.29 ? 35  ASN A HB3  1 
ATOM   146   H  HD21 . ASN A  1 35  ? 94.076  121.972 48.391  1.00 10.20 ? 35  ASN A HD21 1 
ATOM   147   H  HD22 . ASN A  1 35  ? 93.071  121.237 49.208  1.00 10.20 ? 35  ASN A HD22 1 
ATOM   148   N  N    . GLN A  1 36  ? 98.545  122.847 48.213  1.00 11.75 ? 36  GLN A N    1 
ATOM   149   C  CA   . GLN A  1 36  ? 99.776  123.575 47.902  1.00 9.67  ? 36  GLN A CA   1 
ATOM   150   C  C    . GLN A  1 36  ? 99.815  124.988 48.478  1.00 11.15 ? 36  GLN A C    1 
ATOM   151   O  O    . GLN A  1 36  ? 98.767  125.610 48.706  1.00 16.23 ? 36  GLN A O    1 
ATOM   152   C  CB   . GLN A  1 36  ? 99.927  123.642 46.382  1.00 13.47 ? 36  GLN A CB   1 
ATOM   153   C  CG   . GLN A  1 36  ? 99.926  122.286 45.758  1.00 14.95 ? 36  GLN A CG   1 
ATOM   154   C  CD   . GLN A  1 36  ? 101.130 121.502 46.144  1.00 14.60 ? 36  GLN A CD   1 
ATOM   155   O  OE1  . GLN A  1 36  ? 102.216 122.059 46.334  1.00 19.30 ? 36  GLN A OE1  1 
ATOM   156   N  NE2  . GLN A  1 36  ? 100.965 120.200 46.263  1.00 15.96 ? 36  GLN A NE2  1 
ATOM   157   H  H    . GLN A  1 36  ? 97.976  122.832 47.568  1.00 14.10 ? 36  GLN A H    1 
ATOM   158   H  HA   . GLN A  1 36  ? 100.541 123.079 48.263  1.00 11.60 ? 36  GLN A HA   1 
ATOM   159   H  HB2  . GLN A  1 36  ? 99.187  124.147 46.011  1.00 16.16 ? 36  GLN A HB2  1 
ATOM   160   H  HB3  . GLN A  1 36  ? 100.768 124.074 46.165  1.00 16.16 ? 36  GLN A HB3  1 
ATOM   161   H  HG2  . GLN A  1 36  ? 99.140  121.800 46.052  1.00 17.94 ? 36  GLN A HG2  1 
ATOM   162   H  HG3  . GLN A  1 36  ? 99.921  122.379 44.792  1.00 17.94 ? 36  GLN A HG3  1 
ATOM   163   H  HE21 . GLN A  1 36  ? 100.193 119.850 46.119  1.00 19.16 ? 36  GLN A HE21 1 
ATOM   164   H  HE22 . GLN A  1 36  ? 101.629 119.701 46.484  1.00 19.16 ? 36  GLN A HE22 1 
ATOM   165   N  N    . PRO A  1 37  ? 101.032 125.510 48.713  1.00 16.54 ? 37  PRO A N    1 
ATOM   166   C  CA   . PRO A  1 37  ? 101.158 126.901 49.146  1.00 24.02 ? 37  PRO A CA   1 
ATOM   167   C  C    . PRO A  1 37  ? 100.359 127.825 48.251  1.00 20.15 ? 37  PRO A C    1 
ATOM   168   O  O    . PRO A  1 37  ? 100.394 127.677 47.025  1.00 15.49 ? 37  PRO A O    1 
ATOM   169   C  CB   . PRO A  1 37  ? 102.662 127.168 49.021  1.00 18.79 ? 37  PRO A CB   1 
ATOM   170   C  CG   . PRO A  1 37  ? 103.268 125.826 49.296  1.00 19.64 ? 37  PRO A CG   1 
ATOM   171   C  CD   . PRO A  1 37  ? 102.342 124.840 48.642  1.00 16.84 ? 37  PRO A CD   1 
ATOM   172   H  HA   . PRO A  1 37  ? 100.875 127.006 50.078  1.00 28.83 ? 37  PRO A HA   1 
ATOM   173   H  HB2  . PRO A  1 37  ? 102.873 127.469 48.123  1.00 22.55 ? 37  PRO A HB2  1 
ATOM   174   H  HB3  . PRO A  1 37  ? 102.941 127.819 49.683  1.00 22.55 ? 37  PRO A HB3  1 
ATOM   175   H  HG2  . PRO A  1 37  ? 104.153 125.779 48.901  1.00 23.57 ? 37  PRO A HG2  1 
ATOM   176   H  HG3  . PRO A  1 37  ? 103.310 125.675 50.253  1.00 23.57 ? 37  PRO A HG3  1 
ATOM   177   H  HD2  . PRO A  1 37  ? 102.599 124.695 47.718  1.00 20.20 ? 37  PRO A HD2  1 
ATOM   178   H  HD3  . PRO A  1 37  ? 102.325 124.008 49.141  1.00 20.20 ? 37  PRO A HD3  1 
ATOM   179   N  N    . GLY A  1 38  ? 99.607  128.726 48.869  1.00 15.66 ? 38  GLY A N    1 
ATOM   180   C  CA   . GLY A  1 38  ? 98.888  129.770 48.156  1.00 11.13 ? 38  GLY A CA   1 
ATOM   181   C  C    . GLY A  1 38  ? 97.443  129.398 47.923  1.00 14.75 ? 38  GLY A C    1 
ATOM   182   O  O    . GLY A  1 38  ? 96.638  130.272 47.598  1.00 13.97 ? 38  GLY A O    1 
ATOM   183   H  H    . GLY A  1 38  ? 99.496  128.753 49.722  1.00 18.79 ? 38  GLY A H    1 
ATOM   184   H  HA2  . GLY A  1 38  ? 98.917  130.593 48.669  1.00 13.36 ? 38  GLY A HA2  1 
ATOM   185   H  HA3  . GLY A  1 38  ? 99.310  129.926 47.297  1.00 13.36 ? 38  GLY A HA3  1 
ATOM   186   N  N    . GLU A  1 39  ? 97.100  128.113 48.094  1.00 16.03 ? 39  GLU A N    1 
ATOM   187   C  CA   . GLU A  1 39  ? 95.701  127.687 48.010  1.00 14.07 ? 39  GLU A CA   1 
ATOM   188   C  C    . GLU A  1 39  ? 94.925  128.227 49.197  1.00 11.71 ? 39  GLU A C    1 
ATOM   189   O  O    . GLU A  1 39  ? 95.500  128.514 50.242  1.00 14.91 ? 39  GLU A O    1 
ATOM   190   C  CB   . GLU A  1 39  ? 95.555  126.151 48.002  1.00 13.65 ? 39  GLU A CB   1 
ATOM   191   C  CG   . GLU A  1 39  ? 95.954  125.472 46.694  1.00 8.52  ? 39  GLU A CG   1 
ATOM   192   C  CD   . GLU A  1 39  ? 95.596  123.991 46.676  1.00 14.27 ? 39  GLU A CD   1 
ATOM   193   O  OE1  . GLU A  1 39  ? 94.461  123.646 47.087  1.00 12.29 ? 39  GLU A OE1  1 
ATOM   194   O  OE2  . GLU A  1 39  ? 96.440  123.169 46.242  1.00 18.47 ? 39  GLU A OE2  1 
ATOM   195   H  H    . GLU A  1 39  ? 97.655  127.477 48.258  1.00 19.24 ? 39  GLU A H    1 
ATOM   196   H  HA   . GLU A  1 39  ? 95.300  128.042 47.189  1.00 16.88 ? 39  GLU A HA   1 
ATOM   197   H  HB2  . GLU A  1 39  ? 96.115  125.784 48.704  1.00 16.38 ? 39  GLU A HB2  1 
ATOM   198   H  HB3  . GLU A  1 39  ? 94.627  125.928 48.176  1.00 16.38 ? 39  GLU A HB3  1 
ATOM   199   H  HG2  . GLU A  1 39  ? 95.490  125.903 45.959  1.00 10.22 ? 39  GLU A HG2  1 
ATOM   200   H  HG3  . GLU A  1 39  ? 96.913  125.551 46.575  1.00 10.22 ? 39  GLU A HG3  1 
ATOM   201   N  N    . PRO A  1 40  ? 93.600  128.337 49.050  1.00 10.04 ? 40  PRO A N    1 
ATOM   202   C  CA   . PRO A  1 40  ? 92.770  128.809 50.158  1.00 13.17 ? 40  PRO A CA   1 
ATOM   203   C  C    . PRO A  1 40  ? 93.031  128.051 51.446  1.00 13.77 ? 40  PRO A C    1 
ATOM   204   O  O    . PRO A  1 40  ? 93.173  128.710 52.451  1.00 11.48 ? 40  PRO A O    1 
ATOM   205   C  CB   . PRO A  1 40  ? 91.341  128.602 49.649  1.00 8.10  ? 40  PRO A CB   1 
ATOM   206   C  CG   . PRO A  1 40  ? 91.490  128.718 48.146  1.00 10.76 ? 40  PRO A CG   1 
ATOM   207   C  CD   . PRO A  1 40  ? 92.817  128.154 47.817  1.00 12.13 ? 40  PRO A CD   1 
ATOM   208   H  HA   . PRO A  1 40  ? 92.922  129.765 50.311  1.00 15.81 ? 40  PRO A HA   1 
ATOM   209   H  HB2  . PRO A  1 40  ? 91.023  127.721 49.900  1.00 9.71  ? 40  PRO A HB2  1 
ATOM   210   H  HB3  . PRO A  1 40  ? 90.761  129.297 49.997  1.00 9.71  ? 40  PRO A HB3  1 
ATOM   211   H  HG2  . PRO A  1 40  ? 90.788  128.211 47.711  1.00 12.91 ? 40  PRO A HG2  1 
ATOM   212   H  HG3  . PRO A  1 40  ? 91.445  129.652 47.888  1.00 12.91 ? 40  PRO A HG3  1 
ATOM   213   H  HD2  . PRO A  1 40  ? 92.737  127.211 47.606  1.00 14.56 ? 40  PRO A HD2  1 
ATOM   214   H  HD3  . PRO A  1 40  ? 93.220  128.648 47.086  1.00 14.56 ? 40  PRO A HD3  1 
ATOM   215   N  N    . ILE A  1 41  ? 93.128  126.729 51.446  1.00 8.20  ? 41  ILE A N    1 
ATOM   216   C  CA   . ILE A  1 41  ? 93.328  126.045 52.709  1.00 7.48  ? 41  ILE A CA   1 
ATOM   217   C  C    . ILE A  1 41  ? 94.660  126.457 53.312  1.00 7.99  ? 41  ILE A C    1 
ATOM   218   O  O    . ILE A  1 41  ? 94.759  126.660 54.497  1.00 10.80 ? 41  ILE A O    1 
ATOM   219   C  CB   . ILE A  1 41  ? 93.262  124.516 52.543  1.00 7.78  ? 41  ILE A CB   1 
ATOM   220   C  CG1  . ILE A  1 41  ? 91.807  124.111 52.318  1.00 10.17 ? 41  ILE A CG1  1 
ATOM   221   C  CG2  . ILE A  1 41  ? 93.862  123.847 53.751  1.00 12.32 ? 41  ILE A CG2  1 
ATOM   222   C  CD1  . ILE A  1 41  ? 90.964  124.164 53.588  1.00 11.47 ? 41  ILE A CD1  1 
ATOM   223   H  H    . ILE A  1 41  ? 93.083  126.222 50.753  1.00 9.84  ? 41  ILE A H    1 
ATOM   224   H  HA   . ILE A  1 41  ? 92.620  126.312 53.331  1.00 8.97  ? 41  ILE A HA   1 
ATOM   225   H  HB   . ILE A  1 41  ? 93.778  124.266 51.761  1.00 9.34  ? 41  ILE A HB   1 
ATOM   226   H  HG12 . ILE A  1 41  ? 91.410  124.714 51.671  1.00 12.21 ? 41  ILE A HG12 1 
ATOM   227   H  HG13 . ILE A  1 41  ? 91.783  123.202 51.982  1.00 12.21 ? 41  ILE A HG13 1 
ATOM   228   H  HG21 . ILE A  1 41  ? 93.815  122.895 53.636  1.00 14.78 ? 41  ILE A HG21 1 
ATOM   229   H  HG22 . ILE A  1 41  ? 94.778  124.122 53.837  1.00 14.78 ? 41  ILE A HG22 1 
ATOM   230   H  HG23 . ILE A  1 41  ? 93.367  124.108 54.531  1.00 14.78 ? 41  ILE A HG23 1 
ATOM   231   H  HD11 . ILE A  1 41  ? 90.065  123.899 53.377  1.00 13.76 ? 41  ILE A HD11 1 
ATOM   232   H  HD12 . ILE A  1 41  ? 91.338  123.564 54.237  1.00 13.76 ? 41  ILE A HD12 1 
ATOM   233   H  HD13 . ILE A  1 41  ? 90.969  125.061 53.929  1.00 13.76 ? 41  ILE A HD13 1 
ATOM   234   N  N    . ASP A  1 42  ? 95.688  126.598 52.482  1.00 9.17  ? 42  ASP A N    1 
ATOM   235   C  CA   . ASP A  1 42  ? 96.992  127.027 52.958  1.00 12.13 ? 42  ASP A CA   1 
ATOM   236   C  C    . ASP A  1 42  ? 96.901  128.458 53.539  1.00 9.53  ? 42  ASP A C    1 
ATOM   237   O  O    . ASP A  1 42  ? 97.444  128.749 54.620  1.00 13.74 ? 42  ASP A O    1 
ATOM   238   C  CB   . ASP A  1 42  ? 98.001  127.009 51.817  1.00 12.98 ? 42  ASP A CB   1 
ATOM   239   C  CG   . ASP A  1 42  ? 99.387  127.430 52.256  1.00 13.19 ? 42  ASP A CG   1 
ATOM   240   O  OD1  . ASP A  1 42  ? 100.038 126.674 52.990  1.00 13.54 ? 42  ASP A OD1  1 
ATOM   241   O  OD2  . ASP A  1 42  ? 99.850  128.503 51.840  1.00 12.03 ? 42  ASP A OD2  1 
ATOM   242   H  H    . ASP A  1 42  ? 95.653  126.450 51.635  1.00 11.01 ? 42  ASP A H    1 
ATOM   243   H  HA   . ASP A  1 42  ? 97.303  126.421 53.662  1.00 14.56 ? 42  ASP A HA   1 
ATOM   244   H  HB2  . ASP A  1 42  ? 98.060  126.109 51.461  1.00 15.57 ? 42  ASP A HB2  1 
ATOM   245   H  HB3  . ASP A  1 42  ? 97.707  127.622 51.125  1.00 15.57 ? 42  ASP A HB3  1 
ATOM   246   N  N    . LYS A  1 43  ? 96.193  129.344 52.861  1.00 14.41 ? 43  LYS A N    1 
ATOM   247   C  CA   . LYS A  1 43  ? 96.081  130.696 53.393  1.00 11.45 ? 43  LYS A CA   1 
ATOM   248   C  C    . LYS A  1 43  ? 95.321  130.681 54.702  1.00 14.90 ? 43  LYS A C    1 
ATOM   249   O  O    . LYS A  1 43  ? 95.655  131.448 55.613  1.00 13.51 ? 43  LYS A O    1 
ATOM   250   C  CB   . LYS A  1 43  ? 95.425  131.649 52.406  1.00 10.19 ? 43  LYS A CB   1 
ATOM   251   C  CG   . LYS A  1 43  ? 96.253  131.851 51.143  1.00 14.30 ? 43  LYS A CG   1 
ATOM   252   C  CD   . LYS A  1 43  ? 95.731  132.968 50.326  1.00 15.74 ? 43  LYS A CD   1 
ATOM   253   C  CE   . LYS A  1 43  ? 96.681  133.273 49.203  1.00 16.16 ? 43  LYS A CE   1 
ATOM   254   N  NZ   . LYS A  1 43  ? 96.200  134.433 48.456  1.00 12.98 ? 43  LYS A NZ   1 
ATOM   255   H  H    . LYS A  1 43  ? 95.781  129.201 52.120  1.00 17.29 ? 43  LYS A H    1 
ATOM   256   H  HA   . LYS A  1 43  ? 96.982  131.035 53.577  1.00 13.74 ? 43  LYS A HA   1 
ATOM   257   H  HB2  . LYS A  1 43  ? 94.563  131.289 52.145  1.00 12.22 ? 43  LYS A HB2  1 
ATOM   258   H  HB3  . LYS A  1 43  ? 95.309  132.513 52.830  1.00 12.22 ? 43  LYS A HB3  1 
ATOM   259   H  HG2  . LYS A  1 43  ? 97.168  132.056 51.389  1.00 17.17 ? 43  LYS A HG2  1 
ATOM   260   H  HG3  . LYS A  1 43  ? 96.222  131.043 50.607  1.00 17.17 ? 43  LYS A HG3  1 
ATOM   261   H  HD2  . LYS A  1 43  ? 94.874  132.720 49.947  1.00 18.88 ? 43  LYS A HD2  1 
ATOM   262   H  HD3  . LYS A  1 43  ? 95.643  133.760 50.879  1.00 18.88 ? 43  LYS A HD3  1 
ATOM   263   H  HE2  . LYS A  1 43  ? 97.558  133.478 49.564  1.00 19.40 ? 43  LYS A HE2  1 
ATOM   264   H  HE3  . LYS A  1 43  ? 96.728  132.514 48.601  1.00 19.40 ? 43  LYS A HE3  1 
ATOM   265   H  HZ1  . LYS A  1 43  ? 96.759  134.619 47.789  1.00 15.58 ? 43  LYS A HZ1  1 
ATOM   266   H  HZ2  . LYS A  1 43  ? 95.393  134.265 48.119  1.00 15.58 ? 43  LYS A HZ2  1 
ATOM   267   H  HZ3  . LYS A  1 43  ? 96.146  135.140 48.994  1.00 15.58 ? 43  LYS A HZ3  1 
ATOM   268   N  N    . ALA A  1 44  ? 94.298  129.831 54.799  1.00 14.85 ? 44  ALA A N    1 
ATOM   269   C  CA   . ALA A  1 44  ? 93.520  129.723 56.047  1.00 13.16 ? 44  ALA A CA   1 
ATOM   270   C  C    . ALA A  1 44  ? 94.366  129.208 57.208  1.00 10.53 ? 44  ALA A C    1 
ATOM   271   O  O    . ALA A  1 44  ? 94.193  129.626 58.359  1.00 10.71 ? 44  ALA A O    1 
ATOM   272   C  CB   . ALA A  1 44  ? 92.281  128.822 55.844  1.00 11.25 ? 44  ALA A CB   1 
ATOM   273   H  H    . ALA A  1 44  ? 94.033  129.310 54.169  1.00 17.82 ? 44  ALA A H    1 
ATOM   274   H  HA   . ALA A  1 44  ? 93.198  130.616 56.291  1.00 15.79 ? 44  ALA A HA   1 
ATOM   275   H  HB1  . ALA A  1 44  ? 91.795  128.769 56.670  1.00 13.49 ? 44  ALA A HB1  1 
ATOM   276   H  HB2  . ALA A  1 44  ? 91.726  129.204 55.160  1.00 13.49 ? 44  ALA A HB2  1 
ATOM   277   H  HB3  . ALA A  1 44  ? 92.572  127.946 55.579  1.00 13.49 ? 44  ALA A HB3  1 
ATOM   278   N  N    . MET A  1 45  ? 95.255  128.263 56.932  1.00 10.50 ? 45  MET A N    1 
ATOM   279   C  CA   . MET A  1 45  ? 96.060  127.700 57.989  1.00 13.43 ? 45  MET A CA   1 
ATOM   280   C  C    . MET A  1 45  ? 97.037  128.738 58.510  1.00 18.84 ? 45  MET A C    1 
ATOM   281   O  O    . MET A  1 45  ? 97.345  128.761 59.702  1.00 14.76 ? 45  MET A O    1 
ATOM   282   C  CB   . MET A  1 45  ? 96.795  126.452 57.508  1.00 13.44 ? 45  MET A CB   1 
ATOM   283   C  CG   . MET A  1 45  ? 95.868  125.316 57.172  1.00 15.47 ? 45  MET A CG   1 
ATOM   284   S  SD   . MET A  1 45  ? 94.949  124.736 58.607  1.00 12.39 ? 45  MET A SD   1 
ATOM   285   C  CE   . MET A  1 45  ? 93.322  125.364 58.215  1.00 16.38 ? 45  MET A CE   1 
ATOM   286   H  H    . MET A  1 45  ? 95.406  127.939 56.150  1.00 12.59 ? 45  MET A H    1 
ATOM   287   H  HA   . MET A  1 45  ? 95.469  127.431 58.723  1.00 16.11 ? 45  MET A HA   1 
ATOM   288   H  HB2  . MET A  1 45  ? 97.300  126.671 56.709  1.00 16.13 ? 45  MET A HB2  1 
ATOM   289   H  HB3  . MET A  1 45  ? 97.396  126.151 58.207  1.00 16.13 ? 45  MET A HB3  1 
ATOM   290   H  HG2  . MET A  1 45  ? 95.230  125.614 56.506  1.00 18.57 ? 45  MET A HG2  1 
ATOM   291   H  HG3  . MET A  1 45  ? 96.388  124.573 56.828  1.00 18.57 ? 45  MET A HG3  1 
ATOM   292   H  HE1  . MET A  1 45  ? 92.716  125.119 58.917  1.00 19.66 ? 45  MET A HE1  1 
ATOM   293   H  HE2  . MET A  1 45  ? 93.366  126.320 58.138  1.00 19.66 ? 45  MET A HE2  1 
ATOM   294   H  HE3  . MET A  1 45  ? 93.032  124.981 57.383  1.00 19.66 ? 45  MET A HE3  1 
ATOM   295   N  N    . HIS A  1 46  ? 97.523  129.602 57.621  1.00 17.81 ? 46  HIS A N    1 
ATOM   296   C  CA   . HIS A  1 46  ? 98.425  130.678 58.022  1.00 14.42 ? 46  HIS A CA   1 
ATOM   297   C  C    . HIS A  1 46  ? 97.695  131.672 58.902  1.00 15.86 ? 46  HIS A C    1 
ATOM   298   O  O    . HIS A  1 46  ? 98.258  132.201 59.887  1.00 14.83 ? 46  HIS A O    1 
ATOM   299   C  CB   . HIS A  1 46  ? 98.965  131.415 56.784  1.00 11.76 ? 46  HIS A CB   1 
ATOM   300   C  CG   . HIS A  1 46  ? 100.159 130.768 56.166  1.00 17.07 ? 46  HIS A CG   1 
ATOM   301   N  ND1  . HIS A  1 46  ? 101.441 130.984 56.630  1.00 21.88 ? 46  HIS A ND1  1 
ATOM   302   C  CD2  . HIS A  1 46  ? 100.274 129.909 55.127  1.00 21.35 ? 46  HIS A CD2  1 
ATOM   303   C  CE1  . HIS A  1 46  ? 102.292 130.286 55.899  1.00 20.55 ? 46  HIS A CE1  1 
ATOM   304   N  NE2  . HIS A  1 46  ? 101.611 129.629 54.979  1.00 24.50 ? 46  HIS A NE2  1 
ATOM   305   H  H    . HIS A  1 46  ? 97.345  129.586 56.779  1.00 21.38 ? 46  HIS A H    1 
ATOM   306   H  HA   . HIS A  1 46  ? 99.181  130.308 58.524  1.00 17.30 ? 46  HIS A HA   1 
ATOM   307   H  HB2  . HIS A  1 46  ? 98.266  131.450 56.112  1.00 14.11 ? 46  HIS A HB2  1 
ATOM   308   H  HB3  . HIS A  1 46  ? 99.216  132.316 57.042  1.00 14.11 ? 46  HIS A HB3  1 
ATOM   309   H  HD1  . HIS A  1 46  ? 101.652 131.493 57.290  1.00 26.25 ? 46  HIS A HD1  1 
ATOM   310   H  HD2  . HIS A  1 46  ? 99.580  129.575 54.606  1.00 25.63 ? 46  HIS A HD2  1 
ATOM   311   H  HE1  . HIS A  1 46  ? 103.215 130.265 56.012  1.00 24.66 ? 46  HIS A HE1  1 
ATOM   312   H  HE2  . HIS A  1 46  ? 101.949 129.105 54.387  1.00 29.40 ? 46  HIS A HE2  1 
ATOM   313   N  N    . PHE A  1 47  ? 96.443  131.944 58.535  1.00 12.70 ? 47  PHE A N    1 
ATOM   314   C  CA   . PHE A  1 47  ? 95.586  132.799 59.346  1.00 12.43 ? 47  PHE A CA   1 
ATOM   315   C  C    . PHE A  1 47  ? 95.424  132.200 60.750  1.00 11.98 ? 47  PHE A C    1 
ATOM   316   O  O    . PHE A  1 47  ? 95.582  132.893 61.772  1.00 14.64 ? 47  PHE A O    1 
ATOM   317   C  CB   . PHE A  1 47  ? 94.208  132.966 58.699  1.00 15.39 ? 47  PHE A CB   1 
ATOM   318   C  CG   . PHE A  1 47  ? 93.277  133.825 59.503  1.00 13.20 ? 47  PHE A CG   1 
ATOM   319   C  CD1  . PHE A  1 47  ? 92.657  133.312 60.626  1.00 16.59 ? 47  PHE A CD1  1 
ATOM   320   C  CD2  . PHE A  1 47  ? 93.057  135.149 59.159  1.00 16.25 ? 47  PHE A CD2  1 
ATOM   321   C  CE1  . PHE A  1 47  ? 91.828  134.094 61.397  1.00 17.73 ? 47  PHE A CE1  1 
ATOM   322   C  CE2  . PHE A  1 47  ? 92.228  135.941 59.930  1.00 14.85 ? 47  PHE A CE2  1 
ATOM   323   C  CZ   . PHE A  1 47  ? 91.609  135.405 61.035  1.00 16.37 ? 47  PHE A CZ   1 
ATOM   324   H  H    . PHE A  1 47  ? 96.069  131.644 57.821  1.00 15.24 ? 47  PHE A H    1 
ATOM   325   H  HA   . PHE A  1 47  ? 95.997  133.684 59.432  1.00 14.91 ? 47  PHE A HA   1 
ATOM   326   H  HB2  . PHE A  1 47  ? 94.317  133.379 57.828  1.00 18.47 ? 47  PHE A HB2  1 
ATOM   327   H  HB3  . PHE A  1 47  ? 93.798  132.092 58.601  1.00 18.47 ? 47  PHE A HB3  1 
ATOM   328   H  HD1  . PHE A  1 47  ? 92.807  132.427 60.868  1.00 19.90 ? 47  PHE A HD1  1 
ATOM   329   H  HD2  . PHE A  1 47  ? 93.478  135.509 58.412  1.00 19.50 ? 47  PHE A HD2  1 
ATOM   330   H  HE1  . PHE A  1 47  ? 91.407  133.737 62.145  1.00 21.28 ? 47  PHE A HE1  1 
ATOM   331   H  HE2  . PHE A  1 47  ? 92.074  136.827 59.691  1.00 17.82 ? 47  PHE A HE2  1 
ATOM   332   H  HZ   . PHE A  1 47  ? 91.045  135.936 61.549  1.00 19.65 ? 47  PHE A HZ   1 
ATOM   333   N  N    . TRP A  1 48  ? 95.108  130.907 60.806  1.00 11.99 ? 48  TRP A N    1 
ATOM   334   C  CA   . TRP A  1 48  ? 94.917  130.216 62.077  1.00 10.04 ? 48  TRP A CA   1 
ATOM   335   C  C    . TRP A  1 48  ? 96.181  130.289 62.926  1.00 10.66 ? 48  TRP A C    1 
ATOM   336   O  O    . TRP A  1 48  ? 96.133  130.604 64.142  1.00 13.12 ? 48  TRP A O    1 
ATOM   337   C  CB   . TRP A  1 48  ? 94.503  128.763 61.807  1.00 10.85 ? 48  TRP A CB   1 
ATOM   338   C  CG   . TRP A  1 48  ? 93.891  128.013 62.954  1.00 9.61  ? 48  TRP A CG   1 
ATOM   339   C  CD1  . TRP A  1 48  ? 93.557  128.484 64.188  1.00 12.35 ? 48  TRP A CD1  1 
ATOM   340   C  CD2  . TRP A  1 48  ? 93.546  126.632 62.939  1.00 11.04 ? 48  TRP A CD2  1 
ATOM   341   N  NE1  . TRP A  1 48  ? 93.024  127.466 64.955  1.00 11.45 ? 48  TRP A NE1  1 
ATOM   342   C  CE2  . TRP A  1 48  ? 93.011  126.316 64.203  1.00 10.56 ? 48  TRP A CE2  1 
ATOM   343   C  CE3  . TRP A  1 48  ? 93.648  125.625 61.970  1.00 11.23 ? 48  TRP A CE3  1 
ATOM   344   C  CZ2  . TRP A  1 48  ? 92.560  125.047 64.523  1.00 12.20 ? 48  TRP A CZ2  1 
ATOM   345   C  CZ3  . TRP A  1 48  ? 93.207  124.361 62.297  1.00 11.38 ? 48  TRP A CZ3  1 
ATOM   346   C  CH2  . TRP A  1 48  ? 92.673  124.085 63.565  1.00 15.72 ? 48  TRP A CH2  1 
ATOM   347   H  H    . TRP A  1 48  ? 94.998  130.406 60.116  1.00 14.38 ? 48  TRP A H    1 
ATOM   348   H  HA   . TRP A  1 48  ? 94.192  130.652 62.572  1.00 12.05 ? 48  TRP A HA   1 
ATOM   349   H  HB2  . TRP A  1 48  ? 93.856  128.761 61.085  1.00 13.02 ? 48  TRP A HB2  1 
ATOM   350   H  HB3  . TRP A  1 48  ? 95.292  128.270 61.530  1.00 13.02 ? 48  TRP A HB3  1 
ATOM   351   H  HD1  . TRP A  1 48  ? 93.677  129.361 64.474  1.00 14.81 ? 48  TRP A HD1  1 
ATOM   352   H  HE1  . TRP A  1 48  ? 92.744  127.541 65.764  1.00 13.74 ? 48  TRP A HE1  1 
ATOM   353   H  HE3  . TRP A  1 48  ? 94.001  125.805 61.128  1.00 13.47 ? 48  TRP A HE3  1 
ATOM   354   H  HZ2  . TRP A  1 48  ? 92.209  124.855 65.363  1.00 14.64 ? 48  TRP A HZ2  1 
ATOM   355   H  HZ3  . TRP A  1 48  ? 93.265  123.679 61.667  1.00 13.66 ? 48  TRP A HZ3  1 
ATOM   356   H  HH2  . TRP A  1 48  ? 92.384  123.221 63.755  1.00 18.86 ? 48  TRP A HH2  1 
ATOM   357   N  N    . ALA A  1 49  ? 97.312  129.983 62.304  1.00 14.75 ? 49  ALA A N    1 
ATOM   358   C  CA   . ALA A  1 49  ? 98.611  129.994 62.991  1.00 14.31 ? 49  ALA A CA   1 
ATOM   359   C  C    . ALA A  1 49  ? 98.920  131.356 63.569  1.00 14.40 ? 49  ALA A C    1 
ATOM   360   O  O    . ALA A  1 49  ? 99.341  131.485 64.724  1.00 16.35 ? 49  ALA A O    1 
ATOM   361   C  CB   . ALA A  1 49  ? 99.709  129.599 62.033  1.00 24.46 ? 49  ALA A CB   1 
ATOM   362   H  H    . ALA A  1 49  ? 97.360  129.763 61.474  1.00 17.70 ? 49  ALA A H    1 
ATOM   363   H  HA   . ALA A  1 49  ? 98.594  129.345 63.725  1.00 17.17 ? 49  ALA A HA   1 
ATOM   364   H  HB1  . ALA A  1 49  ? 100.548 129.612 62.499  1.00 29.35 ? 49  ALA A HB1  1 
ATOM   365   H  HB2  . ALA A  1 49  ? 99.532  128.716 61.701  1.00 29.35 ? 49  ALA A HB2  1 
ATOM   366   H  HB3  . ALA A  1 49  ? 99.729  130.226 61.306  1.00 29.35 ? 49  ALA A HB3  1 
ATOM   367   N  N    . ASP A  1 50  ? 98.747  132.381 62.753  1.00 14.30 ? 50  ASP A N    1 
ATOM   368   C  CA   . ASP A  1 50  ? 99.049  133.734 63.210  1.00 20.49 ? 50  ASP A CA   1 
ATOM   369   C  C    . ASP A  1 50  ? 98.183  134.089 64.403  1.00 16.84 ? 50  ASP A C    1 
ATOM   370   O  O    . ASP A  1 50  ? 98.684  134.669 65.360  1.00 15.87 ? 50  ASP A O    1 
ATOM   371   C  CB   . ASP A  1 50  ? 98.826  134.758 62.101  1.00 16.22 ? 50  ASP A CB   1 
ATOM   372   C  CG   . ASP A  1 50  ? 99.800  134.595 60.941  1.00 24.39 ? 50  ASP A CG   1 
ATOM   373   O  OD1  . ASP A  1 50  ? 100.731 133.751 61.008  1.00 26.76 ? 50  ASP A OD1  1 
ATOM   374   O  OD2  . ASP A  1 50  ? 99.647  135.344 59.965  1.00 22.58 ? 50  ASP A OD2  1 
ATOM   375   H  H    . ASP A  1 50  ? 98.462  132.327 61.943  1.00 17.15 ? 50  ASP A H    1 
ATOM   376   H  HA   . ASP A  1 50  ? 99.988  133.780 63.486  1.00 24.59 ? 50  ASP A HA   1 
ATOM   377   H  HB2  . ASP A  1 50  ? 97.927  134.656 61.753  1.00 19.47 ? 50  ASP A HB2  1 
ATOM   378   H  HB3  . ASP A  1 50  ? 98.942  135.649 62.466  1.00 19.47 ? 50  ASP A HB3  1 
ATOM   379   N  N    . LYS A  1 51  ? 96.897  133.733 64.337  1.00 15.37 ? 51  LYS A N    1 
ATOM   380   C  CA   . LYS A  1 51  ? 95.951  134.119 65.367  1.00 21.30 ? 51  LYS A CA   1 
ATOM   381   C  C    . LYS A  1 51  ? 96.265  133.426 66.680  1.00 22.06 ? 51  LYS A C    1 
ATOM   382   O  O    . LYS A  1 51  ? 96.224  134.040 67.749  1.00 16.80 ? 51  LYS A O    1 
ATOM   383   C  CB   . LYS A  1 51  ? 94.507  133.814 64.936  1.00 20.40 ? 51  LYS A CB   1 
ATOM   384   C  CG   . LYS A  1 51  ? 93.490  134.831 65.500  1.00 34.40 ? 51  LYS A CG   1 
ATOM   385   C  CD   . LYS A  1 51  ? 93.364  136.050 64.567  1.00 40.35 ? 51  LYS A CD   1 
ATOM   386   C  CE   . LYS A  1 51  ? 92.945  137.322 65.287  1.00 47.83 ? 51  LYS A CE   1 
ATOM   387   N  NZ   . LYS A  1 51  ? 91.583  137.235 65.867  1.00 56.17 ? 51  LYS A NZ   1 
ATOM   388   H  H    . LYS A  1 51  ? 96.554  133.267 63.701  1.00 18.45 ? 51  LYS A H    1 
ATOM   389   H  HA   . LYS A  1 51  ? 96.022  135.085 65.514  1.00 25.55 ? 51  LYS A HA   1 
ATOM   390   H  HB2  . LYS A  1 51  ? 94.454  133.841 63.968  1.00 24.48 ? 51  LYS A HB2  1 
ATOM   391   H  HB3  . LYS A  1 51  ? 94.261  132.933 65.258  1.00 24.48 ? 51  LYS A HB3  1 
ATOM   392   H  HG2  . LYS A  1 51  ? 92.619  134.410 65.573  1.00 41.28 ? 51  LYS A HG2  1 
ATOM   393   H  HG3  . LYS A  1 51  ? 93.790  135.140 66.369  1.00 41.28 ? 51  LYS A HG3  1 
ATOM   394   H  HD2  . LYS A  1 51  ? 94.223  136.215 64.147  1.00 48.42 ? 51  LYS A HD2  1 
ATOM   395   H  HD3  . LYS A  1 51  ? 92.697  135.859 63.889  1.00 48.42 ? 51  LYS A HD3  1 
ATOM   396   H  HE2  . LYS A  1 51  ? 93.568  137.495 66.010  1.00 57.40 ? 51  LYS A HE2  1 
ATOM   397   H  HE3  . LYS A  1 51  ? 92.956  138.059 64.657  1.00 57.40 ? 51  LYS A HE3  1 
ATOM   398   H  HZ1  . LYS A  1 51  ? 91.378  137.998 66.278  1.00 67.40 ? 51  LYS A HZ1  1 
ATOM   399   H  HZ2  . LYS A  1 51  ? 90.987  137.085 65.223  1.00 67.40 ? 51  LYS A HZ2  1 
ATOM   400   H  HZ3  . LYS A  1 51  ? 91.546  136.570 66.457  1.00 67.40 ? 51  LYS A HZ3  1 
ATOM   401   N  N    . VAL A  1 52  ? 96.597  132.144 66.601  1.00 12.62 ? 52  VAL A N    1 
ATOM   402   C  CA   . VAL A  1 52  ? 96.895  131.379 67.796  1.00 16.86 ? 52  VAL A CA   1 
ATOM   403   C  C    . VAL A  1 52  ? 98.167  131.923 68.447  1.00 17.62 ? 52  VAL A C    1 
ATOM   404   O  O    . VAL A  1 52  ? 98.218  132.104 69.673  1.00 17.78 ? 52  VAL A O    1 
ATOM   405   C  CB   . VAL A  1 52  ? 97.018  129.880 67.457  1.00 18.89 ? 52  VAL A CB   1 
ATOM   406   C  CG1  . VAL A  1 52  ? 97.659  129.120 68.589  1.00 33.54 ? 52  VAL A CG1  1 
ATOM   407   C  CG2  . VAL A  1 52  ? 95.630  129.320 67.122  1.00 11.46 ? 52  VAL A CG2  1 
ATOM   408   H  H    . VAL A  1 52  ? 96.655  131.697 65.869  1.00 15.15 ? 52  VAL A H    1 
ATOM   409   H  HA   . VAL A  1 52  ? 96.159  131.484 68.435  1.00 20.23 ? 52  VAL A HA   1 
ATOM   410   H  HB   . VAL A  1 52  ? 97.585  129.778 66.664  1.00 22.67 ? 52  VAL A HB   1 
ATOM   411   H  HG11 . VAL A  1 52  ? 97.721  128.193 68.347  1.00 40.24 ? 52  VAL A HG11 1 
ATOM   412   H  HG12 . VAL A  1 52  ? 98.536  129.477 68.748  1.00 40.24 ? 52  VAL A HG12 1 
ATOM   413   H  HG13 . VAL A  1 52  ? 97.118  129.219 69.376  1.00 40.24 ? 52  VAL A HG13 1 
ATOM   414   H  HG21 . VAL A  1 52  ? 95.712  128.387 66.912  1.00 13.75 ? 52  VAL A HG21 1 
ATOM   415   H  HG22 . VAL A  1 52  ? 95.055  129.435 67.883  1.00 13.75 ? 52  VAL A HG22 1 
ATOM   416   H  HG23 . VAL A  1 52  ? 95.274  129.796 66.368  1.00 13.75 ? 52  VAL A HG23 1 
ATOM   417   N  N    . LYS A  1 53  ? 99.175  132.227 67.627  1.00 14.59 ? 53  LYS A N    1 
ATOM   418   C  CA   . LYS A  1 53  ? 100.431 132.768 68.148  1.00 17.62 ? 53  LYS A CA   1 
ATOM   419   C  C    . LYS A  1 53  ? 100.177 134.109 68.830  1.00 22.24 ? 53  LYS A C    1 
ATOM   420   O  O    . LYS A  1 53  ? 100.736 134.394 69.877  1.00 24.08 ? 53  LYS A O    1 
ATOM   421   C  CB   . LYS A  1 53  ? 101.485 132.930 67.050  1.00 18.39 ? 53  LYS A CB   1 
ATOM   422   C  CG   . LYS A  1 53  ? 102.888 133.177 67.575  1.00 16.67 ? 53  LYS A CG   1 
ATOM   423   C  CD   . LYS A  1 53  ? 103.917 133.069 66.464  1.00 24.96 ? 53  LYS A CD   1 
ATOM   424   C  CE   . LYS A  1 53  ? 105.314 133.377 66.983  1.00 37.03 ? 53  LYS A CE   1 
ATOM   425   N  NZ   . LYS A  1 53  ? 106.368 133.087 65.966  1.00 48.59 ? 53  LYS A NZ   1 
ATOM   426   H  H    . LYS A  1 53  ? 99.158  132.131 66.772  1.00 17.50 ? 53  LYS A H    1 
ATOM   427   H  HA   . LYS A  1 53  ? 100.788 132.150 68.820  1.00 21.15 ? 53  LYS A HA   1 
ATOM   428   H  HB2  . LYS A  1 53  ? 101.506 132.121 66.516  1.00 22.06 ? 53  LYS A HB2  1 
ATOM   429   H  HB3  . LYS A  1 53  ? 101.241 133.685 66.492  1.00 22.06 ? 53  LYS A HB3  1 
ATOM   430   H  HG2  . LYS A  1 53  ? 102.938 134.069 67.952  1.00 20.01 ? 53  LYS A HG2  1 
ATOM   431   H  HG3  . LYS A  1 53  ? 103.099 132.514 68.251  1.00 20.01 ? 53  LYS A HG3  1 
ATOM   432   H  HD2  . LYS A  1 53  ? 103.914 132.167 66.109  1.00 29.95 ? 53  LYS A HD2  1 
ATOM   433   H  HD3  . LYS A  1 53  ? 103.703 133.707 65.765  1.00 29.95 ? 53  LYS A HD3  1 
ATOM   434   H  HE2  . LYS A  1 53  ? 105.368 134.317 67.214  1.00 44.43 ? 53  LYS A HE2  1 
ATOM   435   H  HE3  . LYS A  1 53  ? 105.491 132.830 67.765  1.00 44.43 ? 53  LYS A HE3  1 
ATOM   436   H  HZ1  . LYS A  1 53  ? 107.171 133.276 66.298  1.00 58.30 ? 53  LYS A HZ1  1 
ATOM   437   H  HZ2  . LYS A  1 53  ? 106.343 132.227 65.740  1.00 58.30 ? 53  LYS A HZ2  1 
ATOM   438   H  HZ3  . LYS A  1 53  ? 106.232 133.581 65.238  1.00 58.30 ? 53  LYS A HZ3  1 
ATOM   439   N  N    . GLU A  1 54  ? 99.317  134.919 68.226  1.00 22.82 ? 54  GLU A N    1 
ATOM   440   C  CA   . GLU A  1 54  ? 99.008  136.246 68.744  1.00 27.19 ? 54  GLU A CA   1 
ATOM   441   C  C    . GLU A  1 54  ? 98.232  136.169 70.055  1.00 23.69 ? 54  GLU A C    1 
ATOM   442   O  O    . GLU A  1 54  ? 98.596  136.816 71.027  1.00 19.82 ? 54  GLU A O    1 
ATOM   443   C  CB   . GLU A  1 54  ? 98.194  137.035 67.716  1.00 30.15 ? 54  GLU A CB   1 
ATOM   444   C  CG   . GLU A  1 54  ? 97.480  138.258 68.302  1.00 37.65 ? 54  GLU A CG   1 
ATOM   445   C  CD   . GLU A  1 54  ? 96.366  138.775 67.407  1.00 39.74 ? 54  GLU A CD   1 
ATOM   446   O  OE1  . GLU A  1 54  ? 96.096  138.145 66.361  1.00 44.76 ? 54  GLU A OE1  1 
ATOM   447   O  OE2  . GLU A  1 54  ? 95.750  139.805 67.753  1.00 41.62 ? 54  GLU A OE2  1 
ATOM   448   H  H    . GLU A  1 54  ? 98.894  134.720 67.504  1.00 27.39 ? 54  GLU A H    1 
ATOM   449   H  HA   . GLU A  1 54  ? 99.843  136.730 68.911  1.00 32.62 ? 54  GLU A HA   1 
ATOM   450   H  HB2  . GLU A  1 54  ? 98.791  137.346 67.017  1.00 36.18 ? 54  GLU A HB2  1 
ATOM   451   H  HB3  . GLU A  1 54  ? 97.519  136.451 67.336  1.00 36.18 ? 54  GLU A HB3  1 
ATOM   452   H  HG2  . GLU A  1 54  ? 97.090  138.016 69.157  1.00 45.18 ? 54  GLU A HG2  1 
ATOM   453   H  HG3  . GLU A  1 54  ? 98.125  138.973 68.422  1.00 45.18 ? 54  GLU A HG3  1 
ATOM   454   N  N    . LYS A  1 55  ? 97.159  135.380 70.073  1.00 25.61 ? 55  LYS A N    1 
ATOM   455   C  CA   . LYS A  1 55  ? 96.298  135.282 71.252  1.00 24.02 ? 55  LYS A CA   1 
ATOM   456   C  C    . LYS A  1 55  ? 96.979  134.607 72.443  1.00 20.91 ? 55  LYS A C    1 
ATOM   457   O  O    . LYS A  1 55  ? 96.647  134.915 73.585  1.00 26.09 ? 55  LYS A O    1 
ATOM   458   C  CB   . LYS A  1 55  ? 95.010  134.531 70.924  1.00 32.07 ? 55  LYS A CB   1 
ATOM   459   C  CG   . LYS A  1 55  ? 94.162  135.197 69.865  1.00 32.80 ? 55  LYS A CG   1 
ATOM   460   C  CD   . LYS A  1 55  ? 93.480  136.447 70.389  1.00 34.71 ? 55  LYS A CD   1 
ATOM   461   C  CE   . LYS A  1 55  ? 92.197  136.706 69.603  1.00 43.25 ? 55  LYS A CE   1 
ATOM   462   N  NZ   . LYS A  1 55  ? 91.595  138.039 69.854  1.00 49.19 ? 55  LYS A NZ   1 
ATOM   463   H  H    . LYS A  1 55  ? 96.907  134.889 69.413  1.00 30.73 ? 55  LYS A H    1 
ATOM   464   H  HA   . LYS A  1 55  ? 96.049  136.188 71.530  1.00 28.83 ? 55  LYS A HA   1 
ATOM   465   H  HB2  . LYS A  1 55  ? 95.239  133.644 70.605  1.00 38.49 ? 55  LYS A HB2  1 
ATOM   466   H  HB3  . LYS A  1 55  ? 94.476  134.462 71.731  1.00 38.49 ? 55  LYS A HB3  1 
ATOM   467   H  HG2  . LYS A  1 55  ? 94.725  135.450 69.118  1.00 39.36 ? 55  LYS A HG2  1 
ATOM   468   H  HG3  . LYS A  1 55  ? 93.475  134.578 69.572  1.00 39.36 ? 55  LYS A HG3  1 
ATOM   469   H  HD2  . LYS A  1 55  ? 93.251  136.326 71.324  1.00 41.65 ? 55  LYS A HD2  1 
ATOM   470   H  HD3  . LYS A  1 55  ? 94.069  137.210 70.278  1.00 41.65 ? 55  LYS A HD3  1 
ATOM   471   H  HE2  . LYS A  1 55  ? 92.394  136.643 68.656  1.00 51.91 ? 55  LYS A HE2  1 
ATOM   472   H  HE3  . LYS A  1 55  ? 91.541  136.034 69.847  1.00 51.91 ? 55  LYS A HE3  1 
ATOM   473   H  HZ1  . LYS A  1 55  ? 90.853  138.133 69.371  1.00 59.03 ? 55  LYS A HZ1  1 
ATOM   474   H  HZ2  . LYS A  1 55  ? 91.391  138.124 70.716  1.00 59.03 ? 55  LYS A HZ2  1 
ATOM   475   H  HZ3  . LYS A  1 55  ? 92.170  138.680 69.628  1.00 59.03 ? 55  LYS A HZ3  1 
ATOM   476   N  N    . SER A  1 56  ? 97.918  133.699 72.171  1.00 16.18 ? 56  SER A N    1 
ATOM   477   C  CA   . SER A  1 56  ? 98.654  132.953 73.204  1.00 16.20 ? 56  SER A CA   1 
ATOM   478   C  C    . SER A  1 56  ? 99.955  133.645 73.581  1.00 22.88 ? 56  SER A C    1 
ATOM   479   O  O    . SER A  1 56  ? 100.769 133.094 74.323  1.00 31.00 ? 56  SER A O    1 
ATOM   480   C  CB   . SER A  1 56  ? 99.010  131.557 72.680  1.00 15.00 ? 56  SER A CB   1 
ATOM   481   O  OG   . SER A  1 56  ? 100.022 131.627 71.679  1.00 20.11 ? 56  SER A OG   1 
ATOM   482   H  H    . SER A  1 56  ? 98.156  133.490 71.371  1.00 19.41 ? 56  SER A H    1 
ATOM   483   H  HA   . SER A  1 56  ? 98.099  132.859 74.007  1.00 19.44 ? 56  SER A HA   1 
ATOM   484   H  HB2  . SER A  1 56  ? 99.333  131.017 73.418  1.00 18.00 ? 56  SER A HB2  1 
ATOM   485   H  HB3  . SER A  1 56  ? 98.216  131.153 72.297  1.00 18.00 ? 56  SER A HB3  1 
ATOM   486   H  HG   . SER A  1 56  ? 100.241 132.408 71.556  1.00 24.13 ? 56  SER A HG   1 
ATOM   487   N  N    . ASN A  1 57  ? 100.153 134.847 73.053  1.00 23.80 ? 57  ASN A N    1 
ATOM   488   C  CA   . ASN A  1 57  ? 101.413 135.569 73.185  1.00 30.70 ? 57  ASN A CA   1 
ATOM   489   C  C    . ASN A  1 57  ? 102.645 134.687 73.047  1.00 30.85 ? 57  ASN A C    1 
ATOM   490   O  O    . ASN A  1 57  ? 103.590 134.810 73.810  1.00 31.50 ? 57  ASN A O    1 
ATOM   491   C  CB   . ASN A  1 57  ? 101.448 136.360 74.491  1.00 36.22 ? 57  ASN A CB   1 
ATOM   492   C  CG   . ASN A  1 57  ? 100.382 137.436 74.533  1.00 42.20 ? 57  ASN A CG   1 
ATOM   493   O  OD1  . ASN A  1 57  ? 100.466 138.436 73.820  1.00 46.26 ? 57  ASN A OD1  1 
ATOM   494   N  ND2  . ASN A  1 57  ? 99.361  137.227 75.352  1.00 46.70 ? 57  ASN A ND2  1 
ATOM   495   H  H    . ASN A  1 57  ? 99.558  135.275 72.602  1.00 28.56 ? 57  ASN A H    1 
ATOM   496   H  HA   . ASN A  1 57  ? 101.456 136.225 72.459  1.00 36.85 ? 57  ASN A HA   1 
ATOM   497   H  HB2  . ASN A  1 57  ? 101.297 135.755 75.234  1.00 43.46 ? 57  ASN A HB2  1 
ATOM   498   H  HB3  . ASN A  1 57  ? 102.314 136.789 74.580  1.00 43.46 ? 57  ASN A HB3  1 
ATOM   499   H  HD21 . ASN A  1 57  ? 99.328  136.510 75.825  1.00 56.05 ? 57  ASN A HD21 1 
ATOM   500   H  HD22 . ASN A  1 57  ? 98.730  137.809 75.411  1.00 56.05 ? 57  ASN A HD22 1 
ATOM   501   N  N    . GLY A  1 58  ? 102.636 133.819 72.037  1.00 22.39 ? 58  GLY A N    1 
ATOM   502   C  CA   . GLY A  1 58  ? 103.795 133.013 71.718  1.00 23.68 ? 58  GLY A CA   1 
ATOM   503   C  C    . GLY A  1 58  ? 103.828 131.640 72.348  1.00 26.72 ? 58  GLY A C    1 
ATOM   504   O  O    . GLY A  1 58  ? 104.734 130.852 72.059  1.00 26.39 ? 58  GLY A O    1 
ATOM   505   H  H    . GLY A  1 58  ? 101.961 133.683 71.521  1.00 26.87 ? 58  GLY A H    1 
ATOM   506   H  HA2  . GLY A  1 58  ? 103.841 132.898 70.756  1.00 28.42 ? 58  GLY A HA2  1 
ATOM   507   H  HA3  . GLY A  1 58  ? 104.593 133.487 72.000  1.00 28.42 ? 58  GLY A HA3  1 
ATOM   508   N  N    . ASP A  1 59  ? 102.852 131.355 73.208  1.00 28.80 ? 59  ASP A N    1 
ATOM   509   C  CA   . ASP A  1 59  ? 102.827 130.103 73.944  1.00 27.74 ? 59  ASP A CA   1 
ATOM   510   C  C    . ASP A  1 59  ? 102.406 128.933 73.068  1.00 24.41 ? 59  ASP A C    1 
ATOM   511   O  O    . ASP A  1 59  ? 102.754 127.788 73.350  1.00 28.36 ? 59  ASP A O    1 
ATOM   512   C  CB   . ASP A  1 59  ? 101.885 130.179 75.145  1.00 26.65 ? 59  ASP A CB   1 
ATOM   513   C  CG   . ASP A  1 59  ? 101.854 128.876 75.924  1.00 29.44 ? 59  ASP A CG   1 
ATOM   514   O  OD1  . ASP A  1 59  ? 102.925 128.466 76.403  1.00 27.29 ? 59  ASP A OD1  1 
ATOM   515   O  OD2  . ASP A  1 59  ? 100.781 128.241 76.021  1.00 27.75 ? 59  ASP A OD2  1 
ATOM   516   H  H    . ASP A  1 59  ? 102.190 131.877 73.381  1.00 34.55 ? 59  ASP A H    1 
ATOM   517   H  HA   . ASP A  1 59  ? 103.728 129.917 74.281  1.00 33.28 ? 59  ASP A HA   1 
ATOM   518   H  HB2  . ASP A  1 59  ? 102.185 130.882 75.742  1.00 31.98 ? 59  ASP A HB2  1 
ATOM   519   H  HB3  . ASP A  1 59  ? 100.985 130.366 74.833  1.00 31.98 ? 59  ASP A HB3  1 
ATOM   520   N  N    . ILE A  1 60  ? 101.639 129.220 72.015  1.00 20.97 ? 60  ILE A N    1 
ATOM   521   C  CA   . ILE A  1 60  ? 101.191 128.191 71.098  1.00 17.51 ? 60  ILE A CA   1 
ATOM   522   C  C    . ILE A  1 60  ? 101.687 128.586 69.717  1.00 21.15 ? 60  ILE A C    1 
ATOM   523   O  O    . ILE A  1 60  ? 101.404 129.685 69.246  1.00 19.12 ? 60  ILE A O    1 
ATOM   524   C  CB   . ILE A  1 60  ? 99.655  128.075 71.057  1.00 15.49 ? 60  ILE A CB   1 
ATOM   525   C  CG1  . ILE A  1 60  ? 99.078  127.887 72.461  1.00 25.34 ? 60  ILE A CG1  1 
ATOM   526   C  CG2  . ILE A  1 60  ? 99.246  126.875 70.194  1.00 20.05 ? 60  ILE A CG2  1 
ATOM   527   C  CD1  . ILE A  1 60  ? 97.553  127.964 72.487  1.00 28.53 ? 60  ILE A CD1  1 
ATOM   528   H  H    . ILE A  1 60  ? 101.366 130.010 71.815  1.00 25.16 ? 60  ILE A H    1 
ATOM   529   H  HA   . ILE A  1 60  ? 101.575 127.323 71.345  1.00 21.01 ? 60  ILE A HA   1 
ATOM   530   H  HB   . ILE A  1 60  ? 99.287  128.884 70.669  1.00 18.59 ? 60  ILE A HB   1 
ATOM   531   H  HG12 . ILE A  1 60  ? 99.340  127.015 72.796  1.00 30.40 ? 60  ILE A HG12 1 
ATOM   532   H  HG13 . ILE A  1 60  ? 99.424  128.583 73.041  1.00 30.40 ? 60  ILE A HG13 1 
ATOM   533   H  HG21 . ILE A  1 60  ? 98.288  126.815 70.176  1.00 24.06 ? 60  ILE A HG21 1 
ATOM   534   H  HG22 . ILE A  1 60  ? 99.583  127.002 69.303  1.00 24.06 ? 60  ILE A HG22 1 
ATOM   535   H  HG23 . ILE A  1 60  ? 99.618  126.076 70.574  1.00 24.06 ? 60  ILE A HG23 1 
ATOM   536   H  HD11 . ILE A  1 60  ? 97.249  127.839 73.389  1.00 34.24 ? 60  ILE A HD11 1 
ATOM   537   H  HD12 . ILE A  1 60  ? 97.279  128.826 72.164  1.00 34.24 ? 60  ILE A HD12 1 
ATOM   538   H  HD13 . ILE A  1 60  ? 97.196  127.274 71.922  1.00 34.24 ? 60  ILE A HD13 1 
ATOM   539   N  N    A VAL A  1 61  ? 102.435 127.694 69.074  0.33 15.42 ? 61  VAL A N    1 
ATOM   540   N  N    B VAL A  1 61  ? 102.455 127.704 69.089  0.67 15.34 ? 61  VAL A N    1 
ATOM   541   C  CA   A VAL A  1 61  ? 102.970 127.958 67.740  0.33 17.10 ? 61  VAL A CA   1 
ATOM   542   C  CA   B VAL A  1 61  ? 102.925 127.953 67.735  0.67 17.08 ? 61  VAL A CA   1 
ATOM   543   C  C    A VAL A  1 61  ? 102.631 126.809 66.792  0.33 17.35 ? 61  VAL A C    1 
ATOM   544   C  C    B VAL A  1 61  ? 102.533 126.797 66.830  0.67 17.11 ? 61  VAL A C    1 
ATOM   545   O  O    A VAL A  1 61  ? 102.919 125.644 67.093  0.33 17.81 ? 61  VAL A O    1 
ATOM   546   O  O    B VAL A  1 61  ? 102.658 125.624 67.204  0.67 17.39 ? 61  VAL A O    1 
ATOM   547   C  CB   A VAL A  1 61  ? 104.513 128.163 67.786  0.33 23.24 ? 61  VAL A CB   1 
ATOM   548   C  CB   B VAL A  1 61  ? 104.459 128.151 67.681  0.67 21.11 ? 61  VAL A CB   1 
ATOM   549   C  CG1  A VAL A  1 61  ? 105.104 128.278 66.375  0.33 24.37 ? 61  VAL A CG1  1 
ATOM   550   C  CG1  B VAL A  1 61  ? 104.876 129.340 68.541  0.67 27.36 ? 61  VAL A CG1  1 
ATOM   551   C  CG2  A VAL A  1 61  ? 104.858 129.399 68.609  0.33 29.34 ? 61  VAL A CG2  1 
ATOM   552   C  CG2  B VAL A  1 61  ? 105.180 126.885 68.099  0.67 23.41 ? 61  VAL A CG2  1 
ATOM   553   H  H    A VAL A  1 61  ? 102.648 126.923 69.390  0.33 18.51 ? 61  VAL A H    1 
ATOM   554   H  H    B VAL A  1 61  ? 102.717 126.957 69.424  0.67 18.41 ? 61  VAL A H    1 
ATOM   555   H  HA   A VAL A  1 61  ? 102.564 128.776 67.386  0.33 20.52 ? 61  VAL A HA   1 
ATOM   556   H  HA   B VAL A  1 61  ? 102.500 128.767 67.392  0.67 20.49 ? 61  VAL A HA   1 
ATOM   557   H  HB   A VAL A  1 61  ? 104.924 127.388 68.222  0.33 27.89 ? 61  VAL A HB   1 
ATOM   558   H  HB   B VAL A  1 61  ? 104.717 128.348 66.756  0.67 25.33 ? 61  VAL A HB   1 
ATOM   559   H  HG11 A VAL A  1 61  ? 106.053 128.404 66.444  0.33 29.24 ? 61  VAL A HG11 1 
ATOM   560   H  HG11 B VAL A  1 61  ? 105.829 129.442 68.490  0.67 32.83 ? 61  VAL A HG11 1 
ATOM   561   H  HG12 A VAL A  1 61  ? 104.914 127.471 65.891  0.33 29.24 ? 61  VAL A HG12 1 
ATOM   562   H  HG12 B VAL A  1 61  ? 104.444 130.131 68.210  0.67 32.83 ? 61  VAL A HG12 1 
ATOM   563   H  HG13 A VAL A  1 61  ? 104.705 129.029 65.930  0.33 29.24 ? 61  VAL A HG13 1 
ATOM   564   H  HG13 B VAL A  1 61  ? 104.611 129.176 69.449  0.67 32.83 ? 61  VAL A HG13 1 
ATOM   565   H  HG21 A VAL A  1 61  ? 105.811 129.507 68.625  0.33 35.20 ? 61  VAL A HG21 1 
ATOM   566   H  HG21 B VAL A  1 61  ? 106.127 127.036 68.056  0.67 28.09 ? 61  VAL A HG21 1 
ATOM   567   H  HG22 A VAL A  1 61  ? 104.447 130.167 68.205  0.33 35.20 ? 61  VAL A HG22 1 
ATOM   568   H  HG22 B VAL A  1 61  ? 104.924 126.662 68.997  0.67 28.09 ? 61  VAL A HG22 1 
ATOM   569   H  HG23 A VAL A  1 61  ? 104.526 129.282 69.502  0.33 35.20 ? 61  VAL A HG23 1 
ATOM   570   H  HG23 B VAL A  1 61  ? 104.934 126.174 67.502  0.67 28.09 ? 61  VAL A HG23 1 
ATOM   571   N  N    . PHE A  1 62  ? 102.027 127.146 65.652  1.00 18.33 ? 62  PHE A N    1 
ATOM   572   C  CA   . PHE A  1 62  ? 101.754 126.173 64.593  1.00 16.82 ? 62  PHE A CA   1 
ATOM   573   C  C    . PHE A  1 62  ? 102.891 126.170 63.579  1.00 15.24 ? 62  PHE A C    1 
ATOM   574   O  O    . PHE A  1 62  ? 103.350 127.216 63.149  1.00 20.20 ? 62  PHE A O    1 
ATOM   575   C  CB   . PHE A  1 62  ? 100.450 126.509 63.851  1.00 14.05 ? 62  PHE A CB   1 
ATOM   576   C  CG   . PHE A  1 62  ? 99.187  126.233 64.635  1.00 13.13 ? 62  PHE A CG   1 
ATOM   577   C  CD1  . PHE A  1 62  ? 99.224  125.714 65.931  1.00 18.43 ? 62  PHE A CD1  1 
ATOM   578   C  CD2  . PHE A  1 62  ? 97.954  126.480 64.052  1.00 16.96 ? 62  PHE A CD2  1 
ATOM   579   C  CE1  . PHE A  1 62  ? 98.040  125.464 66.641  1.00 13.20 ? 62  PHE A CE1  1 
ATOM   580   C  CE2  . PHE A  1 62  ? 96.774  126.229 64.741  1.00 18.50 ? 62  PHE A CE2  1 
ATOM   581   C  CZ   . PHE A  1 62  ? 96.815  125.719 66.050  1.00 14.14 ? 62  PHE A CZ   1 
ATOM   582   H  H    . PHE A  1 62  ? 101.795 127.949 65.448  0.33 21.99 ? 62  PHE A H    1 
ATOM   583   H  HA   . PHE A  1 62  ? 101.674 125.276 64.980  1.00 20.19 ? 62  PHE A HA   1 
ATOM   584   H  HB2  . PHE A  1 62  ? 100.456 127.453 63.627  1.00 16.86 ? 62  PHE A HB2  1 
ATOM   585   H  HB3  . PHE A  1 62  ? 100.412 125.982 63.038  1.00 16.86 ? 62  PHE A HB3  1 
ATOM   586   H  HD1  . PHE A  1 62  ? 100.044 125.544 66.334  1.00 22.12 ? 62  PHE A HD1  1 
ATOM   587   H  HD2  . PHE A  1 62  ? 97.916  126.821 63.187  1.00 20.36 ? 62  PHE A HD2  1 
ATOM   588   H  HE1  . PHE A  1 62  ? 98.078  125.122 67.505  1.00 15.84 ? 62  PHE A HE1  1 
ATOM   589   H  HE2  . PHE A  1 62  ? 95.954  126.406 64.338  1.00 22.19 ? 62  PHE A HE2  1 
ATOM   590   H  HZ   . PHE A  1 62  ? 96.027  125.551 66.514  1.00 16.97 ? 62  PHE A HZ   1 
ATOM   591   N  N    . LYS A  1 63  ? 103.350 124.981 63.203  1.00 14.67 ? 63  LYS A N    1 
ATOM   592   C  CA   . LYS A  1 63  ? 104.280 124.826 62.101  1.00 19.97 ? 63  LYS A CA   1 
ATOM   593   C  C    . LYS A  1 63  ? 103.512 124.139 60.976  1.00 19.43 ? 63  LYS A C    1 
ATOM   594   O  O    . LYS A  1 63  ? 102.987 123.045 61.160  1.00 14.66 ? 63  LYS A O    1 
ATOM   595   C  CB   . LYS A  1 63  ? 105.495 124.003 62.529  1.00 25.05 ? 63  LYS A CB   1 
ATOM   596   C  CG   . LYS A  1 63  ? 106.683 124.142 61.594  1.00 36.48 ? 63  LYS A CG   1 
ATOM   597   C  CD   . LYS A  1 63  ? 107.803 123.169 61.955  1.00 42.25 ? 63  LYS A CD   1 
ATOM   598   C  CE   . LYS A  1 63  ? 109.130 123.544 61.305  1.00 46.17 ? 63  LYS A CE   1 
ATOM   599   N  NZ   . LYS A  1 63  ? 109.828 124.613 62.074  1.00 50.34 ? 63  LYS A NZ   1 
ATOM   600   H  H    . LYS A  1 63  ? 103.132 124.239 63.579  1.00 17.60 ? 63  LYS A H    1 
ATOM   601   H  HA   . LYS A  1 63  ? 104.583 125.705 61.791  1.00 23.97 ? 63  LYS A HA   1 
ATOM   602   H  HB2  . LYS A  1 63  ? 105.775 124.294 63.411  1.00 30.06 ? 63  LYS A HB2  1 
ATOM   603   H  HB3  . LYS A  1 63  ? 105.245 123.066 62.555  1.00 30.06 ? 63  LYS A HB3  1 
ATOM   604   H  HG2  . LYS A  1 63  ? 106.398 123.954 60.686  1.00 43.78 ? 63  LYS A HG2  1 
ATOM   605   H  HG3  . LYS A  1 63  ? 107.034 125.045 61.655  1.00 43.78 ? 63  LYS A HG3  1 
ATOM   606   H  HD2  . LYS A  1 63  ? 107.927 123.171 62.917  1.00 50.70 ? 63  LYS A HD2  1 
ATOM   607   H  HD3  . LYS A  1 63  ? 107.560 122.280 61.653  1.00 50.70 ? 63  LYS A HD3  1 
ATOM   608   H  HE2  . LYS A  1 63  ? 109.706 122.763 61.278  1.00 55.41 ? 63  LYS A HE2  1 
ATOM   609   H  HE3  . LYS A  1 63  ? 108.966 123.872 60.407  1.00 55.41 ? 63  LYS A HE3  1 
ATOM   610   H  HZ1  . LYS A  1 63  ? 110.599 124.817 61.680  1.00 60.40 ? 63  LYS A HZ1  1 
ATOM   611   H  HZ2  . LYS A  1 63  ? 109.320 125.342 62.111  1.00 60.40 ? 63  LYS A HZ2  1 
ATOM   612   H  HZ3  . LYS A  1 63  ? 109.992 124.333 62.903  1.00 60.40 ? 63  LYS A HZ3  1 
ATOM   613   N  N    . LEU A  1 64  ? 103.456 124.783 59.813  1.00 17.53 ? 64  LEU A N    1 
ATOM   614   C  CA   . LEU A  1 64  ? 102.633 124.299 58.706  1.00 19.36 ? 64  LEU A CA   1 
ATOM   615   C  C    . LEU A  1 64  ? 103.374 123.356 57.753  1.00 20.28 ? 64  LEU A C    1 
ATOM   616   O  O    . LEU A  1 64  ? 104.520 123.603 57.369  1.00 16.74 ? 64  LEU A O    1 
ATOM   617   C  CB   . LEU A  1 64  ? 102.085 125.480 57.895  1.00 21.82 ? 64  LEU A CB   1 
ATOM   618   C  CG   . LEU A  1 64  ? 101.305 126.550 58.668  1.00 24.87 ? 64  LEU A CG   1 
ATOM   619   C  CD1  . LEU A  1 64  ? 100.777 127.602 57.691  1.00 26.25 ? 64  LEU A CD1  1 
ATOM   620   C  CD2  . LEU A  1 64  ? 100.180 125.934 59.476  1.00 21.90 ? 64  LEU A CD2  1 
ATOM   621   H  H    . LEU A  1 64  ? 103.887 125.506 59.638  1.00 21.04 ? 64  LEU A H    1 
ATOM   622   H  HA   . LEU A  1 64  ? 101.869 123.809 59.075  1.00 23.23 ? 64  LEU A HA   1 
ATOM   623   H  HB2  . LEU A  1 64  ? 102.833 125.925 57.467  1.00 26.18 ? 64  LEU A HB2  1 
ATOM   624   H  HB3  . LEU A  1 64  ? 101.490 125.128 57.214  1.00 26.18 ? 64  LEU A HB3  1 
ATOM   625   H  HG   . LEU A  1 64  ? 101.908 126.993 59.286  1.00 29.84 ? 64  LEU A HG   1 
ATOM   626   H  HD11 . LEU A  1 64  ? 100.290 128.268 58.183  1.00 31.50 ? 64  LEU A HD11 1 
ATOM   627   H  HD12 . LEU A  1 64  ? 101.519 128.008 57.237  1.00 31.50 ? 64  LEU A HD12 1 
ATOM   628   H  HD13 . LEU A  1 64  ? 100.198 127.175 57.056  1.00 31.50 ? 64  LEU A HD13 1 
ATOM   629   H  HD21 . LEU A  1 64  ? 99.715  126.631 59.945  1.00 26.28 ? 64  LEU A HD21 1 
ATOM   630   H  HD22 . LEU A  1 64  ? 99.579  125.482 58.880  1.00 26.28 ? 64  LEU A HD22 1 
ATOM   631   H  HD23 . LEU A  1 64  ? 100.552 125.309 60.102  1.00 26.28 ? 64  LEU A HD23 1 
ATOM   632   N  N    . PHE A  1 65  ? 102.674 122.297 57.350  1.00 16.18 ? 65  PHE A N    1 
ATOM   633   C  CA   . PHE A  1 65  ? 103.215 121.266 56.475  1.00 16.19 ? 65  PHE A CA   1 
ATOM   634   C  C    . PHE A  1 65  ? 102.213 121.026 55.358  1.00 17.49 ? 65  PHE A C    1 
ATOM   635   O  O    . PHE A  1 65  ? 101.421 120.085 55.424  1.00 16.26 ? 65  PHE A O    1 
ATOM   636   C  CB   . PHE A  1 65  ? 103.478 119.966 57.263  1.00 19.19 ? 65  PHE A CB   1 
ATOM   637   C  CG   . PHE A  1 65  ? 104.628 120.075 58.226  1.00 22.70 ? 65  PHE A CG   1 
ATOM   638   C  CD1  . PHE A  1 65  ? 104.441 120.578 59.509  1.00 18.50 ? 65  PHE A CD1  1 
ATOM   639   C  CD2  . PHE A  1 65  ? 105.903 119.707 57.843  1.00 28.37 ? 65  PHE A CD2  1 
ATOM   640   C  CE1  . PHE A  1 65  ? 105.508 120.696 60.380  1.00 20.53 ? 65  PHE A CE1  1 
ATOM   641   C  CE2  . PHE A  1 65  ? 106.967 119.824 58.719  1.00 30.52 ? 65  PHE A CE2  1 
ATOM   642   C  CZ   . PHE A  1 65  ? 106.766 120.321 59.985  1.00 23.95 ? 65  PHE A CZ   1 
ATOM   643   H  H    . PHE A  1 65  ? 101.858 122.152 57.579  1.00 19.41 ? 65  PHE A H    1 
ATOM   644   H  HA   . PHE A  1 65  ? 104.059 121.573 56.082  1.00 19.43 ? 65  PHE A HA   1 
ATOM   645   H  HB2  . PHE A  1 65  ? 102.684 119.741 57.771  1.00 23.03 ? 65  PHE A HB2  1 
ATOM   646   H  HB3  . PHE A  1 65  ? 103.682 119.255 56.635  1.00 23.03 ? 65  PHE A HB3  1 
ATOM   647   H  HD1  . PHE A  1 65  ? 103.591 120.839 59.783  1.00 22.20 ? 65  PHE A HD1  1 
ATOM   648   H  HD2  . PHE A  1 65  ? 106.048 119.374 56.987  1.00 34.05 ? 65  PHE A HD2  1 
ATOM   649   H  HE1  . PHE A  1 65  ? 105.372 121.028 61.238  1.00 24.63 ? 65  PHE A HE1  1 
ATOM   650   H  HE2  . PHE A  1 65  ? 107.820 119.568 58.450  1.00 36.62 ? 65  PHE A HE2  1 
ATOM   651   H  HZ   . PHE A  1 65  ? 107.481 120.395 60.575  1.00 28.74 ? 65  PHE A HZ   1 
ATOM   652   N  N    . PRO A  1 66  ? 102.230 121.895 54.343  1.00 15.53 ? 66  PRO A N    1 
ATOM   653   C  CA   . PRO A  1 66  ? 101.383 121.709 53.155  1.00 16.96 ? 66  PRO A CA   1 
ATOM   654   C  C    . PRO A  1 66  ? 101.909 120.590 52.257  1.00 14.97 ? 66  PRO A C    1 
ATOM   655   O  O    . PRO A  1 66  ? 102.929 119.990 52.559  1.00 19.17 ? 66  PRO A O    1 
ATOM   656   C  CB   . PRO A  1 66  ? 101.474 123.067 52.433  1.00 13.33 ? 66  PRO A CB   1 
ATOM   657   C  CG   . PRO A  1 66  ? 102.808 123.644 52.863  1.00 11.60 ? 66  PRO A CG   1 
ATOM   658   C  CD   . PRO A  1 66  ? 103.040 123.129 54.280  1.00 19.51 ? 66  PRO A CD   1 
ATOM   659   H  HA   . PRO A  1 66  ? 100.454 121.527 53.411  1.00 20.35 ? 66  PRO A HA   1 
ATOM   660   H  HB2  . PRO A  1 66  ? 101.453 122.930 51.473  1.00 16.00 ? 66  PRO A HB2  1 
ATOM   661   H  HB3  . PRO A  1 66  ? 100.744 123.640 52.716  1.00 16.00 ? 66  PRO A HB3  1 
ATOM   662   H  HG2  . PRO A  1 66  ? 103.506 123.330 52.267  1.00 13.92 ? 66  PRO A HG2  1 
ATOM   663   H  HG3  . PRO A  1 66  ? 102.762 124.613 52.855  1.00 13.92 ? 66  PRO A HG3  1 
ATOM   664   H  HD2  . PRO A  1 66  ? 103.978 122.924 54.414  1.00 23.41 ? 66  PRO A HD2  1 
ATOM   665   H  HD3  . PRO A  1 66  ? 102.721 123.775 54.929  1.00 23.41 ? 66  PRO A HD3  1 
ATOM   666   N  N    . SER A  1 67  ? 101.217 120.321 51.159  1.00 15.58 ? 67  SER A N    1 
ATOM   667   C  CA   . SER A  1 67  ? 101.719 119.387 50.143  1.00 12.11 ? 67  SER A CA   1 
ATOM   668   C  C    . SER A  1 67  ? 102.047 118.004 50.695  1.00 11.97 ? 67  SER A C    1 
ATOM   669   O  O    . SER A  1 67  ? 102.978 117.358 50.234  1.00 13.11 ? 67  SER A O    1 
ATOM   670   C  CB   . SER A  1 67  ? 102.978 119.958 49.491  1.00 21.16 ? 67  SER A CB   1 
ATOM   671   O  OG   . SER A  1 67  ? 102.770 121.303 49.107  1.00 18.90 ? 67  SER A OG   1 
ATOM   672   H  H    . SER A  1 67  ? 100.451 120.665 50.971  1.00 18.69 ? 67  SER A H    1 
ATOM   673   H  HA   . SER A  1 67  ? 101.039 119.280 49.446  1.00 14.53 ? 67  SER A HA   1 
ATOM   674   H  HB2  . SER A  1 67  ? 103.710 119.920 50.126  1.00 25.39 ? 67  SER A HB2  1 
ATOM   675   H  HB3  . SER A  1 67  ? 103.193 119.434 48.704  1.00 25.39 ? 67  SER A HB3  1 
ATOM   676   H  HG   . SER A  1 67  ? 103.449 121.603 48.758  1.00 22.68 ? 67  SER A HG   1 
ATOM   677   N  N    . SER A  1 68  ? 101.287 117.552 51.683  1.00 17.20 ? 68  SER A N    1 
ATOM   678   C  CA   . SER A  1 68  ? 101.471 116.217 52.250  1.00 16.32 ? 68  SER A CA   1 
ATOM   679   C  C    . SER A  1 68  ? 102.887 115.955 52.775  1.00 13.61 ? 68  SER A C    1 
ATOM   680   O  O    . SER A  1 68  ? 103.363 114.807 52.755  1.00 17.06 ? 68  SER A O    1 
ATOM   681   C  CB   . SER A  1 68  ? 101.158 115.146 51.185  1.00 15.62 ? 68  SER A CB   1 
ATOM   682   O  OG   . SER A  1 68  ? 99.835  115.240 50.687  1.00 14.95 ? 68  SER A OG   1 
ATOM   683   H  H    . SER A  1 68  ? 100.651 118.001 52.048  1.00 20.64 ? 68  SER A H    1 
ATOM   684   H  HA   . SER A  1 68  ? 100.845 116.097 52.994  1.00 19.58 ? 68  SER A HA   1 
ATOM   685   H  HB2  . SER A  1 68  ? 101.776 115.256 50.445  1.00 18.74 ? 68  SER A HB2  1 
ATOM   686   H  HB3  . SER A  1 68  ? 101.279 114.269 51.582  1.00 18.74 ? 68  SER A HB3  1 
ATOM   687   H  HG   . SER A  1 68  ? 99.441  115.860 51.053  1.00 17.94 ? 68  SER A HG   1 
ATOM   688   N  N    . GLN A  1 69  ? 103.554 116.988 53.277  1.00 17.98 ? 69  GLN A N    1 
ATOM   689   C  CA   . GLN A  1 69  ? 104.927 116.820 53.751  1.00 20.71 ? 69  GLN A CA   1 
ATOM   690   C  C    . GLN A  1 69  ? 105.075 115.834 54.918  1.00 24.48 ? 69  GLN A C    1 
ATOM   691   O  O    . GLN A  1 69  ? 106.102 115.162 55.025  1.00 24.79 ? 69  GLN A O    1 
ATOM   692   C  CB   . GLN A  1 69  ? 105.533 118.166 54.125  1.00 18.14 ? 69  GLN A CB   1 
ATOM   693   C  CG   . GLN A  1 69  ? 105.884 119.032 52.916  1.00 28.32 ? 69  GLN A CG   1 
ATOM   694   C  CD   . GLN A  1 69  ? 106.403 120.395 53.323  1.00 37.22 ? 69  GLN A CD   1 
ATOM   695   O  OE1  . GLN A  1 69  ? 106.906 120.569 54.430  1.00 37.22 ? 69  GLN A OE1  1 
ATOM   696   N  NE2  . GLN A  1 69  ? 106.277 121.371 52.432  1.00 34.73 ? 69  GLN A NE2  1 
ATOM   697   H  H    . GLN A  1 69  ? 103.242 117.785 53.354  1.00 21.58 ? 69  GLN A H    1 
ATOM   698   H  HA   . GLN A  1 69  ? 105.458 116.463 53.009  1.00 24.85 ? 69  GLN A HA   1 
ATOM   699   H  HB2  . GLN A  1 69  ? 104.896 118.657 54.667  1.00 21.77 ? 69  GLN A HB2  1 
ATOM   700   H  HB3  . GLN A  1 69  ? 106.347 118.014 54.629  1.00 21.77 ? 69  GLN A HB3  1 
ATOM   701   H  HG2  . GLN A  1 69  ? 106.574 118.589 52.398  1.00 33.99 ? 69  GLN A HG2  1 
ATOM   702   H  HG3  . GLN A  1 69  ? 105.090 119.160 52.375  1.00 33.99 ? 69  GLN A HG3  1 
ATOM   703   H  HE21 . GLN A  1 69  ? 105.915 121.212 51.668  1.00 41.68 ? 69  GLN A HE21 1 
ATOM   704   H  HE22 . GLN A  1 69  ? 106.557 122.163 52.618  1.00 41.68 ? 69  GLN A HE22 1 
ATOM   705   N  N    . LEU A  1 70  ? 104.073 115.727 55.787  1.00 18.45 ? 70  LEU A N    1 
ATOM   706   C  CA   . LEU A  1 70  ? 104.215 114.845 56.937  1.00 23.07 ? 70  LEU A CA   1 
ATOM   707   C  C    . LEU A  1 70  ? 103.834 113.414 56.591  1.00 23.14 ? 70  LEU A C    1 
ATOM   708   O  O    . LEU A  1 70  ? 104.061 112.503 57.389  1.00 24.21 ? 70  LEU A O    1 
ATOM   709   C  CB   . LEU A  1 70  ? 103.376 115.331 58.127  1.00 19.19 ? 70  LEU A CB   1 
ATOM   710   C  CG   . LEU A  1 70  ? 103.942 116.449 58.998  1.00 27.03 ? 70  LEU A CG   1 
ATOM   711   C  CD1  . LEU A  1 70  ? 103.051 116.664 60.200  1.00 20.90 ? 70  LEU A CD1  1 
ATOM   712   C  CD2  . LEU A  1 70  ? 105.344 116.124 59.456  1.00 22.59 ? 70  LEU A CD2  1 
ATOM   713   H  H    . LEU A  1 70  ? 103.321 116.142 55.735  1.00 22.14 ? 70  LEU A H    1 
ATOM   714   H  HA   . LEU A  1 70  ? 105.154 114.844 57.217  1.00 27.69 ? 70  LEU A HA   1 
ATOM   715   H  HB2  . LEU A  1 70  ? 102.526 115.645 57.783  1.00 23.03 ? 70  LEU A HB2  1 
ATOM   716   H  HB3  . LEU A  1 70  ? 103.220 114.571 58.711  1.00 23.03 ? 70  LEU A HB3  1 
ATOM   717   H  HG   . LEU A  1 70  ? 103.970 117.272 58.486  1.00 32.44 ? 70  LEU A HG   1 
ATOM   718   H  HD11 . LEU A  1 70  ? 103.418 117.369 60.739  1.00 25.07 ? 70  LEU A HD11 1 
ATOM   719   H  HD12 . LEU A  1 70  ? 102.172 116.906 59.898  1.00 25.07 ? 70  LEU A HD12 1 
ATOM   720   H  HD13 . LEU A  1 70  ? 103.010 115.851 60.709  1.00 25.07 ? 70  LEU A HD13 1 
ATOM   721   H  HD21 . LEU A  1 70  ? 105.669 116.845 59.999  1.00 27.11 ? 70  LEU A HD21 1 
ATOM   722   H  HD22 . LEU A  1 70  ? 105.324 115.311 59.966  1.00 27.11 ? 70  LEU A HD22 1 
ATOM   723   H  HD23 . LEU A  1 70  ? 105.906 116.014 58.686  1.00 27.11 ? 70  LEU A HD23 1 
ATOM   724   N  N    . GLY A  1 71  ? 103.251 113.231 55.408  1.00 19.94 ? 71  GLY A N    1 
ATOM   725   C  CA   . GLY A  1 71  ? 102.817 111.926 54.926  1.00 23.96 ? 71  GLY A CA   1 
ATOM   726   C  C    . GLY A  1 71  ? 101.422 112.033 54.339  1.00 17.42 ? 71  GLY A C    1 
ATOM   727   O  O    . GLY A  1 71  ? 100.866 113.127 54.261  1.00 18.85 ? 71  GLY A O    1 
ATOM   728   H  H    . GLY A  1 71  ? 103.093 113.868 54.852  1.00 23.93 ? 71  GLY A H    1 
ATOM   729   H  HA2  . GLY A  1 71  ? 103.424 111.606 54.241  1.00 28.75 ? 71  GLY A HA2  1 
ATOM   730   H  HA3  . GLY A  1 71  ? 102.803 111.289 55.659  1.00 28.75 ? 71  GLY A HA3  1 
ATOM   731   N  N    . SER A  1 72  ? 100.834 110.912 53.938  1.00 16.88 ? 72  SER A N    1 
ATOM   732   C  CA   . SER A  1 72  ? 99.468  110.942 53.393  1.00 17.65 ? 72  SER A CA   1 
ATOM   733   C  C    . SER A  1 72  ? 98.433  111.326 54.449  1.00 19.47 ? 72  SER A C    1 
ATOM   734   O  O    . SER A  1 72  ? 98.673  111.224 55.643  1.00 14.84 ? 72  SER A O    1 
ATOM   735   C  CB   . SER A  1 72  ? 99.076  109.587 52.829  1.00 17.08 ? 72  SER A CB   1 
ATOM   736   O  OG   . SER A  1 72  ? 98.807  108.678 53.883  1.00 17.19 ? 72  SER A OG   1 
ATOM   737   H  H    . SER A  1 72  ? 101.192 110.131 53.967  1.00 20.26 ? 72  SER A H    1 
ATOM   738   H  HA   . SER A  1 72  ? 99.425  111.600 52.668  1.00 21.18 ? 72  SER A HA   1 
ATOM   739   H  HB2  . SER A  1 72  ? 98.280  109.687 52.285  1.00 20.49 ? 72  SER A HB2  1 
ATOM   740   H  HB3  . SER A  1 72  ? 99.807  109.243 52.292  1.00 20.49 ? 72  SER A HB3  1 
ATOM   741   H  HG   . SER A  1 72  ? 98.595  107.948 53.576  1.00 20.62 ? 72  SER A HG   1 
ATOM   742   N  N    . GLU A  1 73  ? 97.267  111.770 54.002  1.00 18.02 ? 73  GLU A N    1 
ATOM   743   C  CA   . GLU A  1 73  ? 96.244  112.220 54.947  1.00 18.00 ? 73  GLU A CA   1 
ATOM   744   C  C    . GLU A  1 73  ? 95.908  111.099 55.941  1.00 16.95 ? 73  GLU A C    1 
ATOM   745   O  O    . GLU A  1 73  ? 95.764  111.331 57.146  1.00 18.33 ? 73  GLU A O    1 
ATOM   746   C  CB   . GLU A  1 73  ? 94.999  112.663 54.177  1.00 14.88 ? 73  GLU A CB   1 
ATOM   747   C  CG   . GLU A  1 73  ? 93.956  113.397 55.016  1.00 18.88 ? 73  GLU A CG   1 
ATOM   748   C  CD   . GLU A  1 73  ? 92.947  114.139 54.164  1.00 16.50 ? 73  GLU A CD   1 
ATOM   749   O  OE1  . GLU A  1 73  ? 93.378  114.771 53.165  1.00 12.46 ? 73  GLU A OE1  1 
ATOM   750   O  OE2  . GLU A  1 73  ? 91.734  114.062 54.482  1.00 12.86 ? 73  GLU A OE2  1 
ATOM   751   H  H    . GLU A  1 73  ? 97.041  111.823 53.174  1.00 21.62 ? 73  GLU A H    1 
ATOM   752   H  HA   . GLU A  1 73  ? 96.584  112.988 55.452  1.00 21.60 ? 73  GLU A HA   1 
ATOM   753   H  HB2  . GLU A  1 73  ? 95.273  113.260 53.463  1.00 17.86 ? 73  GLU A HB2  1 
ATOM   754   H  HB3  . GLU A  1 73  ? 94.572  111.878 53.800  1.00 17.86 ? 73  GLU A HB3  1 
ATOM   755   H  HG2  . GLU A  1 73  ? 93.475  112.753 55.559  1.00 22.66 ? 73  GLU A HG2  1 
ATOM   756   H  HG3  . GLU A  1 73  ? 94.403  114.043 55.584  1.00 22.66 ? 73  GLU A HG3  1 
ATOM   757   N  N    A THR A  1 74  ? 95.795  109.882 55.423  0.35 15.04 ? 74  THR A N    1 
ATOM   758   N  N    B THR A  1 74  ? 95.775  109.876 55.427  0.65 14.87 ? 74  THR A N    1 
ATOM   759   C  CA   A THR A  1 74  ? 95.462  108.727 56.242  0.35 14.10 ? 74  THR A CA   1 
ATOM   760   C  CA   B THR A  1 74  ? 95.459  108.735 56.279  0.65 14.29 ? 74  THR A CA   1 
ATOM   761   C  C    A THR A  1 74  ? 96.593  108.376 57.205  0.35 14.81 ? 74  THR A C    1 
ATOM   762   C  C    B THR A  1 74  ? 96.602  108.397 57.224  0.65 14.78 ? 74  THR A C    1 
ATOM   763   O  O    A THR A  1 74  ? 96.349  108.053 58.372  0.35 17.67 ? 74  THR A O    1 
ATOM   764   O  O    B THR A  1 74  ? 96.375  108.109 58.403  0.65 17.59 ? 74  THR A O    1 
ATOM   765   C  CB   A THR A  1 74  ? 95.115  107.522 55.346  0.35 13.98 ? 74  THR A CB   1 
ATOM   766   C  CB   B THR A  1 74  ? 95.024  107.473 55.472  0.65 13.31 ? 74  THR A CB   1 
ATOM   767   O  OG1  A THR A  1 74  ? 93.799  107.704 54.802  0.35 19.74 ? 74  THR A OG1  1 
ATOM   768   O  OG1  B THR A  1 74  ? 95.949  107.190 54.406  0.65 20.58 ? 74  THR A OG1  1 
ATOM   769   C  CG2  A THR A  1 74  ? 95.179  106.212 56.119  0.35 15.73 ? 74  THR A CG2  1 
ATOM   770   C  CG2  B THR A  1 74  ? 93.634  107.689 54.902  0.65 18.01 ? 74  THR A CG2  1 
ATOM   771   H  H    A THR A  1 74  ? 95.908  109.698 54.591  0.35 18.05 ? 74  THR A H    1 
ATOM   772   H  H    B THR A  1 74  ? 95.861  109.684 54.593  0.65 17.84 ? 74  THR A H    1 
ATOM   773   H  HA   A THR A  1 74  ? 94.669  108.939 56.777  0.35 16.92 ? 74  THR A HA   1 
ATOM   774   H  HA   B THR A  1 74  ? 94.696  108.986 56.839  0.65 17.15 ? 74  THR A HA   1 
ATOM   775   H  HB   A THR A  1 74  ? 95.755  107.473 54.618  0.35 16.77 ? 74  THR A HB   1 
ATOM   776   H  HB   B THR A  1 74  ? 94.988  106.711 56.071  0.65 15.97 ? 74  THR A HB   1 
ATOM   777   H  HG1  A THR A  1 74  ? 93.250  107.759 55.409  0.35 23.69 ? 74  THR A HG1  1 
ATOM   778   H  HG1  B THR A  1 74  ? 95.985  107.826 53.889  0.65 24.70 ? 74  THR A HG1  1 
ATOM   779   H  HG21 A THR A  1 74  ? 94.960  105.479 55.541  0.35 18.88 ? 74  THR A HG21 1 
ATOM   780   H  HG21 B THR A  1 74  ? 93.360  106.915 54.404  0.65 21.61 ? 74  THR A HG21 1 
ATOM   781   H  HG22 A THR A  1 74  ? 96.063  106.081 56.469  0.35 18.88 ? 74  THR A HG22 1 
ATOM   782   H  HG22 B THR A  1 74  ? 93.007  107.840 55.613  0.65 21.61 ? 74  THR A HG22 1 
ATOM   783   H  HG23 A THR A  1 74  ? 94.555  106.232 56.849  0.35 18.88 ? 74  THR A HG23 1 
ATOM   784   H  HG23 B THR A  1 74  ? 93.633  108.451 54.318  0.65 21.61 ? 74  THR A HG23 1 
ATOM   785   N  N    . GLU A  1 75  ? 97.824  108.448 56.714  1.00 14.56 ? 75  GLU A N    1 
ATOM   786   C  CA   . GLU A  1 75  ? 98.993  108.124 57.524  1.00 19.12 ? 75  GLU A CA   1 
ATOM   787   C  C    . GLU A  1 75  ? 99.142  109.116 58.671  1.00 17.11 ? 75  GLU A C    1 
ATOM   788   O  O    . GLU A  1 75  ? 99.499  108.743 59.800  1.00 16.22 ? 75  GLU A O    1 
ATOM   789   C  CB   . GLU A  1 75  ? 100.260 108.133 56.676  1.00 22.70 ? 75  GLU A CB   1 
ATOM   790   C  CG   . GLU A  1 75  ? 100.377 106.936 55.750  1.00 32.43 ? 75  GLU A CG   1 
ATOM   791   C  CD   . GLU A  1 75  ? 101.442 107.115 54.665  1.00 38.87 ? 75  GLU A CD   1 
ATOM   792   O  OE1  . GLU A  1 75  ? 102.106 108.180 54.633  1.00 31.03 ? 75  GLU A OE1  1 
ATOM   793   O  OE2  . GLU A  1 75  ? 101.612 106.179 53.848  1.00 40.86 ? 75  GLU A OE2  1 
ATOM   794   H  H    . GLU A  1 75  ? 98.008  108.674 55.905  0.35 17.47 ? 75  GLU A H    1 
ATOM   795   H  HA   . GLU A  1 75  ? 98.884  107.227 57.905  1.00 22.94 ? 75  GLU A HA   1 
ATOM   796   H  HB2  . GLU A  1 75  ? 100.266 108.934 56.129  1.00 27.25 ? 75  GLU A HB2  1 
ATOM   797   H  HB3  . GLU A  1 75  ? 101.031 108.130 57.265  1.00 27.25 ? 75  GLU A HB3  1 
ATOM   798   H  HG2  . GLU A  1 75  ? 100.613 106.154 56.274  1.00 38.91 ? 75  GLU A HG2  1 
ATOM   799   H  HG3  . GLU A  1 75  ? 99.525  106.793 55.310  1.00 38.91 ? 75  GLU A HG3  1 
ATOM   800   N  N    . VAL A  1 76  ? 98.872  110.382 58.386  1.00 16.53 ? 76  VAL A N    1 
ATOM   801   C  CA   . VAL A  1 76  ? 98.993  111.411 59.410  1.00 12.55 ? 76  VAL A CA   1 
ATOM   802   C  C    . VAL A  1 76  ? 97.922  111.263 60.486  1.00 16.30 ? 76  VAL A C    1 
ATOM   803   O  O    . VAL A  1 76  ? 98.203  111.490 61.670  1.00 20.02 ? 76  VAL A O    1 
ATOM   804   C  CB   . VAL A  1 76  ? 98.933  112.804 58.803  1.00 16.67 ? 76  VAL A CB   1 
ATOM   805   C  CG1  . VAL A  1 76  ? 98.979  113.859 59.877  1.00 17.38 ? 76  VAL A CG1  1 
ATOM   806   C  CG2  . VAL A  1 76  ? 100.085 112.995 57.854  1.00 17.38 ? 76  VAL A CG2  1 
ATOM   807   H  H    . VAL A  1 76  ? 98.619  110.670 57.616  1.00 19.84 ? 76  VAL A H    1 
ATOM   808   H  HA   . VAL A  1 76  ? 99.866  111.315 59.846  1.00 15.06 ? 76  VAL A HA   1 
ATOM   809   H  HB   . VAL A  1 76  ? 98.097  112.907 58.302  1.00 20.00 ? 76  VAL A HB   1 
ATOM   810   H  HG11 . VAL A  1 76  ? 98.939  114.725 59.465  1.00 20.85 ? 76  VAL A HG11 1 
ATOM   811   H  HG12 . VAL A  1 76  ? 98.228  113.740 60.464  1.00 20.85 ? 76  VAL A HG12 1 
ATOM   812   H  HG13 . VAL A  1 76  ? 99.798  113.767 60.370  1.00 20.85 ? 76  VAL A HG13 1 
ATOM   813   H  HG21 . VAL A  1 76  ? 100.036 113.877 57.478  1.00 20.86 ? 76  VAL A HG21 1 
ATOM   814   H  HG22 . VAL A  1 76  ? 100.908 112.890 58.337  1.00 20.86 ? 76  VAL A HG22 1 
ATOM   815   H  HG23 . VAL A  1 76  ? 100.028 112.338 57.157  1.00 20.86 ? 76  VAL A HG23 1 
ATOM   816   N  N    . LEU A  1 77  ? 96.701  110.898 60.107  1.00 19.03 ? 77  LEU A N    1 
ATOM   817   C  CA   . LEU A  1 77  ? 95.684  110.667 61.136  1.00 13.06 ? 77  LEU A CA   1 
ATOM   818   C  C    . LEU A  1 77  ? 96.203  109.612 62.111  1.00 16.91 ? 77  LEU A C    1 
ATOM   819   O  O    . LEU A  1 77  ? 96.032  109.737 63.326  1.00 11.87 ? 77  LEU A O    1 
ATOM   820   C  CB   . LEU A  1 77  ? 94.366  110.192 60.537  1.00 14.54 ? 77  LEU A CB   1 
ATOM   821   C  CG   . LEU A  1 77  ? 93.205  110.058 61.526  1.00 15.40 ? 77  LEU A CG   1 
ATOM   822   C  CD1  . LEU A  1 77  ? 92.922  111.376 62.196  1.00 24.63 ? 77  LEU A CD1  1 
ATOM   823   C  CD2  . LEU A  1 77  ? 91.967  109.570 60.827  1.00 21.06 ? 77  LEU A CD2  1 
ATOM   824   H  H    . LEU A  1 77  ? 96.440  110.781 59.296  1.00 22.84 ? 77  LEU A H    1 
ATOM   825   H  HA   . LEU A  1 77  ? 95.522  111.497 61.631  1.00 15.67 ? 77  LEU A HA   1 
ATOM   826   H  HB2  . LEU A  1 77  ? 94.094  110.824 59.854  1.00 17.45 ? 77  LEU A HB2  1 
ATOM   827   H  HB3  . LEU A  1 77  ? 94.508  109.321 60.135  1.00 17.45 ? 77  LEU A HB3  1 
ATOM   828   H  HG   . LEU A  1 77  ? 93.441  109.413 62.212  1.00 18.48 ? 77  LEU A HG   1 
ATOM   829   H  HD11 . LEU A  1 77  ? 92.192  111.264 62.809  1.00 29.56 ? 77  LEU A HD11 1 
ATOM   830   H  HD12 . LEU A  1 77  ? 93.707  111.661 62.669  1.00 29.56 ? 77  LEU A HD12 1 
ATOM   831   H  HD13 . LEU A  1 77  ? 92.691  112.023 61.526  1.00 29.56 ? 77  LEU A HD13 1 
ATOM   832   H  HD21 . LEU A  1 77  ? 91.256  109.495 61.468  1.00 25.28 ? 77  LEU A HD21 1 
ATOM   833   H  HD22 . LEU A  1 77  ? 91.726  110.199 60.143  1.00 25.28 ? 77  LEU A HD22 1 
ATOM   834   H  HD23 . LEU A  1 77  ? 92.147  108.712 60.435  1.00 25.28 ? 77  LEU A HD23 1 
ATOM   835   N  N    . GLU A  1 78  ? 96.838  108.572 61.578  1.00 16.36 ? 78  GLU A N    1 
ATOM   836   C  CA   . GLU A  1 78  ? 97.411  107.523 62.427  1.00 25.67 ? 78  GLU A CA   1 
ATOM   837   C  C    . GLU A  1 78  ? 98.462  108.060 63.406  1.00 20.98 ? 78  GLU A C    1 
ATOM   838   O  O    . GLU A  1 78  ? 98.478  107.678 64.575  1.00 22.02 ? 78  GLU A O    1 
ATOM   839   C  CB   . GLU A  1 78  ? 98.006  106.397 61.572  1.00 23.28 ? 78  GLU A CB   1 
ATOM   840   C  CG   . GLU A  1 78  ? 97.026  105.277 61.280  1.00 35.29 ? 78  GLU A CG   1 
ATOM   841   C  CD   . GLU A  1 78  ? 96.588  104.544 62.549  1.00 44.32 ? 78  GLU A CD   1 
ATOM   842   O  OE1  . GLU A  1 78  ? 97.443  103.888 63.180  1.00 51.35 ? 78  GLU A OE1  1 
ATOM   843   O  OE2  . GLU A  1 78  ? 95.398  104.630 62.921  1.00 40.25 ? 78  GLU A OE2  1 
ATOM   844   H  H    . GLU A  1 78  ? 96.952  108.448 60.735  1.00 19.64 ? 78  GLU A H    1 
ATOM   845   H  HA   . GLU A  1 78  ? 96.688  107.132 62.962  1.00 30.80 ? 78  GLU A HA   1 
ATOM   846   H  HB2  . GLU A  1 78  ? 98.296  106.767 60.723  1.00 27.94 ? 78  GLU A HB2  1 
ATOM   847   H  HB3  . GLU A  1 78  ? 98.764  106.014 62.040  1.00 27.94 ? 78  GLU A HB3  1 
ATOM   848   H  HG2  . GLU A  1 78  ? 96.235  105.648 60.858  1.00 42.35 ? 78  GLU A HG2  1 
ATOM   849   H  HG3  . GLU A  1 78  ? 97.447  104.632 60.690  1.00 42.35 ? 78  GLU A HG3  1 
ATOM   850   N  N    . GLN A  1 79  ? 99.336  108.938 62.932  1.00 16.25 ? 79  GLN A N    1 
ATOM   851   C  CA   . GLN A  1 79  ? 100.373 109.531 63.785  1.00 13.91 ? 79  GLN A CA   1 
ATOM   852   C  C    . GLN A  1 79  ? 99.695  110.335 64.908  1.00 19.28 ? 79  GLN A C    1 
ATOM   853   O  O    . GLN A  1 79  ? 100.113 110.287 66.068  1.00 23.89 ? 79  GLN A O    1 
ATOM   854   C  CB   . GLN A  1 79  ? 101.300 110.458 62.972  1.00 15.95 ? 79  GLN A CB   1 
ATOM   855   C  CG   . GLN A  1 79  ? 102.153 109.775 61.912  1.00 31.69 ? 79  GLN A CG   1 
ATOM   856   C  CD   . GLN A  1 79  ? 102.933 110.781 61.062  1.00 41.39 ? 79  GLN A CD   1 
ATOM   857   O  OE1  . GLN A  1 79  ? 103.587 111.686 61.585  1.00 49.80 ? 79  GLN A OE1  1 
ATOM   858   N  NE2  . GLN A  1 79  ? 102.856 110.628 59.749  1.00 36.15 ? 79  GLN A NE2  1 
ATOM   859   H  H    . GLN A  1 79  ? 99.354  109.211 62.117  1.00 19.50 ? 79  GLN A H    1 
ATOM   860   H  HA   . GLN A  1 79  ? 100.914 108.821 64.189  1.00 16.69 ? 79  GLN A HA   1 
ATOM   861   H  HB2  . GLN A  1 79  ? 100.752 111.120 62.522  1.00 19.14 ? 79  GLN A HB2  1 
ATOM   862   H  HB3  . GLN A  1 79  ? 101.903 110.903 63.588  1.00 19.14 ? 79  GLN A HB3  1 
ATOM   863   H  HG2  . GLN A  1 79  ? 102.791 109.188 62.347  1.00 38.02 ? 79  GLN A HG2  1 
ATOM   864   H  HG3  . GLN A  1 79  ? 101.578 109.263 61.322  1.00 38.02 ? 79  GLN A HG3  1 
ATOM   865   H  HE21 . GLN A  1 79  ? 102.385 109.990 59.417  1.00 43.38 ? 79  GLN A HE21 1 
ATOM   866   H  HE22 . GLN A  1 79  ? 103.277 111.168 59.228  1.00 43.38 ? 79  GLN A HE22 1 
ATOM   867   N  N    . ALA A  1 80  ? 98.638  111.069 64.562  1.00 20.80 ? 80  ALA A N    1 
ATOM   868   C  CA   . ALA A  1 80  ? 97.914  111.883 65.535  1.00 18.36 ? 80  ALA A CA   1 
ATOM   869   C  C    . ALA A  1 80  ? 97.245  111.018 66.594  1.00 21.23 ? 80  ALA A C    1 
ATOM   870   O  O    . ALA A  1 80  ? 97.338  111.283 67.796  1.00 22.09 ? 80  ALA A O    1 
ATOM   871   C  CB   . ALA A  1 80  ? 96.857  112.727 64.833  1.00 26.95 ? 80  ALA A CB   1 
ATOM   872   H  H    . ALA A  1 80  ? 98.320  111.112 63.765  1.00 24.95 ? 80  ALA A H    1 
ATOM   873   H  HA   . ALA A  1 80  ? 98.543  112.487 65.984  1.00 22.04 ? 80  ALA A HA   1 
ATOM   874   H  HB1  . ALA A  1 80  ? 96.393  113.254 65.488  1.00 32.34 ? 80  ALA A HB1  1 
ATOM   875   H  HB2  . ALA A  1 80  ? 97.289  113.301 64.196  1.00 32.34 ? 80  ALA A HB2  1 
ATOM   876   H  HB3  . ALA A  1 80  ? 96.240  112.145 64.384  1.00 32.34 ? 80  ALA A HB3  1 
ATOM   877   N  N    . LYS A  1 81  ? 96.553  109.982 66.144  1.00 21.72 ? 81  LYS A N    1 
ATOM   878   C  CA   . LYS A  1 81  ? 95.847  109.099 67.052  1.00 22.67 ? 81  LYS A CA   1 
ATOM   879   C  C    . LYS A  1 81  ? 96.805  108.551 68.093  1.00 23.70 ? 81  LYS A C    1 
ATOM   880   O  O    . LYS A  1 81  ? 96.431  108.339 69.238  1.00 24.88 ? 81  LYS A O    1 
ATOM   881   C  CB   . LYS A  1 81  ? 95.195  107.947 66.288  1.00 24.73 ? 81  LYS A CB   1 
ATOM   882   C  CG   . LYS A  1 81  ? 94.538  106.927 67.198  1.00 35.30 ? 81  LYS A CG   1 
ATOM   883   C  CD   . LYS A  1 81  ? 94.083  105.694 66.443  1.00 41.09 ? 81  LYS A CD   1 
ATOM   884   C  CE   . LYS A  1 81  ? 93.281  106.069 65.212  1.00 46.91 ? 81  LYS A CE   1 
ATOM   885   N  NZ   . LYS A  1 81  ? 92.703  104.861 64.544  1.00 54.61 ? 81  LYS A NZ   1 
ATOM   886   H  H    . LYS A  1 81  ? 96.477  109.770 65.314  1.00 26.07 ? 81  LYS A H    1 
ATOM   887   H  HA   . LYS A  1 81  ? 95.143  109.601 67.514  1.00 27.21 ? 81  LYS A HA   1 
ATOM   888   H  HB2  . LYS A  1 81  ? 94.513  108.305 65.700  1.00 29.67 ? 81  LYS A HB2  1 
ATOM   889   H  HB3  . LYS A  1 81  ? 95.874  107.490 65.768  1.00 29.67 ? 81  LYS A HB3  1 
ATOM   890   H  HG2  . LYS A  1 81  ? 95.175  106.648 67.875  1.00 42.36 ? 81  LYS A HG2  1 
ATOM   891   H  HG3  . LYS A  1 81  ? 93.761  107.328 67.617  1.00 42.36 ? 81  LYS A HG3  1 
ATOM   892   H  HD2  . LYS A  1 81  ? 94.859  105.186 66.159  1.00 49.31 ? 81  LYS A HD2  1 
ATOM   893   H  HD3  . LYS A  1 81  ? 93.520  105.154 67.020  1.00 49.31 ? 81  LYS A HD3  1 
ATOM   894   H  HE2  . LYS A  1 81  ? 92.550  106.652 65.471  1.00 56.29 ? 81  LYS A HE2  1 
ATOM   895   H  HE3  . LYS A  1 81  ? 93.861  106.519 64.578  1.00 56.29 ? 81  LYS A HE3  1 
ATOM   896   H  HZ1  . LYS A  1 81  ? 92.238  105.105 63.826  1.00 65.53 ? 81  LYS A HZ1  1 
ATOM   897   H  HZ2  . LYS A  1 81  ? 93.356  104.311 64.293  1.00 65.53 ? 81  LYS A HZ2  1 
ATOM   898   H  HZ3  . LYS A  1 81  ? 92.164  104.432 65.107  1.00 65.53 ? 81  LYS A HZ3  1 
ATOM   899   N  N    . PHE A  1 82  ? 98.049  108.333 67.697  1.00 19.46 ? 82  PHE A N    1 
ATOM   900   C  CA   . PHE A  1 82  ? 99.014  107.780 68.612  1.00 24.58 ? 82  PHE A CA   1 
ATOM   901   C  C    . PHE A  1 82  ? 99.731  108.823 69.470  1.00 25.17 ? 82  PHE A C    1 
ATOM   902   O  O    . PHE A  1 82  ? 100.588 108.483 70.267  1.00 28.26 ? 82  PHE A O    1 
ATOM   903   C  CB   . PHE A  1 82  ? 99.968  106.854 67.869  1.00 30.56 ? 82  PHE A CB   1 
ATOM   904   C  CG   . PHE A  1 82  ? 99.371  105.499 67.597  1.00 40.49 ? 82  PHE A CG   1 
ATOM   905   C  CD1  . PHE A  1 82  ? 98.942  104.699 68.657  1.00 46.92 ? 82  PHE A CD1  1 
ATOM   906   C  CD2  . PHE A  1 82  ? 99.220  105.026 66.301  1.00 42.65 ? 82  PHE A CD2  1 
ATOM   907   C  CE1  . PHE A  1 82  ? 98.382  103.457 68.432  1.00 48.69 ? 82  PHE A CE1  1 
ATOM   908   C  CE2  . PHE A  1 82  ? 98.663  103.781 66.069  1.00 45.48 ? 82  PHE A CE2  1 
ATOM   909   C  CZ   . PHE A  1 82  ? 98.242  102.996 67.136  1.00 49.45 ? 82  PHE A CZ   1 
ATOM   910   H  H    . PHE A  1 82  ? 98.353  108.497 66.909  1.00 23.35 ? 82  PHE A H    1 
ATOM   911   H  HA   . PHE A  1 82  ? 98.519  107.212 69.239  1.00 29.50 ? 82  PHE A HA   1 
ATOM   912   H  HB2  . PHE A  1 82  ? 100.200 107.257 67.018  1.00 36.67 ? 82  PHE A HB2  1 
ATOM   913   H  HB3  . PHE A  1 82  ? 100.767 106.728 68.405  1.00 36.67 ? 82  PHE A HB3  1 
ATOM   914   H  HD1  . PHE A  1 82  ? 99.034  105.008 69.530  1.00 56.30 ? 82  PHE A HD1  1 
ATOM   915   H  HD2  . PHE A  1 82  ? 99.499  105.548 65.584  1.00 51.17 ? 82  PHE A HD2  1 
ATOM   916   H  HE1  . PHE A  1 82  ? 98.103  102.933 69.148  1.00 58.43 ? 82  PHE A HE1  1 
ATOM   917   H  HE2  . PHE A  1 82  ? 98.568  103.470 65.198  1.00 54.58 ? 82  PHE A HE2  1 
ATOM   918   H  HZ   . PHE A  1 82  ? 97.868  102.159 66.978  1.00 59.34 ? 82  PHE A HZ   1 
ATOM   919   N  N    . GLY A  1 83  ? 99.366  110.090 69.323  1.00 19.57 ? 83  GLY A N    1 
ATOM   920   C  CA   . GLY A  1 83  ? 99.751  111.077 70.311  1.00 23.04 ? 83  GLY A CA   1 
ATOM   921   C  C    . GLY A  1 83  ? 100.721 112.123 69.809  1.00 23.64 ? 83  GLY A C    1 
ATOM   922   O  O    . GLY A  1 83  ? 101.212 112.932 70.583  1.00 19.28 ? 83  GLY A O    1 
ATOM   923   H  H    . GLY A  1 83  ? 98.902  110.398 68.667  1.00 23.49 ? 83  GLY A H    1 
ATOM   924   H  HA2  . GLY A  1 83  ? 98.956  111.533 70.629  1.00 27.65 ? 83  GLY A HA2  1 
ATOM   925   H  HA3  . GLY A  1 83  ? 100.161 110.626 71.066  1.00 27.65 ? 83  GLY A HA3  1 
ATOM   926   N  N    . ALA A  1 84  ? 101.007 112.096 68.513  1.00 19.84 ? 84  ALA A N    1 
ATOM   927   C  CA   . ALA A  1 84  ? 101.852 113.109 67.909  1.00 24.74 ? 84  ALA A CA   1 
ATOM   928   C  C    . ALA A  1 84  ? 101.239 114.491 68.079  1.00 13.82 ? 84  ALA A C    1 
ATOM   929   O  O    . ALA A  1 84  ? 100.012 114.661 68.117  1.00 14.71 ? 84  ALA A O    1 
ATOM   930   C  CB   . ALA A  1 84  ? 102.062 112.802 66.427  1.00 30.94 ? 84  ALA A CB   1 
ATOM   931   H  H    . ALA A  1 84  ? 100.722 111.499 67.963  1.00 23.81 ? 84  ALA A H    1 
ATOM   932   H  HA   . ALA A  1 84  ? 102.727 113.104 68.350  1.00 29.69 ? 84  ALA A HA   1 
ATOM   933   H  HB1  . ALA A  1 84  ? 102.622 113.481 66.044  1.00 37.13 ? 84  ALA A HB1  1 
ATOM   934   H  HB2  . ALA A  1 84  ? 102.483 111.943 66.343  1.00 37.13 ? 84  ALA A HB2  1 
ATOM   935   H  HB3  . ALA A  1 84  ? 101.209 112.794 65.987  1.00 37.13 ? 84  ALA A HB3  1 
ATOM   936   N  N    . ASN A  1 85  ? 102.089 115.493 68.150  1.00 19.71 ? 85  ASN A N    1 
ATOM   937   C  CA   . ASN A  1 85  ? 101.616 116.881 68.229  1.00 17.33 ? 85  ASN A CA   1 
ATOM   938   C  C    . ASN A  1 85  ? 101.195 117.419 66.853  1.00 19.44 ? 85  ASN A C    1 
ATOM   939   O  O    . ASN A  1 85  ? 101.832 118.305 66.275  1.00 20.55 ? 85  ASN A O    1 
ATOM   940   C  CB   . ASN A  1 85  ? 102.694 117.763 68.855  1.00 22.05 ? 85  ASN A CB   1 
ATOM   941   C  CG   . ASN A  1 85  ? 104.009 117.694 68.105  1.00 23.47 ? 85  ASN A CG   1 
ATOM   942   O  OD1  . ASN A  1 85  ? 104.381 116.645 67.567  1.00 23.94 ? 85  ASN A OD1  1 
ATOM   943   N  ND2  . ASN A  1 85  ? 104.719 118.818 68.054  1.00 28.22 ? 85  ASN A ND2  1 
ATOM   944   H  H    . ASN A  1 85  ? 102.945 115.409 68.154  1.00 23.65 ? 85  ASN A H    1 
ATOM   945   H  HA   . ASN A  1 85  ? 100.830 116.912 68.813  1.00 20.80 ? 85  ASN A HA   1 
ATOM   946   H  HB2  . ASN A  1 85  ? 102.392 118.685 68.849  1.00 26.47 ? 85  ASN A HB2  1 
ATOM   947   H  HB3  . ASN A  1 85  ? 102.852 117.471 69.766  1.00 26.47 ? 85  ASN A HB3  1 
ATOM   948   H  HD21 . ASN A  1 85  ? 104.424 119.530 68.435  1.00 33.86 ? 85  ASN A HD21 1 
ATOM   949   H  HD22 . ASN A  1 85  ? 105.473 118.832 67.640  1.00 33.86 ? 85  ASN A HD22 1 
ATOM   950   N  N    . ILE A  1 86  ? 100.089 116.885 66.357  1.00 15.18 ? 86  ILE A N    1 
ATOM   951   C  CA   . ILE A  1 86  ? 99.633  117.146 65.011  1.00 14.80 ? 86  ILE A CA   1 
ATOM   952   C  C    . ILE A  1 86  ? 98.169  117.533 65.009  1.00 15.18 ? 86  ILE A C    1 
ATOM   953   O  O    . ILE A  1 86  ? 97.364  116.900 65.672  1.00 12.88 ? 86  ILE A O    1 
ATOM   954   C  CB   . ILE A  1 86  ? 99.757  115.890 64.155  1.00 17.02 ? 86  ILE A CB   1 
ATOM   955   C  CG1  . ILE A  1 86  ? 101.239 115.542 63.946  1.00 16.99 ? 86  ILE A CG1  1 
ATOM   956   C  CG2  . ILE A  1 86  ? 99.026  116.100 62.825  1.00 20.82 ? 86  ILE A CG2  1 
ATOM   957   C  CD1  . ILE A  1 86  ? 101.448 114.280 63.151  1.00 22.14 ? 86  ILE A CD1  1 
ATOM   958   H  H    . ILE A  1 86  ? 99.574  116.355 66.796  1.00 18.22 ? 86  ILE A H    1 
ATOM   959   H  HA   . ILE A  1 86  ? 100.159 117.867 64.607  1.00 17.75 ? 86  ILE A HA   1 
ATOM   960   H  HB   . ILE A  1 86  ? 99.333  115.155 64.625  1.00 20.42 ? 86  ILE A HB   1 
ATOM   961   H  HG12 . ILE A  1 86  ? 101.669 116.270 63.470  1.00 20.39 ? 86  ILE A HG12 1 
ATOM   962   H  HG13 . ILE A  1 86  ? 101.658 115.421 64.812  1.00 20.39 ? 86  ILE A HG13 1 
ATOM   963   H  HG21 . ILE A  1 86  ? 99.110  115.305 62.294  1.00 24.99 ? 86  ILE A HG21 1 
ATOM   964   H  HG22 . ILE A  1 86  ? 98.100  116.279 63.003  1.00 24.99 ? 86  ILE A HG22 1 
ATOM   965   H  HG23 . ILE A  1 86  ? 99.422  116.844 62.366  1.00 24.99 ? 86  ILE A HG23 1 
ATOM   966   H  HD11 . ILE A  1 86  ? 102.390 114.122 63.058  1.00 26.57 ? 86  ILE A HD11 1 
ATOM   967   H  HD12 . ILE A  1 86  ? 101.036 113.548 63.615  1.00 26.57 ? 86  ILE A HD12 1 
ATOM   968   H  HD13 . ILE A  1 86  ? 101.046 114.387 62.285  1.00 26.57 ? 86  ILE A HD13 1 
ATOM   969   N  N    . ILE A  1 87  ? 97.847  118.592 64.274  1.00 14.45 ? 87  ILE A N    1 
ATOM   970   C  CA   . ILE A  1 87  ? 96.473  118.883 63.883  1.00 13.86 ? 87  ILE A CA   1 
ATOM   971   C  C    . ILE A  1 87  ? 96.448  118.651 62.387  1.00 14.33 ? 87  ILE A C    1 
ATOM   972   O  O    . ILE A  1 87  ? 97.281  119.189 61.678  1.00 14.62 ? 87  ILE A O    1 
ATOM   973   C  CB   . ILE A  1 87  ? 96.096  120.359 64.162  1.00 14.54 ? 87  ILE A CB   1 
ATOM   974   C  CG1  . ILE A  1 87  ? 95.935  120.600 65.667  1.00 10.82 ? 87  ILE A CG1  1 
ATOM   975   C  CG2  . ILE A  1 87  ? 94.806  120.736 63.390  1.00 11.80 ? 87  ILE A CG2  1 
ATOM   976   C  CD1  . ILE A  1 87  ? 95.674  122.021 66.014  1.00 10.80 ? 87  ILE A CD1  1 
ATOM   977   H  H    . ILE A  1 87  ? 98.416  119.168 63.986  1.00 17.33 ? 87  ILE A H    1 
ATOM   978   H  HA   . ILE A  1 87  ? 95.841  118.280 64.329  1.00 16.63 ? 87  ILE A HA   1 
ATOM   979   H  HB   . ILE A  1 87  ? 96.818  120.923 63.840  1.00 17.44 ? 87  ILE A HB   1 
ATOM   980   H  HG12 . ILE A  1 87  ? 95.188  120.072 65.991  1.00 12.99 ? 87  ILE A HG12 1 
ATOM   981   H  HG13 . ILE A  1 87  ? 96.750  120.328 66.118  1.00 12.99 ? 87  ILE A HG13 1 
ATOM   982   H  HG21 . ILE A  1 87  ? 94.588  121.652 63.574  1.00 14.16 ? 87  ILE A HG21 1 
ATOM   983   H  HG22 . ILE A  1 87  ? 94.959  120.618 62.449  1.00 14.16 ? 87  ILE A HG22 1 
ATOM   984   H  HG23 . ILE A  1 87  ? 94.091  120.164 63.679  1.00 14.16 ? 87  ILE A HG23 1 
ATOM   985   H  HD11 . ILE A  1 87  ? 95.584  122.098 66.967  1.00 12.96 ? 87  ILE A HD11 1 
ATOM   986   H  HD12 . ILE A  1 87  ? 96.410  122.557 65.710  1.00 12.96 ? 87  ILE A HD12 1 
ATOM   987   H  HD13 . ILE A  1 87  ? 94.863  122.303 65.585  1.00 12.96 ? 87  ILE A HD13 1 
ATOM   988   N  N    . THR A  1 88  ? 95.536  117.812 61.904  1.00 12.75 ? 88  THR A N    1 
ATOM   989   C  CA   . THR A  1 88  ? 95.519  117.462 60.493  1.00 11.30 ? 88  THR A CA   1 
ATOM   990   C  C    . THR A  1 88  ? 94.108  117.608 59.955  1.00 12.49 ? 88  THR A C    1 
ATOM   991   O  O    . THR A  1 88  ? 93.117  117.395 60.655  1.00 10.47 ? 88  THR A O    1 
ATOM   992   C  CB   . THR A  1 88  ? 96.033  116.013 60.255  1.00 10.96 ? 88  THR A CB   1 
ATOM   993   O  OG1  . THR A  1 88  ? 96.068  115.712 58.852  1.00 14.66 ? 88  THR A OG1  1 
ATOM   994   C  CG2  . THR A  1 88  ? 95.162  114.992 61.014  1.00 11.23 ? 88  THR A CG2  1 
ATOM   995   H  H    . THR A  1 88  ? 94.921  117.435 62.372  1.00 15.29 ? 88  THR A H    1 
ATOM   996   H  HA   . THR A  1 88  ? 96.101  118.078 60.001  1.00 13.56 ? 88  THR A HA   1 
ATOM   997   H  HB   . THR A  1 88  ? 96.934  115.945 60.607  1.00 13.15 ? 88  THR A HB   1 
ATOM   998   H  HG1  . THR A  1 88  ? 95.316  115.779 58.532  1.00 17.59 ? 88  THR A HG1  1 
ATOM   999   H  HG21 . THR A  1 88  ? 95.489  114.103 60.859  1.00 13.48 ? 88  THR A HG21 1 
ATOM   1000  H  HG22 . THR A  1 88  ? 95.188  115.175 61.956  1.00 13.48 ? 88  THR A HG22 1 
ATOM   1001  H  HG23 . THR A  1 88  ? 94.252  115.048 60.711  1.00 13.48 ? 88  THR A HG23 1 
ATOM   1002  N  N    . ILE A  1 89  ? 94.031  118.017 58.707  1.00 10.40 ? 89  ILE A N    1 
ATOM   1003  C  CA   . ILE A  1 89  ? 92.779  117.945 57.990  1.00 13.44 ? 89  ILE A CA   1 
ATOM   1004  C  C    . ILE A  1 89  ? 92.469  116.460 57.888  1.00 11.52 ? 89  ILE A C    1 
ATOM   1005  O  O    . ILE A  1 89  ? 93.379  115.641 57.823  1.00 11.01 ? 89  ILE A O    1 
ATOM   1006  C  CB   . ILE A  1 89  ? 92.901  118.600 56.608  1.00 7.94  ? 89  ILE A CB   1 
ATOM   1007  C  CG1  . ILE A  1 89  ? 91.506  118.925 56.060  1.00 10.65 ? 89  ILE A CG1  1 
ATOM   1008  C  CG2  . ILE A  1 89  ? 93.733  117.697 55.639  1.00 13.93 ? 89  ILE A CG2  1 
ATOM   1009  C  CD1  . ILE A  1 89  ? 91.511  119.774 54.785  1.00 11.05 ? 89  ILE A CD1  1 
ATOM   1010  H  H    . ILE A  1 89  ? 94.686  118.339 58.253  1.00 12.48 ? 89  ILE A H    1 
ATOM   1011  H  HA   . ILE A  1 89  ? 92.070  118.390 58.498  1.00 16.12 ? 89  ILE A HA   1 
ATOM   1012  H  HB   . ILE A  1 89  ? 93.379  119.437 56.718  1.00 9.53  ? 89  ILE A HB   1 
ATOM   1013  H  HG12 . ILE A  1 89  ? 91.050  118.093 55.859  1.00 12.79 ? 89  ILE A HG12 1 
ATOM   1014  H  HG13 . ILE A  1 89  ? 91.012  119.413 56.737  1.00 12.79 ? 89  ILE A HG13 1 
ATOM   1015  H  HG21 . ILE A  1 89  ? 93.793  118.129 54.784  1.00 16.71 ? 89  ILE A HG21 1 
ATOM   1016  H  HG22 . ILE A  1 89  ? 94.611  117.571 56.006  1.00 16.71 ? 89  ILE A HG22 1 
ATOM   1017  H  HG23 . ILE A  1 89  ? 93.292  116.849 55.547  1.00 16.71 ? 89  ILE A HG23 1 
ATOM   1018  H  HD11 . ILE A  1 89  ? 90.605  119.930 54.511  1.00 13.26 ? 89  ILE A HD11 1 
ATOM   1019  H  HD12 . ILE A  1 89  ? 91.947  120.609 54.968  1.00 13.26 ? 89  ILE A HD12 1 
ATOM   1020  H  HD13 . ILE A  1 89  ? 91.985  119.301 54.097  1.00 13.26 ? 89  ILE A HD13 1 
ATOM   1021  N  N    . SER A  1 90  ? 91.178  116.135 57.898  1.00 7.92  ? 90  SER A N    1 
ATOM   1022  C  CA   . SER A  1 90  ? 90.703  114.797 57.683  1.00 9.00  ? 90  SER A CA   1 
ATOM   1023  C  C    . SER A  1 90  ? 89.480  114.871 56.783  1.00 12.28 ? 90  SER A C    1 
ATOM   1024  O  O    . SER A  1 90  ? 89.265  115.865 56.072  1.00 10.91 ? 90  SER A O    1 
ATOM   1025  C  CB   . SER A  1 90  ? 90.363  114.153 59.034  1.00 8.86  ? 90  SER A CB   1 
ATOM   1026  O  OG   . SER A  1 90  ? 90.049  112.779 58.899  1.00 12.05 ? 90  SER A OG   1 
ATOM   1027  H  H    . SER A  1 90  ? 90.546  116.702 58.033  1.00 9.50  ? 90  SER A H    1 
ATOM   1028  H  HA   . SER A  1 90  ? 91.395  114.263 57.239  1.00 10.81 ? 90  SER A HA   1 
ATOM   1029  H  HB2  . SER A  1 90  ? 91.127  114.243 59.625  1.00 10.63 ? 90  SER A HB2  1 
ATOM   1030  H  HB3  . SER A  1 90  ? 89.598  114.612 59.415  1.00 10.63 ? 90  SER A HB3  1 
ATOM   1031  H  HG   . SER A  1 90  ? 90.103  112.555 58.112  1.00 14.46 ? 90  SER A HG   1 
ATOM   1032  N  N    . ASP A  1 91  ? 88.707  113.792 56.755  1.00 10.05 ? 91  ASP A N    1 
ATOM   1033  C  CA   . ASP A  1 91  ? 87.547  113.714 55.891  1.00 6.94  ? 91  ASP A CA   1 
ATOM   1034  C  C    . ASP A  1 91  ? 86.489  112.888 56.596  1.00 7.48  ? 91  ASP A C    1 
ATOM   1035  O  O    . ASP A  1 91  ? 86.801  111.837 57.176  1.00 11.69 ? 91  ASP A O    1 
ATOM   1036  C  CB   . ASP A  1 91  ? 87.948  113.078 54.559  1.00 10.78 ? 91  ASP A CB   1 
ATOM   1037  C  CG   . ASP A  1 91  ? 86.789  112.922 53.598  1.00 13.91 ? 91  ASP A CG   1 
ATOM   1038  O  OD1  . ASP A  1 91  ? 86.154  113.930 53.280  1.00 9.84  ? 91  ASP A OD1  1 
ATOM   1039  O  OD2  . ASP A  1 91  ? 86.522  111.766 53.153  1.00 9.28  ? 91  ASP A OD2  1 
ATOM   1040  H  H    . ASP A  1 91  ? 88.838  113.088 57.233  1.00 12.06 ? 91  ASP A H    1 
ATOM   1041  H  HA   . ASP A  1 91  ? 87.192  114.612 55.723  1.00 8.33  ? 91  ASP A HA   1 
ATOM   1042  H  HB2  . ASP A  1 91  ? 88.616  113.637 54.132  1.00 12.93 ? 91  ASP A HB2  1 
ATOM   1043  H  HB3  . ASP A  1 91  ? 88.315  112.196 54.730  1.00 12.93 ? 91  ASP A HB3  1 
ATOM   1044  N  N    . TYR A  1 92  ? 85.245  113.343 56.498  1.00 7.26  ? 92  TYR A N    1 
ATOM   1045  C  CA   . TYR A  1 92  ? 84.130  112.667 57.119  1.00 7.19  ? 92  TYR A CA   1 
ATOM   1046  C  C    . TYR A  1 92  ? 83.908  111.297 56.507  1.00 6.74  ? 92  TYR A C    1 
ATOM   1047  O  O    . TYR A  1 92  ? 83.596  110.320 57.218  1.00 7.41  ? 92  TYR A O    1 
ATOM   1048  C  CB   . TYR A  1 92  ? 82.885  113.547 57.028  1.00 6.67  ? 92  TYR A CB   1 
ATOM   1049  C  CG   . TYR A  1 92  ? 82.951  114.752 57.952  1.00 6.74  ? 92  TYR A CG   1 
ATOM   1050  C  CD1  . TYR A  1 92  ? 83.098  114.584 59.317  1.00 6.88  ? 92  TYR A CD1  1 
ATOM   1051  C  CD2  . TYR A  1 92  ? 82.932  116.059 57.449  1.00 6.72  ? 92  TYR A CD2  1 
ATOM   1052  C  CE1  . TYR A  1 92  ? 83.183  115.654 60.183  1.00 7.04  ? 92  TYR A CE1  1 
ATOM   1053  C  CE2  . TYR A  1 92  ? 82.998  117.147 58.313  1.00 7.45  ? 92  TYR A CE2  1 
ATOM   1054  C  CZ   . TYR A  1 92  ? 83.122  116.935 59.675  1.00 6.94  ? 92  TYR A CZ   1 
ATOM   1055  O  OH   . TYR A  1 92  ? 83.213  117.997 60.543  1.00 9.86  ? 92  TYR A OH   1 
ATOM   1056  H  H    . TYR A  1 92  ? 85.024  114.054 56.069  1.00 8.71  ? 92  TYR A H    1 
ATOM   1057  H  HA   . TYR A  1 92  ? 84.332  112.537 58.069  1.00 8.62  ? 92  TYR A HA   1 
ATOM   1058  H  HB2  . TYR A  1 92  ? 82.793  113.871 56.119  1.00 8.01  ? 92  TYR A HB2  1 
ATOM   1059  H  HB3  . TYR A  1 92  ? 82.108  113.022 57.274  1.00 8.01  ? 92  TYR A HB3  1 
ATOM   1060  H  HD1  . TYR A  1 92  ? 83.127  113.722 59.664  1.00 8.26  ? 92  TYR A HD1  1 
ATOM   1061  H  HD2  . TYR A  1 92  ? 82.835  116.201 56.535  1.00 8.06  ? 92  TYR A HD2  1 
ATOM   1062  H  HE1  . TYR A  1 92  ? 83.264  115.514 61.098  1.00 8.45  ? 92  TYR A HE1  1 
ATOM   1063  H  HE2  . TYR A  1 92  ? 82.972  118.013 57.976  1.00 8.94  ? 92  TYR A HE2  1 
ATOM   1064  H  HH   . TYR A  1 92  ? 82.535  118.455 60.498  1.00 11.83 ? 92  TYR A HH   1 
ATOM   1065  N  N    . GLY A  1 93  ? 84.106  111.216 55.197  1.00 10.30 ? 93  GLY A N    1 
ATOM   1066  C  CA   . GLY A  1 93  ? 84.010  109.950 54.497  1.00 9.12  ? 93  GLY A CA   1 
ATOM   1067  C  C    . GLY A  1 93  ? 85.067  108.988 54.952  1.00 11.69 ? 93  GLY A C    1 
ATOM   1068  O  O    . GLY A  1 93  ? 84.796  107.807 55.093  1.00 23.07 ? 93  GLY A O    1 
ATOM   1069  H  H    . GLY A  1 93  ? 84.298  111.884 54.691  1.00 12.36 ? 93  GLY A H    1 
ATOM   1070  H  HA2  . GLY A  1 93  ? 83.139  109.554 54.657  1.00 10.95 ? 93  GLY A HA2  1 
ATOM   1071  H  HA3  . GLY A  1 93  ? 84.113  110.096 53.543  1.00 10.95 ? 93  GLY A HA3  1 
ATOM   1072  N  N    . ALA A  1 94  ? 86.279  109.464 55.187  1.00 7.34  ? 94  ALA A N    1 
ATOM   1073  C  CA   . ALA A  1 94  ? 87.309  108.629 55.816  1.00 7.21  ? 94  ALA A CA   1 
ATOM   1074  C  C    . ALA A  1 94  ? 86.973  108.273 57.272  1.00 12.17 ? 94  ALA A C    1 
ATOM   1075  O  O    . ALA A  1 94  ? 87.122  107.132 57.702  1.00 10.90 ? 94  ALA A O    1 
ATOM   1076  C  CB   . ALA A  1 94  ? 88.673  109.344 55.753  1.00 10.90 ? 94  ALA A CB   1 
ATOM   1077  H  H    . ALA A  1 94  ? 86.537  110.262 54.996  1.00 8.81  ? 94  ALA A H    1 
ATOM   1078  H  HA   . ALA A  1 94  ? 87.386  107.791 55.313  1.00 8.66  ? 94  ALA A HA   1 
ATOM   1079  H  HB1  . ALA A  1 94  ? 89.337  108.788 56.167  1.00 13.08 ? 94  ALA A HB1  1 
ATOM   1080  H  HB2  . ALA A  1 94  ? 88.902  109.499 54.834  1.00 13.08 ? 94  ALA A HB2  1 
ATOM   1081  H  HB3  . ALA A  1 94  ? 88.608  110.180 56.220  1.00 13.08 ? 94  ALA A HB3  1 
ATOM   1082  N  N    . LEU A  1 95  ? 86.543  109.257 58.051  1.00 9.35  ? 95  LEU A N    1 
ATOM   1083  C  CA   . LEU A  1 95  ? 86.240  108.988 59.448  1.00 7.42  ? 95  LEU A CA   1 
ATOM   1084  C  C    . LEU A  1 95  ? 85.078  108.020 59.636  1.00 8.77  ? 95  LEU A C    1 
ATOM   1085  O  O    . LEU A  1 95  ? 84.875  107.485 60.748  1.00 9.10  ? 95  LEU A O    1 
ATOM   1086  C  CB   . LEU A  1 95  ? 85.983  110.297 60.223  1.00 7.38  ? 95  LEU A CB   1 
ATOM   1087  C  CG   . LEU A  1 95  ? 87.207  111.191 60.242  1.00 7.46  ? 95  LEU A CG   1 
ATOM   1088  C  CD1  . LEU A  1 95  ? 86.822  112.651 60.612  1.00 11.47 ? 95  LEU A CD1  1 
ATOM   1089  C  CD2  . LEU A  1 95  ? 88.308  110.652 61.145  1.00 11.82 ? 95  LEU A CD2  1 
ATOM   1090  H  H    . LEU A  1 95  ? 86.420  110.071 57.802  1.00 11.22 ? 95  LEU A H    1 
ATOM   1091  H  HA   . LEU A  1 95  ? 87.028  108.568 59.851  1.00 8.90  ? 95  LEU A HA   1 
ATOM   1092  H  HB2  . LEU A  1 95  ? 85.260  110.782 59.796  1.00 8.86  ? 95  LEU A HB2  1 
ATOM   1093  H  HB3  . LEU A  1 95  ? 85.749  110.084 61.139  1.00 8.86  ? 95  LEU A HB3  1 
ATOM   1094  H  HG   . LEU A  1 95  ? 87.569  111.217 59.343  1.00 8.95  ? 95  LEU A HG   1 
ATOM   1095  H  HD11 . LEU A  1 95  ? 87.616  113.191 60.617  1.00 13.76 ? 95  LEU A HD11 1 
ATOM   1096  H  HD12 . LEU A  1 95  ? 86.202  112.985 59.961  1.00 13.76 ? 95  LEU A HD12 1 
ATOM   1097  H  HD13 . LEU A  1 95  ? 86.418  112.656 61.483  1.00 13.76 ? 95  LEU A HD13 1 
ATOM   1098  H  HD21 . LEU A  1 95  ? 89.055  111.255 61.120  1.00 14.19 ? 95  LEU A HD21 1 
ATOM   1099  H  HD22 . LEU A  1 95  ? 87.972  110.584 62.041  1.00 14.19 ? 95  LEU A HD22 1 
ATOM   1100  H  HD23 . LEU A  1 95  ? 88.575  109.786 60.828  1.00 14.19 ? 95  LEU A HD23 1 
ATOM   1101  N  N    . MET A  1 96  ? 84.351  107.737 58.564  1.00 14.83 ? 96  MET A N    1 
ATOM   1102  C  CA   . MET A  1 96  ? 83.208  106.855 58.660  1.00 12.56 ? 96  MET A CA   1 
ATOM   1103  C  C    . MET A  1 96  ? 83.664  105.411 58.893  1.00 14.40 ? 96  MET A C    1 
ATOM   1104  O  O    . MET A  1 96  ? 82.834  104.560 59.244  1.00 16.49 ? 96  MET A O    1 
ATOM   1105  C  CB   . MET A  1 96  ? 82.273  107.010 57.441  1.00 13.13 ? 96  MET A CB   1 
ATOM   1106  C  CG   . MET A  1 96  ? 82.592  106.187 56.233  1.00 22.84 ? 96  MET A CG   1 
ATOM   1107  S  SD   . MET A  1 96  ? 81.446  106.617 54.895  1.00 15.31 ? 96  MET A SD   1 
ATOM   1108  C  CE   . MET A  1 96  ? 80.060  105.586 55.286  1.00 18.89 ? 96  MET A CE   1 
ATOM   1109  H  H    . MET A  1 96  ? 84.500  108.044 57.775  1.00 17.80 ? 96  MET A H    1 
ATOM   1110  H  HA   . MET A  1 96  ? 82.689  107.129 59.444  1.00 15.07 ? 96  MET A HA   1 
ATOM   1111  H  HB2  . MET A  1 96  ? 81.374  106.774 57.718  1.00 15.75 ? 96  MET A HB2  1 
ATOM   1112  H  HB3  . MET A  1 96  ? 82.288  107.940 57.165  1.00 15.75 ? 96  MET A HB3  1 
ATOM   1113  H  HG2  . MET A  1 96  ? 83.497  106.374 55.940  1.00 27.41 ? 96  MET A HG2  1 
ATOM   1114  H  HG3  . MET A  1 96  ? 82.487  105.246 56.442  1.00 27.41 ? 96  MET A HG3  1 
ATOM   1115  H  HE1  . MET A  1 96  ? 79.371  105.728 54.633  1.00 22.67 ? 96  MET A HE1  1 
ATOM   1116  H  HE2  . MET A  1 96  ? 80.340  104.668 55.273  1.00 22.67 ? 96  MET A HE2  1 
ATOM   1117  H  HE3  . MET A  1 96  ? 79.736  105.818 56.160  1.00 22.67 ? 96  MET A HE3  1 
ATOM   1118  N  N    . ASP A  1 97  ? 84.966  105.131 58.737  1.00 7.60  ? 97  ASP A N    1 
ATOM   1119  C  CA   . ASP A  1 97  ? 85.498  103.818 59.117  1.00 8.23  ? 97  ASP A CA   1 
ATOM   1120  C  C    . ASP A  1 97  ? 85.316  103.634 60.627  1.00 16.86 ? 97  ASP A C    1 
ATOM   1121  O  O    . ASP A  1 97  ? 85.177  102.499 61.106  1.00 13.70 ? 97  ASP A O    1 
ATOM   1122  C  CB   . ASP A  1 97  ? 86.987  103.686 58.802  1.00 13.91 ? 97  ASP A CB   1 
ATOM   1123  C  CG   . ASP A  1 97  ? 87.281  103.669 57.301  1.00 18.25 ? 97  ASP A CG   1 
ATOM   1124  O  OD1  . ASP A  1 97  ? 86.320  103.563 56.487  1.00 14.05 ? 97  ASP A OD1  1 
ATOM   1125  O  OD2  . ASP A  1 97  ? 88.486  103.732 56.967  1.00 17.35 ? 97  ASP A OD2  1 
ATOM   1126  H  H    . ASP A  1 97  ? 85.552  105.675 58.418  1.00 9.12  ? 97  ASP A H    1 
ATOM   1127  H  HA   . ASP A  1 97  ? 85.008  103.110 58.648  1.00 9.88  ? 97  ASP A HA   1 
ATOM   1128  H  HB2  . ASP A  1 97  ? 87.459  104.439 59.191  1.00 16.69 ? 97  ASP A HB2  1 
ATOM   1129  H  HB3  . ASP A  1 97  ? 87.317  102.856 59.181  1.00 16.69 ? 97  ASP A HB3  1 
ATOM   1130  N  N    . ILE A  1 98  ? 85.325  104.758 61.354  1.00 13.74 ? 98  ILE A N    1 
ATOM   1131  C  CA   . ILE A  1 98  ? 85.276  104.780 62.820  1.00 10.37 ? 98  ILE A CA   1 
ATOM   1132  C  C    . ILE A  1 98  ? 83.879  105.053 63.368  1.00 14.14 ? 98  ILE A C    1 
ATOM   1133  O  O    . ILE A  1 98  ? 83.404  104.303 64.240  1.00 14.09 ? 98  ILE A O    1 
ATOM   1134  C  CB   . ILE A  1 98  ? 86.210  105.821 63.421  1.00 11.64 ? 98  ILE A CB   1 
ATOM   1135  C  CG1  . ILE A  1 98  ? 87.627  105.690 62.879  1.00 16.99 ? 98  ILE A CG1  1 
ATOM   1136  C  CG2  . ILE A  1 98  ? 86.265  105.663 64.935  1.00 14.01 ? 98  ILE A CG2  1 
ATOM   1137  C  CD1  . ILE A  1 98  ? 88.510  106.934 63.184  1.00 17.44 ? 98  ILE A CD1  1 
ATOM   1138  H  H    . ILE A  1 98  ? 85.360  105.544 61.008  1.00 16.49 ? 98  ILE A H    1 
ATOM   1139  H  HA   . ILE A  1 98  ? 85.558  103.903 63.153  1.00 12.44 ? 98  ILE A HA   1 
ATOM   1140  H  HB   . ILE A  1 98  ? 85.873  106.706 63.210  1.00 13.97 ? 98  ILE A HB   1 
ATOM   1141  H  HG12 . ILE A  1 98  ? 88.050  104.917 63.285  1.00 20.39 ? 98  ILE A HG12 1 
ATOM   1142  H  HG13 . ILE A  1 98  ? 87.588  105.579 61.917  1.00 20.39 ? 98  ILE A HG13 1 
ATOM   1143  H  HG21 . ILE A  1 98  ? 86.858  106.326 65.296  1.00 16.81 ? 98  ILE A HG21 1 
ATOM   1144  H  HG22 . ILE A  1 98  ? 85.383  105.782 65.293  1.00 16.81 ? 98  ILE A HG22 1 
ATOM   1145  H  HG23 . ILE A  1 98  ? 86.589  104.784 65.145  1.00 16.81 ? 98  ILE A HG23 1 
ATOM   1146  H  HD11 . ILE A  1 98  ? 89.387  106.791 62.819  1.00 20.93 ? 98  ILE A HD11 1 
ATOM   1147  H  HD12 . ILE A  1 98  ? 88.109  107.707 62.781  1.00 20.93 ? 98  ILE A HD12 1 
ATOM   1148  H  HD13 . ILE A  1 98  ? 88.566  107.052 64.135  1.00 20.93 ? 98  ILE A HD13 1 
ATOM   1149  N  N    . VAL A  1 99  ? 83.258  106.144 62.906  1.00 8.84  ? 99  VAL A N    1 
ATOM   1150  C  CA   . VAL A  1 99  ? 81.903  106.495 63.271  1.00 8.15  ? 99  VAL A CA   1 
ATOM   1151  C  C    . VAL A  1 99  ? 81.122  106.656 61.976  1.00 9.22  ? 99  VAL A C    1 
ATOM   1152  O  O    . VAL A  1 99  ? 81.195  107.699 61.305  1.00 8.05  ? 99  VAL A O    1 
ATOM   1153  C  CB   . VAL A  1 99  ? 81.852  107.788 64.153  1.00 11.16 ? 99  VAL A CB   1 
ATOM   1154  C  CG1  . VAL A  1 99  ? 80.422  108.221 64.382  1.00 14.12 ? 99  VAL A CG1  1 
ATOM   1155  C  CG2  . VAL A  1 99  ? 82.565  107.556 65.471  1.00 14.69 ? 99  VAL A CG2  1 
ATOM   1156  H  H    . VAL A  1 99  ? 83.621  106.705 62.365  1.00 10.61 ? 99  VAL A H    1 
ATOM   1157  H  HA   . VAL A  1 99  ? 81.504  105.760 63.781  1.00 9.78  ? 99  VAL A HA   1 
ATOM   1158  H  HB   . VAL A  1 99  ? 82.315  108.513 63.682  1.00 13.39 ? 99  VAL A HB   1 
ATOM   1159  H  HG11 . VAL A  1 99  ? 80.418  109.013 64.924  1.00 16.95 ? 99  VAL A HG11 1 
ATOM   1160  H  HG12 . VAL A  1 99  ? 80.011  108.402 63.533  1.00 16.95 ? 99  VAL A HG12 1 
ATOM   1161  H  HG13 . VAL A  1 99  ? 79.950  107.515 64.830  1.00 16.95 ? 99  VAL A HG13 1 
ATOM   1162  H  HG21 . VAL A  1 99  ? 82.523  108.359 65.994  1.00 17.63 ? 99  VAL A HG21 1 
ATOM   1163  H  HG22 . VAL A  1 99  ? 82.133  106.837 65.937  1.00 17.63 ? 99  VAL A HG22 1 
ATOM   1164  H  HG23 . VAL A  1 99  ? 83.481  107.328 65.294  1.00 17.63 ? 99  VAL A HG23 1 
ATOM   1165  N  N    . PRO A  1 100 ? 80.387  105.604 61.579  1.00 7.93  ? 100 PRO A N    1 
ATOM   1166  C  CA   . PRO A  1 100 ? 79.844  105.563 60.216  1.00 9.01  ? 100 PRO A CA   1 
ATOM   1167  C  C    . PRO A  1 100 ? 79.011  106.759 59.820  1.00 11.32 ? 100 PRO A C    1 
ATOM   1168  O  O    . PRO A  1 100 ? 79.121  107.193 58.674  1.00 8.62  ? 100 PRO A O    1 
ATOM   1169  C  CB   . PRO A  1 100 ? 78.980  104.297 60.229  1.00 8.38  ? 100 PRO A CB   1 
ATOM   1170  C  CG   . PRO A  1 100 ? 79.734  103.387 61.147  1.00 13.52 ? 100 PRO A CG   1 
ATOM   1171  C  CD   . PRO A  1 100 ? 80.297  104.294 62.244  1.00 9.70  ? 100 PRO A CD   1 
ATOM   1172  H  HA   . PRO A  1 100 ? 80.570  105.448 59.568  1.00 10.81 ? 100 PRO A HA   1 
ATOM   1173  H  HB2  . PRO A  1 100 ? 78.099  104.499 60.582  1.00 10.06 ? 100 PRO A HB2  1 
ATOM   1174  H  HB3  . PRO A  1 100 ? 78.924  103.924 59.335  1.00 10.06 ? 100 PRO A HB3  1 
ATOM   1175  H  HG2  . PRO A  1 100 ? 79.129  102.730 61.524  1.00 16.22 ? 100 PRO A HG2  1 
ATOM   1176  H  HG3  . PRO A  1 100 ? 80.452  102.954 60.660  1.00 16.22 ? 100 PRO A HG3  1 
ATOM   1177  H  HD2  . PRO A  1 100 ? 79.686  104.337 62.996  1.00 11.64 ? 100 PRO A HD2  1 
ATOM   1178  H  HD3  . PRO A  1 100 ? 81.177  103.991 62.517  1.00 11.64 ? 100 PRO A HD3  1 
ATOM   1179  N  N    . ASP A  1 101 ? 78.214  107.301 60.738  1.00 8.69  ? 101 ASP A N    1 
ATOM   1180  C  CA   . ASP A  1 101 ? 77.196  108.262 60.362  1.00 11.23 ? 101 ASP A CA   1 
ATOM   1181  C  C    . ASP A  1 101 ? 77.793  109.611 59.965  1.00 12.33 ? 101 ASP A C    1 
ATOM   1182  O  O    . ASP A  1 101 ? 77.110  110.415 59.336  1.00 7.97  ? 101 ASP A O    1 
ATOM   1183  C  CB   . ASP A  1 101 ? 76.181  108.462 61.495  1.00 8.88  ? 101 ASP A CB   1 
ATOM   1184  C  CG   . ASP A  1 101 ? 75.107  107.353 61.560  1.00 12.93 ? 101 ASP A CG   1 
ATOM   1185  O  OD1  . ASP A  1 101 ? 75.188  106.318 60.864  1.00 12.23 ? 101 ASP A OD1  1 
ATOM   1186  O  OD2  . ASP A  1 101 ? 74.160  107.538 62.338  1.00 11.16 ? 101 ASP A OD2  1 
ATOM   1187  H  H    . ASP A  1 101 ? 78.245  107.127 61.579  1.00 10.43 ? 101 ASP A H    1 
ATOM   1188  H  HA   . ASP A  1 101 ? 76.710  107.914 59.586  1.00 13.47 ? 101 ASP A HA   1 
ATOM   1189  H  HB2  . ASP A  1 101 ? 76.654  108.468 62.342  1.00 10.66 ? 101 ASP A HB2  1 
ATOM   1190  H  HB3  . ASP A  1 101 ? 75.727  109.309 61.363  1.00 10.66 ? 101 ASP A HB3  1 
ATOM   1191  N  N    . LEU A  1 102 ? 79.058  109.841 60.311  1.00 8.72  ? 102 LEU A N    1 
ATOM   1192  C  CA   . LEU A  1 102 ? 79.764  111.060 59.919  1.00 8.28  ? 102 LEU A CA   1 
ATOM   1193  C  C    . LEU A  1 102 ? 79.878  111.143 58.384  1.00 8.61  ? 102 LEU A C    1 
ATOM   1194  O  O    . LEU A  1 102 ? 79.994  112.225 57.822  1.00 9.67  ? 102 LEU A O    1 
ATOM   1195  C  CB   . LEU A  1 102 ? 81.181  111.069 60.509  1.00 8.77  ? 102 LEU A CB   1 
ATOM   1196  C  CG   . LEU A  1 102 ? 81.383  111.407 62.002  1.00 10.20 ? 102 LEU A CG   1 
ATOM   1197  C  CD1  . LEU A  1 102 ? 82.842  111.215 62.321  1.00 12.96 ? 102 LEU A CD1  1 
ATOM   1198  C  CD2  . LEU A  1 102 ? 80.964  112.832 62.306  1.00 10.92 ? 102 LEU A CD2  1 
ATOM   1199  H  H    . LEU A  1 102 ? 79.535  109.299 60.779  1.00 10.46 ? 102 LEU A H    1 
ATOM   1200  H  HA   . LEU A  1 102 ? 79.279  111.847 60.245  1.00 9.93  ? 102 LEU A HA   1 
ATOM   1201  H  HB2  . LEU A  1 102 ? 81.560  110.187 60.372  1.00 10.52 ? 102 LEU A HB2  1 
ATOM   1202  H  HB3  . LEU A  1 102 ? 81.702  111.714 60.007  1.00 10.52 ? 102 LEU A HB3  1 
ATOM   1203  H  HG   . LEU A  1 102 ? 80.860  110.802 62.551  1.00 12.24 ? 102 LEU A HG   1 
ATOM   1204  H  HD11 . LEU A  1 102 ? 82.988  111.421 63.247  1.00 15.55 ? 102 LEU A HD11 1 
ATOM   1205  H  HD12 . LEU A  1 102 ? 83.082  110.302 62.146  1.00 15.55 ? 102 LEU A HD12 1 
ATOM   1206  H  HD13 . LEU A  1 102 ? 83.362  111.803 61.769  1.00 15.55 ? 102 LEU A HD13 1 
ATOM   1207  H  HD21 . LEU A  1 102 ? 81.104  113.006 63.240  1.00 13.10 ? 102 LEU A HD21 1 
ATOM   1208  H  HD22 . LEU A  1 102 ? 81.496  113.433 61.778  1.00 13.10 ? 102 LEU A HD22 1 
ATOM   1209  H  HD23 . LEU A  1 102 ? 80.036  112.938 62.088  1.00 13.10 ? 102 LEU A HD23 1 
ATOM   1210  N  N    . GLY A  1 103 ? 79.877  109.989 57.720  1.00 15.27 ? 103 GLY A N    1 
ATOM   1211  C  CA   . GLY A  1 103 ? 80.131  109.967 56.287  1.00 17.07 ? 103 GLY A CA   1 
ATOM   1212  C  C    . GLY A  1 103 ? 79.039  110.603 55.461  1.00 17.61 ? 103 GLY A C    1 
ATOM   1213  O  O    . GLY A  1 103 ? 79.236  110.859 54.278  1.00 16.26 ? 103 GLY A O    1 
ATOM   1214  H  H    . GLY A  1 103 ? 79.733  109.218 58.072  1.00 18.32 ? 103 GLY A H    1 
ATOM   1215  H  HA2  . GLY A  1 103 ? 80.960  110.436 56.104  1.00 20.49 ? 103 GLY A HA2  1 
ATOM   1216  H  HA3  . GLY A  1 103 ? 80.233  109.047 55.996  1.00 20.49 ? 103 GLY A HA3  1 
ATOM   1217  N  N    . VAL A  1 104 ? 77.874  110.852 56.052  1.00 7.34  ? 104 VAL A N    1 
ATOM   1218  C  CA   . VAL A  1 104 ? 76.763  111.444 55.283  1.00 10.09 ? 104 VAL A CA   1 
ATOM   1219  C  C    . VAL A  1 104 ? 76.938  112.939 55.021  1.00 8.03  ? 104 VAL A C    1 
ATOM   1220  O  O    . VAL A  1 104 ? 76.228  113.536 54.222  1.00 8.10  ? 104 VAL A O    1 
ATOM   1221  C  CB   . VAL A  1 104 ? 75.412  111.187 55.986  1.00 10.41 ? 104 VAL A CB   1 
ATOM   1222  C  CG1  . VAL A  1 104 ? 75.246  112.045 57.243  1.00 9.53  ? 104 VAL A CG1  1 
ATOM   1223  C  CG2  . VAL A  1 104 ? 74.260  111.386 55.037  1.00 9.19  ? 104 VAL A CG2  1 
ATOM   1224  H  H    . VAL A  1 104 ? 77.697  110.695 56.879  1.00 8.81  ? 104 VAL A H    1 
ATOM   1225  H  HA   . VAL A  1 104 ? 76.725  111.000 54.410  1.00 12.11 ? 104 VAL A HA   1 
ATOM   1226  H  HB   . VAL A  1 104 ? 75.391  110.250 56.273  1.00 12.49 ? 104 VAL A HB   1 
ATOM   1227  H  HG11 . VAL A  1 104 ? 74.395  111.851 57.644  1.00 11.43 ? 104 VAL A HG11 1 
ATOM   1228  H  HG12 . VAL A  1 104 ? 75.953  111.837 57.859  1.00 11.43 ? 104 VAL A HG12 1 
ATOM   1229  H  HG13 . VAL A  1 104 ? 75.288  112.972 56.996  1.00 11.43 ? 104 VAL A HG13 1 
ATOM   1230  H  HG21 . VAL A  1 104 ? 73.438  111.219 55.504  1.00 11.03 ? 104 VAL A HG21 1 
ATOM   1231  H  HG22 . VAL A  1 104 ? 74.275  112.289 54.712  1.00 11.03 ? 104 VAL A HG22 1 
ATOM   1232  H  HG23 . VAL A  1 104 ? 74.350  110.772 54.304  1.00 11.03 ? 104 VAL A HG23 1 
ATOM   1233  N  N    . ILE A  1 105 ? 77.881  113.553 55.704  1.00 7.50  ? 105 ILE A N    1 
ATOM   1234  C  CA   . ILE A  1 105 ? 77.957  115.003 55.694  1.00 9.36  ? 105 ILE A CA   1 
ATOM   1235  C  C    . ILE A  1 105 ? 78.233  115.507 54.278  1.00 6.60  ? 105 ILE A C    1 
ATOM   1236  O  O    . ILE A  1 105 ? 77.679  116.515 53.853  1.00 9.58  ? 105 ILE A O    1 
ATOM   1237  C  CB   . ILE A  1 105 ? 79.010  115.467 56.706  1.00 6.67  ? 105 ILE A CB   1 
ATOM   1238  C  CG1  . ILE A  1 105 ? 78.459  115.305 58.145  1.00 7.35  ? 105 ILE A CG1  1 
ATOM   1239  C  CG2  . ILE A  1 105 ? 79.411  116.935 56.439  1.00 6.71  ? 105 ILE A CG2  1 
ATOM   1240  C  CD1  . ILE A  1 105 ? 79.528  115.281 59.214  1.00 8.35  ? 105 ILE A CD1  1 
ATOM   1241  H  H    . ILE A  1 105 ? 78.484  113.163 56.177  1.00 9.01  ? 105 ILE A H    1 
ATOM   1242  H  HA   . ILE A  1 105 ? 77.092  115.366 55.977  1.00 11.23 ? 105 ILE A HA   1 
ATOM   1243  H  HB   . ILE A  1 105 ? 79.798  114.909 56.611  1.00 8.01  ? 105 ILE A HB   1 
ATOM   1244  H  HG12 . ILE A  1 105 ? 77.866  116.048 58.337  1.00 8.82  ? 105 ILE A HG12 1 
ATOM   1245  H  HG13 . ILE A  1 105 ? 77.968  114.470 58.199  1.00 8.82  ? 105 ILE A HG13 1 
ATOM   1246  H  HG21 . ILE A  1 105 ? 80.070  117.201 57.084  1.00 8.05  ? 105 ILE A HG21 1 
ATOM   1247  H  HG22 . ILE A  1 105 ? 79.774  117.004 55.553  1.00 8.05  ? 105 ILE A HG22 1 
ATOM   1248  H  HG23 . ILE A  1 105 ? 78.632  117.491 56.518  1.00 8.05  ? 105 ILE A HG23 1 
ATOM   1249  H  HD11 . ILE A  1 105 ? 79.109  115.179 60.072  1.00 10.02 ? 105 ILE A HD11 1 
ATOM   1250  H  HD12 . ILE A  1 105 ? 80.119  114.544 59.048  1.00 10.02 ? 105 ILE A HD12 1 
ATOM   1251  H  HD13 . ILE A  1 105 ? 80.017  116.107 59.185  1.00 10.02 ? 105 ILE A HD13 1 
ATOM   1252  N  N    . ASN A  1 106 ? 79.054  114.756 53.552  1.00 11.28 ? 106 ASN A N    1 
ATOM   1253  C  CA   . ASN A  1 106 ? 79.471  115.101 52.189  1.00 7.03  ? 106 ASN A CA   1 
ATOM   1254  C  C    . ASN A  1 106 ? 78.928  114.112 51.158  1.00 8.05  ? 106 ASN A C    1 
ATOM   1255  O  O    . ASN A  1 106 ? 79.457  114.005 50.054  1.00 8.65  ? 106 ASN A O    1 
ATOM   1256  C  CB   . ASN A  1 106 ? 80.992  115.142 52.137  1.00 8.75  ? 106 ASN A CB   1 
ATOM   1257  C  CG   . ASN A  1 106 ? 81.544  116.383 52.812  1.00 8.73  ? 106 ASN A CG   1 
ATOM   1258  O  OD1  . ASN A  1 106 ? 80.899  117.420 52.780  1.00 7.30  ? 106 ASN A OD1  1 
ATOM   1259  N  ND2  . ASN A  1 106 ? 82.712  116.270 53.453  1.00 10.98 ? 106 ASN A ND2  1 
ATOM   1260  H  H    . ASN A  1 106 ? 79.395  114.018 53.833  1.00 13.54 ? 106 ASN A H    1 
ATOM   1261  H  HA   . ASN A  1 106 ? 79.133  115.993 51.965  1.00 8.44  ? 106 ASN A HA   1 
ATOM   1262  H  HB2  . ASN A  1 106 ? 81.348  114.364 52.594  1.00 10.50 ? 106 ASN A HB2  1 
ATOM   1263  H  HB3  . ASN A  1 106 ? 81.280  115.147 51.210  1.00 10.50 ? 106 ASN A HB3  1 
ATOM   1264  H  HD21 . ASN A  1 106 ? 83.121  115.513 53.470  1.00 13.18 ? 106 ASN A HD21 1 
ATOM   1265  H  HD22 . ASN A  1 106 ? 83.055  116.953 53.847  1.00 13.18 ? 106 ASN A HD22 1 
ATOM   1266  N  N    . ALA A  1 107 ? 77.868  113.408 51.529  1.00 10.37 ? 107 ALA A N    1 
ATOM   1267  C  CA   . ALA A  1 107 ? 77.191  112.498 50.623  1.00 9.68  ? 107 ALA A CA   1 
ATOM   1268  C  C    . ALA A  1 107 ? 76.733  113.243 49.373  1.00 11.48 ? 107 ALA A C    1 
ATOM   1269  O  O    . ALA A  1 107 ? 76.327  114.392 49.435  1.00 9.70  ? 107 ALA A O    1 
ATOM   1270  C  CB   . ALA A  1 107 ? 76.019  111.871 51.319  1.00 6.56  ? 107 ALA A CB   1 
ATOM   1271  H  H    . ALA A  1 107 ? 77.516  113.442 52.313  1.00 12.44 ? 107 ALA A H    1 
ATOM   1272  H  HA   . ALA A  1 107 ? 77.808  111.787 50.352  1.00 11.62 ? 107 ALA A HA   1 
ATOM   1273  H  HB1  . ALA A  1 107 ? 75.579  111.271 50.712  1.00 7.88  ? 107 ALA A HB1  1 
ATOM   1274  H  HB2  . ALA A  1 107 ? 76.334  111.387 52.087  1.00 7.88  ? 107 ALA A HB2  1 
ATOM   1275  H  HB3  . ALA A  1 107 ? 75.412  112.562 51.594  1.00 7.88  ? 107 ALA A HB3  1 
ATOM   1276  N  N    . PRO A  1 108 ? 76.793  112.569 48.216  1.00 6.65  ? 108 PRO A N    1 
ATOM   1277  C  CA   . PRO A  1 108 ? 76.582  113.291 46.954  1.00 6.79  ? 108 PRO A CA   1 
ATOM   1278  C  C    . PRO A  1 108 ? 75.211  113.950 46.854  1.00 6.95  ? 108 PRO A C    1 
ATOM   1279  O  O    . PRO A  1 108 ? 74.184  113.351 47.159  1.00 10.63 ? 108 PRO A O    1 
ATOM   1280  C  CB   . PRO A  1 108 ? 76.768  112.204 45.890  1.00 8.63  ? 108 PRO A CB   1 
ATOM   1281  C  CG   . PRO A  1 108 ? 76.560  110.899 46.637  1.00 6.71  ? 108 PRO A CG   1 
ATOM   1282  C  CD   . PRO A  1 108 ? 77.064  111.136 48.005  1.00 6.60  ? 108 PRO A CD   1 
ATOM   1283  H  HA   . PRO A  1 108 ? 77.275  113.974 46.838  1.00 8.15  ? 108 PRO A HA   1 
ATOM   1284  H  HB2  . PRO A  1 108 ? 76.103  112.311 45.192  1.00 10.36 ? 108 PRO A HB2  1 
ATOM   1285  H  HB3  . PRO A  1 108 ? 77.665  112.253 45.524  1.00 10.36 ? 108 PRO A HB3  1 
ATOM   1286  H  HG2  . PRO A  1 108 ? 75.615  110.681 46.654  1.00 8.05  ? 108 PRO A HG2  1 
ATOM   1287  H  HG3  . PRO A  1 108 ? 77.065  110.193 46.205  1.00 8.05  ? 108 PRO A HG3  1 
ATOM   1288  H  HD2  . PRO A  1 108 ? 76.572  110.599 48.646  1.00 7.91  ? 108 PRO A HD2  1 
ATOM   1289  H  HD3  . PRO A  1 108 ? 78.017  110.961 48.051  1.00 7.91  ? 108 PRO A HD3  1 
ATOM   1290  N  N    . TYR A  1 109 ? 75.217  115.217 46.418  1.00 10.44 ? 109 TYR A N    1 
ATOM   1291  C  CA   . TYR A  1 109 ? 73.995  116.002 46.188  1.00 7.52  ? 109 TYR A CA   1 
ATOM   1292  C  C    . TYR A  1 109 ? 73.082  116.224 47.406  1.00 10.01 ? 109 TYR A C    1 
ATOM   1293  O  O    . TYR A  1 109 ? 71.900  116.524 47.238  1.00 10.72 ? 109 TYR A O    1 
ATOM   1294  C  CB   . TYR A  1 109 ? 73.202  115.424 45.006  1.00 10.24 ? 109 TYR A CB   1 
ATOM   1295  C  CG   . TYR A  1 109 ? 74.044  115.363 43.731  1.00 7.57  ? 109 TYR A CG   1 
ATOM   1296  C  CD1  . TYR A  1 109 ? 74.416  116.524 43.072  1.00 12.29 ? 109 TYR A CD1  1 
ATOM   1297  C  CD2  . TYR A  1 109 ? 74.531  114.160 43.244  1.00 7.46  ? 109 TYR A CD2  1 
ATOM   1298  C  CE1  . TYR A  1 109 ? 75.184  116.477 41.955  1.00 8.39  ? 109 TYR A CE1  1 
ATOM   1299  C  CE2  . TYR A  1 109 ? 75.308  114.101 42.122  1.00 7.54  ? 109 TYR A CE2  1 
ATOM   1300  C  CZ   . TYR A  1 109 ? 75.645  115.264 41.482  1.00 7.74  ? 109 TYR A CZ   1 
ATOM   1301  O  OH   . TYR A  1 109 ? 76.440  115.215 40.373  1.00 10.10 ? 109 TYR A OH   1 
ATOM   1302  H  H    . TYR A  1 109 ? 75.936  115.655 46.245  1.00 12.53 ? 109 TYR A H    1 
ATOM   1303  H  HA   . TYR A  1 109 ? 74.284  116.896 45.907  1.00 9.02  ? 109 TYR A HA   1 
ATOM   1304  H  HB2  . TYR A  1 109 ? 72.918  114.522 45.224  1.00 12.29 ? 109 TYR A HB2  1 
ATOM   1305  H  HB3  . TYR A  1 109 ? 72.431  115.986 44.834  1.00 12.29 ? 109 TYR A HB3  1 
ATOM   1306  H  HD1  . TYR A  1 109 ? 74.112  117.346 43.385  1.00 14.75 ? 109 TYR A HD1  1 
ATOM   1307  H  HD2  . TYR A  1 109 ? 74.304  113.370 43.679  1.00 8.95  ? 109 TYR A HD2  1 
ATOM   1308  H  HE1  . TYR A  1 109 ? 75.419  117.265 41.520  1.00 10.07 ? 109 TYR A HE1  1 
ATOM   1309  H  HE2  . TYR A  1 109 ? 75.618  113.283 41.806  1.00 9.05  ? 109 TYR A HE2  1 
ATOM   1310  H  HH   . TYR A  1 109 ? 77.127  115.644 40.502  1.00 12.12 ? 109 TYR A HH   1 
ATOM   1311  N  N    . ILE A  1 110 ? 73.611  116.122 48.622  1.00 7.19  ? 110 ILE A N    1 
ATOM   1312  C  CA   . ILE A  1 110 ? 72.740  116.130 49.774  1.00 11.84 ? 110 ILE A CA   1 
ATOM   1313  C  C    . ILE A  1 110 ? 72.277  117.561 50.056  1.00 12.29 ? 110 ILE A C    1 
ATOM   1314  O  O    . ILE A  1 110 ? 71.158  117.776 50.497  1.00 11.20 ? 110 ILE A O    1 
ATOM   1315  C  CB   . ILE A  1 110 ? 73.416  115.483 50.990  1.00 8.14  ? 110 ILE A CB   1 
ATOM   1316  C  CG1  . ILE A  1 110 ? 72.382  115.205 52.096  1.00 10.56 ? 110 ILE A CG1  1 
ATOM   1317  C  CG2  . ILE A  1 110 ? 74.549  116.329 51.501  1.00 14.88 ? 110 ILE A CG2  1 
ATOM   1318  C  CD1  . ILE A  1 110 ? 72.908  114.313 53.200  1.00 7.77  ? 110 ILE A CD1  1 
ATOM   1319  H  H    . ILE A  1 110 ? 74.450  116.048 48.798  1.00 8.63  ? 110 ILE A H    1 
ATOM   1320  H  HA   . ILE A  1 110 ? 71.943  115.600 49.565  1.00 14.20 ? 110 ILE A HA   1 
ATOM   1321  H  HB   . ILE A  1 110 ? 73.784  114.631 50.707  1.00 9.77  ? 110 ILE A HB   1 
ATOM   1322  H  HG12 . ILE A  1 110 ? 72.116  116.048 52.495  1.00 12.67 ? 110 ILE A HG12 1 
ATOM   1323  H  HG13 . ILE A  1 110 ? 71.611  114.769 51.702  1.00 12.67 ? 110 ILE A HG13 1 
ATOM   1324  H  HG21 . ILE A  1 110 ? 74.947  115.893 52.258  1.00 17.85 ? 110 ILE A HG21 1 
ATOM   1325  H  HG22 . ILE A  1 110 ? 75.200  116.432 50.803  1.00 17.85 ? 110 ILE A HG22 1 
ATOM   1326  H  HG23 . ILE A  1 110 ? 74.206  117.187 51.759  1.00 17.85 ? 110 ILE A HG23 1 
ATOM   1327  H  HD11 . ILE A  1 110 ? 72.215  114.183 53.852  1.00 9.33  ? 110 ILE A HD11 1 
ATOM   1328  H  HD12 . ILE A  1 110 ? 73.166  113.469 52.823  1.00 9.33  ? 110 ILE A HD12 1 
ATOM   1329  H  HD13 . ILE A  1 110 ? 73.667  114.736 53.608  1.00 9.33  ? 110 ILE A HD13 1 
ATOM   1330  N  N    . SER A  1 111 ? 73.113  118.526 49.723  1.00 11.48 ? 111 SER A N    1 
ATOM   1331  C  CA   . SER A  1 111 ? 72.740  119.930 49.850  1.00 14.53 ? 111 SER A CA   1 
ATOM   1332  C  C    . SER A  1 111 ? 73.622  120.773 48.962  1.00 11.01 ? 111 SER A C    1 
ATOM   1333  O  O    . SER A  1 111 ? 74.813  120.503 48.829  1.00 9.71  ? 111 SER A O    1 
ATOM   1334  C  CB   . SER A  1 111 ? 72.932  120.402 51.292  1.00 11.34 ? 111 SER A CB   1 
ATOM   1335  O  OG   . SER A  1 111 ? 72.628  121.794 51.445  1.00 12.36 ? 111 SER A OG   1 
ATOM   1336  H  H    . SER A  1 111 ? 73.907  118.399 49.418  1.00 13.77 ? 111 SER A H    1 
ATOM   1337  H  HA   . SER A  1 111 ? 71.804  120.057 49.591  1.00 17.43 ? 111 SER A HA   1 
ATOM   1338  H  HB2  . SER A  1 111 ? 72.346  119.889 51.869  1.00 13.60 ? 111 SER A HB2  1 
ATOM   1339  H  HB3  . SER A  1 111 ? 73.856  120.255 51.548  1.00 13.60 ? 111 SER A HB3  1 
ATOM   1340  H  HG   . SER A  1 111 ? 72.398  122.111 50.725  1.00 14.83 ? 111 SER A HG   1 
ATOM   1341  N  N    . GLN A  1 112 ? 73.061  121.834 48.406  1.00 11.94 ? 112 GLN A N    1 
ATOM   1342  C  CA   . GLN A  1 112 ? 73.866  122.783 47.640  1.00 12.27 ? 112 GLN A CA   1 
ATOM   1343  C  C    . GLN A  1 112 ? 74.469  123.906 48.522  1.00 11.60 ? 112 GLN A C    1 
ATOM   1344  O  O    . GLN A  1 112 ? 75.227  124.746 48.048  1.00 12.19 ? 112 GLN A O    1 
ATOM   1345  C  CB   . GLN A  1 112 ? 73.023  123.422 46.521  1.00 9.83  ? 112 GLN A CB   1 
ATOM   1346  C  CG   . GLN A  1 112 ? 72.412  122.449 45.543  1.00 15.56 ? 112 GLN A CG   1 
ATOM   1347  C  CD   . GLN A  1 112 ? 73.472  121.611 44.840  1.00 17.86 ? 112 GLN A CD   1 
ATOM   1348  O  OE1  . GLN A  1 112 ? 74.167  122.101 43.941  1.00 20.56 ? 112 GLN A OE1  1 
ATOM   1349  N  NE2  . GLN A  1 112 ? 73.626  120.363 45.271  1.00 11.44 ? 112 GLN A NE2  1 
ATOM   1350  H  H    . GLN A  1 112 ? 72.225  122.030 48.453  1.00 14.33 ? 112 GLN A H    1 
ATOM   1351  H  HA   . GLN A  1 112 ? 74.608  122.301 47.219  1.00 14.73 ? 112 GLN A HA   1 
ATOM   1352  H  HB2  . GLN A  1 112 ? 72.298  123.920 46.929  1.00 11.80 ? 112 GLN A HB2  1 
ATOM   1353  H  HB3  . GLN A  1 112 ? 73.589  124.027 46.017  1.00 11.80 ? 112 GLN A HB3  1 
ATOM   1354  H  HG2  . GLN A  1 112 ? 71.818  121.848 46.019  1.00 18.67 ? 112 GLN A HG2  1 
ATOM   1355  H  HG3  . GLN A  1 112 ? 71.919  122.942 44.868  1.00 18.67 ? 112 GLN A HG3  1 
ATOM   1356  H  HE21 . GLN A  1 112 ? 73.139  120.068 45.915  1.00 13.72 ? 112 GLN A HE21 1 
ATOM   1357  H  HE22 . GLN A  1 112 ? 74.212  119.851 44.906  1.00 13.72 ? 112 GLN A HE22 1 
ATOM   1358  N  N    . SER A  1 113 ? 74.140  123.921 49.801  1.00 8.20  ? 113 SER A N    1 
ATOM   1359  C  CA   . SER A  1 113 ? 74.452  125.081 50.657  1.00 9.39  ? 113 SER A CA   1 
ATOM   1360  C  C    . SER A  1 113 ? 75.524  124.800 51.723  1.00 8.73  ? 113 SER A C    1 
ATOM   1361  O  O    . SER A  1 113 ? 75.320  123.974 52.621  1.00 10.65 ? 113 SER A O    1 
ATOM   1362  C  CB   . SER A  1 113 ? 73.194  125.605 51.343  1.00 8.81  ? 113 SER A CB   1 
ATOM   1363  O  OG   . SER A  1 113 ? 73.578  126.604 52.282  1.00 12.96 ? 113 SER A OG   1 
ATOM   1364  H  H    . SER A  1 113 ? 73.736  123.280 50.208  1.00 9.84  ? 113 SER A H    1 
ATOM   1365  H  HA   . SER A  1 113 ? 74.793  125.800 50.085  1.00 11.26 ? 113 SER A HA   1 
ATOM   1366  H  HB2  . SER A  1 113 ? 72.602  125.994 50.681  1.00 10.57 ? 113 SER A HB2  1 
ATOM   1367  H  HB3  . SER A  1 113 ? 72.752  124.877 51.808  1.00 10.57 ? 113 SER A HB3  1 
ATOM   1368  H  HG   . SER A  1 113 ? 72.916  126.900 52.663  1.00 15.55 ? 113 SER A HG   1 
ATOM   1369  N  N    . PHE A  1 114 ? 76.673  125.471 51.590  1.00 10.32 ? 114 PHE A N    1 
ATOM   1370  C  CA   . PHE A  1 114 ? 77.727  125.406 52.591  1.00 10.18 ? 114 PHE A CA   1 
ATOM   1371  C  C    . PHE A  1 114 ? 77.221  125.958 53.917  1.00 11.88 ? 114 PHE A C    1 
ATOM   1372  O  O    . PHE A  1 114 ? 77.546  125.437 54.993  1.00 13.40 ? 114 PHE A O    1 
ATOM   1373  C  CB   . PHE A  1 114 ? 78.987  126.160 52.162  1.00 11.53 ? 114 PHE A CB   1 
ATOM   1374  C  CG   . PHE A  1 114 ? 79.801  125.445 51.106  1.00 14.65 ? 114 PHE A CG   1 
ATOM   1375  C  CD1  . PHE A  1 114 ? 80.406  124.240 51.386  1.00 12.50 ? 114 PHE A CD1  1 
ATOM   1376  C  CD2  . PHE A  1 114 ? 79.964  125.985 49.856  1.00 18.92 ? 114 PHE A CD2  1 
ATOM   1377  C  CE1  . PHE A  1 114 ? 81.144  123.597 50.466  1.00 14.40 ? 114 PHE A CE1  1 
ATOM   1378  C  CE2  . PHE A  1 114 ? 80.715  125.331 48.913  1.00 18.33 ? 114 PHE A CE2  1 
ATOM   1379  C  CZ   . PHE A  1 114 ? 81.299  124.130 49.220  1.00 10.33 ? 114 PHE A CZ   1 
ATOM   1380  H  H    . PHE A  1 114 ? 76.862  125.974 50.918  1.00 12.38 ? 114 PHE A H    1 
ATOM   1381  H  HA   . PHE A  1 114 ? 77.973  124.467 52.731  1.00 12.21 ? 114 PHE A HA   1 
ATOM   1382  H  HB2  . PHE A  1 114 ? 78.727  127.022 51.801  1.00 13.84 ? 114 PHE A HB2  1 
ATOM   1383  H  HB3  . PHE A  1 114 ? 79.555  126.287 52.938  1.00 13.84 ? 114 PHE A HB3  1 
ATOM   1384  H  HD1  . PHE A  1 114 ? 80.306  123.866 52.231  1.00 15.00 ? 114 PHE A HD1  1 
ATOM   1385  H  HD2  . PHE A  1 114 ? 79.566  126.799 49.647  1.00 22.70 ? 114 PHE A HD2  1 
ATOM   1386  H  HE1  . PHE A  1 114 ? 81.540  122.782 50.676  1.00 17.28 ? 114 PHE A HE1  1 
ATOM   1387  H  HE2  . PHE A  1 114 ? 80.820  125.697 48.064  1.00 21.99 ? 114 PHE A HE2  1 
ATOM   1388  H  HZ   . PHE A  1 114 ? 81.809  123.683 48.582  1.00 12.40 ? 114 PHE A HZ   1 
ATOM   1389  N  N    . GLU A  1 115 ? 76.385  126.975 53.833  1.00 12.21 ? 115 GLU A N    1 
ATOM   1390  C  CA   . GLU A  1 115 ? 75.840  127.581 55.041  1.00 13.10 ? 115 GLU A CA   1 
ATOM   1391  C  C    . GLU A  1 115 ? 74.931  126.624 55.824  1.00 9.73  ? 115 GLU A C    1 
ATOM   1392  O  O    . GLU A  1 115 ? 75.017  126.565 57.054  1.00 12.24 ? 115 GLU A O    1 
ATOM   1393  C  CB   . GLU A  1 115 ? 75.103  128.884 54.750  1.00 13.80 ? 115 GLU A CB   1 
ATOM   1394  C  CG   . GLU A  1 115 ? 74.607  129.521 56.027  1.00 21.82 ? 115 GLU A CG   1 
ATOM   1395  C  CD   . GLU A  1 115 ? 75.718  129.688 57.066  1.00 41.62 ? 115 GLU A CD   1 
ATOM   1396  O  OE1  . GLU A  1 115 ? 75.404  129.678 58.285  1.00 42.90 ? 115 GLU A OE1  1 
ATOM   1397  O  OE2  . GLU A  1 115 ? 76.903  129.827 56.665  1.00 44.49 ? 115 GLU A OE2  1 
ATOM   1398  H  H    . GLU A  1 115 ? 76.117  127.334 53.098  1.00 14.65 ? 115 GLU A H    1 
ATOM   1399  H  HA   . GLU A  1 115 ? 76.592  127.804 55.629  1.00 15.72 ? 115 GLU A HA   1 
ATOM   1400  H  HB2  . GLU A  1 115 ? 75.706  129.504 54.312  1.00 16.56 ? 115 GLU A HB2  1 
ATOM   1401  H  HB3  . GLU A  1 115 ? 74.337  128.700 54.182  1.00 16.56 ? 115 GLU A HB3  1 
ATOM   1402  H  HG2  . GLU A  1 115 ? 74.249  130.399 55.825  1.00 26.18 ? 115 GLU A HG2  1 
ATOM   1403  H  HG3  . GLU A  1 115 ? 73.916  128.960 56.413  1.00 26.18 ? 115 GLU A HG3  1 
ATOM   1404  N  N    . LYS A  1 116 ? 74.072  125.876 55.132  1.00 17.06 ? 116 LYS A N    1 
ATOM   1405  C  CA   . LYS A  1 116 ? 73.212  124.913 55.816  1.00 9.62  ? 116 LYS A CA   1 
ATOM   1406  C  C    . LYS A  1 116 ? 74.029  123.775 56.412  1.00 11.71 ? 116 LYS A C    1 
ATOM   1407  O  O    . LYS A  1 116 ? 73.744  123.306 57.518  1.00 13.89 ? 116 LYS A O    1 
ATOM   1408  C  CB   . LYS A  1 116 ? 72.124  124.365 54.892  1.00 9.85  ? 116 LYS A CB   1 
ATOM   1409  C  CG   . LYS A  1 116 ? 71.204  125.436 54.383  1.00 17.32 ? 116 LYS A CG   1 
ATOM   1410  C  CD   . LYS A  1 116 ? 70.056  124.892 53.584  1.00 19.85 ? 116 LYS A CD   1 
ATOM   1411  C  CE   . LYS A  1 116 ? 69.651  125.925 52.507  1.00 31.83 ? 116 LYS A CE   1 
ATOM   1412  N  NZ   . LYS A  1 116 ? 68.384  125.587 51.830  1.00 37.25 ? 116 LYS A NZ   1 
ATOM   1413  H  H    . LYS A  1 116 ? 73.970  125.907 54.278  1.00 20.47 ? 116 LYS A H    1 
ATOM   1414  H  HA   . LYS A  1 116 ? 72.763  125.371 56.557  1.00 11.54 ? 116 LYS A HA   1 
ATOM   1415  H  HB2  . LYS A  1 116 ? 72.543  123.940 54.127  1.00 11.81 ? 116 LYS A HB2  1 
ATOM   1416  H  HB3  . LYS A  1 116 ? 71.591  123.718 55.381  1.00 11.81 ? 116 LYS A HB3  1 
ATOM   1417  H  HG2  . LYS A  1 116 ? 70.838  125.923 55.138  1.00 20.78 ? 116 LYS A HG2  1 
ATOM   1418  H  HG3  . LYS A  1 116 ? 71.706  126.038 53.813  1.00 20.78 ? 116 LYS A HG3  1 
ATOM   1419  H  HD2  . LYS A  1 116 ? 70.324  124.071 53.142  1.00 23.82 ? 116 LYS A HD2  1 
ATOM   1420  H  HD3  . LYS A  1 116 ? 69.296  124.736 54.166  1.00 23.82 ? 116 LYS A HD3  1 
ATOM   1421  H  HE2  . LYS A  1 116 ? 69.544  126.792 52.927  1.00 38.19 ? 116 LYS A HE2  1 
ATOM   1422  H  HE3  . LYS A  1 116 ? 70.348  125.967 51.833  1.00 38.19 ? 116 LYS A HE3  1 
ATOM   1423  H  HZ1  . LYS A  1 116 ? 68.191  126.206 51.220  1.00 44.70 ? 116 LYS A HZ1  1 
ATOM   1424  H  HZ2  . LYS A  1 116 ? 68.456  124.797 51.427  1.00 44.70 ? 116 LYS A HZ2  1 
ATOM   1425  H  HZ3  . LYS A  1 116 ? 67.722  125.550 52.424  1.00 44.70 ? 116 LYS A HZ3  1 
ATOM   1426  N  N    . LYS A  1 117 ? 75.060  123.344 55.697  1.00 15.56 ? 117 LYS A N    1 
ATOM   1427  C  CA   . LYS A  1 117 ? 75.970  122.336 56.247  1.00 11.43 ? 117 LYS A CA   1 
ATOM   1428  C  C    . LYS A  1 117 ? 76.662  122.856 57.526  1.00 9.63  ? 117 LYS A C    1 
ATOM   1429  O  O    . LYS A  1 117 ? 76.829  122.123 58.512  1.00 8.84  ? 117 LYS A O    1 
ATOM   1430  C  CB   . LYS A  1 117 ? 76.988  121.892 55.188  1.00 8.09  ? 117 LYS A CB   1 
ATOM   1431  C  CG   . LYS A  1 117 ? 76.413  120.944 54.143  1.00 8.13  ? 117 LYS A CG   1 
ATOM   1432  C  CD   . LYS A  1 117 ? 77.517  120.244 53.374  1.00 10.31 ? 117 LYS A CD   1 
ATOM   1433  C  CE   . LYS A  1 117 ? 76.962  119.351 52.312  1.00 8.95  ? 117 LYS A CE   1 
ATOM   1434  N  NZ   . LYS A  1 117 ? 77.977  118.354 51.796  1.00 9.86  ? 117 LYS A NZ   1 
ATOM   1435  H  H    . LYS A  1 117 ? 75.255  123.610 54.903  1.00 18.67 ? 117 LYS A H    1 
ATOM   1436  H  HA   . LYS A  1 117 ? 75.445  121.547 56.498  1.00 13.71 ? 117 LYS A HA   1 
ATOM   1437  H  HB2  . LYS A  1 117 ? 77.321  122.677 54.726  1.00 9.71  ? 117 LYS A HB2  1 
ATOM   1438  H  HB3  . LYS A  1 117 ? 77.721  121.436 55.631  1.00 9.71  ? 117 LYS A HB3  1 
ATOM   1439  H  HG2  . LYS A  1 117 ? 75.872  120.270 54.584  1.00 9.76  ? 117 LYS A HG2  1 
ATOM   1440  H  HG3  . LYS A  1 117 ? 75.875  121.449 53.513  1.00 9.76  ? 117 LYS A HG3  1 
ATOM   1441  H  HD2  . LYS A  1 117 ? 78.081  120.908 52.949  1.00 12.37 ? 117 LYS A HD2  1 
ATOM   1442  H  HD3  . LYS A  1 117 ? 78.039  119.701 53.986  1.00 12.37 ? 117 LYS A HD3  1 
ATOM   1443  H  HE2  . LYS A  1 117 ? 76.213  118.854 52.676  1.00 10.74 ? 117 LYS A HE2  1 
ATOM   1444  H  HE3  . LYS A  1 117 ? 76.668  119.894 51.564  1.00 10.74 ? 117 LYS A HE3  1 
ATOM   1445  H  HZ1  . LYS A  1 117 ? 77.609  117.843 51.168  1.00 11.83 ? 117 LYS A HZ1  1 
ATOM   1446  H  HZ2  . LYS A  1 117 ? 78.675  118.784 51.448  1.00 11.83 ? 117 LYS A HZ2  1 
ATOM   1447  H  HZ3  . LYS A  1 117 ? 78.260  117.836 52.462  1.00 11.83 ? 117 LYS A HZ3  1 
ATOM   1448  N  N    . SER A  1 118 ? 77.062  124.121 57.516  1.00 8.52  ? 118 SER A N    1 
ATOM   1449  C  CA   . SER A  1 118 ? 77.716  124.696 58.697  1.00 12.16 ? 118 SER A CA   1 
ATOM   1450  C  C    . SER A  1 118 ? 76.784  124.596 59.886  1.00 12.54 ? 118 SER A C    1 
ATOM   1451  O  O    . SER A  1 118 ? 77.198  124.256 60.993  1.00 12.21 ? 118 SER A O    1 
ATOM   1452  C  CB   . SER A  1 118 ? 78.107  126.160 58.447  1.00 9.18  ? 118 SER A CB   1 
ATOM   1453  O  OG   . SER A  1 118 ? 78.708  126.726 59.599  1.00 14.63 ? 118 SER A OG   1 
ATOM   1454  H  H    . SER A  1 118 ? 76.972  124.663 56.855  1.00 10.23 ? 118 SER A H    1 
ATOM   1455  H  HA   . SER A  1 118 ? 78.529  124.188 58.898  1.00 14.59 ? 118 SER A HA   1 
ATOM   1456  H  HB2  . SER A  1 118 ? 78.738  126.197 57.712  1.00 11.02 ? 118 SER A HB2  1 
ATOM   1457  H  HB3  . SER A  1 118 ? 77.310  126.667 58.226  1.00 11.02 ? 118 SER A HB3  1 
ATOM   1458  H  HG   . SER A  1 118 ? 78.912  127.507 59.454  1.00 17.56 ? 118 SER A HG   1 
ATOM   1459  N  N    . LYS A  1 119 ? 75.503  124.856 59.657  1.00 11.75 ? 119 LYS A N    1 
ATOM   1460  C  CA   . LYS A  1 119 ? 74.534  124.790 60.738  1.00 9.68  ? 119 LYS A CA   1 
ATOM   1461  C  C    . LYS A  1 119 ? 74.381  123.341 61.227  1.00 11.80 ? 119 LYS A C    1 
ATOM   1462  O  O    . LYS A  1 119 ? 74.329  123.058 62.441  1.00 14.15 ? 119 LYS A O    1 
ATOM   1463  C  CB   . LYS A  1 119 ? 73.200  125.391 60.281  1.00 12.75 ? 119 LYS A CB   1 
ATOM   1464  C  CG   . LYS A  1 119 ? 73.326  126.911 59.980  1.00 16.35 ? 119 LYS A CG   1 
ATOM   1465  C  CD   . LYS A  1 119 ? 71.993  127.565 59.637  1.00 25.69 ? 119 LYS A CD   1 
ATOM   1466  C  CE   . LYS A  1 119 ? 72.086  129.113 59.766  1.00 27.70 ? 119 LYS A CE   1 
ATOM   1467  N  NZ   . LYS A  1 119 ? 71.358  129.827 58.687  1.00 35.80 ? 119 LYS A NZ   1 
ATOM   1468  H  H    . LYS A  1 119 ? 75.174  125.072 58.893  1.00 14.10 ? 119 LYS A H    1 
ATOM   1469  H  HA   . LYS A  1 119 ? 74.862  125.327 61.490  1.00 11.62 ? 119 LYS A HA   1 
ATOM   1470  H  HB2  . LYS A  1 119 ? 72.909  124.945 59.470  1.00 15.30 ? 119 LYS A HB2  1 
ATOM   1471  H  HB3  . LYS A  1 119 ? 72.540  125.275 60.982  1.00 15.30 ? 119 LYS A HB3  1 
ATOM   1472  H  HG2  . LYS A  1 119 ? 73.686  127.358 60.762  1.00 19.62 ? 119 LYS A HG2  1 
ATOM   1473  H  HG3  . LYS A  1 119 ? 73.923  127.034 59.225  1.00 19.62 ? 119 LYS A HG3  1 
ATOM   1474  H  HD2  . LYS A  1 119 ? 71.754  127.348 58.722  1.00 30.82 ? 119 LYS A HD2  1 
ATOM   1475  H  HD3  . LYS A  1 119 ? 71.311  127.247 60.249  1.00 30.82 ? 119 LYS A HD3  1 
ATOM   1476  H  HE2  . LYS A  1 119 ? 71.703  129.382 60.615  1.00 33.24 ? 119 LYS A HE2  1 
ATOM   1477  H  HE3  . LYS A  1 119 ? 73.018  129.377 59.724  1.00 33.24 ? 119 LYS A HE3  1 
ATOM   1478  H  HZ1  . LYS A  1 119 ? 71.437  130.707 58.798  1.00 42.95 ? 119 LYS A HZ1  1 
ATOM   1479  H  HZ2  . LYS A  1 119 ? 71.696  129.605 57.894  1.00 42.95 ? 119 LYS A HZ2  1 
ATOM   1480  H  HZ3  . LYS A  1 119 ? 70.496  129.609 58.706  1.00 42.95 ? 119 LYS A HZ3  1 
ATOM   1481  N  N    . LEU A  1 120 ? 74.338  122.415 60.276  1.00 14.90 ? 120 LEU A N    1 
ATOM   1482  C  CA   . LEU A  1 120 ? 74.221  121.017 60.609  1.00 10.25 ? 120 LEU A CA   1 
ATOM   1483  C  C    . LEU A  1 120 ? 75.389  120.623 61.520  1.00 10.75 ? 120 LEU A C    1 
ATOM   1484  O  O    . LEU A  1 120 ? 75.235  119.844 62.487  1.00 11.44 ? 120 LEU A O    1 
ATOM   1485  C  CB   . LEU A  1 120 ? 74.223  120.197 59.309  1.00 8.52  ? 120 LEU A CB   1 
ATOM   1486  C  CG   . LEU A  1 120 ? 74.240  118.679 59.529  1.00 11.68 ? 120 LEU A CG   1 
ATOM   1487  C  CD1  . LEU A  1 120 ? 72.864  118.201 60.029  1.00 15.42 ? 120 LEU A CD1  1 
ATOM   1488  C  CD2  . LEU A  1 120 ? 74.661  117.921 58.289  1.00 11.96 ? 120 LEU A CD2  1 
ATOM   1489  H  H    . LEU A  1 120 ? 74.376  122.577 59.432  1.00 17.88 ? 120 LEU A H    1 
ATOM   1490  H  HA   . LEU A  1 120 ? 73.379  120.856 61.085  1.00 12.30 ? 120 LEU A HA   1 
ATOM   1491  H  HB2  . LEU A  1 120 ? 73.424  120.413 58.803  1.00 10.22 ? 120 LEU A HB2  1 
ATOM   1492  H  HB3  . LEU A  1 120 ? 75.011  120.431 58.794  1.00 10.22 ? 120 LEU A HB3  1 
ATOM   1493  H  HG   . LEU A  1 120 ? 74.887  118.479 60.224  1.00 14.02 ? 120 LEU A HG   1 
ATOM   1494  H  HD11 . LEU A  1 120 ? 72.893  117.251 60.161  1.00 18.50 ? 120 LEU A HD11 1 
ATOM   1495  H  HD12 . LEU A  1 120 ? 72.663  118.642 60.858  1.00 18.50 ? 120 LEU A HD12 1 
ATOM   1496  H  HD13 . LEU A  1 120 ? 72.200  118.421 59.372  1.00 18.50 ? 120 LEU A HD13 1 
ATOM   1497  H  HD21 . LEU A  1 120 ? 74.655  116.980 58.481  1.00 14.35 ? 120 LEU A HD21 1 
ATOM   1498  H  HD22 . LEU A  1 120 ? 74.044  118.115 57.580  1.00 14.35 ? 120 LEU A HD22 1 
ATOM   1499  H  HD23 . LEU A  1 120 ? 75.546  118.199 58.039  1.00 14.35 ? 120 LEU A HD23 1 
ATOM   1500  N  N    . LEU A  1 121 ? 76.552  121.183 61.213  1.00 8.11  ? 121 LEU A N    1 
ATOM   1501  C  CA   . LEU A  1 121 ? 77.795  120.835 61.883  1.00 9.52  ? 121 LEU A CA   1 
ATOM   1502  C  C    . LEU A  1 121 ? 77.958  121.535 63.240  1.00 13.40 ? 121 LEU A C    1 
ATOM   1503  O  O    . LEU A  1 121 ? 78.994  121.406 63.909  1.00 13.32 ? 121 LEU A O    1 
ATOM   1504  C  CB   . LEU A  1 121 ? 78.982  121.124 60.965  1.00 7.92  ? 121 LEU A CB   1 
ATOM   1505  C  CG   . LEU A  1 121 ? 79.043  120.221 59.715  1.00 10.40 ? 121 LEU A CG   1 
ATOM   1506  C  CD1  . LEU A  1 121 ? 80.117  120.690 58.772  1.00 10.50 ? 121 LEU A CD1  1 
ATOM   1507  C  CD2  . LEU A  1 121 ? 79.305  118.785 60.056  1.00 15.35 ? 121 LEU A CD2  1 
ATOM   1508  H  H    . LEU A  1 121 ? 76.648  121.783 60.604  1.00 9.74  ? 121 LEU A H    1 
ATOM   1509  H  HA   . LEU A  1 121 ? 77.790  119.870 62.054  1.00 11.42 ? 121 LEU A HA   1 
ATOM   1510  H  HB2  . LEU A  1 121 ? 78.926  122.044 60.663  1.00 9.50  ? 121 LEU A HB2  1 
ATOM   1511  H  HB3  . LEU A  1 121 ? 79.803  120.992 61.465  1.00 9.50  ? 121 LEU A HB3  1 
ATOM   1512  H  HG   . LEU A  1 121 ? 78.193  120.268 59.250  1.00 12.48 ? 121 LEU A HG   1 
ATOM   1513  H  HD11 . LEU A  1 121 ? 80.133  120.113 58.005  1.00 12.60 ? 121 LEU A HD11 1 
ATOM   1514  H  HD12 . LEU A  1 121 ? 79.922  121.590 58.500  1.00 12.60 ? 121 LEU A HD12 1 
ATOM   1515  H  HD13 . LEU A  1 121 ? 80.964  120.660 59.223  1.00 12.60 ? 121 LEU A HD13 1 
ATOM   1516  H  HD21 . LEU A  1 121 ? 79.333  118.271 59.245  1.00 18.42 ? 121 LEU A HD21 1 
ATOM   1517  H  HD22 . LEU A  1 121 ? 80.147  118.721 60.513  1.00 18.42 ? 121 LEU A HD22 1 
ATOM   1518  H  HD23 . LEU A  1 121 ? 78.600  118.465 60.623  1.00 18.42 ? 121 LEU A HD23 1 
ATOM   1519  N  N    . HIS A  1 122 ? 76.923  122.260 63.639  1.00 11.35 ? 122 HIS A N    1 
ATOM   1520  C  CA   . HIS A  1 122 ? 76.828  122.780 65.013  1.00 12.63 ? 122 HIS A CA   1 
ATOM   1521  C  C    . HIS A  1 122 ? 75.574  122.286 65.715  1.00 16.01 ? 122 HIS A C    1 
ATOM   1522  O  O    . HIS A  1 122 ? 75.184  122.791 66.790  1.00 14.63 ? 122 HIS A O    1 
ATOM   1523  C  CB   . HIS A  1 122 ? 76.887  124.311 64.993  1.00 13.39 ? 122 HIS A CB   1 
ATOM   1524  C  CG   . HIS A  1 122 ? 78.241  124.822 64.630  1.00 18.73 ? 122 HIS A CG   1 
ATOM   1525  N  ND1  . HIS A  1 122 ? 78.657  124.984 63.322  1.00 16.17 ? 122 HIS A ND1  1 
ATOM   1526  C  CD2  . HIS A  1 122 ? 79.315  125.104 65.404  1.00 22.32 ? 122 HIS A CD2  1 
ATOM   1527  C  CE1  . HIS A  1 122 ? 79.912  125.391 63.317  1.00 18.92 ? 122 HIS A CE1  1 
ATOM   1528  N  NE2  . HIS A  1 122 ? 80.332  125.478 64.565  1.00 25.14 ? 122 HIS A NE2  1 
ATOM   1529  H  H    . HIS A  1 122 ? 76.257  122.471 63.138  1.00 13.61 ? 122 HIS A H    1 
ATOM   1530  H  HA   . HIS A  1 122 ? 77.600  122.459 65.524  1.00 15.15 ? 122 HIS A HA   1 
ATOM   1531  H  HB2  . HIS A  1 122 ? 76.254  124.644 64.338  1.00 16.06 ? 122 HIS A HB2  1 
ATOM   1532  H  HB3  . HIS A  1 122 ? 76.664  124.648 65.874  1.00 16.06 ? 122 HIS A HB3  1 
ATOM   1533  H  HD1  . HIS A  1 122 ? 78.170  124.857 62.624  1.00 19.40 ? 122 HIS A HD1  1 
ATOM   1534  H  HD2  . HIS A  1 122 ? 79.348  125.078 66.333  1.00 26.78 ? 122 HIS A HD2  1 
ATOM   1535  H  HE1  . HIS A  1 122 ? 80.413  125.592 62.560  1.00 22.70 ? 122 HIS A HE1  1 
ATOM   1536  H  HE2  . HIS A  1 122 ? 81.119  125.725 64.811  1.00 30.17 ? 122 HIS A HE2  1 
ATOM   1537  N  N    . SER A  1 123 ? 74.934  121.309 65.096  1.00 16.56 ? 123 SER A N    1 
ATOM   1538  C  CA   . SER A  1 123 ? 73.703  120.740 65.630  1.00 14.11 ? 123 SER A CA   1 
ATOM   1539  C  C    . SER A  1 123 ? 74.014  119.643 66.655  1.00 13.64 ? 123 SER A C    1 
ATOM   1540  O  O    . SER A  1 123 ? 75.145  119.176 66.734  1.00 13.15 ? 123 SER A O    1 
ATOM   1541  C  CB   . SER A  1 123 ? 72.873  120.168 64.500  1.00 12.97 ? 123 SER A CB   1 
ATOM   1542  O  OG   . SER A  1 123 ? 73.451  118.964 64.035  1.00 12.00 ? 123 SER A OG   1 
ATOM   1543  H  H    . SER A  1 123 ? 75.192  120.953 64.357  1.00 19.88 ? 123 SER A H    1 
ATOM   1544  H  HA   . SER A  1 123 ? 73.183  121.442 66.074  1.00 16.93 ? 123 SER A HA   1 
ATOM   1545  H  HB2  . SER A  1 123 ? 71.977  119.987 64.824  1.00 15.57 ? 123 SER A HB2  1 
ATOM   1546  H  HB3  . SER A  1 123 ? 72.843  120.809 63.772  1.00 15.57 ? 123 SER A HB3  1 
ATOM   1547  H  HG   . SER A  1 123 ? 74.130  118.795 64.463  1.00 14.40 ? 123 SER A HG   1 
ATOM   1548  N  N    . ASP A  1 124 ? 73.008  119.251 67.440  1.00 13.65 ? 124 ASP A N    1 
ATOM   1549  C  CA   . ASP A  1 124 ? 73.152  118.176 68.427  1.00 12.50 ? 124 ASP A CA   1 
ATOM   1550  C  C    . ASP A  1 124 ? 73.383  116.820 67.746  1.00 11.40 ? 124 ASP A C    1 
ATOM   1551  O  O    . ASP A  1 124 ? 74.071  115.959 68.291  1.00 13.01 ? 124 ASP A O    1 
ATOM   1552  C  CB   . ASP A  1 124 ? 71.898  118.074 69.290  1.00 15.91 ? 124 ASP A CB   1 
ATOM   1553  C  CG   . ASP A  1 124 ? 71.907  119.047 70.477  1.00 25.83 ? 124 ASP A CG   1 
ATOM   1554  O  OD1  . ASP A  1 124 ? 72.865  119.832 70.583  1.00 23.09 ? 124 ASP A OD1  1 
ATOM   1555  O  OD2  . ASP A  1 124 ? 70.990  118.990 71.332  1.00 26.20 ? 124 ASP A OD2  1 
ATOM   1556  H  H    . ASP A  1 124 ? 72.220  119.596 67.419  1.00 16.38 ? 124 ASP A H    1 
ATOM   1557  H  HA   . ASP A  1 124 ? 73.917  118.366 69.009  1.00 15.00 ? 124 ASP A HA   1 
ATOM   1558  H  HB2  . ASP A  1 124 ? 71.122  118.277 68.744  1.00 19.09 ? 124 ASP A HB2  1 
ATOM   1559  H  HB3  . ASP A  1 124 ? 71.829  117.173 69.642  1.00 19.09 ? 124 ASP A HB3  1 
ATOM   1560  N  N    . TRP A  1 125 ? 72.790  116.629 66.566  1.00 10.10 ? 125 TRP A N    1 
ATOM   1561  C  CA   . TRP A  1 125 ? 73.023  115.401 65.788  1.00 9.38  ? 125 TRP A CA   1 
ATOM   1562  C  C    . TRP A  1 125 ? 74.533  115.222 65.562  1.00 13.54 ? 125 TRP A C    1 
ATOM   1563  O  O    . TRP A  1 125 ? 75.084  114.129 65.721  1.00 14.86 ? 125 TRP A O    1 
ATOM   1564  C  CB   . TRP A  1 125 ? 72.279  115.464 64.444  1.00 13.15 ? 125 TRP A CB   1 
ATOM   1565  C  CG   . TRP A  1 125 ? 72.714  114.424 63.499  1.00 13.13 ? 125 TRP A CG   1 
ATOM   1566  C  CD1  . TRP A  1 125 ? 72.250  113.134 63.422  1.00 20.95 ? 125 TRP A CD1  1 
ATOM   1567  C  CD2  . TRP A  1 125 ? 73.717  114.553 62.484  1.00 8.60  ? 125 TRP A CD2  1 
ATOM   1568  N  NE1  . TRP A  1 125 ? 72.914  112.451 62.430  1.00 17.72 ? 125 TRP A NE1  1 
ATOM   1569  C  CE2  . TRP A  1 125 ? 73.800  113.308 61.819  1.00 8.65  ? 125 TRP A CE2  1 
ATOM   1570  C  CE3  . TRP A  1 125 ? 74.542  115.601 62.062  1.00 11.52 ? 125 TRP A CE3  1 
ATOM   1571  C  CZ2  . TRP A  1 125 ? 74.702  113.083 60.790  1.00 11.06 ? 125 TRP A CZ2  1 
ATOM   1572  C  CZ3  . TRP A  1 125 ? 75.426  115.377 61.046  1.00 11.65 ? 125 TRP A CZ3  1 
ATOM   1573  C  CH2  . TRP A  1 125 ? 75.508  114.135 60.417  1.00 9.34  ? 125 TRP A CH2  1 
ATOM   1574  H  H    . TRP A  1 125 ? 72.253  117.188 66.194  1.00 12.12 ? 125 TRP A H    1 
ATOM   1575  H  HA   . TRP A  1 125 ? 72.691  114.629 66.291  1.00 11.25 ? 125 TRP A HA   1 
ATOM   1576  H  HB2  . TRP A  1 125 ? 71.329  115.345 64.603  1.00 15.77 ? 125 TRP A HB2  1 
ATOM   1577  H  HB3  . TRP A  1 125 ? 72.441  116.328 64.034  1.00 15.77 ? 125 TRP A HB3  1 
ATOM   1578  H  HD1  . TRP A  1 125 ? 71.590  112.772 63.968  1.00 25.15 ? 125 TRP A HD1  1 
ATOM   1579  H  HE1  . TRP A  1 125 ? 72.773  111.633 62.204  1.00 21.27 ? 125 TRP A HE1  1 
ATOM   1580  H  HE3  . TRP A  1 125 ? 74.506  116.430 62.483  1.00 13.83 ? 125 TRP A HE3  1 
ATOM   1581  H  HZ2  . TRP A  1 125 ? 74.756  112.257 60.366  1.00 13.28 ? 125 TRP A HZ2  1 
ATOM   1582  H  HZ3  . TRP A  1 125 ? 75.976  116.070 60.759  1.00 13.98 ? 125 TRP A HZ3  1 
ATOM   1583  H  HH2  . TRP A  1 125 ? 76.106  114.021 59.714  1.00 11.21 ? 125 TRP A HH2  1 
ATOM   1584  N  N    . PHE A  1 126 ? 75.205  116.304 65.179  1.00 8.41  ? 126 PHE A N    1 
ATOM   1585  C  CA   . PHE A  1 126 ? 76.638  116.277 64.951  1.00 9.30  ? 126 PHE A CA   1 
ATOM   1586  C  C    . PHE A  1 126 ? 77.446  116.138 66.220  1.00 9.59  ? 126 PHE A C    1 
ATOM   1587  O  O    . PHE A  1 126 ? 78.381  115.330 66.282  1.00 10.08 ? 126 PHE A O    1 
ATOM   1588  C  CB   . PHE A  1 126 ? 77.131  117.505 64.155  1.00 8.37  ? 126 PHE A CB   1 
ATOM   1589  C  CG   . PHE A  1 126 ? 78.614  117.500 63.940  1.00 8.44  ? 126 PHE A CG   1 
ATOM   1590  C  CD1  . PHE A  1 126 ? 79.171  116.676 62.978  1.00 10.17 ? 126 PHE A CD1  1 
ATOM   1591  C  CD2  . PHE A  1 126 ? 79.446  118.248 64.738  1.00 11.49 ? 126 PHE A CD2  1 
ATOM   1592  C  CE1  . PHE A  1 126 ? 80.531  116.643 62.777  1.00 16.26 ? 126 PHE A CE1  1 
ATOM   1593  C  CE2  . PHE A  1 126 ? 80.810  118.217 64.550  1.00 14.50 ? 126 PHE A CE2  1 
ATOM   1594  C  CZ   . PHE A  1 126 ? 81.351  117.408 63.558  1.00 12.82 ? 126 PHE A CZ   1 
ATOM   1595  H  H    . PHE A  1 126 ? 74.846  117.073 65.044  1.00 10.10 ? 126 PHE A H    1 
ATOM   1596  H  HA   . PHE A  1 126 ? 76.836  115.488 64.404  1.00 11.16 ? 126 PHE A HA   1 
ATOM   1597  H  HB2  . PHE A  1 126 ? 76.702  117.511 63.285  1.00 10.04 ? 126 PHE A HB2  1 
ATOM   1598  H  HB3  . PHE A  1 126 ? 76.902  118.311 64.644  1.00 10.04 ? 126 PHE A HB3  1 
ATOM   1599  H  HD1  . PHE A  1 126 ? 78.616  116.160 62.439  1.00 12.21 ? 126 PHE A HD1  1 
ATOM   1600  H  HD2  . PHE A  1 126 ? 79.084  118.796 65.397  1.00 13.78 ? 126 PHE A HD2  1 
ATOM   1601  H  HE1  . PHE A  1 126 ? 80.892  116.097 62.116  1.00 19.51 ? 126 PHE A HE1  1 
ATOM   1602  H  HE2  . PHE A  1 126 ? 81.367  118.739 65.081  1.00 17.41 ? 126 PHE A HE2  1 
ATOM   1603  H  HZ   . PHE A  1 126 ? 82.271  117.383 63.428  1.00 15.38 ? 126 PHE A HZ   1 
ATOM   1604  N  N    . LYS A  1 127 ? 77.104  116.923 67.237  1.00 13.10 ? 127 LYS A N    1 
ATOM   1605  C  CA   . LYS A  1 127 ? 77.800  116.855 68.499  1.00 8.87  ? 127 LYS A CA   1 
ATOM   1606  C  C    . LYS A  1 127 ? 77.881  115.412 69.006  1.00 12.94 ? 127 LYS A C    1 
ATOM   1607  O  O    . LYS A  1 127 ? 78.923  114.993 69.492  1.00 9.15  ? 127 LYS A O    1 
ATOM   1608  C  CB   . LYS A  1 127 ? 77.070  117.700 69.523  1.00 10.28 ? 127 LYS A CB   1 
ATOM   1609  C  CG   . LYS A  1 127 ? 77.887  117.980 70.788  1.00 22.91 ? 127 LYS A CG   1 
ATOM   1610  C  CD   . LYS A  1 127 ? 77.068  118.788 71.812  1.00 36.14 ? 127 LYS A CD   1 
ATOM   1611  C  CE   . LYS A  1 127 ? 77.663  120.172 72.071  1.00 40.66 ? 127 LYS A CE   1 
ATOM   1612  N  NZ   . LYS A  1 127 ? 76.819  121.012 73.000  1.00 42.26 ? 127 LYS A NZ   1 
ATOM   1613  H  H    . LYS A  1 127 ? 76.470  117.503 67.214  1.00 15.72 ? 127 LYS A H    1 
ATOM   1614  H  HA   . LYS A  1 127 ? 78.710  117.204 68.395  1.00 10.64 ? 127 LYS A HA   1 
ATOM   1615  H  HB2  . LYS A  1 127 ? 76.844  118.553 69.120  1.00 12.34 ? 127 LYS A HB2  1 
ATOM   1616  H  HB3  . LYS A  1 127 ? 76.260  117.238 69.789  1.00 12.34 ? 127 LYS A HB3  1 
ATOM   1617  H  HG2  . LYS A  1 127 ? 78.143  117.139 71.198  1.00 27.49 ? 127 LYS A HG2  1 
ATOM   1618  H  HG3  . LYS A  1 127 ? 78.675  118.494 70.554  1.00 27.49 ? 127 LYS A HG3  1 
ATOM   1619  H  HD2  . LYS A  1 127 ? 76.166  118.907 71.475  1.00 43.37 ? 127 LYS A HD2  1 
ATOM   1620  H  HD3  . LYS A  1 127 ? 77.048  118.306 72.654  1.00 43.37 ? 127 LYS A HD3  1 
ATOM   1621  H  HE2  . LYS A  1 127 ? 78.539  120.068 72.475  1.00 48.80 ? 127 LYS A HE2  1 
ATOM   1622  H  HE3  . LYS A  1 127 ? 77.741  120.645 71.228  1.00 48.80 ? 127 LYS A HE3  1 
ATOM   1623  H  HZ1  . LYS A  1 127 ? 76.737  120.606 73.788  1.00 50.71 ? 127 LYS A HZ1  1 
ATOM   1624  H  HZ2  . LYS A  1 127 ? 76.009  121.132 72.651  1.00 50.71 ? 127 LYS A HZ2  1 
ATOM   1625  H  HZ3  . LYS A  1 127 ? 77.201  121.807 73.123  1.00 50.71 ? 127 LYS A HZ3  1 
ATOM   1626  N  N    . ASP A  1 128 ? 76.786  114.655 68.881  1.00 9.86  ? 128 ASP A N    1 
ATOM   1627  C  CA   . ASP A  1 128 ? 76.751  113.293 69.419  1.00 16.85 ? 128 ASP A CA   1 
ATOM   1628  C  C    . ASP A  1 128 ? 77.743  112.386 68.671  1.00 14.29 ? 128 ASP A C    1 
ATOM   1629  O  O    . ASP A  1 128 ? 78.417  111.559 69.279  1.00 11.33 ? 128 ASP A O    1 
ATOM   1630  C  CB   . ASP A  1 128 ? 75.326  112.703 69.379  1.00 15.96 ? 128 ASP A CB   1 
ATOM   1631  C  CG   . ASP A  1 128 ? 74.376  113.375 70.372  1.00 19.55 ? 128 ASP A CG   1 
ATOM   1632  O  OD1  . ASP A  1 128 ? 74.838  113.961 71.381  1.00 17.06 ? 128 ASP A OD1  1 
ATOM   1633  O  OD2  . ASP A  1 128 ? 73.148  113.329 70.144  1.00 22.78 ? 128 ASP A OD2  1 
ATOM   1634  H  H    . ASP A  1 128 ? 76.060  114.904 68.493  1.00 11.84 ? 128 ASP A H    1 
ATOM   1635  H  HA   . ASP A  1 128 ? 77.030  113.323 70.358  1.00 20.22 ? 128 ASP A HA   1 
ATOM   1636  H  HB2  . ASP A  1 128 ? 74.961  112.821 68.488  1.00 19.15 ? 128 ASP A HB2  1 
ATOM   1637  H  HB3  . ASP A  1 128 ? 75.369  111.759 69.598  1.00 19.15 ? 128 ASP A HB3  1 
ATOM   1638  N  N    . LEU A  1 129 ? 77.834  112.550 67.348  1.00 10.27 ? 129 LEU A N    1 
ATOM   1639  C  CA   . LEU A  1 129 ? 78.838  111.842 66.553  1.00 8.35  ? 129 LEU A CA   1 
ATOM   1640  C  C    . LEU A  1 129 ? 80.258  112.287 66.920  1.00 11.05 ? 129 LEU A C    1 
ATOM   1641  O  O    . LEU A  1 129 ? 81.160  111.460 66.997  1.00 7.62  ? 129 LEU A O    1 
ATOM   1642  C  CB   . LEU A  1 129 ? 78.580  112.069 65.070  1.00 7.55  ? 129 LEU A CB   1 
ATOM   1643  C  CG   . LEU A  1 129 ? 77.206  111.609 64.563  1.00 10.80 ? 129 LEU A CG   1 
ATOM   1644  C  CD1  . LEU A  1 129 ? 77.049  111.922 63.067  1.00 12.78 ? 129 LEU A CD1  1 
ATOM   1645  C  CD2  . LEU A  1 129 ? 76.994  110.085 64.788  1.00 12.77 ? 129 LEU A CD2  1 
ATOM   1646  H  H    . LEU A  1 129 ? 77.324  113.067 66.887  1.00 12.33 ? 129 LEU A H    1 
ATOM   1647  H  HA   . LEU A  1 129 ? 78.766  110.881 66.731  1.00 10.02 ? 129 LEU A HA   1 
ATOM   1648  H  HB2  . LEU A  1 129 ? 78.655  113.018 64.886  1.00 9.06  ? 129 LEU A HB2  1 
ATOM   1649  H  HB3  . LEU A  1 129 ? 79.254  111.587 64.564  1.00 9.06  ? 129 LEU A HB3  1 
ATOM   1650  H  HG   . LEU A  1 129 ? 76.513  112.085 65.046  1.00 12.96 ? 129 LEU A HG   1 
ATOM   1651  H  HD11 . LEU A  1 129 ? 76.184  111.626 62.775  1.00 15.33 ? 129 LEU A HD11 1 
ATOM   1652  H  HD12 . LEU A  1 129 ? 77.133  112.870 62.936  1.00 15.33 ? 129 LEU A HD12 1 
ATOM   1653  H  HD13 . LEU A  1 129 ? 77.736  111.462 62.578  1.00 15.33 ? 129 LEU A HD13 1 
ATOM   1654  H  HD21 . LEU A  1 129 ? 76.127  109.839 64.459  1.00 15.32 ? 129 LEU A HD21 1 
ATOM   1655  H  HD22 . LEU A  1 129 ? 77.674  109.602 64.314  1.00 15.32 ? 129 LEU A HD22 1 
ATOM   1656  H  HD23 . LEU A  1 129 ? 77.054  109.898 65.728  1.00 15.32 ? 129 LEU A HD23 1 
ATOM   1657  N  N    . SER A  1 130 ? 80.471  113.585 67.160  1.00 9.36  ? 130 SER A N    1 
ATOM   1658  C  CA   . SER A  1 130 ? 81.812  114.034 67.547  1.00 7.40  ? 130 SER A CA   1 
ATOM   1659  C  C    . SER A  1 130 ? 82.180  113.423 68.919  1.00 7.65  ? 130 SER A C    1 
ATOM   1660  O  O    . SER A  1 130 ? 83.311  112.973 69.135  1.00 8.40  ? 130 SER A O    1 
ATOM   1661  C  CB   . SER A  1 130 ? 81.904  115.568 67.592  1.00 7.99  ? 130 SER A CB   1 
ATOM   1662  O  OG   . SER A  1 130 ? 83.127  115.994 68.155  1.00 13.82 ? 130 SER A OG   1 
ATOM   1663  H  H    . SER A  1 130 ? 79.878  114.206 67.108  1.00 11.23 ? 130 SER A H    1 
ATOM   1664  H  HA   . SER A  1 130 ? 82.460  113.710 66.888  1.00 8.88  ? 130 SER A HA   1 
ATOM   1665  H  HB2  . SER A  1 130 ? 81.838  115.912 66.687  1.00 9.59  ? 130 SER A HB2  1 
ATOM   1666  H  HB3  . SER A  1 130 ? 81.174  115.911 68.130  1.00 9.59  ? 130 SER A HB3  1 
ATOM   1667  H  HG   . SER A  1 130 ? 83.158  116.813 68.170  1.00 16.58 ? 130 SER A HG   1 
ATOM   1668  N  N    . ASP A  1 131 ? 81.222  113.384 69.833  1.00 11.57 ? 131 ASP A N    1 
ATOM   1669  C  CA   . ASP A  1 131 ? 81.469  112.752 71.146  1.00 9.70  ? 131 ASP A CA   1 
ATOM   1670  C  C    . ASP A  1 131 ? 81.803  111.249 70.986  1.00 11.57 ? 131 ASP A C    1 
ATOM   1671  O  O    . ASP A  1 131 ? 82.729  110.727 71.626  1.00 8.31  ? 131 ASP A O    1 
ATOM   1672  C  CB   . ASP A  1 131 ? 80.273  112.932 72.075  1.00 9.21  ? 131 ASP A CB   1 
ATOM   1673  C  CG   . ASP A  1 131 ? 80.027  114.375 72.449  1.00 10.04 ? 131 ASP A CG   1 
ATOM   1674  O  OD1  . ASP A  1 131 ? 80.963  115.205 72.301  1.00 11.91 ? 131 ASP A OD1  1 
ATOM   1675  O  OD2  . ASP A  1 131 ? 78.884  114.678 72.883  1.00 14.39 ? 131 ASP A OD2  1 
ATOM   1676  H  H    . ASP A  1 131 ? 80.431  113.706 69.732  1.00 13.89 ? 131 ASP A H    1 
ATOM   1677  H  HA   . ASP A  1 131 ? 82.241  113.186 71.565  1.00 11.64 ? 131 ASP A HA   1 
ATOM   1678  H  HB2  . ASP A  1 131 ? 79.477  112.598 71.633  1.00 11.05 ? 131 ASP A HB2  1 
ATOM   1679  H  HB3  . ASP A  1 131 ? 80.431  112.434 72.893  1.00 11.05 ? 131 ASP A HB3  1 
ATOM   1680  N  N    . LYS A  1 132 ? 81.055  110.551 70.133  1.00 9.76  ? 132 LYS A N    1 
ATOM   1681  C  CA   . LYS A  1 132 ? 81.424  109.172 69.782  1.00 8.19  ? 132 LYS A CA   1 
ATOM   1682  C  C    . LYS A  1 132 ? 82.872  109.059 69.224  1.00 7.92  ? 132 LYS A C    1 
ATOM   1683  O  O    . LYS A  1 132 ? 83.639  108.179 69.627  1.00 10.81 ? 132 LYS A O    1 
ATOM   1684  C  CB   . LYS A  1 132 ? 80.429  108.587 68.799  1.00 13.05 ? 132 LYS A CB   1 
ATOM   1685  C  CG   . LYS A  1 132 ? 79.081  108.206 69.410  1.00 15.71 ? 132 LYS A CG   1 
ATOM   1686  C  CD   . LYS A  1 132 ? 78.125  107.802 68.272  1.00 21.60 ? 132 LYS A CD   1 
ATOM   1687  C  CE   . LYS A  1 132 ? 76.846  107.176 68.772  1.00 36.18 ? 132 LYS A CE   1 
ATOM   1688  N  NZ   . LYS A  1 132 ? 75.977  106.705 67.640  1.00 37.47 ? 132 LYS A NZ   1 
ATOM   1689  H  H    . LYS A  1 132 ? 80.343  110.842 69.748  1.00 11.71 ? 132 LYS A H    1 
ATOM   1690  H  HA   . LYS A  1 132 ? 81.383  108.628 70.595  1.00 9.83  ? 132 LYS A HA   1 
ATOM   1691  H  HB2  . LYS A  1 132 ? 80.262  109.239 68.101  1.00 15.66 ? 132 LYS A HB2  1 
ATOM   1692  H  HB3  . LYS A  1 132 ? 80.813  107.785 68.410  1.00 15.66 ? 132 LYS A HB3  1 
ATOM   1693  H  HG2  . LYS A  1 132 ? 79.192  107.450 70.008  1.00 18.85 ? 132 LYS A HG2  1 
ATOM   1694  H  HG3  . LYS A  1 132 ? 78.705  108.966 69.879  1.00 18.85 ? 132 LYS A HG3  1 
ATOM   1695  H  HD2  . LYS A  1 132 ? 77.891  108.593 67.761  1.00 25.92 ? 132 LYS A HD2  1 
ATOM   1696  H  HD3  . LYS A  1 132 ? 78.570  107.157 67.700  1.00 25.92 ? 132 LYS A HD3  1 
ATOM   1697  H  HE2  . LYS A  1 132 ? 77.061  106.411 69.329  1.00 43.41 ? 132 LYS A HE2  1 
ATOM   1698  H  HE3  . LYS A  1 132 ? 76.348  107.833 69.284  1.00 43.41 ? 132 LYS A HE3  1 
ATOM   1699  H  HZ1  . LYS A  1 132 ? 75.231  106.341 67.961  1.00 44.96 ? 132 LYS A HZ1  1 
ATOM   1700  H  HZ2  . LYS A  1 132 ? 75.762  107.391 67.116  1.00 44.96 ? 132 LYS A HZ2  1 
ATOM   1701  H  HZ3  . LYS A  1 132 ? 76.411  106.096 67.157  1.00 44.96 ? 132 LYS A HZ3  1 
ATOM   1702  N  N    . LEU A  1 133 ? 83.261  109.947 68.315  1.00 7.68  ? 133 LEU A N    1 
ATOM   1703  C  CA   . LEU A  1 133 ? 84.598  109.875 67.744  1.00 11.35 ? 133 LEU A CA   1 
ATOM   1704  C  C    . LEU A  1 133 ? 85.718  110.108 68.767  1.00 9.14  ? 133 LEU A C    1 
ATOM   1705  O  O    . LEU A  1 133 ? 86.775  109.480 68.686  1.00 11.23 ? 133 LEU A O    1 
ATOM   1706  C  CB   . LEU A  1 133 ? 84.738  110.866 66.563  1.00 11.08 ? 133 LEU A CB   1 
ATOM   1707  C  CG   . LEU A  1 133 ? 86.015  110.739 65.725  1.00 11.01 ? 133 LEU A CG   1 
ATOM   1708  C  CD1  . LEU A  1 133 ? 86.060  109.465 64.894  1.00 14.64 ? 133 LEU A CD1  1 
ATOM   1709  C  CD2  . LEU A  1 133 ? 86.086  111.941 64.823  1.00 13.25 ? 133 LEU A CD2  1 
ATOM   1710  H  H    . LEU A  1 133 ? 82.776  110.591 68.016  1.00 9.22  ? 133 LEU A H    1 
ATOM   1711  H  HA   . LEU A  1 133 ? 84.725  108.974 67.381  1.00 13.62 ? 133 LEU A HA   1 
ATOM   1712  H  HB2  . LEU A  1 133 ? 83.985  110.734 65.965  1.00 13.29 ? 133 LEU A HB2  1 
ATOM   1713  H  HB3  . LEU A  1 133 ? 84.713  111.768 66.917  1.00 13.29 ? 133 LEU A HB3  1 
ATOM   1714  H  HG   . LEU A  1 133 ? 86.788  110.749 66.311  1.00 13.21 ? 133 LEU A HG   1 
ATOM   1715  H  HD11 . LEU A  1 133 ? 86.880  109.446 64.395  1.00 17.57 ? 133 LEU A HD11 1 
ATOM   1716  H  HD12 . LEU A  1 133 ? 86.016  108.707 65.481  1.00 17.57 ? 133 LEU A HD12 1 
ATOM   1717  H  HD13 . LEU A  1 133 ? 85.311  109.458 64.293  1.00 17.57 ? 133 LEU A HD13 1 
ATOM   1718  H  HD21 . LEU A  1 133 ? 86.881  111.882 64.288  1.00 15.90 ? 133 LEU A HD21 1 
ATOM   1719  H  HD22 . LEU A  1 133 ? 85.310  111.954 64.259  1.00 15.90 ? 133 LEU A HD22 1 
ATOM   1720  H  HD23 . LEU A  1 133 ? 86.112  112.734 65.363  1.00 15.90 ? 133 LEU A HD23 1 
ATOM   1721  N  N    . ASP A  1 134 ? 85.487  111.023 69.713  1.00 7.82  ? 134 ASP A N    1 
ATOM   1722  C  CA   . ASP A  1 134 ? 86.414  111.279 70.815  1.00 15.16 ? 134 ASP A CA   1 
ATOM   1723  C  C    . ASP A  1 134 ? 86.771  109.993 71.556  1.00 10.26 ? 134 ASP A C    1 
ATOM   1724  O  O    . ASP A  1 134 ? 87.919  109.796 71.937  1.00 12.78 ? 134 ASP A O    1 
ATOM   1725  C  CB   . ASP A  1 134 ? 85.814  112.255 71.835  1.00 12.60 ? 134 ASP A CB   1 
ATOM   1726  C  CG   . ASP A  1 134 ? 85.790  113.682 71.359  1.00 15.13 ? 134 ASP A CG   1 
ATOM   1727  O  OD1  . ASP A  1 134 ? 86.331  114.009 70.256  1.00 15.99 ? 134 ASP A OD1  1 
ATOM   1728  O  OD2  . ASP A  1 134 ? 85.229  114.505 72.121  1.00 12.69 ? 134 ASP A OD2  1 
ATOM   1729  H  H    . ASP A  1 134 ? 84.784  111.518 69.737  1.00 9.39  ? 134 ASP A H    1 
ATOM   1730  H  HA   . ASP A  1 134 ? 87.239  111.671 70.460  1.00 18.19 ? 134 ASP A HA   1 
ATOM   1731  H  HB2  . ASP A  1 134 ? 84.901  111.988 72.024  1.00 15.12 ? 134 ASP A HB2  1 
ATOM   1732  H  HB3  . ASP A  1 134 ? 86.342  112.221 72.648  1.00 15.12 ? 134 ASP A HB3  1 
ATOM   1733  N  N    . GLN A  1 135 ? 85.787  109.129 71.771  1.00 17.25 ? 135 GLN A N    1 
ATOM   1734  C  CA   . GLN A  1 135 ? 86.030  107.886 72.503  1.00 20.70 ? 135 GLN A CA   1 
ATOM   1735  C  C    . GLN A  1 135 ? 86.836  106.874 71.685  1.00 14.78 ? 135 GLN A C    1 
ATOM   1736  O  O    . GLN A  1 135 ? 87.351  105.910 72.234  1.00 13.46 ? 135 GLN A O    1 
ATOM   1737  C  CB   . GLN A  1 135 ? 84.717  107.258 72.930  1.00 14.88 ? 135 GLN A CB   1 
ATOM   1738  C  CG   . GLN A  1 135 ? 83.888  108.138 73.805  1.00 15.23 ? 135 GLN A CG   1 
ATOM   1739  C  CD   . GLN A  1 135 ? 84.515  108.353 75.181  1.00 13.84 ? 135 GLN A CD   1 
ATOM   1740  O  OE1  . GLN A  1 135 ? 85.231  107.486 75.706  1.00 18.38 ? 135 GLN A OE1  1 
ATOM   1741  N  NE2  . GLN A  1 135 ? 84.265  109.520 75.760  1.00 15.67 ? 135 GLN A NE2  1 
ATOM   1742  H  H    . GLN A  1 135 ? 84.976  109.234 71.506  1.00 20.70 ? 135 GLN A H    1 
ATOM   1743  H  HA   . GLN A  1 135 ? 86.541  108.092 73.314  1.00 24.84 ? 135 GLN A HA   1 
ATOM   1744  H  HB2  . GLN A  1 135 ? 84.196  107.051 72.138  1.00 17.86 ? 135 GLN A HB2  1 
ATOM   1745  H  HB3  . GLN A  1 135 ? 84.905  106.443 73.422  1.00 17.86 ? 135 GLN A HB3  1 
ATOM   1746  H  HG2  . GLN A  1 135 ? 83.790  109.004 73.380  1.00 18.28 ? 135 GLN A HG2  1 
ATOM   1747  H  HG3  . GLN A  1 135 ? 83.017  107.729 73.931  1.00 18.28 ? 135 GLN A HG3  1 
ATOM   1748  H  HE21 . GLN A  1 135 ? 83.775  110.103 75.359  1.00 18.81 ? 135 GLN A HE21 1 
ATOM   1749  H  HE22 . GLN A  1 135 ? 84.593  109.695 76.535  1.00 18.81 ? 135 GLN A HE22 1 
ATOM   1750  N  N    . HIS A  1 136 ? 86.945  107.114 70.381  1.00 12.60 ? 136 HIS A N    1 
ATOM   1751  C  CA   . HIS A  1 136 ? 87.795  106.328 69.499  1.00 16.88 ? 136 HIS A CA   1 
ATOM   1752  C  C    . HIS A  1 136 ? 89.091  107.072 69.183  1.00 14.27 ? 136 HIS A C    1 
ATOM   1753  O  O    . HIS A  1 136 ? 89.713  106.846 68.124  1.00 11.79 ? 136 HIS A O    1 
ATOM   1754  C  CB   . HIS A  1 136 ? 87.054  106.004 68.201  1.00 17.30 ? 136 HIS A CB   1 
ATOM   1755  C  CG   . HIS A  1 136 ? 85.880  105.104 68.392  1.00 13.28 ? 136 HIS A CG   1 
ATOM   1756  N  ND1  . HIS A  1 136 ? 86.009  103.738 68.516  1.00 24.65 ? 136 HIS A ND1  1 
ATOM   1757  C  CD2  . HIS A  1 136 ? 84.557  105.367 68.491  1.00 15.79 ? 136 HIS A CD2  1 
ATOM   1758  C  CE1  . HIS A  1 136 ? 84.813  103.198 68.669  1.00 21.08 ? 136 HIS A CE1  1 
ATOM   1759  N  NE2  . HIS A  1 136 ? 83.914  104.164 68.656  1.00 22.99 ? 136 HIS A NE2  1 
ATOM   1760  H  H    . HIS A  1 136 ? 86.523  107.745 69.975  1.00 15.12 ? 136 HIS A H    1 
ATOM   1761  H  HA   . HIS A  1 136 ? 88.025  105.483 69.940  1.00 20.25 ? 136 HIS A HA   1 
ATOM   1762  H  HB2  . HIS A  1 136 ? 86.734  106.831 67.809  1.00 20.76 ? 136 HIS A HB2  1 
ATOM   1763  H  HB3  . HIS A  1 136 ? 87.668  105.566 67.591  1.00 20.76 ? 136 HIS A HB3  1 
ATOM   1764  H  HD1  . HIS A  1 136 ? 86.751  103.304 68.487  1.00 29.58 ? 136 HIS A HD1  1 
ATOM   1765  H  HD2  . HIS A  1 136 ? 84.156  106.205 68.443  1.00 18.95 ? 136 HIS A HD2  1 
ATOM   1766  H  HE1  . HIS A  1 136 ? 84.635  102.291 68.773  1.00 25.29 ? 136 HIS A HE1  1 
ATOM   1767  H  HE2  . HIS A  1 136 ? 83.066  104.058 68.745  1.00 27.58 ? 136 HIS A HE2  1 
ATOM   1768  N  N    . ASP A  1 137 ? 89.427  108.007 70.074  1.00 18.10 ? 137 ASP A N    1 
ATOM   1769  C  CA   . ASP A  1 137 ? 90.755  108.602 70.187  1.00 16.61 ? 137 ASP A CA   1 
ATOM   1770  C  C    . ASP A  1 137 ? 91.057  109.698 69.162  1.00 17.05 ? 137 ASP A C    1 
ATOM   1771  O  O    . ASP A  1 137 ? 92.200  110.124 69.022  1.00 14.36 ? 137 ASP A O    1 
ATOM   1772  C  CB   . ASP A  1 137 ? 91.838  107.515 70.168  1.00 27.86 ? 137 ASP A CB   1 
ATOM   1773  C  CG   . ASP A  1 137 ? 91.681  106.516 71.314  1.00 26.63 ? 137 ASP A CG   1 
ATOM   1774  O  OD1  . ASP A  1 137 ? 91.590  106.952 72.479  1.00 27.69 ? 137 ASP A OD1  1 
ATOM   1775  O  OD2  . ASP A  1 137 ? 91.617  105.305 71.048  1.00 28.43 ? 137 ASP A OD2  1 
ATOM   1776  H  H    . ASP A  1 137 ? 88.872  108.324 70.650  1.00 21.72 ? 137 ASP A H    1 
ATOM   1777  H  HA   . ASP A  1 137 ? 90.808  109.028 71.067  1.00 19.93 ? 137 ASP A HA   1 
ATOM   1778  H  HB2  . ASP A  1 137 ? 91.781  107.025 69.332  1.00 33.43 ? 137 ASP A HB2  1 
ATOM   1779  H  HB3  . ASP A  1 137 ? 92.709  107.933 70.250  1.00 33.43 ? 137 ASP A HB3  1 
ATOM   1780  N  N    . ILE A  1 138 ? 90.039  110.172 68.464  1.00 9.34  ? 138 ILE A N    1 
ATOM   1781  C  CA   . ILE A  1 138 ? 90.229  111.306 67.571  1.00 12.71 ? 138 ILE A CA   1 
ATOM   1782  C  C    . ILE A  1 138 ? 89.269  112.436 67.915  1.00 11.67 ? 138 ILE A C    1 
ATOM   1783  O  O    . ILE A  1 138 ? 88.077  112.215 68.120  1.00 10.27 ? 138 ILE A O    1 
ATOM   1784  C  CB   . ILE A  1 138 ? 90.055  110.895 66.113  1.00 9.99  ? 138 ILE A CB   1 
ATOM   1785  C  CG1  . ILE A  1 138 ? 91.259  110.082 65.651  1.00 18.81 ? 138 ILE A CG1  1 
ATOM   1786  C  CG2  . ILE A  1 138 ? 89.942  112.120 65.206  1.00 12.22 ? 138 ILE A CG2  1 
ATOM   1787  C  CD1  . ILE A  1 138 ? 90.885  108.997 64.679  1.00 26.40 ? 138 ILE A CD1  1 
ATOM   1788  H  H    . ILE A  1 138 ? 89.237  109.862 68.486  1.00 11.20 ? 138 ILE A H    1 
ATOM   1789  H  HA   . ILE A  1 138 ? 91.142  111.644 67.680  1.00 15.25 ? 138 ILE A HA   1 
ATOM   1790  H  HB   . ILE A  1 138 ? 89.253  110.357 66.026  1.00 11.99 ? 138 ILE A HB   1 
ATOM   1791  H  HG12 . ILE A  1 138 ? 91.892  110.673 65.214  1.00 22.57 ? 138 ILE A HG12 1 
ATOM   1792  H  HG13 . ILE A  1 138 ? 91.674  109.664 66.422  1.00 22.57 ? 138 ILE A HG13 1 
ATOM   1793  H  HG21 . ILE A  1 138 ? 89.833  111.828 64.298  1.00 14.67 ? 138 ILE A HG21 1 
ATOM   1794  H  HG22 . ILE A  1 138 ? 89.181  112.639 65.477  1.00 14.67 ? 138 ILE A HG22 1 
ATOM   1795  H  HG23 . ILE A  1 138 ? 90.742  112.645 65.289  1.00 14.67 ? 138 ILE A HG23 1 
ATOM   1796  H  HD11 . ILE A  1 138 ? 91.678  108.520 64.423  1.00 31.68 ? 138 ILE A HD11 1 
ATOM   1797  H  HD12 . ILE A  1 138 ? 90.264  108.400 65.101  1.00 31.68 ? 138 ILE A HD12 1 
ATOM   1798  H  HD13 . ILE A  1 138 ? 90.480  109.398 63.906  1.00 31.68 ? 138 ILE A HD13 1 
ATOM   1799  N  N    . HIS A  1 139 ? 89.785  113.656 67.924  1.00 8.92  ? 139 HIS A N    1 
ATOM   1800  C  CA   . HIS A  1 139 ? 88.947  114.789 68.238  1.00 8.16  ? 139 HIS A CA   1 
ATOM   1801  C  C    . HIS A  1 139 ? 88.858  115.853 67.145  1.00 12.55 ? 139 HIS A C    1 
ATOM   1802  O  O    . HIS A  1 139 ? 89.857  116.412 66.715  1.00 12.24 ? 139 HIS A O    1 
ATOM   1803  C  CB   . HIS A  1 139 ? 89.443  115.464 69.506  1.00 10.80 ? 139 HIS A CB   1 
ATOM   1804  C  CG   . HIS A  1 139 ? 88.628  116.646 69.882  1.00 11.06 ? 139 HIS A CG   1 
ATOM   1805  N  ND1  . HIS A  1 139 ? 87.274  116.559 70.122  1.00 13.60 ? 139 HIS A ND1  1 
ATOM   1806  C  CD2  . HIS A  1 139 ? 88.954  117.950 70.008  1.00 11.85 ? 139 HIS A CD2  1 
ATOM   1807  C  CE1  . HIS A  1 139 ? 86.807  117.761 70.397  1.00 12.39 ? 139 HIS A CE1  1 
ATOM   1808  N  NE2  . HIS A  1 139 ? 87.805  118.620 70.329  1.00 11.09 ? 139 HIS A NE2  1 
ATOM   1809  H  H    . HIS A  1 139 ? 90.606  113.848 67.755  1.00 10.71 ? 139 HIS A H    1 
ATOM   1810  H  HA   . HIS A  1 139 ? 88.038  114.466 68.411  1.00 9.80  ? 139 HIS A HA   1 
ATOM   1811  H  HB2  . HIS A  1 139 ? 89.406  114.829 70.238  1.00 12.96 ? 139 HIS A HB2  1 
ATOM   1812  H  HB3  . HIS A  1 139 ? 90.356  115.761 69.370  1.00 12.96 ? 139 HIS A HB3  1 
ATOM   1813  H  HD1  . HIS A  1 139 ? 86.809  115.836 70.099  1.00 16.32 ? 139 HIS A HD1  1 
ATOM   1814  H  HD2  . HIS A  1 139 ? 89.799  118.322 69.897  1.00 14.22 ? 139 HIS A HD2  1 
ATOM   1815  H  HE1  . HIS A  1 139 ? 85.924  117.967 70.605  1.00 14.87 ? 139 HIS A HE1  1 
ATOM   1816  H  HE2  . HIS A  1 139 ? 87.746  119.465 70.478  1.00 13.31 ? 139 HIS A HE2  1 
ATOM   1817  N  N    . ILE A  1 140 ? 87.629  116.149 66.739  1.00 10.19 ? 140 ILE A N    1 
ATOM   1818  C  CA   . ILE A  1 140 ? 87.370  117.205 65.784  1.00 7.53  ? 140 ILE A CA   1 
ATOM   1819  C  C    . ILE A  1 140 ? 87.457  118.553 66.488  1.00 11.93 ? 140 ILE A C    1 
ATOM   1820  O  O    . ILE A  1 140 ? 86.651  118.859 67.383  1.00 11.52 ? 140 ILE A O    1 
ATOM   1821  C  CB   . ILE A  1 140 ? 85.985  117.027 65.139  1.00 7.50  ? 140 ILE A CB   1 
ATOM   1822  C  CG1  . ILE A  1 140 ? 85.970  115.698 64.365  1.00 7.63  ? 140 ILE A CG1  1 
ATOM   1823  C  CG2  . ILE A  1 140 ? 85.668  118.204 64.206  1.00 14.39 ? 140 ILE A CG2  1 
ATOM   1824  C  CD1  . ILE A  1 140 ? 84.617  115.294 63.852  1.00 9.91  ? 140 ILE A CD1  1 
ATOM   1825  H  H    . ILE A  1 140 ? 86.920  115.744 67.010  1.00 12.23 ? 140 ILE A H    1 
ATOM   1826  H  HA   . ILE A  1 140 ? 88.048  117.179 65.076  1.00 9.03  ? 140 ILE A HA   1 
ATOM   1827  H  HB   . ILE A  1 140 ? 85.315  116.991 65.838  1.00 9.00  ? 140 ILE A HB   1 
ATOM   1828  H  HG12 . ILE A  1 140 ? 86.563  115.777 63.602  1.00 9.16  ? 140 ILE A HG12 1 
ATOM   1829  H  HG13 . ILE A  1 140 ? 86.286  114.994 64.953  1.00 9.16  ? 140 ILE A HG13 1 
ATOM   1830  H  HG21 . ILE A  1 140 ? 84.801  118.069 63.817  1.00 17.27 ? 140 ILE A HG21 1 
ATOM   1831  H  HG22 . ILE A  1 140 ? 85.676  119.017 64.716  1.00 17.27 ? 140 ILE A HG22 1 
ATOM   1832  H  HG23 . ILE A  1 140 ? 86.335  118.243 63.516  1.00 17.27 ? 140 ILE A HG23 1 
ATOM   1833  H  HD11 . ILE A  1 140 ? 84.697  114.459 63.385  1.00 11.89 ? 140 ILE A HD11 1 
ATOM   1834  H  HD12 . ILE A  1 140 ? 84.017  115.197 64.596  1.00 11.89 ? 140 ILE A HD12 1 
ATOM   1835  H  HD13 . ILE A  1 140 ? 84.292  115.973 63.257  1.00 11.89 ? 140 ILE A HD13 1 
ATOM   1836  N  N    . ILE A  1 141 ? 88.462  119.327 66.100  1.00 8.04  ? 141 ILE A N    1 
ATOM   1837  C  CA   . ILE A  1 141 ? 88.686  120.655 66.651  1.00 9.54  ? 141 ILE A CA   1 
ATOM   1838  C  C    . ILE A  1 141 ? 87.776  121.679 65.994  1.00 11.10 ? 141 ILE A C    1 
ATOM   1839  O  O    . ILE A  1 141 ? 87.214  122.560 66.662  1.00 9.68  ? 141 ILE A O    1 
ATOM   1840  C  CB   . ILE A  1 141 ? 90.152  121.048 66.456  1.00 11.82 ? 141 ILE A CB   1 
ATOM   1841  C  CG1  . ILE A  1 141 ? 91.047  120.087 67.248  1.00 11.65 ? 141 ILE A CG1  1 
ATOM   1842  C  CG2  . ILE A  1 141 ? 90.379  122.497 66.882  1.00 17.02 ? 141 ILE A CG2  1 
ATOM   1843  C  CD1  . ILE A  1 141 ? 92.516  120.167 66.895  1.00 13.50 ? 141 ILE A CD1  1 
ATOM   1844  H  H    . ILE A  1 141 ? 89.041  119.099 65.506  1.00 9.65  ? 141 ILE A H    1 
ATOM   1845  H  HA   . ILE A  1 141 ? 88.494  120.644 67.612  1.00 11.44 ? 141 ILE A HA   1 
ATOM   1846  H  HB   . ILE A  1 141 ? 90.370  120.967 65.514  1.00 14.18 ? 141 ILE A HB   1 
ATOM   1847  H  HG12 . ILE A  1 141 ? 90.959  120.289 68.192  1.00 13.98 ? 141 ILE A HG12 1 
ATOM   1848  H  HG13 . ILE A  1 141 ? 90.752  119.179 67.079  1.00 13.98 ? 141 ILE A HG13 1 
ATOM   1849  H  HG21 . ILE A  1 141 ? 91.303  122.720 66.751  1.00 20.43 ? 141 ILE A HG21 1 
ATOM   1850  H  HG22 . ILE A  1 141 ? 89.824  123.070 66.348  1.00 20.43 ? 141 ILE A HG22 1 
ATOM   1851  H  HG23 . ILE A  1 141 ? 90.148  122.589 67.810  1.00 20.43 ? 141 ILE A HG23 1 
ATOM   1852  H  HD11 . ILE A  1 141 ? 93.001  119.537 67.433  1.00 16.20 ? 141 ILE A HD11 1 
ATOM   1853  H  HD12 . ILE A  1 141 ? 92.625  119.956 65.964  1.00 16.20 ? 141 ILE A HD12 1 
ATOM   1854  H  HD13 . ILE A  1 141 ? 92.831  121.057 67.068  1.00 16.20 ? 141 ILE A HD13 1 
ATOM   1855  N  N    . VAL A  1 142 ? 87.660  121.574 64.674  1.00 7.59  ? 142 VAL A N    1 
ATOM   1856  C  CA   . VAL A  1 142 ? 86.838  122.485 63.896  1.00 9.98  ? 142 VAL A CA   1 
ATOM   1857  C  C    . VAL A  1 142 ? 86.177  121.690 62.767  1.00 8.20  ? 142 VAL A C    1 
ATOM   1858  O  O    . VAL A  1 142 ? 86.834  120.964 62.039  1.00 9.42  ? 142 VAL A O    1 
ATOM   1859  C  CB   . VAL A  1 142 ? 87.664  123.719 63.362  1.00 16.75 ? 142 VAL A CB   1 
ATOM   1860  C  CG1  . VAL A  1 142 ? 88.873  123.283 62.549  1.00 19.65 ? 142 VAL A CG1  1 
ATOM   1861  C  CG2  . VAL A  1 142 ? 86.788  124.640 62.552  1.00 8.89  ? 142 VAL A CG2  1 
ATOM   1862  H  H    . VAL A  1 142 ? 88.054  120.973 64.202  1.00 9.11  ? 142 VAL A H    1 
ATOM   1863  H  HA   . VAL A  1 142 ? 86.125  122.833 64.471  1.00 11.98 ? 142 VAL A HA   1 
ATOM   1864  H  HB   . VAL A  1 142 ? 87.994  124.228 64.132  1.00 20.10 ? 142 VAL A HB   1 
ATOM   1865  H  HG11 . VAL A  1 142 ? 89.343  124.064 62.246  1.00 23.58 ? 142 VAL A HG11 1 
ATOM   1866  H  HG12 . VAL A  1 142 ? 89.446  122.750 63.104  1.00 23.58 ? 142 VAL A HG12 1 
ATOM   1867  H  HG13 . VAL A  1 142 ? 88.573  122.769 61.796  1.00 23.58 ? 142 VAL A HG13 1 
ATOM   1868  H  HG21 . VAL A  1 142 ? 87.316  125.379 62.242  1.00 10.67 ? 142 VAL A HG21 1 
ATOM   1869  H  HG22 . VAL A  1 142 ? 86.432  124.155 61.804  1.00 10.67 ? 142 VAL A HG22 1 
ATOM   1870  H  HG23 . VAL A  1 142 ? 86.073  124.959 63.107  1.00 10.67 ? 142 VAL A HG23 1 
ATOM   1871  N  N    . PRO A  1 143 ? 84.852  121.795 62.650  1.00 9.70  ? 143 PRO A N    1 
ATOM   1872  C  CA   . PRO A  1 143 ? 84.166  120.870 61.758  1.00 7.08  ? 143 PRO A CA   1 
ATOM   1873  C  C    . PRO A  1 143 ? 83.793  121.381 60.392  1.00 7.04  ? 143 PRO A C    1 
ATOM   1874  O  O    . PRO A  1 143 ? 83.468  120.538 59.545  1.00 11.18 ? 143 PRO A O    1 
ATOM   1875  C  CB   . PRO A  1 143 ? 82.856  120.606 62.490  1.00 9.77  ? 143 PRO A CB   1 
ATOM   1876  C  CG   . PRO A  1 143 ? 82.586  121.908 63.215  1.00 8.72  ? 143 PRO A CG   1 
ATOM   1877  C  CD   . PRO A  1 143 ? 83.941  122.385 63.646  1.00 10.94 ? 143 PRO A CD   1 
ATOM   1878  H  HA   . PRO A  1 143 ? 84.669  120.034 61.672  1.00 8.49  ? 143 PRO A HA   1 
ATOM   1879  H  HB2  . PRO A  1 143 ? 82.153  120.411 61.852  1.00 11.73 ? 143 PRO A HB2  1 
ATOM   1880  H  HB3  . PRO A  1 143 ? 82.970  119.875 63.119  1.00 11.73 ? 143 PRO A HB3  1 
ATOM   1881  H  HG2  . PRO A  1 143 ? 82.174  122.542 62.608  1.00 10.47 ? 143 PRO A HG2  1 
ATOM   1882  H  HG3  . PRO A  1 143 ? 82.017  121.745 63.983  1.00 10.47 ? 143 PRO A HG3  1 
ATOM   1883  H  HD2  . PRO A  1 143 ? 83.985  123.354 63.610  1.00 13.13 ? 143 PRO A HD2  1 
ATOM   1884  H  HD3  . PRO A  1 143 ? 84.150  122.053 64.533  1.00 13.13 ? 143 PRO A HD3  1 
ATOM   1885  N  N    . ASP A  1 144 ? 83.822  122.692 60.178  1.00 8.03  ? 144 ASP A N    1 
ATOM   1886  C  CA   . ASP A  1 144 ? 83.112  123.265 59.059  1.00 9.59  ? 144 ASP A CA   1 
ATOM   1887  C  C    . ASP A  1 144 ? 83.975  124.177 58.190  1.00 10.78 ? 144 ASP A C    1 
ATOM   1888  O  O    . ASP A  1 144 ? 83.531  125.234 57.775  1.00 11.63 ? 144 ASP A O    1 
ATOM   1889  C  CB   . ASP A  1 144 ? 81.865  124.000 59.551  1.00 8.66  ? 144 ASP A CB   1 
ATOM   1890  C  CG   . ASP A  1 144 ? 82.172  125.049 60.621  1.00 13.44 ? 144 ASP A CG   1 
ATOM   1891  O  OD1  . ASP A  1 144 ? 83.243  124.985 61.290  1.00 12.63 ? 144 ASP A OD1  1 
ATOM   1892  O  OD2  . ASP A  1 144 ? 81.310  125.921 60.789  1.00 15.64 ? 144 ASP A OD2  1 
ATOM   1893  H  H    . ASP A  1 144 ? 84.243  123.262 60.665  1.00 9.64  ? 144 ASP A H    1 
ATOM   1894  H  HA   . ASP A  1 144 ? 82.807  122.530 58.487  1.00 11.51 ? 144 ASP A HA   1 
ATOM   1895  H  HB2  . ASP A  1 144 ? 81.448  124.451 58.800  1.00 10.39 ? 144 ASP A HB2  1 
ATOM   1896  H  HB3  . ASP A  1 144 ? 81.249  123.354 59.932  1.00 10.39 ? 144 ASP A HB3  1 
ATOM   1897  N  N    . VAL A  1 145 ? 85.202  123.762 57.909  1.00 7.02  ? 145 VAL A N    1 
ATOM   1898  C  CA   . VAL A  1 145 ? 85.995  124.464 56.905  1.00 7.49  ? 145 VAL A CA   1 
ATOM   1899  C  C    . VAL A  1 145 ? 85.433  124.209 55.506  1.00 7.94  ? 145 VAL A C    1 
ATOM   1900  O  O    . VAL A  1 145 ? 85.328  123.050 55.045  1.00 9.08  ? 145 VAL A O    1 
ATOM   1901  C  CB   . VAL A  1 145 ? 87.490  124.050 57.006  1.00 7.57  ? 145 VAL A CB   1 
ATOM   1902  C  CG1  . VAL A  1 145 ? 88.334  124.748 55.951  1.00 14.93 ? 145 VAL A CG1  1 
ATOM   1903  C  CG2  . VAL A  1 145 ? 88.008  124.373 58.392  1.00 12.74 ? 145 VAL A CG2  1 
ATOM   1904  H  H    . VAL A  1 145 ? 85.595  123.091 58.276  1.00 8.42  ? 145 VAL A H    1 
ATOM   1905  H  HA   . VAL A  1 145 ? 85.940  125.427 57.077  1.00 8.98  ? 145 VAL A HA   1 
ATOM   1906  H  HB   . VAL A  1 145 ? 87.567  123.083 56.869  1.00 9.08  ? 145 VAL A HB   1 
ATOM   1907  H  HG11 . VAL A  1 145 ? 89.247  124.468 56.046  1.00 17.92 ? 145 VAL A HG11 1 
ATOM   1908  H  HG12 . VAL A  1 145 ? 88.006  124.509 55.081  1.00 17.92 ? 145 VAL A HG12 1 
ATOM   1909  H  HG13 . VAL A  1 145 ? 88.267  125.698 56.076  1.00 17.92 ? 145 VAL A HG13 1 
ATOM   1910  H  HG21 . VAL A  1 145 ? 88.931  124.115 58.449  1.00 15.29 ? 145 VAL A HG21 1 
ATOM   1911  H  HG22 . VAL A  1 145 ? 87.920  125.316 58.546  1.00 15.29 ? 145 VAL A HG22 1 
ATOM   1912  H  HG23 . VAL A  1 145 ? 87.491  123.886 59.039  1.00 15.29 ? 145 VAL A HG23 1 
ATOM   1913  N  N    . ILE A  1 146 ? 85.105  125.276 54.773  1.00 7.59  ? 146 ILE A N    1 
ATOM   1914  C  CA   . ILE A  1 146 ? 84.667  125.094 53.382  1.00 9.79  ? 146 ILE A CA   1 
ATOM   1915  C  C    . ILE A  1 146 ? 85.850  124.690 52.501  1.00 8.41  ? 146 ILE A C    1 
ATOM   1916  O  O    . ILE A  1 146 ? 86.814  125.438 52.352  1.00 9.87  ? 146 ILE A O    1 
ATOM   1917  C  CB   . ILE A  1 146 ? 84.008  126.350 52.816  1.00 11.28 ? 146 ILE A CB   1 
ATOM   1918  C  CG1  . ILE A  1 146 ? 82.769  126.695 53.641  1.00 14.78 ? 146 ILE A CG1  1 
ATOM   1919  C  CG2  . ILE A  1 146 ? 83.654  126.133 51.344  1.00 10.68 ? 146 ILE A CG2  1 
ATOM   1920  C  CD1  . ILE A  1 146 ? 82.212  128.092 53.401  1.00 12.89 ? 146 ILE A CD1  1 
ATOM   1921  H  H    . ILE A  1 146 ? 85.124  126.092 55.045  1.00 9.10  ? 146 ILE A H    1 
ATOM   1922  H  HA   . ILE A  1 146 ? 84.008  124.369 53.351  1.00 11.75 ? 146 ILE A HA   1 
ATOM   1923  H  HB   . ILE A  1 146 ? 84.637  127.085 52.879  1.00 13.54 ? 146 ILE A HB   1 
ATOM   1924  H  HG12 . ILE A  1 146 ? 82.069  126.059 53.428  1.00 17.74 ? 146 ILE A HG12 1 
ATOM   1925  H  HG13 . ILE A  1 146 ? 82.996  126.627 54.582  1.00 17.74 ? 146 ILE A HG13 1 
ATOM   1926  H  HG21 . ILE A  1 146 ? 83.241  126.930 51.002  1.00 12.81 ? 146 ILE A HG21 1 
ATOM   1927  H  HG22 . ILE A  1 146 ? 84.458  125.945 50.854  1.00 12.81 ? 146 ILE A HG22 1 
ATOM   1928  H  HG23 . ILE A  1 146 ? 83.046  125.393 51.275  1.00 12.81 ? 146 ILE A HG23 1 
ATOM   1929  H  HD11 . ILE A  1 146 ? 81.440  128.220 53.958  1.00 15.47 ? 146 ILE A HD11 1 
ATOM   1930  H  HD12 . ILE A  1 146 ? 82.886  128.739 53.621  1.00 15.47 ? 146 ILE A HD12 1 
ATOM   1931  H  HD13 . ILE A  1 146 ? 81.966  128.176 52.477  1.00 15.47 ? 146 ILE A HD13 1 
ATOM   1932  N  N    . TYR A  1 147 ? 85.769  123.500 51.911  1.00 6.89  ? 147 TYR A N    1 
ATOM   1933  C  CA   . TYR A  1 147 ? 86.846  122.993 51.071  1.00 8.54  ? 147 TYR A CA   1 
ATOM   1934  C  C    . TYR A  1 147 ? 86.569  123.317 49.614  1.00 9.05  ? 147 TYR A C    1 
ATOM   1935  O  O    . TYR A  1 147 ? 87.500  123.548 48.838  1.00 7.56  ? 147 TYR A O    1 
ATOM   1936  C  CB   . TYR A  1 147 ? 86.997  121.467 51.249  1.00 6.86  ? 147 TYR A CB   1 
ATOM   1937  C  CG   . TYR A  1 147 ? 88.285  120.887 50.742  1.00 6.88  ? 147 TYR A CG   1 
ATOM   1938  C  CD1  . TYR A  1 147 ? 89.470  121.126 51.398  1.00 8.12  ? 147 TYR A CD1  1 
ATOM   1939  C  CD2  . TYR A  1 147 ? 88.324  120.113 49.576  1.00 8.01  ? 147 TYR A CD2  1 
ATOM   1940  C  CE1  . TYR A  1 147 ? 90.653  120.603 50.962  1.00 6.98  ? 147 TYR A CE1  1 
ATOM   1941  C  CE2  . TYR A  1 147 ? 89.510  119.609 49.107  1.00 7.02  ? 147 TYR A CE2  1 
ATOM   1942  C  CZ   . TYR A  1 147 ? 90.664  119.846 49.795  1.00 7.04  ? 147 TYR A CZ   1 
ATOM   1943  O  OH   . TYR A  1 147 ? 91.849  119.335 49.351  1.00 7.17  ? 147 TYR A OH   1 
ATOM   1944  H  H    . TYR A  1 147 ? 85.098  122.966 51.982  1.00 8.27  ? 147 TYR A H    1 
ATOM   1945  H  HA   . TYR A  1 147 ? 87.690  123.420 51.328  1.00 10.25 ? 147 TYR A HA   1 
ATOM   1946  H  HB2  . TYR A  1 147 ? 86.937  121.260 52.195  1.00 8.23  ? 147 TYR A HB2  1 
ATOM   1947  H  HB3  . TYR A  1 147 ? 86.273  121.029 50.774  1.00 8.23  ? 147 TYR A HB3  1 
ATOM   1948  H  HD1  . TYR A  1 147 ? 89.460  121.632 52.179  1.00 9.74  ? 147 TYR A HD1  1 
ATOM   1949  H  HD2  . TYR A  1 147 ? 87.538  119.951 49.106  1.00 9.61  ? 147 TYR A HD2  1 
ATOM   1950  H  HE1  . TYR A  1 147 ? 91.443  120.775 51.422  1.00 8.37  ? 147 TYR A HE1  1 
ATOM   1951  H  HE2  . TYR A  1 147 ? 89.525  119.088 48.336  1.00 8.42  ? 147 TYR A HE2  1 
ATOM   1952  H  HH   . TYR A  1 147 ? 92.169  118.837 49.918  1.00 8.61  ? 147 TYR A HH   1 
ATOM   1953  N  N    . GLY A  1 148 ? 85.287  123.318 49.250  1.00 11.32 ? 148 GLY A N    1 
ATOM   1954  C  CA   . GLY A  1 148 ? 84.856  123.708 47.918  1.00 8.62  ? 148 GLY A CA   1 
ATOM   1955  C  C    . GLY A  1 148 ? 83.930  122.698 47.261  1.00 8.65  ? 148 GLY A C    1 
ATOM   1956  O  O    . GLY A  1 148 ? 83.626  121.653 47.845  1.00 8.15  ? 148 GLY A O    1 
ATOM   1957  H  H    . GLY A  1 148 ? 84.640  123.091 49.769  1.00 13.58 ? 148 GLY A H    1 
ATOM   1958  H  HA2  . GLY A  1 148 ? 84.391  124.558 47.969  1.00 10.34 ? 148 GLY A HA2  1 
ATOM   1959  H  HA3  . GLY A  1 148 ? 85.634  123.820 47.351  1.00 10.34 ? 148 GLY A HA3  1 
ATOM   1960  N  N    . THR A  1 149 ? 83.497  122.985 46.028  1.00 10.69 ? 149 THR A N    1 
ATOM   1961  C  CA   . THR A  1 149 ? 82.639  122.065 45.285  1.00 9.76  ? 149 THR A CA   1 
ATOM   1962  C  C    . THR A  1 149 ? 83.460  121.115 44.430  1.00 10.02 ? 149 THR A C    1 
ATOM   1963  O  O    . THR A  1 149 ? 84.215  121.556 43.554  1.00 8.87  ? 149 THR A O    1 
ATOM   1964  C  CB   . THR A  1 149 ? 81.663  122.850 44.368  1.00 14.80 ? 149 THR A CB   1 
ATOM   1965  O  OG1  . THR A  1 149 ? 80.735  123.599 45.165  1.00 12.79 ? 149 THR A OG1  1 
ATOM   1966  C  CG2  . THR A  1 149 ? 80.867  121.903 43.481  1.00 15.94 ? 149 THR A CG2  1 
ATOM   1967  H  H    . THR A  1 149 ? 83.688  123.707 45.601  1.00 12.83 ? 149 THR A H    1 
ATOM   1968  H  HA   . THR A  1 149 ? 82.110  121.534 45.916  1.00 11.71 ? 149 THR A HA   1 
ATOM   1969  H  HB   . THR A  1 149 ? 82.166  123.455 43.801  1.00 17.76 ? 149 THR A HB   1 
ATOM   1970  H  HG1  . THR A  1 149 ? 81.139  124.131 45.640  1.00 15.35 ? 149 THR A HG1  1 
ATOM   1971  H  HG21 . THR A  1 149 ? 80.270  122.404 42.921  1.00 19.12 ? 149 THR A HG21 1 
ATOM   1972  H  HG22 . THR A  1 149 ? 81.464  121.396 42.925  1.00 19.12 ? 149 THR A HG22 1 
ATOM   1973  H  HG23 . THR A  1 149 ? 80.355  121.299 44.022  1.00 19.12 ? 149 THR A HG23 1 
ATOM   1974  N  N    . ARG A  1 150 ? 83.313  119.807 44.676  1.00 7.77  ? 150 ARG A N    1 
ATOM   1975  C  CA   . ARG A  1 150 ? 84.109  118.799 43.967  1.00 7.67  ? 150 ARG A CA   1 
ATOM   1976  C  C    . ARG A  1 150 ? 83.536  118.543 42.595  1.00 8.09  ? 150 ARG A C    1 
ATOM   1977  O  O    . ARG A  1 150 ? 82.327  118.382 42.458  1.00 7.86  ? 150 ARG A O    1 
ATOM   1978  C  CB   . ARG A  1 150 ? 84.117  117.490 44.774  1.00 9.35  ? 150 ARG A CB   1 
ATOM   1979  C  CG   . ARG A  1 150 ? 84.697  117.688 46.179  1.00 7.39  ? 150 ARG A CG   1 
ATOM   1980  C  CD   . ARG A  1 150 ? 84.845  116.335 46.910  1.00 7.50  ? 150 ARG A CD   1 
ATOM   1981  N  NE   . ARG A  1 150 ? 86.044  115.625 46.500  1.00 7.66  ? 150 ARG A NE   1 
ATOM   1982  C  CZ   . ARG A  1 150 ? 87.214  115.711 47.123  1.00 7.47  ? 150 ARG A CZ   1 
ATOM   1983  N  NH1  . ARG A  1 150 ? 87.353  116.486 48.201  1.00 12.67 ? 150 ARG A NH1  1 
ATOM   1984  N  NH2  . ARG A  1 150 ? 88.253  115.036 46.662  1.00 7.88  ? 150 ARG A NH2  1 
ATOM   1985  H  H    . ARG A  1 150 ? 82.760  119.479 45.247  1.00 9.33  ? 150 ARG A H    1 
ATOM   1986  H  HA   . ARG A  1 150 ? 85.032  119.115 43.870  1.00 9.21  ? 150 ARG A HA   1 
ATOM   1987  H  HB2  . ARG A  1 150 ? 83.207  117.166 44.865  1.00 11.22 ? 150 ARG A HB2  1 
ATOM   1988  H  HB3  . ARG A  1 150 ? 84.662  116.834 44.312  1.00 11.22 ? 150 ARG A HB3  1 
ATOM   1989  H  HG2  . ARG A  1 150 ? 85.574  118.097 46.110  1.00 8.87  ? 150 ARG A HG2  1 
ATOM   1990  H  HG3  . ARG A  1 150 ? 84.101  118.252 46.696  1.00 8.87  ? 150 ARG A HG3  1 
ATOM   1991  H  HD2  . ARG A  1 150 ? 84.898  116.493 47.866  1.00 9.00  ? 150 ARG A HD2  1 
ATOM   1992  H  HD3  . ARG A  1 150 ? 84.078  115.777 46.706  1.00 9.00  ? 150 ARG A HD3  1 
ATOM   1993  H  HE   . ARG A  1 150 ? 85.994  115.117 45.808  1.00 9.19  ? 150 ARG A HE   1 
ATOM   1994  H  HH11 . ARG A  1 150 ? 86.681  116.930 48.501  1.00 15.20 ? 150 ARG A HH11 1 
ATOM   1995  H  HH12 . ARG A  1 150 ? 88.114  116.536 48.599  1.00 15.20 ? 150 ARG A HH12 1 
ATOM   1996  H  HH21 . ARG A  1 150 ? 88.167  114.536 45.968  1.00 9.46  ? 150 ARG A HH21 1 
ATOM   1997  H  HH22 . ARG A  1 150 ? 89.011  115.087 47.064  1.00 9.46  ? 150 ARG A HH22 1 
ATOM   1998  N  N    . HIS A  1 151 ? 84.417  118.540 41.590  1.00 12.09 ? 151 HIS A N    1 
ATOM   1999  C  CA   . HIS A  1 151 ? 84.086  118.231 40.185  1.00 8.81  ? 151 HIS A CA   1 
ATOM   2000  C  C    . HIS A  1 151 ? 85.035  117.162 39.648  1.00 7.97  ? 151 HIS A C    1 
ATOM   2001  O  O    . HIS A  1 151 ? 86.167  117.037 40.099  1.00 11.42 ? 151 HIS A O    1 
ATOM   2002  C  CB   . HIS A  1 151 ? 84.269  119.446 39.266  1.00 7.88  ? 151 HIS A CB   1 
ATOM   2003  C  CG   . HIS A  1 151 ? 83.457  120.650 39.635  1.00 7.88  ? 151 HIS A CG   1 
ATOM   2004  N  ND1  . HIS A  1 151 ? 82.087  120.706 39.492  1.00 10.36 ? 151 HIS A ND1  1 
ATOM   2005  C  CD2  . HIS A  1 151 ? 83.837  121.868 40.079  1.00 7.77  ? 151 HIS A CD2  1 
ATOM   2006  C  CE1  . HIS A  1 151 ? 81.656  121.898 39.862  1.00 8.12  ? 151 HIS A CE1  1 
ATOM   2007  N  NE2  . HIS A  1 151 ? 82.700  122.616 40.233  1.00 9.39  ? 151 HIS A NE2  1 
ATOM   2008  H  H    . HIS A  1 151 ? 85.251  118.722 41.700  1.00 14.51 ? 151 HIS A H    1 
ATOM   2009  H  HA   . HIS A  1 151 ? 83.163  117.909 40.117  1.00 10.57 ? 151 HIS A HA   1 
ATOM   2010  H  HB2  . HIS A  1 151 ? 85.203  119.708 39.282  1.00 9.46  ? 151 HIS A HB2  1 
ATOM   2011  H  HB3  . HIS A  1 151 ? 84.019  119.191 38.364  1.00 9.46  ? 151 HIS A HB3  1 
ATOM   2012  H  HD1  . HIS A  1 151 ? 81.589  120.062 39.214  1.00 12.43 ? 151 HIS A HD1  1 
ATOM   2013  H  HD2  . HIS A  1 151 ? 84.705  122.138 40.271  1.00 9.33  ? 151 HIS A HD2  1 
ATOM   2014  H  HE1  . HIS A  1 151 ? 80.770  122.179 39.872  1.00 9.74  ? 151 HIS A HE1  1 
ATOM   2015  H  HE2  . HIS A  1 151 ? 82.672  123.429 40.513  1.00 11.27 ? 151 HIS A HE2  1 
ATOM   2016  N  N    . LEU A  1 152 ? 84.606  116.425 38.628  1.00 10.95 ? 152 LEU A N    1 
ATOM   2017  C  CA   . LEU A  1 152 ? 85.510  115.509 37.925  1.00 8.33  ? 152 LEU A CA   1 
ATOM   2018  C  C    . LEU A  1 152 ? 86.544  116.243 37.061  1.00 10.86 ? 152 LEU A C    1 
ATOM   2019  O  O    . LEU A  1 152 ? 86.215  117.225 36.384  1.00 12.67 ? 152 LEU A O    1 
ATOM   2020  C  CB   . LEU A  1 152 ? 84.725  114.577 37.012  1.00 9.93  ? 152 LEU A CB   1 
ATOM   2021  C  CG   . LEU A  1 152 ? 83.706  113.625 37.594  1.00 17.21 ? 152 LEU A CG   1 
ATOM   2022  C  CD1  . LEU A  1 152 ? 82.977  112.949 36.458  1.00 16.43 ? 152 LEU A CD1  1 
ATOM   2023  C  CD2  . LEU A  1 152 ? 84.397  112.636 38.480  1.00 13.79 ? 152 LEU A CD2  1 
ATOM   2024  H  H    . LEU A  1 152 ? 83.802  116.433 38.323  1.00 13.13 ? 152 LEU A H    1 
ATOM   2025  H  HA   . LEU A  1 152 ? 85.991  114.963 38.582  1.00 10.00 ? 152 LEU A HA   1 
ATOM   2026  H  HB2  . LEU A  1 152 ? 84.250  115.129 36.372  1.00 11.91 ? 152 LEU A HB2  1 
ATOM   2027  H  HB3  . LEU A  1 152 ? 85.368  114.030 36.534  1.00 11.91 ? 152 LEU A HB3  1 
ATOM   2028  H  HG   . LEU A  1 152 ? 83.063  114.121 38.124  1.00 20.65 ? 152 LEU A HG   1 
ATOM   2029  H  HD11 . LEU A  1 152 ? 82.328  112.342 36.821  1.00 19.72 ? 152 LEU A HD11 1 
ATOM   2030  H  HD12 . LEU A  1 152 ? 82.540  113.617 35.925  1.00 19.72 ? 152 LEU A HD12 1 
ATOM   2031  H  HD13 . LEU A  1 152 ? 83.612  112.467 35.923  1.00 19.72 ? 152 LEU A HD13 1 
ATOM   2032  H  HD21 . LEU A  1 152 ? 83.744  112.035 38.846  1.00 16.55 ? 152 LEU A HD21 1 
ATOM   2033  H  HD22 . LEU A  1 152 ? 85.039  112.147 37.960  1.00 16.55 ? 152 LEU A HD22 1 
ATOM   2034  H  HD23 . LEU A  1 152 ? 84.842  113.109 39.188  1.00 16.55 ? 152 LEU A HD23 1 
ATOM   2035  N  N    . LEU A  1 153 ? 87.788  115.773 37.079  1.00 13.28 ? 153 LEU A N    1 
ATOM   2036  C  CA   . LEU A  1 153 ? 88.780  116.210 36.075  1.00 10.39 ? 153 LEU A CA   1 
ATOM   2037  C  C    . LEU A  1 153 ? 89.306  114.962 35.373  1.00 10.44 ? 153 LEU A C    1 
ATOM   2038  O  O    . LEU A  1 153 ? 89.868  114.079 36.011  1.00 9.64  ? 153 LEU A O    1 
ATOM   2039  C  CB   . LEU A  1 153 ? 89.924  117.000 36.724  1.00 10.77 ? 153 LEU A CB   1 
ATOM   2040  C  CG   . LEU A  1 153 ? 90.921  117.576 35.723  1.00 10.34 ? 153 LEU A CG   1 
ATOM   2041  C  CD1  . LEU A  1 153 ? 90.332  118.763 35.024  1.00 15.83 ? 153 LEU A CD1  1 
ATOM   2042  C  CD2  . LEU A  1 153 ? 92.249  117.923 36.367  1.00 10.52 ? 153 LEU A CD2  1 
ATOM   2043  H  H    . LEU A  1 153 ? 88.088  115.206 37.652  1.00 15.94 ? 153 LEU A H    1 
ATOM   2044  H  HA   . LEU A  1 153 ? 88.344  116.782 35.410  1.00 12.46 ? 153 LEU A HA   1 
ATOM   2045  H  HB2  . LEU A  1 153 ? 89.547  117.740 37.226  1.00 12.92 ? 153 LEU A HB2  1 
ATOM   2046  H  HB3  . LEU A  1 153 ? 90.411  116.412 37.322  1.00 12.92 ? 153 LEU A HB3  1 
ATOM   2047  H  HG   . LEU A  1 153 ? 91.097  116.903 35.047  1.00 12.41 ? 153 LEU A HG   1 
ATOM   2048  H  HD11 . LEU A  1 153 ? 90.974  119.109 34.400  1.00 19.00 ? 153 LEU A HD11 1 
ATOM   2049  H  HD12 . LEU A  1 153 ? 89.538  118.489 34.559  1.00 19.00 ? 153 LEU A HD12 1 
ATOM   2050  H  HD13 . LEU A  1 153 ? 90.115  119.433 35.676  1.00 19.00 ? 153 LEU A HD13 1 
ATOM   2051  H  HD21 . LEU A  1 153 ? 92.837  118.280 35.698  1.00 12.63 ? 153 LEU A HD21 1 
ATOM   2052  H  HD22 . LEU A  1 153 ? 92.100  118.576 37.055  1.00 12.63 ? 153 LEU A HD22 1 
ATOM   2053  H  HD23 . LEU A  1 153 ? 92.629  117.128 36.747  1.00 12.63 ? 153 LEU A HD23 1 
ATOM   2054  N  N    . THR A  1 154 ? 89.119  114.875 34.061  1.00 8.80  ? 154 THR A N    1 
ATOM   2055  C  CA   . THR A  1 154 ? 89.376  113.614 33.379  1.00 9.12  ? 154 THR A CA   1 
ATOM   2056  C  C    . THR A  1 154 ? 90.096  113.865 32.077  1.00 9.27  ? 154 THR A C    1 
ATOM   2057  O  O    . THR A  1 154 ? 90.165  114.991 31.607  1.00 9.23  ? 154 THR A O    1 
ATOM   2058  C  CB   . THR A  1 154 ? 88.075  112.863 33.069  1.00 9.32  ? 154 THR A CB   1 
ATOM   2059  O  OG1  . THR A  1 154 ? 87.204  113.729 32.343  1.00 13.32 ? 154 THR A OG1  1 
ATOM   2060  C  CG2  . THR A  1 154 ? 87.380  112.411 34.339  1.00 15.82 ? 154 THR A CG2  1 
ATOM   2061  H  H    . THR A  1 154 ? 88.850  115.515 33.554  1.00 10.56 ? 154 THR A H    1 
ATOM   2062  H  HA   . THR A  1 154 ? 89.939  113.045 33.944  1.00 10.95 ? 154 THR A HA   1 
ATOM   2063  H  HB   . THR A  1 154 ? 88.274  112.080 32.532  1.00 11.18 ? 154 THR A HB   1 
ATOM   2064  H  HG1  . THR A  1 154 ? 86.503  113.340 32.169  1.00 15.98 ? 154 THR A HG1  1 
ATOM   2065  H  HG21 . THR A  1 154 ? 86.570  111.943 34.122  1.00 18.99 ? 154 THR A HG21 1 
ATOM   2066  H  HG22 . THR A  1 154 ? 87.955  111.824 34.836  1.00 18.99 ? 154 THR A HG22 1 
ATOM   2067  H  HG23 . THR A  1 154 ? 87.165  113.171 34.884  1.00 18.99 ? 154 THR A HG23 1 
ATOM   2068  N  N    . LYS A  1 155 ? 90.653  112.793 31.525  1.00 9.62  ? 155 LYS A N    1 
ATOM   2069  C  CA   . LYS A  1 155 ? 91.389  112.896 30.260  1.00 14.98 ? 155 LYS A CA   1 
ATOM   2070  C  C    . LYS A  1 155 ? 90.446  113.087 29.085  1.00 13.59 ? 155 LYS A C    1 
ATOM   2071  O  O    . LYS A  1 155 ? 90.768  113.811 28.139  1.00 11.75 ? 155 LYS A O    1 
ATOM   2072  C  CB   . LYS A  1 155 ? 92.271  111.671 30.061  1.00 10.71 ? 155 LYS A CB   1 
ATOM   2073  C  CG   . LYS A  1 155 ? 93.543  111.750 30.908  1.00 11.17 ? 155 LYS A CG   1 
ATOM   2074  C  CD   . LYS A  1 155 ? 94.470  110.589 30.671  1.00 16.24 ? 155 LYS A CD   1 
ATOM   2075  C  CE   . LYS A  1 155 ? 95.673  110.662 31.607  1.00 27.45 ? 155 LYS A CE   1 
ATOM   2076  N  NZ   . LYS A  1 155 ? 96.564  109.479 31.490  1.00 35.32 ? 155 LYS A NZ   1 
ATOM   2077  H  H    . LYS A  1 155 ? 90.623  112.000 31.855  1.00 11.55 ? 155 LYS A H    1 
ATOM   2078  H  HA   . LYS A  1 155 ? 91.975  113.680 30.301  1.00 17.98 ? 155 LYS A HA   1 
ATOM   2079  H  HB2  . LYS A  1 155 ? 91.780  110.877 30.324  1.00 12.86 ? 155 LYS A HB2  1 
ATOM   2080  H  HB3  . LYS A  1 155 ? 92.530  111.612 29.128  1.00 12.86 ? 155 LYS A HB3  1 
ATOM   2081  H  HG2  . LYS A  1 155 ? 94.020  112.565 30.687  1.00 13.41 ? 155 LYS A HG2  1 
ATOM   2082  H  HG3  . LYS A  1 155 ? 93.298  111.752 31.847  1.00 13.41 ? 155 LYS A HG3  1 
ATOM   2083  H  HD2  . LYS A  1 155 ? 93.998  109.759 30.842  1.00 19.48 ? 155 LYS A HD2  1 
ATOM   2084  H  HD3  . LYS A  1 155 ? 94.791  110.614 29.756  1.00 19.48 ? 155 LYS A HD3  1 
ATOM   2085  H  HE2  . LYS A  1 155 ? 96.193  111.452 31.393  1.00 32.94 ? 155 LYS A HE2  1 
ATOM   2086  H  HE3  . LYS A  1 155 ? 95.358  110.711 32.524  1.00 32.94 ? 155 LYS A HE3  1 
ATOM   2087  H  HZ1  . LYS A  1 155 ? 97.251  109.559 32.050  1.00 42.39 ? 155 LYS A HZ1  1 
ATOM   2088  H  HZ2  . LYS A  1 155 ? 96.114  108.738 31.690  1.00 42.39 ? 155 LYS A HZ2  1 
ATOM   2089  H  HZ3  . LYS A  1 155 ? 96.875  109.413 30.659  1.00 42.39 ? 155 LYS A HZ3  1 
ATOM   2090  N  N    . LYS A  1 156 ? 89.277  112.457 29.143  1.00 12.00 ? 156 LYS A N    1 
ATOM   2091  C  CA   . LYS A  1 156 ? 88.271  112.612 28.092  1.00 10.97 ? 156 LYS A CA   1 
ATOM   2092  C  C    . LYS A  1 156 ? 86.992  113.214 28.667  1.00 13.91 ? 156 LYS A C    1 
ATOM   2093  O  O    . LYS A  1 156 ? 86.771  113.170 29.882  1.00 16.40 ? 156 LYS A O    1 
ATOM   2094  C  CB   . LYS A  1 156 ? 88.017  111.278 27.372  1.00 19.86 ? 156 LYS A CB   1 
ATOM   2095  C  CG   . LYS A  1 156 ? 87.098  110.334 28.066  1.00 23.49 ? 156 LYS A CG   1 
ATOM   2096  C  CD   . LYS A  1 156 ? 87.430  108.895 27.663  1.00 37.11 ? 156 LYS A CD   1 
ATOM   2097  C  CE   . LYS A  1 156 ? 86.461  108.346 26.651  1.00 44.56 ? 156 LYS A CE   1 
ATOM   2098  N  NZ   . LYS A  1 156 ? 85.573  107.303 27.251  1.00 42.20 ? 156 LYS A NZ   1 
ATOM   2099  H  H    . LYS A  1 156 ? 89.040  111.931 29.781  1.00 14.40 ? 156 LYS A H    1 
ATOM   2100  H  HA   . LYS A  1 156 ? 88.616  113.242 27.426  1.00 13.16 ? 156 LYS A HA   1 
ATOM   2101  H  HB2  . LYS A  1 156 ? 87.634  111.468 26.502  1.00 23.83 ? 156 LYS A HB2  1 
ATOM   2102  H  HB3  . LYS A  1 156 ? 88.867  110.824 27.259  1.00 23.83 ? 156 LYS A HB3  1 
ATOM   2103  H  HG2  . LYS A  1 156 ? 87.208  110.420 29.026  1.00 28.19 ? 156 LYS A HG2  1 
ATOM   2104  H  HG3  . LYS A  1 156 ? 86.182  110.524 27.810  1.00 28.19 ? 156 LYS A HG3  1 
ATOM   2105  H  HD2  . LYS A  1 156 ? 88.318  108.872 27.273  1.00 44.53 ? 156 LYS A HD2  1 
ATOM   2106  H  HD3  . LYS A  1 156 ? 87.397  108.330 28.450  1.00 44.53 ? 156 LYS A HD3  1 
ATOM   2107  H  HE2  . LYS A  1 156 ? 85.903  109.066 26.319  1.00 53.47 ? 156 LYS A HE2  1 
ATOM   2108  H  HE3  . LYS A  1 156 ? 86.956  107.941 25.922  1.00 53.47 ? 156 LYS A HE3  1 
ATOM   2109  H  HZ1  . LYS A  1 156 ? 85.009  106.993 26.636  1.00 50.63 ? 156 LYS A HZ1  1 
ATOM   2110  H  HZ2  . LYS A  1 156 ? 85.104  107.652 27.923  1.00 50.63 ? 156 LYS A HZ2  1 
ATOM   2111  H  HZ3  . LYS A  1 156 ? 86.063  106.628 27.561  1.00 50.63 ? 156 LYS A HZ3  1 
ATOM   2112  N  N    . PRO A  1 157 ? 86.184  113.847 27.808  1.00 14.66 ? 157 PRO A N    1 
ATOM   2113  C  CA   . PRO A  1 157 ? 85.016  114.572 28.318  1.00 10.02 ? 157 PRO A CA   1 
ATOM   2114  C  C    . PRO A  1 157 ? 84.010  113.634 28.966  1.00 12.34 ? 157 PRO A C    1 
ATOM   2115  O  O    . PRO A  1 157 ? 83.844  112.508 28.513  1.00 10.57 ? 157 PRO A O    1 
ATOM   2116  C  CB   . PRO A  1 157 ? 84.432  115.270 27.083  1.00 14.96 ? 157 PRO A CB   1 
ATOM   2117  C  CG   . PRO A  1 157 ? 85.154  114.764 25.942  1.00 16.14 ? 157 PRO A CG   1 
ATOM   2118  C  CD   . PRO A  1 157 ? 86.413  114.087 26.375  1.00 16.13 ? 157 PRO A CD   1 
ATOM   2119  H  HA   . PRO A  1 157 ? 85.295  115.248 28.970  1.00 12.02 ? 157 PRO A HA   1 
ATOM   2120  H  HB2  . PRO A  1 157 ? 83.489  115.058 27.009  1.00 17.95 ? 157 PRO A HB2  1 
ATOM   2121  H  HB3  . PRO A  1 157 ? 84.558  116.229 27.165  1.00 17.95 ? 157 PRO A HB3  1 
ATOM   2122  H  HG2  . PRO A  1 157 ? 84.588  114.131 25.474  1.00 19.36 ? 157 PRO A HG2  1 
ATOM   2123  H  HG3  . PRO A  1 157 ? 85.368  115.507 25.356  1.00 19.36 ? 157 PRO A HG3  1 
ATOM   2124  H  HD2  . PRO A  1 157 ? 86.527  113.247 25.904  1.00 19.35 ? 157 PRO A HD2  1 
ATOM   2125  H  HD3  . PRO A  1 157 ? 87.175  114.674 26.248  1.00 19.35 ? 157 PRO A HD3  1 
ATOM   2126  N  N    . VAL A  1 158 ? 83.378  114.094 30.042  1.00 11.79 ? 158 VAL A N    1 
ATOM   2127  C  CA   . VAL A  1 158 ? 82.331  113.331 30.703  1.00 11.70 ? 158 VAL A CA   1 
ATOM   2128  C  C    . VAL A  1 158 ? 81.140  114.262 30.875  1.00 17.10 ? 158 VAL A C    1 
ATOM   2129  O  O    . VAL A  1 158 ? 81.263  115.314 31.505  1.00 14.86 ? 158 VAL A O    1 
ATOM   2130  C  CB   . VAL A  1 158 ? 82.806  112.812 32.084  1.00 15.45 ? 158 VAL A CB   1 
ATOM   2131  C  CG1  . VAL A  1 158 ? 81.637  112.289 32.871  1.00 14.62 ? 158 VAL A CG1  1 
ATOM   2132  C  CG2  . VAL A  1 158 ? 83.881  111.728 31.922  1.00 14.11 ? 158 VAL A CG2  1 
ATOM   2133  H  H    . VAL A  1 158 ? 83.541  114.854 30.410  1.00 14.15 ? 158 VAL A H    1 
ATOM   2134  H  HA   . VAL A  1 158 ? 82.066  112.569 30.146  1.00 14.05 ? 158 VAL A HA   1 
ATOM   2135  H  HB   . VAL A  1 158 ? 83.200  113.555 32.586  1.00 18.54 ? 158 VAL A HB   1 
ATOM   2136  H  HG11 . VAL A  1 158 ? 81.950  111.972 33.722  1.00 17.54 ? 158 VAL A HG11 1 
ATOM   2137  H  HG12 . VAL A  1 158 ? 81.004  113.000 32.999  1.00 17.54 ? 158 VAL A HG12 1 
ATOM   2138  H  HG13 . VAL A  1 158 ? 81.229  111.570 32.383  1.00 17.54 ? 158 VAL A HG13 1 
ATOM   2139  H  HG21 . VAL A  1 158 ? 84.154  111.426 32.791  1.00 16.94 ? 158 VAL A HG21 1 
ATOM   2140  H  HG22 . VAL A  1 158 ? 83.513  110.996 31.422  1.00 16.94 ? 158 VAL A HG22 1 
ATOM   2141  H  HG23 . VAL A  1 158 ? 84.631  112.100 31.453  1.00 16.94 ? 158 VAL A HG23 1 
ATOM   2142  N  N    . THR A  1 159 ? 80.004  113.907 30.286  1.00 10.86 ? 159 THR A N    1 
ATOM   2143  C  CA   . THR A  1 159 ? 78.783  114.710 30.406  1.00 9.85  ? 159 THR A CA   1 
ATOM   2144  C  C    . THR A  1 159 ? 77.600  113.896 30.941  1.00 13.67 ? 159 THR A C    1 
ATOM   2145  O  O    . THR A  1 159 ? 76.540  114.454 31.176  1.00 14.03 ? 159 THR A O    1 
ATOM   2146  C  CB   . THR A  1 159 ? 78.365  115.388 29.040  1.00 19.28 ? 159 THR A CB   1 
ATOM   2147  O  OG1  . THR A  1 159 ? 78.036  114.398 28.063  1.00 15.21 ? 159 THR A OG1  1 
ATOM   2148  C  CG2  . THR A  1 159 ? 79.480  116.261 28.511  1.00 15.81 ? 159 THR A CG2  1 
ATOM   2149  H  H    . THR A  1 159 ? 79.909  113.199 29.806  1.00 13.03 ? 159 THR A H    1 
ATOM   2150  H  HA   . THR A  1 159 ? 78.954  115.431 31.048  1.00 11.82 ? 159 THR A HA   1 
ATOM   2151  H  HB   . THR A  1 159 ? 77.589  115.952 29.191  1.00 23.13 ? 159 THR A HB   1 
ATOM   2152  H  HG1  . THR A  1 159 ? 78.683  113.913 27.927  1.00 18.25 ? 159 THR A HG1  1 
ATOM   2153  H  HG21 . THR A  1 159 ? 79.214  116.666 27.682  1.00 18.97 ? 159 THR A HG21 1 
ATOM   2154  H  HG22 . THR A  1 159 ? 79.684  116.952 29.145  1.00 18.97 ? 159 THR A HG22 1 
ATOM   2155  H  HG23 . THR A  1 159 ? 80.267  115.732 28.361  1.00 18.97 ? 159 THR A HG23 1 
ATOM   2156  N  N    . LYS A  1 160 ? 77.772  112.576 31.050  1.00 15.32 ? 160 LYS A N    1 
ATOM   2157  C  CA   . LYS A  1 160 ? 76.758  111.703 31.653  1.00 18.29 ? 160 LYS A CA   1 
ATOM   2158  C  C    . LYS A  1 160 ? 77.420  110.456 32.210  1.00 12.63 ? 160 LYS A C    1 
ATOM   2159  O  O    . LYS A  1 160 ? 78.556  110.126 31.862  1.00 12.42 ? 160 LYS A O    1 
ATOM   2160  C  CB   . LYS A  1 160 ? 75.679  111.330 30.626  1.00 25.19 ? 160 LYS A CB   1 
ATOM   2161  C  CG   . LYS A  1 160 ? 76.212  110.624 29.398  1.00 28.73 ? 160 LYS A CG   1 
ATOM   2162  C  CD   . LYS A  1 160 ? 75.138  110.429 28.312  1.00 31.15 ? 160 LYS A CD   1 
ATOM   2163  C  CE   . LYS A  1 160 ? 75.782  110.382 26.923  1.00 32.03 ? 160 LYS A CE   1 
ATOM   2164  N  NZ   . LYS A  1 160 ? 74.804  110.026 25.856  1.00 40.85 ? 160 LYS A NZ   1 
ATOM   2165  H  H    . LYS A  1 160 ? 78.473  112.158 30.779  1.00 18.39 ? 160 LYS A H    1 
ATOM   2166  H  HA   . LYS A  1 160 ? 76.325  112.176 32.394  1.00 21.95 ? 160 LYS A HA   1 
ATOM   2167  H  HB2  . LYS A  1 160 ? 75.036  110.740 31.050  1.00 30.23 ? 160 LYS A HB2  1 
ATOM   2168  H  HB3  . LYS A  1 160 ? 75.235  112.140 30.332  1.00 30.23 ? 160 LYS A HB3  1 
ATOM   2169  H  HG2  . LYS A  1 160 ? 76.931  111.151 29.018  1.00 34.47 ? 160 LYS A HG2  1 
ATOM   2170  H  HG3  . LYS A  1 160 ? 76.541  109.748 29.655  1.00 34.47 ? 160 LYS A HG3  1 
ATOM   2171  H  HD2  . LYS A  1 160 ? 74.673  109.591 28.463  1.00 37.39 ? 160 LYS A HD2  1 
ATOM   2172  H  HD3  . LYS A  1 160 ? 74.515  111.172 28.336  1.00 37.39 ? 160 LYS A HD3  1 
ATOM   2173  H  HE2  . LYS A  1 160 ? 76.152  111.254 26.714  1.00 38.44 ? 160 LYS A HE2  1 
ATOM   2174  H  HE3  . LYS A  1 160 ? 76.486  109.713 26.922  1.00 38.44 ? 160 LYS A HE3  1 
ATOM   2175  H  HZ1  . LYS A  1 160 ? 74.454  109.224 26.020  1.00 49.01 ? 160 LYS A HZ1  1 
ATOM   2176  H  HZ2  . LYS A  1 160 ? 74.149  110.628 25.831  1.00 49.01 ? 160 LYS A HZ2  1 
ATOM   2177  H  HZ3  . LYS A  1 160 ? 75.211  110.007 25.065  1.00 49.01 ? 160 LYS A HZ3  1 
ATOM   2178  N  N    . PRO A  1 161 ? 76.722  109.748 33.116  1.00 13.57 ? 161 PRO A N    1 
ATOM   2179  C  CA   . PRO A  1 161 ? 77.346  108.608 33.790  1.00 11.34 ? 161 PRO A CA   1 
ATOM   2180  C  C    . PRO A  1 161 ? 77.932  107.549 32.833  1.00 13.38 ? 161 PRO A C    1 
ATOM   2181  O  O    . PRO A  1 161 ? 78.993  106.973 33.093  1.00 13.71 ? 161 PRO A O    1 
ATOM   2182  C  CB   . PRO A  1 161 ? 76.190  108.040 34.633  1.00 15.72 ? 161 PRO A CB   1 
ATOM   2183  C  CG   . PRO A  1 161 ? 75.421  109.241 35.010  1.00 10.28 ? 161 PRO A CG   1 
ATOM   2184  C  CD   . PRO A  1 161 ? 75.466  110.150 33.767  1.00 13.29 ? 161 PRO A CD   1 
ATOM   2185  H  HA   . PRO A  1 161 ? 78.054  108.922 34.390  1.00 13.61 ? 161 PRO A HA   1 
ATOM   2186  H  HB2  . PRO A  1 161 ? 75.652  107.437 34.096  1.00 18.87 ? 161 PRO A HB2  1 
ATOM   2187  H  HB3  . PRO A  1 161 ? 76.541  107.591 35.418  1.00 18.87 ? 161 PRO A HB3  1 
ATOM   2188  H  HG2  . PRO A  1 161 ? 74.507  108.992 35.220  1.00 12.34 ? 161 PRO A HG2  1 
ATOM   2189  H  HG3  . PRO A  1 161 ? 75.842  109.674 35.768  1.00 12.34 ? 161 PRO A HG3  1 
ATOM   2190  H  HD2  . PRO A  1 161 ? 74.710  109.971 33.187  1.00 15.95 ? 161 PRO A HD2  1 
ATOM   2191  H  HD3  . PRO A  1 161 ? 75.503  111.083 34.030  1.00 15.95 ? 161 PRO A HD3  1 
ATOM   2192  N  N    . SER A  1 162 ? 77.250  107.306 31.726  1.00 14.33 ? 162 SER A N    1 
ATOM   2193  C  CA   . SER A  1 162 ? 77.696  106.289 30.783  1.00 16.42 ? 162 SER A CA   1 
ATOM   2194  C  C    . SER A  1 162 ? 79.106  106.620 30.269  1.00 11.67 ? 162 SER A C    1 
ATOM   2195  O  O    . SER A  1 162 ? 79.834  105.716 29.881  1.00 14.28 ? 162 SER A O    1 
ATOM   2196  C  CB   . SER A  1 162 ? 76.693  106.131 29.639  1.00 18.74 ? 162 SER A CB   1 
ATOM   2197  O  OG   . SER A  1 162 ? 76.590  107.320 28.869  1.00 18.34 ? 162 SER A OG   1 
ATOM   2198  H  H    . SER A  1 162 ? 76.528  107.713 31.496  1.00 17.19 ? 162 SER A H    1 
ATOM   2199  H  HA   . SER A  1 162 ? 77.746  105.430 31.252  1.00 19.71 ? 162 SER A HA   1 
ATOM   2200  H  HB2  . SER A  1 162 ? 76.988  105.409 29.062  1.00 22.49 ? 162 SER A HB2  1 
ATOM   2201  H  HB3  . SER A  1 162 ? 75.823  105.922 30.011  1.00 22.49 ? 162 SER A HB3  1 
ATOM   2202  H  HG   . SER A  1 162 ? 77.090  107.894 29.172  1.00 22.01 ? 162 SER A HG   1 
ATOM   2203  N  N    . ASP A  1 163 ? 79.490  107.894 30.260  1.00 13.45 ? 163 ASP A N    1 
ATOM   2204  C  CA   . ASP A  1 163 ? 80.833  108.289 29.815  1.00 11.45 ? 163 ASP A CA   1 
ATOM   2205  C  C    . ASP A  1 163 ? 81.932  107.828 30.757  1.00 11.37 ? 163 ASP A C    1 
ATOM   2206  O  O    . ASP A  1 163 ? 83.092  107.820 30.369  1.00 15.70 ? 163 ASP A O    1 
ATOM   2207  C  CB   . ASP A  1 163 ? 80.944  109.829 29.666  1.00 13.76 ? 163 ASP A CB   1 
ATOM   2208  C  CG   . ASP A  1 163 ? 80.191  110.369 28.460  1.00 17.02 ? 163 ASP A CG   1 
ATOM   2209  O  OD1  . ASP A  1 163 ? 80.075  109.660 27.445  1.00 16.34 ? 163 ASP A OD1  1 
ATOM   2210  O  OD2  . ASP A  1 163 ? 79.720  111.526 28.523  1.00 16.34 ? 163 ASP A OD2  1 
ATOM   2211  H  H    . ASP A  1 163 ? 78.994  108.552 30.507  1.00 16.14 ? 163 ASP A H    1 
ATOM   2212  H  HA   . ASP A  1 163 ? 81.004  107.890 28.936  1.00 13.74 ? 163 ASP A HA   1 
ATOM   2213  H  HB2  . ASP A  1 163 ? 80.577  110.248 30.460  1.00 16.51 ? 163 ASP A HB2  1 
ATOM   2214  H  HB3  . ASP A  1 163 ? 81.878  110.069 29.567  1.00 16.51 ? 163 ASP A HB3  1 
ATOM   2215  N  N    . LEU A  1 164 ? 81.583  107.481 32.009  1.00 11.15 ? 164 LEU A N    1 
ATOM   2216  C  CA   . LEU A  1 164 ? 82.576  106.997 32.970  1.00 10.17 ? 164 LEU A CA   1 
ATOM   2217  C  C    . LEU A  1 164 ? 82.822  105.491 32.810  1.00 10.79 ? 164 LEU A C    1 
ATOM   2218  O  O    . LEU A  1 164 ? 83.649  104.924 33.524  1.00 11.41 ? 164 LEU A O    1 
ATOM   2219  C  CB   . LEU A  1 164 ? 82.127  107.265 34.422  1.00 9.72  ? 164 LEU A CB   1 
ATOM   2220  C  CG   . LEU A  1 164 ? 82.128  108.735 34.859  1.00 9.13  ? 164 LEU A CG   1 
ATOM   2221  C  CD1  . LEU A  1 164 ? 81.474  108.872 36.248  1.00 11.17 ? 164 LEU A CD1  1 
ATOM   2222  C  CD2  . LEU A  1 164 ? 83.525  109.303 34.893  1.00 15.96 ? 164 LEU A CD2  1 
ATOM   2223  H  H    . LEU A  1 164 ? 80.781  107.519 32.319  1.00 13.38 ? 164 LEU A H    1 
ATOM   2224  H  HA   . LEU A  1 164 ? 83.425  107.465 32.820  1.00 12.21 ? 164 LEU A HA   1 
ATOM   2225  H  HB2  . LEU A  1 164 ? 81.222  106.932 34.528  1.00 11.67 ? 164 LEU A HB2  1 
ATOM   2226  H  HB3  . LEU A  1 164 ? 82.721  106.784 35.019  1.00 11.67 ? 164 LEU A HB3  1 
ATOM   2227  H  HG   . LEU A  1 164 ? 81.607  109.255 34.227  1.00 10.96 ? 164 LEU A HG   1 
ATOM   2228  H  HD11 . LEU A  1 164 ? 81.483  109.796 36.508  1.00 13.40 ? 164 LEU A HD11 1 
ATOM   2229  H  HD12 . LEU A  1 164 ? 80.570  108.554 36.200  1.00 13.40 ? 164 LEU A HD12 1 
ATOM   2230  H  HD13 . LEU A  1 164 ? 81.973  108.350 36.881  1.00 13.40 ? 164 LEU A HD13 1 
ATOM   2231  H  HD21 . LEU A  1 164 ? 83.483  110.221 35.170  1.00 19.15 ? 164 LEU A HD21 1 
ATOM   2232  H  HD22 . LEU A  1 164 ? 84.053  108.796 35.516  1.00 19.15 ? 164 LEU A HD22 1 
ATOM   2233  H  HD23 . LEU A  1 164 ? 83.908  109.243 34.015  1.00 19.15 ? 164 LEU A HD23 1 
ATOM   2234  N  N    . LYS A  1 165 ? 82.115  104.853 31.877  1.00 12.29 ? 165 LYS A N    1 
ATOM   2235  C  CA   . LYS A  1 165 ? 82.236  103.407 31.693  1.00 14.12 ? 165 LYS A CA   1 
ATOM   2236  C  C    . LYS A  1 165 ? 83.678  102.948 31.541  1.00 16.81 ? 165 LYS A C    1 
ATOM   2237  O  O    . LYS A  1 165 ? 84.363  103.308 30.585  1.00 15.41 ? 165 LYS A O    1 
ATOM   2238  C  CB   . LYS A  1 165 ? 81.409  102.931 30.519  1.00 14.02 ? 165 LYS A CB   1 
ATOM   2239  C  CG   . LYS A  1 165 ? 81.340  101.424 30.362  1.00 21.25 ? 165 LYS A CG   1 
ATOM   2240  C  CD   . LYS A  1 165 ? 80.514  101.071 29.121  1.00 27.30 ? 165 LYS A CD   1 
ATOM   2241  C  CE   . LYS A  1 165 ? 79.066  101.580 29.272  1.00 38.14 ? 165 LYS A CE   1 
ATOM   2242  N  NZ   . LYS A  1 165 ? 78.198  101.318 28.083  1.00 46.88 ? 165 LYS A NZ   1 
ATOM   2243  H  H    . LYS A  1 165 ? 81.561  105.233 31.339  1.00 14.75 ? 165 LYS A H    1 
ATOM   2244  H  HA   . LYS A  1 165 ? 81.878  102.969 32.493  1.00 16.94 ? 165 LYS A HA   1 
ATOM   2245  H  HB2  . LYS A  1 165 ? 80.502  103.256 30.628  1.00 16.83 ? 165 LYS A HB2  1 
ATOM   2246  H  HB3  . LYS A  1 165 ? 81.790  103.293 29.705  1.00 16.83 ? 165 LYS A HB3  1 
ATOM   2247  H  HG2  . LYS A  1 165 ? 82.235  101.066 30.251  1.00 25.50 ? 165 LYS A HG2  1 
ATOM   2248  H  HG3  . LYS A  1 165 ? 80.911  101.034 31.140  1.00 25.50 ? 165 LYS A HG3  1 
ATOM   2249  H  HD2  . LYS A  1 165 ? 80.908  101.492 28.341  1.00 32.76 ? 165 LYS A HD2  1 
ATOM   2250  H  HD3  . LYS A  1 165 ? 80.491  100.108 29.011  1.00 32.76 ? 165 LYS A HD3  1 
ATOM   2251  H  HE2  . LYS A  1 165 ? 78.661  101.142 30.037  1.00 45.77 ? 165 LYS A HE2  1 
ATOM   2252  H  HE3  . LYS A  1 165 ? 79.087  102.539 29.418  1.00 45.77 ? 165 LYS A HE3  1 
ATOM   2253  H  HZ1  . LYS A  1 165 ? 77.378  101.633 28.229  1.00 56.26 ? 165 LYS A HZ1  1 
ATOM   2254  H  HZ2  . LYS A  1 165 ? 78.537  101.719 27.364  1.00 56.26 ? 165 LYS A HZ2  1 
ATOM   2255  H  HZ3  . LYS A  1 165 ? 78.148  100.443 27.930  1.00 56.26 ? 165 LYS A HZ3  1 
ATOM   2256  N  N    . GLY A  1 166 ? 84.107  102.139 32.508  1.00 12.40 ? 166 GLY A N    1 
ATOM   2257  C  CA   . GLY A  1 166 ? 85.443  101.572 32.531  1.00 19.43 ? 166 GLY A CA   1 
ATOM   2258  C  C    . GLY A  1 166 ? 86.555  102.563 32.836  1.00 15.60 ? 166 GLY A C    1 
ATOM   2259  O  O    . GLY A  1 166 ? 87.732  102.191 32.793  1.00 17.50 ? 166 GLY A O    1 
ATOM   2260  H  H    . GLY A  1 166 ? 83.624  101.900 33.179  1.00 14.88 ? 166 GLY A H    1 
ATOM   2261  H  HA2  . GLY A  1 166 ? 85.476  100.871 33.200  1.00 23.31 ? 166 GLY A HA2  1 
ATOM   2262  H  HA3  . GLY A  1 166 ? 85.629  101.172 31.667  1.00 23.31 ? 166 GLY A HA3  1 
ATOM   2263  N  N    . MET A  1 167 ? 86.194  103.808 33.162  1.00 15.26 ? 167 MET A N    1 
ATOM   2264  C  CA   . MET A  1 167 ? 87.178  104.837 33.412  1.00 12.27 ? 167 MET A CA   1 
ATOM   2265  C  C    . MET A  1 167 ? 87.693  104.715 34.836  1.00 14.67 ? 167 MET A C    1 
ATOM   2266  O  O    . MET A  1 167 ? 86.908  104.679 35.791  1.00 10.52 ? 167 MET A O    1 
ATOM   2267  C  CB   . MET A  1 167 ? 86.597  106.235 33.195  1.00 11.84 ? 167 MET A CB   1 
ATOM   2268  C  CG   . MET A  1 167 ? 87.649  107.317 33.231  1.00 12.39 ? 167 MET A CG   1 
ATOM   2269  S  SD   . MET A  1 167 ? 87.010  108.987 33.064  1.00 13.85 ? 167 MET A SD   1 
ATOM   2270  C  CE   . MET A  1 167 ? 86.218  108.932 31.447  1.00 11.64 ? 167 MET A CE   1 
ATOM   2271  H  H    . MET A  1 167 ? 85.380  104.073 33.241  1.00 18.31 ? 167 MET A H    1 
ATOM   2272  H  HA   . MET A  1 167 ? 87.927  104.721 32.791  1.00 14.72 ? 167 MET A HA   1 
ATOM   2273  H  HB2  . MET A  1 167 ? 86.164  106.266 32.327  1.00 14.20 ? 167 MET A HB2  1 
ATOM   2274  H  HB3  . MET A  1 167 ? 85.951  106.421 33.895  1.00 14.20 ? 167 MET A HB3  1 
ATOM   2275  H  HG2  . MET A  1 167 ? 88.118  107.265 34.078  1.00 14.87 ? 167 MET A HG2  1 
ATOM   2276  H  HG3  . MET A  1 167 ? 88.273  107.167 32.503  1.00 14.87 ? 167 MET A HG3  1 
ATOM   2277  H  HE1  . MET A  1 167 ? 85.837  109.792 31.257  1.00 13.97 ? 167 MET A HE1  1 
ATOM   2278  H  HE2  . MET A  1 167 ? 86.877  108.712 30.784  1.00 13.97 ? 167 MET A HE2  1 
ATOM   2279  H  HE3  . MET A  1 167 ? 85.530  108.263 31.459  1.00 13.97 ? 167 MET A HE3  1 
ATOM   2280  N  N    . LYS A  1 168 ? 89.011  104.628 34.965  1.00 11.74 ? 168 LYS A N    1 
ATOM   2281  C  CA   . LYS A  1 168 ? 89.641  104.531 36.271  1.00 13.22 ? 168 LYS A CA   1 
ATOM   2282  C  C    . LYS A  1 168 ? 89.732  105.921 36.855  1.00 17.67 ? 168 LYS A C    1 
ATOM   2283  O  O    . LYS A  1 168 ? 90.637  106.695 36.534  1.00 18.71 ? 168 LYS A O    1 
ATOM   2284  C  CB   . LYS A  1 168 ? 91.029  103.915 36.142  1.00 14.28 ? 168 LYS A CB   1 
ATOM   2285  C  CG   . LYS A  1 168 ? 90.954  102.490 35.566  1.00 23.73 ? 168 LYS A CG   1 
ATOM   2286  C  CD   . LYS A  1 168 ? 92.298  101.895 35.221  1.00 30.05 ? 168 LYS A CD   1 
ATOM   2287  C  CE   . LYS A  1 168 ? 92.116  100.432 34.767  1.00 36.77 ? 168 LYS A CE   1 
ATOM   2288  N  NZ   . LYS A  1 168 ? 93.399  99.758  34.410  1.00 41.96 ? 168 LYS A NZ   1 
ATOM   2289  H  H    . LYS A  1 168 ? 89.564  104.624 34.306  1.00 14.09 ? 168 LYS A H    1 
ATOM   2290  H  HA   . LYS A  1 168 ? 89.097  103.971 36.864  1.00 15.87 ? 168 LYS A HA   1 
ATOM   2291  H  HB2  . LYS A  1 168 ? 91.567  104.458 35.545  1.00 17.13 ? 168 LYS A HB2  1 
ATOM   2292  H  HB3  . LYS A  1 168 ? 91.442  103.868 37.018  1.00 17.13 ? 168 LYS A HB3  1 
ATOM   2293  H  HG2  . LYS A  1 168 ? 90.534  101.911 36.220  1.00 28.47 ? 168 LYS A HG2  1 
ATOM   2294  H  HG3  . LYS A  1 168 ? 90.423  102.510 34.755  1.00 28.47 ? 168 LYS A HG3  1 
ATOM   2295  H  HD2  . LYS A  1 168 ? 92.700  102.397 34.494  1.00 36.06 ? 168 LYS A HD2  1 
ATOM   2296  H  HD3  . LYS A  1 168 ? 92.871  101.908 36.003  1.00 36.06 ? 168 LYS A HD3  1 
ATOM   2297  H  HE2  . LYS A  1 168 ? 91.706  99.929  35.488  1.00 44.13 ? 168 LYS A HE2  1 
ATOM   2298  H  HE3  . LYS A  1 168 ? 91.543  100.415 33.985  1.00 44.13 ? 168 LYS A HE3  1 
ATOM   2299  H  HZ1  . LYS A  1 168 ? 93.242  98.920  34.156  1.00 50.35 ? 168 LYS A HZ1  1 
ATOM   2300  H  HZ2  . LYS A  1 168 ? 93.796  100.194 33.743  1.00 50.35 ? 168 LYS A HZ2  1 
ATOM   2301  H  HZ3  . LYS A  1 168 ? 93.944  99.750  35.114  1.00 50.35 ? 168 LYS A HZ3  1 
ATOM   2302  N  N    . VAL A  1 169 ? 88.765  106.242 37.699  1.00 11.65 ? 169 VAL A N    1 
ATOM   2303  C  CA   . VAL A  1 169 ? 88.748  107.512 38.410  1.00 11.05 ? 169 VAL A CA   1 
ATOM   2304  C  C    . VAL A  1 169 ? 89.309  107.407 39.819  1.00 12.94 ? 169 VAL A C    1 
ATOM   2305  O  O    . VAL A  1 169 ? 88.832  106.605 40.638  1.00 11.54 ? 169 VAL A O    1 
ATOM   2306  C  CB   . VAL A  1 169 ? 87.321  108.049 38.477  1.00 12.99 ? 169 VAL A CB   1 
ATOM   2307  C  CG1  . VAL A  1 169 ? 87.300  109.419 39.136  1.00 11.03 ? 169 VAL A CG1  1 
ATOM   2308  C  CG2  . VAL A  1 169 ? 86.726  108.162 37.046  1.00 15.83 ? 169 VAL A CG2  1 
ATOM   2309  H  H    . VAL A  1 169 ? 88.096  105.733 37.881  1.00 13.98 ? 169 VAL A H    1 
ATOM   2310  H  HA   . VAL A  1 169 ? 89.292  108.160 37.916  1.00 13.25 ? 169 VAL A HA   1 
ATOM   2311  H  HB   . VAL A  1 169 ? 86.762  107.438 39.002  1.00 15.59 ? 169 VAL A HB   1 
ATOM   2312  H  HG11 . VAL A  1 169 ? 86.395  109.737 39.168  1.00 13.24 ? 169 VAL A HG11 1 
ATOM   2313  H  HG12 . VAL A  1 169 ? 87.652  109.342 40.026  1.00 13.24 ? 169 VAL A HG12 1 
ATOM   2314  H  HG13 . VAL A  1 169 ? 87.842  110.021 38.621  1.00 13.24 ? 169 VAL A HG13 1 
ATOM   2315  H  HG21 . VAL A  1 169 ? 85.830  108.500 37.106  1.00 19.00 ? 169 VAL A HG21 1 
ATOM   2316  H  HG22 . VAL A  1 169 ? 87.269  108.762 36.529  1.00 19.00 ? 169 VAL A HG22 1 
ATOM   2317  H  HG23 . VAL A  1 169 ? 86.722  107.292 36.640  1.00 19.00 ? 169 VAL A HG23 1 
ATOM   2318  N  N    . ARG A  1 170 ? 90.356  108.175 40.084  1.00 11.83 ? 170 ARG A N    1 
ATOM   2319  C  CA   . ARG A  1 170 ? 90.963  108.209 41.408  1.00 12.63 ? 170 ARG A CA   1 
ATOM   2320  C  C    . ARG A  1 170 ? 90.022  108.793 42.446  1.00 8.88  ? 170 ARG A C    1 
ATOM   2321  O  O    . ARG A  1 170 ? 89.312  109.781 42.204  1.00 12.87 ? 170 ARG A O    1 
ATOM   2322  C  CB   . ARG A  1 170 ? 92.272  109.001 41.400  1.00 9.40  ? 170 ARG A CB   1 
ATOM   2323  C  CG   . ARG A  1 170 ? 92.941  109.116 42.761  1.00 13.28 ? 170 ARG A CG   1 
ATOM   2324  C  CD   . ARG A  1 170 ? 92.461  110.315 43.518  1.00 9.34  ? 170 ARG A CD   1 
ATOM   2325  N  NE   . ARG A  1 170 ? 93.080  110.425 44.838  1.00 9.71  ? 170 ARG A NE   1 
ATOM   2326  C  CZ   . ARG A  1 170 ? 92.926  111.498 45.612  1.00 9.78  ? 170 ARG A CZ   1 
ATOM   2327  N  NH1  . ARG A  1 170 ? 92.154  112.493 45.194  1.00 9.15  ? 170 ARG A NH1  1 
ATOM   2328  N  NH2  . ARG A  1 170 ? 93.536  111.581 46.793  1.00 12.63 ? 170 ARG A NH2  1 
ATOM   2329  H  H    . ARG A  1 170 ? 90.738  108.690 39.510  1.00 14.20 ? 170 ARG A H    1 
ATOM   2330  H  HA   . ARG A  1 170 ? 91.172  107.291 41.680  1.00 15.15 ? 170 ARG A HA   1 
ATOM   2331  H  HB2  . ARG A  1 170 ? 92.897  108.564 40.800  1.00 11.28 ? 170 ARG A HB2  1 
ATOM   2332  H  HB3  . ARG A  1 170 ? 92.090  109.900 41.084  1.00 11.28 ? 170 ARG A HB3  1 
ATOM   2333  H  HG2  . ARG A  1 170 ? 92.737  108.325 43.284  1.00 15.94 ? 170 ARG A HG2  1 
ATOM   2334  H  HG3  . ARG A  1 170 ? 93.900  109.198 42.639  1.00 15.94 ? 170 ARG A HG3  1 
ATOM   2335  H  HD2  . ARG A  1 170 ? 92.679  111.115 43.016  1.00 11.21 ? 170 ARG A HD2  1 
ATOM   2336  H  HD3  . ARG A  1 170 ? 91.501  110.249 43.640  1.00 11.21 ? 170 ARG A HD3  1 
ATOM   2337  H  HE   . ARG A  1 170 ? 93.710  109.873 45.034  1.00 11.66 ? 170 ARG A HE   1 
ATOM   2338  H  HH11 . ARG A  1 170 ? 91.769  112.445 44.427  1.00 10.98 ? 170 ARG A HH11 1 
ATOM   2339  H  HH12 . ARG A  1 170 ? 92.044  113.189 45.688  1.00 10.98 ? 170 ARG A HH12 1 
ATOM   2340  H  HH21 . ARG A  1 170 ? 94.029  110.933 47.069  1.00 15.15 ? 170 ARG A HH21 1 
ATOM   2341  H  HH22 . ARG A  1 170 ? 93.415  112.272 47.292  1.00 15.15 ? 170 ARG A HH22 1 
ATOM   2342  N  N    . VAL A  1 171 ? 90.018  108.154 43.609  1.00 9.15  ? 171 VAL A N    1 
ATOM   2343  C  CA   . VAL A  1 171 ? 89.477  108.747 44.833  1.00 10.23 ? 171 VAL A CA   1 
ATOM   2344  C  C    . VAL A  1 171 ? 90.507  108.617 45.944  1.00 9.32  ? 171 VAL A C    1 
ATOM   2345  O  O    . VAL A  1 171 ? 91.409  107.804 45.877  1.00 10.49 ? 171 VAL A O    1 
ATOM   2346  C  CB   . VAL A  1 171 ? 88.157  108.068 45.290  1.00 11.64 ? 171 VAL A CB   1 
ATOM   2347  C  CG1  . VAL A  1 171 ? 87.043  108.353 44.295  1.00 15.21 ? 171 VAL A CG1  1 
ATOM   2348  C  CG2  . VAL A  1 171 ? 88.350  106.584 45.452  1.00 15.76 ? 171 VAL A CG2  1 
ATOM   2349  H  H    . VAL A  1 171 ? 90.329  107.360 43.720  1.00 10.98 ? 171 VAL A H    1 
ATOM   2350  H  HA   . VAL A  1 171 ? 89.300  109.699 44.683  1.00 12.28 ? 171 VAL A HA   1 
ATOM   2351  H  HB   . VAL A  1 171 ? 87.891  108.436 46.159  1.00 13.97 ? 171 VAL A HB   1 
ATOM   2352  H  HG11 . VAL A  1 171 ? 86.238  107.924 44.597  1.00 18.25 ? 171 VAL A HG11 1 
ATOM   2353  H  HG12 . VAL A  1 171 ? 86.909  109.302 44.240  1.00 18.25 ? 171 VAL A HG12 1 
ATOM   2354  H  HG13 . VAL A  1 171 ? 87.296  108.007 43.436  1.00 18.25 ? 171 VAL A HG13 1 
ATOM   2355  H  HG21 . VAL A  1 171 ? 87.521  106.190 45.735  1.00 18.92 ? 171 VAL A HG21 1 
ATOM   2356  H  HG22 . VAL A  1 171 ? 88.619  106.211 44.610  1.00 18.92 ? 171 VAL A HG22 1 
ATOM   2357  H  HG23 . VAL A  1 171 ? 89.029  106.427 46.112  1.00 18.92 ? 171 VAL A HG23 1 
ATOM   2358  N  N    . GLN A  1 172 ? 90.378  109.449 46.978  1.00 9.17  ? 172 GLN A N    1 
ATOM   2359  C  CA   . GLN A  1 172 ? 91.203  109.309 48.152  1.00 9.64  ? 172 GLN A CA   1 
ATOM   2360  C  C    . GLN A  1 172 ? 90.737  108.074 48.888  1.00 12.19 ? 172 GLN A C    1 
ATOM   2361  O  O    . GLN A  1 172 ? 89.737  107.455 48.515  1.00 12.33 ? 172 GLN A O    1 
ATOM   2362  C  CB   . GLN A  1 172 ? 91.065  110.519 49.089  1.00 9.43  ? 172 GLN A CB   1 
ATOM   2363  C  CG   . GLN A  1 172 ? 89.718  110.662 49.745  1.00 12.75 ? 172 GLN A CG   1 
ATOM   2364  C  CD   . GLN A  1 172 ? 89.536  112.026 50.335  1.00 12.03 ? 172 GLN A CD   1 
ATOM   2365  O  OE1  . GLN A  1 172 ? 89.886  112.282 51.503  1.00 11.13 ? 172 GLN A OE1  1 
ATOM   2366  N  NE2  . GLN A  1 172 ? 88.992  112.912 49.550  1.00 8.45  ? 172 GLN A NE2  1 
ATOM   2367  H  H    . GLN A  1 172 ? 89.818  110.101 47.014  1.00 11.00 ? 172 GLN A H    1 
ATOM   2368  H  HA   . GLN A  1 172 ? 92.143  109.200 47.898  1.00 11.57 ? 172 GLN A HA   1 
ATOM   2369  H  HB2  . GLN A  1 172 ? 91.727  110.441 49.793  1.00 11.32 ? 172 GLN A HB2  1 
ATOM   2370  H  HB3  . GLN A  1 172 ? 91.228  111.326 48.576  1.00 11.32 ? 172 GLN A HB3  1 
ATOM   2371  H  HG2  . GLN A  1 172 ? 89.023  110.522 49.084  1.00 15.30 ? 172 GLN A HG2  1 
ATOM   2372  H  HG3  . GLN A  1 172 ? 89.639  110.010 50.459  1.00 15.30 ? 172 GLN A HG3  1 
ATOM   2373  H  HE21 . GLN A  1 172 ? 88.763  112.695 48.750  1.00 10.14 ? 172 GLN A HE21 1 
ATOM   2374  H  HE22 . GLN A  1 172 ? 88.862  113.714 49.832  1.00 10.14 ? 172 GLN A HE22 1 
ATOM   2375  N  N    . HIS A  1 173 ? 91.438  107.730 49.952  1.00 12.97 ? 173 HIS A N    1 
ATOM   2376  C  CA   . HIS A  1 173 ? 90.968  106.662 50.817  1.00 13.68 ? 173 HIS A CA   1 
ATOM   2377  C  C    . HIS A  1 173 ? 89.749  107.109 51.591  1.00 13.42 ? 173 HIS A C    1 
ATOM   2378  O  O    . HIS A  1 173 ? 89.842  107.639 52.696  1.00 21.22 ? 173 HIS A O    1 
ATOM   2379  C  CB   . HIS A  1 173 ? 92.115  106.114 51.676  1.00 17.00 ? 173 HIS A CB   1 
ATOM   2380  C  CG   . HIS A  1 173 ? 93.183  105.437 50.861  1.00 29.55 ? 173 HIS A CG   1 
ATOM   2381  N  ND1  . HIS A  1 173 ? 93.024  104.178 50.319  1.00 30.04 ? 173 HIS A ND1  1 
ATOM   2382  C  CD2  . HIS A  1 173 ? 94.402  105.866 50.452  1.00 39.04 ? 173 HIS A CD2  1 
ATOM   2383  C  CE1  . HIS A  1 173 ? 94.106  103.852 49.634  1.00 33.73 ? 173 HIS A CE1  1 
ATOM   2384  N  NE2  . HIS A  1 173 ? 94.959  104.859 49.699  1.00 40.12 ? 173 HIS A NE2  1 
ATOM   2385  H  H    . HIS A  1 173 ? 92.179  108.093 50.196  1.00 15.56 ? 173 HIS A H    1 
ATOM   2386  H  HA   . HIS A  1 173 ? 90.676  105.924 50.242  1.00 16.42 ? 173 HIS A HA   1 
ATOM   2387  H  HB2  . HIS A  1 173 ? 92.526  106.847 52.159  1.00 20.40 ? 173 HIS A HB2  1 
ATOM   2388  H  HB3  . HIS A  1 173 ? 91.758  105.463 52.301  1.00 20.40 ? 173 HIS A HB3  1 
ATOM   2389  H  HD1  . HIS A  1 173 ? 92.331  103.679 50.420  1.00 36.04 ? 173 HIS A HD1  1 
ATOM   2390  H  HD2  . HIS A  1 173 ? 94.794  106.685 50.654  1.00 46.84 ? 173 HIS A HD2  1 
ATOM   2391  H  HE1  . HIS A  1 173 ? 94.245  103.050 49.184  1.00 40.48 ? 173 HIS A HE1  1 
ATOM   2392  H  HE2  . HIS A  1 173 ? 95.736  104.881 49.332  1.00 48.14 ? 173 HIS A HE2  1 
ATOM   2393  N  N    . SER A  1 174 ? 88.591  106.902 50.974  1.00 14.09 ? 174 SER A N    1 
ATOM   2394  C  CA   . SER A  1 174 ? 87.299  107.238 51.572  1.00 11.85 ? 174 SER A CA   1 
ATOM   2395  C  C    . SER A  1 174 ? 86.227  106.325 51.019  1.00 16.25 ? 174 SER A C    1 
ATOM   2396  O  O    . SER A  1 174 ? 85.979  106.295 49.801  1.00 15.72 ? 174 SER A O    1 
ATOM   2397  C  CB   . SER A  1 174 ? 86.909  108.695 51.282  1.00 12.56 ? 174 SER A CB   1 
ATOM   2398  O  OG   . SER A  1 174 ? 85.492  108.882 51.420  1.00 15.13 ? 174 SER A OG   1 
ATOM   2399  H  H    . SER A  1 174 ? 88.525  106.560 50.188  1.00 16.91 ? 174 SER A H    1 
ATOM   2400  H  HA   . SER A  1 174 ? 87.344  107.114 52.543  1.00 14.22 ? 174 SER A HA   1 
ATOM   2401  H  HB2  . SER A  1 174 ? 87.367  109.275 51.909  1.00 15.07 ? 174 SER A HB2  1 
ATOM   2402  H  HB3  . SER A  1 174 ? 87.169  108.916 50.374  1.00 15.07 ? 174 SER A HB3  1 
ATOM   2403  H  HG   . SER A  1 174 ? 85.295  109.662 51.263  1.00 18.15 ? 174 SER A HG   1 
ATOM   2404  N  N    . ARG A  1 175 ? 85.603  105.570 51.913  1.00 11.50 ? 175 ARG A N    1 
ATOM   2405  C  CA   . ARG A  1 175 ? 84.462  104.728 51.578  1.00 11.09 ? 175 ARG A CA   1 
ATOM   2406  C  C    . ARG A  1 175 ? 83.357  105.516 50.855  1.00 10.29 ? 175 ARG A C    1 
ATOM   2407  O  O    . ARG A  1 175 ? 82.745  105.042 49.899  1.00 12.36 ? 175 ARG A O    1 
ATOM   2408  C  CB   . ARG A  1 175 ? 83.898  104.135 52.871  1.00 18.96 ? 175 ARG A CB   1 
ATOM   2409  C  CG   . ARG A  1 175 ? 82.633  103.327 52.685  1.00 19.44 ? 175 ARG A CG   1 
ATOM   2410  C  CD   . ARG A  1 175 ? 82.723  102.039 53.464  1.00 23.99 ? 175 ARG A CD   1 
ATOM   2411  N  NE   . ARG A  1 175 ? 81.432  101.388 53.571  1.00 20.93 ? 175 ARG A NE   1 
ATOM   2412  C  CZ   . ARG A  1 175 ? 80.886  100.604 52.644  1.00 17.07 ? 175 ARG A CZ   1 
ATOM   2413  N  NH1  . ARG A  1 175 ? 79.702  100.053 52.893  1.00 13.94 ? 175 ARG A NH1  1 
ATOM   2414  N  NH2  . ARG A  1 175 ? 81.496  100.350 51.483  1.00 17.23 ? 175 ARG A NH2  1 
ATOM   2415  H  H    . ARG A  1 175 ? 85.828  105.527 52.742  1.00 13.80 ? 175 ARG A H    1 
ATOM   2416  H  HA   . ARG A  1 175 ? 84.754  103.994 50.998  1.00 13.31 ? 175 ARG A HA   1 
ATOM   2417  H  HB2  . ARG A  1 175 ? 84.566  103.551 53.263  1.00 22.76 ? 175 ARG A HB2  1 
ATOM   2418  H  HB3  . ARG A  1 175 ? 83.697  104.860 53.484  1.00 22.76 ? 175 ARG A HB3  1 
ATOM   2419  H  HG2  . ARG A  1 175 ? 81.873  103.833 53.013  1.00 23.33 ? 175 ARG A HG2  1 
ATOM   2420  H  HG3  . ARG A  1 175 ? 82.520  103.113 51.746  1.00 23.33 ? 175 ARG A HG3  1 
ATOM   2421  H  HD2  . ARG A  1 175 ? 83.332  101.433 53.011  1.00 28.79 ? 175 ARG A HD2  1 
ATOM   2422  H  HD3  . ARG A  1 175 ? 83.043  102.228 54.360  1.00 28.79 ? 175 ARG A HD3  1 
ATOM   2423  H  HE   . ARG A  1 175 ? 80.983  101.520 54.292  1.00 25.12 ? 175 ARG A HE   1 
ATOM   2424  H  HH11 . ARG A  1 175 ? 79.300  100.214 53.636  1.00 16.73 ? 175 ARG A HH11 1 
ATOM   2425  H  HH12 . ARG A  1 175 ? 79.328  99.551  52.303  1.00 16.73 ? 175 ARG A HH12 1 
ATOM   2426  H  HH21 . ARG A  1 175 ? 82.266  100.696 51.318  1.00 20.68 ? 175 ARG A HH21 1 
ATOM   2427  H  HH22 . ARG A  1 175 ? 81.120  99.841  50.901  1.00 20.68 ? 175 ARG A HH22 1 
ATOM   2428  N  N    . LEU A  1 176 ? 83.091  106.730 51.334  1.00 11.77 ? 176 LEU A N    1 
ATOM   2429  C  CA   . LEU A  1 176 ? 82.029  107.541 50.784  1.00 8.47  ? 176 LEU A CA   1 
ATOM   2430  C  C    . LEU A  1 176 ? 82.316  107.808 49.291  1.00 8.22  ? 176 LEU A C    1 
ATOM   2431  O  O    . LEU A  1 176 ? 81.450  107.607 48.457  1.00 8.82  ? 176 LEU A O    1 
ATOM   2432  C  CB   . LEU A  1 176 ? 81.896  108.862 51.551  1.00 11.34 ? 176 LEU A CB   1 
ATOM   2433  C  CG   . LEU A  1 176 ? 80.851  109.839 50.991  1.00 10.54 ? 176 LEU A CG   1 
ATOM   2434  C  CD1  . LEU A  1 176 ? 79.453  109.337 51.175  1.00 10.98 ? 176 LEU A CD1  1 
ATOM   2435  C  CD2  . LEU A  1 176 ? 80.995  111.212 51.600  1.00 19.60 ? 176 LEU A CD2  1 
ATOM   2436  H  H    . LEU A  1 176 ? 83.518  107.101 51.981  1.00 14.12 ? 176 LEU A H    1 
ATOM   2437  H  HA   . LEU A  1 176 ? 81.181  107.056 50.854  1.00 10.17 ? 176 LEU A HA   1 
ATOM   2438  H  HB2  . LEU A  1 176 ? 81.647  108.663 52.467  1.00 13.60 ? 176 LEU A HB2  1 
ATOM   2439  H  HB3  . LEU A  1 176 ? 82.754  109.313 51.538  1.00 13.60 ? 176 LEU A HB3  1 
ATOM   2440  H  HG   . LEU A  1 176 ? 81.001  109.929 50.036  1.00 12.65 ? 176 LEU A HG   1 
ATOM   2441  H  HD11 . LEU A  1 176 ? 78.840  109.980 50.810  1.00 13.18 ? 176 LEU A HD11 1 
ATOM   2442  H  HD12 . LEU A  1 176 ? 79.360  108.498 50.717  1.00 13.18 ? 176 LEU A HD12 1 
ATOM   2443  H  HD13 . LEU A  1 176 ? 79.285  109.219 52.113  1.00 13.18 ? 176 LEU A HD13 1 
ATOM   2444  H  HD21 . LEU A  1 176 ? 80.327  111.791 51.225  1.00 23.52 ? 176 LEU A HD21 1 
ATOM   2445  H  HD22 . LEU A  1 176 ? 80.877  111.146 52.550  1.00 23.52 ? 176 LEU A HD22 1 
ATOM   2446  H  HD23 . LEU A  1 176 ? 81.871  111.551 51.402  1.00 23.52 ? 176 LEU A HD23 1 
ATOM   2447  N  N    . PHE A  1 177 ? 83.536  108.207 48.964  1.00 8.15  ? 177 PHE A N    1 
ATOM   2448  C  CA   . PHE A  1 177 ? 83.816  108.606 47.575  1.00 12.46 ? 177 PHE A CA   1 
ATOM   2449  C  C    . PHE A  1 177 ? 84.025  107.371 46.689  1.00 10.67 ? 177 PHE A C    1 
ATOM   2450  O  O    . PHE A  1 177 ? 83.662  107.393 45.502  1.00 8.53  ? 177 PHE A O    1 
ATOM   2451  C  CB   . PHE A  1 177 ? 85.011  109.553 47.478  1.00 9.85  ? 177 PHE A CB   1 
ATOM   2452  C  CG   . PHE A  1 177 ? 84.763  110.925 48.056  1.00 15.86 ? 177 PHE A CG   1 
ATOM   2453  C  CD1  . PHE A  1 177 ? 83.496  111.492 48.053  1.00 23.46 ? 177 PHE A CD1  1 
ATOM   2454  C  CD2  . PHE A  1 177 ? 85.809  111.654 48.589  1.00 10.08 ? 177 PHE A CD2  1 
ATOM   2455  C  CE1  . PHE A  1 177 ? 83.273  112.751 48.585  1.00 20.00 ? 177 PHE A CE1  1 
ATOM   2456  C  CE2  . PHE A  1 177 ? 85.584  112.944 49.129  1.00 12.98 ? 177 PHE A CE2  1 
ATOM   2457  C  CZ   . PHE A  1 177 ? 84.317  113.478 49.106  1.00 8.05  ? 177 PHE A CZ   1 
ATOM   2458  H  H    . PHE A  1 177 ? 84.206  108.258 49.501  1.00 9.78  ? 177 PHE A H    1 
ATOM   2459  H  HA   . PHE A  1 177 ? 83.034  109.086 47.229  1.00 14.95 ? 177 PHE A HA   1 
ATOM   2460  H  HB2  . PHE A  1 177 ? 85.757  109.161 47.957  1.00 11.82 ? 177 PHE A HB2  1 
ATOM   2461  H  HB3  . PHE A  1 177 ? 85.244  109.665 46.543  1.00 11.82 ? 177 PHE A HB3  1 
ATOM   2462  H  HD1  . PHE A  1 177 ? 82.782  111.013 47.697  1.00 28.15 ? 177 PHE A HD1  1 
ATOM   2463  H  HD2  . PHE A  1 177 ? 86.667  111.293 48.596  1.00 12.09 ? 177 PHE A HD2  1 
ATOM   2464  H  HE1  . PHE A  1 177 ? 82.417  113.114 48.572  1.00 24.00 ? 177 PHE A HE1  1 
ATOM   2465  H  HE2  . PHE A  1 177 ? 86.291  113.431 49.486  1.00 15.57 ? 177 PHE A HE2  1 
ATOM   2466  H  HZ   . PHE A  1 177 ? 84.162  114.322 49.464  1.00 9.66  ? 177 PHE A HZ   1 
ATOM   2467  N  N    . LEU A  1 178 ? 84.581  106.300 47.251  1.00 8.91  ? 178 LEU A N    1 
ATOM   2468  C  CA   . LEU A  1 178 ? 84.716  105.052 46.484  1.00 8.53  ? 178 LEU A CA   1 
ATOM   2469  C  C    . LEU A  1 178 ? 83.316  104.635 46.016  1.00 8.53  ? 178 LEU A C    1 
ATOM   2470  O  O    . LEU A  1 178 ? 83.064  104.457 44.835  1.00 8.58  ? 178 LEU A O    1 
ATOM   2471  C  CB   . LEU A  1 178 ? 85.383  103.955 47.327  1.00 8.86  ? 178 LEU A CB   1 
ATOM   2472  C  CG   . LEU A  1 178 ? 85.823  102.690 46.591  1.00 11.05 ? 178 LEU A CG   1 
ATOM   2473  C  CD1  . LEU A  1 178 ? 86.960  102.003 47.344  1.00 19.17 ? 178 LEU A CD1  1 
ATOM   2474  C  CD2  . LEU A  1 178 ? 84.656  101.742 46.418  1.00 10.26 ? 178 LEU A CD2  1 
ATOM   2475  H  H    . LEU A  1 178 ? 84.883  106.264 48.056  1.00 10.69 ? 178 LEU A H    1 
ATOM   2476  H  HA   . LEU A  1 178 ? 85.271  105.214 45.693  1.00 10.23 ? 178 LEU A HA   1 
ATOM   2477  H  HB2  . LEU A  1 178 ? 86.173  104.333 47.744  1.00 10.63 ? 178 LEU A HB2  1 
ATOM   2478  H  HB3  . LEU A  1 178 ? 84.758  103.682 48.017  1.00 10.63 ? 178 LEU A HB3  1 
ATOM   2479  H  HG   . LEU A  1 178 ? 86.148  102.931 45.710  1.00 13.26 ? 178 LEU A HG   1 
ATOM   2480  H  HD11 . LEU A  1 178 ? 87.219  101.213 46.865  1.00 23.01 ? 178 LEU A HD11 1 
ATOM   2481  H  HD12 . LEU A  1 178 ? 87.703  102.608 47.406  1.00 23.01 ? 178 LEU A HD12 1 
ATOM   2482  H  HD13 . LEU A  1 178 ? 86.654  101.768 48.224  1.00 23.01 ? 178 LEU A HD13 1 
ATOM   2483  H  HD21 . LEU A  1 178 ? 84.957  100.957 45.955  1.00 12.32 ? 178 LEU A HD21 1 
ATOM   2484  H  HD22 . LEU A  1 178 ? 84.318  101.501 47.284  1.00 12.32 ? 178 LEU A HD22 1 
ATOM   2485  H  HD23 . LEU A  1 178 ? 83.970  102.180 45.909  1.00 12.32 ? 178 LEU A HD23 1 
ATOM   2486  N  N    . GLN A  1 179 ? 82.382  104.509 46.942  1.00 9.72  ? 179 GLN A N    1 
ATOM   2487  C  CA   . GLN A  1 179 ? 81.017  104.137 46.583  1.00 9.93  ? 179 GLN A CA   1 
ATOM   2488  C  C    . GLN A  1 179 ? 80.305  105.142 45.698  1.00 9.11  ? 179 GLN A C    1 
ATOM   2489  O  O    . GLN A  1 179 ? 79.508  104.725 44.838  1.00 8.57  ? 179 GLN A O    1 
ATOM   2490  C  CB   . GLN A  1 179 ? 80.162  103.854 47.822  1.00 12.47 ? 179 GLN A CB   1 
ATOM   2491  C  CG   . GLN A  1 179 ? 80.595  102.652 48.584  1.00 11.15 ? 179 GLN A CG   1 
ATOM   2492  C  CD   . GLN A  1 179 ? 80.669  101.402 47.736  1.00 14.66 ? 179 GLN A CD   1 
ATOM   2493  O  OE1  . GLN A  1 179 ? 79.757  101.077 46.998  1.00 19.36 ? 179 GLN A OE1  1 
ATOM   2494  N  NE2  . GLN A  1 179 ? 81.790  100.708 47.826  1.00 20.12 ? 179 GLN A NE2  1 
ATOM   2495  H  H    . GLN A  1 179 ? 82.508  104.631 47.784  1.00 11.66 ? 179 GLN A H    1 
ATOM   2496  H  HA   . GLN A  1 179 ? 81.062  103.300 46.076  1.00 11.91 ? 179 GLN A HA   1 
ATOM   2497  H  HB2  . GLN A  1 179 ? 80.213  104.618 48.418  1.00 14.97 ? 179 GLN A HB2  1 
ATOM   2498  H  HB3  . GLN A  1 179 ? 79.244  103.714 47.544  1.00 14.97 ? 179 GLN A HB3  1 
ATOM   2499  H  HG2  . GLN A  1 179 ? 81.478  102.815 48.953  1.00 13.38 ? 179 GLN A HG2  1 
ATOM   2500  H  HG3  . GLN A  1 179 ? 79.962  102.490 49.301  1.00 13.38 ? 179 GLN A HG3  1 
ATOM   2501  H  HE21 . GLN A  1 179 ? 82.422  100.977 48.343  1.00 24.14 ? 179 GLN A HE21 1 
ATOM   2502  H  HE22 . GLN A  1 179 ? 81.888  99.988  47.366  1.00 24.14 ? 179 GLN A HE22 1 
ATOM   2503  N  N    . THR A  1 180 ? 80.542  106.454 45.912  1.00 8.23  ? 180 THR A N    1 
ATOM   2504  C  CA   . THR A  1 180 ? 79.937  107.483 45.071  1.00 10.79 ? 180 THR A CA   1 
ATOM   2505  C  C    . THR A  1 180 ? 80.419  107.379 43.617  1.00 10.45 ? 180 THR A C    1 
ATOM   2506  O  O    . THR A  1 180 ? 79.602  107.390 42.685  1.00 8.34  ? 180 THR A O    1 
ATOM   2507  C  CB   . THR A  1 180 ? 80.244  108.898 45.592  1.00 10.79 ? 180 THR A CB   1 
ATOM   2508  O  OG1  . THR A  1 180 ? 79.650  109.052 46.865  1.00 10.29 ? 180 THR A OG1  1 
ATOM   2509  C  CG2  . THR A  1 180 ? 79.685  109.986 44.692  1.00 9.03  ? 180 THR A CG2  1 
ATOM   2510  H  H    . THR A  1 180 ? 81.048  106.762 46.536  1.00 9.87  ? 180 THR A H    1 
ATOM   2511  H  HA   . THR A  1 180 ? 78.964  107.364 45.075  1.00 12.94 ? 180 THR A HA   1 
ATOM   2512  H  HB   . THR A  1 180 ? 81.204  109.018 45.664  1.00 12.95 ? 180 THR A HB   1 
ATOM   2513  H  HG1  . THR A  1 180 ? 79.953  108.496 47.386  1.00 12.35 ? 180 THR A HG1  1 
ATOM   2514  H  HG21 . THR A  1 180 ? 79.897  110.851 45.051  1.00 10.83 ? 180 THR A HG21 1 
ATOM   2515  H  HG22 . THR A  1 180 ? 80.064  109.912 43.813  1.00 10.83 ? 180 THR A HG22 1 
ATOM   2516  H  HG23 . THR A  1 180 ? 78.731  109.901 44.628  1.00 10.83 ? 180 THR A HG23 1 
ATOM   2517  N  N    . ILE A  1 181 ? 81.731  107.270 43.416  1.00 8.78  ? 181 ILE A N    1 
ATOM   2518  C  CA   . ILE A  1 181 ? 82.251  107.164 42.052  1.00 13.91 ? 181 ILE A CA   1 
ATOM   2519  C  C    . ILE A  1 181 ? 81.803  105.846 41.418  1.00 14.98 ? 181 ILE A C    1 
ATOM   2520  O  O    . ILE A  1 181 ? 81.514  105.814 40.243  1.00 10.38 ? 181 ILE A O    1 
ATOM   2521  C  CB   . ILE A  1 181 ? 83.798  107.349 41.963  1.00 11.61 ? 181 ILE A CB   1 
ATOM   2522  C  CG1  . ILE A  1 181 ? 84.207  108.789 42.270  1.00 16.09 ? 181 ILE A CG1  1 
ATOM   2523  C  CG2  . ILE A  1 181 ? 84.337  106.942 40.573  1.00 11.83 ? 181 ILE A CG2  1 
ATOM   2524  C  CD1  . ILE A  1 181 ? 83.545  109.852 41.413  1.00 23.69 ? 181 ILE A CD1  1 
ATOM   2525  H  H    . ILE A  1 181 ? 82.328  107.255 44.034  1.00 10.54 ? 181 ILE A H    1 
ATOM   2526  H  HA   . ILE A  1 181 ? 81.850  107.884 41.523  1.00 16.70 ? 181 ILE A HA   1 
ATOM   2527  H  HB   . ILE A  1 181 ? 84.209  106.772 42.625  1.00 13.94 ? 181 ILE A HB   1 
ATOM   2528  H  HG12 . ILE A  1 181 ? 83.984  108.980 43.195  1.00 19.31 ? 181 ILE A HG12 1 
ATOM   2529  H  HG13 . ILE A  1 181 ? 85.165  108.869 42.145  1.00 19.31 ? 181 ILE A HG13 1 
ATOM   2530  H  HG21 . ILE A  1 181 ? 85.288  107.070 40.558  1.00 14.19 ? 181 ILE A HG21 1 
ATOM   2531  H  HG22 . ILE A  1 181 ? 84.127  106.019 40.416  1.00 14.19 ? 181 ILE A HG22 1 
ATOM   2532  H  HG23 . ILE A  1 181 ? 83.921  107.492 39.905  1.00 14.19 ? 181 ILE A HG23 1 
ATOM   2533  H  HD11 . ILE A  1 181 ? 83.866  110.715 41.684  1.00 28.43 ? 181 ILE A HD11 1 
ATOM   2534  H  HD12 . ILE A  1 181 ? 83.767  109.693 40.493  1.00 28.43 ? 181 ILE A HD12 1 
ATOM   2535  H  HD13 . ILE A  1 181 ? 82.594  109.803 41.535  1.00 28.43 ? 181 ILE A HD13 1 
ATOM   2536  N  N    . ASN A  1 182 ? 81.692  104.769 42.192  1.00 8.70  ? 182 ASN A N    1 
ATOM   2537  C  CA   . ASN A  1 182 ? 81.184  103.529 41.628  1.00 12.06 ? 182 ASN A CA   1 
ATOM   2538  C  C    . ASN A  1 182 ? 79.730  103.670 41.163  1.00 15.67 ? 182 ASN A C    1 
ATOM   2539  O  O    . ASN A  1 182 ? 79.349  103.157 40.107  1.00 13.21 ? 182 ASN A O    1 
ATOM   2540  C  CB   . ASN A  1 182 ? 81.315  102.397 42.649  1.00 11.86 ? 182 ASN A CB   1 
ATOM   2541  C  CG   . ASN A  1 182 ? 80.878  101.063 42.083  1.00 17.02 ? 182 ASN A CG   1 
ATOM   2542  O  OD1  . ASN A  1 182 ? 81.576  100.461 41.266  1.00 24.21 ? 182 ASN A OD1  1 
ATOM   2543  N  ND2  . ASN A  1 182 ? 79.702  100.614 42.486  1.00 19.19 ? 182 ASN A ND2  1 
ATOM   2544  H  H    . ASN A  1 182 ? 81.900  104.732 43.026  1.00 10.45 ? 182 ASN A H    1 
ATOM   2545  H  HA   . ASN A  1 182 ? 81.727  103.292 40.847  1.00 14.48 ? 182 ASN A HA   1 
ATOM   2546  H  HB2  . ASN A  1 182 ? 82.242  102.320 42.922  1.00 14.23 ? 182 ASN A HB2  1 
ATOM   2547  H  HB3  . ASN A  1 182 ? 80.756  102.595 43.418  1.00 14.23 ? 182 ASN A HB3  1 
ATOM   2548  H  HD21 . ASN A  1 182 ? 79.232  101.075 43.040  1.00 23.03 ? 182 ASN A HD21 1 
ATOM   2549  H  HD22 . ASN A  1 182 ? 79.406  99.861  42.194  1.00 23.03 ? 182 ASN A HD22 1 
ATOM   2550  N  N    . ALA A  1 183 ? 78.920  104.394 41.925  1.00 8.91  ? 183 ALA A N    1 
ATOM   2551  C  CA   . ALA A  1 183 ? 77.511  104.579 41.571  1.00 9.05  ? 183 ALA A CA   1 
ATOM   2552  C  C    . ALA A  1 183 ? 77.381  105.505 40.380  1.00 9.41  ? 183 ALA A C    1 
ATOM   2553  O  O    . ALA A  1 183 ? 76.472  105.350 39.560  1.00 14.39 ? 183 ALA A O    1 
ATOM   2554  C  CB   . ALA A  1 183 ? 76.717  105.146 42.749  1.00 10.37 ? 183 ALA A CB   1 
ATOM   2555  H  H    . ALA A  1 183 ? 79.157  104.789 42.651  1.00 10.69 ? 183 ALA A H    1 
ATOM   2556  H  HA   . ALA A  1 183 ? 77.122  103.712 41.329  1.00 10.86 ? 183 ALA A HA   1 
ATOM   2557  H  HB1  . ALA A  1 183 ? 75.801  105.255 42.485  1.00 12.44 ? 183 ALA A HB1  1 
ATOM   2558  H  HB2  . ALA A  1 183 ? 76.775  104.535 43.487  1.00 12.44 ? 183 ALA A HB2  1 
ATOM   2559  H  HB3  . ALA A  1 183 ? 77.090  105.996 42.997  1.00 12.44 ? 183 ALA A HB3  1 
ATOM   2560  N  N    . MET A  1 184 ? 78.260  106.486 40.310  1.00 11.04 ? 184 MET A N    1 
ATOM   2561  C  CA   . MET A  1 184 ? 78.234  107.448 39.213  1.00 11.19 ? 184 MET A CA   1 
ATOM   2562  C  C    . MET A  1 184 ? 78.619  106.794 37.878  1.00 13.73 ? 184 MET A C    1 
ATOM   2563  O  O    . MET A  1 184 ? 78.403  107.378 36.822  1.00 19.16 ? 184 MET A O    1 
ATOM   2564  C  CB   . MET A  1 184 ? 79.164  108.616 39.499  1.00 13.11 ? 184 MET A CB   1 
ATOM   2565  C  CG   . MET A  1 184 ? 78.544  109.663 40.416  1.00 16.03 ? 184 MET A CG   1 
ATOM   2566  S  SD   . MET A  1 184 ? 79.618  110.972 41.043  1.00 16.61 ? 184 MET A SD   1 
ATOM   2567  C  CE   . MET A  1 184 ? 80.009  111.928 39.573  1.00 25.22 ? 184 MET A CE   1 
ATOM   2568  H  H    . MET A  1 184 ? 78.886  106.621 40.884  1.00 13.25 ? 184 MET A H    1 
ATOM   2569  H  HA   . MET A  1 184 ? 77.325  107.805 39.134  1.00 13.43 ? 184 MET A HA   1 
ATOM   2570  H  HB2  . MET A  1 184 ? 79.967  108.281 39.927  1.00 15.74 ? 184 MET A HB2  1 
ATOM   2571  H  HB3  . MET A  1 184 ? 79.391  109.050 38.662  1.00 15.74 ? 184 MET A HB3  1 
ATOM   2572  H  HG2  . MET A  1 184 ? 77.823  110.096 39.932  1.00 19.24 ? 184 MET A HG2  1 
ATOM   2573  H  HG3  . MET A  1 184 ? 78.177  109.204 41.188  1.00 19.24 ? 184 MET A HG3  1 
ATOM   2574  H  HE1  . MET A  1 184 ? 80.585  112.656 39.818  1.00 30.27 ? 184 MET A HE1  1 
ATOM   2575  H  HE2  . MET A  1 184 ? 80.451  111.359 38.939  1.00 30.27 ? 184 MET A HE2  1 
ATOM   2576  H  HE3  . MET A  1 184 ? 79.194  112.268 39.196  1.00 30.27 ? 184 MET A HE3  1 
ATOM   2577  N  N    . GLY A  1 185 ? 79.223  105.620 37.938  1.00 10.93 ? 185 GLY A N    1 
ATOM   2578  C  CA   . GLY A  1 185 ? 79.477  104.825 36.743  1.00 11.04 ? 185 GLY A CA   1 
ATOM   2579  C  C    . GLY A  1 185 ? 80.932  104.539 36.457  1.00 10.11 ? 185 GLY A C    1 
ATOM   2580  O  O    . GLY A  1 185 ? 81.231  103.844 35.489  1.00 10.50 ? 185 GLY A O    1 
ATOM   2581  H  H    . GLY A  1 185 ? 79.500  105.254 38.666  1.00 13.11 ? 185 GLY A H    1 
ATOM   2582  H  HA2  . GLY A  1 185 ? 79.017  103.975 36.828  1.00 13.25 ? 185 GLY A HA2  1 
ATOM   2583  H  HA3  . GLY A  1 185 ? 79.108  105.288 35.974  1.00 13.25 ? 185 GLY A HA3  1 
ATOM   2584  N  N    . GLY A  1 186 ? 81.835  105.066 37.282  1.00 9.67  ? 186 GLY A N    1 
ATOM   2585  C  CA   . GLY A  1 186 ? 83.257  104.858 37.071  1.00 13.38 ? 186 GLY A CA   1 
ATOM   2586  C  C    . GLY A  1 186 ? 83.861  103.689 37.819  1.00 12.45 ? 186 GLY A C    1 
ATOM   2587  O  O    . GLY A  1 186 ? 83.181  102.970 38.561  1.00 12.11 ? 186 GLY A O    1 
ATOM   2588  H  H    . GLY A  1 186 ? 81.646  105.546 37.970  1.00 11.60 ? 186 GLY A H    1 
ATOM   2589  H  HA2  . GLY A  1 186 ? 83.416  104.719 36.124  1.00 16.05 ? 186 GLY A HA2  1 
ATOM   2590  H  HA3  . GLY A  1 186 ? 83.734  105.660 37.338  1.00 16.05 ? 186 GLY A HA3  1 
ATOM   2591  N  N    . VAL A  1 187 ? 85.163  103.527 37.642  1.00 13.01 ? 187 VAL A N    1 
ATOM   2592  C  CA   . VAL A  1 187 ? 85.922  102.509 38.354  1.00 12.31 ? 187 VAL A CA   1 
ATOM   2593  C  C    . VAL A  1 187 ? 86.825  103.210 39.367  1.00 9.88  ? 187 VAL A C    1 
ATOM   2594  O  O    . VAL A  1 187 ? 87.894  103.717 39.014  1.00 12.31 ? 187 VAL A O    1 
ATOM   2595  C  CB   . VAL A  1 187 ? 86.744  101.674 37.370  1.00 14.40 ? 187 VAL A CB   1 
ATOM   2596  C  CG1  . VAL A  1 187 ? 87.565  100.605 38.095  1.00 15.02 ? 187 VAL A CG1  1 
ATOM   2597  C  CG2  . VAL A  1 187 ? 85.814  101.028 36.347  1.00 16.49 ? 187 VAL A CG2  1 
ATOM   2598  H  H    . VAL A  1 187 ? 85.639  104.002 37.105  1.00 15.61 ? 187 VAL A H    1 
ATOM   2599  H  HA   . VAL A  1 187 ? 85.309  101.915 38.836  1.00 14.77 ? 187 VAL A HA   1 
ATOM   2600  H  HB   . VAL A  1 187 ? 87.364  102.262 36.890  1.00 17.28 ? 187 VAL A HB   1 
ATOM   2601  H  HG11 . VAL A  1 187 ? 88.066  100.103 37.448  1.00 18.02 ? 187 VAL A HG11 1 
ATOM   2602  H  HG12 . VAL A  1 187 ? 88.163  101.035 38.711  1.00 18.02 ? 187 VAL A HG12 1 
ATOM   2603  H  HG13 . VAL A  1 187 ? 86.968  100.022 38.571  1.00 18.02 ? 187 VAL A HG13 1 
ATOM   2604  H  HG21 . VAL A  1 187 ? 86.338  100.507 35.735  1.00 19.78 ? 187 VAL A HG21 1 
ATOM   2605  H  HG22 . VAL A  1 187 ? 85.189  100.462 36.807  1.00 19.78 ? 187 VAL A HG22 1 
ATOM   2606  H  HG23 . VAL A  1 187 ? 85.344  101.717 35.873  1.00 19.78 ? 187 VAL A HG23 1 
ATOM   2607  N  N    . PRO A  1 188 ? 86.378  103.269 40.641  1.00 11.03 ? 188 PRO A N    1 
ATOM   2608  C  CA   . PRO A  1 188 ? 87.082  104.055 41.659  1.00 14.07 ? 188 PRO A CA   1 
ATOM   2609  C  C    . PRO A  1 188 ? 88.397  103.405 42.049  1.00 15.75 ? 188 PRO A C    1 
ATOM   2610  O  O    . PRO A  1 188 ? 88.459  102.198 42.348  1.00 16.24 ? 188 PRO A O    1 
ATOM   2611  C  CB   . PRO A  1 188 ? 86.107  104.064 42.828  1.00 13.77 ? 188 PRO A CB   1 
ATOM   2612  C  CG   . PRO A  1 188 ? 85.369  102.815 42.710  1.00 17.24 ? 188 PRO A CG   1 
ATOM   2613  C  CD   . PRO A  1 188 ? 85.253  102.521 41.224  1.00 18.21 ? 188 PRO A CD   1 
ATOM   2614  H  HA   . PRO A  1 188 ? 87.240  104.971 41.347  1.00 16.88 ? 188 PRO A HA   1 
ATOM   2615  H  HB2  . PRO A  1 188 ? 86.599  104.095 43.664  1.00 16.53 ? 188 PRO A HB2  1 
ATOM   2616  H  HB3  . PRO A  1 188 ? 85.510  104.825 42.751  1.00 16.53 ? 188 PRO A HB3  1 
ATOM   2617  H  HG2  . PRO A  1 188 ? 85.859  102.107 43.158  1.00 20.69 ? 188 PRO A HG2  1 
ATOM   2618  H  HG3  . PRO A  1 188 ? 84.489  102.921 43.104  1.00 20.69 ? 188 PRO A HG3  1 
ATOM   2619  H  HD2  . PRO A  1 188 ? 85.357  101.571 41.058  1.00 21.86 ? 188 PRO A HD2  1 
ATOM   2620  H  HD3  . PRO A  1 188 ? 84.410  102.854 40.878  1.00 21.86 ? 188 PRO A HD3  1 
ATOM   2621  N  N    . THR A  1 189 ? 89.449  104.208 42.026  1.00 9.57  ? 189 THR A N    1 
ATOM   2622  C  CA   . THR A  1 189 ? 90.797  103.752 42.207  1.00 9.95  ? 189 THR A CA   1 
ATOM   2623  C  C    . THR A  1 189 ? 91.420  104.521 43.379  1.00 9.76  ? 189 THR A C    1 
ATOM   2624  O  O    . THR A  1 189 ? 91.897  105.631 43.226  1.00 9.60  ? 189 THR A O    1 
ATOM   2625  C  CB   . THR A  1 189 ? 91.556  103.977 40.898  1.00 11.61 ? 189 THR A CB   1 
ATOM   2626  O  OG1  . THR A  1 189 ? 90.811  103.350 39.842  1.00 19.72 ? 189 THR A OG1  1 
ATOM   2627  C  CG2  . THR A  1 189 ? 92.941  103.424 40.975  1.00 11.77 ? 189 THR A CG2  1 
ATOM   2628  H  H    . THR A  1 189 ? 89.393  105.058 41.902  1.00 11.48 ? 189 THR A H    1 
ATOM   2629  H  HA   . THR A  1 189 ? 90.801  102.794 42.417  1.00 11.94 ? 189 THR A HA   1 
ATOM   2630  H  HB   . THR A  1 189 ? 91.618  104.929 40.724  1.00 13.93 ? 189 THR A HB   1 
ATOM   2631  H  HG1  . THR A  1 189 ? 91.197  103.456 39.126  1.00 23.66 ? 189 THR A HG1  1 
ATOM   2632  H  HG21 . THR A  1 189 ? 93.401  103.575 40.146  1.00 14.12 ? 189 THR A HG21 1 
ATOM   2633  H  HG22 . THR A  1 189 ? 93.427  103.853 41.683  1.00 14.12 ? 189 THR A HG22 1 
ATOM   2634  H  HG23 . THR A  1 189 ? 92.908  102.480 41.146  1.00 14.12 ? 189 THR A HG23 1 
ATOM   2635  N  N    . PRO A  1 190 ? 91.416  103.923 44.576  1.00 9.85  ? 190 PRO A N    1 
ATOM   2636  C  CA   . PRO A  1 190 ? 91.918  104.685 45.736  1.00 15.06 ? 190 PRO A CA   1 
ATOM   2637  C  C    . PRO A  1 190 ? 93.431  104.967 45.688  1.00 19.40 ? 190 PRO A C    1 
ATOM   2638  O  O    . PRO A  1 190 ? 94.238  104.074 45.415  1.00 16.11 ? 190 PRO A O    1 
ATOM   2639  C  CB   . PRO A  1 190 ? 91.568  103.795 46.949  1.00 19.66 ? 190 PRO A CB   1 
ATOM   2640  C  CG   . PRO A  1 190 ? 90.653  102.732 46.433  1.00 21.74 ? 190 PRO A CG   1 
ATOM   2641  C  CD   . PRO A  1 190 ? 90.868  102.611 44.943  1.00 17.27 ? 190 PRO A CD   1 
ATOM   2642  H  HA   . PRO A  1 190 ? 91.437  105.535 45.814  1.00 18.08 ? 190 PRO A HA   1 
ATOM   2643  H  HB2  . PRO A  1 190 ? 92.379  103.401 47.307  1.00 23.59 ? 190 PRO A HB2  1 
ATOM   2644  H  HB3  . PRO A  1 190 ? 91.122  104.329 47.625  1.00 23.59 ? 190 PRO A HB3  1 
ATOM   2645  H  HG2  . PRO A  1 190 ? 90.863  101.892 46.870  1.00 26.09 ? 190 PRO A HG2  1 
ATOM   2646  H  HG3  . PRO A  1 190 ? 89.735  102.984 46.619  1.00 26.09 ? 190 PRO A HG3  1 
ATOM   2647  H  HD2  . PRO A  1 190 ? 91.509  101.910 44.749  1.00 20.73 ? 190 PRO A HD2  1 
ATOM   2648  H  HD3  . PRO A  1 190 ? 90.024  102.458 44.490  1.00 20.73 ? 190 PRO A HD3  1 
ATOM   2649  N  N    . MET A  1 191 ? 93.814  106.222 45.926  1.00 14.16 ? 191 MET A N    1 
ATOM   2650  C  CA   . MET A  1 191 ? 95.233  106.535 46.035  1.00 10.20 ? 191 MET A CA   1 
ATOM   2651  C  C    . MET A  1 191 ? 95.394  107.860 46.752  1.00 12.07 ? 191 MET A C    1 
ATOM   2652  O  O    . MET A  1 191 ? 94.482  108.680 46.788  1.00 11.52 ? 191 MET A O    1 
ATOM   2653  C  CB   . MET A  1 191 ? 95.936  106.489 44.662  1.00 27.57 ? 191 MET A CB   1 
ATOM   2654  C  CG   . MET A  1 191 ? 96.080  107.769 43.883  1.00 30.73 ? 191 MET A CG   1 
ATOM   2655  S  SD   . MET A  1 191 ? 96.994  107.495 42.325  1.00 26.29 ? 191 MET A SD   1 
ATOM   2656  C  CE   . MET A  1 191 ? 96.102  106.104 41.660  1.00 24.11 ? 191 MET A CE   1 
ATOM   2657  H  H    . MET A  1 191 ? 93.285  106.893 46.025  1.00 16.99 ? 191 MET A H    1 
ATOM   2658  H  HA   . MET A  1 191 ? 95.650  105.843 46.588  1.00 12.24 ? 191 MET A HA   1 
ATOM   2659  H  HB2  . MET A  1 191 ? 96.832  106.143 44.801  1.00 33.08 ? 191 MET A HB2  1 
ATOM   2660  H  HB3  . MET A  1 191 ? 95.445  105.871 44.099  1.00 33.08 ? 191 MET A HB3  1 
ATOM   2661  H  HG2  . MET A  1 191 ? 95.199  108.111 43.663  1.00 36.88 ? 191 MET A HG2  1 
ATOM   2662  H  HG3  . MET A  1 191 ? 96.570  108.415 44.414  1.00 36.88 ? 191 MET A HG3  1 
ATOM   2663  H  HE1  . MET A  1 191 ? 96.494  105.855 40.819  1.00 28.93 ? 191 MET A HE1  1 
ATOM   2664  H  HE2  . MET A  1 191 ? 96.160  105.372 42.278  1.00 28.93 ? 191 MET A HE2  1 
ATOM   2665  H  HE3  . MET A  1 191 ? 95.184  106.354 41.533  1.00 28.93 ? 191 MET A HE3  1 
ATOM   2666  N  N    . SER A  1 192 ? 96.554  108.042 47.353  1.00 12.17 ? 192 SER A N    1 
ATOM   2667  C  CA   . SER A  1 192 ? 96.852  109.271 48.058  1.00 12.38 ? 192 SER A CA   1 
ATOM   2668  C  C    . SER A  1 192 ? 97.066  110.425 47.091  1.00 15.29 ? 192 SER A C    1 
ATOM   2669  O  O    . SER A  1 192 ? 97.506  110.238 45.947  1.00 12.60 ? 192 SER A O    1 
ATOM   2670  C  CB   . SER A  1 192 ? 98.093  109.066 48.935  1.00 17.62 ? 192 SER A CB   1 
ATOM   2671  O  OG   . SER A  1 192 ? 97.879  107.971 49.829  1.00 23.49 ? 192 SER A OG   1 
ATOM   2672  H  H    . SER A  1 192 ? 97.191  107.464 47.368  1.00 14.61 ? 192 SER A H    1 
ATOM   2673  H  HA   . SER A  1 192 ? 96.099  109.498 48.642  1.00 14.85 ? 192 SER A HA   1 
ATOM   2674  H  HB2  . SER A  1 192 ? 98.855  108.870 48.368  1.00 21.15 ? 192 SER A HB2  1 
ATOM   2675  H  HB3  . SER A  1 192 ? 98.256  109.871 49.450  1.00 21.15 ? 192 SER A HB3  1 
ATOM   2676  H  HG   . SER A  1 192 ? 98.542  107.860 50.299  1.00 28.19 ? 192 SER A HG   1 
ATOM   2677  N  N    . LEU A  1 193 ? 96.751  111.623 47.562  1.00 10.43 ? 193 LEU A N    1 
ATOM   2678  C  CA   . LEU A  1 193 ? 96.801  112.805 46.711  1.00 11.31 ? 193 LEU A CA   1 
ATOM   2679  C  C    . LEU A  1 193 ? 98.164  112.977 46.035  1.00 13.49 ? 193 LEU A C    1 
ATOM   2680  O  O    . LEU A  1 193 ? 98.242  113.322 44.847  1.00 16.81 ? 193 LEU A O    1 
ATOM   2681  C  CB   . LEU A  1 193 ? 96.425  114.057 47.511  1.00 10.68 ? 193 LEU A CB   1 
ATOM   2682  C  CG   . LEU A  1 193 ? 96.300  115.350 46.703  1.00 10.08 ? 193 LEU A CG   1 
ATOM   2683  C  CD1  . LEU A  1 193 ? 95.217  115.236 45.616  1.00 12.54 ? 193 LEU A CD1  1 
ATOM   2684  C  CD2  . LEU A  1 193 ? 95.995  116.541 47.595  1.00 12.33 ? 193 LEU A CD2  1 
ATOM   2685  H  H    . LEU A  1 193 ? 96.506  111.780 48.371  1.00 12.52 ? 193 LEU A H    1 
ATOM   2686  H  HA   . LEU A  1 193 ? 96.134  112.701 46.001  1.00 13.58 ? 193 LEU A HA   1 
ATOM   2687  H  HB2  . LEU A  1 193 ? 95.569  113.899 47.941  1.00 12.81 ? 193 LEU A HB2  1 
ATOM   2688  H  HB3  . LEU A  1 193 ? 97.104  114.202 48.188  1.00 12.81 ? 193 LEU A HB3  1 
ATOM   2689  H  HG   . LEU A  1 193 ? 97.145  115.523 46.260  1.00 12.09 ? 193 LEU A HG   1 
ATOM   2690  H  HD11 . LEU A  1 193 ? 95.171  116.065 45.134  1.00 15.04 ? 193 LEU A HD11 1 
ATOM   2691  H  HD12 . LEU A  1 193 ? 95.450  114.522 45.018  1.00 15.04 ? 193 LEU A HD12 1 
ATOM   2692  H  HD13 . LEU A  1 193 ? 94.373  115.053 46.034  1.00 15.04 ? 193 LEU A HD13 1 
ATOM   2693  H  HD21 . LEU A  1 193 ? 95.925  117.329 47.051  1.00 14.79 ? 193 LEU A HD21 1 
ATOM   2694  H  HD22 . LEU A  1 193 ? 95.166  116.384 48.053  1.00 14.79 ? 193 LEU A HD22 1 
ATOM   2695  H  HD23 . LEU A  1 193 ? 96.707  116.644 48.231  1.00 14.79 ? 193 LEU A HD23 1 
ATOM   2696  N  N    A SER A  1 194 ? 99.232  112.719 46.774  0.51 13.93 ? 194 SER A N    1 
ATOM   2697  N  N    B SER A  1 194 ? 99.241  112.729 46.775  0.49 13.94 ? 194 SER A N    1 
ATOM   2698  C  CA   A SER A  1 194 ? 100.574 112.939 46.253  0.51 18.09 ? 194 SER A CA   1 
ATOM   2699  C  CA   B SER A  1 194 ? 100.591 112.938 46.248  0.49 18.08 ? 194 SER A CA   1 
ATOM   2700  C  C    A SER A  1 194 ? 100.949 111.970 45.124  0.51 20.06 ? 194 SER A C    1 
ATOM   2701  C  C    B SER A  1 194 ? 100.951 111.970 45.116  0.49 20.09 ? 194 SER A C    1 
ATOM   2702  O  O    A SER A  1 194 ? 101.899 112.222 44.397  0.51 18.04 ? 194 SER A O    1 
ATOM   2703  O  O    B SER A  1 194 ? 101.895 112.223 44.381  0.49 18.27 ? 194 SER A O    1 
ATOM   2704  C  CB   A SER A  1 194 ? 101.601 112.844 47.380  0.51 19.60 ? 194 SER A CB   1 
ATOM   2705  C  CB   B SER A  1 194 ? 101.635 112.838 47.366  0.49 19.67 ? 194 SER A CB   1 
ATOM   2706  O  OG   A SER A  1 194 ? 101.701 111.522 47.876  0.51 14.37 ? 194 SER A OG   1 
ATOM   2707  O  OG   B SER A  1 194 ? 101.524 113.920 48.272  0.49 16.47 ? 194 SER A OG   1 
ATOM   2708  H  H    A SER A  1 194 ? 99.209  112.417 47.579  0.51 16.71 ? 194 SER A H    1 
ATOM   2709  H  H    B SER A  1 194 ? 99.220  112.440 47.585  0.49 16.73 ? 194 SER A H    1 
ATOM   2710  H  HA   A SER A  1 194 ? 100.620 113.847 45.889  0.51 21.71 ? 194 SER A HA   1 
ATOM   2711  H  HA   B SER A  1 194 ? 100.641 113.846 45.882  0.49 21.69 ? 194 SER A HA   1 
ATOM   2712  H  HB2  A SER A  1 194 ? 102.467 113.118 47.040  0.51 23.51 ? 194 SER A HB2  1 
ATOM   2713  H  HB2  B SER A  1 194 ? 101.500 112.008 47.849  0.49 23.61 ? 194 SER A HB2  1 
ATOM   2714  H  HB3  A SER A  1 194 ? 101.329 113.431 48.103  0.51 23.51 ? 194 SER A HB3  1 
ATOM   2715  H  HB3  B SER A  1 194 ? 102.521 112.850 46.971  0.49 23.61 ? 194 SER A HB3  1 
ATOM   2716  H  HG   A SER A  1 194 ? 102.256 111.490 48.479  0.51 17.25 ? 194 SER A HG   1 
ATOM   2717  H  HG   B SER A  1 194 ? 102.089 113.850 48.863  0.49 19.77 ? 194 SER A HG   1 
ATOM   2718  N  N    . ASP A  1 195 ? 100.216 110.865 44.995  1.00 19.08 ? 195 ASP A N    1 
ATOM   2719  C  CA   . ASP A  1 195 ? 100.449 109.889 43.920  1.00 18.50 ? 195 ASP A CA   1 
ATOM   2720  C  C    . ASP A  1 195 ? 99.600  110.140 42.669  1.00 15.62 ? 195 ASP A C    1 
ATOM   2721  O  O    . ASP A  1 195 ? 99.779  109.468 41.633  1.00 15.40 ? 195 ASP A O    1 
ATOM   2722  C  CB   . ASP A  1 195 ? 100.122 108.474 44.412  1.00 13.83 ? 195 ASP A CB   1 
ATOM   2723  C  CG   . ASP A  1 195 ? 101.158 107.931 45.387  1.00 23.40 ? 195 ASP A CG   1 
ATOM   2724  O  OD1  . ASP A  1 195 ? 102.358 108.228 45.219  1.00 24.59 ? 195 ASP A OD1  1 
ATOM   2725  O  OD2  . ASP A  1 195 ? 100.770 107.190 46.321  1.00 29.01 ? 195 ASP A OD2  1 
ATOM   2726  H  H    . ASP A  1 195 ? 99.571  110.652 45.523  0.49 22.90 ? 195 ASP A H    1 
ATOM   2727  H  HA   . ASP A  1 195 ? 101.393 109.914 43.661  1.00 22.20 ? 195 ASP A HA   1 
ATOM   2728  H  HB2  . ASP A  1 195 ? 99.264  108.487 44.863  1.00 16.60 ? 195 ASP A HB2  1 
ATOM   2729  H  HB3  . ASP A  1 195 ? 100.087 107.876 43.649  1.00 16.60 ? 195 ASP A HB3  1 
ATOM   2730  N  N    . VAL A  1 196 ? 98.648  111.066 42.753  1.00 10.74 ? 196 VAL A N    1 
ATOM   2731  C  CA   . VAL A  1 196 ? 97.708  111.266 41.663  1.00 14.32 ? 196 VAL A CA   1 
ATOM   2732  C  C    . VAL A  1 196 ? 98.388  111.755 40.374  1.00 13.16 ? 196 VAL A C    1 
ATOM   2733  O  O    . VAL A  1 196 ? 98.168  111.169 39.335  1.00 13.51 ? 196 VAL A O    1 
ATOM   2734  C  CB   . VAL A  1 196 ? 96.561  112.231 42.040  1.00 16.16 ? 196 VAL A CB   1 
ATOM   2735  C  CG1  . VAL A  1 196 ? 95.632  112.439 40.856  1.00 18.55 ? 196 VAL A CG1  1 
ATOM   2736  C  CG2  . VAL A  1 196 ? 95.780  111.683 43.228  1.00 11.14 ? 196 VAL A CG2  1 
ATOM   2737  H  H    . VAL A  1 196 ? 98.529  111.587 43.427  1.00 12.89 ? 196 VAL A H    1 
ATOM   2738  H  HA   . VAL A  1 196 ? 97.297  110.400 41.458  1.00 17.18 ? 196 VAL A HA   1 
ATOM   2739  H  HB   . VAL A  1 196 ? 96.938  113.100 42.293  1.00 19.39 ? 196 VAL A HB   1 
ATOM   2740  H  HG11 . VAL A  1 196 ? 94.929  113.041 41.113  1.00 22.26 ? 196 VAL A HG11 1 
ATOM   2741  H  HG12 . VAL A  1 196 ? 96.134  112.813 40.128  1.00 22.26 ? 196 VAL A HG12 1 
ATOM   2742  H  HG13 . VAL A  1 196 ? 95.261  111.592 40.598  1.00 22.26 ? 196 VAL A HG13 1 
ATOM   2743  H  HG21 . VAL A  1 196 ? 95.074  112.295 43.446  1.00 13.37 ? 196 VAL A HG21 1 
ATOM   2744  H  HG22 . VAL A  1 196 ? 95.412  110.828 42.991  1.00 13.37 ? 196 VAL A HG22 1 
ATOM   2745  H  HG23 . VAL A  1 196 ? 96.375  111.588 43.975  1.00 13.37 ? 196 VAL A HG23 1 
ATOM   2746  N  N    . TYR A  1 197 ? 99.233  112.783 40.458  1.00 13.17 ? 197 TYR A N    1 
ATOM   2747  C  CA   . TYR A  1 197 ? 99.828  113.367 39.247  1.00 11.50 ? 197 TYR A CA   1 
ATOM   2748  C  C    . TYR A  1 197 ? 100.611 112.303 38.465  1.00 17.68 ? 197 TYR A C    1 
ATOM   2749  O  O    . TYR A  1 197 ? 100.326 112.077 37.290  1.00 21.87 ? 197 TYR A O    1 
ATOM   2750  C  CB   . TYR A  1 197 ? 100.708 114.590 39.575  1.00 14.70 ? 197 TYR A CB   1 
ATOM   2751  C  CG   . TYR A  1 197 ? 101.178 115.370 38.351  1.00 16.66 ? 197 TYR A CG   1 
ATOM   2752  C  CD1  . TYR A  1 197 ? 102.206 114.887 37.553  1.00 22.28 ? 197 TYR A CD1  1 
ATOM   2753  C  CD2  . TYR A  1 197 ? 100.621 116.600 38.019  1.00 16.25 ? 197 TYR A CD2  1 
ATOM   2754  C  CE1  . TYR A  1 197 ? 102.657 115.595 36.447  1.00 17.69 ? 197 TYR A CE1  1 
ATOM   2755  C  CE2  . TYR A  1 197 ? 101.063 117.316 36.902  1.00 18.69 ? 197 TYR A CE2  1 
ATOM   2756  C  CZ   . TYR A  1 197 ? 102.078 116.808 36.129  1.00 14.75 ? 197 TYR A CZ   1 
ATOM   2757  O  OH   . TYR A  1 197 ? 102.532 117.512 35.029  1.00 14.78 ? 197 TYR A OH   1 
ATOM   2758  H  H    . TYR A  1 197 ? 99.477  113.158 41.192  1.00 15.80 ? 197 TYR A H    1 
ATOM   2759  H  HA   . TYR A  1 197 ? 99.102  113.679 38.667  1.00 13.80 ? 197 TYR A HA   1 
ATOM   2760  H  HB2  . TYR A  1 197 ? 100.200 115.197 40.135  1.00 17.64 ? 197 TYR A HB2  1 
ATOM   2761  H  HB3  . TYR A  1 197 ? 101.497 114.286 40.052  1.00 17.64 ? 197 TYR A HB3  1 
ATOM   2762  H  HD1  . TYR A  1 197 ? 102.599 114.071 37.762  1.00 26.73 ? 197 TYR A HD1  1 
ATOM   2763  H  HD2  . TYR A  1 197 ? 99.933  116.946 38.541  1.00 19.50 ? 197 TYR A HD2  1 
ATOM   2764  H  HE1  . TYR A  1 197 ? 103.343 115.252 35.920  1.00 21.22 ? 197 TYR A HE1  1 
ATOM   2765  H  HE2  . TYR A  1 197 ? 100.679 118.136 36.689  1.00 22.43 ? 197 TYR A HE2  1 
ATOM   2766  H  HH   . TYR A  1 197 ? 102.813 118.246 35.262  1.00 17.74 ? 197 TYR A HH   1 
ATOM   2767  N  N    . PRO A  1 198 ? 101.559 111.610 39.122  1.00 18.43 ? 198 PRO A N    1 
ATOM   2768  C  CA   . PRO A  1 198 ? 102.272 110.546 38.388  1.00 20.25 ? 198 PRO A CA   1 
ATOM   2769  C  C    . PRO A  1 198 ? 101.364 109.391 37.958  1.00 19.94 ? 198 PRO A C    1 
ATOM   2770  O  O    . PRO A  1 198 ? 101.629 108.749 36.936  1.00 21.27 ? 198 PRO A O    1 
ATOM   2771  C  CB   . PRO A  1 198 ? 103.322 110.053 39.380  1.00 17.39 ? 198 PRO A CB   1 
ATOM   2772  C  CG   . PRO A  1 198 ? 103.291 111.026 40.547  1.00 23.07 ? 198 PRO A CG   1 
ATOM   2773  C  CD   . PRO A  1 198 ? 101.976 111.695 40.534  1.00 22.15 ? 198 PRO A CD   1 
ATOM   2774  H  HA   . PRO A  1 198 ? 102.721 110.918 37.600  1.00 24.30 ? 198 PRO A HA   1 
ATOM   2775  H  HB2  . PRO A  1 198 ? 103.093 109.159 39.677  1.00 20.87 ? 198 PRO A HB2  1 
ATOM   2776  H  HB3  . PRO A  1 198 ? 104.195 110.058 38.957  1.00 20.87 ? 198 PRO A HB3  1 
ATOM   2777  H  HG2  . PRO A  1 198 ? 103.410 110.535 41.375  1.00 27.69 ? 198 PRO A HG2  1 
ATOM   2778  H  HG3  . PRO A  1 198 ? 104.001 111.678 40.438  1.00 27.69 ? 198 PRO A HG3  1 
ATOM   2779  H  HD2  . PRO A  1 198 ? 101.349 111.220 41.101  1.00 26.58 ? 198 PRO A HD2  1 
ATOM   2780  H  HD3  . PRO A  1 198 ? 102.067 112.623 40.804  1.00 26.58 ? 198 PRO A HD3  1 
ATOM   2781  N  N    . GLY A  1 199 ? 100.308 109.130 38.722  1.00 18.62 ? 199 GLY A N    1 
ATOM   2782  C  CA   . GLY A  1 199 ? 99.308  108.151 38.324  1.00 14.53 ? 199 GLY A CA   1 
ATOM   2783  C  C    . GLY A  1 199 ? 98.619  108.520 37.021  1.00 20.87 ? 199 GLY A C    1 
ATOM   2784  O  O    . GLY A  1 199 ? 98.426  107.676 36.134  1.00 18.87 ? 199 GLY A O    1 
ATOM   2785  H  H    . GLY A  1 199 ? 100.148 109.508 39.478  1.00 22.35 ? 199 GLY A H    1 
ATOM   2786  H  HA2  . GLY A  1 199 ? 99.731  107.285 38.213  1.00 17.44 ? 199 GLY A HA2  1 
ATOM   2787  H  HA3  . GLY A  1 199 ? 98.634  108.077 39.017  1.00 17.44 ? 199 GLY A HA3  1 
ATOM   2788  N  N    . LEU A  1 200 ? 98.260  109.789 36.875  1.00 14.25 ? 200 LEU A N    1 
ATOM   2789  C  CA   . LEU A  1 200 ? 97.736  110.242 35.586  1.00 13.50 ? 200 LEU A CA   1 
ATOM   2790  C  C    . LEU A  1 200 ? 98.762  110.160 34.480  1.00 21.53 ? 200 LEU A C    1 
ATOM   2791  O  O    . LEU A  1 200 ? 98.467  109.661 33.399  1.00 14.31 ? 200 LEU A O    1 
ATOM   2792  C  CB   . LEU A  1 200 ? 97.211  111.679 35.661  1.00 11.73 ? 200 LEU A CB   1 
ATOM   2793  C  CG   . LEU A  1 200 ? 95.971  111.860 36.532  1.00 11.04 ? 200 LEU A CG   1 
ATOM   2794  C  CD1  . LEU A  1 200 ? 95.785  113.367 36.827  1.00 13.97 ? 200 LEU A CD1  1 
ATOM   2795  C  CD2  . LEU A  1 200 ? 94.735  111.271 35.896  1.00 10.95 ? 200 LEU A CD2  1 
ATOM   2796  H  H    . LEU A  1 200 ? 98.307  110.394 37.484  1.00 17.09 ? 200 LEU A H    1 
ATOM   2797  H  HA   . LEU A  1 200 ? 96.985  109.665 35.336  1.00 16.20 ? 200 LEU A HA   1 
ATOM   2798  H  HB2  . LEU A  1 200 ? 97.909  112.246 36.024  1.00 14.07 ? 200 LEU A HB2  1 
ATOM   2799  H  HB3  . LEU A  1 200 ? 96.985  111.974 34.765  1.00 14.07 ? 200 LEU A HB3  1 
ATOM   2800  H  HG   . LEU A  1 200 ? 96.114  111.408 37.378  1.00 13.25 ? 200 LEU A HG   1 
ATOM   2801  H  HD11 . LEU A  1 200 ? 95.006  113.484 37.375  1.00 16.76 ? 200 LEU A HD11 1 
ATOM   2802  H  HD12 . LEU A  1 200 ? 96.562  113.692 37.288  1.00 16.76 ? 200 LEU A HD12 1 
ATOM   2803  H  HD13 . LEU A  1 200 ? 95.676  113.836 35.997  1.00 16.76 ? 200 LEU A HD13 1 
ATOM   2804  H  HD21 . LEU A  1 200 ? 93.987  111.410 36.481  1.00 13.15 ? 200 LEU A HD21 1 
ATOM   2805  H  HD22 . LEU A  1 200 ? 94.580  111.706 35.055  1.00 13.15 ? 200 LEU A HD22 1 
ATOM   2806  H  HD23 . LEU A  1 200 ? 94.874  110.331 35.759  1.00 13.15 ? 200 LEU A HD23 1 
ATOM   2807  N  N    . SER A  1 201 ? 99.972  110.626 34.750  1.00 27.04 ? 201 SER A N    1 
ATOM   2808  C  CA   . SER A  1 201 ? 101.001 110.669 33.715  1.00 27.31 ? 201 SER A CA   1 
ATOM   2809  C  C    . SER A  1 201 ? 101.373 109.256 33.262  1.00 22.86 ? 201 SER A C    1 
ATOM   2810  O  O    . SER A  1 201 ? 101.626 109.034 32.081  1.00 22.89 ? 201 SER A O    1 
ATOM   2811  C  CB   . SER A  1 201 ? 102.235 111.442 34.202  1.00 25.91 ? 201 SER A CB   1 
ATOM   2812  O  OG   . SER A  1 201 ? 102.947 110.688 35.165  1.00 41.93 ? 201 SER A OG   1 
ATOM   2813  H  H    . SER A  1 201 ? 100.224 110.921 35.517  1.00 32.45 ? 201 SER A H    1 
ATOM   2814  H  HA   . SER A  1 201 ? 100.642 111.145 32.937  1.00 32.78 ? 201 SER A HA   1 
ATOM   2815  H  HB2  . SER A  1 201 ? 102.816 111.620 33.446  1.00 31.10 ? 201 SER A HB2  1 
ATOM   2816  H  HB3  . SER A  1 201 ? 101.948 112.277 34.604  1.00 31.10 ? 201 SER A HB3  1 
ATOM   2817  H  HG   . SER A  1 201 ? 103.604 111.108 35.420  1.00 50.31 ? 201 SER A HG   1 
ATOM   2818  N  N    . GLU A  1 202 ? 101.372 108.294 34.177  1.00 21.24 ? 202 GLU A N    1 
ATOM   2819  C  CA   . GLU A  1 202 ? 101.747 106.926 33.826  1.00 28.79 ? 202 GLU A CA   1 
ATOM   2820  C  C    . GLU A  1 202 ? 100.578 106.117 33.251  1.00 31.65 ? 202 GLU A C    1 
ATOM   2821  O  O    . GLU A  1 202 ? 100.768 104.992 32.803  1.00 31.94 ? 202 GLU A O    1 
ATOM   2822  C  CB   . GLU A  1 202 ? 102.352 106.205 35.032  1.00 28.84 ? 202 GLU A CB   1 
ATOM   2823  C  CG   . GLU A  1 202 ? 103.582 106.907 35.603  1.00 40.85 ? 202 GLU A CG   1 
ATOM   2824  C  CD   . GLU A  1 202 ? 104.038 106.332 36.940  1.00 43.24 ? 202 GLU A CD   1 
ATOM   2825  O  OE1  . GLU A  1 202 ? 103.620 105.203 37.277  1.00 50.07 ? 202 GLU A OE1  1 
ATOM   2826  O  OE2  . GLU A  1 202 ? 104.821 107.007 37.649  1.00 38.78 ? 202 GLU A OE2  1 
ATOM   2827  H  H    . GLU A  1 202 ? 101.160 108.404 35.003  1.00 25.49 ? 202 GLU A H    1 
ATOM   2828  H  HA   . GLU A  1 202 ? 102.440 106.967 33.134  1.00 34.54 ? 202 GLU A HA   1 
ATOM   2829  H  HB2  . GLU A  1 202 ? 101.685 106.155 35.735  1.00 34.61 ? 202 GLU A HB2  1 
ATOM   2830  H  HB3  . GLU A  1 202 ? 102.618 105.312 34.764  1.00 34.61 ? 202 GLU A HB3  1 
ATOM   2831  H  HG2  . GLU A  1 202 ? 104.315 106.819 34.974  1.00 49.03 ? 202 GLU A HG2  1 
ATOM   2832  H  HG3  . GLU A  1 202 ? 103.374 107.845 35.738  1.00 49.03 ? 202 GLU A HG3  1 
ATOM   2833  N  N    . GLY A  1 203 ? 99.377  106.695 33.256  1.00 24.15 ? 203 GLY A N    1 
ATOM   2834  C  CA   . GLY A  1 203 ? 98.187  106.032 32.747  1.00 19.48 ? 203 GLY A CA   1 
ATOM   2835  C  C    . GLY A  1 203 ? 97.546  105.011 33.678  1.00 18.19 ? 203 GLY A C    1 
ATOM   2836  O  O    . GLY A  1 203 ? 96.701  104.228 33.265  1.00 19.13 ? 203 GLY A O    1 
ATOM   2837  H  H    . GLY A  1 203 ? 99.228  107.487 33.556  1.00 28.98 ? 203 GLY A H    1 
ATOM   2838  H  HA2  . GLY A  1 203 ? 97.519  106.704 32.542  1.00 23.38 ? 203 GLY A HA2  1 
ATOM   2839  H  HA3  . GLY A  1 203 ? 98.414  105.576 31.921  1.00 23.38 ? 203 GLY A HA3  1 
ATOM   2840  N  N    . ILE A  1 204 ? 97.956  105.017 34.936  1.00 18.75 ? 204 ILE A N    1 
ATOM   2841  C  CA   . ILE A  1 204 ? 97.348  104.187 35.962  1.00 19.16 ? 204 ILE A CA   1 
ATOM   2842  C  C    . ILE A  1 204 ? 95.911  104.631 36.252  1.00 22.24 ? 204 ILE A C    1 
ATOM   2843  O  O    . ILE A  1 204 ? 95.072  103.813 36.617  1.00 15.91 ? 204 ILE A O    1 
ATOM   2844  C  CB   . ILE A  1 204 ? 98.156  104.294 37.271  1.00 21.38 ? 204 ILE A CB   1 
ATOM   2845  C  CG1  . ILE A  1 204 ? 99.516  103.603 37.136  1.00 30.13 ? 204 ILE A CG1  1 
ATOM   2846  C  CG2  . ILE A  1 204 ? 97.383  103.717 38.448  1.00 31.21 ? 204 ILE A CG2  1 
ATOM   2847  C  CD1  . ILE A  1 204 ? 100.409 103.811 38.361  1.00 30.84 ? 204 ILE A CD1  1 
ATOM   2848  H  H    . ILE A  1 204 ? 98.601  105.505 35.228  1.00 22.50 ? 204 ILE A H    1 
ATOM   2849  H  HA   . ILE A  1 204 ? 97.339  103.251 35.672  1.00 22.99 ? 204 ILE A HA   1 
ATOM   2850  H  HB   . ILE A  1 204 ? 98.314  105.235 37.449  1.00 25.65 ? 204 ILE A HB   1 
ATOM   2851  H  HG12 . ILE A  1 204 ? 99.376  102.649 37.025  1.00 36.15 ? 204 ILE A HG12 1 
ATOM   2852  H  HG13 . ILE A  1 204 ? 99.978  103.963 36.363  1.00 36.15 ? 204 ILE A HG13 1 
ATOM   2853  H  HG21 . ILE A  1 204 ? 97.915  103.802 39.243  1.00 37.45 ? 204 ILE A HG21 1 
ATOM   2854  H  HG22 . ILE A  1 204 ? 96.562  104.204 38.551  1.00 37.45 ? 204 ILE A HG22 1 
ATOM   2855  H  HG23 . ILE A  1 204 ? 97.197  102.792 38.275  1.00 37.45 ? 204 ILE A HG23 1 
ATOM   2856  H  HD11 . ILE A  1 204 ? 101.243 103.358 38.220  1.00 37.01 ? 204 ILE A HD11 1 
ATOM   2857  H  HD12 . ILE A  1 204 ? 100.563 104.751 38.479  1.00 37.01 ? 204 ILE A HD12 1 
ATOM   2858  H  HD13 . ILE A  1 204 ? 99.967  103.452 39.134  1.00 37.01 ? 204 ILE A HD13 1 
ATOM   2859  N  N    . ILE A  1 205 ? 95.649  105.936 36.137  1.00 11.50 ? 205 ILE A N    1 
ATOM   2860  C  CA   . ILE A  1 205 ? 94.304  106.483 36.340  1.00 15.27 ? 205 ILE A CA   1 
ATOM   2861  C  C    . ILE A  1 205 ? 93.997  107.479 35.227  1.00 12.18 ? 205 ILE A C    1 
ATOM   2862  O  O    . ILE A  1 205 ? 94.918  107.994 34.609  1.00 11.61 ? 205 ILE A O    1 
ATOM   2863  C  CB   . ILE A  1 205 ? 94.163  107.234 37.706  1.00 21.70 ? 205 ILE A CB   1 
ATOM   2864  C  CG1  . ILE A  1 205 ? 95.387  108.124 37.961  1.00 20.57 ? 205 ILE A CG1  1 
ATOM   2865  C  CG2  . ILE A  1 205 ? 93.973  106.253 38.823  1.00 23.18 ? 205 ILE A CG2  1 
ATOM   2866  C  CD1  . ILE A  1 205 ? 95.232  109.096 39.127  1.00 15.15 ? 205 ILE A CD1  1 
ATOM   2867  H  H    . ILE A  1 205 ? 96.238  106.530 35.940  1.00 13.80 ? 205 ILE A H    1 
ATOM   2868  H  HA   . ILE A  1 205 ? 93.643  105.760 36.308  1.00 18.32 ? 205 ILE A HA   1 
ATOM   2869  H  HB   . ILE A  1 205 ? 93.378  107.802 37.662  1.00 26.04 ? 205 ILE A HB   1 
ATOM   2870  H  HG12 . ILE A  1 205 ? 96.149  107.555 38.152  1.00 24.69 ? 205 ILE A HG12 1 
ATOM   2871  H  HG13 . ILE A  1 205 ? 95.561  108.647 37.163  1.00 24.69 ? 205 ILE A HG13 1 
ATOM   2872  H  HG21 . ILE A  1 205 ? 93.889  106.734 39.650  1.00 27.81 ? 205 ILE A HG21 1 
ATOM   2873  H  HG22 . ILE A  1 205 ? 93.177  105.743 38.658  1.00 27.81 ? 205 ILE A HG22 1 
ATOM   2874  H  HG23 . ILE A  1 205 ? 94.734  105.670 38.859  1.00 27.81 ? 205 ILE A HG23 1 
ATOM   2875  H  HD11 . ILE A  1 205 ? 96.039  109.609 39.214  1.00 18.18 ? 205 ILE A HD11 1 
ATOM   2876  H  HD12 . ILE A  1 205 ? 94.490  109.679 38.951  1.00 18.18 ? 205 ILE A HD12 1 
ATOM   2877  H  HD13 . ILE A  1 205 ? 95.073  108.596 39.931  1.00 18.18 ? 205 ILE A HD13 1 
ATOM   2878  N  N    . ASP A  1 206 ? 92.709  107.726 34.987  1.00 10.31 ? 206 ASP A N    1 
ATOM   2879  C  CA   . ASP A  1 206 ? 92.224  108.514 33.859  1.00 15.46 ? 206 ASP A CA   1 
ATOM   2880  C  C    . ASP A  1 206 ? 91.649  109.849 34.332  1.00 11.11 ? 206 ASP A C    1 
ATOM   2881  O  O    . ASP A  1 206 ? 91.211  110.666 33.539  1.00 11.02 ? 206 ASP A O    1 
ATOM   2882  C  CB   . ASP A  1 206 ? 91.133  107.726 33.117  1.00 16.15 ? 206 ASP A CB   1 
ATOM   2883  C  CG   . ASP A  1 206 ? 91.632  106.378 32.621  1.00 19.54 ? 206 ASP A CG   1 
ATOM   2884  O  OD1  . ASP A  1 206 ? 92.808  106.328 32.187  1.00 22.15 ? 206 ASP A OD1  1 
ATOM   2885  O  OD2  . ASP A  1 206 ? 90.864  105.386 32.675  1.00 21.20 ? 206 ASP A OD2  1 
ATOM   2886  H  H    . ASP A  1 206 ? 92.073  107.433 35.487  1.00 12.38 ? 206 ASP A H    1 
ATOM   2887  H  HA   . ASP A  1 206 ? 92.961  108.691 33.238  1.00 18.55 ? 206 ASP A HA   1 
ATOM   2888  H  HB2  . ASP A  1 206 ? 90.389  107.568 33.720  1.00 19.38 ? 206 ASP A HB2  1 
ATOM   2889  H  HB3  . ASP A  1 206 ? 90.837  108.239 32.349  1.00 19.38 ? 206 ASP A HB3  1 
ATOM   2890  N  N    . GLY A  1 207 ? 91.583  110.056 35.640  1.00 10.30 ? 207 GLY A N    1 
ATOM   2891  C  CA   . GLY A  1 207 ? 91.032  111.291 36.150  1.00 13.98 ? 207 GLY A CA   1 
ATOM   2892  C  C    . GLY A  1 207 ? 90.900  111.243 37.661  1.00 10.66 ? 207 GLY A C    1 
ATOM   2893  O  O    . GLY A  1 207 ? 91.317  110.264 38.286  1.00 12.10 ? 207 GLY A O    1 
ATOM   2894  H  H    . GLY A  1 207 ? 91.847  109.502 36.242  1.00 12.36 ? 207 GLY A H    1 
ATOM   2895  H  HA2  . GLY A  1 207 ? 91.610  112.032 35.911  1.00 16.77 ? 207 GLY A HA2  1 
ATOM   2896  H  HA3  . GLY A  1 207 ? 90.154  111.443 35.765  1.00 16.77 ? 207 GLY A HA3  1 
ATOM   2897  N  N    . LEU A  1 208 ? 90.355  112.315 38.231  1.00 8.46  ? 208 LEU A N    1 
ATOM   2898  C  CA   . LEU A  1 208 ? 90.116  112.396 39.678  1.00 12.57 ? 208 LEU A CA   1 
ATOM   2899  C  C    . LEU A  1 208 ? 88.955  113.338 39.946  1.00 10.30 ? 208 LEU A C    1 
ATOM   2900  O  O    . LEU A  1 208 ? 88.225  113.762 39.036  1.00 9.86  ? 208 LEU A O    1 
ATOM   2901  C  CB   . LEU A  1 208 ? 91.358  112.908 40.428  1.00 8.50  ? 208 LEU A CB   1 
ATOM   2902  C  CG   . LEU A  1 208 ? 91.691  114.384 40.165  1.00 10.64 ? 208 LEU A CG   1 
ATOM   2903  C  CD1  . LEU A  1 208 ? 92.342  115.067 41.368  1.00 9.40  ? 208 LEU A CD1  1 
ATOM   2904  C  CD2  . LEU A  1 208 ? 92.597  114.524 38.930  1.00 12.47 ? 208 LEU A CD2  1 
ATOM   2905  H  H    . LEU A  1 208 ? 90.111  113.018 37.800  1.00 10.15 ? 208 LEU A H    1 
ATOM   2906  H  HA   . LEU A  1 208 ? 89.886  111.509 40.024  1.00 15.08 ? 208 LEU A HA   1 
ATOM   2907  H  HB2  . LEU A  1 208 ? 91.211  112.804 41.381  1.00 10.20 ? 208 LEU A HB2  1 
ATOM   2908  H  HB3  . LEU A  1 208 ? 92.125  112.380 40.155  1.00 10.20 ? 208 LEU A HB3  1 
ATOM   2909  H  HG   . LEU A  1 208 ? 90.865  114.856 39.975  1.00 12.77 ? 208 LEU A HG   1 
ATOM   2910  H  HD11 . LEU A  1 208 ? 92.525  115.982 41.145  1.00 11.28 ? 208 LEU A HD11 1 
ATOM   2911  H  HD12 . LEU A  1 208 ? 91.739  115.026 42.114  1.00 11.28 ? 208 LEU A HD12 1 
ATOM   2912  H  HD13 . LEU A  1 208 ? 93.159  114.611 41.581  1.00 11.28 ? 208 LEU A HD13 1 
ATOM   2913  H  HD21 . LEU A  1 208 ? 92.790  115.454 38.788  1.00 14.96 ? 208 LEU A HD21 1 
ATOM   2914  H  HD22 . LEU A  1 208 ? 93.412  114.040 39.084  1.00 14.96 ? 208 LEU A HD22 1 
ATOM   2915  H  HD23 . LEU A  1 208 ? 92.141  114.164 38.166  1.00 14.96 ? 208 LEU A HD23 1 
ATOM   2916  N  N    . GLU A  1 209 ? 88.766  113.686 41.202  1.00 7.81  ? 209 GLU A N    1 
ATOM   2917  C  CA   . GLU A  1 209 ? 87.801  114.716 41.494  1.00 8.69  ? 209 GLU A CA   1 
ATOM   2918  C  C    . GLU A  1 209 ? 88.245  115.583 42.682  1.00 7.53  ? 209 GLU A C    1 
ATOM   2919  O  O    . GLU A  1 209 ? 88.937  115.118 43.583  1.00 11.02 ? 209 GLU A O    1 
ATOM   2920  C  CB   . GLU A  1 209 ? 86.404  114.107 41.691  1.00 11.29 ? 209 GLU A CB   1 
ATOM   2921  C  CG   . GLU A  1 209 ? 86.370  112.869 42.566  1.00 10.67 ? 209 GLU A CG   1 
ATOM   2922  C  CD   . GLU A  1 209 ? 86.331  113.220 44.036  1.00 9.00  ? 209 GLU A CD   1 
ATOM   2923  O  OE1  . GLU A  1 209 ? 87.296  112.919 44.767  1.00 8.35  ? 209 GLU A OE1  1 
ATOM   2924  O  OE2  . GLU A  1 209 ? 85.344  113.839 44.434  1.00 8.25  ? 209 GLU A OE2  1 
ATOM   2925  H  H    . GLU A  1 209 ? 89.171  113.352 41.884  1.00 9.37  ? 209 GLU A H    1 
ATOM   2926  H  HA   . GLU A  1 209 ? 87.747  115.308 40.715  1.00 10.43 ? 209 GLU A HA   1 
ATOM   2927  H  HB2  . GLU A  1 209 ? 85.831  114.773 42.102  1.00 13.55 ? 209 GLU A HB2  1 
ATOM   2928  H  HB3  . GLU A  1 209 ? 86.048  113.863 40.822  1.00 13.55 ? 209 GLU A HB3  1 
ATOM   2929  H  HG2  . GLU A  1 209 ? 85.577  112.352 42.357  1.00 12.81 ? 209 GLU A HG2  1 
ATOM   2930  H  HG3  . GLU A  1 209 ? 87.167  112.341 42.402  1.00 12.81 ? 209 GLU A HG3  1 
ATOM   2931  N  N    . ASN A  1 210 ? 87.891  116.865 42.617  1.00 7.41  ? 210 ASN A N    1 
ATOM   2932  C  CA   . ASN A  1 210 ? 88.250  117.811 43.654  1.00 7.44  ? 210 ASN A CA   1 
ATOM   2933  C  C    . ASN A  1 210 ? 87.700  119.169 43.277  1.00 7.91  ? 210 ASN A C    1 
ATOM   2934  O  O    . ASN A  1 210 ? 87.256  119.379 42.148  1.00 8.86  ? 210 ASN A O    1 
ATOM   2935  C  CB   . ASN A  1 210 ? 89.780  117.907 43.715  1.00 7.73  ? 210 ASN A CB   1 
ATOM   2936  C  CG   . ASN A  1 210 ? 90.379  117.241 44.933  1.00 9.21  ? 210 ASN A CG   1 
ATOM   2937  O  OD1  . ASN A  1 210 ? 89.919  117.438 46.076  1.00 7.80  ? 210 ASN A OD1  1 
ATOM   2938  N  ND2  . ASN A  1 210 ? 91.464  116.483 44.708  1.00 10.26 ? 210 ASN A ND2  1 
ATOM   2939  H  H    . ASN A  1 210 ? 87.437  117.210 41.972  1.00 8.90  ? 210 ASN A H    1 
ATOM   2940  H  HA   . ASN A  1 210 ? 87.895  117.533 44.524  1.00 8.93  ? 210 ASN A HA   1 
ATOM   2941  H  HB2  . ASN A  1 210 ? 90.152  117.478 42.928  1.00 9.27  ? 210 ASN A HB2  1 
ATOM   2942  H  HB3  . ASN A  1 210 ? 90.035  118.842 43.732  1.00 9.27  ? 210 ASN A HB3  1 
ATOM   2943  H  HD21 . ASN A  1 210 ? 91.773  116.401 43.909  1.00 12.31 ? 210 ASN A HD21 1 
ATOM   2944  H  HD22 . ASN A  1 210 ? 91.849  116.078 45.362  1.00 12.31 ? 210 ASN A HD22 1 
ATOM   2945  N  N    . PRO A  1 211 ? 87.743  120.114 44.212  1.00 7.39  ? 211 PRO A N    1 
ATOM   2946  C  CA   . PRO A  1 211 ? 87.436  121.482 43.820  1.00 7.42  ? 211 PRO A CA   1 
ATOM   2947  C  C    . PRO A  1 211 ? 88.461  122.101 42.860  1.00 7.64  ? 211 PRO A C    1 
ATOM   2948  O  O    . PRO A  1 211 ? 89.629  121.715 42.841  1.00 9.31  ? 211 PRO A O    1 
ATOM   2949  C  CB   . PRO A  1 211 ? 87.413  122.233 45.164  1.00 10.01 ? 211 PRO A CB   1 
ATOM   2950  C  CG   . PRO A  1 211 ? 87.308  121.147 46.225  1.00 11.72 ? 211 PRO A CG   1 
ATOM   2951  C  CD   . PRO A  1 211 ? 88.071  120.003 45.642  1.00 7.45  ? 211 PRO A CD   1 
ATOM   2952  H  HA   . PRO A  1 211 ? 86.546  121.525 43.412  1.00 8.90  ? 211 PRO A HA   1 
ATOM   2953  H  HB2  . PRO A  1 211 ? 88.234  122.739 45.271  1.00 12.02 ? 211 PRO A HB2  1 
ATOM   2954  H  HB3  . PRO A  1 211 ? 86.641  122.820 45.198  1.00 12.02 ? 211 PRO A HB3  1 
ATOM   2955  H  HG2  . PRO A  1 211 ? 87.717  121.451 47.051  1.00 14.07 ? 211 PRO A HG2  1 
ATOM   2956  H  HG3  . PRO A  1 211 ? 86.378  120.909 46.364  1.00 14.07 ? 211 PRO A HG3  1 
ATOM   2957  H  HD2  . PRO A  1 211 ? 89.023  120.119 45.785  1.00 8.95  ? 211 PRO A HD2  1 
ATOM   2958  H  HD3  . PRO A  1 211 ? 87.752  119.161 46.002  1.00 8.95  ? 211 PRO A HD3  1 
ATOM   2959  N  N    . THR A  1 212 ? 88.028  123.104 42.093  1.00 7.69  ? 212 THR A N    1 
ATOM   2960  C  CA   . THR A  1 212 ? 88.882  123.760 41.116  1.00 8.76  ? 212 THR A CA   1 
ATOM   2961  C  C    . THR A  1 212 ? 90.174  124.251 41.750  1.00 10.64 ? 212 THR A C    1 
ATOM   2962  O  O    . THR A  1 212 ? 91.249  124.129 41.147  1.00 8.48  ? 212 THR A O    1 
ATOM   2963  C  CB   . THR A  1 212 ? 88.166  124.968 40.473  1.00 9.39  ? 212 THR A CB   1 
ATOM   2964  O  OG1  . THR A  1 212 ? 87.810  125.878 41.524  1.00 11.56 ? 212 THR A OG1  1 
ATOM   2965  C  CG2  . THR A  1 212 ? 86.896  124.525 39.773  1.00 7.82  ? 212 THR A CG2  1 
ATOM   2966  H  H    . THR A  1 212 ? 87.230  123.423 42.124  1.00 9.22  ? 212 THR A H    1 
ATOM   2967  H  HA   . THR A  1 212 ? 89.110  123.124 40.407  1.00 10.51 ? 212 THR A HA   1 
ATOM   2968  H  HB   . THR A  1 212 ? 88.750  125.405 39.833  1.00 11.27 ? 212 THR A HB   1 
ATOM   2969  H  HG1  . THR A  1 212 ? 87.427  126.532 41.212  1.00 13.87 ? 212 THR A HG1  1 
ATOM   2970  H  HG21 . THR A  1 212 ? 86.459  125.282 39.376  1.00 9.38  ? 212 THR A HG21 1 
ATOM   2971  H  HG22 . THR A  1 212 ? 87.106  123.890 39.084  1.00 9.38  ? 212 THR A HG22 1 
ATOM   2972  H  HG23 . THR A  1 212 ? 86.300  124.115 40.404  1.00 9.38  ? 212 THR A HG23 1 
ATOM   2973  N  N    . VAL A  1 213 ? 90.098  124.832 42.959  1.00 10.00 ? 213 VAL A N    1 
ATOM   2974  C  CA   . VAL A  1 213 ? 91.318  125.393 43.546  1.00 9.29  ? 213 VAL A CA   1 
ATOM   2975  C  C    . VAL A  1 213 ? 92.366  124.323 43.830  1.00 10.37 ? 213 VAL A C    1 
ATOM   2976  O  O    . VAL A  1 213 ? 93.573  124.598 43.721  1.00 10.20 ? 213 VAL A O    1 
ATOM   2977  C  CB   . VAL A  1 213 ? 91.061  126.242 44.825  1.00 12.12 ? 213 VAL A CB   1 
ATOM   2978  C  CG1  . VAL A  1 213 ? 90.188  127.419 44.503  1.00 8.71  ? 213 VAL A CG1  1 
ATOM   2979  C  CG2  . VAL A  1 213 ? 90.463  125.398 45.907  1.00 12.55 ? 213 VAL A CG2  1 
ATOM   2980  H  H    . VAL A  1 213 ? 89.387  124.910 43.437  1.00 12.00 ? 213 VAL A H    1 
ATOM   2981  H  HA   . VAL A  1 213 ? 91.711  125.999 42.884  1.00 11.15 ? 213 VAL A HA   1 
ATOM   2982  H  HB   . VAL A  1 213 ? 91.918  126.586 45.153  1.00 14.54 ? 213 VAL A HB   1 
ATOM   2983  H  HG11 . VAL A  1 213 ? 90.042  127.928 45.304  1.00 10.45 ? 213 VAL A HG11 1 
ATOM   2984  H  HG12 . VAL A  1 213 ? 90.626  127.962 43.844  1.00 10.45 ? 213 VAL A HG12 1 
ATOM   2985  H  HG13 . VAL A  1 213 ? 89.350  127.100 44.160  1.00 10.45 ? 213 VAL A HG13 1 
ATOM   2986  H  HG21 . VAL A  1 213 ? 90.314  125.943 46.683  1.00 15.06 ? 213 VAL A HG21 1 
ATOM   2987  H  HG22 . VAL A  1 213 ? 89.629  125.036 45.596  1.00 15.06 ? 213 VAL A HG22 1 
ATOM   2988  H  HG23 . VAL A  1 213 ? 91.070  124.685 46.119  1.00 15.06 ? 213 VAL A HG23 1 
ATOM   2989  N  N    . VAL A  1 214 ? 91.903  123.125 44.217  1.00 8.43  ? 214 VAL A N    1 
ATOM   2990  C  CA   . VAL A  1 214 ? 92.752  121.991 44.471  1.00 10.69 ? 214 VAL A CA   1 
ATOM   2991  C  C    . VAL A  1 214 ? 93.242  121.378 43.156  1.00 8.66  ? 214 VAL A C    1 
ATOM   2992  O  O    . VAL A  1 214 ? 94.394  120.993 43.068  1.00 11.38 ? 214 VAL A O    1 
ATOM   2993  C  CB   . VAL A  1 214 ? 92.016  120.926 45.276  1.00 11.05 ? 214 VAL A CB   1 
ATOM   2994  C  CG1  . VAL A  1 214 ? 92.960  119.761 45.638  1.00 8.88  ? 214 VAL A CG1  1 
ATOM   2995  C  CG2  . VAL A  1 214 ? 91.417  121.585 46.532  1.00 8.21  ? 214 VAL A CG2  1 
ATOM   2996  H  H    . VAL A  1 214 ? 91.068  122.956 44.338  1.00 10.11 ? 214 VAL A H    1 
ATOM   2997  H  HA   . VAL A  1 214 ? 93.533  122.280 44.986  1.00 12.83 ? 214 VAL A HA   1 
ATOM   2998  H  HB   . VAL A  1 214 ? 91.279  120.567 44.738  1.00 13.26 ? 214 VAL A HB   1 
ATOM   2999  H  HG11 . VAL A  1 214 ? 92.471  119.108 46.143  1.00 10.66 ? 214 VAL A HG11 1 
ATOM   3000  H  HG12 . VAL A  1 214 ? 93.294  119.367 44.828  1.00 10.66 ? 214 VAL A HG12 1 
ATOM   3001  H  HG13 . VAL A  1 214 ? 93.689  120.102 46.161  1.00 10.66 ? 214 VAL A HG13 1 
ATOM   3002  H  HG21 . VAL A  1 214 ? 90.952  120.918 47.043  1.00 9.85  ? 214 VAL A HG21 1 
ATOM   3003  H  HG22 . VAL A  1 214 ? 92.128  121.962 47.056  1.00 9.85  ? 214 VAL A HG22 1 
ATOM   3004  H  HG23 . VAL A  1 214 ? 90.807  122.275 46.262  1.00 9.85  ? 214 VAL A HG23 1 
ATOM   3005  N  N    . LEU A  1 215 ? 92.385  121.324 42.141  1.00 8.46  ? 215 LEU A N    1 
ATOM   3006  C  CA   . LEU A  1 215 ? 92.830  120.846 40.802  1.00 8.61  ? 215 LEU A CA   1 
ATOM   3007  C  C    . LEU A  1 215 ? 93.878  121.765 40.178  1.00 12.03 ? 215 LEU A C    1 
ATOM   3008  O  O    . LEU A  1 215 ? 94.835  121.308 39.537  1.00 12.40 ? 215 LEU A O    1 
ATOM   3009  C  CB   . LEU A  1 215 ? 91.630  120.717 39.854  1.00 8.35  ? 215 LEU A CB   1 
ATOM   3010  C  CG   . LEU A  1 215 ? 90.516  119.764 40.239  1.00 8.13  ? 215 LEU A CG   1 
ATOM   3011  C  CD1  . LEU A  1 215 ? 89.330  119.955 39.368  1.00 9.28  ? 215 LEU A CD1  1 
ATOM   3012  C  CD2  . LEU A  1 215 ? 90.943  118.288 40.238  1.00 9.73  ? 215 LEU A CD2  1 
ATOM   3013  H  H    . LEU A  1 215 ? 91.557  121.550 42.184  1.00 10.15 ? 215 LEU A H    1 
ATOM   3014  H  HA   . LEU A  1 215 ? 93.231  119.958 40.901  1.00 10.33 ? 215 LEU A HA   1 
ATOM   3015  H  HB2  . LEU A  1 215 ? 91.229  121.596 39.759  1.00 10.02 ? 215 LEU A HB2  1 
ATOM   3016  H  HB3  . LEU A  1 215 ? 91.963  120.427 38.990  1.00 10.02 ? 215 LEU A HB3  1 
ATOM   3017  H  HG   . LEU A  1 215 ? 90.240  119.977 41.144  1.00 9.76  ? 215 LEU A HG   1 
ATOM   3018  H  HD11 . LEU A  1 215 ? 88.643  119.340 39.635  1.00 11.14 ? 215 LEU A HD11 1 
ATOM   3019  H  HD12 . LEU A  1 215 ? 89.016  120.858 39.462  1.00 11.14 ? 215 LEU A HD12 1 
ATOM   3020  H  HD13 . LEU A  1 215 ? 89.582  119.789 38.457  1.00 11.14 ? 215 LEU A HD13 1 
ATOM   3021  H  HD21 . LEU A  1 215 ? 90.193  117.745 40.490  1.00 11.68 ? 215 LEU A HD21 1 
ATOM   3022  H  HD22 . LEU A  1 215 ? 91.239  118.049 39.357  1.00 11.68 ? 215 LEU A HD22 1 
ATOM   3023  H  HD23 . LEU A  1 215 ? 91.659  118.170 40.867  1.00 11.68 ? 215 LEU A HD23 1 
ATOM   3024  N  N    . PHE A  1 216 ? 93.714  123.075 40.347  1.00 12.75 ? 216 PHE A N    1 
ATOM   3025  C  CA   . PHE A  1 216 ? 94.679  124.007 39.790  1.00 10.90 ? 216 PHE A CA   1 
ATOM   3026  C  C    . PHE A  1 216 ? 95.988  123.988 40.564  1.00 13.51 ? 216 PHE A C    1 
ATOM   3027  O  O    . PHE A  1 216 ? 97.065  124.001 39.972  1.00 10.31 ? 216 PHE A O    1 
ATOM   3028  C  CB   . PHE A  1 216 ? 94.115  125.426 39.751  1.00 13.80 ? 216 PHE A CB   1 
ATOM   3029  C  CG   . PHE A  1 216 ? 95.014  126.402 39.034  1.00 13.40 ? 216 PHE A CG   1 
ATOM   3030  C  CD1  . PHE A  1 216 ? 95.166  126.337 37.649  1.00 21.26 ? 216 PHE A CD1  1 
ATOM   3031  C  CD2  . PHE A  1 216 ? 95.737  127.352 39.744  1.00 17.32 ? 216 PHE A CD2  1 
ATOM   3032  C  CE1  . PHE A  1 216 ? 96.019  127.213 36.978  1.00 26.10 ? 216 PHE A CE1  1 
ATOM   3033  C  CE2  . PHE A  1 216 ? 96.587  128.238 39.086  1.00 23.33 ? 216 PHE A CE2  1 
ATOM   3034  C  CZ   . PHE A  1 216 ? 96.726  128.174 37.703  1.00 30.94 ? 216 PHE A CZ   1 
ATOM   3035  H  H    . PHE A  1 216 ? 93.063  123.441 40.772  1.00 15.29 ? 216 PHE A H    1 
ATOM   3036  H  HA   . PHE A  1 216 ? 94.876  123.741 38.867  1.00 13.08 ? 216 PHE A HA   1 
ATOM   3037  H  HB2  . PHE A  1 216 ? 93.261  125.413 39.292  1.00 16.56 ? 216 PHE A HB2  1 
ATOM   3038  H  HB3  . PHE A  1 216 ? 93.997  125.743 40.661  1.00 16.56 ? 216 PHE A HB3  1 
ATOM   3039  H  HD1  . PHE A  1 216 ? 94.695  125.696 37.166  1.00 25.52 ? 216 PHE A HD1  1 
ATOM   3040  H  HD2  . PHE A  1 216 ? 95.648  127.401 40.669  1.00 20.79 ? 216 PHE A HD2  1 
ATOM   3041  H  HE1  . PHE A  1 216 ? 96.105  127.167 36.053  1.00 31.32 ? 216 PHE A HE1  1 
ATOM   3042  H  HE2  . PHE A  1 216 ? 97.059  128.876 39.571  1.00 27.99 ? 216 PHE A HE2  1 
ATOM   3043  H  HZ   . PHE A  1 216 ? 97.293  128.767 37.263  1.00 37.13 ? 216 PHE A HZ   1 
ATOM   3044  N  N    . GLY A  1 217 ? 95.889  123.932 41.891  1.00 16.24 ? 217 GLY A N    1 
ATOM   3045  C  CA   . GLY A  1 217 ? 97.058  123.944 42.756  1.00 17.72 ? 217 GLY A CA   1 
ATOM   3046  C  C    . GLY A  1 217 ? 97.947  122.739 42.554  1.00 14.27 ? 217 GLY A C    1 
ATOM   3047  O  O    . GLY A  1 217 ? 99.165  122.826 42.668  1.00 15.56 ? 217 GLY A O    1 
ATOM   3048  H  H    . GLY A  1 217 ? 95.143  123.885 42.316  1.00 19.48 ? 217 GLY A H    1 
ATOM   3049  H  HA2  . GLY A  1 217 ? 97.580  124.743 42.581  1.00 21.26 ? 217 GLY A HA2  1 
ATOM   3050  H  HA3  . GLY A  1 217 ? 96.772  123.962 43.683  1.00 21.26 ? 217 GLY A HA3  1 
ATOM   3051  N  N    . GLY A  1 218 ? 97.334  121.603 42.253  1.00 14.34 ? 218 GLY A N    1 
ATOM   3052  C  CA   . GLY A  1 218 ? 98.071  120.378 42.040  1.00 14.20 ? 218 GLY A CA   1 
ATOM   3053  C  C    . GLY A  1 218 ? 98.552  120.225 40.614  1.00 16.02 ? 218 GLY A C    1 
ATOM   3054  O  O    . GLY A  1 218 ? 99.222  119.245 40.321  1.00 15.07 ? 218 GLY A O    1 
ATOM   3055  H  H    . GLY A  1 218 ? 96.482  121.519 42.167  1.00 17.21 ? 218 GLY A H    1 
ATOM   3056  H  HA2  . GLY A  1 218 ? 98.843  120.361 42.627  1.00 17.04 ? 218 GLY A HA2  1 
ATOM   3057  H  HA3  . GLY A  1 218 ? 97.505  119.620 42.255  1.00 17.04 ? 218 GLY A HA3  1 
ATOM   3058  N  N    . LYS A  1 219 ? 98.226  121.196 39.753  1.00 17.14 ? 219 LYS A N    1 
ATOM   3059  C  CA   . LYS A  1 219 ? 98.669  121.195 38.360  1.00 16.24 ? 219 LYS A CA   1 
ATOM   3060  C  C    . LYS A  1 219 ? 98.161  119.976 37.616  1.00 16.86 ? 219 LYS A C    1 
ATOM   3061  O  O    . LYS A  1 219 ? 98.739  119.557 36.642  1.00 15.84 ? 219 LYS A O    1 
ATOM   3062  C  CB   . LYS A  1 219 ? 100.200 121.293 38.282  1.00 12.84 ? 219 LYS A CB   1 
ATOM   3063  C  CG   . LYS A  1 219 ? 100.703 122.556 38.949  1.00 22.42 ? 219 LYS A CG   1 
ATOM   3064  C  CD   . LYS A  1 219 ? 102.068 122.995 38.497  1.00 35.20 ? 219 LYS A CD   1 
ATOM   3065  C  CE   . LYS A  1 219 ? 102.340 124.388 39.050  1.00 35.60 ? 219 LYS A CE   1 
ATOM   3066  N  NZ   . LYS A  1 219 ? 103.733 124.834 38.830  1.00 43.18 ? 219 LYS A NZ   1 
ATOM   3067  H  H    . LYS A  1 219 ? 97.740  121.875 39.959  1.00 20.57 ? 219 LYS A H    1 
ATOM   3068  H  HA   . LYS A  1 219 ? 98.300  121.987 37.916  1.00 19.49 ? 219 LYS A HA   1 
ATOM   3069  H  HB2  . LYS A  1 219 ? 100.593 120.531 38.735  1.00 15.41 ? 219 LYS A HB2  1 
ATOM   3070  H  HB3  . LYS A  1 219 ? 100.473 121.310 37.351  1.00 15.41 ? 219 LYS A HB3  1 
ATOM   3071  H  HG2  . LYS A  1 219 ? 100.083 123.276 38.758  1.00 26.90 ? 219 LYS A HG2  1 
ATOM   3072  H  HG3  . LYS A  1 219 ? 100.745 122.405 39.906  1.00 26.90 ? 219 LYS A HG3  1 
ATOM   3073  H  HD2  . LYS A  1 219 ? 102.740 122.386 38.839  1.00 42.24 ? 219 LYS A HD2  1 
ATOM   3074  H  HD3  . LYS A  1 219 ? 102.097 123.032 37.528  1.00 42.24 ? 219 LYS A HD3  1 
ATOM   3075  H  HE2  . LYS A  1 219 ? 101.750 125.022 38.612  1.00 42.72 ? 219 LYS A HE2  1 
ATOM   3076  H  HE3  . LYS A  1 219 ? 102.174 124.386 40.005  1.00 42.72 ? 219 LYS A HE3  1 
ATOM   3077  H  HZ1  . LYS A  1 219 ? 103.848 125.649 39.167  1.00 51.81 ? 219 LYS A HZ1  1 
ATOM   3078  H  HZ2  . LYS A  1 219 ? 104.298 124.273 39.228  1.00 51.81 ? 219 LYS A HZ2  1 
ATOM   3079  H  HZ3  . LYS A  1 219 ? 103.912 124.853 37.958  1.00 51.81 ? 219 LYS A HZ3  1 
ATOM   3080  N  N    . PHE A  1 220 ? 97.051  119.410 38.055  1.00 20.64 ? 220 PHE A N    1 
ATOM   3081  C  CA   . PHE A  1 220 ? 96.574  118.211 37.401  1.00 16.59 ? 220 PHE A CA   1 
ATOM   3082  C  C    . PHE A  1 220 ? 96.119  118.505 35.969  1.00 13.00 ? 220 PHE A C    1 
ATOM   3083  O  O    . PHE A  1 220 ? 95.922  117.569 35.194  1.00 15.28 ? 220 PHE A O    1 
ATOM   3084  C  CB   . PHE A  1 220 ? 95.441  117.586 38.194  1.00 19.91 ? 220 PHE A CB   1 
ATOM   3085  C  CG   . PHE A  1 220 ? 95.842  117.160 39.574  1.00 9.59  ? 220 PHE A CG   1 
ATOM   3086  C  CD1  . PHE A  1 220 ? 96.695  116.096 39.762  1.00 14.98 ? 220 PHE A CD1  1 
ATOM   3087  C  CD2  . PHE A  1 220 ? 95.358  117.826 40.681  1.00 17.67 ? 220 PHE A CD2  1 
ATOM   3088  C  CE1  . PHE A  1 220 ? 97.052  115.680 41.044  1.00 17.06 ? 220 PHE A CE1  1 
ATOM   3089  C  CE2  . PHE A  1 220 ? 95.708  117.423 41.947  1.00 15.80 ? 220 PHE A CE2  1 
ATOM   3090  C  CZ   . PHE A  1 220 ? 96.566  116.357 42.129  1.00 11.21 ? 220 PHE A CZ   1 
ATOM   3091  H  H    . PHE A  1 220 ? 96.570  119.690 38.710  1.00 24.77 ? 220 PHE A H    1 
ATOM   3092  H  HA   . PHE A  1 220 ? 97.306  117.560 37.357  1.00 19.90 ? 220 PHE A HA   1 
ATOM   3093  H  HB2  . PHE A  1 220 ? 94.724  118.233 38.279  1.00 23.90 ? 220 PHE A HB2  1 
ATOM   3094  H  HB3  . PHE A  1 220 ? 95.123  116.801 37.721  1.00 23.90 ? 220 PHE A HB3  1 
ATOM   3095  H  HD1  . PHE A  1 220 ? 97.024  115.636 39.023  1.00 17.98 ? 220 PHE A HD1  1 
ATOM   3096  H  HD2  . PHE A  1 220 ? 94.779  118.544 40.569  1.00 21.20 ? 220 PHE A HD2  1 
ATOM   3097  H  HE1  . PHE A  1 220 ? 97.632  114.962 41.160  1.00 20.47 ? 220 PHE A HE1  1 
ATOM   3098  H  HE2  . PHE A  1 220 ? 95.378  117.882 42.686  1.00 18.95 ? 220 PHE A HE2  1 
ATOM   3099  H  HZ   . PHE A  1 220 ? 96.804  116.092 42.988  1.00 13.45 ? 220 PHE A HZ   1 
ATOM   3100  N  N    . PHE A  1 221 ? 95.915  119.790 35.652  1.00 15.23 ? 221 PHE A N    1 
ATOM   3101  C  CA   . PHE A  1 221 ? 95.525  120.226 34.292  1.00 12.22 ? 221 PHE A CA   1 
ATOM   3102  C  C    . PHE A  1 221 ? 96.620  119.929 33.264  1.00 15.75 ? 221 PHE A C    1 
ATOM   3103  O  O    . PHE A  1 221 ? 96.370  119.862 32.044  1.00 17.22 ? 221 PHE A O    1 
ATOM   3104  C  CB   . PHE A  1 221 ? 95.195  121.717 34.278  1.00 18.85 ? 221 PHE A CB   1 
ATOM   3105  C  CG   . PHE A  1 221 ? 96.307  122.579 34.785  1.00 14.25 ? 221 PHE A CG   1 
ATOM   3106  C  CD1  . PHE A  1 221 ? 97.383  122.876 33.972  1.00 13.00 ? 221 PHE A CD1  1 
ATOM   3107  C  CD2  . PHE A  1 221 ? 96.287  123.073 36.090  1.00 18.45 ? 221 PHE A CD2  1 
ATOM   3108  C  CE1  . PHE A  1 221 ? 98.431  123.660 34.432  1.00 18.10 ? 221 PHE A CE1  1 
ATOM   3109  C  CE2  . PHE A  1 221 ? 97.319  123.871 36.563  1.00 20.26 ? 221 PHE A CE2  1 
ATOM   3110  C  CZ   . PHE A  1 221 ? 98.392  124.171 35.739  1.00 19.60 ? 221 PHE A CZ   1 
ATOM   3111  H  H    . PHE A  1 221 ? 95.995  120.439 36.210  1.00 18.28 ? 221 PHE A H    1 
ATOM   3112  H  HA   . PHE A  1 221 ? 94.720  119.738 34.022  1.00 14.66 ? 221 PHE A HA   1 
ATOM   3113  H  HB2  . PHE A  1 221 ? 95.001  121.987 33.367  1.00 22.62 ? 221 PHE A HB2  1 
ATOM   3114  H  HB3  . PHE A  1 221 ? 94.420  121.871 34.840  1.00 22.62 ? 221 PHE A HB3  1 
ATOM   3115  H  HD1  . PHE A  1 221 ? 97.407  122.542 33.104  1.00 15.60 ? 221 PHE A HD1  1 
ATOM   3116  H  HD2  . PHE A  1 221 ? 95.565  122.879 36.643  1.00 22.14 ? 221 PHE A HD2  1 
ATOM   3117  H  HE1  . PHE A  1 221 ? 99.146  123.861 33.873  1.00 21.72 ? 221 PHE A HE1  1 
ATOM   3118  H  HE2  . PHE A  1 221 ? 97.292  124.200 37.433  1.00 24.32 ? 221 PHE A HE2  1 
ATOM   3119  H  HZ   . PHE A  1 221 ? 99.090  124.699 36.055  1.00 23.52 ? 221 PHE A HZ   1 
ATOM   3120  N  N    . GLU A  1 222 ? 97.837  119.737 33.750  1.00 17.22 ? 222 GLU A N    1 
ATOM   3121  C  CA   . GLU A  1 222 ? 98.942  119.386 32.868  1.00 17.44 ? 222 GLU A CA   1 
ATOM   3122  C  C    . GLU A  1 222 ? 98.711  118.007 32.238  1.00 16.97 ? 222 GLU A C    1 
ATOM   3123  O  O    . GLU A  1 222 ? 99.126  117.758 31.095  1.00 17.54 ? 222 GLU A O    1 
ATOM   3124  C  CB   . GLU A  1 222 ? 100.265 119.444 33.633  1.00 17.39 ? 222 GLU A CB   1 
ATOM   3125  C  CG   . GLU A  1 222 ? 100.580 120.835 34.205  1.00 18.31 ? 222 GLU A CG   1 
ATOM   3126  C  CD   . GLU A  1 222 ? 101.935 120.931 34.892  1.00 16.67 ? 222 GLU A CD   1 
ATOM   3127  O  OE1  . GLU A  1 222 ? 102.530 119.896 35.251  1.00 18.20 ? 222 GLU A OE1  1 
ATOM   3128  O  OE2  . GLU A  1 222 ? 102.404 122.064 35.095  1.00 19.86 ? 222 GLU A OE2  1 
ATOM   3129  H  H    . GLU A  1 222 ? 98.051  119.804 34.581  1.00 20.67 ? 222 GLU A H    1 
ATOM   3130  H  HA   . GLU A  1 222 ? 98.988  120.043 32.142  1.00 20.93 ? 222 GLU A HA   1 
ATOM   3131  H  HB2  . GLU A  1 222 ? 100.226 118.819 34.374  1.00 20.86 ? 222 GLU A HB2  1 
ATOM   3132  H  HB3  . GLU A  1 222 ? 100.986 119.198 33.032  1.00 20.86 ? 222 GLU A HB3  1 
ATOM   3133  H  HG2  . GLU A  1 222 ? 100.570 121.479 33.480  1.00 21.97 ? 222 GLU A HG2  1 
ATOM   3134  H  HG3  . GLU A  1 222 ? 99.901  121.065 34.858  1.00 21.97 ? 222 GLU A HG3  1 
ATOM   3135  N  N    . VAL A  1 223 ? 97.979  117.136 32.936  1.00 18.79 ? 223 VAL A N    1 
ATOM   3136  C  CA   . VAL A  1 223 ? 97.791  115.759 32.460  1.00 17.85 ? 223 VAL A CA   1 
ATOM   3137  C  C    . VAL A  1 223 ? 96.334  115.287 32.335  1.00 20.46 ? 223 VAL A C    1 
ATOM   3138  O  O    . VAL A  1 223 ? 96.093  114.137 31.978  1.00 24.21 ? 223 VAL A O    1 
ATOM   3139  C  CB   . VAL A  1 223 ? 98.570  114.759 33.342  1.00 24.58 ? 223 VAL A CB   1 
ATOM   3140  C  CG1  . VAL A  1 223 ? 100.071 114.859 33.061  1.00 29.50 ? 223 VAL A CG1  1 
ATOM   3141  C  CG2  . VAL A  1 223 ? 98.293  115.026 34.790  1.00 19.64 ? 223 VAL A CG2  1 
ATOM   3142  H  H    . VAL A  1 223 ? 97.584  117.312 33.679  1.00 22.54 ? 223 VAL A H    1 
ATOM   3143  H  HA   . VAL A  1 223 ? 98.180  115.703 31.563  1.00 21.42 ? 223 VAL A HA   1 
ATOM   3144  H  HB   . VAL A  1 223 ? 98.277  113.847 33.135  1.00 29.49 ? 223 VAL A HB   1 
ATOM   3145  H  HG11 . VAL A  1 223 ? 100.536 114.231 33.618  1.00 35.40 ? 223 VAL A HG11 1 
ATOM   3146  H  HG12 . VAL A  1 223 ? 100.230 114.657 32.136  1.00 35.40 ? 223 VAL A HG12 1 
ATOM   3147  H  HG13 . VAL A  1 223 ? 100.367 115.751 33.256  1.00 35.40 ? 223 VAL A HG13 1 
ATOM   3148  H  HG21 . VAL A  1 223 ? 98.785  114.397 35.323  1.00 23.57 ? 223 VAL A HG21 1 
ATOM   3149  H  HG22 . VAL A  1 223 ? 98.570  115.921 35.001  1.00 23.57 ? 223 VAL A HG22 1 
ATOM   3150  H  HG23 . VAL A  1 223 ? 97.352  114.928 34.952  1.00 23.57 ? 223 VAL A HG23 1 
ATOM   3151  N  N    . ALA A  1 224 ? 95.368  116.166 32.605  1.00 13.64 ? 224 ALA A N    1 
ATOM   3152  C  CA   . ALA A  1 224 ? 93.947  115.823 32.452  1.00 13.83 ? 224 ALA A CA   1 
ATOM   3153  C  C    . ALA A  1 224 ? 93.204  117.126 32.193  1.00 15.16 ? 224 ALA A C    1 
ATOM   3154  O  O    . ALA A  1 224 ? 93.153  118.000 33.070  1.00 15.40 ? 224 ALA A O    1 
ATOM   3155  C  CB   . ALA A  1 224 ? 93.396  115.118 33.717  1.00 9.95  ? 224 ALA A CB   1 
ATOM   3156  H  H    . ALA A  1 224 ? 95.506  116.969 32.880  1.00 16.37 ? 224 ALA A H    1 
ATOM   3157  H  HA   . ALA A  1 224 ? 93.828  115.231 31.681  1.00 16.59 ? 224 ALA A HA   1 
ATOM   3158  H  HB1  . ALA A  1 224 ? 92.469  114.910 33.580  1.00 11.94 ? 224 ALA A HB1  1 
ATOM   3159  H  HB2  . ALA A  1 224 ? 93.895  114.310 33.866  1.00 11.94 ? 224 ALA A HB2  1 
ATOM   3160  H  HB3  . ALA A  1 224 ? 93.493  115.706 34.470  1.00 11.94 ? 224 ALA A HB3  1 
ATOM   3161  N  N    . LYS A  1 225 ? 92.640  117.265 30.993  1.00 10.28 ? 225 LYS A N    1 
ATOM   3162  C  CA   . LYS A  1 225 ? 92.163  118.561 30.536  1.00 12.78 ? 225 LYS A CA   1 
ATOM   3163  C  C    . LYS A  1 225 ? 90.666  118.702 30.311  1.00 16.36 ? 225 LYS A C    1 
ATOM   3164  O  O    . LYS A  1 225 ? 90.234  119.620 29.626  1.00 16.98 ? 225 LYS A O    1 
ATOM   3165  C  CB   . LYS A  1 225 ? 92.907  118.936 29.250  1.00 15.17 ? 225 LYS A CB   1 
ATOM   3166  C  CG   . LYS A  1 225 ? 94.378  119.260 29.528  1.00 19.14 ? 225 LYS A CG   1 
ATOM   3167  C  CD   . LYS A  1 225 ? 95.115  119.716 28.286  1.00 31.08 ? 225 LYS A CD   1 
ATOM   3168  C  CE   . LYS A  1 225 ? 96.481  120.295 28.653  1.00 32.68 ? 225 LYS A CE   1 
ATOM   3169  N  NZ   . LYS A  1 225 ? 97.339  119.307 29.375  1.00 22.67 ? 225 LYS A NZ   1 
ATOM   3170  H  H    . LYS A  1 225 ? 92.524  116.626 30.430  1.00 12.34 ? 225 LYS A H    1 
ATOM   3171  H  HA   . LYS A  1 225 ? 92.410  119.225 31.212  1.00 15.33 ? 225 LYS A HA   1 
ATOM   3172  H  HB2  . LYS A  1 225 ? 92.872  118.191 28.630  1.00 18.21 ? 225 LYS A HB2  1 
ATOM   3173  H  HB3  . LYS A  1 225 ? 92.492  119.720 28.857  1.00 18.21 ? 225 LYS A HB3  1 
ATOM   3174  H  HG2  . LYS A  1 225 ? 94.427  119.972 30.185  1.00 22.97 ? 225 LYS A HG2  1 
ATOM   3175  H  HG3  . LYS A  1 225 ? 94.819  118.465 29.865  1.00 22.97 ? 225 LYS A HG3  1 
ATOM   3176  H  HD2  . LYS A  1 225 ? 95.251  118.958 27.696  1.00 37.29 ? 225 LYS A HD2  1 
ATOM   3177  H  HD3  . LYS A  1 225 ? 94.599  120.405 27.840  1.00 37.29 ? 225 LYS A HD3  1 
ATOM   3178  H  HE2  . LYS A  1 225 ? 96.943  120.558 27.841  1.00 39.21 ? 225 LYS A HE2  1 
ATOM   3179  H  HE3  . LYS A  1 225 ? 96.356  121.065 29.230  1.00 39.21 ? 225 LYS A HE3  1 
ATOM   3180  H  HZ1  . LYS A  1 225 ? 96.940  119.052 30.129  1.00 27.20 ? 225 LYS A HZ1  1 
ATOM   3181  H  HZ2  . LYS A  1 225 ? 97.475  118.591 28.864  1.00 27.20 ? 225 LYS A HZ2  1 
ATOM   3182  H  HZ3  . LYS A  1 225 ? 98.125  119.674 29.574  1.00 27.20 ? 225 LYS A HZ3  1 
ATOM   3183  N  N    . ASN A  1 226 ? 89.870  117.806 30.880  1.00 9.01  ? 226 ASN A N    1 
ATOM   3184  C  CA   . ASN A  1 226 ? 88.423  117.949 30.856  1.00 8.72  ? 226 ASN A CA   1 
ATOM   3185  C  C    . ASN A  1 226 ? 87.881  118.127 32.280  1.00 8.36  ? 226 ASN A C    1 
ATOM   3186  O  O    . ASN A  1 226 ? 87.941  117.199 33.071  1.00 9.22  ? 226 ASN A O    1 
ATOM   3187  C  CB   . ASN A  1 226 ? 87.772  116.758 30.183  1.00 14.16 ? 226 ASN A CB   1 
ATOM   3188  C  CG   . ASN A  1 226 ? 87.944  116.786 28.658  1.00 13.45 ? 226 ASN A CG   1 
ATOM   3189  O  OD1  . ASN A  1 226 ? 87.148  117.395 27.953  1.00 14.13 ? 226 ASN A OD1  1 
ATOM   3190  N  ND2  . ASN A  1 226 ? 88.958  116.110 28.164  1.00 14.65 ? 226 ASN A ND2  1 
ATOM   3191  H  H    . ASN A  1 226 ? 90.145  117.102 31.289  1.00 10.81 ? 226 ASN A H    1 
ATOM   3192  H  HA   . ASN A  1 226 ? 88.191  118.751 30.342  1.00 10.46 ? 226 ASN A HA   1 
ATOM   3193  H  HB2  . ASN A  1 226 ? 88.179  115.943 30.518  1.00 16.99 ? 226 ASN A HB2  1 
ATOM   3194  H  HB3  . ASN A  1 226 ? 86.823  116.762 30.380  1.00 16.99 ? 226 ASN A HB3  1 
ATOM   3195  H  HD21 . ASN A  1 226 ? 89.486  115.680 28.690  1.00 17.58 ? 226 ASN A HD21 1 
ATOM   3196  H  HD22 . ASN A  1 226 ? 89.094  116.097 27.315  1.00 17.58 ? 226 ASN A HD22 1 
ATOM   3197  N  N    . LEU A  1 227 ? 87.438  119.342 32.602  1.00 8.88  ? 227 LEU A N    1 
ATOM   3198  C  CA   . LEU A  1 227 ? 86.734  119.616 33.852  1.00 7.98  ? 227 LEU A CA   1 
ATOM   3199  C  C    . LEU A  1 227 ? 85.233  119.444 33.619  1.00 8.21  ? 227 LEU A C    1 
ATOM   3200  O  O    . LEU A  1 227 ? 84.613  120.195 32.887  1.00 13.51 ? 227 LEU A O    1 
ATOM   3201  C  CB   . LEU A  1 227 ? 87.012  121.044 34.327  1.00 11.33 ? 227 LEU A CB   1 
ATOM   3202  C  CG   . LEU A  1 227 ? 86.341  121.447 35.661  1.00 12.56 ? 227 LEU A CG   1 
ATOM   3203  C  CD1  . LEU A  1 227 ? 86.946  120.711 36.856  1.00 14.13 ? 227 LEU A CD1  1 
ATOM   3204  C  CD2  . LEU A  1 227 ? 86.415  122.966 35.862  1.00 12.34 ? 227 LEU A CD2  1 
ATOM   3205  H  H    . LEU A  1 227 ? 87.535  120.035 32.103  1.00 10.66 ? 227 LEU A H    1 
ATOM   3206  H  HA   . LEU A  1 227 ? 87.023  118.987 34.546  1.00 9.57  ? 227 LEU A HA   1 
ATOM   3207  H  HB2  . LEU A  1 227 ? 87.970  121.148 34.440  1.00 13.60 ? 227 LEU A HB2  1 
ATOM   3208  H  HB3  . LEU A  1 227 ? 86.698  121.660 33.646  1.00 13.60 ? 227 LEU A HB3  1 
ATOM   3209  H  HG   . LEU A  1 227 ? 85.403  121.205 35.616  1.00 15.08 ? 227 LEU A HG   1 
ATOM   3210  H  HD11 . LEU A  1 227 ? 86.498  120.995 37.656  1.00 16.96 ? 227 LEU A HD11 1 
ATOM   3211  H  HD12 . LEU A  1 227 ? 86.830  119.766 36.732  1.00 16.96 ? 227 LEU A HD12 1 
ATOM   3212  H  HD13 . LEU A  1 227 ? 87.881  120.922 36.911  1.00 16.96 ? 227 LEU A HD13 1 
ATOM   3213  H  HD21 . LEU A  1 227 ? 85.994  123.192 36.694  1.00 14.80 ? 227 LEU A HD21 1 
ATOM   3214  H  HD22 . LEU A  1 227 ? 87.337  123.235 35.878  1.00 14.80 ? 227 LEU A HD22 1 
ATOM   3215  H  HD23 . LEU A  1 227 ? 85.961  123.400 35.136  1.00 14.80 ? 227 LEU A HD23 1 
ATOM   3216  N  N    . ASN A  1 228 ? 84.655  118.437 34.242  1.00 7.63  ? 228 ASN A N    1 
ATOM   3217  C  CA   . ASN A  1 228 ? 83.243  118.149 34.082  1.00 7.53  ? 228 ASN A CA   1 
ATOM   3218  C  C    . ASN A  1 228 ? 82.474  118.506 35.345  1.00 14.38 ? 228 ASN A C    1 
ATOM   3219  O  O    . ASN A  1 228 ? 82.703  117.896 36.415  1.00 10.49 ? 228 ASN A O    1 
ATOM   3220  C  CB   . ASN A  1 228 ? 83.088  116.671 33.704  1.00 8.67  ? 228 ASN A CB   1 
ATOM   3221  C  CG   . ASN A  1 228 ? 84.219  116.189 32.829  1.00 9.04  ? 228 ASN A CG   1 
ATOM   3222  O  OD1  . ASN A  1 228 ? 84.321  116.566 31.642  1.00 9.78  ? 228 ASN A OD1  1 
ATOM   3223  N  ND2  . ASN A  1 228 ? 85.088  115.339 33.391  1.00 11.44 ? 228 ASN A ND2  1 
ATOM   3224  H  H    . ASN A  1 228 ? 85.064  117.896 34.771  1.00 9.15  ? 228 ASN A H    1 
ATOM   3225  H  HA   . ASN A  1 228 ? 82.886  118.690 33.346  1.00 9.04  ? 228 ASN A HA   1 
ATOM   3226  H  HB2  . ASN A  1 228 ? 83.083  116.135 34.513  1.00 10.40 ? 228 ASN A HB2  1 
ATOM   3227  H  HB3  . ASN A  1 228 ? 82.258  116.552 33.218  1.00 10.40 ? 228 ASN A HB3  1 
ATOM   3228  H  HD21 . ASN A  1 228 ? 84.984  115.097 34.210  1.00 13.73 ? 228 ASN A HD21 1 
ATOM   3229  H  HD22 . ASN A  1 228 ? 85.750  115.036 32.934  1.00 13.73 ? 228 ASN A HD22 1 
ATOM   3230  N  N    . LEU A  1 229 ? 81.558  119.476 35.224  1.00 7.35  ? 229 LEU A N    1 
ATOM   3231  C  CA   . LEU A  1 229 ? 80.962  120.124 36.417  1.00 9.81  ? 229 LEU A CA   1 
ATOM   3232  C  C    . LEU A  1 229 ? 79.843  119.309 37.038  1.00 7.88  ? 229 LEU A C    1 
ATOM   3233  O  O    . LEU A  1 229 ? 78.677  119.722 37.081  1.00 10.75 ? 229 LEU A O    1 
ATOM   3234  C  CB   . LEU A  1 229 ? 80.451  121.520 36.075  1.00 13.16 ? 229 LEU A CB   1 
ATOM   3235  C  CG   . LEU A  1 229 ? 81.515  122.378 35.390  1.00 11.61 ? 229 LEU A CG   1 
ATOM   3236  C  CD1  . LEU A  1 229 ? 80.927  123.682 34.907  1.00 8.79  ? 229 LEU A CD1  1 
ATOM   3237  C  CD2  . LEU A  1 229 ? 82.661  122.639 36.373  1.00 12.36 ? 229 LEU A CD2  1 
ATOM   3238  H  H    . LEU A  1 229 ? 81.263  119.778 34.474  1.00 8.82  ? 229 LEU A H    1 
ATOM   3239  H  HA   . LEU A  1 229 ? 81.662  120.226 37.095  1.00 11.77 ? 229 LEU A HA   1 
ATOM   3240  H  HB2  . LEU A  1 229 ? 79.694  121.443 35.473  1.00 15.79 ? 229 LEU A HB2  1 
ATOM   3241  H  HB3  . LEU A  1 229 ? 80.182  121.969 36.892  1.00 15.79 ? 229 LEU A HB3  1 
ATOM   3242  H  HG   . LEU A  1 229 ? 81.871  121.900 34.625  1.00 13.93 ? 229 LEU A HG   1 
ATOM   3243  H  HD11 . LEU A  1 229 ? 81.618  124.197 34.483  1.00 10.54 ? 229 LEU A HD11 1 
ATOM   3244  H  HD12 . LEU A  1 229 ? 80.226  123.494 34.279  1.00 10.54 ? 229 LEU A HD12 1 
ATOM   3245  H  HD13 . LEU A  1 229 ? 80.574  124.163 35.659  1.00 10.54 ? 229 LEU A HD13 1 
ATOM   3246  H  HD21 . LEU A  1 229 ? 83.327  123.177 35.940  1.00 14.83 ? 229 LEU A HD21 1 
ATOM   3247  H  HD22 . LEU A  1 229 ? 82.314  123.099 37.141  1.00 14.83 ? 229 LEU A HD22 1 
ATOM   3248  H  HD23 . LEU A  1 229 ? 83.041  121.798 36.639  1.00 14.83 ? 229 LEU A HD23 1 
ATOM   3249  N  N    . THR A  1 230 ? 80.236  118.166 37.583  1.00 9.60  ? 230 THR A N    1 
ATOM   3250  C  CA   . THR A  1 230 ? 79.324  117.303 38.285  1.00 11.86 ? 230 THR A CA   1 
ATOM   3251  C  C    . THR A  1 230 ? 78.866  117.897 39.611  1.00 9.77  ? 230 THR A C    1 
ATOM   3252  O  O    . THR A  1 230 ? 77.766  117.617 40.054  1.00 8.51  ? 230 THR A O    1 
ATOM   3253  C  CB   . THR A  1 230 ? 79.977  115.964 38.568  1.00 10.12 ? 230 THR A CB   1 
ATOM   3254  O  OG1  . THR A  1 230 ? 81.303  116.154 39.077  1.00 9.99  ? 230 THR A OG1  1 
ATOM   3255  C  CG2  . THR A  1 230 ? 80.054  115.190 37.278  1.00 10.92 ? 230 THR A CG2  1 
ATOM   3256  H  H    . THR A  1 230 ? 81.042  117.869 37.554  1.00 11.51 ? 230 THR A H    1 
ATOM   3257  H  HA   . THR A  1 230 ? 78.532  117.148 37.729  1.00 14.24 ? 230 THR A HA   1 
ATOM   3258  H  HB   . THR A  1 230 ? 79.445  115.462 39.205  1.00 12.14 ? 230 THR A HB   1 
ATOM   3259  H  HG1  . THR A  1 230 ? 81.277  116.587 39.773  1.00 11.99 ? 230 THR A HG1  1 
ATOM   3260  H  HG21 . THR A  1 230 ? 80.466  114.337 37.432  1.00 13.10 ? 230 THR A HG21 1 
ATOM   3261  H  HG22 . THR A  1 230 ? 79.173  115.053 36.925  1.00 13.10 ? 230 THR A HG22 1 
ATOM   3262  H  HG23 . THR A  1 230 ? 80.576  115.676 36.635  1.00 13.10 ? 230 THR A HG23 1 
ATOM   3263  N  N    . ALA A  1 231 ? 79.716  118.697 40.231  1.00 10.47 ? 231 ALA A N    1 
ATOM   3264  C  CA   . ALA A  1 231 ? 79.358  119.402 41.472  1.00 8.65  ? 231 ALA A CA   1 
ATOM   3265  C  C    . ALA A  1 231 ? 78.724  118.426 42.464  1.00 8.87  ? 231 ALA A C    1 
ATOM   3266  O  O    . ALA A  1 231 ? 77.694  118.720 43.105  1.00 11.72 ? 231 ALA A O    1 
ATOM   3267  C  CB   . ALA A  1 231 ? 78.428  120.579 41.184  1.00 10.04 ? 231 ALA A CB   1 
ATOM   3268  H  H    . ALA A  1 231 ? 80.516  118.857 39.958  1.00 12.56 ? 231 ALA A H    1 
ATOM   3269  H  HA   . ALA A  1 231 ? 80.174  119.758 41.881  1.00 10.38 ? 231 ALA A HA   1 
ATOM   3270  H  HB1  . ALA A  1 231 ? 78.213  121.017 42.011  1.00 12.04 ? 231 ALA A HB1  1 
ATOM   3271  H  HB2  . ALA A  1 231 ? 78.874  121.192 40.594  1.00 12.04 ? 231 ALA A HB2  1 
ATOM   3272  H  HB3  . ALA A  1 231 ? 77.627  120.250 40.769  1.00 12.04 ? 231 ALA A HB3  1 
ATOM   3273  N  N    . HIS A  1 232 ? 79.370  117.277 42.628  1.00 10.92 ? 232 HIS A N    1 
ATOM   3274  C  CA   . HIS A  1 232 ? 78.729  116.185 43.332  1.00 9.37  ? 232 HIS A CA   1 
ATOM   3275  C  C    . HIS A  1 232 ? 78.807  116.385 44.838  1.00 15.17 ? 232 HIS A C    1 
ATOM   3276  O  O    . HIS A  1 232 ? 77.914  115.943 45.548  1.00 13.14 ? 232 HIS A O    1 
ATOM   3277  C  CB   . HIS A  1 232 ? 79.272  114.800 42.890  1.00 7.61  ? 232 HIS A CB   1 
ATOM   3278  C  CG   . HIS A  1 232 ? 80.762  114.726 42.849  1.00 12.69 ? 232 HIS A CG   1 
ATOM   3279  N  ND1  . HIS A  1 232 ? 81.502  115.092 41.740  1.00 14.23 ? 232 HIS A ND1  1 
ATOM   3280  C  CD2  . HIS A  1 232 ? 81.655  114.373 43.798  1.00 10.37 ? 232 HIS A CD2  1 
ATOM   3281  C  CE1  . HIS A  1 232 ? 82.787  114.960 42.016  1.00 8.82  ? 232 HIS A CE1  1 
ATOM   3282  N  NE2  . HIS A  1 232 ? 82.904  114.513 43.257  1.00 7.01  ? 232 HIS A NE2  1 
ATOM   3283  H  H    . HIS A  1 232 ? 80.165  117.109 42.347  1.00 13.10 ? 232 HIS A H    1 
ATOM   3284  H  HA   . HIS A  1 232 ? 77.778  116.200 43.097  1.00 11.24 ? 232 HIS A HA   1 
ATOM   3285  H  HB2  . HIS A  1 232 ? 78.958  114.127 43.514  1.00 9.14  ? 232 HIS A HB2  1 
ATOM   3286  H  HB3  . HIS A  1 232 ? 78.940  114.604 41.999  1.00 9.14  ? 232 HIS A HB3  1 
ATOM   3287  H  HD1  . HIS A  1 232 ? 81.178  115.371 40.994  1.00 17.07 ? 232 HIS A HD1  1 
ATOM   3288  H  HD2  . HIS A  1 232 ? 81.457  114.081 44.658  1.00 12.45 ? 232 HIS A HD2  1 
ATOM   3289  H  HE1  . HIS A  1 232 ? 83.489  115.129 41.430  1.00 10.59 ? 232 HIS A HE1  1 
ATOM   3290  H  HE2  . HIS A  1 232 ? 83.645  114.344 43.659  1.00 8.41  ? 232 HIS A HE2  1 
ATOM   3291  N  N    . THR A  1 233 ? 79.849  117.062 45.322  1.00 8.06  ? 233 THR A N    1 
ATOM   3292  C  CA   . THR A  1 233 ? 79.962  117.312 46.767  1.00 10.65 ? 233 THR A CA   1 
ATOM   3293  C  C    . THR A  1 233 ? 80.281  118.765 47.071  1.00 10.05 ? 233 THR A C    1 
ATOM   3294  O  O    . THR A  1 233 ? 81.232  119.314 46.514  1.00 10.94 ? 233 THR A O    1 
ATOM   3295  C  CB   . THR A  1 233 ? 81.083  116.460 47.377  1.00 12.16 ? 233 THR A CB   1 
ATOM   3296  O  OG1  . THR A  1 233 ? 80.768  115.073 47.206  1.00 17.39 ? 233 THR A OG1  1 
ATOM   3297  C  CG2  . THR A  1 233 ? 81.256  116.762 48.851  1.00 13.96 ? 233 THR A CG2  1 
ATOM   3298  H  H    . THR A  1 233 ? 80.492  117.383 44.850  1.00 9.67  ? 233 THR A H    1 
ATOM   3299  H  HA   . THR A  1 233 ? 79.118  117.079 47.207  1.00 12.78 ? 233 THR A HA   1 
ATOM   3300  H  HB   . THR A  1 233 ? 81.918  116.657 46.926  1.00 14.59 ? 233 THR A HB   1 
ATOM   3301  H  HG1  . THR A  1 233 ? 80.059  114.898 47.580  1.00 20.87 ? 233 THR A HG1  1 
ATOM   3302  H  HG21 . THR A  1 233 ? 81.960  116.221 49.216  1.00 16.76 ? 233 THR A HG21 1 
ATOM   3303  H  HG22 . THR A  1 233 ? 81.479  117.687 48.972  1.00 16.76 ? 233 THR A HG22 1 
ATOM   3304  H  HG23 . THR A  1 233 ? 80.441  116.573 49.322  1.00 16.76 ? 233 THR A HG23 1 
ATOM   3305  N  N    . LYS A  1 234 ? 79.490  119.376 47.941  1.00 9.17  ? 234 LYS A N    1 
ATOM   3306  C  CA   . LYS A  1 234 ? 79.845  120.651 48.558  1.00 12.01 ? 234 LYS A CA   1 
ATOM   3307  C  C    . LYS A  1 234 ? 80.635  120.307 49.816  1.00 11.62 ? 234 LYS A C    1 
ATOM   3308  O  O    . LYS A  1 234 ? 80.058  120.070 50.897  1.00 8.68  ? 234 LYS A O    1 
ATOM   3309  C  CB   . LYS A  1 234 ? 78.601  121.465 48.930  1.00 15.80 ? 234 LYS A CB   1 
ATOM   3310  C  CG   . LYS A  1 234 ? 77.708  121.815 47.758  1.00 16.45 ? 234 LYS A CG   1 
ATOM   3311  C  CD   . LYS A  1 234 ? 78.261  122.950 46.951  1.00 17.52 ? 234 LYS A CD   1 
ATOM   3312  C  CE   . LYS A  1 234 ? 77.682  122.936 45.547  1.00 27.90 ? 234 LYS A CE   1 
ATOM   3313  N  NZ   . LYS A  1 234 ? 78.199  124.069 44.761  1.00 31.14 ? 234 LYS A NZ   1 
ATOM   3314  H  H    . LYS A  1 234 ? 78.728  119.069 48.196  1.00 11.00 ? 234 LYS A H    1 
ATOM   3315  H  HA   . LYS A  1 234 ? 80.410  121.177 47.954  1.00 14.41 ? 234 LYS A HA   1 
ATOM   3316  H  HB2  . LYS A  1 234 ? 78.072  120.952 49.560  1.00 18.96 ? 234 LYS A HB2  1 
ATOM   3317  H  HB3  . LYS A  1 234 ? 78.885  122.295 49.342  1.00 18.96 ? 234 LYS A HB3  1 
ATOM   3318  H  HG2  . LYS A  1 234 ? 77.626  121.043 47.178  1.00 19.74 ? 234 LYS A HG2  1 
ATOM   3319  H  HG3  . LYS A  1 234 ? 76.835  122.078 48.091  1.00 19.74 ? 234 LYS A HG3  1 
ATOM   3320  H  HD2  . LYS A  1 234 ? 78.026  123.791 47.373  1.00 21.03 ? 234 LYS A HD2  1 
ATOM   3321  H  HD3  . LYS A  1 234 ? 79.225  122.861 46.887  1.00 21.03 ? 234 LYS A HD3  1 
ATOM   3322  H  HE2  . LYS A  1 234 ? 77.935  122.113 45.102  1.00 33.48 ? 234 LYS A HE2  1 
ATOM   3323  H  HE3  . LYS A  1 234 ? 76.716  123.012 45.596  1.00 33.48 ? 234 LYS A HE3  1 
ATOM   3324  H  HZ1  . LYS A  1 234 ? 77.855  124.052 43.941  1.00 37.37 ? 234 LYS A HZ1  1 
ATOM   3325  H  HZ2  . LYS A  1 234 ? 77.978  124.837 45.152  1.00 37.37 ? 234 LYS A HZ2  1 
ATOM   3326  H  HZ3  . LYS A  1 234 ? 79.086  124.019 44.703  1.00 37.37 ? 234 LYS A HZ3  1 
ATOM   3327  N  N    . HIS A  1 235 ? 81.958  120.253 49.672  1.00 7.16  ? 235 HIS A N    1 
ATOM   3328  C  CA   . HIS A  1 235 ? 82.792  119.532 50.640  1.00 7.25  ? 235 HIS A CA   1 
ATOM   3329  C  C    . HIS A  1 235 ? 83.097  120.342 51.887  1.00 7.42  ? 235 HIS A C    1 
ATOM   3330  O  O    . HIS A  1 235 ? 83.666  121.436 51.774  1.00 7.54  ? 235 HIS A O    1 
ATOM   3331  C  CB   . HIS A  1 235 ? 84.113  119.138 49.972  1.00 9.83  ? 235 HIS A CB   1 
ATOM   3332  C  CG   . HIS A  1 235 ? 84.939  118.191 50.786  1.00 8.74  ? 235 HIS A CG   1 
ATOM   3333  N  ND1  . HIS A  1 235 ? 85.033  116.849 50.497  1.00 10.92 ? 235 HIS A ND1  1 
ATOM   3334  C  CD2  . HIS A  1 235 ? 85.689  118.391 51.897  1.00 7.57  ? 235 HIS A CD2  1 
ATOM   3335  C  CE1  . HIS A  1 235 ? 85.843  116.271 51.365  1.00 11.85 ? 235 HIS A CE1  1 
ATOM   3336  N  NE2  . HIS A  1 235 ? 86.251  117.184 52.229  1.00 11.57 ? 235 HIS A NE2  1 
ATOM   3337  H  H    . HIS A  1 235 ? 82.395  120.621 49.029  1.00 8.60  ? 235 HIS A H    1 
ATOM   3338  H  HA   . HIS A  1 235 ? 82.331  118.712 50.914  1.00 8.70  ? 235 HIS A HA   1 
ATOM   3339  H  HB2  . HIS A  1 235 ? 83.919  118.709 49.124  1.00 11.80 ? 235 HIS A HB2  1 
ATOM   3340  H  HB3  . HIS A  1 235 ? 84.640  119.939 49.823  1.00 11.80 ? 235 HIS A HB3  1 
ATOM   3341  H  HD1  . HIS A  1 235 ? 84.656  116.456 49.831  1.00 13.11 ? 235 HIS A HD1  1 
ATOM   3342  H  HD2  . HIS A  1 235 ? 85.825  119.202 52.333  1.00 9.09  ? 235 HIS A HD2  1 
ATOM   3343  H  HE1  . HIS A  1 235 ? 86.066  115.368 51.383  1.00 14.22 ? 235 HIS A HE1  1 
ATOM   3344  H  HE2  . HIS A  1 235 ? 86.772  117.042 52.899  1.00 13.88 ? 235 HIS A HE2  1 
ATOM   3345  N  N    . MET A  1 236 ? 82.675  119.824 53.047  1.00 9.15  ? 236 MET A N    1 
ATOM   3346  C  CA   . MET A  1 236 ? 83.061  120.385 54.338  1.00 8.51  ? 236 MET A CA   1 
ATOM   3347  C  C    . MET A  1 236 ? 84.213  119.562 54.935  1.00 7.89  ? 236 MET A C    1 
ATOM   3348  O  O    . MET A  1 236 ? 84.199  118.333 54.886  1.00 9.57  ? 236 MET A O    1 
ATOM   3349  C  CB   . MET A  1 236 ? 81.903  120.382 55.330  1.00 10.76 ? 236 MET A CB   1 
ATOM   3350  C  CG   . MET A  1 236 ? 80.670  121.148 54.917  1.00 13.67 ? 236 MET A CG   1 
ATOM   3351  S  SD   . MET A  1 236 ? 80.963  122.843 54.384  1.00 34.12 ? 236 MET A SD   1 
ATOM   3352  C  CE   . MET A  1 236 ? 81.880  123.393 55.705  1.00 8.16  ? 236 MET A CE   1 
ATOM   3353  H  H    . MET A  1 236 ? 82.159  119.140 53.109  1.00 10.98 ? 236 MET A H    1 
ATOM   3354  H  HA   . MET A  1 236 ? 83.356  121.311 54.213  1.00 10.21 ? 236 MET A HA   1 
ATOM   3355  H  HB2  . MET A  1 236 ? 81.634  119.462 55.481  1.00 12.91 ? 236 MET A HB2  1 
ATOM   3356  H  HB3  . MET A  1 236 ? 82.215  120.766 56.164  1.00 12.91 ? 236 MET A HB3  1 
ATOM   3357  H  HG2  . MET A  1 236 ? 80.248  120.679 54.179  1.00 16.40 ? 236 MET A HG2  1 
ATOM   3358  H  HG3  . MET A  1 236 ? 80.060  121.180 55.671  1.00 16.40 ? 236 MET A HG3  1 
ATOM   3359  H  HE1  . MET A  1 236 ? 82.118  124.312 55.559  1.00 9.79  ? 236 MET A HE1  1 
ATOM   3360  H  HE2  . MET A  1 236 ? 81.354  123.314 56.504  1.00 9.79  ? 236 MET A HE2  1 
ATOM   3361  H  HE3  . MET A  1 236 ? 82.673  122.857 55.779  1.00 9.79  ? 236 MET A HE3  1 
ATOM   3362  N  N    . SER A  1 237 ? 85.187  120.258 55.509  1.00 8.07  ? 237 SER A N    1 
ATOM   3363  C  CA   . SER A  1 237 ? 86.368  119.656 56.103  1.00 8.27  ? 237 SER A CA   1 
ATOM   3364  C  C    . SER A  1 237 ? 86.524  119.844 57.625  1.00 8.58  ? 237 SER A C    1 
ATOM   3365  O  O    . SER A  1 237 ? 86.477  120.970 58.140  1.00 9.52  ? 237 SER A O    1 
ATOM   3366  C  CB   . SER A  1 237 ? 87.622  120.190 55.435  1.00 10.27 ? 237 SER A CB   1 
ATOM   3367  O  OG   . SER A  1 237 ? 87.721  119.682 54.109  1.00 11.44 ? 237 SER A OG   1 
ATOM   3368  H  H    . SER A  1 237 ? 85.183  121.116 55.567  1.00 9.68  ? 237 SER A H    1 
ATOM   3369  H  HA   . SER A  1 237 ? 86.337  118.691 55.933  1.00 9.92  ? 237 SER A HA   1 
ATOM   3370  H  HB2  . SER A  1 237 ? 87.578  121.159 55.403  1.00 12.32 ? 237 SER A HB2  1 
ATOM   3371  H  HB3  . SER A  1 237 ? 88.398  119.907 55.943  1.00 12.32 ? 237 SER A HB3  1 
ATOM   3372  H  HG   . SER A  1 237 ? 87.082  119.194 53.947  1.00 13.73 ? 237 SER A HG   1 
ATOM   3373  N  N    . PRO A  1 238 ? 86.806  118.744 58.340  1.00 10.53 ? 238 PRO A N    1 
ATOM   3374  C  CA   . PRO A  1 238 ? 87.245  118.880 59.720  1.00 11.82 ? 238 PRO A CA   1 
ATOM   3375  C  C    . PRO A  1 238 ? 88.769  118.986 59.824  1.00 11.73 ? 238 PRO A C    1 
ATOM   3376  O  O    . PRO A  1 238 ? 89.487  118.437 58.996  1.00 9.44  ? 238 PRO A O    1 
ATOM   3377  C  CB   . PRO A  1 238 ? 86.810  117.559 60.342  1.00 9.98  ? 238 PRO A CB   1 
ATOM   3378  C  CG   . PRO A  1 238 ? 86.949  116.570 59.221  1.00 13.01 ? 238 PRO A CG   1 
ATOM   3379  C  CD   . PRO A  1 238 ? 86.716  117.322 57.936  1.00 11.06 ? 238 PRO A CD   1 
ATOM   3380  H  HA   . PRO A  1 238 ? 86.810  119.635 60.168  1.00 14.19 ? 238 PRO A HA   1 
ATOM   3381  H  HB2  . PRO A  1 238 ? 87.397  117.332 61.080  1.00 11.98 ? 238 PRO A HB2  1 
ATOM   3382  H  HB3  . PRO A  1 238 ? 85.888  117.621 60.638  1.00 11.98 ? 238 PRO A HB3  1 
ATOM   3383  H  HG2  . PRO A  1 238 ? 87.843  116.193 59.234  1.00 15.62 ? 238 PRO A HG2  1 
ATOM   3384  H  HG3  . PRO A  1 238 ? 86.287  115.869 59.326  1.00 15.62 ? 238 PRO A HG3  1 
ATOM   3385  H  HD2  . PRO A  1 238 ? 87.409  117.110 57.291  1.00 13.27 ? 238 PRO A HD2  1 
ATOM   3386  H  HD3  . PRO A  1 238 ? 85.833  117.126 57.586  1.00 13.27 ? 238 PRO A HD3  1 
ATOM   3387  N  N    . PHE A  1 239 ? 89.247  119.682 60.844  1.00 9.67  ? 239 PHE A N    1 
ATOM   3388  C  CA   . PHE A  1 239 ? 90.607  119.500 61.330  1.00 10.04 ? 239 PHE A CA   1 
ATOM   3389  C  C    . PHE A  1 239 ? 90.562  118.838 62.701  1.00 16.02 ? 239 PHE A C    1 
ATOM   3390  O  O    . PHE A  1 239 ? 89.752  119.205 63.553  1.00 12.37 ? 239 PHE A O    1 
ATOM   3391  C  CB   . PHE A  1 239 ? 91.337  120.824 61.347  1.00 12.87 ? 239 PHE A CB   1 
ATOM   3392  C  CG   . PHE A  1 239 ? 91.698  121.310 59.970  1.00 12.90 ? 239 PHE A CG   1 
ATOM   3393  C  CD1  . PHE A  1 239 ? 90.730  121.815 59.120  1.00 11.87 ? 239 PHE A CD1  1 
ATOM   3394  C  CD2  . PHE A  1 239 ? 93.004  121.216 59.519  1.00 16.18 ? 239 PHE A CD2  1 
ATOM   3395  C  CE1  . PHE A  1 239 ? 91.062  122.233 57.828  1.00 10.11 ? 239 PHE A CE1  1 
ATOM   3396  C  CE2  . PHE A  1 239 ? 93.350  121.647 58.243  1.00 15.31 ? 239 PHE A CE2  1 
ATOM   3397  C  CZ   . PHE A  1 239 ? 92.389  122.158 57.405  1.00 12.12 ? 239 PHE A CZ   1 
ATOM   3398  H  H    . PHE A  1 239 ? 88.799  120.275 61.277  1.00 11.60 ? 239 PHE A H    1 
ATOM   3399  H  HA   . PHE A  1 239 ? 91.085  118.899 60.720  1.00 12.04 ? 239 PHE A HA   1 
ATOM   3400  H  HB2  . PHE A  1 239 ? 90.769  121.492 61.761  1.00 15.44 ? 239 PHE A HB2  1 
ATOM   3401  H  HB3  . PHE A  1 239 ? 92.158  120.725 61.855  1.00 15.44 ? 239 PHE A HB3  1 
ATOM   3402  H  HD1  . PHE A  1 239 ? 89.847  121.868 59.408  1.00 14.25 ? 239 PHE A HD1  1 
ATOM   3403  H  HD2  . PHE A  1 239 ? 93.661  120.877 60.083  1.00 19.41 ? 239 PHE A HD2  1 
ATOM   3404  H  HE1  . PHE A  1 239 ? 90.410  122.584 57.266  1.00 12.13 ? 239 PHE A HE1  1 
ATOM   3405  H  HE2  . PHE A  1 239 ? 94.233  121.587 57.957  1.00 18.37 ? 239 PHE A HE2  1 
ATOM   3406  H  HZ   . PHE A  1 239 ? 92.620  122.439 56.549  1.00 14.55 ? 239 PHE A HZ   1 
ATOM   3407  N  N    . VAL A  1 240 ? 91.433  117.853 62.896  1.00 12.95 ? 240 VAL A N    1 
ATOM   3408  C  CA   . VAL A  1 240 ? 91.333  116.927 64.023  1.00 11.02 ? 240 VAL A CA   1 
ATOM   3409  C  C    . VAL A  1 240 ? 92.691  116.738 64.677  1.00 11.54 ? 240 VAL A C    1 
ATOM   3410  O  O    . VAL A  1 240 ? 93.730  117.037 64.081  1.00 12.52 ? 240 VAL A O    1 
ATOM   3411  C  CB   . VAL A  1 240 ? 90.816  115.539 63.544  1.00 10.89 ? 240 VAL A CB   1 
ATOM   3412  C  CG1  . VAL A  1 240 ? 89.566  115.689 62.664  1.00 10.39 ? 240 VAL A CG1  1 
ATOM   3413  C  CG2  . VAL A  1 240 ? 91.903  114.814 62.779  1.00 15.14 ? 240 VAL A CG2  1 
ATOM   3414  H  H    . VAL A  1 240 ? 92.103  117.696 62.380  1.00 15.54 ? 240 VAL A H    1 
ATOM   3415  H  HA   . VAL A  1 240 ? 90.709  117.283 64.690  1.00 13.23 ? 240 VAL A HA   1 
ATOM   3416  H  HB   . VAL A  1 240 ? 90.578  114.997 64.325  1.00 13.07 ? 240 VAL A HB   1 
ATOM   3417  H  HG11 . VAL A  1 240 ? 89.274  114.818 62.386  1.00 12.47 ? 240 VAL A HG11 1 
ATOM   3418  H  HG12 . VAL A  1 240 ? 88.876  116.119 63.173  1.00 12.47 ? 240 VAL A HG12 1 
ATOM   3419  H  HG13 . VAL A  1 240 ? 89.787  116.221 61.896  1.00 12.47 ? 240 VAL A HG13 1 
ATOM   3420  H  HG21 . VAL A  1 240 ? 91.567  113.962 62.492  1.00 18.17 ? 240 VAL A HG21 1 
ATOM   3421  H  HG22 . VAL A  1 240 ? 92.153  115.342 62.017  1.00 18.17 ? 240 VAL A HG22 1 
ATOM   3422  H  HG23 . VAL A  1 240 ? 92.661  114.691 63.355  1.00 18.17 ? 240 VAL A HG23 1 
ATOM   3423  N  N    . ALA A  1 241 ? 92.677  116.268 65.919  1.00 15.88 ? 241 ALA A N    1 
ATOM   3424  C  CA   . ALA A  1 241 ? 93.883  115.832 66.592  1.00 16.32 ? 241 ALA A CA   1 
ATOM   3425  C  C    . ALA A  1 241 ? 93.566  114.584 67.393  1.00 13.64 ? 241 ALA A C    1 
ATOM   3426  O  O    . ALA A  1 241 ? 92.405  114.266 67.644  1.00 17.46 ? 241 ALA A O    1 
ATOM   3427  C  CB   . ALA A  1 241 ? 94.422  116.913 67.518  1.00 14.01 ? 241 ALA A CB   1 
ATOM   3428  H  H    . ALA A  1 241 ? 91.966  116.191 66.397  1.00 19.05 ? 241 ALA A H    1 
ATOM   3429  H  HA   . ALA A  1 241 ? 94.571  115.614 65.929  1.00 19.59 ? 241 ALA A HA   1 
ATOM   3430  H  HB1  . ALA A  1 241 ? 95.219  116.589 67.945  1.00 16.81 ? 241 ALA A HB1  1 
ATOM   3431  H  HB2  . ALA A  1 241 ? 94.623  117.696 67.001  1.00 16.81 ? 241 ALA A HB2  1 
ATOM   3432  H  HB3  . ALA A  1 241 ? 93.757  117.119 68.179  1.00 16.81 ? 241 ALA A HB3  1 
ATOM   3433  N  N    . GLY A  1 242 ? 94.609  113.874 67.790  1.00 14.42 ? 242 GLY A N    1 
ATOM   3434  C  CA   . GLY A  1 242 ? 94.417  112.702 68.609  1.00 13.82 ? 242 GLY A CA   1 
ATOM   3435  C  C    . GLY A  1 242 ? 93.990  113.204 69.964  1.00 22.59 ? 242 GLY A C    1 
ATOM   3436  O  O    . GLY A  1 242 ? 94.470  114.247 70.417  1.00 22.62 ? 242 GLY A O    1 
ATOM   3437  H  H    . GLY A  1 242 ? 95.429  114.051 67.599  1.00 17.31 ? 242 GLY A H    1 
ATOM   3438  H  HA2  . GLY A  1 242 ? 93.725  112.133 68.238  1.00 16.59 ? 242 GLY A HA2  1 
ATOM   3439  H  HA3  . GLY A  1 242 ? 95.244  112.201 68.691  1.00 16.59 ? 242 GLY A HA3  1 
ATOM   3440  N  N    . THR A  1 243 ? 93.067  112.484 70.593  1.00 15.34 ? 243 THR A N    1 
ATOM   3441  C  CA   . THR A  1 243 ? 92.574  112.860 71.902  1.00 21.11 ? 243 THR A CA   1 
ATOM   3442  C  C    . THR A  1 243 ? 93.704  112.821 72.941  1.00 19.91 ? 243 THR A C    1 
ATOM   3443  O  O    . THR A  1 243 ? 93.692  113.583 73.898  1.00 25.99 ? 243 THR A O    1 
ATOM   3444  C  CB   . THR A  1 243 ? 91.459  111.914 72.329  1.00 24.46 ? 243 THR A CB   1 
ATOM   3445  O  OG1  . THR A  1 243 ? 91.906  110.569 72.133  1.00 24.91 ? 243 THR A OG1  1 
ATOM   3446  C  CG2  . THR A  1 243 ? 90.194  112.135 71.492  1.00 14.05 ? 243 THR A CG2  1 
ATOM   3447  H  H    . THR A  1 243 ? 92.710  111.769 70.276  1.00 18.40 ? 243 THR A H    1 
ATOM   3448  H  HA   . THR A  1 243 ? 92.214  113.770 71.867  1.00 25.33 ? 243 THR A HA   1 
ATOM   3449  H  HB   . THR A  1 243 ? 91.245  112.057 73.264  1.00 29.35 ? 243 THR A HB   1 
ATOM   3450  H  HG1  . THR A  1 243 ? 92.577  110.428 72.583  1.00 29.90 ? 243 THR A HG1  1 
ATOM   3451  H  HG21 . THR A  1 243 ? 89.503  111.531 71.775  1.00 16.86 ? 243 THR A HG21 1 
ATOM   3452  H  HG22 . THR A  1 243 ? 89.883  113.037 71.599  1.00 16.86 ? 243 THR A HG22 1 
ATOM   3453  H  HG23 . THR A  1 243 ? 90.383  111.979 70.564  1.00 16.86 ? 243 THR A HG23 1 
ATOM   3454  N  N    . ALA A  1 244 ? 94.678  111.937 72.737  1.00 32.32 ? 244 ALA A N    1 
ATOM   3455  C  CA   . ALA A  1 244 ? 95.788  111.777 73.676  1.00 32.93 ? 244 ALA A CA   1 
ATOM   3456  C  C    . ALA A  1 244 ? 96.782  112.946 73.630  1.00 31.46 ? 244 ALA A C    1 
ATOM   3457  O  O    . ALA A  1 244 ? 97.576  113.135 74.546  1.00 32.16 ? 244 ALA A O    1 
ATOM   3458  C  CB   . ALA A  1 244 ? 96.503  110.464 73.415  1.00 34.55 ? 244 ALA A CB   1 
ATOM   3459  H  H    . ALA A  1 244 ? 94.719  111.413 72.056  1.00 38.78 ? 244 ALA A H    1 
ATOM   3460  H  HA   . ALA A  1 244 ? 95.423  111.738 74.585  1.00 39.52 ? 244 ALA A HA   1 
ATOM   3461  H  HB1  . ALA A  1 244 ? 97.228  110.374 74.038  1.00 41.46 ? 244 ALA A HB1  1 
ATOM   3462  H  HB2  . ALA A  1 244 ? 95.881  109.742 73.528  1.00 41.46 ? 244 ALA A HB2  1 
ATOM   3463  H  HB3  . ALA A  1 244 ? 96.841  110.467 72.516  1.00 41.46 ? 244 ALA A HB3  1 
ATOM   3464  N  N    . PHE A  1 245 ? 96.759  113.715 72.554  1.00 23.03 ? 245 PHE A N    1 
ATOM   3465  C  CA   . PHE A  1 245 ? 97.533  114.950 72.510  1.00 22.49 ? 245 PHE A CA   1 
ATOM   3466  C  C    . PHE A  1 245 ? 96.640  116.139 72.884  1.00 22.42 ? 245 PHE A C    1 
ATOM   3467  O  O    . PHE A  1 245 ? 97.009  116.998 73.684  1.00 17.29 ? 245 PHE A O    1 
ATOM   3468  C  CB   . PHE A  1 245 ? 98.159  115.161 71.141  1.00 26.54 ? 245 PHE A CB   1 
ATOM   3469  C  CG   . PHE A  1 245 ? 98.708  116.535 70.964  1.00 23.80 ? 245 PHE A CG   1 
ATOM   3470  C  CD1  . PHE A  1 245 ? 99.876  116.907 71.612  1.00 22.66 ? 245 PHE A CD1  1 
ATOM   3471  C  CD2  . PHE A  1 245 ? 98.035  117.471 70.198  1.00 32.32 ? 245 PHE A CD2  1 
ATOM   3472  C  CE1  . PHE A  1 245 ? 100.371 118.172 71.484  1.00 26.61 ? 245 PHE A CE1  1 
ATOM   3473  C  CE2  . PHE A  1 245 ? 98.529  118.738 70.076  1.00 27.37 ? 245 PHE A CE2  1 
ATOM   3474  C  CZ   . PHE A  1 245 ? 99.703  119.082 70.725  1.00 18.42 ? 245 PHE A CZ   1 
ATOM   3475  H  H    . PHE A  1 245 ? 96.310  113.549 71.840  1.00 27.64 ? 245 PHE A H    1 
ATOM   3476  H  HA   . PHE A  1 245 ? 98.257  114.896 73.169  1.00 26.99 ? 245 PHE A HA   1 
ATOM   3477  H  HB2  . PHE A  1 245 ? 98.886  114.530 71.025  1.00 31.84 ? 245 PHE A HB2  1 
ATOM   3478  H  HB3  . PHE A  1 245 ? 97.484  115.018 70.460  1.00 31.84 ? 245 PHE A HB3  1 
ATOM   3479  H  HD1  . PHE A  1 245 ? 100.328 116.286 72.137  1.00 27.19 ? 245 PHE A HD1  1 
ATOM   3480  H  HD2  . PHE A  1 245 ? 97.244  117.238 69.769  1.00 38.79 ? 245 PHE A HD2  1 
ATOM   3481  H  HE1  . PHE A  1 245 ? 101.159 118.412 71.915  1.00 31.93 ? 245 PHE A HE1  1 
ATOM   3482  H  HE2  . PHE A  1 245 ? 98.083  119.365 69.554  1.00 32.85 ? 245 PHE A HE2  1 
ATOM   3483  H  HZ   . PHE A  1 245 ? 100.045 119.942 70.632  1.00 22.10 ? 245 PHE A HZ   1 
ATOM   3484  N  N    . TRP A  1 246 ? 95.439  116.165 72.331  1.00 24.65 ? 246 TRP A N    1 
ATOM   3485  C  CA   . TRP A  1 246 ? 94.545  117.286 72.551  1.00 18.12 ? 246 TRP A CA   1 
ATOM   3486  C  C    . TRP A  1 246 ? 94.187  117.462 74.038  1.00 21.08 ? 246 TRP A C    1 
ATOM   3487  O  O    . TRP A  1 246 ? 94.154  118.581 74.545  1.00 19.52 ? 246 TRP A O    1 
ATOM   3488  C  CB   . TRP A  1 246 ? 93.289  117.127 71.697  1.00 19.39 ? 246 TRP A CB   1 
ATOM   3489  C  CG   . TRP A  1 246 ? 92.291  118.228 71.874  1.00 19.51 ? 246 TRP A CG   1 
ATOM   3490  C  CD1  . TRP A  1 246 ? 91.134  118.173 72.594  1.00 21.87 ? 246 TRP A CD1  1 
ATOM   3491  C  CD2  . TRP A  1 246 ? 92.359  119.550 71.322  1.00 17.29 ? 246 TRP A CD2  1 
ATOM   3492  N  NE1  . TRP A  1 246 ? 90.471  119.374 72.513  1.00 18.24 ? 246 TRP A NE1  1 
ATOM   3493  C  CE2  . TRP A  1 246 ? 91.213  120.245 71.762  1.00 17.66 ? 246 TRP A CE2  1 
ATOM   3494  C  CE3  . TRP A  1 246 ? 93.279  120.218 70.515  1.00 17.53 ? 246 TRP A CE3  1 
ATOM   3495  C  CZ2  . TRP A  1 246 ? 90.950  121.568 71.394  1.00 20.84 ? 246 TRP A CZ2  1 
ATOM   3496  C  CZ3  . TRP A  1 246 ? 93.019  121.542 70.164  1.00 21.88 ? 246 TRP A CZ3  1 
ATOM   3497  C  CH2  . TRP A  1 246 ? 91.869  122.199 70.616  1.00 15.31 ? 246 TRP A CH2  1 
ATOM   3498  H  H    . TRP A  1 246 ? 95.119  115.548 71.825  1.00 29.57 ? 246 TRP A H    1 
ATOM   3499  H  HA   . TRP A  1 246 ? 94.997  118.105 72.259  1.00 21.74 ? 246 TRP A HA   1 
ATOM   3500  H  HB2  . TRP A  1 246 ? 93.548  117.109 70.762  1.00 23.27 ? 246 TRP A HB2  1 
ATOM   3501  H  HB3  . TRP A  1 246 ? 92.855  116.293 71.933  1.00 23.27 ? 246 TRP A HB3  1 
ATOM   3502  H  HD1  . TRP A  1 246 ? 90.829  117.426 73.057  1.00 26.24 ? 246 TRP A HD1  1 
ATOM   3503  H  HE1  . TRP A  1 246 ? 89.726  119.560 72.900  1.00 21.89 ? 246 TRP A HE1  1 
ATOM   3504  H  HE3  . TRP A  1 246 ? 94.051  119.791 70.220  1.00 21.04 ? 246 TRP A HE3  1 
ATOM   3505  H  HZ2  . TRP A  1 246 ? 90.186  122.008 71.690  1.00 25.01 ? 246 TRP A HZ2  1 
ATOM   3506  H  HZ3  . TRP A  1 246 ? 93.626  122.000 69.629  1.00 26.25 ? 246 TRP A HZ3  1 
ATOM   3507  H  HH2  . TRP A  1 246 ? 91.719  123.080 70.360  1.00 18.37 ? 246 TRP A HH2  1 
ATOM   3508  N  N    . ASN A  1 247 ? 93.907  116.353 74.717  1.00 21.19 ? 247 ASN A N    1 
ATOM   3509  C  CA   . ASN A  1 247 ? 93.436  116.393 76.102  1.00 28.39 ? 247 ASN A CA   1 
ATOM   3510  C  C    . ASN A  1 247 ? 94.536  116.778 77.080  1.00 24.26 ? 247 ASN A C    1 
ATOM   3511  O  O    . ASN A  1 247 ? 94.257  117.177 78.212  1.00 27.98 ? 247 ASN A O    1 
ATOM   3512  C  CB   . ASN A  1 247 ? 92.834  115.044 76.507  1.00 29.66 ? 247 ASN A CB   1 
ATOM   3513  C  CG   . ASN A  1 247 ? 91.445  114.826 75.917  1.00 37.57 ? 247 ASN A CG   1 
ATOM   3514  O  OD1  . ASN A  1 247 ? 90.984  115.601 75.073  1.00 41.27 ? 247 ASN A OD1  1 
ATOM   3515  N  ND2  . ASN A  1 247 ? 90.771  113.764 76.361  1.00 30.41 ? 247 ASN A ND2  1 
ATOM   3516  H  H    . ASN A  1 247 ? 93.981  115.558 74.397  1.00 25.43 ? 247 ASN A H    1 
ATOM   3517  H  HA   . ASN A  1 247 ? 92.728  117.067 76.172  1.00 34.06 ? 247 ASN A HA   1 
ATOM   3518  H  HB2  . ASN A  1 247 ? 93.411  114.332 76.190  1.00 35.59 ? 247 ASN A HB2  1 
ATOM   3519  H  HB3  . ASN A  1 247 ? 92.760  115.008 77.473  1.00 35.59 ? 247 ASN A HB3  1 
ATOM   3520  H  HD21 . ASN A  1 247 ? 91.124  113.246 76.949  1.00 36.50 ? 247 ASN A HD21 1 
ATOM   3521  H  HD22 . ASN A  1 247 ? 89.983  113.598 76.058  1.00 36.50 ? 247 ASN A HD22 1 
ATOM   3522  N  N    . ASN A  1 248 ? 95.786  116.661 76.645  1.00 27.85 ? 248 ASN A N    1 
ATOM   3523  C  CA   . ASN A  1 248 ? 96.900  117.033 77.501  1.00 28.74 ? 248 ASN A CA   1 
ATOM   3524  C  C    . ASN A  1 248 ? 97.323  118.493 77.307  1.00 27.77 ? 248 ASN A C    1 
ATOM   3525  O  O    . ASN A  1 248 ? 98.224  118.975 77.990  1.00 33.50 ? 248 ASN A O    1 
ATOM   3526  C  CB   . ASN A  1 248 ? 98.092  116.110 77.290  1.00 36.83 ? 248 ASN A CB   1 
ATOM   3527  C  CG   . ASN A  1 248 ? 98.925  115.958 78.542  1.00 48.80 ? 248 ASN A CG   1 
ATOM   3528  O  OD1  . ASN A  1 248 ? 98.785  116.730 79.493  1.00 49.92 ? 248 ASN A OD1  1 
ATOM   3529  N  ND2  . ASN A  1 248 ? 99.797  114.957 78.556  1.00 55.95 ? 248 ASN A ND2  1 
ATOM   3530  H  H    . ASN A  1 248 ? 96.012  116.372 75.867  1.00 33.42 ? 248 ASN A H    1 
ATOM   3531  H  HA   . ASN A  1 248 ? 96.617  116.934 78.434  1.00 34.49 ? 248 ASN A HA   1 
ATOM   3532  H  HB2  . ASN A  1 248 ? 97.772  115.231 77.032  1.00 44.19 ? 248 ASN A HB2  1 
ATOM   3533  H  HB3  . ASN A  1 248 ? 98.659  116.476 76.594  1.00 44.19 ? 248 ASN A HB3  1 
ATOM   3534  H  HD21 . ASN A  1 248 ? 99.865  114.437 77.875  1.00 67.14 ? 248 ASN A HD21 1 
ATOM   3535  H  HD22 . ASN A  1 248 ? 100.294 114.830 79.246  1.00 67.14 ? 248 ASN A HD22 1 
ATOM   3536  N  N    . LEU A  1 249 ? 96.676  119.187 76.378  1.00 19.46 ? 249 LEU A N    1 
ATOM   3537  C  CA   . LEU A  1 249 ? 96.765  120.642 76.314  1.00 20.02 ? 249 LEU A CA   1 
ATOM   3538  C  C    . LEU A  1 249 ? 95.990  121.232 77.492  1.00 24.78 ? 249 LEU A C    1 
ATOM   3539  O  O    . LEU A  1 249 ? 95.082  120.596 78.011  1.00 25.96 ? 249 LEU A O    1 
ATOM   3540  C  CB   . LEU A  1 249 ? 96.189  121.164 74.996  1.00 22.53 ? 249 LEU A CB   1 
ATOM   3541  C  CG   . LEU A  1 249 ? 96.900  120.761 73.700  1.00 21.97 ? 249 LEU A CG   1 
ATOM   3542  C  CD1  . LEU A  1 249 ? 96.255  121.439 72.497  1.00 19.23 ? 249 LEU A CD1  1 
ATOM   3543  C  CD2  . LEU A  1 249 ? 98.384  121.109 73.742  1.00 31.28 ? 249 LEU A CD2  1 
ATOM   3544  H  H    . LEU A  1 249 ? 96.177  118.838 75.770  1.00 23.35 ? 249 LEU A H    1 
ATOM   3545  H  HA   . LEU A  1 249 ? 97.702  120.921 76.381  1.00 24.02 ? 249 LEU A HA   1 
ATOM   3546  H  HB2  . LEU A  1 249 ? 95.273  120.852 74.926  1.00 27.04 ? 249 LEU A HB2  1 
ATOM   3547  H  HB3  . LEU A  1 249 ? 96.193  122.133 75.031  1.00 27.04 ? 249 LEU A HB3  1 
ATOM   3548  H  HG   . LEU A  1 249 ? 96.821  119.801 73.582  1.00 26.37 ? 249 LEU A HG   1 
ATOM   3549  H  HD11 . LEU A  1 249 ? 96.719  121.169 71.701  1.00 23.08 ? 249 LEU A HD11 1 
ATOM   3550  H  HD12 . LEU A  1 249 ? 95.334  121.172 72.446  1.00 23.08 ? 249 LEU A HD12 1 
ATOM   3551  H  HD13 . LEU A  1 249 ? 96.315  122.391 72.606  1.00 23.08 ? 249 LEU A HD13 1 
ATOM   3552  H  HD21 . LEU A  1 249 ? 98.791  120.842 72.915  1.00 37.53 ? 249 LEU A HD21 1 
ATOM   3553  H  HD22 . LEU A  1 249 ? 98.479  122.057 73.863  1.00 37.53 ? 249 LEU A HD22 1 
ATOM   3554  H  HD23 . LEU A  1 249 ? 98.793  120.643 74.475  1.00 37.53 ? 249 LEU A HD23 1 
ATOM   3555  N  N    . THR A  1 250 ? 96.342  122.436 77.933  1.00 28.07 ? 250 THR A N    1 
ATOM   3556  C  CA   . THR A  1 250 ? 95.571  123.076 78.996  1.00 29.39 ? 250 THR A CA   1 
ATOM   3557  C  C    . THR A  1 250 ? 94.224  123.492 78.413  1.00 26.83 ? 250 THR A C    1 
ATOM   3558  O  O    . THR A  1 250 ? 94.114  123.712 77.210  1.00 22.62 ? 250 THR A O    1 
ATOM   3559  C  CB   . THR A  1 250 ? 96.257  124.340 79.559  1.00 30.84 ? 250 THR A CB   1 
ATOM   3560  O  OG1  . THR A  1 250 ? 96.162  125.402 78.599  1.00 24.01 ? 250 THR A OG1  1 
ATOM   3561  C  CG2  . THR A  1 250 ? 97.717  124.077 79.883  1.00 28.77 ? 250 THR A CG2  1 
ATOM   3562  H  H    . THR A  1 250 ? 97.007  122.896 77.641  1.00 33.69 ? 250 THR A H    1 
ATOM   3563  H  HA   . THR A  1 250 ? 95.420  122.442 79.728  1.00 35.27 ? 250 THR A HA   1 
ATOM   3564  H  HB   . THR A  1 250 ? 95.809  124.608 80.377  1.00 37.00 ? 250 THR A HB   1 
ATOM   3565  H  HG1  . THR A  1 250 ? 96.524  126.077 78.891  1.00 28.81 ? 250 THR A HG1  1 
ATOM   3566  H  HG21 . THR A  1 250 ? 98.125  124.873 80.230  1.00 34.53 ? 250 THR A HG21 1 
ATOM   3567  H  HG22 . THR A  1 250 ? 97.788  123.379 80.538  1.00 34.53 ? 250 THR A HG22 1 
ATOM   3568  H  HG23 . THR A  1 250 ? 98.186  123.808 79.089  1.00 34.53 ? 250 THR A HG23 1 
ATOM   3569  N  N    . PRO A  1 251 ? 93.188  123.596 79.258  1.00 16.74 ? 251 PRO A N    1 
ATOM   3570  C  CA   . PRO A  1 251 ? 91.915  124.166 78.797  1.00 20.32 ? 251 PRO A CA   1 
ATOM   3571  C  C    . PRO A  1 251 ? 92.101  125.534 78.151  1.00 25.88 ? 251 PRO A C    1 
ATOM   3572  O  O    . PRO A  1 251 ? 91.388  125.842 77.180  1.00 26.25 ? 251 PRO A O    1 
ATOM   3573  C  CB   . PRO A  1 251 ? 91.100  124.297 80.087  1.00 26.88 ? 251 PRO A CB   1 
ATOM   3574  C  CG   . PRO A  1 251 ? 91.626  123.186 80.961  1.00 26.91 ? 251 PRO A CG   1 
ATOM   3575  C  CD   . PRO A  1 251 ? 93.106  123.090 80.646  1.00 21.73 ? 251 PRO A CD   1 
ATOM   3576  H  HA   . PRO A  1 251 ? 91.463  123.559 78.175  1.00 24.38 ? 251 PRO A HA   1 
ATOM   3577  H  HB2  . PRO A  1 251 ? 91.260  125.163 80.493  1.00 32.25 ? 251 PRO A HB2  1 
ATOM   3578  H  HB3  . PRO A  1 251 ? 90.157  124.172 79.896  1.00 32.25 ? 251 PRO A HB3  1 
ATOM   3579  H  HG2  . PRO A  1 251 ? 91.489  123.413 81.894  1.00 32.29 ? 251 PRO A HG2  1 
ATOM   3580  H  HG3  . PRO A  1 251 ? 91.174  122.356 80.740  1.00 32.29 ? 251 PRO A HG3  1 
ATOM   3581  H  HD2  . PRO A  1 251 ? 93.617  123.656 81.245  1.00 26.08 ? 251 PRO A HD2  1 
ATOM   3582  H  HD3  . PRO A  1 251 ? 93.402  122.167 80.688  1.00 26.08 ? 251 PRO A HD3  1 
ATOM   3583  N  N    . GLU A  1 252 ? 93.041  126.340 78.648  1.00 26.45 ? 252 GLU A N    1 
ATOM   3584  C  CA   . GLU A  1 252 ? 93.214  127.690 78.088  1.00 22.31 ? 252 GLU A CA   1 
ATOM   3585  C  C    . GLU A  1 252 ? 93.787  127.683 76.649  1.00 22.78 ? 252 GLU A C    1 
ATOM   3586  O  O    . GLU A  1 252 ? 93.379  128.481 75.802  1.00 20.40 ? 252 GLU A O    1 
ATOM   3587  C  CB   . GLU A  1 252 ? 94.069  128.564 79.009  1.00 26.52 ? 252 GLU A CB   1 
ATOM   3588  C  CG   . GLU A  1 252 ? 93.401  128.873 80.360  1.00 34.74 ? 252 GLU A CG   1 
ATOM   3589  C  CD   . GLU A  1 252 ? 93.383  127.680 81.301  1.00 39.09 ? 252 GLU A CD   1 
ATOM   3590  O  OE1  . GLU A  1 252 ? 94.274  126.808 81.172  1.00 36.56 ? 252 GLU A OE1  1 
ATOM   3591  O  OE2  . GLU A  1 252 ? 92.477  127.611 82.166  1.00 42.86 ? 252 GLU A OE2  1 
ATOM   3592  H  H    . GLU A  1 252 ? 93.578  126.142 79.290  1.00 31.73 ? 252 GLU A H    1 
ATOM   3593  H  HA   . GLU A  1 252 ? 92.329  128.109 78.039  1.00 26.78 ? 252 GLU A HA   1 
ATOM   3594  H  HB2  . GLU A  1 252 ? 94.904  128.105 79.189  1.00 31.82 ? 252 GLU A HB2  1 
ATOM   3595  H  HB3  . GLU A  1 252 ? 94.245  129.408 78.565  1.00 31.82 ? 252 GLU A HB3  1 
ATOM   3596  H  HG2  . GLU A  1 252 ? 93.888  129.590 80.795  1.00 41.69 ? 252 GLU A HG2  1 
ATOM   3597  H  HG3  . GLU A  1 252 ? 92.483  129.143 80.203  1.00 41.69 ? 252 GLU A HG3  1 
ATOM   3598  N  N    . GLN A  1 253 ? 94.738  126.790 76.397  1.00 20.14 ? 253 GLN A N    1 
ATOM   3599  C  CA   . GLN A  1 253 ? 95.303  126.586 75.069  1.00 13.75 ? 253 GLN A CA   1 
ATOM   3600  C  C    . GLN A  1 253 ? 94.241  126.057 74.109  1.00 15.86 ? 253 GLN A C    1 
ATOM   3601  O  O    . GLN A  1 253 ? 94.172  126.483 72.960  1.00 21.78 ? 253 GLN A O    1 
ATOM   3602  C  CB   . GLN A  1 253 ? 96.459  125.595 75.129  1.00 14.85 ? 253 GLN A CB   1 
ATOM   3603  C  CG   . GLN A  1 253 ? 97.735  126.133 75.744  1.00 20.52 ? 253 GLN A CG   1 
ATOM   3604  C  CD   . GLN A  1 253 ? 98.788  125.052 75.856  1.00 22.61 ? 253 GLN A CD   1 
ATOM   3605  O  OE1  . GLN A  1 253 ? 98.486  123.906 76.222  1.00 26.88 ? 253 GLN A OE1  1 
ATOM   3606  N  NE2  . GLN A  1 253 ? 100.031 125.398 75.535  1.00 22.63 ? 253 GLN A NE2  1 
ATOM   3607  H  H    . GLN A  1 253 ? 95.081  126.277 76.996  1.00 24.16 ? 253 GLN A H    1 
ATOM   3608  H  HA   . GLN A  1 253 ? 95.641  127.438 74.721  1.00 16.50 ? 253 GLN A HA   1 
ATOM   3609  H  HB2  . GLN A  1 253 ? 96.181  124.829 75.656  1.00 17.82 ? 253 GLN A HB2  1 
ATOM   3610  H  HB3  . GLN A  1 253 ? 96.668  125.309 74.226  1.00 17.82 ? 253 GLN A HB3  1 
ATOM   3611  H  HG2  . GLN A  1 253 ? 98.086  126.843 75.185  1.00 24.62 ? 253 GLN A HG2  1 
ATOM   3612  H  HG3  . GLN A  1 253 ? 97.546  126.468 76.634  1.00 24.62 ? 253 GLN A HG3  1 
ATOM   3613  H  HE21 . GLN A  1 253 ? 100.202 126.201 75.280  1.00 27.16 ? 253 GLN A HE21 1 
ATOM   3614  H  HE22 . GLN A  1 253 ? 100.665 124.818 75.583  1.00 27.16 ? 253 GLN A HE22 1 
ATOM   3615  N  N    . GLN A  1 254 ? 93.417  125.127 74.590  1.00 21.05 ? 254 GLN A N    1 
ATOM   3616  C  CA   . GLN A  1 254 ? 92.357  124.537 73.776  1.00 24.08 ? 254 GLN A CA   1 
ATOM   3617  C  C    . GLN A  1 254 ? 91.402  125.604 73.279  1.00 20.12 ? 254 GLN A C    1 
ATOM   3618  O  O    . GLN A  1 254 ? 91.063  125.652 72.091  1.00 16.25 ? 254 GLN A O    1 
ATOM   3619  C  CB   . GLN A  1 254 ? 91.580  123.481 74.571  1.00 19.08 ? 254 GLN A CB   1 
ATOM   3620  C  CG   . GLN A  1 254 ? 92.372  122.232 74.882  1.00 16.27 ? 254 GLN A CG   1 
ATOM   3621  C  CD   . GLN A  1 254 ? 91.553  121.184 75.614  1.00 22.29 ? 254 GLN A CD   1 
ATOM   3622  O  OE1  . GLN A  1 254 ? 90.410  121.423 75.996  1.00 23.83 ? 254 GLN A OE1  1 
ATOM   3623  N  NE2  . GLN A  1 254 ? 92.128  120.005 75.784  1.00 28.48 ? 254 GLN A NE2  1 
ATOM   3624  H  H    . GLN A  1 254 ? 93.453  124.818 75.392  1.00 25.26 ? 254 GLN A H    1 
ATOM   3625  H  HA   . GLN A  1 254 ? 92.757  124.098 72.997  1.00 28.90 ? 254 GLN A HA   1 
ATOM   3626  H  HB2  . GLN A  1 254 ? 91.300  123.870 75.415  1.00 22.90 ? 254 GLN A HB2  1 
ATOM   3627  H  HB3  . GLN A  1 254 ? 90.801  123.216 74.058  1.00 22.90 ? 254 GLN A HB3  1 
ATOM   3628  H  HG2  . GLN A  1 254 ? 92.686  121.842 74.051  1.00 19.53 ? 254 GLN A HG2  1 
ATOM   3629  H  HG3  . GLN A  1 254 ? 93.127  122.468 75.443  1.00 19.53 ? 254 GLN A HG3  1 
ATOM   3630  H  HE21 . GLN A  1 254 ? 92.923  119.868 75.486  1.00 34.18 ? 254 GLN A HE21 1 
ATOM   3631  H  HE22 . GLN A  1 254 ? 91.707  119.376 76.192  1.00 34.18 ? 254 GLN A HE22 1 
ATOM   3632  N  N    . LYS A  1 255 ? 90.967  126.455 74.200  1.00 17.05 ? 255 LYS A N    1 
ATOM   3633  C  CA   . LYS A  1 255 ? 90.058  127.547 73.893  1.00 15.55 ? 255 LYS A CA   1 
ATOM   3634  C  C    . LYS A  1 255 ? 90.644  128.550 72.900  1.00 16.47 ? 255 LYS A C    1 
ATOM   3635  O  O    . LYS A  1 255 ? 89.912  129.065 72.059  1.00 15.71 ? 255 LYS A O    1 
ATOM   3636  C  CB   . LYS A  1 255 ? 89.642  128.261 75.175  1.00 21.84 ? 255 LYS A CB   1 
ATOM   3637  C  CG   . LYS A  1 255 ? 88.736  129.446 74.960  1.00 24.89 ? 255 LYS A CG   1 
ATOM   3638  C  CD   . LYS A  1 255 ? 88.145  129.931 76.276  1.00 38.56 ? 255 LYS A CD   1 
ATOM   3639  C  CE   . LYS A  1 255 ? 86.915  130.791 76.027  1.00 48.93 ? 255 LYS A CE   1 
ATOM   3640  N  NZ   . LYS A  1 255 ? 87.227  131.944 75.137  1.00 48.66 ? 255 LYS A NZ   1 
ATOM   3641  H  H    . LYS A  1 255 ? 91.191  126.417 75.030  1.00 20.45 ? 255 LYS A H    1 
ATOM   3642  H  HA   . LYS A  1 255 ? 89.248  127.171 73.489  1.00 18.66 ? 255 LYS A HA   1 
ATOM   3643  H  HB2  . LYS A  1 255 ? 89.172  127.631 75.744  1.00 26.21 ? 255 LYS A HB2  1 
ATOM   3644  H  HB3  . LYS A  1 255 ? 90.439  128.578 75.627  1.00 26.21 ? 255 LYS A HB3  1 
ATOM   3645  H  HG2  . LYS A  1 255 ? 89.245  130.173 74.568  1.00 29.86 ? 255 LYS A HG2  1 
ATOM   3646  H  HG3  . LYS A  1 255 ? 88.007  129.191 74.374  1.00 29.86 ? 255 LYS A HG3  1 
ATOM   3647  H  HD2  . LYS A  1 255 ? 87.882  129.167 76.812  1.00 46.28 ? 255 LYS A HD2  1 
ATOM   3648  H  HD3  . LYS A  1 255 ? 88.803  130.465 76.747  1.00 46.28 ? 255 LYS A HD3  1 
ATOM   3649  H  HE2  . LYS A  1 255 ? 86.229  130.254 75.599  1.00 58.72 ? 255 LYS A HE2  1 
ATOM   3650  H  HE3  . LYS A  1 255 ? 86.591  131.139 76.872  1.00 58.72 ? 255 LYS A HE3  1 
ATOM   3651  H  HZ1  . LYS A  1 255 ? 86.495  132.433 75.005  1.00 58.40 ? 255 LYS A HZ1  1 
ATOM   3652  H  HZ2  . LYS A  1 255 ? 87.853  132.455 75.510  1.00 58.40 ? 255 LYS A HZ2  1 
ATOM   3653  H  HZ3  . LYS A  1 255 ? 87.524  131.650 74.351  1.00 58.40 ? 255 LYS A HZ3  1 
ATOM   3654  N  N    . ILE A  1 256 ? 91.943  128.831 72.985  1.00 15.36 ? 256 ILE A N    1 
ATOM   3655  C  CA   . ILE A  1 256 ? 92.573  129.775 72.053  1.00 12.13 ? 256 ILE A CA   1 
ATOM   3656  C  C    . ILE A  1 256 ? 92.517  129.196 70.652  1.00 15.42 ? 256 ILE A C    1 
ATOM   3657  O  O    . ILE A  1 256 ? 92.193  129.889 69.677  1.00 17.08 ? 256 ILE A O    1 
ATOM   3658  C  CB   . ILE A  1 256 ? 94.040  130.041 72.460  1.00 12.54 ? 256 ILE A CB   1 
ATOM   3659  C  CG1  . ILE A  1 256 ? 94.072  130.926 73.722  1.00 19.80 ? 256 ILE A CG1  1 
ATOM   3660  C  CG2  . ILE A  1 256 ? 94.805  130.651 71.321  1.00 17.07 ? 256 ILE A CG2  1 
ATOM   3661  C  CD1  . ILE A  1 256 ? 95.439  131.057 74.404  1.00 16.92 ? 256 ILE A CD1  1 
ATOM   3662  H  H    . ILE A  1 256 ? 92.480  128.494 73.566  1.00 18.44 ? 256 ILE A H    1 
ATOM   3663  H  HA   . ILE A  1 256 ? 92.086  130.625 72.063  1.00 14.55 ? 256 ILE A HA   1 
ATOM   3664  H  HB   . ILE A  1 256 ? 94.452  129.190 72.677  1.00 15.05 ? 256 ILE A HB   1 
ATOM   3665  H  HG12 . ILE A  1 256 ? 93.783  131.818 73.477  1.00 23.76 ? 256 ILE A HG12 1 
ATOM   3666  H  HG13 . ILE A  1 256 ? 93.457  130.553 74.373  1.00 23.76 ? 256 ILE A HG13 1 
ATOM   3667  H  HG21 . ILE A  1 256 ? 95.711  130.805 71.600  1.00 20.49 ? 256 ILE A HG21 1 
ATOM   3668  H  HG22 . ILE A  1 256 ? 94.791  130.046 70.575  1.00 20.49 ? 256 ILE A HG22 1 
ATOM   3669  H  HG23 . ILE A  1 256 ? 94.392  131.482 71.077  1.00 20.49 ? 256 ILE A HG23 1 
ATOM   3670  H  HD11 . ILE A  1 256 ? 95.350  131.625 75.174  1.00 20.30 ? 256 ILE A HD11 1 
ATOM   3671  H  HD12 . ILE A  1 256 ? 95.739  130.186 74.673  1.00 20.30 ? 256 ILE A HD12 1 
ATOM   3672  H  HD13 . ILE A  1 256 ? 96.062  131.442 73.784  1.00 20.30 ? 256 ILE A HD13 1 
ATOM   3673  N  N    . ILE A  1 257 ? 92.862  127.914 70.558  1.00 17.48 ? 257 ILE A N    1 
ATOM   3674  C  CA   . ILE A  1 257 ? 92.873  127.199 69.275  1.00 11.14 ? 257 ILE A CA   1 
ATOM   3675  C  C    . ILE A  1 257 ? 91.469  127.162 68.689  1.00 12.21 ? 257 ILE A C    1 
ATOM   3676  O  O    . ILE A  1 257 ? 91.283  127.500 67.502  1.00 12.12 ? 257 ILE A O    1 
ATOM   3677  C  CB   . ILE A  1 257 ? 93.468  125.797 69.445  1.00 11.19 ? 257 ILE A CB   1 
ATOM   3678  C  CG1  . ILE A  1 257 ? 94.965  125.932 69.762  1.00 11.57 ? 257 ILE A CG1  1 
ATOM   3679  C  CG2  . ILE A  1 257 ? 93.219  124.919 68.198  1.00 10.86 ? 257 ILE A CG2  1 
ATOM   3680  C  CD1  . ILE A  1 257 ? 95.562  124.684 70.376  1.00 17.98 ? 257 ILE A CD1  1 
ATOM   3681  H  H    . ILE A  1 257 ? 93.097  127.428 71.228  1.00 20.97 ? 257 ILE A H    1 
ATOM   3682  H  HA   . ILE A  1 257 ? 93.444  127.690 68.648  1.00 13.37 ? 257 ILE A HA   1 
ATOM   3683  H  HB   . ILE A  1 257 ? 93.035  125.374 70.204  1.00 13.43 ? 257 ILE A HB   1 
ATOM   3684  H  HG12 . ILE A  1 257 ? 95.444  126.119 68.940  1.00 13.88 ? 257 ILE A HG12 1 
ATOM   3685  H  HG13 . ILE A  1 257 ? 95.089  126.662 70.389  1.00 13.88 ? 257 ILE A HG13 1 
ATOM   3686  H  HG21 . ILE A  1 257 ? 93.605  124.053 68.344  1.00 13.03 ? 257 ILE A HG21 1 
ATOM   3687  H  HG22 . ILE A  1 257 ? 92.272  124.837 68.058  1.00 13.03 ? 257 ILE A HG22 1 
ATOM   3688  H  HG23 . ILE A  1 257 ? 93.628  125.337 67.436  1.00 13.03 ? 257 ILE A HG23 1 
ATOM   3689  H  HD11 . ILE A  1 257 ? 96.495  124.836 70.548  1.00 21.58 ? 257 ILE A HD11 1 
ATOM   3690  H  HD12 . ILE A  1 257 ? 95.105  124.490 71.198  1.00 21.58 ? 257 ILE A HD12 1 
ATOM   3691  H  HD13 . ILE A  1 257 ? 95.457  123.953 69.763  1.00 21.58 ? 257 ILE A HD13 1 
ATOM   3692  N  N    . VAL A  1 258 ? 90.480  126.778 69.499  1.00 14.14 ? 258 VAL A N    1 
ATOM   3693  C  CA   . VAL A  1 258 ? 89.104  126.685 69.008  1.00 10.73 ? 258 VAL A CA   1 
ATOM   3694  C  C    . VAL A  1 258 ? 88.517  128.070 68.681  1.00 11.77 ? 258 VAL A C    1 
ATOM   3695  O  O    . VAL A  1 258 ? 87.830  128.227 67.675  1.00 12.21 ? 258 VAL A O    1 
ATOM   3696  C  CB   . VAL A  1 258 ? 88.179  125.902 69.981  1.00 10.94 ? 258 VAL A CB   1 
ATOM   3697  C  CG1  . VAL A  1 258 ? 86.721  126.005 69.538  1.00 12.39 ? 258 VAL A CG1  1 
ATOM   3698  C  CG2  . VAL A  1 258 ? 88.620  124.451 70.083  1.00 17.04 ? 258 VAL A CG2  1 
ATOM   3699  H  H    . VAL A  1 258 ? 90.578  126.568 70.328  1.00 16.97 ? 258 VAL A H    1 
ATOM   3700  H  HA   . VAL A  1 258 ? 89.121  126.181 68.168  1.00 12.88 ? 258 VAL A HA   1 
ATOM   3701  H  HB   . VAL A  1 258 ? 88.250  126.300 70.873  1.00 13.13 ? 258 VAL A HB   1 
ATOM   3702  H  HG11 . VAL A  1 258 ? 86.172  125.514 70.155  1.00 14.87 ? 258 VAL A HG11 1 
ATOM   3703  H  HG12 . VAL A  1 258 ? 86.460  126.929 69.533  1.00 14.87 ? 258 VAL A HG12 1 
ATOM   3704  H  HG13 . VAL A  1 258 ? 86.635  125.635 68.657  1.00 14.87 ? 258 VAL A HG13 1 
ATOM   3705  H  HG21 . VAL A  1 258 ? 88.035  123.989 70.688  1.00 20.45 ? 258 VAL A HG21 1 
ATOM   3706  H  HG22 . VAL A  1 258 ? 88.575  124.049 69.212  1.00 20.45 ? 258 VAL A HG22 1 
ATOM   3707  H  HG23 . VAL A  1 258 ? 89.521  124.421 70.411  1.00 20.45 ? 258 VAL A HG23 1 
ATOM   3708  N  N    . ASP A  1 259 ? 88.788  129.075 69.507  1.00 12.14 ? 259 ASP A N    1 
ATOM   3709  C  CA   . ASP A  1 259 ? 88.302  130.416 69.221  1.00 12.29 ? 259 ASP A CA   1 
ATOM   3710  C  C    . ASP A  1 259 ? 88.906  130.884 67.913  1.00 14.44 ? 259 ASP A C    1 
ATOM   3711  O  O    . ASP A  1 259 ? 88.228  131.450 67.085  1.00 15.33 ? 259 ASP A O    1 
ATOM   3712  C  CB   . ASP A  1 259 ? 88.642  131.402 70.359  1.00 14.01 ? 259 ASP A CB   1 
ATOM   3713  C  CG   . ASP A  1 259 ? 87.691  131.294 71.532  1.00 19.97 ? 259 ASP A CG   1 
ATOM   3714  O  OD1  . ASP A  1 259 ? 86.686  130.577 71.423  1.00 23.61 ? 259 ASP A OD1  1 
ATOM   3715  O  OD2  . ASP A  1 259 ? 87.940  131.946 72.569  1.00 27.10 ? 259 ASP A OD2  1 
ATOM   3716  H  H    . ASP A  1 259 ? 89.246  129.007 70.232  1.00 14.57 ? 259 ASP A H    1 
ATOM   3717  H  HA   . ASP A  1 259 ? 87.328  130.391 69.118  1.00 14.75 ? 259 ASP A HA   1 
ATOM   3718  H  HB2  . ASP A  1 259 ? 89.538  131.216 70.681  1.00 16.81 ? 259 ASP A HB2  1 
ATOM   3719  H  HB3  . ASP A  1 259 ? 88.593  132.308 70.017  1.00 16.81 ? 259 ASP A HB3  1 
ATOM   3720  N  N    . ALA A  1 260 ? 90.192  130.627 67.722  1.00 14.39 ? 260 ALA A N    1 
ATOM   3721  C  CA   . ALA A  1 260 ? 90.871  131.094 66.526  1.00 13.42 ? 260 ALA A CA   1 
ATOM   3722  C  C    . ALA A  1 260 ? 90.341  130.379 65.284  1.00 14.39 ? 260 ALA A C    1 
ATOM   3723  O  O    . ALA A  1 260 ? 90.274  130.953 64.195  1.00 11.86 ? 260 ALA A O    1 
ATOM   3724  C  CB   . ALA A  1 260 ? 92.358  130.874 66.674  1.00 12.84 ? 260 ALA A CB   1 
ATOM   3725  H  H    . ALA A  1 260 ? 90.690  130.186 68.267  1.00 17.27 ? 260 ALA A H    1 
ATOM   3726  H  HA   . ALA A  1 260 ? 90.712  132.055 66.418  1.00 16.11 ? 260 ALA A HA   1 
ATOM   3727  H  HB1  . ALA A  1 260 ? 92.800  131.185 65.881  1.00 15.40 ? 260 ALA A HB1  1 
ATOM   3728  H  HB2  . ALA A  1 260 ? 92.671  131.365 67.438  1.00 15.40 ? 260 ALA A HB2  1 
ATOM   3729  H  HB3  . ALA A  1 260 ? 92.524  129.936 66.797  1.00 15.40 ? 260 ALA A HB3  1 
ATOM   3730  N  N    . SER A  1 261 ? 89.972  129.125 65.471  1.00 11.57 ? 261 SER A N    1 
ATOM   3731  C  CA   . SER A  1 261 ? 89.516  128.256 64.394  1.00 10.91 ? 261 SER A CA   1 
ATOM   3732  C  C    . SER A  1 261 ? 88.202  128.782 63.835  1.00 10.32 ? 261 SER A C    1 
ATOM   3733  O  O    . SER A  1 261 ? 87.947  128.645 62.627  1.00 11.68 ? 261 SER A O    1 
ATOM   3734  C  CB   . SER A  1 261 ? 89.351  126.792 64.880  1.00 11.36 ? 261 SER A CB   1 
ATOM   3735  O  OG   . SER A  1 261 ? 88.094  126.556 65.511  1.00 13.89 ? 261 SER A OG   1 
ATOM   3736  H  H    . SER A  1 261 ? 89.976  128.739 66.239  1.00 13.89 ? 261 SER A H    1 
ATOM   3737  H  HA   . SER A  1 261 ? 90.179  128.264 63.672  1.00 13.09 ? 261 SER A HA   1 
ATOM   3738  H  HB2  . SER A  1 261 ? 89.428  126.202 64.114  1.00 13.63 ? 261 SER A HB2  1 
ATOM   3739  H  HB3  . SER A  1 261 ? 90.057  126.596 65.514  1.00 13.63 ? 261 SER A HB3  1 
ATOM   3740  H  HG   . SER A  1 261 ? 87.649  127.244 65.517  1.00 16.67 ? 261 SER A HG   1 
ATOM   3741  N  N    . ARG A  1 262 ? 87.399  129.420 64.691  1.00 10.26 ? 262 ARG A N    1 
ATOM   3742  C  CA   . ARG A  1 262 ? 86.100  129.956 64.261  1.00 10.99 ? 262 ARG A CA   1 
ATOM   3743  C  C    . ARG A  1 262 ? 86.329  131.110 63.311  1.00 12.24 ? 262 ARG A C    1 
ATOM   3744  O  O    . ARG A  1 262 ? 85.655  131.225 62.273  1.00 11.17 ? 262 ARG A O    1 
ATOM   3745  C  CB   . ARG A  1 262 ? 85.248  130.445 65.437  1.00 14.24 ? 262 ARG A CB   1 
ATOM   3746  C  CG   . ARG A  1 262 ? 84.855  129.378 66.428  1.00 26.26 ? 262 ARG A CG   1 
ATOM   3747  C  CD   . ARG A  1 262 ? 84.333  128.149 65.750  1.00 32.56 ? 262 ARG A CD   1 
ATOM   3748  N  NE   . ARG A  1 262 ? 83.311  128.456 64.757  1.00 42.17 ? 262 ARG A NE   1 
ATOM   3749  C  CZ   . ARG A  1 262 ? 83.038  127.680 63.710  1.00 38.61 ? 262 ARG A CZ   1 
ATOM   3750  N  NH1  . ARG A  1 262 ? 83.698  126.546 63.540  1.00 15.60 ? 262 ARG A NH1  1 
ATOM   3751  N  NH2  . ARG A  1 262 ? 82.097  128.031 62.842  1.00 45.49 ? 262 ARG A NH2  1 
ATOM   3752  H  H    . ARG A  1 262 ? 87.580  129.555 65.521  1.00 12.32 ? 262 ARG A H    1 
ATOM   3753  H  HA   . ARG A  1 262 ? 85.602  129.259 63.786  1.00 13.19 ? 262 ARG A HA   1 
ATOM   3754  H  HB2  . ARG A  1 262 ? 85.748  131.121 65.920  1.00 17.09 ? 262 ARG A HB2  1 
ATOM   3755  H  HB3  . ARG A  1 262 ? 84.432  130.833 65.086  1.00 17.09 ? 262 ARG A HB3  1 
ATOM   3756  H  HG2  . ARG A  1 262 ? 85.631  129.128 66.952  1.00 31.51 ? 262 ARG A HG2  1 
ATOM   3757  H  HG3  . ARG A  1 262 ? 84.157  129.723 67.007  1.00 31.51 ? 262 ARG A HG3  1 
ATOM   3758  H  HD2  . ARG A  1 262 ? 85.066  127.699 65.300  1.00 39.07 ? 262 ARG A HD2  1 
ATOM   3759  H  HD3  . ARG A  1 262 ? 83.941  127.562 66.415  1.00 39.07 ? 262 ARG A HD3  1 
ATOM   3760  H  HE   . ARG A  1 262 ? 82.925  129.223 64.801  1.00 50.60 ? 262 ARG A HE   1 
ATOM   3761  H  HH11 . ARG A  1 262 ? 84.310  126.316 64.099  1.00 18.72 ? 262 ARG A HH11 1 
ATOM   3762  H  HH12 . ARG A  1 262 ? 83.521  126.042 62.866  1.00 18.72 ? 262 ARG A HH12 1 
ATOM   3763  H  HH21 . ARG A  1 262 ? 81.662  128.764 62.952  1.00 54.59 ? 262 ARG A HH21 1 
ATOM   3764  H  HH22 . ARG A  1 262 ? 81.920  127.522 62.172  1.00 54.59 ? 262 ARG A HH22 1 
ATOM   3765  N  N    . GLU A  1 263 ? 87.274  131.975 63.678  1.00 17.41 ? 263 GLU A N    1 
ATOM   3766  C  CA   . GLU A  1 263 ? 87.690  133.068 62.803  1.00 13.72 ? 263 GLU A CA   1 
ATOM   3767  C  C    . GLU A  1 263 ? 88.326  132.538 61.506  1.00 13.26 ? 263 GLU A C    1 
ATOM   3768  O  O    . GLU A  1 263 ? 88.113  133.099 60.424  1.00 11.22 ? 263 GLU A O    1 
ATOM   3769  C  CB   . GLU A  1 263 ? 88.651  133.992 63.542  1.00 11.34 ? 263 GLU A CB   1 
ATOM   3770  C  CG   . GLU A  1 263 ? 88.023  134.657 64.757  1.00 12.81 ? 263 GLU A CG   1 
ATOM   3771  C  CD   . GLU A  1 263 ? 88.882  135.776 65.274  1.00 26.50 ? 263 GLU A CD   1 
ATOM   3772  O  OE1  . GLU A  1 263 ? 88.696  136.924 64.827  1.00 38.35 ? 263 GLU A OE1  1 
ATOM   3773  O  OE2  . GLU A  1 263 ? 89.771  135.487 66.086  1.00 20.65 ? 263 GLU A OE2  1 
ATOM   3774  H  H    . GLU A  1 263 ? 87.689  131.950 64.430  1.00 20.89 ? 263 GLU A H    1 
ATOM   3775  H  HA   . GLU A  1 263 ? 86.901  133.593 62.556  1.00 16.47 ? 263 GLU A HA   1 
ATOM   3776  H  HB2  . GLU A  1 263 ? 89.415  133.476 63.845  1.00 13.60 ? 263 GLU A HB2  1 
ATOM   3777  H  HB3  . GLU A  1 263 ? 88.944  134.691 62.936  1.00 13.60 ? 263 GLU A HB3  1 
ATOM   3778  H  HG2  . GLU A  1 263 ? 87.160  135.025 64.511  1.00 15.37 ? 263 GLU A HG2  1 
ATOM   3779  H  HG3  . GLU A  1 263 ? 87.920  134.001 65.464  1.00 15.37 ? 263 GLU A HG3  1 
ATOM   3780  N  N    . MET A  1 264 ? 89.116  131.476 61.621  1.00 10.75 ? 264 MET A N    1 
ATOM   3781  C  CA   . MET A  1 264 ? 89.723  130.849 60.463  1.00 10.18 ? 264 MET A CA   1 
ATOM   3782  C  C    . MET A  1 264 ? 88.640  130.380 59.503  1.00 11.87 ? 264 MET A C    1 
ATOM   3783  O  O    . MET A  1 264 ? 88.766  130.543 58.290  1.00 12.43 ? 264 MET A O    1 
ATOM   3784  C  CB   . MET A  1 264 ? 90.651  129.703 60.878  1.00 15.85 ? 264 MET A CB   1 
ATOM   3785  C  CG   . MET A  1 264 ? 91.215  128.897 59.706  1.00 15.69 ? 264 MET A CG   1 
ATOM   3786  S  SD   . MET A  1 264 ? 90.102  127.602 59.138  1.00 12.16 ? 264 MET A SD   1 
ATOM   3787  C  CE   . MET A  1 264 ? 90.136  126.517 60.586  1.00 10.67 ? 264 MET A CE   1 
ATOM   3788  H  H    . MET A  1 264 ? 89.316  131.099 62.368  1.00 12.90 ? 264 MET A H    1 
ATOM   3789  H  HA   . MET A  1 264 ? 90.273  131.518 60.004  1.00 12.21 ? 264 MET A HA   1 
ATOM   3790  H  HB2  . MET A  1 264 ? 91.401  130.072 61.370  1.00 19.02 ? 264 MET A HB2  1 
ATOM   3791  H  HB3  . MET A  1 264 ? 90.156  129.092 61.445  1.00 19.02 ? 264 MET A HB3  1 
ATOM   3792  H  HG2  . MET A  1 264 ? 91.380  129.497 58.962  1.00 18.83 ? 264 MET A HG2  1 
ATOM   3793  H  HG3  . MET A  1 264 ? 92.045  128.478 59.983  1.00 18.83 ? 264 MET A HG3  1 
ATOM   3794  H  HE1  . MET A  1 264 ? 89.570  125.760 60.422  1.00 12.80 ? 264 MET A HE1  1 
ATOM   3795  H  HE2  . MET A  1 264 ? 91.038  126.226 60.736  1.00 12.80 ? 264 MET A HE2  1 
ATOM   3796  H  HE3  . MET A  1 264 ? 89.818  127.005 61.349  1.00 12.80 ? 264 MET A HE3  1 
ATOM   3797  N  N    . VAL A  1 265 ? 87.557  129.815 60.026  1.00 9.84  ? 265 VAL A N    1 
ATOM   3798  C  CA   . VAL A  1 265 ? 86.487  129.371 59.134  1.00 9.75  ? 265 VAL A CA   1 
ATOM   3799  C  C    . VAL A  1 265 ? 85.830  130.532 58.352  1.00 10.01 ? 265 VAL A C    1 
ATOM   3800  O  O    . VAL A  1 265 ? 85.585  130.431 57.151  1.00 9.98  ? 265 VAL A O    1 
ATOM   3801  C  CB   . VAL A  1 265 ? 85.451  128.560 59.923  1.00 9.74  ? 265 VAL A CB   1 
ATOM   3802  C  CG1  . VAL A  1 265 ? 84.102  128.452 59.180  1.00 11.75 ? 265 VAL A CG1  1 
ATOM   3803  C  CG2  . VAL A  1 265 ? 86.016  127.185 60.209  1.00 13.10 ? 265 VAL A CG2  1 
ATOM   3804  H  H    . VAL A  1 265 ? 87.417  129.680 60.864  1.00 11.81 ? 265 VAL A H    1 
ATOM   3805  H  HA   . VAL A  1 265 ? 86.879  128.766 58.470  1.00 11.70 ? 265 VAL A HA   1 
ATOM   3806  H  HB   . VAL A  1 265 ? 85.287  129.004 60.781  1.00 11.69 ? 265 VAL A HB   1 
ATOM   3807  H  HG11 . VAL A  1 265 ? 83.492  127.937 59.714  1.00 14.11 ? 265 VAL A HG11 1 
ATOM   3808  H  HG12 . VAL A  1 265 ? 83.751  129.334 59.039  1.00 14.11 ? 265 VAL A HG12 1 
ATOM   3809  H  HG13 . VAL A  1 265 ? 84.245  128.017 58.335  1.00 14.11 ? 265 VAL A HG13 1 
ATOM   3810  H  HG21 . VAL A  1 265 ? 85.367  126.678 60.703  1.00 15.72 ? 265 VAL A HG21 1 
ATOM   3811  H  HG22 . VAL A  1 265 ? 86.209  126.748 59.377  1.00 15.72 ? 265 VAL A HG22 1 
ATOM   3812  H  HG23 . VAL A  1 265 ? 86.820  127.279 60.725  1.00 15.72 ? 265 VAL A HG23 1 
ATOM   3813  N  N    . THR A  1 266 ? 85.579  131.637 59.047  1.00 11.03 ? 266 THR A N    1 
ATOM   3814  C  CA   . THR A  1 266 ? 85.007  132.834 58.442  1.00 11.30 ? 266 THR A CA   1 
ATOM   3815  C  C    . THR A  1 266 ? 85.938  133.460 57.437  1.00 10.86 ? 266 THR A C    1 
ATOM   3816  O  O    . THR A  1 266 ? 85.486  133.853 56.362  1.00 12.22 ? 266 THR A O    1 
ATOM   3817  C  CB   . THR A  1 266 ? 84.688  133.876 59.533  1.00 13.53 ? 266 THR A CB   1 
ATOM   3818  O  OG1  . THR A  1 266 ? 83.827  133.278 60.496  1.00 15.12 ? 266 THR A OG1  1 
ATOM   3819  C  CG2  . THR A  1 266 ? 83.993  135.140 58.949  1.00 11.72 ? 266 THR A CG2  1 
ATOM   3820  H  H    . THR A  1 266 ? 85.735  131.719 59.888  1.00 13.23 ? 266 THR A H    1 
ATOM   3821  H  HA   . THR A  1 266 ? 84.172  132.600 57.985  1.00 13.56 ? 266 THR A HA   1 
ATOM   3822  H  HB   . THR A  1 266 ? 85.512  134.152 59.965  1.00 16.23 ? 266 THR A HB   1 
ATOM   3823  H  HG1  . THR A  1 266 ? 83.647  133.819 61.086  1.00 18.15 ? 266 THR A HG1  1 
ATOM   3824  H  HG21 . THR A  1 266 ? 83.808  135.768 59.652  1.00 14.07 ? 266 THR A HG21 1 
ATOM   3825  H  HG22 . THR A  1 266 ? 84.563  135.558 58.299  1.00 14.07 ? 266 THR A HG22 1 
ATOM   3826  H  HG23 . THR A  1 266 ? 83.167  134.894 58.526  1.00 14.07 ? 266 THR A HG23 1 
ATOM   3827  N  N    . TYR A  1 267 ? 87.222  133.550 57.781  1.00 10.83 ? 267 TYR A N    1 
ATOM   3828  C  CA   . TYR A  1 267 ? 88.259  134.020 56.852  1.00 11.01 ? 267 TYR A CA   1 
ATOM   3829  C  C    . TYR A  1 267 ? 88.351  133.141 55.590  1.00 12.57 ? 267 TYR A C    1 
ATOM   3830  O  O    . TYR A  1 267 ? 88.399  133.618 54.462  1.00 10.92 ? 267 TYR A O    1 
ATOM   3831  C  CB   . TYR A  1 267 ? 89.620  134.056 57.571  1.00 11.08 ? 267 TYR A CB   1 
ATOM   3832  C  CG   . TYR A  1 267 ? 90.782  134.445 56.682  1.00 11.35 ? 267 TYR A CG   1 
ATOM   3833  C  CD1  . TYR A  1 267 ? 90.971  135.758 56.290  1.00 15.29 ? 267 TYR A CD1  1 
ATOM   3834  C  CD2  . TYR A  1 267 ? 91.684  133.493 56.240  1.00 19.34 ? 267 TYR A CD2  1 
ATOM   3835  C  CE1  . TYR A  1 267 ? 92.032  136.107 55.476  1.00 15.86 ? 267 TYR A CE1  1 
ATOM   3836  C  CE2  . TYR A  1 267 ? 92.742  133.831 55.443  1.00 20.92 ? 267 TYR A CE2  1 
ATOM   3837  C  CZ   . TYR A  1 267 ? 92.905  135.130 55.057  1.00 19.97 ? 267 TYR A CZ   1 
ATOM   3838  O  OH   . TYR A  1 267 ? 93.973  135.435 54.263  1.00 18.93 ? 267 TYR A OH   1 
ATOM   3839  H  H    . TYR A  1 267 ? 87.525  133.342 58.558  1.00 13.00 ? 267 TYR A H    1 
ATOM   3840  H  HA   . TYR A  1 267 ? 88.042  134.932 56.568  1.00 13.21 ? 267 TYR A HA   1 
ATOM   3841  H  HB2  . TYR A  1 267 ? 89.572  134.701 58.293  1.00 13.29 ? 267 TYR A HB2  1 
ATOM   3842  H  HB3  . TYR A  1 267 ? 89.805  133.175 57.930  1.00 13.29 ? 267 TYR A HB3  1 
ATOM   3843  H  HD1  . TYR A  1 267 ? 90.374  136.413 56.573  1.00 18.35 ? 267 TYR A HD1  1 
ATOM   3844  H  HD2  . TYR A  1 267 ? 91.573  132.606 56.498  1.00 23.21 ? 267 TYR A HD2  1 
ATOM   3845  H  HE1  . TYR A  1 267 ? 92.155  136.991 55.216  1.00 19.04 ? 267 TYR A HE1  1 
ATOM   3846  H  HE2  . TYR A  1 267 ? 93.337  133.178 55.154  1.00 25.10 ? 267 TYR A HE2  1 
ATOM   3847  H  HH   . TYR A  1 267 ? 94.463  135.970 54.646  1.00 22.72 ? 267 TYR A HH   1 
ATOM   3848  N  N    . GLY A  1 268 ? 88.359  131.834 55.786  1.00 11.94 ? 268 GLY A N    1 
ATOM   3849  C  CA   . GLY A  1 268 ? 88.421  130.935 54.657  1.00 10.87 ? 268 GLY A CA   1 
ATOM   3850  C  C    . GLY A  1 268 ? 87.192  131.040 53.768  1.00 12.09 ? 268 GLY A C    1 
ATOM   3851  O  O    . GLY A  1 268 ? 87.273  130.791 52.556  1.00 11.07 ? 268 GLY A O    1 
ATOM   3852  H  H    . GLY A  1 268 ? 88.329  131.449 56.554  1.00 14.32 ? 268 GLY A H    1 
ATOM   3853  H  HA2  . GLY A  1 268 ? 89.205  131.138 54.124  1.00 13.04 ? 268 GLY A HA2  1 
ATOM   3854  H  HA3  . GLY A  1 268 ? 88.494  130.021 54.975  1.00 13.04 ? 268 GLY A HA3  1 
ATOM   3855  N  N    . GLY A  1 269 ? 86.049  131.350 54.381  1.00 10.22 ? 269 GLY A N    1 
ATOM   3856  C  CA   . GLY A  1 269 ? 84.794  131.518 53.665  1.00 10.42 ? 269 GLY A CA   1 
ATOM   3857  C  C    . GLY A  1 269 ? 84.958  132.678 52.690  1.00 11.80 ? 269 GLY A C    1 
ATOM   3858  O  O    . GLY A  1 269 ? 84.470  132.661 51.551  1.00 11.68 ? 269 GLY A O    1 
ATOM   3859  H  H    . GLY A  1 269 ? 85.978  131.469 55.230  1.00 12.27 ? 269 GLY A H    1 
ATOM   3860  H  HA2  . GLY A  1 269 ? 84.576  130.712 53.171  1.00 12.50 ? 269 GLY A HA2  1 
ATOM   3861  H  HA3  . GLY A  1 269 ? 84.076  131.719 54.285  1.00 12.50 ? 269 GLY A HA3  1 
ATOM   3862  N  N    . GLY A  1 270 ? 85.645  133.703 53.166  1.00 11.15 ? 270 GLY A N    1 
ATOM   3863  C  CA   . GLY A  1 270 ? 85.961  134.847 52.330  1.00 11.62 ? 270 GLY A CA   1 
ATOM   3864  C  C    . GLY A  1 270 ? 86.912  134.482 51.193  1.00 12.22 ? 270 GLY A C    1 
ATOM   3865  O  O    . GLY A  1 270 ? 86.739  134.927 50.039  1.00 13.12 ? 270 GLY A O    1 
ATOM   3866  H  H    . GLY A  1 270 ? 85.940  133.761 53.972  1.00 13.38 ? 270 GLY A H    1 
ATOM   3867  H  HA2  . GLY A  1 270 ? 85.145  135.204 51.946  1.00 13.94 ? 270 GLY A HA2  1 
ATOM   3868  H  HA3  . GLY A  1 270 ? 86.377  135.538 52.869  1.00 13.94 ? 270 GLY A HA3  1 
ATOM   3869  N  N    . LEU A  1 271 ? 87.939  133.698 51.503  1.00 14.59 ? 271 LEU A N    1 
ATOM   3870  C  CA   . LEU A  1 271 ? 88.920  133.309 50.488  1.00 17.16 ? 271 LEU A CA   1 
ATOM   3871  C  C    . LEU A  1 271 ? 88.258  132.523 49.362  1.00 15.77 ? 271 LEU A C    1 
ATOM   3872  O  O    . LEU A  1 271 ? 88.514  132.768 48.175  1.00 17.60 ? 271 LEU A O    1 
ATOM   3873  C  CB   . LEU A  1 271 ? 90.008  132.429 51.101  1.00 13.38 ? 271 LEU A CB   1 
ATOM   3874  C  CG   . LEU A  1 271 ? 90.962  133.024 52.127  1.00 16.05 ? 271 LEU A CG   1 
ATOM   3875  C  CD1  . LEU A  1 271 ? 91.783  131.901 52.759  1.00 22.98 ? 271 LEU A CD1  1 
ATOM   3876  C  CD2  . LEU A  1 271 ? 91.872  134.071 51.507  1.00 16.06 ? 271 LEU A CD2  1 
ATOM   3877  H  H    . LEU A  1 271 ? 88.093  133.380 52.287  1.00 17.51 ? 271 LEU A H    1 
ATOM   3878  H  HA   . LEU A  1 271 ? 89.339  134.109 50.109  1.00 20.59 ? 271 LEU A HA   1 
ATOM   3879  H  HB2  . LEU A  1 271 ? 89.570  131.679 51.533  1.00 16.05 ? 271 LEU A HB2  1 
ATOM   3880  H  HB3  . LEU A  1 271 ? 90.557  132.094 50.375  1.00 16.05 ? 271 LEU A HB3  1 
ATOM   3881  H  HG   . LEU A  1 271 ? 90.446  133.451 52.829  1.00 19.26 ? 271 LEU A HG   1 
ATOM   3882  H  HD11 . LEU A  1 271 ? 92.383  132.279 53.405  1.00 27.58 ? 271 LEU A HD11 1 
ATOM   3883  H  HD12 . LEU A  1 271 ? 91.187  131.282 53.187  1.00 27.58 ? 271 LEU A HD12 1 
ATOM   3884  H  HD13 . LEU A  1 271 ? 92.281  131.454 52.071  1.00 27.58 ? 271 LEU A HD13 1 
ATOM   3885  H  HD21 . LEU A  1 271 ? 92.455  134.419 52.185  1.00 19.27 ? 271 LEU A HD21 1 
ATOM   3886  H  HD22 . LEU A  1 271 ? 92.389  133.661 50.809  1.00 19.27 ? 271 LEU A HD22 1 
ATOM   3887  H  HD23 . LEU A  1 271 ? 91.333  134.777 51.144  1.00 19.27 ? 271 LEU A HD23 1 
ATOM   3888  N  N    . ILE A  1 272 ? 87.412  131.578 49.756  1.00 14.25 ? 272 ILE A N    1 
ATOM   3889  C  CA   . ILE A  1 272 ? 86.865  130.561 48.858  1.00 12.50 ? 272 ILE A CA   1 
ATOM   3890  C  C    . ILE A  1 272 ? 85.728  131.114 47.992  1.00 13.34 ? 272 ILE A C    1 
ATOM   3891  O  O    . ILE A  1 272 ? 85.496  130.619 46.870  1.00 10.83 ? 272 ILE A O    1 
ATOM   3892  C  CB   . ILE A  1 272 ? 86.406  129.306 49.668  1.00 16.73 ? 272 ILE A CB   1 
ATOM   3893  C  CG1  . ILE A  1 272 ? 86.125  128.123 48.744  1.00 25.05 ? 272 ILE A CG1  1 
ATOM   3894  C  CG2  . ILE A  1 272 ? 85.168  129.584 50.472  1.00 27.68 ? 272 ILE A CG2  1 
ATOM   3895  C  CD1  . ILE A  1 272 ? 87.364  127.529 48.134  1.00 21.20 ? 272 ILE A CD1  1 
ATOM   3896  H  H    . ILE A  1 272 ? 87.129  131.501 50.565  1.00 17.10 ? 272 ILE A H    1 
ATOM   3897  H  HA   . ILE A  1 272 ? 87.578  130.271 48.251  1.00 15.00 ? 272 ILE A HA   1 
ATOM   3898  H  HB   . ILE A  1 272 ? 87.118  129.057 50.278  1.00 20.08 ? 272 ILE A HB   1 
ATOM   3899  H  HG12 . ILE A  1 272 ? 85.681  127.427 49.253  1.00 30.07 ? 272 ILE A HG12 1 
ATOM   3900  H  HG13 . ILE A  1 272 ? 85.551  128.420 48.021  1.00 30.07 ? 272 ILE A HG13 1 
ATOM   3901  H  HG21 . ILE A  1 272 ? 84.923  128.790 50.952  1.00 33.21 ? 272 ILE A HG21 1 
ATOM   3902  H  HG22 . ILE A  1 272 ? 85.350  130.297 51.089  1.00 33.21 ? 272 ILE A HG22 1 
ATOM   3903  H  HG23 . ILE A  1 272 ? 84.460  129.839 49.876  1.00 33.21 ? 272 ILE A HG23 1 
ATOM   3904  H  HD11 . ILE A  1 272 ? 87.112  126.795 47.569  1.00 25.44 ? 272 ILE A HD11 1 
ATOM   3905  H  HD12 . ILE A  1 272 ? 87.811  128.203 47.617  1.00 25.44 ? 272 ILE A HD12 1 
ATOM   3906  H  HD13 . ILE A  1 272 ? 87.940  127.219 48.837  1.00 25.44 ? 272 ILE A HD13 1 
ATOM   3907  N  N    . GLU A  1 273 ? 85.091  132.187 48.475  1.00 12.45 ? 273 GLU A N    1 
ATOM   3908  C  CA   . GLU A  1 273 ? 83.916  132.785 47.823  1.00 13.36 ? 273 GLU A CA   1 
ATOM   3909  C  C    . GLU A  1 273 ? 84.104  133.009 46.311  1.00 15.03 ? 273 GLU A C    1 
ATOM   3910  O  O    . GLU A  1 273 ? 83.292  132.557 45.502  1.00 24.91 ? 273 GLU A O    1 
ATOM   3911  C  CB   . GLU A  1 273 ? 83.546  134.086 48.548  1.00 15.44 ? 273 GLU A CB   1 
ATOM   3912  C  CG   . GLU A  1 273 ? 82.749  135.120 47.764  1.00 29.49 ? 273 GLU A CG   1 
ATOM   3913  C  CD   . GLU A  1 273 ? 81.374  134.646 47.347  1.00 31.80 ? 273 GLU A CD   1 
ATOM   3914  O  OE1  . GLU A  1 273 ? 80.846  133.712 47.986  1.00 26.48 ? 273 GLU A OE1  1 
ATOM   3915  O  OE2  . GLU A  1 273 ? 80.824  135.216 46.376  1.00 34.32 ? 273 GLU A OE2  1 
ATOM   3916  H  H    . GLU A  1 273 ? 85.326  132.596 49.194  1.00 14.93 ? 273 GLU A H    1 
ATOM   3917  H  HA   . GLU A  1 273 ? 83.161  132.169 47.931  1.00 16.03 ? 273 GLU A HA   1 
ATOM   3918  H  HB2  . GLU A  1 273 ? 83.020  133.855 49.330  1.00 18.53 ? 273 GLU A HB2  1 
ATOM   3919  H  HB3  . GLU A  1 273 ? 84.367  134.516 48.833  1.00 18.53 ? 273 GLU A HB3  1 
ATOM   3920  H  HG2  . GLU A  1 273 ? 82.635  135.911 48.315  1.00 35.39 ? 273 GLU A HG2  1 
ATOM   3921  H  HG3  . GLU A  1 273 ? 83.240  135.349 46.959  1.00 35.39 ? 273 GLU A HG3  1 
ATOM   3922  N  N    . GLN A  1 274 ? 85.187  133.659 45.933  1.00 15.36 ? 274 GLN A N    1 
ATOM   3923  C  CA   . GLN A  1 274 ? 85.500  133.823 44.510  1.00 21.38 ? 274 GLN A CA   1 
ATOM   3924  C  C    . GLN A  1 274 ? 86.709  133.024 44.037  1.00 14.22 ? 274 GLN A C    1 
ATOM   3925  O  O    . GLN A  1 274 ? 87.005  132.997 42.840  1.00 17.18 ? 274 GLN A O    1 
ATOM   3926  C  CB   . GLN A  1 274 ? 85.728  135.297 44.167  1.00 17.83 ? 274 GLN A CB   1 
ATOM   3927  C  CG   . GLN A  1 274 ? 84.444  136.093 44.057  1.00 32.74 ? 274 GLN A CG   1 
ATOM   3928  C  CD   . GLN A  1 274 ? 83.472  135.504 43.033  1.00 45.39 ? 274 GLN A CD   1 
ATOM   3929  O  OE1  . GLN A  1 274 ? 83.825  135.281 41.869  1.00 43.40 ? 274 GLN A OE1  1 
ATOM   3930  N  NE2  . GLN A  1 274 ? 82.243  135.233 43.476  1.00 49.61 ? 274 GLN A NE2  1 
ATOM   3931  H  H    . GLN A  1 274 ? 85.758  134.015 46.468  1.00 18.43 ? 274 GLN A H    1 
ATOM   3932  H  HA   . GLN A  1 274 ? 84.728  133.518 43.990  1.00 25.66 ? 274 GLN A HA   1 
ATOM   3933  H  HB2  . GLN A  1 274 ? 86.271  135.701 44.861  1.00 21.40 ? 274 GLN A HB2  1 
ATOM   3934  H  HB3  . GLN A  1 274 ? 86.187  135.353 43.314  1.00 21.40 ? 274 GLN A HB3  1 
ATOM   3935  H  HG2  . GLN A  1 274 ? 84.003  136.101 44.921  1.00 39.29 ? 274 GLN A HG2  1 
ATOM   3936  H  HG3  . GLN A  1 274 ? 84.656  136.999 43.784  1.00 39.29 ? 274 GLN A HG3  1 
ATOM   3937  H  HE21 . GLN A  1 274 ? 81.657  134.901 42.941  1.00 59.53 ? 274 GLN A HE21 1 
ATOM   3938  H  HE22 . GLN A  1 274 ? 82.036  135.392 44.295  1.00 59.53 ? 274 GLN A HE22 1 
ATOM   3939  N  N    . ALA A  1 275 ? 87.421  132.397 44.953  1.00 14.18 ? 275 ALA A N    1 
ATOM   3940  C  CA   . ALA A  1 275 ? 88.590  131.640 44.565  1.00 17.16 ? 275 ALA A CA   1 
ATOM   3941  C  C    . ALA A  1 275 ? 88.215  130.457 43.678  1.00 16.80 ? 275 ALA A C    1 
ATOM   3942  O  O    . ALA A  1 275 ? 88.994  130.075 42.810  1.00 11.41 ? 275 ALA A O    1 
ATOM   3943  C  CB   . ALA A  1 275 ? 89.378  131.199 45.770  1.00 18.05 ? 275 ALA A CB   1 
ATOM   3944  H  H    . ALA A  1 275 ? 87.251  132.394 45.796  1.00 17.01 ? 275 ALA A H    1 
ATOM   3945  H  HA   . ALA A  1 275 ? 89.172  132.225 44.036  1.00 20.59 ? 275 ALA A HA   1 
ATOM   3946  H  HB1  . ALA A  1 275 ? 90.144  130.701 45.476  1.00 21.66 ? 275 ALA A HB1  1 
ATOM   3947  H  HB2  . ALA A  1 275 ? 89.660  131.975 46.260  1.00 21.66 ? 275 ALA A HB2  1 
ATOM   3948  H  HB3  . ALA A  1 275 ? 88.820  130.647 46.323  1.00 21.66 ? 275 ALA A HB3  1 
ATOM   3949  N  N    . GLU A  1 276 ? 87.024  129.893 43.852  1.00 15.61 ? 276 GLU A N    1 
ATOM   3950  C  CA   . GLU A  1 276 ? 86.684  128.714 43.056  1.00 16.95 ? 276 GLU A CA   1 
ATOM   3951  C  C    . GLU A  1 276 ? 86.447  129.101 41.596  1.00 12.32 ? 276 GLU A C    1 
ATOM   3952  O  O    . GLU A  1 276 ? 86.866  128.388 40.684  1.00 11.53 ? 276 GLU A O    1 
ATOM   3953  C  CB   . GLU A  1 276 ? 85.490  127.970 43.639  1.00 17.27 ? 276 GLU A CB   1 
ATOM   3954  C  CG   . GLU A  1 276 ? 85.777  127.371 45.011  1.00 19.00 ? 276 GLU A CG   1 
ATOM   3955  C  CD   . GLU A  1 276 ? 84.712  126.381 45.410  1.00 15.28 ? 276 GLU A CD   1 
ATOM   3956  O  OE1  . GLU A  1 276 ? 83.753  126.779 46.082  1.00 16.63 ? 276 GLU A OE1  1 
ATOM   3957  O  OE2  . GLU A  1 276 ? 84.804  125.213 45.010  1.00 11.49 ? 276 GLU A OE2  1 
ATOM   3958  H  H    . GLU A  1 276 ? 86.416  130.159 44.400  1.00 18.73 ? 276 GLU A H    1 
ATOM   3959  H  HA   . GLU A  1 276 ? 87.448  128.100 43.074  1.00 20.34 ? 276 GLU A HA   1 
ATOM   3960  H  HB2  . GLU A  1 276 ? 84.747  128.587 43.731  1.00 20.72 ? 276 GLU A HB2  1 
ATOM   3961  H  HB3  . GLU A  1 276 ? 85.247  127.246 43.041  1.00 20.72 ? 276 GLU A HB3  1 
ATOM   3962  H  HG2  . GLU A  1 276 ? 86.629  126.909 44.987  1.00 22.80 ? 276 GLU A HG2  1 
ATOM   3963  H  HG3  . GLU A  1 276 ? 85.796  128.080 45.673  1.00 22.80 ? 276 GLU A HG3  1 
ATOM   3964  N  N    A ASN A  1 277 ? 85.789  130.232 41.388  0.46 13.31 ? 277 ASN A N    1 
ATOM   3965  N  N    B ASN A  1 277 ? 85.784  130.232 41.375  0.54 13.30 ? 277 ASN A N    1 
ATOM   3966  C  CA   A ASN A  1 277 ? 85.585  130.745 40.046  0.46 16.44 ? 277 ASN A CA   1 
ATOM   3967  C  CA   B ASN A  1 277 ? 85.599  130.735 40.018  0.54 16.44 ? 277 ASN A CA   1 
ATOM   3968  C  C    A ASN A  1 277 ? 86.906  131.206 39.433  0.46 16.19 ? 277 ASN A C    1 
ATOM   3969  C  C    B ASN A  1 277 ? 86.929  131.182 39.430  0.54 16.15 ? 277 ASN A C    1 
ATOM   3970  O  O    A ASN A  1 277 ? 87.173  130.969 38.266  0.46 14.84 ? 277 ASN A O    1 
ATOM   3971  O  O    B ASN A  1 277 ? 87.224  130.923 38.277  0.54 14.88 ? 277 ASN A O    1 
ATOM   3972  C  CB   A ASN A  1 277 ? 84.558  131.878 40.069  0.46 21.79 ? 277 ASN A CB   1 
ATOM   3973  C  CB   B ASN A  1 277 ? 84.597  131.892 39.980  0.54 22.42 ? 277 ASN A CB   1 
ATOM   3974  C  CG   A ASN A  1 277 ? 83.161  131.383 40.413  0.46 25.39 ? 277 ASN A CG   1 
ATOM   3975  C  CG   B ASN A  1 277 ? 84.343  132.396 38.563  0.54 25.09 ? 277 ASN A CG   1 
ATOM   3976  O  OD1  A ASN A  1 277 ? 82.864  130.193 40.281  0.46 33.03 ? 277 ASN A OD1  1 
ATOM   3977  O  OD1  B ASN A  1 277 ? 83.760  131.696 37.734  0.54 27.90 ? 277 ASN A OD1  1 
ATOM   3978  N  ND2  A ASN A  1 277 ? 82.297  132.292 40.852  0.46 21.06 ? 277 ASN A ND2  1 
ATOM   3979  N  ND2  B ASN A  1 277 ? 84.777  133.617 38.284  0.54 18.92 ? 277 ASN A ND2  1 
ATOM   3980  H  H    A ASN A  1 277 ? 85.451  130.721 42.010  0.46 15.97 ? 277 ASN A H    1 
ATOM   3981  H  H    B ASN A  1 277 ? 85.434  130.723 41.988  0.54 15.96 ? 277 ASN A H    1 
ATOM   3982  H  HA   A ASN A  1 277 ? 85.228  130.027 39.483  0.46 19.72 ? 277 ASN A HA   1 
ATOM   3983  H  HA   B ASN A  1 277 ? 85.248  130.013 39.456  0.54 19.73 ? 277 ASN A HA   1 
ATOM   3984  H  HB2  A ASN A  1 277 ? 84.820  132.530 40.737  0.46 26.14 ? 277 ASN A HB2  1 
ATOM   3985  H  HB2  B ASN A  1 277 ? 83.751  131.591 40.348  0.54 26.91 ? 277 ASN A HB2  1 
ATOM   3986  H  HB3  A ASN A  1 277 ? 84.524  132.293 39.193  0.46 26.14 ? 277 ASN A HB3  1 
ATOM   3987  H  HB3  B ASN A  1 277 ? 84.944  132.630 40.505  0.54 26.91 ? 277 ASN A HB3  1 
ATOM   3988  H  HD21 A ASN A  1 277 ? 82.539  133.114 40.928  0.46 25.28 ? 277 ASN A HD21 1 
ATOM   3989  H  HD21 B ASN A  1 277 ? 85.177  134.080 38.888  0.54 22.71 ? 277 ASN A HD21 1 
ATOM   3990  H  HD22 A ASN A  1 277 ? 81.496  132.059 41.059  0.46 25.28 ? 277 ASN A HD22 1 
ATOM   3991  H  HD22 B ASN A  1 277 ? 84.658  133.946 37.498  0.54 22.71 ? 277 ASN A HD22 1 
ATOM   3992  N  N    . GLU A  1 278 ? 87.745  131.849 40.232  1.00 14.24 ? 278 GLU A N    1 
ATOM   3993  C  CA   . GLU A  1 278 ? 89.047  132.287 39.757  1.00 14.39 ? 278 GLU A CA   1 
ATOM   3994  C  C    . GLU A  1 278 ? 89.850  131.083 39.271  1.00 16.32 ? 278 GLU A C    1 
ATOM   3995  O  O    . GLU A  1 278 ? 90.463  131.119 38.209  1.00 14.07 ? 278 GLU A O    1 
ATOM   3996  C  CB   . GLU A  1 278 ? 89.789  133.040 40.868  1.00 17.18 ? 278 GLU A CB   1 
ATOM   3997  C  CG   . GLU A  1 278 ? 91.252  133.320 40.592  1.00 23.08 ? 278 GLU A CG   1 
ATOM   3998  C  CD   . GLU A  1 278 ? 91.939  134.009 41.767  1.00 22.87 ? 278 GLU A CD   1 
ATOM   3999  O  OE1  . GLU A  1 278 ? 91.665  133.643 42.940  1.00 25.89 ? 278 GLU A OE1  1 
ATOM   4000  O  OE2  . GLU A  1 278 ? 92.733  134.947 41.518  1.00 22.75 ? 278 GLU A OE2  1 
ATOM   4001  H  H    . GLU A  1 278 ? 87.576  132.050 41.051  0.46 17.08 ? 278 GLU A H    1 
ATOM   4002  H  HA   . GLU A  1 278 ? 88.925  132.899 39.001  1.00 17.27 ? 278 GLU A HA   1 
ATOM   4003  H  HB2  . GLU A  1 278 ? 89.350  133.893 41.008  1.00 20.61 ? 278 GLU A HB2  1 
ATOM   4004  H  HB3  . GLU A  1 278 ? 89.741  132.513 41.681  1.00 20.61 ? 278 GLU A HB3  1 
ATOM   4005  H  HG2  . GLU A  1 278 ? 91.710  132.481 40.424  1.00 27.69 ? 278 GLU A HG2  1 
ATOM   4006  H  HG3  . GLU A  1 278 ? 91.324  133.899 39.817  1.00 27.69 ? 278 GLU A HG3  1 
ATOM   4007  N  N    . ALA A  1 279 ? 89.828  129.998 40.034  1.00 12.17 ? 279 ALA A N    1 
ATOM   4008  C  CA   . ALA A  1 279 ? 90.573  128.809 39.640  1.00 12.01 ? 279 ALA A CA   1 
ATOM   4009  C  C    . ALA A  1 279 ? 89.971  128.180 38.380  1.00 12.18 ? 279 ALA A C    1 
ATOM   4010  O  O    . ALA A  1 279 ? 90.687  127.664 37.539  1.00 15.86 ? 279 ALA A O    1 
ATOM   4011  C  CB   . ALA A  1 279 ? 90.610  127.807 40.815  1.00 11.46 ? 279 ALA A CB   1 
ATOM   4012  H  H    . ALA A  1 279 ? 89.396  129.924 40.774  1.00 14.60 ? 279 ALA A H    1 
ATOM   4013  H  HA   . ALA A  1 279 ? 91.496  129.067 39.436  1.00 14.41 ? 279 ALA A HA   1 
ATOM   4014  H  HB1  . ALA A  1 279 ? 91.103  127.028 40.545  1.00 13.75 ? 279 ALA A HB1  1 
ATOM   4015  H  HB2  . ALA A  1 279 ? 91.040  128.222 41.566  1.00 13.75 ? 279 ALA A HB2  1 
ATOM   4016  H  HB3  . ALA A  1 279 ? 89.711  127.562 41.045  1.00 13.75 ? 279 ALA A HB3  1 
ATOM   4017  N  N    . LEU A  1 280 ? 88.652  128.243 38.246  1.00 12.18 ? 280 LEU A N    1 
ATOM   4018  C  CA   . LEU A  1 280 ? 87.988  127.785 37.050  1.00 12.45 ? 280 LEU A CA   1 
ATOM   4019  C  C    . LEU A  1 280 ? 88.562  128.530 35.846  1.00 13.04 ? 280 LEU A C    1 
ATOM   4020  O  O    . LEU A  1 280 ? 88.949  127.910 34.853  1.00 13.26 ? 280 LEU A O    1 
ATOM   4021  C  CB   . LEU A  1 280 ? 86.486  127.999 37.154  1.00 12.51 ? 280 LEU A CB   1 
ATOM   4022  C  CG   . LEU A  1 280 ? 85.642  127.672 35.927  1.00 23.51 ? 280 LEU A CG   1 
ATOM   4023  C  CD1  . LEU A  1 280 ? 85.526  126.181 35.740  1.00 24.39 ? 280 LEU A CD1  1 
ATOM   4024  C  CD2  . LEU A  1 280 ? 84.273  128.308 36.076  1.00 31.69 ? 280 LEU A CD2  1 
ATOM   4025  H  H    . LEU A  1 280 ? 88.119  128.552 38.845  1.00 14.61 ? 280 LEU A H    1 
ATOM   4026  H  HA   . LEU A  1 280 ? 88.157  126.827 36.931  1.00 14.94 ? 280 LEU A HA   1 
ATOM   4027  H  HB2  . LEU A  1 280 ? 86.154  127.450 37.881  1.00 15.01 ? 280 LEU A HB2  1 
ATOM   4028  H  HB3  . LEU A  1 280 ? 86.330  128.933 37.365  1.00 15.01 ? 280 LEU A HB3  1 
ATOM   4029  H  HG   . LEU A  1 280 ? 86.066  128.045 35.139  1.00 28.22 ? 280 LEU A HG   1 
ATOM   4030  H  HD11 . LEU A  1 280 ? 84.991  126.005 34.963  1.00 29.27 ? 280 LEU A HD11 1 
ATOM   4031  H  HD12 . LEU A  1 280 ? 86.404  125.811 35.624  1.00 29.27 ? 280 LEU A HD12 1 
ATOM   4032  H  HD13 . LEU A  1 280 ? 85.110  125.800 36.517  1.00 29.27 ? 280 LEU A HD13 1 
ATOM   4033  H  HD21 . LEU A  1 280 ? 83.746  128.099 35.302  1.00 38.03 ? 280 LEU A HD21 1 
ATOM   4034  H  HD22 . LEU A  1 280 ? 83.851  127.958 36.864  1.00 38.03 ? 280 LEU A HD22 1 
ATOM   4035  H  HD23 . LEU A  1 280 ? 84.378  129.259 36.155  1.00 38.03 ? 280 LEU A HD23 1 
ATOM   4036  N  N    . GLU A  1 281 ? 88.657  129.856 35.952  1.00 13.37 ? 281 GLU A N    1 
ATOM   4037  C  CA   . GLU A  1 281 ? 89.226  130.657 34.863  1.00 14.05 ? 281 GLU A CA   1 
ATOM   4038  C  C    . GLU A  1 281 ? 90.704  130.321 34.643  1.00 14.14 ? 281 GLU A C    1 
ATOM   4039  O  O    . GLU A  1 281 ? 91.158  130.232 33.501  1.00 17.49 ? 281 GLU A O    1 
ATOM   4040  C  CB   . GLU A  1 281 ? 89.085  132.157 35.136  1.00 18.88 ? 281 GLU A CB   1 
ATOM   4041  C  CG   . GLU A  1 281 ? 87.659  132.662 35.090  1.00 25.84 ? 281 GLU A CG   1 
ATOM   4042  C  CD   . GLU A  1 281 ? 86.976  132.360 33.773  1.00 32.97 ? 281 GLU A CD   1 
ATOM   4043  O  OE1  . GLU A  1 281 ? 87.645  132.474 32.721  1.00 33.35 ? 281 GLU A OE1  1 
ATOM   4044  O  OE2  . GLU A  1 281 ? 85.775  132.000 33.789  1.00 28.02 ? 281 GLU A OE2  1 
ATOM   4045  H  H    . GLU A  1 281 ? 88.403  130.313 36.635  1.00 16.04 ? 281 GLU A H    1 
ATOM   4046  H  HA   . GLU A  1 281 ? 88.744  130.455 34.034  1.00 16.86 ? 281 GLU A HA   1 
ATOM   4047  H  HB2  . GLU A  1 281 ? 89.438  132.346 36.020  1.00 22.65 ? 281 GLU A HB2  1 
ATOM   4048  H  HB3  . GLU A  1 281 ? 89.593  132.644 34.469  1.00 22.65 ? 281 GLU A HB3  1 
ATOM   4049  H  HG2  . GLU A  1 281 ? 87.150  132.236 35.797  1.00 31.01 ? 281 GLU A HG2  1 
ATOM   4050  H  HG3  . GLU A  1 281 ? 87.660  133.624 35.214  1.00 31.01 ? 281 GLU A HG3  1 
ATOM   4051  N  N    . ASN A  1 282 ? 91.438  130.117 35.735  1.00 15.56 ? 282 ASN A N    1 
ATOM   4052  C  CA   . ASN A  1 282 ? 92.846  129.739 35.620  1.00 15.74 ? 282 ASN A CA   1 
ATOM   4053  C  C    . ASN A  1 282 ? 92.997  128.389 34.915  1.00 16.85 ? 282 ASN A C    1 
ATOM   4054  O  O    . ASN A  1 282 ? 93.918  128.202 34.117  1.00 19.14 ? 282 ASN A O    1 
ATOM   4055  C  CB   . ASN A  1 282 ? 93.519  129.691 36.983  1.00 17.27 ? 282 ASN A CB   1 
ATOM   4056  C  CG   . ASN A  1 282 ? 93.868  131.060 37.503  1.00 25.45 ? 282 ASN A CG   1 
ATOM   4057  O  OD1  . ASN A  1 282 ? 93.926  132.025 36.739  1.00 25.13 ? 282 ASN A OD1  1 
ATOM   4058  N  ND2  . ASN A  1 282 ? 94.124  131.150 38.799  1.00 23.78 ? 282 ASN A ND2  1 
ATOM   4059  H  H    . ASN A  1 282 ? 91.151  130.190 36.542  1.00 18.67 ? 282 ASN A H    1 
ATOM   4060  H  HA   . ASN A  1 282 ? 93.310  130.412 35.081  1.00 18.89 ? 282 ASN A HA   1 
ATOM   4061  H  HB2  . ASN A  1 282 ? 92.917  129.272 37.619  1.00 20.72 ? 282 ASN A HB2  1 
ATOM   4062  H  HB3  . ASN A  1 282 ? 94.339  129.177 36.914  1.00 20.72 ? 282 ASN A HB3  1 
ATOM   4063  H  HD21 . ASN A  1 282 ? 94.087  130.449 39.295  1.00 28.54 ? 282 ASN A HD21 1 
ATOM   4064  H  HD22 . ASN A  1 282 ? 94.329  131.911 39.144  1.00 28.54 ? 282 ASN A HD22 1 
ATOM   4065  N  N    . LEU A  1 283 ? 92.086  127.466 35.198  1.00 15.12 ? 283 LEU A N    1 
ATOM   4066  C  CA   . LEU A  1 283 ? 92.142  126.171 34.547  1.00 16.11 ? 283 LEU A CA   1 
ATOM   4067  C  C    . LEU A  1 283 ? 91.942  126.342 33.055  1.00 13.88 ? 283 LEU A C    1 
ATOM   4068  O  O    . LEU A  1 283 ? 92.706  125.770 32.279  1.00 14.20 ? 283 LEU A O    1 
ATOM   4069  C  CB   . LEU A  1 283 ? 91.125  125.202 35.117  1.00 12.83 ? 283 LEU A CB   1 
ATOM   4070  C  CG   . LEU A  1 283 ? 91.496  124.702 36.527  1.00 14.67 ? 283 LEU A CG   1 
ATOM   4071  C  CD1  . LEU A  1 283 ? 90.278  124.135 37.227  1.00 17.29 ? 283 LEU A CD1  1 
ATOM   4072  C  CD2  . LEU A  1 283 ? 92.623  123.656 36.460  1.00 15.98 ? 283 LEU A CD2  1 
ATOM   4073  H  H    . LEU A  1 283 ? 91.437  127.564 35.755  1.00 18.14 ? 283 LEU A H    1 
ATOM   4074  H  HA   . LEU A  1 283 ? 93.032  125.786 34.687  1.00 19.34 ? 283 LEU A HA   1 
ATOM   4075  H  HB2  . LEU A  1 283 ? 90.264  125.645 35.173  1.00 15.40 ? 283 LEU A HB2  1 
ATOM   4076  H  HB3  . LEU A  1 283 ? 91.063  124.430 34.533  1.00 15.40 ? 283 LEU A HB3  1 
ATOM   4077  H  HG   . LEU A  1 283 ? 91.817  125.452 37.051  1.00 17.60 ? 283 LEU A HG   1 
ATOM   4078  H  HD11 . LEU A  1 283 ? 90.533  123.831 38.101  1.00 20.75 ? 283 LEU A HD11 1 
ATOM   4079  H  HD12 . LEU A  1 283 ? 89.612  124.822 37.300  1.00 20.75 ? 283 LEU A HD12 1 
ATOM   4080  H  HD13 . LEU A  1 283 ? 89.936  123.400 36.711  1.00 20.75 ? 283 LEU A HD13 1 
ATOM   4081  H  HD21 . LEU A  1 283 ? 92.832  123.364 37.351  1.00 19.17 ? 283 LEU A HD21 1 
ATOM   4082  H  HD22 . LEU A  1 283 ? 92.327  122.911 35.932  1.00 19.17 ? 283 LEU A HD22 1 
ATOM   4083  H  HD23 . LEU A  1 283 ? 93.397  124.056 36.057  1.00 19.17 ? 283 LEU A HD23 1 
ATOM   4084  N  N    . LYS A  1 284 ? 90.957  127.146 32.644  1.00 14.08 ? 284 LYS A N    1 
ATOM   4085  C  CA   . LYS A  1 284 ? 90.694  127.354 31.207  1.00 15.48 ? 284 LYS A CA   1 
ATOM   4086  C  C    . LYS A  1 284 ? 91.873  127.981 30.497  1.00 17.63 ? 284 LYS A C    1 
ATOM   4087  O  O    . LYS A  1 284 ? 92.181  127.625 29.358  1.00 18.34 ? 284 LYS A O    1 
ATOM   4088  C  CB   . LYS A  1 284 ? 89.441  128.210 30.983  1.00 20.03 ? 284 LYS A CB   1 
ATOM   4089  C  CG   . LYS A  1 284 ? 88.188  127.526 31.470  1.00 15.03 ? 284 LYS A CG   1 
ATOM   4090  C  CD   . LYS A  1 284 ? 86.909  128.225 31.066  1.00 18.27 ? 284 LYS A CD   1 
ATOM   4091  C  CE   . LYS A  1 284 ? 86.780  129.579 31.758  1.00 29.54 ? 284 LYS A CE   1 
ATOM   4092  N  NZ   . LYS A  1 284 ? 85.528  130.287 31.340  1.00 41.65 ? 284 LYS A NZ   1 
ATOM   4093  H  H    . LYS A  1 284 ? 90.431  127.580 33.167  1.00 16.89 ? 284 LYS A H    1 
ATOM   4094  H  HA   . LYS A  1 284 ? 90.531  126.480 30.793  1.00 18.58 ? 284 LYS A HA   1 
ATOM   4095  H  HB2  . LYS A  1 284 ? 89.536  129.045 31.467  1.00 24.03 ? 284 LYS A HB2  1 
ATOM   4096  H  HB3  . LYS A  1 284 ? 89.340  128.384 30.034  1.00 24.03 ? 284 LYS A HB3  1 
ATOM   4097  H  HG2  . LYS A  1 284 ? 88.162  126.627 31.105  1.00 18.04 ? 284 LYS A HG2  1 
ATOM   4098  H  HG3  . LYS A  1 284 ? 88.211  127.486 32.439  1.00 18.04 ? 284 LYS A HG3  1 
ATOM   4099  H  HD2  . LYS A  1 284 ? 86.912  128.371 30.107  1.00 21.92 ? 284 LYS A HD2  1 
ATOM   4100  H  HD3  . LYS A  1 284 ? 86.149  127.678 31.321  1.00 21.92 ? 284 LYS A HD3  1 
ATOM   4101  H  HE2  . LYS A  1 284 ? 86.749  129.447 32.719  1.00 35.44 ? 284 LYS A HE2  1 
ATOM   4102  H  HE3  . LYS A  1 284 ? 87.538  130.135 31.519  1.00 35.44 ? 284 LYS A HE3  1 
ATOM   4103  H  HZ1  . LYS A  1 284 ? 85.470  131.073 31.753  1.00 49.98 ? 284 LYS A HZ1  1 
ATOM   4104  H  HZ2  . LYS A  1 284 ? 85.535  130.422 30.460  1.00 49.98 ? 284 LYS A HZ2  1 
ATOM   4105  H  HZ3  . LYS A  1 284 ? 84.816  129.796 31.552  1.00 49.98 ? 284 LYS A HZ3  1 
ATOM   4106  N  N    . LYS A  1 285 ? 92.516  128.934 31.159  1.00 17.82 ? 285 LYS A N    1 
ATOM   4107  C  CA   . LYS A  1 285 ? 93.655  129.628 30.579  1.00 16.13 ? 285 LYS A CA   1 
ATOM   4108  C  C    . LYS A  1 285 ? 94.824  128.691 30.356  1.00 18.10 ? 285 LYS A C    1 
ATOM   4109  O  O    . LYS A  1 285 ? 95.620  128.908 29.446  1.00 22.22 ? 285 LYS A O    1 
ATOM   4110  C  CB   . LYS A  1 285 ? 94.079  130.816 31.448  1.00 23.09 ? 285 LYS A CB   1 
ATOM   4111  C  CG   . LYS A  1 285 ? 93.254  132.058 31.194  1.00 41.71 ? 285 LYS A CG   1 
ATOM   4112  C  CD   . LYS A  1 285 ? 93.928  133.309 31.748  1.00 49.71 ? 285 LYS A CD   1 
ATOM   4113  C  CE   . LYS A  1 285 ? 93.053  133.971 32.804  1.00 52.15 ? 285 LYS A CE   1 
ATOM   4114  N  NZ   . LYS A  1 285 ? 93.709  135.151 33.464  1.00 52.56 ? 285 LYS A NZ   1 
ATOM   4115  H  H    . LYS A  1 285 ? 92.309  129.199 31.951  1.00 21.38 ? 285 LYS A H    1 
ATOM   4116  H  HA   . LYS A  1 285 ? 93.390  129.982 29.705  1.00 19.36 ? 285 LYS A HA   1 
ATOM   4117  H  HB2  . LYS A  1 285 ? 93.978  130.576 32.382  1.00 27.71 ? 285 LYS A HB2  1 
ATOM   4118  H  HB3  . LYS A  1 285 ? 95.006  131.030 31.259  1.00 27.71 ? 285 LYS A HB3  1 
ATOM   4119  H  HG2  . LYS A  1 285 ? 93.138  132.175 30.238  1.00 50.06 ? 285 LYS A HG2  1 
ATOM   4120  H  HG3  . LYS A  1 285 ? 92.391  131.962 31.626  1.00 50.06 ? 285 LYS A HG3  1 
ATOM   4121  H  HD2  . LYS A  1 285 ? 94.772  133.065 32.159  1.00 59.65 ? 285 LYS A HD2  1 
ATOM   4122  H  HD3  . LYS A  1 285 ? 94.073  133.943 31.029  1.00 59.65 ? 285 LYS A HD3  1 
ATOM   4123  H  HE2  . LYS A  1 285 ? 92.235  134.280 32.385  1.00 62.58 ? 285 LYS A HE2  1 
ATOM   4124  H  HE3  . LYS A  1 285 ? 92.847  133.321 33.493  1.00 62.58 ? 285 LYS A HE3  1 
ATOM   4125  H  HZ1  . LYS A  1 285 ? 93.161  135.503 34.070  1.00 63.08 ? 285 LYS A HZ1  1 
ATOM   4126  H  HZ2  . LYS A  1 285 ? 94.461  134.896 33.866  1.00 63.08 ? 285 LYS A HZ2  1 
ATOM   4127  H  HZ3  . LYS A  1 285 ? 93.903  135.771 32.855  1.00 63.08 ? 285 LYS A HZ3  1 
ATOM   4128  N  N    . ALA A  1 286 ? 94.883  127.622 31.152  1.00 17.84 ? 286 ALA A N    1 
ATOM   4129  C  CA   . ALA A  1 286 ? 95.932  126.629 31.020  1.00 16.08 ? 286 ALA A CA   1 
ATOM   4130  C  C    . ALA A  1 286 ? 95.486  125.478 30.115  1.00 18.36 ? 286 ALA A C    1 
ATOM   4131  O  O    . ALA A  1 286 ? 96.172  124.471 30.030  1.00 25.03 ? 286 ALA A O    1 
ATOM   4132  C  CB   . ALA A  1 286 ? 96.339  126.080 32.410  1.00 23.96 ? 286 ALA A CB   1 
ATOM   4133  H  H    . ALA A  1 286 ? 94.319  127.453 31.779  1.00 21.41 ? 286 ALA A H    1 
ATOM   4134  H  HA   . ALA A  1 286 ? 96.720  127.047 30.615  1.00 19.30 ? 286 ALA A HA   1 
ATOM   4135  H  HB1  . ALA A  1 286 ? 97.032  125.426 32.296  1.00 28.75 ? 286 ALA A HB1  1 
ATOM   4136  H  HB2  . ALA A  1 286 ? 96.657  126.806 32.951  1.00 28.75 ? 286 ALA A HB2  1 
ATOM   4137  H  HB3  . ALA A  1 286 ? 95.572  125.675 32.822  1.00 28.75 ? 286 ALA A HB3  1 
ATOM   4138  N  N    . GLY A  1 287 ? 94.339  125.634 29.459  1.00 17.15 ? 287 GLY A N    1 
ATOM   4139  C  CA   . GLY A  1 287 ? 93.933  124.726 28.397  1.00 18.65 ? 287 GLY A CA   1 
ATOM   4140  C  C    . GLY A  1 287 ? 92.883  123.691 28.759  1.00 20.09 ? 287 GLY A C    1 
ATOM   4141  O  O    . GLY A  1 287 ? 92.608  122.758 27.968  1.00 17.23 ? 287 GLY A O    1 
ATOM   4142  H  H    . GLY A  1 287 ? 93.775  126.264 29.613  1.00 20.58 ? 287 GLY A H    1 
ATOM   4143  H  HA2  . GLY A  1 287 ? 93.586  125.250 27.658  1.00 22.38 ? 287 GLY A HA2  1 
ATOM   4144  H  HA3  . GLY A  1 287 ? 94.717  124.251 28.080  1.00 22.38 ? 287 GLY A HA3  1 
ATOM   4145  N  N    . VAL A  1 288 ? 92.284  123.819 29.939  1.00 15.39 ? 288 VAL A N    1 
ATOM   4146  C  CA   . VAL A  1 288 ? 91.250  122.878 30.306  1.00 12.10 ? 288 VAL A CA   1 
ATOM   4147  C  C    . VAL A  1 288 ? 89.936  123.242 29.634  1.00 11.91 ? 288 VAL A C    1 
ATOM   4148  O  O    . VAL A  1 288 ? 89.514  124.411 29.633  1.00 14.92 ? 288 VAL A O    1 
ATOM   4149  C  CB   . VAL A  1 288 ? 91.029  122.808 31.842  1.00 10.99 ? 288 VAL A CB   1 
ATOM   4150  C  CG1  . VAL A  1 288 ? 89.830  121.944 32.163  1.00 13.22 ? 288 VAL A CG1  1 
ATOM   4151  C  CG2  . VAL A  1 288 ? 92.292  122.305 32.522  1.00 11.38 ? 288 VAL A CG2  1 
ATOM   4152  H  H    . VAL A  1 288 ? 92.455  124.425 30.525  1.00 18.47 ? 288 VAL A H    1 
ATOM   4153  H  HA   . VAL A  1 288 ? 91.510  121.985 29.998  1.00 14.52 ? 288 VAL A HA   1 
ATOM   4154  H  HB   . VAL A  1 288 ? 90.847  123.711 32.177  1.00 13.19 ? 288 VAL A HB   1 
ATOM   4155  H  HG11 . VAL A  1 288 ? 89.712  121.915 33.115  1.00 15.87 ? 288 VAL A HG11 1 
ATOM   4156  H  HG12 . VAL A  1 288 ? 89.052  122.324 31.748  1.00 15.87 ? 288 VAL A HG12 1 
ATOM   4157  H  HG13 . VAL A  1 288 ? 89.983  121.059 31.824  1.00 15.87 ? 288 VAL A HG13 1 
ATOM   4158  H  HG21 . VAL A  1 288 ? 92.142  122.266 33.469  1.00 13.65 ? 288 VAL A HG21 1 
ATOM   4159  H  HG22 . VAL A  1 288 ? 92.499  121.429 32.187  1.00 13.65 ? 288 VAL A HG22 1 
ATOM   4160  H  HG23 . VAL A  1 288 ? 93.013  122.909 32.328  1.00 13.65 ? 288 VAL A HG23 1 
ATOM   4161  N  N    . THR A  1 289 ? 89.284  122.223 29.087  1.00 10.28 ? 289 THR A N    1 
ATOM   4162  C  CA   . THR A  1 289 ? 87.937  122.340 28.551  1.00 10.32 ? 289 THR A CA   1 
ATOM   4163  C  C    . THR A  1 289 ? 86.915  122.102 29.661  1.00 9.95  ? 289 THR A C    1 
ATOM   4164  O  O    . THR A  1 289 ? 86.998  121.081 30.367  1.00 10.80 ? 289 THR A O    1 
ATOM   4165  C  CB   . THR A  1 289 ? 87.711  121.313 27.427  1.00 17.04 ? 289 THR A CB   1 
ATOM   4166  O  OG1  . THR A  1 289 ? 88.566  121.637 26.319  1.00 18.16 ? 289 THR A OG1  1 
ATOM   4167  C  CG2  . THR A  1 289 ? 86.254  121.297 26.965  1.00 11.25 ? 289 THR A CG2  1 
ATOM   4168  H  H    . THR A  1 289 ? 89.612  121.431 29.013  1.00 12.34 ? 289 THR A H    1 
ATOM   4169  H  HA   . THR A  1 289 ? 87.802  123.240 28.187  1.00 12.38 ? 289 THR A HA   1 
ATOM   4170  H  HB   . THR A  1 289 ? 87.934  120.427 27.754  1.00 20.45 ? 289 THR A HB   1 
ATOM   4171  H  HG1  . THR A  1 289 ? 88.392  122.389 26.041  1.00 21.79 ? 289 THR A HG1  1 
ATOM   4172  H  HG21 . THR A  1 289 ? 86.139  120.651 26.266  1.00 13.49 ? 289 THR A HG21 1 
ATOM   4173  H  HG22 . THR A  1 289 ? 85.680  121.069 27.700  1.00 13.49 ? 289 THR A HG22 1 
ATOM   4174  H  HG23 . THR A  1 289 ? 86.006  122.164 26.634  1.00 13.49 ? 289 THR A HG23 1 
ATOM   4175  N  N    . VAL A  1 290 ? 85.959  123.023 29.791  1.00 10.30 ? 290 VAL A N    1 
ATOM   4176  C  CA   . VAL A  1 290 ? 84.929  122.928 30.814  1.00 12.25 ? 290 VAL A CA   1 
ATOM   4177  C  C    . VAL A  1 290 ? 83.612  122.419 30.241  1.00 10.66 ? 290 VAL A C    1 
ATOM   4178  O  O    . VAL A  1 290 ? 83.010  123.039 29.378  1.00 15.00 ? 290 VAL A O    1 
ATOM   4179  C  CB   . VAL A  1 290 ? 84.686  124.282 31.513  1.00 10.55 ? 290 VAL A CB   1 
ATOM   4180  C  CG1  . VAL A  1 290 ? 83.722  124.134 32.682  1.00 11.85 ? 290 VAL A CG1  1 
ATOM   4181  C  CG2  . VAL A  1 290 ? 85.997  124.861 32.002  1.00 14.29 ? 290 VAL A CG2  1 
ATOM   4182  H  H    . VAL A  1 290 ? 85.889  123.718 29.291  1.00 12.36 ? 290 VAL A H    1 
ATOM   4183  H  HA   . VAL A  1 290 ? 85.223  122.289 31.497  1.00 14.70 ? 290 VAL A HA   1 
ATOM   4184  H  HB   . VAL A  1 290 ? 84.294  124.910 30.871  1.00 12.66 ? 290 VAL A HB   1 
ATOM   4185  H  HG11 . VAL A  1 290 ? 83.595  124.993 33.092  1.00 14.22 ? 290 VAL A HG11 1 
ATOM   4186  H  HG12 . VAL A  1 290 ? 82.884  123.799 32.355  1.00 14.22 ? 290 VAL A HG12 1 
ATOM   4187  H  HG13 . VAL A  1 290 ? 84.095  123.519 33.318  1.00 14.22 ? 290 VAL A HG13 1 
ATOM   4188  H  HG21 . VAL A  1 290 ? 85.825  125.702 32.433  1.00 17.15 ? 290 VAL A HG21 1 
ATOM   4189  H  HG22 . VAL A  1 290 ? 86.396  124.249 32.625  1.00 17.15 ? 290 VAL A HG22 1 
ATOM   4190  H  HG23 . VAL A  1 290 ? 86.580  124.991 31.251  1.00 17.15 ? 290 VAL A HG23 1 
ATOM   4191  N  N    . ASN A  1 291 ? 83.170  121.265 30.750  1.00 10.96 ? 291 ASN A N    1 
ATOM   4192  C  CA   . ASN A  1 291 ? 81.980  120.608 30.244  1.00 10.01 ? 291 ASN A CA   1 
ATOM   4193  C  C    . ASN A  1 291 ? 80.861  120.678 31.248  1.00 16.02 ? 291 ASN A C    1 
ATOM   4194  O  O    . ASN A  1 291 ? 81.031  120.249 32.399  1.00 17.48 ? 291 ASN A O    1 
ATOM   4195  C  CB   . ASN A  1 291 ? 82.273  119.121 29.951  1.00 9.58  ? 291 ASN A CB   1 
ATOM   4196  C  CG   . ASN A  1 291 ? 83.437  118.933 29.006  1.00 11.41 ? 291 ASN A CG   1 
ATOM   4197  O  OD1  . ASN A  1 291 ? 83.420  119.439 27.894  1.00 11.85 ? 291 ASN A OD1  1 
ATOM   4198  N  ND2  . ASN A  1 291 ? 84.484  118.257 29.470  1.00 9.68  ? 291 ASN A ND2  1 
ATOM   4199  H  H    . ASN A  1 291 ? 83.553  120.844 31.395  1.00 13.16 ? 291 ASN A H    1 
ATOM   4200  H  HA   . ASN A  1 291 ? 81.688  121.042 29.415  1.00 12.01 ? 291 ASN A HA   1 
ATOM   4201  H  HB2  . ASN A  1 291 ? 82.486  118.671 30.783  1.00 11.49 ? 291 ASN A HB2  1 
ATOM   4202  H  HB3  . ASN A  1 291 ? 81.489  118.718 29.546  1.00 11.49 ? 291 ASN A HB3  1 
ATOM   4203  H  HD21 . ASN A  1 291 ? 84.477  117.951 30.274  1.00 11.62 ? 291 ASN A HD21 1 
ATOM   4204  H  HD22 . ASN A  1 291 ? 85.169  118.126 28.966  1.00 11.62 ? 291 ASN A HD22 1 
ATOM   4205  N  N    . ASP A  1 292 ? 79.721  121.219 30.831  1.00 12.56 ? 292 ASP A N    1 
ATOM   4206  C  CA   . ASP A  1 292 ? 78.497  121.040 31.596  1.00 18.09 ? 292 ASP A CA   1 
ATOM   4207  C  C    . ASP A  1 292 ? 78.082  119.566 31.533  1.00 18.26 ? 292 ASP A C    1 
ATOM   4208  O  O    . ASP A  1 292 ? 78.302  118.892 30.526  1.00 12.84 ? 292 ASP A O    1 
ATOM   4209  C  CB   . ASP A  1 292 ? 77.380  121.916 31.058  1.00 19.45 ? 292 ASP A CB   1 
ATOM   4210  C  CG   . ASP A  1 292 ? 77.686  123.374 31.201  1.00 28.78 ? 292 ASP A CG   1 
ATOM   4211  O  OD1  . ASP A  1 292 ? 78.338  123.727 32.195  1.00 18.78 ? 292 ASP A OD1  1 
ATOM   4212  O  OD2  . ASP A  1 292 ? 77.301  124.158 30.307  1.00 34.89 ? 292 ASP A OD2  1 
ATOM   4213  H  H    . ASP A  1 292 ? 79.631  121.689 30.116  1.00 15.07 ? 292 ASP A H    1 
ATOM   4214  H  HA   . ASP A  1 292 ? 78.658  121.279 32.532  1.00 21.71 ? 292 ASP A HA   1 
ATOM   4215  H  HB2  . ASP A  1 292 ? 77.252  121.726 30.116  1.00 23.34 ? 292 ASP A HB2  1 
ATOM   4216  H  HB3  . ASP A  1 292 ? 76.565  121.729 31.550  1.00 23.34 ? 292 ASP A HB3  1 
ATOM   4217  N  N    . VAL A  1 293 ? 77.489  119.071 32.615  1.00 12.05 ? 293 VAL A N    1 
ATOM   4218  C  CA   . VAL A  1 293 ? 77.021  117.706 32.613  1.00 11.38 ? 293 VAL A CA   1 
ATOM   4219  C  C    . VAL A  1 293 ? 75.493  117.628 32.744  1.00 9.90  ? 293 VAL A C    1 
ATOM   4220  O  O    . VAL A  1 293 ? 74.815  118.585 33.131  1.00 10.56 ? 293 VAL A O    1 
ATOM   4221  C  CB   . VAL A  1 293 ? 77.661  116.854 33.752  1.00 14.77 ? 293 VAL A CB   1 
ATOM   4222  C  CG1  . VAL A  1 293 ? 79.188  117.051 33.845  1.00 12.69 ? 293 VAL A CG1  1 
ATOM   4223  C  CG2  . VAL A  1 293 ? 77.013  117.145 35.068  1.00 13.44 ? 293 VAL A CG2  1 
ATOM   4224  H  H    . VAL A  1 293 ? 77.352  119.501 33.346  1.00 14.45 ? 293 VAL A H    1 
ATOM   4225  H  HA   . VAL A  1 293 ? 77.267  117.293 31.759  1.00 13.66 ? 293 VAL A HA   1 
ATOM   4226  H  HB   . VAL A  1 293 ? 77.502  115.908 33.553  1.00 17.72 ? 293 VAL A HB   1 
ATOM   4227  H  HG11 . VAL A  1 293 ? 79.530  116.507 34.559  1.00 15.23 ? 293 VAL A HG11 1 
ATOM   4228  H  HG12 . VAL A  1 293 ? 79.588  116.789 33.013  1.00 15.23 ? 293 VAL A HG12 1 
ATOM   4229  H  HG13 . VAL A  1 293 ? 79.374  117.976 34.021  1.00 15.23 ? 293 VAL A HG13 1 
ATOM   4230  H  HG21 . VAL A  1 293 ? 77.428  116.606 35.745  1.00 16.13 ? 293 VAL A HG21 1 
ATOM   4231  H  HG22 . VAL A  1 293 ? 77.127  118.076 35.273  1.00 16.13 ? 293 VAL A HG22 1 
ATOM   4232  H  HG23 . VAL A  1 293 ? 76.079  116.934 35.009  1.00 16.13 ? 293 VAL A HG23 1 
ATOM   4233  N  N    . ASP A  1 294 ? 74.975  116.448 32.443  1.00 9.46  ? 294 ASP A N    1 
ATOM   4234  C  CA   . ASP A  1 294 ? 73.593  116.105 32.737  1.00 14.65 ? 294 ASP A CA   1 
ATOM   4235  C  C    . ASP A  1 294 ? 73.450  115.889 34.256  1.00 14.59 ? 294 ASP A C    1 
ATOM   4236  O  O    . ASP A  1 294 ? 73.646  114.782 34.774  1.00 13.74 ? 294 ASP A O    1 
ATOM   4237  C  CB   . ASP A  1 294 ? 73.235  114.823 31.979  1.00 14.96 ? 294 ASP A CB   1 
ATOM   4238  C  CG   . ASP A  1 294 ? 71.746  114.517 31.995  1.00 16.99 ? 294 ASP A CG   1 
ATOM   4239  O  OD1  . ASP A  1 294 ? 71.028  114.962 32.907  1.00 15.40 ? 294 ASP A OD1  1 
ATOM   4240  O  OD2  . ASP A  1 294 ? 71.285  113.836 31.060  1.00 16.84 ? 294 ASP A OD2  1 
ATOM   4241  H  H    . ASP A  1 294 ? 75.413  115.815 32.060  1.00 11.36 ? 294 ASP A H    1 
ATOM   4242  H  HA   . ASP A  1 294 ? 72.994  116.827 32.454  1.00 17.58 ? 294 ASP A HA   1 
ATOM   4243  H  HB2  . ASP A  1 294 ? 73.512  114.916 31.054  1.00 17.95 ? 294 ASP A HB2  1 
ATOM   4244  H  HB3  . ASP A  1 294 ? 73.698  114.075 32.389  1.00 17.95 ? 294 ASP A HB3  1 
ATOM   4245  N  N    . LEU A  1 295 ? 73.141  116.954 34.982  1.00 13.03 ? 295 LEU A N    1 
ATOM   4246  C  CA   . LEU A  1 295 ? 73.078  116.853 36.423  1.00 9.07  ? 295 LEU A CA   1 
ATOM   4247  C  C    . LEU A  1 295 ? 71.944  115.961 36.910  1.00 11.40 ? 295 LEU A C    1 
ATOM   4248  O  O    . LEU A  1 295 ? 72.120  115.217 37.864  1.00 10.91 ? 295 LEU A O    1 
ATOM   4249  C  CB   . LEU A  1 295 ? 72.980  118.248 37.048  1.00 13.16 ? 295 LEU A CB   1 
ATOM   4250  C  CG   . LEU A  1 295 ? 74.308  119.009 37.012  1.00 13.14 ? 295 LEU A CG   1 
ATOM   4251  C  CD1  . LEU A  1 295 ? 74.122  120.497 37.337  1.00 15.50 ? 295 LEU A CD1  1 
ATOM   4252  C  CD2  . LEU A  1 295 ? 75.305  118.368 37.961  1.00 15.27 ? 295 LEU A CD2  1 
ATOM   4253  H  H    . LEU A  1 295 ? 72.966  117.734 34.666  1.00 15.64 ? 295 LEU A H    1 
ATOM   4254  H  HA   . LEU A  1 295 ? 73.916  116.453 36.737  1.00 10.89 ? 295 LEU A HA   1 
ATOM   4255  H  HB2  . LEU A  1 295 ? 72.323  118.768 36.560  1.00 15.79 ? 295 LEU A HB2  1 
ATOM   4256  H  HB3  . LEU A  1 295 ? 72.711  118.160 37.976  1.00 15.79 ? 295 LEU A HB3  1 
ATOM   4257  H  HG   . LEU A  1 295 ? 74.675  118.948 36.116  1.00 15.77 ? 295 LEU A HG   1 
ATOM   4258  H  HD11 . LEU A  1 295 ? 74.977  120.933 37.303  1.00 18.60 ? 295 LEU A HD11 1 
ATOM   4259  H  HD12 . LEU A  1 295 ? 73.529  120.887 36.690  1.00 18.60 ? 295 LEU A HD12 1 
ATOM   4260  H  HD13 . LEU A  1 295 ? 73.747  120.580 38.217  1.00 18.60 ? 295 LEU A HD13 1 
ATOM   4261  H  HD21 . LEU A  1 295 ? 76.129  118.858 37.925  1.00 18.32 ? 295 LEU A HD21 1 
ATOM   4262  H  HD22 . LEU A  1 295 ? 74.948  118.393 38.852  1.00 18.32 ? 295 LEU A HD22 1 
ATOM   4263  H  HD23 . LEU A  1 295 ? 75.451  117.459 37.692  1.00 18.32 ? 295 LEU A HD23 1 
ATOM   4264  N  N    . PRO A  1 296 ? 70.770  116.044 36.274  1.00 9.47  ? 296 PRO A N    1 
ATOM   4265  C  CA   . PRO A  1 296 ? 69.739  115.118 36.726  1.00 9.62  ? 296 PRO A CA   1 
ATOM   4266  C  C    . PRO A  1 296 ? 70.167  113.657 36.594  1.00 10.57 ? 296 PRO A C    1 
ATOM   4267  O  O    . PRO A  1 296 ? 69.851  112.855 37.470  1.00 9.58  ? 296 PRO A O    1 
ATOM   4268  C  CB   . PRO A  1 296 ? 68.554  115.437 35.810  1.00 9.98  ? 296 PRO A CB   1 
ATOM   4269  C  CG   . PRO A  1 296 ? 68.766  116.838 35.376  1.00 12.07 ? 296 PRO A CG   1 
ATOM   4270  C  CD   . PRO A  1 296 ? 70.248  117.057 35.342  1.00 9.71  ? 296 PRO A CD   1 
ATOM   4271  H  HA   . PRO A  1 296 ? 69.493  115.305 37.656  1.00 11.54 ? 296 PRO A HA   1 
ATOM   4272  H  HB2  . PRO A  1 296 ? 68.560  114.837 35.047  1.00 11.98 ? 296 PRO A HB2  1 
ATOM   4273  H  HB3  . PRO A  1 296 ? 67.725  115.353 36.306  1.00 11.98 ? 296 PRO A HB3  1 
ATOM   4274  H  HG2  . PRO A  1 296 ? 68.385  116.964 34.493  1.00 14.49 ? 296 PRO A HG2  1 
ATOM   4275  H  HG3  . PRO A  1 296 ? 68.349  117.440 36.013  1.00 14.49 ? 296 PRO A HG3  1 
ATOM   4276  H  HD2  . PRO A  1 296 ? 70.592  116.903 34.449  1.00 11.65 ? 296 PRO A HD2  1 
ATOM   4277  H  HD3  . PRO A  1 296 ? 70.465  117.949 35.657  1.00 11.65 ? 296 PRO A HD3  1 
ATOM   4278  N  N    . ALA A  1 297 ? 70.872  113.306 35.526  1.00 14.09 ? 297 ALA A N    1 
ATOM   4279  C  CA   . ALA A  1 297 ? 71.356  111.939 35.380  1.00 10.10 ? 297 ALA A CA   1 
ATOM   4280  C  C    . ALA A  1 297 ? 72.423  111.598 36.431  1.00 9.35  ? 297 ALA A C    1 
ATOM   4281  O  O    . ALA A  1 297 ? 72.469  110.465 36.961  1.00 10.01 ? 297 ALA A O    1 
ATOM   4282  C  CB   . ALA A  1 297 ? 71.898  111.709 33.936  1.00 10.48 ? 297 ALA A CB   1 
ATOM   4283  H  H    . ALA A  1 297 ? 71.082  113.832 34.879  1.00 16.91 ? 297 ALA A H    1 
ATOM   4284  H  HA   . ALA A  1 297 ? 70.604  111.326 35.515  1.00 12.12 ? 297 ALA A HA   1 
ATOM   4285  H  HB1  . ALA A  1 297 ? 72.211  110.805 33.860  1.00 12.57 ? 297 ALA A HB1  1 
ATOM   4286  H  HB2  . ALA A  1 297 ? 71.187  111.863 33.308  1.00 12.57 ? 297 ALA A HB2  1 
ATOM   4287  H  HB3  . ALA A  1 297 ? 72.619  112.321 33.771  1.00 12.57 ? 297 ALA A HB3  1 
ATOM   4288  N  N    . PHE A  1 298 ? 73.285  112.560 36.770  1.00 9.56  ? 298 PHE A N    1 
ATOM   4289  C  CA   . PHE A  1 298 ? 74.279  112.284 37.810  1.00 10.74 ? 298 PHE A CA   1 
ATOM   4290  C  C    . PHE A  1 298 ? 73.637  112.153 39.190  1.00 9.65  ? 298 PHE A C    1 
ATOM   4291  O  O    . PHE A  1 298 ? 73.939  111.210 39.946  1.00 11.83 ? 298 PHE A O    1 
ATOM   4292  C  CB   . PHE A  1 298 ? 75.462  113.256 37.780  1.00 12.25 ? 298 PHE A CB   1 
ATOM   4293  C  CG   . PHE A  1 298 ? 76.547  112.836 36.802  1.00 8.94  ? 298 PHE A CG   1 
ATOM   4294  C  CD1  . PHE A  1 298 ? 77.389  111.777 37.099  1.00 10.07 ? 298 PHE A CD1  1 
ATOM   4295  C  CD2  . PHE A  1 298 ? 76.722  113.496 35.607  1.00 15.65 ? 298 PHE A CD2  1 
ATOM   4296  C  CE1  . PHE A  1 298 ? 78.376  111.379 36.220  1.00 15.06 ? 298 PHE A CE1  1 
ATOM   4297  C  CE2  . PHE A  1 298 ? 77.705  113.094 34.732  1.00 11.48 ? 298 PHE A CE2  1 
ATOM   4298  C  CZ   . PHE A  1 298 ? 78.526  112.045 35.036  1.00 8.83  ? 298 PHE A CZ   1 
ATOM   4299  H  H    . PHE A  1 298 ? 73.317  113.348 36.429  1.00 11.48 ? 298 PHE A H    1 
ATOM   4300  H  HA   . PHE A  1 298 ? 74.658  111.402 37.610  1.00 12.89 ? 298 PHE A HA   1 
ATOM   4301  H  HB2  . PHE A  1 298 ? 75.143  114.133 37.515  1.00 14.71 ? 298 PHE A HB2  1 
ATOM   4302  H  HB3  . PHE A  1 298 ? 75.857  113.300 38.665  1.00 14.71 ? 298 PHE A HB3  1 
ATOM   4303  H  HD1  . PHE A  1 298 ? 77.283  111.322 37.902  1.00 12.09 ? 298 PHE A HD1  1 
ATOM   4304  H  HD2  . PHE A  1 298 ? 76.167  114.209 35.385  1.00 18.77 ? 298 PHE A HD2  1 
ATOM   4305  H  HE1  . PHE A  1 298 ? 78.933  110.665 36.432  1.00 18.08 ? 298 PHE A HE1  1 
ATOM   4306  H  HE2  . PHE A  1 298 ? 77.815  113.545 33.926  1.00 13.78 ? 298 PHE A HE2  1 
ATOM   4307  H  HZ   . PHE A  1 298 ? 79.191  111.787 34.438  1.00 10.60 ? 298 PHE A HZ   1 
ATOM   4308  N  N    . GLU A  1 299 ? 72.688  113.031 39.512  1.00 8.87  ? 299 GLU A N    1 
ATOM   4309  C  CA   . GLU A  1 299 ? 71.969  112.858 40.771  1.00 11.53 ? 299 GLU A CA   1 
ATOM   4310  C  C    . GLU A  1 299 ? 71.220  111.513 40.832  1.00 11.08 ? 299 GLU A C    1 
ATOM   4311  O  O    . GLU A  1 299 ? 71.204  110.827 41.864  1.00 10.98 ? 299 GLU A O    1 
ATOM   4312  C  CB   . GLU A  1 299 ? 71.006  114.037 40.941  1.00 9.03  ? 299 GLU A CB   1 
ATOM   4313  C  CG   . GLU A  1 299 ? 70.293  114.086 42.255  1.00 22.68 ? 299 GLU A CG   1 
ATOM   4314  C  CD   . GLU A  1 299 ? 69.233  115.178 42.253  1.00 36.86 ? 299 GLU A CD   1 
ATOM   4315  O  OE1  . GLU A  1 299 ? 68.647  115.426 41.170  1.00 32.63 ? 299 GLU A OE1  1 
ATOM   4316  O  OE2  . GLU A  1 299 ? 68.994  115.774 43.324  1.00 38.57 ? 299 GLU A OE2  1 
ATOM   4317  H  H    . GLU A  1 299 ? 72.449  113.708 39.039  1.00 10.64 ? 299 GLU A H    1 
ATOM   4318  H  HA   . GLU A  1 299 ? 72.611  112.882 41.511  1.00 13.83 ? 299 GLU A HA   1 
ATOM   4319  H  HB2  . GLU A  1 299 ? 71.509  114.862 40.850  1.00 10.83 ? 299 GLU A HB2  1 
ATOM   4320  H  HB3  . GLU A  1 299 ? 70.333  113.988 40.244  1.00 10.83 ? 299 GLU A HB3  1 
ATOM   4321  H  HG2  . GLU A  1 299 ? 69.856  113.236 42.417  1.00 27.21 ? 299 GLU A HG2  1 
ATOM   4322  H  HG3  . GLU A  1 299 ? 70.930  114.279 42.960  1.00 27.21 ? 299 GLU A HG3  1 
ATOM   4323  N  N    . ALA A  1 300 ? 70.564  111.135 39.739  1.00 10.50 ? 300 ALA A N    1 
ATOM   4324  C  CA   . ALA A  1 300 ? 69.833  109.874 39.704  1.00 10.21 ? 300 ALA A CA   1 
ATOM   4325  C  C    . ALA A  1 300 ? 70.750  108.688 39.933  1.00 12.18 ? 300 ALA A C    1 
ATOM   4326  O  O    . ALA A  1 300 ? 70.328  107.670 40.478  1.00 13.82 ? 300 ALA A O    1 
ATOM   4327  C  CB   . ALA A  1 300 ? 69.113  109.690 38.382  1.00 11.95 ? 300 ALA A CB   1 
ATOM   4328  H  H    . ALA A  1 300 ? 70.527  111.588 39.009  1.00 12.59 ? 300 ALA A H    1 
ATOM   4329  H  HA   . ALA A  1 300 ? 69.161  109.877 40.417  1.00 12.26 ? 300 ALA A HA   1 
ATOM   4330  H  HB1  . ALA A  1 300 ? 68.644  108.852 38.396  1.00 14.34 ? 300 ALA A HB1  1 
ATOM   4331  H  HB2  . ALA A  1 300 ? 68.490  110.411 38.263  1.00 14.34 ? 300 ALA A HB2  1 
ATOM   4332  H  HB3  . ALA A  1 300 ? 69.758  109.693 37.672  1.00 14.34 ? 300 ALA A HB3  1 
ATOM   4333  N  N    . SER A  1 301 ? 72.001  108.803 39.488  1.00 9.35  ? 301 SER A N    1 
ATOM   4334  C  CA   . SER A  1 301 ? 72.890  107.659 39.490  1.00 11.54 ? 301 SER A CA   1 
ATOM   4335  C  C    . SER A  1 301 ? 73.286  107.266 40.914  1.00 10.76 ? 301 SER A C    1 
ATOM   4336  O  O    . SER A  1 301 ? 73.726  106.145 41.154  1.00 12.15 ? 301 SER A O    1 
ATOM   4337  C  CB   . SER A  1 301 ? 74.123  107.949 38.625  1.00 9.24  ? 301 SER A CB   1 
ATOM   4338  O  OG   . SER A  1 301 ? 75.031  108.783 39.302  1.00 10.03 ? 301 SER A OG   1 
ATOM   4339  H  H    . SER A  1 301 ? 72.350  109.527 39.184  1.00 11.22 ? 301 SER A H    1 
ATOM   4340  H  HA   . SER A  1 301 ? 72.420  106.897 39.092  1.00 13.84 ? 301 SER A HA   1 
ATOM   4341  H  HB2  . SER A  1 301 ? 74.562  107.111 38.413  1.00 11.09 ? 301 SER A HB2  1 
ATOM   4342  H  HB3  . SER A  1 301 ? 73.838  108.390 37.809  1.00 11.09 ? 301 SER A HB3  1 
ATOM   4343  H  HG   . SER A  1 301 ? 74.741  108.970 40.046  1.00 12.04 ? 301 SER A HG   1 
ATOM   4344  N  N    . VAL A  1 302 ? 73.095  108.183 41.861  1.00 10.01 ? 302 VAL A N    1 
ATOM   4345  C  CA   . VAL A  1 302 ? 73.449  107.899 43.242  1.00 9.02  ? 302 VAL A CA   1 
ATOM   4346  C  C    . VAL A  1 302 ? 72.264  107.594 44.157  1.00 9.23  ? 302 VAL A C    1 
ATOM   4347  O  O    . VAL A  1 302 ? 72.466  107.401 45.352  1.00 12.45 ? 302 VAL A O    1 
ATOM   4348  C  CB   . VAL A  1 302 ? 74.282  109.056 43.882  1.00 16.03 ? 302 VAL A CB   1 
ATOM   4349  C  CG1  . VAL A  1 302 ? 75.565  109.290 43.112  1.00 14.63 ? 302 VAL A CG1  1 
ATOM   4350  C  CG2  . VAL A  1 302 ? 73.465  110.306 43.967  1.00 13.22 ? 302 VAL A CG2  1 
ATOM   4351  H  H    . VAL A  1 302 ? 72.766  108.966 41.729  1.00 12.01 ? 302 VAL A H    1 
ATOM   4352  H  HA   . VAL A  1 302 ? 74.020  107.103 43.245  1.00 10.82 ? 302 VAL A HA   1 
ATOM   4353  H  HB   . VAL A  1 302 ? 74.526  108.799 44.795  1.00 19.24 ? 302 VAL A HB   1 
ATOM   4354  H  HG11 . VAL A  1 302 ? 76.053  110.004 43.527  1.00 17.55 ? 302 VAL A HG11 1 
ATOM   4355  H  HG12 . VAL A  1 302 ? 76.087  108.484 43.125  1.00 17.55 ? 302 VAL A HG12 1 
ATOM   4356  H  HG13 . VAL A  1 302 ? 75.347  109.525 42.207  1.00 17.55 ? 302 VAL A HG13 1 
ATOM   4357  H  HG21 . VAL A  1 302 ? 73.997  111.001 44.362  1.00 15.87 ? 302 VAL A HG21 1 
ATOM   4358  H  HG22 . VAL A  1 302 ? 73.196  110.564 43.082  1.00 15.87 ? 302 VAL A HG22 1 
ATOM   4359  H  HG23 . VAL A  1 302 ? 72.691  110.137 44.509  1.00 15.87 ? 302 VAL A HG23 1 
ATOM   4360  N  N    . ALA A  1 303 ? 71.060  107.504 43.601  1.00 9.45  ? 303 ALA A N    1 
ATOM   4361  C  CA   . ALA A  1 303 ? 69.853  107.310 44.395  1.00 9.70  ? 303 ALA A CA   1 
ATOM   4362  C  C    . ALA A  1 303 ? 69.886  106.021 45.210  1.00 12.65 ? 303 ALA A C    1 
ATOM   4363  O  O    . ALA A  1 303 ? 69.478  106.015 46.363  1.00 12.75 ? 303 ALA A O    1 
ATOM   4364  C  CB   . ALA A  1 303 ? 68.627  107.350 43.523  1.00 9.96  ? 303 ALA A CB   1 
ATOM   4365  H  H    . ALA A  1 303 ? 70.915  107.554 42.755  1.00 11.34 ? 303 ALA A H    1 
ATOM   4366  H  HA   . ALA A  1 303 ? 69.782  108.053 45.030  1.00 11.64 ? 303 ALA A HA   1 
ATOM   4367  H  HB1  . ALA A  1 303 ? 67.850  107.219 44.071  1.00 11.95 ? 303 ALA A HB1  1 
ATOM   4368  H  HB2  . ALA A  1 303 ? 68.581  108.204 43.087  1.00 11.95 ? 303 ALA A HB2  1 
ATOM   4369  H  HB3  . ALA A  1 303 ? 68.687  106.650 42.868  1.00 11.95 ? 303 ALA A HB3  1 
ATOM   4370  N  N    . ASP A  1 304 ? 70.376  104.933 44.618  1.00 15.08 ? 304 ASP A N    1 
ATOM   4371  C  CA   . ASP A  1 304 ? 70.478  103.669 45.347  1.00 15.71 ? 304 ASP A CA   1 
ATOM   4372  C  C    . ASP A  1 304 ? 71.560  103.704 46.404  1.00 18.27 ? 304 ASP A C    1 
ATOM   4373  O  O    . ASP A  1 304 ? 71.332  103.291 47.538  1.00 13.66 ? 304 ASP A O    1 
ATOM   4374  C  CB   . ASP A  1 304 ? 70.786  102.514 44.379  1.00 16.38 ? 304 ASP A CB   1 
ATOM   4375  C  CG   . ASP A  1 304 ? 69.620  102.191 43.491  1.00 24.29 ? 304 ASP A CG   1 
ATOM   4376  O  OD1  . ASP A  1 304 ? 68.505  102.612 43.863  1.00 27.53 ? 304 ASP A OD1  1 
ATOM   4377  O  OD2  . ASP A  1 304 ? 69.808  101.505 42.449  1.00 29.11 ? 304 ASP A OD2  1 
ATOM   4378  H  H    . ASP A  1 304 ? 70.654  104.900 43.805  1.00 18.09 ? 304 ASP A H    1 
ATOM   4379  H  HA   . ASP A  1 304 ? 69.623  103.481 45.788  1.00 18.86 ? 304 ASP A HA   1 
ATOM   4380  H  HB2  . ASP A  1 304 ? 71.535  102.763 43.815  1.00 19.65 ? 304 ASP A HB2  1 
ATOM   4381  H  HB3  . ASP A  1 304 ? 71.003  101.720 44.892  1.00 19.65 ? 304 ASP A HB3  1 
ATOM   4382  N  N    . VAL A  1 305 ? 72.739  104.183 46.030  1.00 10.29 ? 305 VAL A N    1 
ATOM   4383  C  CA   . VAL A  1 305 ? 73.879  104.116 46.926  1.00 13.02 ? 305 VAL A CA   1 
ATOM   4384  C  C    . VAL A  1 305 ? 73.657  104.937 48.206  1.00 14.66 ? 305 VAL A C    1 
ATOM   4385  O  O    . VAL A  1 305 ? 73.999  104.484 49.301  1.00 11.41 ? 305 VAL A O    1 
ATOM   4386  C  CB   . VAL A  1 305 ? 75.201  104.501 46.239  1.00 10.69 ? 305 VAL A CB   1 
ATOM   4387  C  CG1  . VAL A  1 305 ? 75.309  106.010 45.972  1.00 12.41 ? 305 VAL A CG1  1 
ATOM   4388  C  CG2  . VAL A  1 305 ? 76.352  104.016 47.069  1.00 11.66 ? 305 VAL A CG2  1 
ATOM   4389  H  H    . VAL A  1 305 ? 72.903  104.548 45.268  1.00 12.35 ? 305 VAL A H    1 
ATOM   4390  H  HA   . VAL A  1 305 ? 73.975  103.183 47.209  1.00 15.62 ? 305 VAL A HA   1 
ATOM   4391  H  HB   . VAL A  1 305 ? 75.247  104.044 45.374  1.00 12.83 ? 305 VAL A HB   1 
ATOM   4392  H  HG11 . VAL A  1 305 ? 76.149  106.191 45.544  1.00 14.89 ? 305 VAL A HG11 1 
ATOM   4393  H  HG12 . VAL A  1 305 ? 74.586  106.278 45.401  1.00 14.89 ? 305 VAL A HG12 1 
ATOM   4394  H  HG13 . VAL A  1 305 ? 75.258  106.479 46.808  1.00 14.89 ? 305 VAL A HG13 1 
ATOM   4395  H  HG21 . VAL A  1 305 ? 77.173  104.259 46.636  1.00 13.99 ? 305 VAL A HG21 1 
ATOM   4396  H  HG22 . VAL A  1 305 ? 76.305  104.425 47.937  1.00 13.99 ? 305 VAL A HG22 1 
ATOM   4397  H  HG23 . VAL A  1 305 ? 76.295  103.061 47.153  1.00 13.99 ? 305 VAL A HG23 1 
ATOM   4398  N  N    . ILE A  1 306 ? 73.061  106.117 48.093  1.00 9.66  ? 306 ILE A N    1 
ATOM   4399  C  CA   . ILE A  1 306 ? 72.792  106.896 49.308  1.00 11.87 ? 306 ILE A CA   1 
ATOM   4400  C  C    . ILE A  1 306 ? 71.776  106.245 50.277  1.00 16.14 ? 306 ILE A C    1 
ATOM   4401  O  O    . ILE A  1 306 ? 71.805  106.505 51.485  1.00 13.06 ? 306 ILE A O    1 
ATOM   4402  C  CB   . ILE A  1 306 ? 72.373  108.327 48.935  1.00 13.45 ? 306 ILE A CB   1 
ATOM   4403  C  CG1  . ILE A  1 306 ? 71.014  108.313 48.232  1.00 15.70 ? 306 ILE A CG1  1 
ATOM   4404  C  CG2  . ILE A  1 306 ? 73.444  108.940 48.034  1.00 11.27 ? 306 ILE A CG2  1 
ATOM   4405  C  CD1  . ILE A  1 306 ? 70.622  109.642 47.640  1.00 22.48 ? 306 ILE A CD1  1 
ATOM   4406  H  H    . ILE A  1 306 ? 72.808  106.482 47.357  1.00 11.59 ? 306 ILE A H    1 
ATOM   4407  H  HA   . ILE A  1 306 ? 73.636  106.972 49.801  1.00 14.24 ? 306 ILE A HA   1 
ATOM   4408  H  HB   . ILE A  1 306 ? 72.303  108.855 49.745  1.00 16.14 ? 306 ILE A HB   1 
ATOM   4409  H  HG12 . ILE A  1 306 ? 71.041  107.664 47.512  1.00 18.83 ? 306 ILE A HG12 1 
ATOM   4410  H  HG13 . ILE A  1 306 ? 70.332  108.062 48.875  1.00 18.83 ? 306 ILE A HG13 1 
ATOM   4411  H  HG21 . ILE A  1 306 ? 73.182  109.834 47.801  1.00 13.52 ? 306 ILE A HG21 1 
ATOM   4412  H  HG22 . ILE A  1 306 ? 74.279  108.957 48.508  1.00 13.52 ? 306 ILE A HG22 1 
ATOM   4413  H  HG23 . ILE A  1 306 ? 73.528  108.406 47.240  1.00 13.52 ? 306 ILE A HG23 1 
ATOM   4414  H  HD11 . ILE A  1 306 ? 69.764  109.555 47.219  1.00 26.97 ? 306 ILE A HD11 1 
ATOM   4415  H  HD12 . ILE A  1 306 ? 70.578  110.295 48.342  1.00 26.97 ? 306 ILE A HD12 1 
ATOM   4416  H  HD13 . ILE A  1 306 ? 71.281  109.901 46.992  1.00 26.97 ? 306 ILE A HD13 1 
ATOM   4417  N  N    . SER A  1 307 ? 70.904  105.387 49.753  1.00 11.20 ? 307 SER A N    1 
ATOM   4418  C  CA   . SER A  1 307 ? 69.835  104.771 50.529  1.00 14.87 ? 307 SER A CA   1 
ATOM   4419  C  C    . SER A  1 307 ? 70.280  103.477 51.209  1.00 16.63 ? 307 SER A C    1 
ATOM   4420  O  O    . SER A  1 307 ? 70.024  103.286 52.411  1.00 15.13 ? 307 SER A O    1 
ATOM   4421  C  CB   . SER A  1 307 ? 68.633  104.455 49.633  1.00 26.86 ? 307 SER A CB   1 
ATOM   4422  O  OG   . SER A  1 307 ? 67.873  105.614 49.355  1.00 34.42 ? 307 SER A OG   1 
ATOM   4423  H  H    . SER A  1 307 ? 70.912  105.142 48.928  1.00 13.44 ? 307 SER A H    1 
ATOM   4424  H  HA   . SER A  1 307 ? 69.541  105.396 51.225  1.00 17.85 ? 307 SER A HA   1 
ATOM   4425  H  HB2  . SER A  1 307 ? 68.955  104.083 48.797  1.00 32.23 ? 307 SER A HB2  1 
ATOM   4426  H  HB3  . SER A  1 307 ? 68.067  103.809 50.084  1.00 32.23 ? 307 SER A HB3  1 
ATOM   4427  H  HG   . SER A  1 307 ? 68.208  106.265 49.725  1.00 41.31 ? 307 SER A HG   1 
ATOM   4428  N  N    . THR A  1 308 ? 70.886  102.573 50.432  1.00 14.20 ? 308 THR A N    1 
ATOM   4429  C  CA   . THR A  1 308 ? 71.221  101.228 50.919  1.00 15.08 ? 308 THR A CA   1 
ATOM   4430  C  C    . THR A  1 308 ? 72.661  100.788 50.616  1.00 12.82 ? 308 THR A C    1 
ATOM   4431  O  O    . THR A  1 308 ? 73.068  99.658  50.942  1.00 14.85 ? 308 THR A O    1 
ATOM   4432  C  CB   . THR A  1 308 ? 70.243  100.194 50.347  1.00 21.62 ? 308 THR A CB   1 
ATOM   4433  O  OG1  . THR A  1 308 ? 70.321  100.197 48.910  1.00 27.09 ? 308 THR A OG1  1 
ATOM   4434  C  CG2  . THR A  1 308 ? 68.814  100.515 50.784  1.00 22.37 ? 308 THR A CG2  1 
ATOM   4435  H  H    . THR A  1 308 ? 71.115  102.715 49.616  1.00 17.04 ? 308 THR A H    1 
ATOM   4436  H  HA   . THR A  1 308 ? 71.115  101.220 51.893  1.00 18.09 ? 308 THR A HA   1 
ATOM   4437  H  HB   . THR A  1 308 ? 70.475  99.313  50.680  1.00 25.95 ? 308 THR A HB   1 
ATOM   4438  H  HG1  . THR A  1 308 ? 71.082  100.008 48.670  1.00 32.51 ? 308 THR A HG1  1 
ATOM   4439  H  HG21 . THR A  1 308 ? 68.207  99.865  50.424  1.00 26.84 ? 308 THR A HG21 1 
ATOM   4440  H  HG22 . THR A  1 308 ? 68.753  100.501 51.742  1.00 26.84 ? 308 THR A HG22 1 
ATOM   4441  H  HG23 . THR A  1 308 ? 68.562  101.386 50.469  1.00 26.84 ? 308 THR A HG23 1 
ATOM   4442  N  N    . GLY A  1 309 ? 73.451  101.681 50.046  1.00 9.90  ? 309 GLY A N    1 
ATOM   4443  C  CA   . GLY A  1 309 ? 74.833  101.388 49.720  1.00 13.79 ? 309 GLY A CA   1 
ATOM   4444  C  C    . GLY A  1 309 ? 75.821  101.488 50.856  1.00 13.64 ? 309 GLY A C    1 
ATOM   4445  O  O    . GLY A  1 309 ? 76.984  101.102 50.703  1.00 10.32 ? 309 GLY A O    1 
ATOM   4446  H  H    . GLY A  1 309 ? 73.205  102.478 49.835  1.00 11.88 ? 309 GLY A H    1 
ATOM   4447  H  HA2  . GLY A  1 309 ? 74.883  100.487 49.364  1.00 16.55 ? 309 GLY A HA2  1 
ATOM   4448  H  HA3  . GLY A  1 309 ? 75.123  101.998 49.023  1.00 16.55 ? 309 GLY A HA3  1 
ATOM   4449  N  N    . PHE A  1 310 ? 75.384  102.032 51.994  1.00 9.78  ? 310 PHE A N    1 
ATOM   4450  C  CA   . PHE A  1 310 ? 76.232  102.128 53.178  1.00 9.38  ? 310 PHE A CA   1 
ATOM   4451  C  C    . PHE A  1 310 ? 75.493  101.438 54.311  1.00 9.64  ? 310 PHE A C    1 
ATOM   4452  O  O    . PHE A  1 310 ? 74.864  102.069 55.157  1.00 10.22 ? 310 PHE A O    1 
ATOM   4453  C  CB   . PHE A  1 310 ? 76.530  103.584 53.541  1.00 8.90  ? 310 PHE A CB   1 
ATOM   4454  C  CG   . PHE A  1 310 ? 77.235  104.351 52.436  1.00 12.23 ? 310 PHE A CG   1 
ATOM   4455  C  CD1  . PHE A  1 310 ? 78.608  104.228 52.247  1.00 15.06 ? 310 PHE A CD1  1 
ATOM   4456  C  CD2  . PHE A  1 310 ? 76.523  105.177 51.581  1.00 14.26 ? 310 PHE A CD2  1 
ATOM   4457  C  CE1  . PHE A  1 310 ? 79.252  104.932 51.215  1.00 14.31 ? 310 PHE A CE1  1 
ATOM   4458  C  CE2  . PHE A  1 310 ? 77.168  105.887 50.553  1.00 10.83 ? 310 PHE A CE2  1 
ATOM   4459  C  CZ   . PHE A  1 310 ? 78.521  105.759 50.378  1.00 10.68 ? 310 PHE A CZ   1 
ATOM   4460  H  H    . PHE A  1 310 ? 74.594  102.354 52.103  1.00 11.74 ? 310 PHE A H    1 
ATOM   4461  H  HA   . PHE A  1 310 ? 77.078  101.661 53.021  1.00 11.26 ? 310 PHE A HA   1 
ATOM   4462  H  HB2  . PHE A  1 310 ? 75.694  104.037 53.732  1.00 10.67 ? 310 PHE A HB2  1 
ATOM   4463  H  HB3  . PHE A  1 310 ? 77.101  103.601 54.326  1.00 10.67 ? 310 PHE A HB3  1 
ATOM   4464  H  HD1  . PHE A  1 310 ? 79.103  103.674 52.807  1.00 18.08 ? 310 PHE A HD1  1 
ATOM   4465  H  HD2  . PHE A  1 310 ? 75.605  105.269 51.695  1.00 17.11 ? 310 PHE A HD2  1 
ATOM   4466  H  HE1  . PHE A  1 310 ? 80.171  104.848 51.098  1.00 17.18 ? 310 PHE A HE1  1 
ATOM   4467  H  HE2  . PHE A  1 310 ? 76.676  106.440 49.990  1.00 13.00 ? 310 PHE A HE2  1 
ATOM   4468  H  HZ   . PHE A  1 310 ? 78.948  106.227 49.697  1.00 12.81 ? 310 PHE A HZ   1 
ATOM   4469  N  N    . PRO A  1 311 ? 75.552  100.107 54.315  1.00 10.28 ? 311 PRO A N    1 
ATOM   4470  C  CA   . PRO A  1 311 ? 74.749  99.349  55.279  1.00 14.59 ? 311 PRO A CA   1 
ATOM   4471  C  C    . PRO A  1 311 ? 75.075  99.677  56.736  1.00 18.73 ? 311 PRO A C    1 
ATOM   4472  O  O    . PRO A  1 311 ? 74.232  99.452  57.613  1.00 19.96 ? 311 PRO A O    1 
ATOM   4473  C  CB   . PRO A  1 311 ? 75.051  97.876  54.938  1.00 14.11 ? 311 PRO A CB   1 
ATOM   4474  C  CG   . PRO A  1 311 ? 76.169  97.890  53.935  1.00 21.97 ? 311 PRO A CG   1 
ATOM   4475  C  CD   . PRO A  1 311 ? 76.188  99.262  53.300  1.00 12.53 ? 311 PRO A CD   1 
ATOM   4476  H  HA   . PRO A  1 311 ? 73.797  99.519  55.123  1.00 17.51 ? 311 PRO A HA   1 
ATOM   4477  H  HB2  . PRO A  1 311 ? 75.324  97.408  55.743  1.00 16.94 ? 311 PRO A HB2  1 
ATOM   4478  H  HB3  . PRO A  1 311 ? 74.260  97.464  54.558  1.00 16.94 ? 311 PRO A HB3  1 
ATOM   4479  H  HG2  . PRO A  1 311 ? 77.009  97.717  54.389  1.00 26.36 ? 311 PRO A HG2  1 
ATOM   4480  H  HG3  . PRO A  1 311 ? 76.004  97.210  53.263  1.00 26.36 ? 311 PRO A HG3  1 
ATOM   4481  H  HD2  . PRO A  1 311 ? 77.101  99.550  53.143  1.00 15.04 ? 311 PRO A HD2  1 
ATOM   4482  H  HD3  . PRO A  1 311 ? 75.667  99.265  52.482  1.00 15.04 ? 311 PRO A HD3  1 
ATOM   4483  N  N    . GLU A  1 312 ? 76.267  100.201 56.982  1.00 18.01 ? 312 GLU A N    1 
ATOM   4484  C  CA   . GLU A  1 312 ? 76.690  100.599 58.331  1.00 18.33 ? 312 GLU A CA   1 
ATOM   4485  C  C    . GLU A  1 312 ? 75.997  101.885 58.870  1.00 17.14 ? 312 GLU A C    1 
ATOM   4486  O  O    . GLU A  1 312 ? 76.026  102.138 60.100  1.00 11.81 ? 312 GLU A O    1 
ATOM   4487  C  CB   . GLU A  1 312 ? 78.215  100.764 58.367  1.00 14.92 ? 312 GLU A CB   1 
ATOM   4488  C  CG   . GLU A  1 312 ? 78.774  101.965 57.608  1.00 15.03 ? 312 GLU A CG   1 
ATOM   4489  C  CD   . GLU A  1 312 ? 79.168  101.656 56.151  1.00 16.17 ? 312 GLU A CD   1 
ATOM   4490  O  OE1  . GLU A  1 312 ? 78.359  101.083 55.409  1.00 17.76 ? 312 GLU A OE1  1 
ATOM   4491  O  OE2  . GLU A  1 312 ? 80.307  101.961 55.758  1.00 15.23 ? 312 GLU A OE2  1 
ATOM   4492  H  H    . GLU A  1 312 ? 76.863  100.341 56.379  1.00 21.61 ? 312 GLU A H    1 
ATOM   4493  H  HA   . GLU A  1 312 ? 76.463  99.871  58.947  1.00 21.99 ? 312 GLU A HA   1 
ATOM   4494  H  HB2  . GLU A  1 312 ? 78.490  100.854 59.293  1.00 17.90 ? 312 GLU A HB2  1 
ATOM   4495  H  HB3  . GLU A  1 312 ? 78.617  99.968  57.987  1.00 17.90 ? 312 GLU A HB3  1 
ATOM   4496  H  HG2  . GLU A  1 312 ? 78.102  102.664 57.591  1.00 18.04 ? 312 GLU A HG2  1 
ATOM   4497  H  HG3  . GLU A  1 312 ? 79.567  102.283 58.068  1.00 18.04 ? 312 GLU A HG3  1 
ATOM   4498  N  N    . TRP A  1 313 ? 75.403  102.685 57.977  1.00 12.02 ? 313 TRP A N    1 
ATOM   4499  C  CA   . TRP A  1 313 ? 74.631  103.871 58.373  1.00 11.17 ? 313 TRP A CA   1 
ATOM   4500  C  C    . TRP A  1 313 ? 73.358  103.507 59.126  1.00 11.94 ? 313 TRP A C    1 
ATOM   4501  O  O    . TRP A  1 313 ? 72.715  102.471 58.860  1.00 10.04 ? 313 TRP A O    1 
ATOM   4502  C  CB   . TRP A  1 313 ? 74.217  104.722 57.162  1.00 8.91  ? 313 TRP A CB   1 
ATOM   4503  C  CG   . TRP A  1 313 ? 75.266  105.580 56.620  1.00 8.52  ? 313 TRP A CG   1 
ATOM   4504  C  CD1  . TRP A  1 313 ? 76.504  105.779 57.123  1.00 8.45  ? 313 TRP A CD1  1 
ATOM   4505  C  CD2  . TRP A  1 313 ? 75.169  106.399 55.443  1.00 8.26  ? 313 TRP A CD2  1 
ATOM   4506  N  NE1  . TRP A  1 313 ? 77.190  106.691 56.341  1.00 9.26  ? 313 TRP A NE1  1 
ATOM   4507  C  CE2  . TRP A  1 313 ? 76.386  107.069 55.300  1.00 8.40  ? 313 TRP A CE2  1 
ATOM   4508  C  CE3  . TRP A  1 313 ? 74.165  106.616 54.504  1.00 8.31  ? 313 TRP A CE3  1 
ATOM   4509  C  CZ2  . TRP A  1 313 ? 76.645  107.923 54.233  1.00 7.82  ? 313 TRP A CZ2  1 
ATOM   4510  C  CZ3  . TRP A  1 313 ? 74.421  107.480 53.445  1.00 9.92  ? 313 TRP A CZ3  1 
ATOM   4511  C  CH2  . TRP A  1 313 ? 75.648  108.120 53.332  1.00 10.60 ? 313 TRP A CH2  1 
ATOM   4512  H  H    . TRP A  1 313 ? 75.431  102.560 57.126  1.00 14.42 ? 313 TRP A H    1 
ATOM   4513  H  HA   . TRP A  1 313 ? 75.183  104.429 58.961  1.00 13.40 ? 313 TRP A HA   1 
ATOM   4514  H  HB2  . TRP A  1 313 ? 73.930  104.127 56.452  1.00 10.69 ? 313 TRP A HB2  1 
ATOM   4515  H  HB3  . TRP A  1 313 ? 73.479  105.293 57.426  1.00 10.69 ? 313 TRP A HB3  1 
ATOM   4516  H  HD1  . TRP A  1 313 ? 76.833  105.389 57.901  1.00 10.14 ? 313 TRP A HD1  1 
ATOM   4517  H  HE1  . TRP A  1 313 ? 77.999  106.953 56.470  1.00 11.11 ? 313 TRP A HE1  1 
ATOM   4518  H  HE3  . TRP A  1 313 ? 73.347  106.179 54.574  1.00 9.98  ? 313 TRP A HE3  1 
ATOM   4519  H  HZ2  . TRP A  1 313 ? 77.460  108.365 54.156  1.00 9.38  ? 313 TRP A HZ2  1 
ATOM   4520  H  HZ3  . TRP A  1 313 ? 73.761  107.636 52.809  1.00 11.90 ? 313 TRP A HZ3  1 
ATOM   4521  H  HH2  . TRP A  1 313 ? 75.791  108.702 52.620  1.00 12.72 ? 313 TRP A HH2  1 
ATOM   4522  N  N    . SER A  1 314 ? 72.976  104.397 60.038  1.00 9.68  ? 314 SER A N    1 
ATOM   4523  C  CA   . SER A  1 314 ? 71.660  104.329 60.651  1.00 10.86 ? 314 SER A CA   1 
ATOM   4524  C  C    . SER A  1 314 ? 70.600  104.342 59.564  1.00 10.15 ? 314 SER A C    1 
ATOM   4525  O  O    . SER A  1 314 ? 70.760  105.003 58.530  1.00 9.75  ? 314 SER A O    1 
ATOM   4526  C  CB   . SER A  1 314 ? 71.451  105.519 61.612  1.00 18.31 ? 314 SER A CB   1 
ATOM   4527  O  OG   . SER A  1 314 ? 72.445  105.508 62.628  1.00 17.64 ? 314 SER A OG   1 
ATOM   4528  H  H    . SER A  1 314 ? 73.463  105.049 60.317  1.00 11.61 ? 314 SER A H    1 
ATOM   4529  H  HA   . SER A  1 314 ? 71.576  103.496 61.160  1.00 13.03 ? 314 SER A HA   1 
ATOM   4530  H  HB2  . SER A  1 314 ? 71.516  106.347 61.112  1.00 21.98 ? 314 SER A HB2  1 
ATOM   4531  H  HB3  . SER A  1 314 ? 70.575  105.445 62.023  1.00 21.98 ? 314 SER A HB3  1 
ATOM   4532  H  HG   . SER A  1 314 ? 72.332  106.141 63.137  1.00 21.17 ? 314 SER A HG   1 
ATOM   4533  N  N    . PRO A  1 315 ? 69.473  103.684 59.820  1.00 18.03 ? 315 PRO A N    1 
ATOM   4534  C  CA   . PRO A  1 315 ? 68.336  103.721 58.901  1.00 20.95 ? 315 PRO A CA   1 
ATOM   4535  C  C    . PRO A  1 315 ? 68.007  105.139 58.416  1.00 15.22 ? 315 PRO A C    1 
ATOM   4536  O  O    . PRO A  1 315 ? 67.859  106.074 59.213  1.00 16.42 ? 315 PRO A O    1 
ATOM   4537  C  CB   . PRO A  1 315 ? 67.180  103.194 59.758  1.00 21.86 ? 315 PRO A CB   1 
ATOM   4538  C  CG   . PRO A  1 315 ? 67.822  102.353 60.763  1.00 23.23 ? 315 PRO A CG   1 
ATOM   4539  C  CD   . PRO A  1 315 ? 69.173  102.905 61.030  1.00 15.88 ? 315 PRO A CD   1 
ATOM   4540  H  HA   . PRO A  1 315 ? 68.483  103.128 58.134  1.00 25.14 ? 315 PRO A HA   1 
ATOM   4541  H  HB2  . PRO A  1 315 ? 66.716  103.936 60.176  1.00 26.24 ? 315 PRO A HB2  1 
ATOM   4542  H  HB3  . PRO A  1 315 ? 66.575  102.672 59.209  1.00 26.24 ? 315 PRO A HB3  1 
ATOM   4543  H  HG2  . PRO A  1 315 ? 67.290  102.365 61.574  1.00 27.88 ? 315 PRO A HG2  1 
ATOM   4544  H  HG3  . PRO A  1 315 ? 67.893  101.448 60.422  1.00 27.88 ? 315 PRO A HG3  1 
ATOM   4545  H  HD2  . PRO A  1 315 ? 69.153  103.484 61.808  1.00 19.06 ? 315 PRO A HD2  1 
ATOM   4546  H  HD3  . PRO A  1 315 ? 69.816  102.187 61.138  1.00 19.06 ? 315 PRO A HD3  1 
ATOM   4547  N  N    . ASN A  1 316 ? 67.851  105.257 57.109  1.00 10.54 ? 316 ASN A N    1 
ATOM   4548  C  CA   . ASN A  1 316 ? 67.365  106.497 56.476  1.00 10.53 ? 316 ASN A CA   1 
ATOM   4549  C  C    . ASN A  1 316 ? 68.195  107.723 56.745  1.00 12.60 ? 316 ASN A C    1 
ATOM   4550  O  O    . ASN A  1 316 ? 67.669  108.837 56.756  1.00 15.54 ? 316 ASN A O    1 
ATOM   4551  C  CB   . ASN A  1 316 ? 65.936  106.809 56.920  1.00 18.92 ? 316 ASN A CB   1 
ATOM   4552  C  CG   . ASN A  1 316 ? 65.063  105.572 56.962  1.00 20.03 ? 316 ASN A CG   1 
ATOM   4553  O  OD1  . ASN A  1 316 ? 65.017  104.796 56.007  1.00 22.35 ? 316 ASN A OD1  1 
ATOM   4554  N  ND2  . ASN A  1 316 ? 64.364  105.385 58.069  1.00 13.50 ? 316 ASN A ND2  1 
ATOM   4555  H  H    . ASN A  1 316 ? 68.019  104.628 56.548  1.00 12.65 ? 316 ASN A H    1 
ATOM   4556  H  HA   . ASN A  1 316 ? 67.349  106.361 55.506  1.00 12.63 ? 316 ASN A HA   1 
ATOM   4557  H  HB2  . ASN A  1 316 ? 65.956  107.194 57.810  1.00 22.70 ? 316 ASN A HB2  1 
ATOM   4558  H  HB3  . ASN A  1 316 ? 65.540  107.436 56.294  1.00 22.70 ? 316 ASN A HB3  1 
ATOM   4559  H  HD21 . ASN A  1 316 ? 64.422  105.950 58.715  1.00 16.21 ? 316 ASN A HD21 1 
ATOM   4560  H  HD22 . ASN A  1 316 ? 63.853  104.697 58.143  1.00 16.21 ? 316 ASN A HD22 1 
ATOM   4561  N  N    . LEU A  1 317 ? 69.494  107.535 56.923  1.00 15.43 ? 317 LEU A N    1 
ATOM   4562  C  CA   . LEU A  1 317 ? 70.357  108.622 57.365  1.00 9.18  ? 317 LEU A CA   1 
ATOM   4563  C  C    . LEU A  1 317 ? 70.367  109.796 56.389  1.00 16.99 ? 317 LEU A C    1 
ATOM   4564  O  O    . LEU A  1 317 ? 70.240  110.936 56.797  1.00 12.41 ? 317 LEU A O    1 
ATOM   4565  C  CB   . LEU A  1 317 ? 71.780  108.095 57.597  1.00 8.81  ? 317 LEU A CB   1 
ATOM   4566  C  CG   . LEU A  1 317 ? 72.802  109.133 58.056  1.00 8.48  ? 317 LEU A CG   1 
ATOM   4567  C  CD1  . LEU A  1 317 ? 72.506  109.689 59.459  1.00 8.72  ? 317 LEU A CD1  1 
ATOM   4568  C  CD2  . LEU A  1 317 ? 74.217  108.571 58.021  1.00 8.24  ? 317 LEU A CD2  1 
ATOM   4569  H  H    . LEU A  1 317 ? 69.901  106.788 56.796  1.00 18.51 ? 317 LEU A H    1 
ATOM   4570  H  HA   . LEU A  1 317 ? 70.022  108.955 58.223  1.00 11.02 ? 317 LEU A HA   1 
ATOM   4571  H  HB2  . LEU A  1 317 ? 71.743  107.403 58.276  1.00 10.57 ? 317 LEU A HB2  1 
ATOM   4572  H  HB3  . LEU A  1 317 ? 72.105  107.715 56.765  1.00 10.57 ? 317 LEU A HB3  1 
ATOM   4573  H  HG   . LEU A  1 317 ? 72.774  109.881 57.438  1.00 10.17 ? 317 LEU A HG   1 
ATOM   4574  H  HD11 . LEU A  1 317 ? 73.181  110.332 59.688  1.00 10.47 ? 317 LEU A HD11 1 
ATOM   4575  H  HD12 . LEU A  1 317 ? 71.642  110.107 59.453  1.00 10.47 ? 317 LEU A HD12 1 
ATOM   4576  H  HD13 . LEU A  1 317 ? 72.516  108.965 60.089  1.00 10.47 ? 317 LEU A HD13 1 
ATOM   4577  H  HD21 . LEU A  1 317 ? 74.830  109.249 58.315  1.00 9.89  ? 317 LEU A HD21 1 
ATOM   4578  H  HD22 . LEU A  1 317 ? 74.265  107.810 58.605  1.00 9.89  ? 317 LEU A HD22 1 
ATOM   4579  H  HD23 . LEU A  1 317 ? 74.426  108.308 57.122  1.00 9.89  ? 317 LEU A HD23 1 
ATOM   4580  N  N    . TYR A  1 318 ? 70.527  109.519 55.102  1.00 8.90  ? 318 TYR A N    1 
ATOM   4581  C  CA   . TYR A  1 318 ? 70.612  110.587 54.091  1.00 8.83  ? 318 TYR A CA   1 
ATOM   4582  C  C    . TYR A  1 318 ? 69.337  111.407 54.048  1.00 9.35  ? 318 TYR A C    1 
ATOM   4583  O  O    . TYR A  1 318 ? 69.357  112.639 54.003  1.00 10.23 ? 318 TYR A O    1 
ATOM   4584  C  CB   . TYR A  1 318 ? 70.875  109.959 52.727  1.00 8.80  ? 318 TYR A CB   1 
ATOM   4585  C  CG   . TYR A  1 318 ? 71.097  110.943 51.585  1.00 8.80  ? 318 TYR A CG   1 
ATOM   4586  C  CD1  . TYR A  1 318 ? 70.030  111.484 50.906  1.00 11.37 ? 318 TYR A CD1  1 
ATOM   4587  C  CD2  . TYR A  1 318 ? 72.384  111.249 51.136  1.00 8.44  ? 318 TYR A CD2  1 
ATOM   4588  C  CE1  . TYR A  1 318 ? 70.224  112.375 49.833  1.00 9.43  ? 318 TYR A CE1  1 
ATOM   4589  C  CE2  . TYR A  1 318 ? 72.586  112.094 50.070  1.00 8.55  ? 318 TYR A CE2  1 
ATOM   4590  C  CZ   . TYR A  1 318 ? 71.504  112.658 49.418  1.00 12.62 ? 318 TYR A CZ   1 
ATOM   4591  O  OH   . TYR A  1 318 ? 71.713  113.505 48.339  1.00 10.29 ? 318 TYR A OH   1 
ATOM   4592  H  H    . TYR A  1 318 ? 70.590  108.724 54.780  1.00 10.68 ? 318 TYR A H    1 
ATOM   4593  H  HA   . TYR A  1 318 ? 71.359  111.184 54.308  1.00 10.59 ? 318 TYR A HA   1 
ATOM   4594  H  HB2  . TYR A  1 318 ? 71.669  109.405 52.792  1.00 10.56 ? 318 TYR A HB2  1 
ATOM   4595  H  HB3  . TYR A  1 318 ? 70.114  109.407 52.491  1.00 10.56 ? 318 TYR A HB3  1 
ATOM   4596  H  HD1  . TYR A  1 318 ? 69.165  111.289 51.186  1.00 13.65 ? 318 TYR A HD1  1 
ATOM   4597  H  HD2  . TYR A  1 318 ? 73.118  110.872 51.565  1.00 10.13 ? 318 TYR A HD2  1 
ATOM   4598  H  HE1  . TYR A  1 318 ? 69.494  112.738 49.386  1.00 11.31 ? 318 TYR A HE1  1 
ATOM   4599  H  HE2  . TYR A  1 318 ? 73.451  112.295 49.794  1.00 10.26 ? 318 TYR A HE2  1 
ATOM   4600  H  HH   . TYR A  1 318 ? 72.117  113.109 47.745  1.00 12.35 ? 318 TYR A HH   1 
ATOM   4601  N  N    . LYS A  1 319 ? 68.195  110.737 54.070  1.00 9.85  ? 319 LYS A N    1 
ATOM   4602  C  CA   . LYS A  1 319 ? 66.951  111.472 54.019  1.00 10.53 ? 319 LYS A CA   1 
ATOM   4603  C  C    . LYS A  1 319 ? 66.718  112.258 55.320  1.00 10.72 ? 319 LYS A C    1 
ATOM   4604  O  O    . LYS A  1 319 ? 66.152  113.350 55.303  1.00 13.85 ? 319 LYS A O    1 
ATOM   4605  C  CB   . LYS A  1 319 ? 65.773  110.528 53.756  1.00 13.63 ? 319 LYS A CB   1 
ATOM   4606  C  CG   . LYS A  1 319 ? 65.687  110.014 52.323  1.00 21.28 ? 319 LYS A CG   1 
ATOM   4607  C  CD   . LYS A  1 319 ? 64.283  109.463 52.024  1.00 28.02 ? 319 LYS A CD   1 
ATOM   4608  C  CE   . LYS A  1 319 ? 64.217  108.747 50.675  1.00 32.81 ? 319 LYS A CE   1 
ATOM   4609  N  NZ   . LYS A  1 319 ? 64.457  109.648 49.511  1.00 31.57 ? 319 LYS A NZ   1 
ATOM   4610  H  H    . LYS A  1 319 ? 68.117  109.882 54.114  1.00 11.83 ? 319 LYS A H    1 
ATOM   4611  H  HA   . LYS A  1 319 ? 66.993  112.115 53.281  1.00 12.63 ? 319 LYS A HA   1 
ATOM   4612  H  HB2  . LYS A  1 319 ? 65.855  109.759 54.340  1.00 16.35 ? 319 LYS A HB2  1 
ATOM   4613  H  HB3  . LYS A  1 319 ? 64.948  111.000 53.949  1.00 16.35 ? 319 LYS A HB3  1 
ATOM   4614  H  HG2  . LYS A  1 319 ? 65.868  110.742 51.708  1.00 25.53 ? 319 LYS A HG2  1 
ATOM   4615  H  HG3  . LYS A  1 319 ? 66.330  109.298 52.198  1.00 25.53 ? 319 LYS A HG3  1 
ATOM   4616  H  HD2  . LYS A  1 319 ? 64.037  108.829 52.715  1.00 33.62 ? 319 LYS A HD2  1 
ATOM   4617  H  HD3  . LYS A  1 319 ? 63.651  110.199 52.007  1.00 33.62 ? 319 LYS A HD3  1 
ATOM   4618  H  HE2  . LYS A  1 319 ? 64.892  108.051 50.656  1.00 39.37 ? 319 LYS A HE2  1 
ATOM   4619  H  HE3  . LYS A  1 319 ? 63.336  108.355 50.571  1.00 39.37 ? 319 LYS A HE3  1 
ATOM   4620  H  HZ1  . LYS A  1 319 ? 64.408  109.185 48.753  1.00 37.89 ? 319 LYS A HZ1  1 
ATOM   4621  H  HZ2  . LYS A  1 319 ? 63.845  110.294 49.496  1.00 37.89 ? 319 LYS A HZ2  1 
ATOM   4622  H  HZ3  . LYS A  1 319 ? 65.264  110.017 49.573  1.00 37.89 ? 319 LYS A HZ3  1 
ATOM   4623  N  N    . ASN A  1 320 ? 67.161  111.693 56.438  1.00 14.18 ? 320 ASN A N    1 
ATOM   4624  C  CA   . ASN A  1 320 ? 67.046  112.384 57.717  1.00 10.72 ? 320 ASN A CA   1 
ATOM   4625  C  C    . ASN A  1 320 ? 67.852  113.689 57.675  1.00 16.56 ? 320 ASN A C    1 
ATOM   4626  O  O    . ASN A  1 320 ? 67.356  114.761 58.030  1.00 16.96 ? 320 ASN A O    1 
ATOM   4627  C  CB   . ASN A  1 320 ? 67.538  111.469 58.823  1.00 15.42 ? 320 ASN A CB   1 
ATOM   4628  C  CG   . ASN A  1 320 ? 67.675  112.172 60.141  1.00 23.10 ? 320 ASN A CG   1 
ATOM   4629  O  OD1  . ASN A  1 320 ? 67.118  113.263 60.354  1.00 21.91 ? 320 ASN A OD1  1 
ATOM   4630  N  ND2  . ASN A  1 320 ? 68.433  111.560 61.045  1.00 28.98 ? 320 ASN A ND2  1 
ATOM   4631  H  H    . ASN A  1 320 ? 67.530  110.917 56.484  1.00 17.02 ? 320 ASN A H    1 
ATOM   4632  H  HA   . ASN A  1 320 ? 66.106  112.603 57.888  1.00 12.86 ? 320 ASN A HA   1 
ATOM   4633  H  HB2  . ASN A  1 320 ? 66.906  110.741 58.936  1.00 18.50 ? 320 ASN A HB2  1 
ATOM   4634  H  HB3  . ASN A  1 320 ? 68.408  111.117 58.579  1.00 18.50 ? 320 ASN A HB3  1 
ATOM   4635  H  HD21 . ASN A  1 320 ? 68.807  110.809 60.855  1.00 34.77 ? 320 ASN A HD21 1 
ATOM   4636  H  HD22 . ASN A  1 320 ? 68.549  111.914 61.820  1.00 34.77 ? 320 ASN A HD22 1 
ATOM   4637  N  N    . VAL A  1 321 ? 69.102  113.585 57.240  1.00 9.69  ? 321 VAL A N    1 
ATOM   4638  C  CA   . VAL A  1 321 ? 69.993  114.731 57.208  1.00 9.38  ? 321 VAL A CA   1 
ATOM   4639  C  C    . VAL A  1 321 ? 69.553  115.698 56.110  1.00 15.58 ? 321 VAL A C    1 
ATOM   4640  O  O    . VAL A  1 321 ? 69.533  116.897 56.320  1.00 12.03 ? 321 VAL A O    1 
ATOM   4641  C  CB   . VAL A  1 321 ? 71.465  114.285 57.043  1.00 8.71  ? 321 VAL A CB   1 
ATOM   4642  C  CG1  . VAL A  1 321 ? 72.387  115.459 56.761  1.00 9.19  ? 321 VAL A CG1  1 
ATOM   4643  C  CG2  . VAL A  1 321 ? 71.913  113.536 58.284  1.00 11.43 ? 321 VAL A CG2  1 
ATOM   4644  H  H    . VAL A  1 321 ? 69.459  112.856 56.956  1.00 11.63 ? 321 VAL A H    1 
ATOM   4645  H  HA   . VAL A  1 321 ? 69.922  115.203 58.063  1.00 11.26 ? 321 VAL A HA   1 
ATOM   4646  H  HB   . VAL A  1 321 ? 71.525  113.669 56.283  1.00 10.46 ? 321 VAL A HB   1 
ATOM   4647  H  HG11 . VAL A  1 321 ? 73.286  115.134 56.667  1.00 11.03 ? 321 VAL A HG11 1 
ATOM   4648  H  HG12 . VAL A  1 321 ? 72.107  115.888 55.950  1.00 11.03 ? 321 VAL A HG12 1 
ATOM   4649  H  HG13 . VAL A  1 321 ? 72.337  116.078 57.494  1.00 11.03 ? 321 VAL A HG13 1 
ATOM   4650  H  HG21 . VAL A  1 321 ? 72.827  113.265 58.171  1.00 13.72 ? 321 VAL A HG21 1 
ATOM   4651  H  HG22 . VAL A  1 321 ? 71.835  114.117 59.044  1.00 13.72 ? 321 VAL A HG22 1 
ATOM   4652  H  HG23 . VAL A  1 321 ? 71.354  112.765 58.401  1.00 13.72 ? 321 VAL A HG23 1 
ATOM   4653  N  N    . GLN A  1 322 ? 69.123  115.170 54.971  1.00 14.53 ? 322 GLN A N    1 
ATOM   4654  C  CA   . GLN A  1 322 ? 68.608  116.021 53.896  1.00 28.62 ? 322 GLN A CA   1 
ATOM   4655  C  C    . GLN A  1 322 ? 67.579  116.977 54.466  1.00 33.09 ? 322 GLN A C    1 
ATOM   4656  O  O    . GLN A  1 322 ? 67.523  118.165 54.117  1.00 34.05 ? 322 GLN A O    1 
ATOM   4657  C  CB   . GLN A  1 322 ? 67.915  115.158 52.860  1.00 29.93 ? 322 GLN A CB   1 
ATOM   4658  C  CG   . GLN A  1 322 ? 68.369  115.374 51.475  1.00 22.28 ? 322 GLN A CG   1 
ATOM   4659  C  CD   . GLN A  1 322 ? 67.485  114.655 50.486  1.00 23.40 ? 322 GLN A CD   1 
ATOM   4660  O  OE1  . GLN A  1 322 ? 66.765  113.696 50.835  1.00 19.55 ? 322 GLN A OE1  1 
ATOM   4661  N  NE2  . GLN A  1 322 ? 67.533  115.098 49.249  1.00 24.31 ? 322 GLN A NE2  1 
ATOM   4662  H  H    . GLN A  1 322 ? 69.116  114.328 54.792  1.00 17.43 ? 322 GLN A H    1 
ATOM   4663  H  HA   . GLN A  1 322 ? 69.334  116.527 53.475  1.00 34.35 ? 322 GLN A HA   1 
ATOM   4664  H  HB2  . GLN A  1 322 ? 68.073  114.226 53.078  1.00 35.92 ? 322 GLN A HB2  1 
ATOM   4665  H  HB3  . GLN A  1 322 ? 66.964  115.343 52.890  1.00 35.92 ? 322 GLN A HB3  1 
ATOM   4666  H  HG2  . GLN A  1 322 ? 68.341  116.323 51.273  1.00 26.74 ? 322 GLN A HG2  1 
ATOM   4667  H  HG3  . GLN A  1 322 ? 69.273  115.036 51.377  1.00 26.74 ? 322 GLN A HG3  1 
ATOM   4668  H  HE21 . GLN A  1 322 ? 68.047  115.758 49.048  1.00 29.17 ? 322 GLN A HE21 1 
ATOM   4669  H  HE22 . GLN A  1 322 ? 67.051  114.727 48.641  1.00 29.17 ? 322 GLN A HE22 1 
ATOM   4670  N  N    . GLU A  1 323 ? 66.752  116.443 55.355  1.00 24.53 ? 323 GLU A N    1 
ATOM   4671  C  CA   . GLU A  1 323 ? 65.644  117.197 55.896  1.00 33.35 ? 323 GLU A CA   1 
ATOM   4672  C  C    . GLU A  1 323 ? 66.042  118.156 57.020  1.00 32.41 ? 323 GLU A C    1 
ATOM   4673  O  O    . GLU A  1 323 ? 65.499  119.265 57.115  1.00 29.18 ? 323 GLU A O    1 
ATOM   4674  C  CB   . GLU A  1 323 ? 64.581  116.251 56.405  1.00 30.76 ? 323 GLU A CB   1 
ATOM   4675  C  CG   . GLU A  1 323 ? 63.353  116.983 56.832  1.00 34.73 ? 323 GLU A CG   1 
ATOM   4676  C  CD   . GLU A  1 323 ? 62.267  116.046 57.230  1.00 30.54 ? 323 GLU A CD   1 
ATOM   4677  O  OE1  . GLU A  1 323 ? 62.525  115.235 58.130  1.00 29.31 ? 323 GLU A OE1  1 
ATOM   4678  O  OE2  . GLU A  1 323 ? 61.169  116.108 56.642  1.00 35.79 ? 323 GLU A OE2  1 
ATOM   4679  H  H    . GLU A  1 323 ? 66.815  115.641 55.659  1.00 29.43 ? 323 GLU A H    1 
ATOM   4680  H  HA   . GLU A  1 323 ? 65.247  117.731 55.176  1.00 40.02 ? 323 GLU A HA   1 
ATOM   4681  H  HB2  . GLU A  1 323 ? 64.336  115.634 55.698  1.00 36.92 ? 323 GLU A HB2  1 
ATOM   4682  H  HB3  . GLU A  1 323 ? 64.925  115.764 57.171  1.00 36.92 ? 323 GLU A HB3  1 
ATOM   4683  H  HG2  . GLU A  1 323 ? 63.564  117.545 57.594  1.00 41.68 ? 323 GLU A HG2  1 
ATOM   4684  H  HG3  . GLU A  1 323 ? 63.032  117.525 56.094  1.00 41.68 ? 323 GLU A HG3  1 
ATOM   4685  N  N    . LYS A  1 324 ? 66.954  117.718 57.885  1.00 23.41 ? 324 LYS A N    1 
ATOM   4686  C  CA   . LYS A  1 324 ? 67.572  118.616 58.851  1.00 14.73 ? 324 LYS A CA   1 
ATOM   4687  C  C    . LYS A  1 324 ? 68.082  119.858 58.139  1.00 18.26 ? 324 LYS A C    1 
ATOM   4688  O  O    . LYS A  1 324 ? 67.883  120.984 58.589  1.00 16.66 ? 324 LYS A O    1 
ATOM   4689  C  CB   . LYS A  1 324 ? 68.747  117.934 59.554  1.00 10.82 ? 324 LYS A CB   1 
ATOM   4690  C  CG   . LYS A  1 324 ? 68.344  116.881 60.543  1.00 16.42 ? 324 LYS A CG   1 
ATOM   4691  C  CD   . LYS A  1 324 ? 69.564  116.351 61.280  1.00 23.11 ? 324 LYS A CD   1 
ATOM   4692  C  CE   . LYS A  1 324 ? 69.284  115.062 62.030  1.00 18.46 ? 324 LYS A CE   1 
ATOM   4693  N  NZ   . LYS A  1 324 ? 67.969  115.054 62.714  1.00 21.05 ? 324 LYS A NZ   1 
ATOM   4694  H  H    . LYS A  1 324 ? 67.231  116.905 57.932  1.00 28.10 ? 324 LYS A H    1 
ATOM   4695  H  HA   . LYS A  1 324 ? 66.913  118.885 59.525  1.00 17.68 ? 324 LYS A HA   1 
ATOM   4696  H  HB2  . LYS A  1 324 ? 69.307  117.510 58.885  1.00 12.98 ? 324 LYS A HB2  1 
ATOM   4697  H  HB3  . LYS A  1 324 ? 69.258  118.607 60.030  1.00 12.98 ? 324 LYS A HB3  1 
ATOM   4698  H  HG2  . LYS A  1 324 ? 67.735  117.265 61.193  1.00 19.71 ? 324 LYS A HG2  1 
ATOM   4699  H  HG3  . LYS A  1 324 ? 67.922  116.143 60.077  1.00 19.71 ? 324 LYS A HG3  1 
ATOM   4700  H  HD2  . LYS A  1 324 ? 70.270  116.177 60.638  1.00 27.74 ? 324 LYS A HD2  1 
ATOM   4701  H  HD3  . LYS A  1 324 ? 69.857  117.015 61.923  1.00 27.74 ? 324 LYS A HD3  1 
ATOM   4702  H  HE2  . LYS A  1 324 ? 69.298  114.324 61.402  1.00 22.15 ? 324 LYS A HE2  1 
ATOM   4703  H  HE3  . LYS A  1 324 ? 69.971  114.936 62.704  1.00 22.15 ? 324 LYS A HE3  1 
ATOM   4704  H  HZ1  . LYS A  1 324 ? 67.852  114.280 63.138  1.00 25.26 ? 324 LYS A HZ1  1 
ATOM   4705  H  HZ2  . LYS A  1 324 ? 67.930  115.717 63.306  1.00 25.26 ? 324 LYS A HZ2  1 
ATOM   4706  H  HZ3  . LYS A  1 324 ? 67.316  115.159 62.119  1.00 25.26 ? 324 LYS A HZ3  1 
ATOM   4707  N  N    . LEU A  1 325 ? 68.755  119.627 57.018  1.00 17.63 ? 325 LEU A N    1 
ATOM   4708  C  CA   . LEU A  1 325 ? 69.384  120.704 56.278  1.00 23.96 ? 325 LEU A CA   1 
ATOM   4709  C  C    . LEU A  1 325 ? 68.309  121.671 55.786  1.00 29.35 ? 325 LEU A C    1 
ATOM   4710  O  O    . LEU A  1 325 ? 68.583  122.844 55.576  1.00 21.23 ? 325 LEU A O    1 
ATOM   4711  C  CB   . LEU A  1 325 ? 70.252  120.140 55.139  1.00 10.25 ? 325 LEU A CB   1 
ATOM   4712  C  CG   . LEU A  1 325 ? 71.574  119.505 55.598  1.00 13.33 ? 325 LEU A CG   1 
ATOM   4713  C  CD1  . LEU A  1 325 ? 72.189  118.503 54.586  1.00 19.94 ? 325 LEU A CD1  1 
ATOM   4714  C  CD2  . LEU A  1 325 ? 72.578  120.578 55.979  1.00 13.35 ? 325 LEU A CD2  1 
ATOM   4715  H  H    . LEU A  1 325 ? 68.861  118.850 56.666  1.00 21.16 ? 325 LEU A H    1 
ATOM   4716  H  HA   . LEU A  1 325 ? 69.973  121.199 56.884  1.00 28.75 ? 325 LEU A HA   1 
ATOM   4717  H  HB2  . LEU A  1 325 ? 69.746  119.458 54.671  1.00 12.30 ? 325 LEU A HB2  1 
ATOM   4718  H  HB3  . LEU A  1 325 ? 70.469  120.861 54.528  1.00 12.30 ? 325 LEU A HB3  1 
ATOM   4719  H  HG   . LEU A  1 325 ? 71.390  119.001 56.406  1.00 15.99 ? 325 LEU A HG   1 
ATOM   4720  H  HD11 . LEU A  1 325 ? 73.007  118.155 54.949  1.00 23.93 ? 325 LEU A HD11 1 
ATOM   4721  H  HD12 . LEU A  1 325 ? 71.566  117.788 54.438  1.00 23.93 ? 325 LEU A HD12 1 
ATOM   4722  H  HD13 . LEU A  1 325 ? 72.364  118.961 53.761  1.00 23.93 ? 325 LEU A HD13 1 
ATOM   4723  H  HD21 . LEU A  1 325 ? 73.393  120.157 56.261  1.00 16.02 ? 325 LEU A HD21 1 
ATOM   4724  H  HD22 . LEU A  1 325 ? 72.745  121.135 55.214  1.00 16.02 ? 325 LEU A HD22 1 
ATOM   4725  H  HD23 . LEU A  1 325 ? 72.216  121.105 56.695  1.00 16.02 ? 325 LEU A HD23 1 
ATOM   4726  N  N    . SER A  1 326 ? 67.071  121.187 55.676  1.00 37.04 ? 326 SER A N    1 
ATOM   4727  C  CA   . SER A  1 326 ? 65.954  122.004 55.201  1.00 37.14 ? 326 SER A CA   1 
ATOM   4728  C  C    . SER A  1 326 ? 65.373  122.962 56.238  1.00 37.57 ? 326 SER A C    1 
ATOM   4729  O  O    . SER A  1 326 ? 64.895  124.033 55.874  1.00 40.02 ? 326 SER A O    1 
ATOM   4730  C  CB   . SER A  1 326 ? 64.835  121.115 54.640  1.00 42.76 ? 326 SER A CB   1 
ATOM   4731  O  OG   . SER A  1 326 ? 64.119  120.439 55.668  1.00 47.08 ? 326 SER A OG   1 
ATOM   4732  H  H    . SER A  1 326 ? 66.850  120.380 55.874  1.00 44.45 ? 326 SER A H    1 
ATOM   4733  H  HA   . SER A  1 326 ? 66.281  122.554 54.458  1.00 44.56 ? 326 SER A HA   1 
ATOM   4734  H  HB2  . SER A  1 326 ? 64.215  121.671 54.142  1.00 51.31 ? 326 SER A HB2  1 
ATOM   4735  H  HB3  . SER A  1 326 ? 65.229  120.454 54.049  1.00 51.31 ? 326 SER A HB3  1 
ATOM   4736  H  HG   . SER A  1 326 ? 64.427  120.639 56.401  1.00 56.49 ? 326 SER A HG   1 
ATOM   4737  N  N    . GLN A  1 327 ? 65.375  122.587 57.515  1.00 34.95 ? 327 GLN A N    1 
ATOM   4738  C  CA   . GLN A  1 327 ? 64.938  123.516 58.555  1.00 40.36 ? 327 GLN A CA   1 
ATOM   4739  C  C    . GLN A  1 327 ? 65.828  124.754 58.536  1.00 34.89 ? 327 GLN A C    1 
ATOM   4740  O  O    . GLN A  1 327 ? 65.440  125.818 59.014  1.00 45.47 ? 327 GLN A O    1 
ATOM   4741  C  CB   . GLN A  1 327 ? 65.000  122.870 59.944  1.00 46.30 ? 327 GLN A CB   1 
ATOM   4742  C  CG   . GLN A  1 327 ? 64.045  121.709 60.150  1.00 44.07 ? 327 GLN A CG   1 
ATOM   4743  C  CD   . GLN A  1 327 ? 62.605  122.090 59.866  1.00 50.65 ? 327 GLN A CD   1 
ATOM   4744  O  OE1  . GLN A  1 327 ? 62.100  123.087 60.384  1.00 51.15 ? 327 GLN A OE1  1 
ATOM   4745  N  NE2  . GLN A  1 327 ? 61.936  121.299 59.029  1.00 55.05 ? 327 GLN A NE2  1 
ATOM   4746  H  H    . GLN A  1 327 ? 65.620  121.814 57.802  1.00 41.94 ? 327 GLN A H    1 
ATOM   4747  H  HA   . GLN A  1 327 ? 64.015  123.793 58.380  1.00 48.43 ? 327 GLN A HA   1 
ATOM   4748  H  HB2  . GLN A  1 327 ? 65.900  122.539 60.092  1.00 55.56 ? 327 GLN A HB2  1 
ATOM   4749  H  HB3  . GLN A  1 327 ? 64.789  123.545 60.609  1.00 55.56 ? 327 GLN A HB3  1 
ATOM   4750  H  HG2  . GLN A  1 327 ? 64.290  120.987 59.551  1.00 52.88 ? 327 GLN A HG2  1 
ATOM   4751  H  HG3  . GLN A  1 327 ? 64.101  121.411 61.072  1.00 52.88 ? 327 GLN A HG3  1 
ATOM   4752  H  HE21 . GLN A  1 327 ? 62.324  120.614 58.682  1.00 66.06 ? 327 GLN A HE21 1 
ATOM   4753  H  HE22 . GLN A  1 327 ? 61.116  121.472 58.836  1.00 66.06 ? 327 GLN A HE22 1 
ATOM   4754  N  N    . PHE A  1 328 ? 67.035  124.603 57.993  1.00 24.95 ? 328 PHE A N    1 
ATOM   4755  C  CA   . PHE A  1 328 ? 67.978  125.708 57.929  1.00 21.13 ? 328 PHE A CA   1 
ATOM   4756  C  C    . PHE A  1 328 ? 67.675  126.588 56.717  1.00 31.35 ? 328 PHE A C    1 
ATOM   4757  O  O    . PHE A  1 328 ? 67.852  127.806 56.773  1.00 45.67 ? 328 PHE A O    1 
ATOM   4758  C  CB   . PHE A  1 328 ? 69.412  125.182 57.871  1.00 25.69 ? 328 PHE A CB   1 
ATOM   4759  C  CG   . PHE A  1 328 ? 69.805  124.344 59.063  1.00 25.42 ? 328 PHE A CG   1 
ATOM   4760  C  CD1  . PHE A  1 328 ? 69.412  124.704 60.342  1.00 27.09 ? 328 PHE A CD1  1 
ATOM   4761  C  CD2  . PHE A  1 328 ? 70.567  123.198 58.897  1.00 24.41 ? 328 PHE A CD2  1 
ATOM   4762  C  CE1  . PHE A  1 328 ? 69.775  123.943 61.436  1.00 17.79 ? 328 PHE A CE1  1 
ATOM   4763  C  CE2  . PHE A  1 328 ? 70.941  122.422 59.976  1.00 18.38 ? 328 PHE A CE2  1 
ATOM   4764  C  CZ   . PHE A  1 328 ? 70.531  122.798 61.271  1.00 12.04 ? 328 PHE A CZ   1 
ATOM   4765  H  H    . PHE A  1 328 ? 67.329  123.868 57.656  1.00 29.94 ? 328 PHE A H    1 
ATOM   4766  H  HA   . PHE A  1 328 ? 67.887  126.257 58.736  1.00 25.35 ? 328 PHE A HA   1 
ATOM   4767  H  HB2  . PHE A  1 328 ? 69.511  124.633 57.078  1.00 30.83 ? 328 PHE A HB2  1 
ATOM   4768  H  HB3  . PHE A  1 328 ? 70.020  125.936 57.827  1.00 30.83 ? 328 PHE A HB3  1 
ATOM   4769  H  HD1  . PHE A  1 328 ? 68.901  125.472 60.465  1.00 32.50 ? 328 PHE A HD1  1 
ATOM   4770  H  HD2  . PHE A  1 328 ? 70.836  122.949 58.042  1.00 29.29 ? 328 PHE A HD2  1 
ATOM   4771  H  HE1  . PHE A  1 328 ? 69.501  124.197 62.288  1.00 21.35 ? 328 PHE A HE1  1 
ATOM   4772  H  HE2  . PHE A  1 328 ? 71.452  121.655 59.849  1.00 22.05 ? 328 PHE A HE2  1 
ATOM   4773  H  HZ   . PHE A  1 328 ? 70.775  122.286 62.008  1.00 14.45 ? 328 PHE A HZ   1 
ATOM   4774  N  N    . GLU B  1 26  ? 30.590  125.696 -27.737 1.00 32.48 ? 26  GLU B N    1 
ATOM   4775  C  CA   . GLU B  1 26  ? 31.102  125.734 -26.361 1.00 28.27 ? 26  GLU B CA   1 
ATOM   4776  C  C    . GLU B  1 26  ? 31.532  124.344 -25.876 1.00 24.12 ? 26  GLU B C    1 
ATOM   4777  O  O    . GLU B  1 26  ? 30.768  123.378 -25.907 1.00 30.50 ? 26  GLU B O    1 
ATOM   4778  C  CB   . GLU B  1 26  ? 30.067  126.357 -25.413 1.00 29.18 ? 26  GLU B CB   1 
ATOM   4779  C  CG   . GLU B  1 26  ? 30.472  126.340 -23.957 1.00 22.87 ? 26  GLU B CG   1 
ATOM   4780  C  CD   . GLU B  1 26  ? 29.497  127.048 -23.050 1.00 28.96 ? 26  GLU B CD   1 
ATOM   4781  O  OE1  . GLU B  1 26  ? 28.683  126.349 -22.408 1.00 24.22 ? 26  GLU B OE1  1 
ATOM   4782  O  OE2  . GLU B  1 26  ? 29.552  128.297 -22.959 1.00 33.77 ? 26  GLU B OE2  1 
ATOM   4783  H  HA   . GLU B  1 26  ? 31.896  126.308 -26.344 1.00 33.92 ? 26  GLU B HA   1 
ATOM   4784  H  HB2  . GLU B  1 26  ? 29.926  127.282 -25.670 1.00 35.02 ? 26  GLU B HB2  1 
ATOM   4785  H  HB3  . GLU B  1 26  ? 29.235  125.864 -25.494 1.00 35.02 ? 26  GLU B HB3  1 
ATOM   4786  H  HG2  . GLU B  1 26  ? 30.538  125.419 -23.661 1.00 27.45 ? 26  GLU B HG2  1 
ATOM   4787  H  HG3  . GLU B  1 26  ? 31.333  126.777 -23.866 1.00 27.45 ? 26  GLU B HG3  1 
ATOM   4788  N  N    . THR B  1 27  ? 32.788  124.256 -25.461 1.00 18.84 ? 27  THR B N    1 
ATOM   4789  C  CA   . THR B  1 27  ? 33.347  123.030 -24.938 1.00 14.47 ? 27  THR B CA   1 
ATOM   4790  C  C    . THR B  1 27  ? 33.440  123.105 -23.406 1.00 17.25 ? 27  THR B C    1 
ATOM   4791  O  O    . THR B  1 27  ? 34.256  123.858 -22.872 1.00 21.09 ? 27  THR B O    1 
ATOM   4792  C  CB   . THR B  1 27  ? 34.748  122.804 -25.507 1.00 21.29 ? 27  THR B CB   1 
ATOM   4793  O  OG1  . THR B  1 27  ? 34.692  122.771 -26.940 1.00 22.31 ? 27  THR B OG1  1 
ATOM   4794  C  CG2  . THR B  1 27  ? 35.334  121.511 -24.995 1.00 19.05 ? 27  THR B CG2  1 
ATOM   4795  H  H    . THR B  1 27  ? 33.345  124.911 -25.474 1.00 22.61 ? 27  THR B H    1 
ATOM   4796  H  HA   . THR B  1 27  ? 32.778  122.272 -25.186 1.00 17.37 ? 27  THR B HA   1 
ATOM   4797  H  HB   . THR B  1 27  ? 35.327  123.530 -25.228 1.00 25.55 ? 27  THR B HB   1 
ATOM   4798  H  HG1  . THR B  1 27  ? 34.399  123.481 -27.226 1.00 26.77 ? 27  THR B HG1  1 
ATOM   4799  H  HG21 . THR B  1 27  ? 36.212  121.381 -25.359 1.00 22.86 ? 27  THR B HG21 1 
ATOM   4800  H  HG22 . THR B  1 27  ? 35.394  121.535 -24.037 1.00 22.86 ? 27  THR B HG22 1 
ATOM   4801  H  HG23 . THR B  1 27  ? 34.777  120.773 -25.254 1.00 22.86 ? 27  THR B HG23 1 
ATOM   4802  N  N    . GLU B  1 28  ? 32.600  122.330 -22.717 1.00 16.83 ? 28  GLU B N    1 
ATOM   4803  C  CA   . GLU B  1 28  ? 32.580  122.301 -21.252 1.00 16.83 ? 28  GLU B CA   1 
ATOM   4804  C  C    . GLU B  1 28  ? 33.507  121.196 -20.752 1.00 17.71 ? 28  GLU B C    1 
ATOM   4805  O  O    . GLU B  1 28  ? 33.451  120.073 -21.239 1.00 23.48 ? 28  GLU B O    1 
ATOM   4806  C  CB   . GLU B  1 28  ? 31.161  122.062 -20.741 1.00 18.81 ? 28  GLU B CB   1 
ATOM   4807  C  CG   . GLU B  1 28  ? 31.030  121.983 -19.213 1.00 28.60 ? 28  GLU B CG   1 
ATOM   4808  C  CD   . GLU B  1 28  ? 29.592  121.696 -18.746 1.00 32.63 ? 28  GLU B CD   1 
ATOM   4809  O  OE1  . GLU B  1 28  ? 29.310  120.546 -18.348 1.00 32.28 ? 28  GLU B OE1  1 
ATOM   4810  O  OE2  . GLU B  1 28  ? 28.744  122.613 -18.774 1.00 33.57 ? 28  GLU B OE2  1 
ATOM   4811  H  H    . GLU B  1 28  ? 32.025  121.804 -23.081 1.00 20.19 ? 28  GLU B H    1 
ATOM   4812  H  HA   . GLU B  1 28  ? 32.899  123.159 -20.902 1.00 20.20 ? 28  GLU B HA   1 
ATOM   4813  H  HB2  . GLU B  1 28  ? 30.596  122.789 -21.046 1.00 22.57 ? 28  GLU B HB2  1 
ATOM   4814  H  HB3  . GLU B  1 28  ? 30.839  121.223 -21.107 1.00 22.57 ? 28  GLU B HB3  1 
ATOM   4815  H  HG2  . GLU B  1 28  ? 31.599  121.269 -18.885 1.00 34.32 ? 28  GLU B HG2  1 
ATOM   4816  H  HG3  . GLU B  1 28  ? 31.306  122.829 -18.829 1.00 34.32 ? 28  GLU B HG3  1 
ATOM   4817  N  N    . ILE B  1 29  ? 34.368  121.536 -19.795 1.00 13.20 ? 29  ILE B N    1 
ATOM   4818  C  CA   . ILE B  1 29  ? 35.307  120.584 -19.222 1.00 10.64 ? 29  ILE B CA   1 
ATOM   4819  C  C    . ILE B  1 29  ? 35.173  120.559 -17.724 1.00 11.66 ? 29  ILE B C    1 
ATOM   4820  O  O    . ILE B  1 29  ? 35.177  121.616 -17.093 1.00 14.30 ? 29  ILE B O    1 
ATOM   4821  C  CB   . ILE B  1 29  ? 36.766  120.970 -19.556 1.00 9.92  ? 29  ILE B CB   1 
ATOM   4822  C  CG1  . ILE B  1 29  ? 36.939  121.005 -21.089 1.00 14.73 ? 29  ILE B CG1  1 
ATOM   4823  C  CG2  . ILE B  1 29  ? 37.704  119.987 -18.942 1.00 13.02 ? 29  ILE B CG2  1 
ATOM   4824  C  CD1  . ILE B  1 29  ? 38.316  121.487 -21.544 1.00 11.75 ? 29  ILE B CD1  1 
ATOM   4825  H  H    . ILE B  1 29  ? 34.427  122.325 -19.458 1.00 15.83 ? 29  ILE B H    1 
ATOM   4826  H  HA   . ILE B  1 29  ? 35.128  119.686 -19.572 1.00 12.76 ? 29  ILE B HA   1 
ATOM   4827  H  HB   . ILE B  1 29  ? 36.951  121.852 -19.196 1.00 11.90 ? 29  ILE B HB   1 
ATOM   4828  H  HG12 . ILE B  1 29  ? 36.807  120.110 -21.439 1.00 17.67 ? 29  ILE B HG12 1 
ATOM   4829  H  HG13 . ILE B  1 29  ? 36.276  121.606 -21.465 1.00 17.67 ? 29  ILE B HG13 1 
ATOM   4830  H  HG21 . ILE B  1 29  ? 38.605  120.239 -19.157 1.00 15.62 ? 29  ILE B HG21 1 
ATOM   4831  H  HG22 . ILE B  1 29  ? 37.581  119.991 -17.990 1.00 15.62 ? 29  ILE B HG22 1 
ATOM   4832  H  HG23 . ILE B  1 29  ? 37.514  119.114 -19.294 1.00 15.62 ? 29  ILE B HG23 1 
ATOM   4833  H  HD11 . ILE B  1 29  ? 38.348  121.481 -22.503 1.00 14.10 ? 29  ILE B HD11 1 
ATOM   4834  H  HD12 . ILE B  1 29  ? 38.459  122.378 -21.216 1.00 14.10 ? 29  ILE B HD12 1 
ATOM   4835  H  HD13 . ILE B  1 29  ? 38.986  120.896 -21.191 1.00 14.10 ? 29  ILE B HD13 1 
ATOM   4836  N  N    . MET B  1 30  ? 35.033  119.366 -17.158 1.00 14.40 ? 30  MET B N    1 
ATOM   4837  C  CA   . MET B  1 30  ? 34.861  119.220 -15.709 1.00 14.42 ? 30  MET B CA   1 
ATOM   4838  C  C    . MET B  1 30  ? 36.219  119.199 -15.034 1.00 10.43 ? 30  MET B C    1 
ATOM   4839  O  O    . MET B  1 30  ? 37.109  118.535 -15.505 1.00 13.00 ? 30  MET B O    1 
ATOM   4840  C  CB   . MET B  1 30  ? 34.099  117.933 -15.395 1.00 15.63 ? 30  MET B CB   1 
ATOM   4841  C  CG   . MET B  1 30  ? 32.658  117.919 -15.917 1.00 20.80 ? 30  MET B CG   1 
ATOM   4842  S  SD   . MET B  1 30  ? 31.781  116.374 -15.574 1.00 24.60 ? 30  MET B SD   1 
ATOM   4843  C  CE   . MET B  1 30  ? 32.732  115.201 -16.538 1.00 32.74 ? 30  MET B CE   1 
ATOM   4844  H  H    . MET B  1 30  ? 35.035  118.621 -17.588 1.00 17.28 ? 30  MET B H    1 
ATOM   4845  H  HA   . MET B  1 30  ? 34.341  119.977 -15.366 1.00 17.30 ? 30  MET B HA   1 
ATOM   4846  H  HB2  . MET B  1 30  ? 34.568  117.187 -15.801 1.00 18.76 ? 30  MET B HB2  1 
ATOM   4847  H  HB3  . MET B  1 30  ? 34.066  117.816 -14.433 1.00 18.76 ? 30  MET B HB3  1 
ATOM   4848  H  HG2  . MET B  1 30  ? 32.166  118.641 -15.496 1.00 24.95 ? 30  MET B HG2  1 
ATOM   4849  H  HG3  . MET B  1 30  ? 32.672  118.047 -16.879 1.00 24.95 ? 30  MET B HG3  1 
ATOM   4850  H  HE1  . MET B  1 30  ? 32.350  114.327 -16.431 1.00 39.29 ? 30  MET B HE1  1 
ATOM   4851  H  HE2  . MET B  1 30  ? 32.703  115.461 -17.462 1.00 39.29 ? 30  MET B HE2  1 
ATOM   4852  H  HE3  . MET B  1 30  ? 33.640  115.203 -16.226 1.00 39.29 ? 30  MET B HE3  1 
ATOM   4853  N  N    . VAL B  1 31  ? 36.371  119.909 -13.912 1.00 11.94 ? 31  VAL B N    1 
ATOM   4854  C  CA   . VAL B  1 31  ? 37.670  120.002 -13.247 1.00 9.01  ? 31  VAL B CA   1 
ATOM   4855  C  C    . VAL B  1 31  ? 37.512  119.385 -11.847 1.00 13.83 ? 31  VAL B C    1 
ATOM   4856  O  O    . VAL B  1 31  ? 36.739  119.883 -11.046 1.00 11.41 ? 31  VAL B O    1 
ATOM   4857  C  CB   . VAL B  1 31  ? 38.140  121.456 -13.179 1.00 10.14 ? 31  VAL B CB   1 
ATOM   4858  C  CG1  . VAL B  1 31  ? 39.521  121.558 -12.547 1.00 9.95  ? 31  VAL B CG1  1 
ATOM   4859  C  CG2  . VAL B  1 31  ? 38.138  122.061 -14.603 1.00 12.99 ? 31  VAL B CG2  1 
ATOM   4860  H  H    . VAL B  1 31  ? 35.741  120.344 -13.520 1.00 14.33 ? 31  VAL B H    1 
ATOM   4861  H  HA   . VAL B  1 31  ? 38.334  119.481 -13.745 1.00 10.81 ? 31  VAL B HA   1 
ATOM   4862  H  HB   . VAL B  1 31  ? 37.513  121.970 -12.628 1.00 12.16 ? 31  VAL B HB   1 
ATOM   4863  H  HG11 . VAL B  1 31  ? 39.784  122.481 -12.520 1.00 11.94 ? 31  VAL B HG11 1 
ATOM   4864  H  HG12 . VAL B  1 31  ? 39.484  121.202 -11.656 1.00 11.94 ? 31  VAL B HG12 1 
ATOM   4865  H  HG13 . VAL B  1 31  ? 40.144  121.055 -13.076 1.00 11.94 ? 31  VAL B HG13 1 
ATOM   4866  H  HG21 . VAL B  1 31  ? 38.433  122.973 -14.556 1.00 15.59 ? 31  VAL B HG21 1 
ATOM   4867  H  HG22 . VAL B  1 31  ? 38.733  121.552 -15.159 1.00 15.59 ? 31  VAL B HG22 1 
ATOM   4868  H  HG23 . VAL B  1 31  ? 37.246  122.023 -14.957 1.00 15.59 ? 31  VAL B HG23 1 
ATOM   4869  N  N    . ALA B  1 32  ? 38.203  118.279 -11.595 1.00 10.93 ? 32  ALA B N    1 
ATOM   4870  C  CA   . ALA B  1 32  ? 38.012  117.469 -10.381 1.00 7.12  ? 32  ALA B CA   1 
ATOM   4871  C  C    . ALA B  1 32  ? 39.187  117.572 -9.409  1.00 10.67 ? 32  ALA B C    1 
ATOM   4872  O  O    . ALA B  1 32  ? 40.339  117.561 -9.817  1.00 7.76  ? 32  ALA B O    1 
ATOM   4873  C  CB   . ALA B  1 32  ? 37.806  116.005 -10.776 1.00 11.95 ? 32  ALA B CB   1 
ATOM   4874  H  H    . ALA B  1 32  ? 38.805  117.964 -12.122 1.00 13.11 ? 32  ALA B H    1 
ATOM   4875  H  HA   . ALA B  1 32  ? 37.205  117.776 -9.916  1.00 8.55  ? 32  ALA B HA   1 
ATOM   4876  H  HB1  . ALA B  1 32  ? 37.682  115.482 -9.981  1.00 14.34 ? 32  ALA B HB1  1 
ATOM   4877  H  HB2  . ALA B  1 32  ? 37.030  115.939 -11.337 1.00 14.34 ? 32  ALA B HB2  1 
ATOM   4878  H  HB3  . ALA B  1 32  ? 38.581  115.699 -11.253 1.00 14.34 ? 32  ALA B HB3  1 
ATOM   4879  N  N    . TYR B  1 33  ? 38.890  117.711 -8.111  1.00 9.18  ? 33  TYR B N    1 
ATOM   4880  C  CA   . TYR B  1 33  ? 39.926  117.731 -7.084  1.00 9.13  ? 33  TYR B CA   1 
ATOM   4881  C  C    . TYR B  1 33  ? 39.284  117.431 -5.728  1.00 7.72  ? 33  TYR B C    1 
ATOM   4882  O  O    . TYR B  1 33  ? 38.054  117.374 -5.641  1.00 8.83  ? 33  TYR B O    1 
ATOM   4883  C  CB   . TYR B  1 33  ? 40.675  119.066 -7.081  1.00 8.44  ? 33  TYR B CB   1 
ATOM   4884  C  CG   . TYR B  1 33  ? 39.789  120.292 -7.120  1.00 8.85  ? 33  TYR B CG   1 
ATOM   4885  C  CD1  . TYR B  1 33  ? 39.154  120.678 -8.297  1.00 7.47  ? 33  TYR B CD1  1 
ATOM   4886  C  CD2  . TYR B  1 33  ? 39.606  121.080 -5.990  1.00 8.38  ? 33  TYR B CD2  1 
ATOM   4887  C  CE1  . TYR B  1 33  ? 38.348  121.790 -8.346  1.00 8.84  ? 33  TYR B CE1  1 
ATOM   4888  C  CE2  . TYR B  1 33  ? 38.789  122.227 -6.026  1.00 12.74 ? 33  TYR B CE2  1 
ATOM   4889  C  CZ   . TYR B  1 33  ? 38.175  122.577 -7.204  1.00 14.12 ? 33  TYR B CZ   1 
ATOM   4890  O  OH   . TYR B  1 33  ? 37.363  123.698 -7.273  1.00 16.13 ? 33  TYR B OH   1 
ATOM   4891  H  H    . TYR B  1 33  ? 38.091  117.795 -7.803  1.00 11.01 ? 33  TYR B H    1 
ATOM   4892  H  HA   . TYR B  1 33  ? 40.576  117.022 -7.273  1.00 10.95 ? 33  TYR B HA   1 
ATOM   4893  H  HB2  . TYR B  1 33  ? 41.212  119.118 -6.274  1.00 10.12 ? 33  TYR B HB2  1 
ATOM   4894  H  HB3  . TYR B  1 33  ? 41.253  119.097 -7.859  1.00 10.12 ? 33  TYR B HB3  1 
ATOM   4895  H  HD1  . TYR B  1 33  ? 39.266  120.163 -9.064  1.00 8.96  ? 33  TYR B HD1  1 
ATOM   4896  H  HD2  . TYR B  1 33  ? 40.026  120.843 -5.195  1.00 10.06 ? 33  TYR B HD2  1 
ATOM   4897  H  HE1  . TYR B  1 33  ? 37.932  122.029 -9.143  1.00 10.61 ? 33  TYR B HE1  1 
ATOM   4898  H  HE2  . TYR B  1 33  ? 38.672  122.746 -5.263  1.00 15.29 ? 33  TYR B HE2  1 
ATOM   4899  H  HH   . TYR B  1 33  ? 37.797  124.370 -7.091  1.00 19.36 ? 33  TYR B HH   1 
ATOM   4900  N  N    . GLY B  1 34  ? 40.103  117.221 -4.701  1.00 8.62  ? 34  GLY B N    1 
ATOM   4901  C  CA   . GLY B  1 34  ? 39.621  116.761 -3.396  1.00 11.85 ? 34  GLY B CA   1 
ATOM   4902  C  C    . GLY B  1 34  ? 39.494  117.872 -2.363  1.00 10.31 ? 34  GLY B C    1 
ATOM   4903  O  O    . GLY B  1 34  ? 38.915  117.684 -1.278  1.00 12.47 ? 34  GLY B O    1 
ATOM   4904  H  H    . GLY B  1 34  ? 40.955  117.339 -4.733  1.00 10.35 ? 34  GLY B H    1 
ATOM   4905  H  HA2  . GLY B  1 34  ? 38.750  116.349 -3.506  1.00 14.23 ? 34  GLY B HA2  1 
ATOM   4906  H  HA3  . GLY B  1 34  ? 40.231  116.092 -3.048  1.00 14.23 ? 34  GLY B HA3  1 
ATOM   4907  N  N    . ASN B  1 35  ? 40.064  119.025 -2.690  1.00 10.81 ? 35  ASN B N    1 
ATOM   4908  C  CA   . ASN B  1 35  ? 40.064  120.176 -1.798  1.00 12.19 ? 35  ASN B CA   1 
ATOM   4909  C  C    . ASN B  1 35  ? 38.703  120.818 -1.686  1.00 13.71 ? 35  ASN B C    1 
ATOM   4910  O  O    . ASN B  1 35  ? 37.884  120.727 -2.593  1.00 12.18 ? 35  ASN B O    1 
ATOM   4911  C  CB   . ASN B  1 35  ? 41.111  121.171 -2.278  1.00 8.33  ? 35  ASN B CB   1 
ATOM   4912  C  CG   . ASN B  1 35  ? 42.454  120.500 -2.459  1.00 9.83  ? 35  ASN B CG   1 
ATOM   4913  O  OD1  . ASN B  1 35  ? 42.758  119.986 -3.552  1.00 6.62  ? 35  ASN B OD1  1 
ATOM   4914  N  ND2  . ASN B  1 35  ? 43.221  120.406 -1.373  1.00 8.93  ? 35  ASN B ND2  1 
ATOM   4915  H  H    . ASN B  1 35  ? 40.465  119.168 -3.437  1.00 12.97 ? 35  ASN B H    1 
ATOM   4916  H  HA   . ASN B  1 35  ? 40.326  119.878 -0.901  1.00 14.63 ? 35  ASN B HA   1 
ATOM   4917  H  HB2  . ASN B  1 35  ? 40.836  121.539 -3.132  1.00 10.00 ? 35  ASN B HB2  1 
ATOM   4918  H  HB3  . ASN B  1 35  ? 41.208  121.877 -1.621  1.00 10.00 ? 35  ASN B HB3  1 
ATOM   4919  H  HD21 . ASN B  1 35  ? 42.943  120.718 -0.622  1.00 10.72 ? 35  ASN B HD21 1 
ATOM   4920  H  HD22 . ASN B  1 35  ? 43.994  120.033 -1.424  1.00 10.72 ? 35  ASN B HD22 1 
ATOM   4921  N  N    . GLN B  1 36  ? 38.460  121.442 -0.542  1.00 11.13 ? 36  GLN B N    1 
ATOM   4922  C  CA   . GLN B  1 36  ? 37.162  122.031 -0.273  1.00 7.81  ? 36  GLN B CA   1 
ATOM   4923  C  C    . GLN B  1 36  ? 37.111  123.452 -0.813  1.00 8.03  ? 36  GLN B C    1 
ATOM   4924  O  O    . GLN B  1 36  ? 38.130  124.110 -0.911  1.00 9.52  ? 36  GLN B O    1 
ATOM   4925  C  CB   . GLN B  1 36  ? 36.957  122.086 1.239   1.00 12.45 ? 36  GLN B CB   1 
ATOM   4926  C  CG   . GLN B  1 36  ? 37.060  120.731 1.916   1.00 13.96 ? 36  GLN B CG   1 
ATOM   4927  C  CD   . GLN B  1 36  ? 35.937  119.829 1.527   1.00 11.58 ? 36  GLN B CD   1 
ATOM   4928  O  OE1  . GLN B  1 36  ? 34.810  120.283 1.320   1.00 18.94 ? 36  GLN B OE1  1 
ATOM   4929  N  NE2  . GLN B  1 36  ? 36.216  118.546 1.442   1.00 14.45 ? 36  GLN B NE2  1 
ATOM   4930  H  H    . GLN B  1 36  ? 39.031  121.537 0.094   1.00 13.35 ? 36  GLN B H    1 
ATOM   4931  H  HA   . GLN B  1 36  ? 36.450  121.497 -0.682  1.00 9.37  ? 36  GLN B HA   1 
ATOM   4932  H  HB2  . GLN B  1 36  ? 37.633  122.664 1.626   1.00 14.93 ? 36  GLN B HB2  1 
ATOM   4933  H  HB3  . GLN B  1 36  ? 36.074  122.443 1.422   1.00 14.93 ? 36  GLN B HB3  1 
ATOM   4934  H  HG2  . GLN B  1 36  ? 37.893  120.308 1.656   1.00 16.75 ? 36  GLN B HG2  1 
ATOM   4935  H  HG3  . GLN B  1 36  ? 37.031  120.852 2.878   1.00 16.75 ? 36  GLN B HG3  1 
ATOM   4936  H  HE21 . GLN B  1 36  ? 37.012  118.267 1.607   1.00 17.34 ? 36  GLN B HE21 1 
ATOM   4937  H  HE22 . GLN B  1 36  ? 35.601  117.987 1.221   1.00 17.34 ? 36  GLN B HE22 1 
ATOM   4938  N  N    . PRO B  1 37  ? 35.903  123.957 -1.063  1.00 8.15  ? 37  PRO B N    1 
ATOM   4939  C  CA   . PRO B  1 37  ? 35.720  125.364 -1.418  1.00 16.82 ? 37  PRO B CA   1 
ATOM   4940  C  C    . PRO B  1 37  ? 36.496  126.283 -0.488  1.00 10.62 ? 37  PRO B C    1 
ATOM   4941  O  O    . PRO B  1 37  ? 36.474  126.071 0.740   1.00 13.17 ? 37  PRO B O    1 
ATOM   4942  C  CB   . PRO B  1 37  ? 34.204  125.561 -1.269  1.00 18.38 ? 37  PRO B CB   1 
ATOM   4943  C  CG   . PRO B  1 37  ? 33.639  124.220 -1.575  1.00 10.89 ? 37  PRO B CG   1 
ATOM   4944  C  CD   . PRO B  1 37  ? 34.615  123.245 -0.975  1.00 11.93 ? 37  PRO B CD   1 
ATOM   4945  H  HA   . PRO B  1 37  ? 35.987  125.526 -2.347  1.00 20.18 ? 37  PRO B HA   1 
ATOM   4946  H  HB2  . PRO B  1 37  ? 33.992  125.827 -0.361  1.00 22.06 ? 37  PRO B HB2  1 
ATOM   4947  H  HB3  . PRO B  1 37  ? 33.892  126.222 -1.907  1.00 22.06 ? 37  PRO B HB3  1 
ATOM   4948  H  HG2  . PRO B  1 37  ? 32.766  124.130 -1.162  1.00 13.07 ? 37  PRO B HG2  1 
ATOM   4949  H  HG3  . PRO B  1 37  ? 33.580  124.100 -2.536  1.00 13.07 ? 37  PRO B HG3  1 
ATOM   4950  H  HD2  . PRO B  1 37  ? 34.389  123.067 -0.049  1.00 14.32 ? 37  PRO B HD2  1 
ATOM   4951  H  HD3  . PRO B  1 37  ? 34.643  122.429 -1.499  1.00 14.32 ? 37  PRO B HD3  1 
ATOM   4952  N  N    . GLY B  1 38  ? 37.212  127.248 -1.075  1.00 10.13 ? 38  GLY B N    1 
ATOM   4953  C  CA   . GLY B  1 38  ? 37.930  128.264 -0.314  1.00 15.75 ? 38  GLY B CA   1 
ATOM   4954  C  C    . GLY B  1 38  ? 39.394  127.937 -0.088  1.00 13.76 ? 38  GLY B C    1 
ATOM   4955  O  O    . GLY B  1 38  ? 40.199  128.820 0.228   1.00 10.55 ? 38  GLY B O    1 
ATOM   4956  H  H    . GLY B  1 38  ? 37.296  127.333 -1.926  1.00 12.15 ? 38  GLY B H    1 
ATOM   4957  H  HA2  . GLY B  1 38  ? 37.878  129.110 -0.785  1.00 18.90 ? 38  GLY B HA2  1 
ATOM   4958  H  HA3  . GLY B  1 38  ? 37.506  128.372 0.552   1.00 18.90 ? 38  GLY B HA3  1 
ATOM   4959  N  N    . GLU B  1 39  ? 39.760  126.665 -0.250  1.00 9.68  ? 39  GLU B N    1 
ATOM   4960  C  CA   . GLU B  1 39  ? 41.166  126.275 -0.165  1.00 6.97  ? 39  GLU B CA   1 
ATOM   4961  C  C    . GLU B  1 39  ? 41.955  126.838 -1.356  1.00 8.88  ? 39  GLU B C    1 
ATOM   4962  O  O    . GLU B  1 39  ? 41.384  127.138 -2.399  1.00 8.66  ? 39  GLU B O    1 
ATOM   4963  C  CB   . GLU B  1 39  ? 41.304  124.756 -0.111  1.00 8.50  ? 39  GLU B CB   1 
ATOM   4964  C  CG   . GLU B  1 39  ? 41.112  124.078 1.243   1.00 9.60  ? 39  GLU B CG   1 
ATOM   4965  C  CD   . GLU B  1 39  ? 41.409  122.606 1.099   1.00 10.06 ? 39  GLU B CD   1 
ATOM   4966  O  OE1  . GLU B  1 39  ? 42.531  122.285 0.653   1.00 9.76  ? 39  GLU B OE1  1 
ATOM   4967  O  OE2  . GLU B  1 39  ? 40.520  121.779 1.379   1.00 13.80 ? 39  GLU B OE2  1 
ATOM   4968  H  H    . GLU B  1 39  ? 39.219  126.016 -0.410  1.00 11.61 ? 39  GLU B H    1 
ATOM   4969  H  HA   . GLU B  1 39  ? 41.551  126.645 0.657   1.00 8.36  ? 39  GLU B HA   1 
ATOM   4970  H  HB2  . GLU B  1 39  ? 40.649  124.374 -0.715  1.00 10.20 ? 39  GLU B HB2  1 
ATOM   4971  H  HB3  . GLU B  1 39  ? 42.194  124.525 -0.420  1.00 10.20 ? 39  GLU B HB3  1 
ATOM   4972  H  HG2  . GLU B  1 39  ? 41.725  124.459 1.891   1.00 11.52 ? 39  GLU B HG2  1 
ATOM   4973  H  HG3  . GLU B  1 39  ? 40.193  124.184 1.536   1.00 11.52 ? 39  GLU B HG3  1 
ATOM   4974  N  N    . PRO B  1 40  ? 43.283  126.979 -1.210  1.00 9.44  ? 40  PRO B N    1 
ATOM   4975  C  CA   . PRO B  1 40  ? 44.079  127.505 -2.330  1.00 5.45  ? 40  PRO B CA   1 
ATOM   4976  C  C    . PRO B  1 40  ? 43.884  126.783 -3.654  1.00 5.39  ? 40  PRO B C    1 
ATOM   4977  O  O    . PRO B  1 40  ? 43.835  127.439 -4.700  1.00 5.69  ? 40  PRO B O    1 
ATOM   4978  C  CB   . PRO B  1 40  ? 45.528  127.355 -1.837  1.00 4.86  ? 40  PRO B CB   1 
ATOM   4979  C  CG   . PRO B  1 40  ? 45.391  127.400 -0.356  1.00 11.49 ? 40  PRO B CG   1 
ATOM   4980  C  CD   . PRO B  1 40  ? 44.086  126.797 -0.000  1.00 15.05 ? 40  PRO B CD   1 
ATOM   4981  H  HA   . PRO B  1 40  ? 43.884  128.457 -2.458  1.00 6.53  ? 40  PRO B HA   1 
ATOM   4982  H  HB2  . PRO B  1 40  ? 45.892  126.504 -2.128  1.00 5.83  ? 40  PRO B HB2  1 
ATOM   4983  H  HB3  . PRO B  1 40  ? 46.067  128.095 -2.160  1.00 5.83  ? 40  PRO B HB3  1 
ATOM   4984  H  HG2  . PRO B  1 40  ? 46.114  126.893 0.046   1.00 13.79 ? 40  PRO B HG2  1 
ATOM   4985  H  HG3  . PRO B  1 40  ? 45.425  128.323 -0.061  1.00 13.79 ? 40  PRO B HG3  1 
ATOM   4986  H  HD2  . PRO B  1 40  ? 44.192  125.853 0.196   1.00 18.06 ? 40  PRO B HD2  1 
ATOM   4987  H  HD3  . PRO B  1 40  ? 43.686  127.273 0.745   1.00 18.06 ? 40  PRO B HD3  1 
ATOM   4988  N  N    . ILE B  1 41  ? 43.762  125.464 -3.639  1.00 9.12  ? 41  ILE B N    1 
ATOM   4989  C  CA   . ILE B  1 41  ? 43.609  124.770 -4.898  1.00 7.91  ? 41  ILE B CA   1 
ATOM   4990  C  C    . ILE B  1 41  ? 42.280  125.158 -5.535  1.00 6.13  ? 41  ILE B C    1 
ATOM   4991  O  O    . ILE B  1 41  ? 42.199  125.316 -6.751  1.00 11.37 ? 41  ILE B O    1 
ATOM   4992  C  CB   . ILE B  1 41  ? 43.664  123.231 -4.723  1.00 10.10 ? 41  ILE B CB   1 
ATOM   4993  C  CG1  . ILE B  1 41  ? 45.101  122.782 -4.435  1.00 7.36  ? 41  ILE B CG1  1 
ATOM   4994  C  CG2  . ILE B  1 41  ? 43.197  122.566 -5.996  1.00 6.46  ? 41  ILE B CG2  1 
ATOM   4995  C  CD1  . ILE B  1 41  ? 46.016  122.881 -5.650  1.00 17.67 ? 41  ILE B CD1  1 
ATOM   4996  H  H    . ILE B  1 41  ? 43.765  124.965 -2.939  1.00 10.95 ? 41  ILE B H    1 
ATOM   4997  H  HA   . ILE B  1 41  ? 44.331  125.037 -5.505  1.00 9.49  ? 41  ILE B HA   1 
ATOM   4998  H  HB   . ILE B  1 41  ? 43.088  122.967 -3.989  1.00 12.12 ? 41  ILE B HB   1 
ATOM   4999  H  HG12 . ILE B  1 41  ? 45.471  123.344 -3.736  1.00 8.83  ? 41  ILE B HG12 1 
ATOM   5000  H  HG13 . ILE B  1 41  ? 45.089  121.857 -4.144  1.00 8.83  ? 41  ILE B HG13 1 
ATOM   5001  H  HG21 . ILE B  1 41  ? 43.233  121.614 -5.882  1.00 7.76  ? 41  ILE B HG21 1 
ATOM   5002  H  HG22 . ILE B  1 41  ? 42.295  122.841 -6.179  1.00 7.76  ? 41  ILE B HG22 1 
ATOM   5003  H  HG23 . ILE B  1 41  ? 43.773  122.832 -6.716  1.00 7.76  ? 41  ILE B HG23 1 
ATOM   5004  H  HD11 . ILE B  1 41  ? 46.896  122.586 -5.402  1.00 21.21 ? 41  ILE B HD11 1 
ATOM   5005  H  HD12 . ILE B  1 41  ? 45.668  122.322 -6.349  1.00 21.21 ? 41  ILE B HD12 1 
ATOM   5006  H  HD13 . ILE B  1 41  ? 46.047  123.794 -5.944  1.00 21.21 ? 41  ILE B HD13 1 
ATOM   5007  N  N    . ASP B  1 42  ? 41.245  125.305 -4.707  1.00 10.22 ? 42  ASP B N    1 
ATOM   5008  C  CA   . ASP B  1 42  ? 39.921  125.702 -5.197  1.00 10.04 ? 42  ASP B CA   1 
ATOM   5009  C  C    . ASP B  1 42  ? 39.941  127.118 -5.791  1.00 7.33  ? 42  ASP B C    1 
ATOM   5010  O  O    . ASP B  1 42  ? 39.343  127.377 -6.835  1.00 12.31 ? 42  ASP B O    1 
ATOM   5011  C  CB   . ASP B  1 42  ? 38.908  125.636 -4.067  1.00 7.86  ? 42  ASP B CB   1 
ATOM   5012  C  CG   . ASP B  1 42  ? 37.494  125.990 -4.508  1.00 14.30 ? 42  ASP B CG   1 
ATOM   5013  O  OD1  . ASP B  1 42  ? 36.906  125.214 -5.291  1.00 13.76 ? 42  ASP B OD1  1 
ATOM   5014  O  OD2  . ASP B  1 42  ? 36.966  127.043 -4.053  1.00 11.32 ? 42  ASP B OD2  1 
ATOM   5015  H  H    . ASP B  1 42  ? 41.282  125.182 -3.856  1.00 12.26 ? 42  ASP B H    1 
ATOM   5016  H  HA   . ASP B  1 42  ? 39.637  125.079 -5.899  1.00 12.04 ? 42  ASP B HA   1 
ATOM   5017  H  HB2  . ASP B  1 42  ? 38.892  124.734 -3.711  1.00 9.43  ? 42  ASP B HB2  1 
ATOM   5018  H  HB3  . ASP B  1 42  ? 39.170  126.261 -3.373  1.00 9.43  ? 42  ASP B HB3  1 
ATOM   5019  N  N    . LYS B  1 43  ? 40.618  128.038 -5.119  1.00 9.53  ? 43  LYS B N    1 
ATOM   5020  C  CA   . LYS B  1 43  ? 40.771  129.403 -5.651  1.00 9.75  ? 43  LYS B CA   1 
ATOM   5021  C  C    . LYS B  1 43  ? 41.537  129.436 -6.983  1.00 10.15 ? 43  LYS B C    1 
ATOM   5022  O  O    . LYS B  1 43  ? 41.169  130.177 -7.907  1.00 8.02  ? 43  LYS B O    1 
ATOM   5023  C  CB   . LYS B  1 43  ? 41.450  130.304 -4.621  1.00 14.73 ? 43  LYS B CB   1 
ATOM   5024  C  CG   . LYS B  1 43  ? 40.604  130.564 -3.399  1.00 12.51 ? 43  LYS B CG   1 
ATOM   5025  C  CD   . LYS B  1 43  ? 41.111  131.752 -2.601  1.00 15.91 ? 43  LYS B CD   1 
ATOM   5026  C  CE   . LYS B  1 43  ? 40.196  132.033 -1.411  1.00 23.29 ? 43  LYS B CE   1 
ATOM   5027  N  NZ   . LYS B  1 43  ? 40.639  133.177 -0.553  1.00 25.19 ? 43  LYS B NZ   1 
ATOM   5028  H  H    . LYS B  1 43  ? 40.998  127.908 -4.359  1.00 11.43 ? 43  LYS B H    1 
ATOM   5029  H  HA   . LYS B  1 43  ? 39.879  129.771 -5.818  1.00 11.70 ? 43  LYS B HA   1 
ATOM   5030  H  HB2  . LYS B  1 43  ? 42.273  129.881 -4.329  1.00 17.67 ? 43  LYS B HB2  1 
ATOM   5031  H  HB3  . LYS B  1 43  ? 41.648  131.159 -5.034  1.00 17.67 ? 43  LYS B HB3  1 
ATOM   5032  H  HG2  . LYS B  1 43  ? 39.693  130.752 -3.676  1.00 15.02 ? 43  LYS B HG2  1 
ATOM   5033  H  HG3  . LYS B  1 43  ? 40.624  129.783 -2.825  1.00 15.02 ? 43  LYS B HG3  1 
ATOM   5034  H  HD2  . LYS B  1 43  ? 42.000  131.559 -2.266  1.00 19.09 ? 43  LYS B HD2  1 
ATOM   5035  H  HD3  . LYS B  1 43  ? 41.126  132.538 -3.169  1.00 19.09 ? 43  LYS B HD3  1 
ATOM   5036  H  HE2  . LYS B  1 43  ? 39.308  132.239 -1.743  1.00 27.95 ? 43  LYS B HE2  1 
ATOM   5037  H  HE3  . LYS B  1 43  ? 40.161  131.241 -0.852  1.00 27.95 ? 43  LYS B HE3  1 
ATOM   5038  H  HZ1  . LYS B  1 43  ? 40.069  133.291 0.120   1.00 30.23 ? 43  LYS B HZ1  1 
ATOM   5039  H  HZ2  . LYS B  1 43  ? 41.449  133.013 -0.222  1.00 30.23 ? 43  LYS B HZ2  1 
ATOM   5040  H  HZ3  . LYS B  1 43  ? 40.670  133.925 -1.035  1.00 30.23 ? 43  LYS B HZ3  1 
ATOM   5041  N  N    . ALA B  1 44  ? 42.610  128.655 -7.060  1.00 9.55  ? 44  ALA B N    1 
ATOM   5042  C  CA   . ALA B  1 44  ? 43.403  128.541 -8.266  1.00 9.50  ? 44  ALA B CA   1 
ATOM   5043  C  C    . ALA B  1 44  ? 42.549  127.971 -9.394  1.00 11.12 ? 44  ALA B C    1 
ATOM   5044  O  O    . ALA B  1 44  ? 42.693  128.354 -10.574 1.00 11.43 ? 44  ALA B O    1 
ATOM   5045  C  CB   . ALA B  1 44  ? 44.618  127.664 -8.011  1.00 10.14 ? 44  ALA B CB   1 
ATOM   5046  H  H    . ALA B  1 44  ? 42.901  128.174 -6.409  1.00 11.46 ? 44  ALA B H    1 
ATOM   5047  H  HA   . ALA B  1 44  ? 43.715  129.430 -8.535  1.00 11.40 ? 44  ALA B HA   1 
ATOM   5048  H  HB1  . ALA B  1 44  ? 45.131  127.599 -8.820  1.00 12.17 ? 44  ALA B HB1  1 
ATOM   5049  H  HB2  . ALA B  1 44  ? 45.149  128.062 -7.317  1.00 12.17 ? 44  ALA B HB2  1 
ATOM   5050  H  HB3  . ALA B  1 44  ? 44.322  126.792 -7.739  1.00 12.17 ? 44  ALA B HB3  1 
ATOM   5051  N  N    . MET B  1 45  ? 41.676  127.021 -9.061  1.00 10.51 ? 45  MET B N    1 
ATOM   5052  C  CA   . MET B  1 45  ? 40.855  126.410 -10.081 1.00 16.09 ? 45  MET B CA   1 
ATOM   5053  C  C    . MET B  1 45  ? 39.854  127.444 -10.593 1.00 14.35 ? 45  MET B C    1 
ATOM   5054  O  O    . MET B  1 45  ? 39.587  127.529 -11.787 1.00 11.09 ? 45  MET B O    1 
ATOM   5055  C  CB   . MET B  1 45  ? 40.175  125.133 -9.580  1.00 9.39  ? 45  MET B CB   1 
ATOM   5056  C  CG   . MET B  1 45  ? 41.165  124.023 -9.312  1.00 8.62  ? 45  MET B CG   1 
ATOM   5057  S  SD   . MET B  1 45  ? 42.105  123.517 -10.772 1.00 9.66  ? 45  MET B SD   1 
ATOM   5058  C  CE   . MET B  1 45  ? 43.738  124.141 -10.390 1.00 6.18  ? 45  MET B CE   1 
ATOM   5059  H  H    . MET B  1 45  ? 41.548  126.722 -8.265  1.00 12.61 ? 45  MET B H    1 
ATOM   5060  H  HA   . MET B  1 45  ? 41.436  126.153 -10.827 1.00 19.31 ? 45  MET B HA   1 
ATOM   5061  H  HB2  . MET B  1 45  ? 39.707  125.326 -8.753  1.00 11.27 ? 45  MET B HB2  1 
ATOM   5062  H  HB3  . MET B  1 45  ? 39.548  124.823 -10.252 1.00 11.27 ? 45  MET B HB3  1 
ATOM   5063  H  HG2  . MET B  1 45  ? 41.798  124.323 -8.641  1.00 10.34 ? 45  MET B HG2  1 
ATOM   5064  H  HG3  . MET B  1 45  ? 40.683  123.246 -8.986  1.00 10.34 ? 45  MET B HG3  1 
ATOM   5065  H  HE1  . MET B  1 45  ? 44.332  123.924 -11.112 1.00 7.42  ? 45  MET B HE1  1 
ATOM   5066  H  HE2  . MET B  1 45  ? 43.690  125.093 -10.279 1.00 7.42  ? 45  MET B HE2  1 
ATOM   5067  H  HE3  . MET B  1 45  ? 44.046  123.732 -9.578  1.00 7.42  ? 45  MET B HE3  1 
ATOM   5068  N  N    . HIS B  1 46  ? 39.338  128.278 -9.697  1.00 11.35 ? 46  HIS B N    1 
ATOM   5069  C  CA   . HIS B  1 46  ? 38.463  129.347 -10.156 1.00 12.33 ? 46  HIS B CA   1 
ATOM   5070  C  C    . HIS B  1 46  ? 39.195  130.367 -11.036 1.00 11.67 ? 46  HIS B C    1 
ATOM   5071  O  O    . HIS B  1 46  ? 38.640  130.825 -12.007 1.00 12.38 ? 46  HIS B O    1 
ATOM   5072  C  CB   . HIS B  1 46  ? 37.788  130.047 -8.974  1.00 10.87 ? 46  HIS B CB   1 
ATOM   5073  C  CG   . HIS B  1 46  ? 36.572  129.328 -8.493  1.00 24.07 ? 46  HIS B CG   1 
ATOM   5074  N  ND1  . HIS B  1 46  ? 36.606  128.429 -7.449  1.00 27.18 ? 46  HIS B ND1  1 
ATOM   5075  C  CD2  . HIS B  1 46  ? 35.289  129.358 -8.926  1.00 19.03 ? 46  HIS B CD2  1 
ATOM   5076  C  CE1  . HIS B  1 46  ? 35.393  127.946 -7.248  1.00 21.48 ? 46  HIS B CE1  1 
ATOM   5077  N  NE2  . HIS B  1 46  ? 34.575  128.494 -8.129  1.00 27.76 ? 46  HIS B NE2  1 
ATOM   5078  H  H    . HIS B  1 46  ? 39.472  128.249 -8.848  1.00 13.61 ? 46  HIS B H    1 
ATOM   5079  H  HA   . HIS B  1 46  ? 37.754  128.949 -10.703 1.00 14.79 ? 46  HIS B HA   1 
ATOM   5080  H  HB2  . HIS B  1 46  ? 38.416  130.099 -8.237  1.00 13.04 ? 46  HIS B HB2  1 
ATOM   5081  H  HB3  . HIS B  1 46  ? 37.521  130.939 -9.246  1.00 13.04 ? 46  HIS B HB3  1 
ATOM   5082  H  HD1  . HIS B  1 46  ? 37.305  128.222 -6.994  1.00 32.62 ? 46  HIS B HD1  1 
ATOM   5083  H  HD2  . HIS B  1 46  ? 34.952  129.873 -9.622  1.00 22.83 ? 46  HIS B HD2  1 
ATOM   5084  H  HE1  . HIS B  1 46  ? 35.156  127.325 -6.598  1.00 25.78 ? 46  HIS B HE1  1 
ATOM   5085  H  HE2  . HIS B  1 46  ? 33.733  128.333 -8.197  1.00 33.31 ? 46  HIS B HE2  1 
ATOM   5086  N  N    . PHE B  1 47  ? 40.424  130.728 -10.669 1.00 10.56 ? 47  PHE B N    1 
ATOM   5087  C  CA   . PHE B  1 47  ? 41.270  131.570 -11.517 1.00 9.55  ? 47  PHE B CA   1 
ATOM   5088  C  C    . PHE B  1 47  ? 41.410  130.969 -12.910 1.00 13.43 ? 47  PHE B C    1 
ATOM   5089  O  O    . PHE B  1 47  ? 41.242  131.657 -13.933 1.00 12.04 ? 47  PHE B O    1 
ATOM   5090  C  CB   . PHE B  1 47  ? 42.664  131.686 -10.894 1.00 9.02  ? 47  PHE B CB   1 
ATOM   5091  C  CG   . PHE B  1 47  ? 43.581  132.601 -11.627 1.00 12.55 ? 47  PHE B CG   1 
ATOM   5092  C  CD1  . PHE B  1 47  ? 44.301  132.160 -12.719 1.00 10.39 ? 47  PHE B CD1  1 
ATOM   5093  C  CD2  . PHE B  1 47  ? 43.702  133.918 -11.232 1.00 12.34 ? 47  PHE B CD2  1 
ATOM   5094  C  CE1  . PHE B  1 47  ? 45.148  133.006 -13.404 1.00 14.67 ? 47  PHE B CE1  1 
ATOM   5095  C  CE2  . PHE B  1 47  ? 44.535  134.775 -11.909 1.00 17.04 ? 47  PHE B CE2  1 
ATOM   5096  C  CZ   . PHE B  1 47  ? 45.263  134.329 -13.000 1.00 15.17 ? 47  PHE B CZ   1 
ATOM   5097  H  H    . PHE B  1 47  ? 40.794  130.498 -9.928  1.00 12.68 ? 47  PHE B H    1 
ATOM   5098  H  HA   . PHE B  1 47  ? 40.880  132.466 -11.595 1.00 11.46 ? 47  PHE B HA   1 
ATOM   5099  H  HB2  . PHE B  1 47  ? 42.574  132.021 -9.989  1.00 10.83 ? 47  PHE B HB2  1 
ATOM   5100  H  HB3  . PHE B  1 47  ? 43.073  130.807 -10.880 1.00 10.83 ? 47  PHE B HB3  1 
ATOM   5101  H  HD1  . PHE B  1 47  ? 44.223  131.274 -12.990 1.00 12.47 ? 47  PHE B HD1  1 
ATOM   5102  H  HD2  . PHE B  1 47  ? 43.216  134.228 -10.502 1.00 14.80 ? 47  PHE B HD2  1 
ATOM   5103  H  HE1  . PHE B  1 47  ? 45.630  132.695 -14.136 1.00 17.61 ? 47  PHE B HE1  1 
ATOM   5104  H  HE2  . PHE B  1 47  ? 44.612  135.659 -11.632 1.00 20.45 ? 47  PHE B HE2  1 
ATOM   5105  H  HZ   . PHE B  1 47  ? 45.830  134.910 -13.453 1.00 18.20 ? 47  PHE B HZ   1 
ATOM   5106  N  N    . TRP B  1 48  ? 41.736  129.681 -12.963 1.00 8.34  ? 48  TRP B N    1 
ATOM   5107  C  CA   . TRP B  1 48  ? 41.958  129.013 -14.255 1.00 8.25  ? 48  TRP B CA   1 
ATOM   5108  C  C    . TRP B  1 48  ? 40.675  129.030 -15.083 1.00 8.99  ? 48  TRP B C    1 
ATOM   5109  O  O    . TRP B  1 48  ? 40.684  129.363 -16.290 1.00 9.35  ? 48  TRP B O    1 
ATOM   5110  C  CB   . TRP B  1 48  ? 42.396  127.593 -13.975 1.00 11.42 ? 48  TRP B CB   1 
ATOM   5111  C  CG   . TRP B  1 48  ? 43.079  126.874 -15.121 1.00 7.26  ? 48  TRP B CG   1 
ATOM   5112  C  CD1  . TRP B  1 48  ? 43.491  127.382 -16.340 1.00 7.49  ? 48  TRP B CD1  1 
ATOM   5113  C  CD2  . TRP B  1 48  ? 43.437  125.503 -15.114 1.00 10.45 ? 48  TRP B CD2  1 
ATOM   5114  N  NE1  . TRP B  1 48  ? 44.082  126.366 -17.082 1.00 7.86  ? 48  TRP B NE1  1 
ATOM   5115  C  CE2  . TRP B  1 48  ? 44.057  125.211 -16.342 1.00 6.63  ? 48  TRP B CE2  1 
ATOM   5116  C  CE3  . TRP B  1 48  ? 43.283  124.483 -14.189 1.00 9.58  ? 48  TRP B CE3  1 
ATOM   5117  C  CZ2  . TRP B  1 48  ? 44.531  123.938 -16.647 1.00 9.78  ? 48  TRP B CZ2  1 
ATOM   5118  C  CZ3  . TRP B  1 48  ? 43.750  123.217 -14.509 1.00 8.81  ? 48  TRP B CZ3  1 
ATOM   5119  C  CH2  . TRP B  1 48  ? 44.365  122.962 -15.721 1.00 13.50 ? 48  TRP B CH2  1 
ATOM   5120  H  H    . TRP B  1 48  ? 41.836  129.171 -12.277 1.00 10.01 ? 48  TRP B H    1 
ATOM   5121  H  HA   . TRP B  1 48  ? 42.666  129.473 -14.753 1.00 9.90  ? 48  TRP B HA   1 
ATOM   5122  H  HB2  . TRP B  1 48  ? 43.017  127.606 -13.229 1.00 13.71 ? 48  TRP B HB2  1 
ATOM   5123  H  HB3  . TRP B  1 48  ? 41.613  127.074 -13.733 1.00 13.71 ? 48  TRP B HB3  1 
ATOM   5124  H  HD1  . TRP B  1 48  ? 43.391  128.264 -16.618 1.00 8.99  ? 48  TRP B HD1  1 
ATOM   5125  H  HE1  . TRP B  1 48  ? 44.416  126.449 -17.870 1.00 9.43  ? 48  TRP B HE1  1 
ATOM   5126  H  HE3  . TRP B  1 48  ? 42.877  124.645 -13.367 1.00 11.49 ? 48  TRP B HE3  1 
ATOM   5127  H  HZ2  . TRP B  1 48  ? 44.934  123.759 -17.466 1.00 11.73 ? 48  TRP B HZ2  1 
ATOM   5128  H  HZ3  . TRP B  1 48  ? 43.658  122.528 -13.891 1.00 10.57 ? 48  TRP B HZ3  1 
ATOM   5129  H  HH2  . TRP B  1 48  ? 44.667  122.102 -15.906 1.00 16.19 ? 48  TRP B HH2  1 
ATOM   5130  N  N    . ALA B  1 49  ? 39.567  128.704 -14.433 1.00 10.88 ? 49  ALA B N    1 
ATOM   5131  C  CA   . ALA B  1 49  ? 38.269  128.669 -15.090 1.00 19.02 ? 49  ALA B CA   1 
ATOM   5132  C  C    . ALA B  1 49  ? 37.934  130.049 -15.673 1.00 19.72 ? 49  ALA B C    1 
ATOM   5133  O  O    . ALA B  1 49  ? 37.576  130.178 -16.858 1.00 15.15 ? 49  ALA B O    1 
ATOM   5134  C  CB   . ALA B  1 49  ? 37.217  128.220 -14.134 1.00 14.53 ? 49  ALA B CB   1 
ATOM   5135  H  H    . ALA B  1 49  ? 39.540  128.497 -13.599 1.00 13.06 ? 49  ALA B H    1 
ATOM   5136  H  HA   . ALA B  1 49  ? 38.302  128.027 -15.829 1.00 22.82 ? 49  ALA B HA   1 
ATOM   5137  H  HB1  . ALA B  1 49  ? 36.371  128.203 -14.586 1.00 17.44 ? 49  ALA B HB1  1 
ATOM   5138  H  HB2  . ALA B  1 49  ? 37.438  127.340 -13.818 1.00 17.44 ? 49  ALA B HB2  1 
ATOM   5139  H  HB3  . ALA B  1 49  ? 37.183  128.833 -13.396 1.00 17.44 ? 49  ALA B HB3  1 
ATOM   5140  N  N    . ASP B  1 50  ? 38.093  131.085 -14.856 1.00 18.14 ? 50  ASP B N    1 
ATOM   5141  C  CA   . ASP B  1 50  ? 37.762  132.425 -15.306 1.00 21.61 ? 50  ASP B CA   1 
ATOM   5142  C  C    . ASP B  1 50  ? 38.634  132.814 -16.506 1.00 17.81 ? 50  ASP B C    1 
ATOM   5143  O  O    . ASP B  1 50  ? 38.126  133.360 -17.476 1.00 18.97 ? 50  ASP B O    1 
ATOM   5144  C  CB   . ASP B  1 50  ? 37.903  133.459 -14.173 1.00 17.54 ? 50  ASP B CB   1 
ATOM   5145  C  CG   . ASP B  1 50  ? 36.899  133.257 -13.053 1.00 22.55 ? 50  ASP B CG   1 
ATOM   5146  O  OD1  . ASP B  1 50  ? 35.934  132.477 -13.201 1.00 20.14 ? 50  ASP B OD1  1 
ATOM   5147  O  OD2  . ASP B  1 50  ? 37.074  133.917 -12.014 1.00 21.44 ? 50  ASP B OD2  1 
ATOM   5148  H  H    . ASP B  1 50  ? 38.386  131.037 -14.049 1.00 21.77 ? 50  ASP B H    1 
ATOM   5149  H  HA   . ASP B  1 50  ? 36.828  132.434 -15.602 1.00 25.94 ? 50  ASP B HA   1 
ATOM   5150  H  HB2  . ASP B  1 50  ? 38.792  133.389 -13.792 1.00 21.05 ? 50  ASP B HB2  1 
ATOM   5151  H  HB3  . ASP B  1 50  ? 37.768  134.347 -14.539 1.00 21.05 ? 50  ASP B HB3  1 
ATOM   5152  N  N    . LYS B  1 51  ? 39.941  132.540 -16.430 1.00 12.45 ? 51  LYS B N    1 
ATOM   5153  C  CA   . LYS B  1 51  ? 40.875  132.933 -17.472 1.00 11.04 ? 51  LYS B CA   1 
ATOM   5154  C  C    . LYS B  1 51  ? 40.572  132.238 -18.773 1.00 19.74 ? 51  LYS B C    1 
ATOM   5155  O  O    . LYS B  1 51  ? 40.639  132.852 -19.845 1.00 13.53 ? 51  LYS B O    1 
ATOM   5156  C  CB   . LYS B  1 51  ? 42.314  132.629 -17.046 1.00 10.17 ? 51  LYS B CB   1 
ATOM   5157  C  CG   . LYS B  1 51  ? 43.386  133.157 -17.948 1.00 16.04 ? 51  LYS B CG   1 
ATOM   5158  C  CD   . LYS B  1 51  ? 43.309  134.681 -18.124 1.00 28.64 ? 51  LYS B CD   1 
ATOM   5159  C  CE   . LYS B  1 51  ? 43.558  135.449 -16.825 1.00 35.33 ? 51  LYS B CE   1 
ATOM   5160  N  NZ   . LYS B  1 51  ? 44.963  135.345 -16.348 1.00 48.57 ? 51  LYS B NZ   1 
ATOM   5161  H  H    . LYS B  1 51  ? 40.309  132.122 -15.774 1.00 14.94 ? 51  LYS B H    1 
ATOM   5162  H  HA   . LYS B  1 51  ? 40.799  133.899 -17.619 1.00 13.25 ? 51  LYS B HA   1 
ATOM   5163  H  HB2  . LYS B  1 51  ? 42.460  133.013 -16.167 1.00 12.20 ? 51  LYS B HB2  1 
ATOM   5164  H  HB3  . LYS B  1 51  ? 42.422  131.666 -17.000 1.00 12.20 ? 51  LYS B HB3  1 
ATOM   5165  H  HG2  . LYS B  1 51  ? 44.253  132.941 -17.569 1.00 19.25 ? 51  LYS B HG2  1 
ATOM   5166  H  HG3  . LYS B  1 51  ? 43.294  132.747 -18.822 1.00 19.25 ? 51  LYS B HG3  1 
ATOM   5167  H  HD2  . LYS B  1 51  ? 43.979  134.958 -18.769 1.00 34.37 ? 51  LYS B HD2  1 
ATOM   5168  H  HD3  . LYS B  1 51  ? 42.424  134.916 -18.445 1.00 34.37 ? 51  LYS B HD3  1 
ATOM   5169  H  HE2  . LYS B  1 51  ? 43.361  136.387 -16.972 1.00 42.40 ? 51  LYS B HE2  1 
ATOM   5170  H  HE3  . LYS B  1 51  ? 42.980  135.093 -16.133 1.00 42.40 ? 51  LYS B HE3  1 
ATOM   5171  H  HZ1  . LYS B  1 51  ? 45.062  135.805 -15.593 1.00 58.29 ? 51  LYS B HZ1  1 
ATOM   5172  H  HZ2  . LYS B  1 51  ? 45.170  134.493 -16.197 1.00 58.29 ? 51  LYS B HZ2  1 
ATOM   5173  H  HZ3  . LYS B  1 51  ? 45.518  135.673 -16.962 1.00 58.29 ? 51  LYS B HZ3  1 
ATOM   5174  N  N    . VAL B  1 52  ? 40.256  130.951 -18.686 1.00 14.21 ? 52  VAL B N    1 
ATOM   5175  C  CA   . VAL B  1 52  ? 39.975  130.181 -19.870 1.00 11.75 ? 52  VAL B CA   1 
ATOM   5176  C  C    . VAL B  1 52  ? 38.733  130.694 -20.574 1.00 16.88 ? 52  VAL B C    1 
ATOM   5177  O  O    . VAL B  1 52  ? 38.714  130.837 -21.809 1.00 13.35 ? 52  VAL B O    1 
ATOM   5178  C  CB   . VAL B  1 52  ? 39.871  128.684 -19.540 1.00 13.68 ? 52  VAL B CB   1 
ATOM   5179  C  CG1  . VAL B  1 52  ? 39.190  127.947 -20.644 1.00 24.26 ? 52  VAL B CG1  1 
ATOM   5180  C  CG2  . VAL B  1 52  ? 41.264  128.119 -19.331 1.00 12.83 ? 52  VAL B CG2  1 
ATOM   5181  H  H    . VAL B  1 52  ? 40.199  130.509 -17.951 1.00 17.06 ? 52  VAL B H    1 
ATOM   5182  H  HA   . VAL B  1 52  ? 40.725  130.289 -20.491 1.00 14.10 ? 52  VAL B HA   1 
ATOM   5183  H  HB   . VAL B  1 52  ? 39.355  128.562 -18.716 1.00 16.42 ? 52  VAL B HB   1 
ATOM   5184  H  HG11 . VAL B  1 52  ? 39.138  127.016 -20.412 1.00 29.11 ? 52  VAL B HG11 1 
ATOM   5185  H  HG12 . VAL B  1 52  ? 38.307  128.305 -20.760 1.00 29.11 ? 52  VAL B HG12 1 
ATOM   5186  H  HG13 . VAL B  1 52  ? 39.697  128.056 -21.452 1.00 29.11 ? 52  VAL B HG13 1 
ATOM   5187  H  HG21 . VAL B  1 52  ? 41.194  127.184 -19.125 1.00 15.39 ? 52  VAL B HG21 1 
ATOM   5188  H  HG22 . VAL B  1 52  ? 41.774  128.241 -20.135 1.00 15.39 ? 52  VAL B HG22 1 
ATOM   5189  H  HG23 . VAL B  1 52  ? 41.683  128.584 -18.604 1.00 15.39 ? 52  VAL B HG23 1 
ATOM   5190  N  N    . LYS B  1 53  ? 37.722  131.025 -19.788 1.00 16.41 ? 53  LYS B N    1 
ATOM   5191  C  CA   . LYS B  1 53  ? 36.471  131.512 -20.333 1.00 13.35 ? 53  LYS B CA   1 
ATOM   5192  C  C    . LYS B  1 53  ? 36.726  132.878 -20.979 1.00 23.04 ? 53  LYS B C    1 
ATOM   5193  O  O    . LYS B  1 53  ? 36.224  133.168 -22.084 1.00 21.77 ? 53  LYS B O    1 
ATOM   5194  C  CB   . LYS B  1 53  ? 35.421  131.603 -19.242 1.00 16.44 ? 53  LYS B CB   1 
ATOM   5195  C  CG   . LYS B  1 53  ? 34.017  131.855 -19.777 1.00 20.99 ? 53  LYS B CG   1 
ATOM   5196  C  CD   . LYS B  1 53  ? 33.028  131.997 -18.651 1.00 28.01 ? 53  LYS B CD   1 
ATOM   5197  C  CE   . LYS B  1 53  ? 31.600  132.054 -19.159 1.00 39.24 ? 53  LYS B CE   1 
ATOM   5198  N  NZ   . LYS B  1 53  ? 30.654  131.970 -18.002 1.00 44.49 ? 53  LYS B NZ   1 
ATOM   5199  H  H    . LYS B  1 53  ? 37.737  130.977 -18.929 1.00 19.69 ? 53  LYS B H    1 
ATOM   5200  H  HA   . LYS B  1 53  ? 36.152  130.894 -21.024 1.00 16.02 ? 53  LYS B HA   1 
ATOM   5201  H  HB2  . LYS B  1 53  ? 35.406  130.767 -18.749 1.00 19.73 ? 53  LYS B HB2  1 
ATOM   5202  H  HB3  . LYS B  1 53  ? 35.649  132.334 -18.646 1.00 19.73 ? 53  LYS B HB3  1 
ATOM   5203  H  HG2  . LYS B  1 53  ? 34.013  132.676 -20.293 1.00 25.18 ? 53  LYS B HG2  1 
ATOM   5204  H  HG3  . LYS B  1 53  ? 33.745  131.107 -20.330 1.00 25.18 ? 53  LYS B HG3  1 
ATOM   5205  H  HD2  . LYS B  1 53  ? 33.109  131.234 -18.058 1.00 33.62 ? 53  LYS B HD2  1 
ATOM   5206  H  HD3  . LYS B  1 53  ? 33.211  132.818 -18.168 1.00 33.62 ? 53  LYS B HD3  1 
ATOM   5207  H  HE2  . LYS B  1 53  ? 31.451  132.893 -19.621 1.00 47.08 ? 53  LYS B HE2  1 
ATOM   5208  H  HE3  . LYS B  1 53  ? 31.434  131.303 -19.751 1.00 47.08 ? 53  LYS B HE3  1 
ATOM   5209  H  HZ1  . LYS B  1 53  ? 29.814  132.002 -18.294 1.00 53.39 ? 53  LYS B HZ1  1 
ATOM   5210  H  HZ2  . LYS B  1 53  ? 30.778  131.206 -17.563 1.00 53.39 ? 53  LYS B HZ2  1 
ATOM   5211  H  HZ3  . LYS B  1 53  ? 30.793  132.650 -17.445 1.00 53.39 ? 53  LYS B HZ3  1 
ATOM   5212  N  N    . GLU B  1 54  ? 37.552  133.685 -20.310 1.00 20.53 ? 54  GLU B N    1 
ATOM   5213  C  CA   . GLU B  1 54  ? 37.908  135.041 -20.773 1.00 21.31 ? 54  GLU B CA   1 
ATOM   5214  C  C    . GLU B  1 54  ? 38.654  134.992 -22.098 1.00 19.53 ? 54  GLU B C    1 
ATOM   5215  O  O    . GLU B  1 54  ? 38.257  135.651 -23.064 1.00 22.32 ? 54  GLU B O    1 
ATOM   5216  C  CB   . GLU B  1 54  ? 38.773  135.761 -19.718 1.00 21.95 ? 54  GLU B CB   1 
ATOM   5217  C  CG   . GLU B  1 54  ? 39.435  137.078 -20.191 1.00 31.60 ? 54  GLU B CG   1 
ATOM   5218  C  CD   . GLU B  1 54  ? 40.514  137.600 -19.230 1.00 38.62 ? 54  GLU B CD   1 
ATOM   5219  O  OE1  . GLU B  1 54  ? 40.680  137.032 -18.127 1.00 41.39 ? 54  GLU B OE1  1 
ATOM   5220  O  OE2  . GLU B  1 54  ? 41.210  138.579 -19.582 1.00 37.73 ? 54  GLU B OE2  1 
ATOM   5221  H  H    . GLU B  1 54  ? 37.930  133.469 -19.568 1.00 24.63 ? 54  GLU B H    1 
ATOM   5222  H  HA   . GLU B  1 54  ? 37.088  135.562 -20.903 1.00 25.57 ? 54  GLU B HA   1 
ATOM   5223  H  HB2  . GLU B  1 54  ? 38.213  135.974 -18.955 1.00 26.34 ? 54  GLU B HB2  1 
ATOM   5224  H  HB3  . GLU B  1 54  ? 39.483  135.161 -19.441 1.00 26.34 ? 54  GLU B HB3  1 
ATOM   5225  H  HG2  . GLU B  1 54  ? 39.852  136.928 -21.053 1.00 37.92 ? 54  GLU B HG2  1 
ATOM   5226  H  HG3  . GLU B  1 54  ? 38.752  137.762 -20.270 1.00 37.92 ? 54  GLU B HG3  1 
ATOM   5227  N  N    . LYS B  1 55  ? 39.729  134.200 -22.137 1.00 18.06 ? 55  LYS B N    1 
ATOM   5228  C  CA   . LYS B  1 55  ? 40.640  134.169 -23.269 1.00 23.52 ? 55  LYS B CA   1 
ATOM   5229  C  C    . LYS B  1 55  ? 40.020  133.483 -24.477 1.00 25.34 ? 55  LYS B C    1 
ATOM   5230  O  O    . LYS B  1 55  ? 40.432  133.709 -25.621 1.00 28.52 ? 55  LYS B O    1 
ATOM   5231  C  CB   . LYS B  1 55  ? 41.938  133.469 -22.883 1.00 22.27 ? 55  LYS B CB   1 
ATOM   5232  C  CG   . LYS B  1 55  ? 42.763  134.198 -21.857 1.00 25.54 ? 55  LYS B CG   1 
ATOM   5233  C  CD   . LYS B  1 55  ? 42.956  135.662 -22.209 1.00 40.04 ? 55  LYS B CD   1 
ATOM   5234  C  CE   . LYS B  1 55  ? 44.375  136.132 -21.917 1.00 45.55 ? 55  LYS B CE   1 
ATOM   5235  N  NZ   . LYS B  1 55  ? 44.513  137.616 -22.028 1.00 48.88 ? 55  LYS B NZ   1 
ATOM   5236  H  H    . LYS B  1 55  ? 39.951  133.663 -21.503 1.00 21.67 ? 55  LYS B H    1 
ATOM   5237  H  HA   . LYS B  1 55  ? 40.858  135.090 -23.526 1.00 28.23 ? 55  LYS B HA   1 
ATOM   5238  H  HB2  . LYS B  1 55  ? 41.722  132.596 -22.520 1.00 26.72 ? 55  LYS B HB2  1 
ATOM   5239  H  HB3  . LYS B  1 55  ? 42.483  133.366 -23.679 1.00 26.72 ? 55  LYS B HB3  1 
ATOM   5240  H  HG2  . LYS B  1 55  ? 42.316  134.150 -20.998 1.00 30.65 ? 55  LYS B HG2  1 
ATOM   5241  H  HG3  . LYS B  1 55  ? 43.638  133.783 -21.801 1.00 30.65 ? 55  LYS B HG3  1 
ATOM   5242  H  HD2  . LYS B  1 55  ? 42.784  135.789 -23.155 1.00 48.05 ? 55  LYS B HD2  1 
ATOM   5243  H  HD3  . LYS B  1 55  ? 42.345  136.201 -21.682 1.00 48.05 ? 55  LYS B HD3  1 
ATOM   5244  H  HE2  . LYS B  1 55  ? 44.615  135.873 -21.013 1.00 54.66 ? 55  LYS B HE2  1 
ATOM   5245  H  HE3  . LYS B  1 55  ? 44.982  135.723 -22.554 1.00 54.66 ? 55  LYS B HE3  1 
ATOM   5246  H  HZ1  . LYS B  1 55  ? 45.351  137.857 -21.852 1.00 58.66 ? 55  LYS B HZ1  1 
ATOM   5247  H  HZ2  . LYS B  1 55  ? 44.303  137.879 -22.852 1.00 58.66 ? 55  LYS B HZ2  1 
ATOM   5248  H  HZ3  . LYS B  1 55  ? 43.968  138.016 -21.449 1.00 58.66 ? 55  LYS B HZ3  1 
ATOM   5249  N  N    . SER B  1 56  ? 39.009  132.664 -24.231 1.00 20.59 ? 56  SER B N    1 
ATOM   5250  C  CA   . SER B  1 56  ? 38.348  131.953 -25.318 1.00 24.56 ? 56  SER B CA   1 
ATOM   5251  C  C    . SER B  1 56  ? 37.008  132.563 -25.705 1.00 21.81 ? 56  SER B C    1 
ATOM   5252  O  O    . SER B  1 56  ? 36.319  132.029 -26.570 1.00 17.86 ? 56  SER B O    1 
ATOM   5253  C  CB   . SER B  1 56  ? 38.104  130.510 -24.899 1.00 21.69 ? 56  SER B CB   1 
ATOM   5254  O  OG   . SER B  1 56  ? 37.068  130.450 -23.951 1.00 17.63 ? 56  SER B OG   1 
ATOM   5255  H  H    . SER B  1 56  ? 38.687  132.501 -23.451 1.00 24.70 ? 56  SER B H    1 
ATOM   5256  H  HA   . SER B  1 56  ? 38.928  131.953 -26.108 1.00 29.48 ? 56  SER B HA   1 
ATOM   5257  H  HB2  . SER B  1 56  ? 37.852  129.991 -25.678 1.00 26.03 ? 56  SER B HB2  1 
ATOM   5258  H  HB3  . SER B  1 56  ? 38.915  130.151 -24.506 1.00 26.03 ? 56  SER B HB3  1 
ATOM   5259  H  HG   . SER B  1 56  ? 36.784  131.204 -23.797 1.00 21.15 ? 56  SER B HG   1 
ATOM   5260  N  N    . ASN B  1 57  ? 36.601  133.644 -25.044 1.00 18.29 ? 57  ASN B N    1 
ATOM   5261  C  CA   . ASN B  1 57  ? 35.318  134.275 -25.370 1.00 25.63 ? 57  ASN B CA   1 
ATOM   5262  C  C    . ASN B  1 57  ? 34.139  133.328 -25.197 1.00 26.41 ? 57  ASN B C    1 
ATOM   5263  O  O    . ASN B  1 57  ? 33.191  133.349 -25.982 1.00 25.06 ? 57  ASN B O    1 
ATOM   5264  C  CB   . ASN B  1 57  ? 35.311  134.799 -26.817 1.00 30.86 ? 57  ASN B CB   1 
ATOM   5265  C  CG   . ASN B  1 57  ? 36.452  135.743 -27.104 1.00 37.34 ? 57  ASN B CG   1 
ATOM   5266  O  OD1  . ASN B  1 57  ? 36.802  136.589 -26.282 1.00 46.44 ? 57  ASN B OD1  1 
ATOM   5267  N  ND2  . ASN B  1 57  ? 37.044  135.603 -28.278 1.00 44.64 ? 57  ASN B ND2  1 
ATOM   5268  H  H    . ASN B  1 57  ? 37.039  134.028 -24.411 1.00 21.94 ? 57  ASN B H    1 
ATOM   5269  H  HA   . ASN B  1 57  ? 35.180  135.039 -24.772 1.00 30.76 ? 57  ASN B HA   1 
ATOM   5270  H  HB2  . ASN B  1 57  ? 35.383  134.047 -27.425 1.00 37.03 ? 57  ASN B HB2  1 
ATOM   5271  H  HB3  . ASN B  1 57  ? 34.481  135.275 -26.976 1.00 37.03 ? 57  ASN B HB3  1 
ATOM   5272  H  HD21 . ASN B  1 57  ? 36.773  134.999 -28.827 1.00 53.56 ? 57  ASN B HD21 1 
ATOM   5273  H  HD22 . ASN B  1 57  ? 37.701  136.115 -28.492 1.00 53.56 ? 57  ASN B HD22 1 
ATOM   5274  N  N    . GLY B  1 58  ? 34.200  132.492 -24.168 1.00 28.26 ? 58  GLY B N    1 
ATOM   5275  C  CA   . GLY B  1 58  ? 33.105  131.592 -23.865 1.00 22.88 ? 58  GLY B CA   1 
ATOM   5276  C  C    . GLY B  1 58  ? 33.167  130.242 -24.551 1.00 19.86 ? 58  GLY B C    1 
ATOM   5277  O  O    . GLY B  1 58  ? 32.341  129.372 -24.251 1.00 22.66 ? 58  GLY B O    1 
ATOM   5278  H  H    . GLY B  1 58  ? 34.867  132.428 -23.629 1.00 33.91 ? 58  GLY B H    1 
ATOM   5279  H  HA2  . GLY B  1 58  ? 33.081  131.438 -22.908 1.00 27.45 ? 58  GLY B HA2  1 
ATOM   5280  H  HA3  . GLY B  1 58  ? 32.271  132.016 -24.120 1.00 27.45 ? 58  GLY B HA3  1 
ATOM   5281  N  N    . ASP B  1 59  ? 34.132  130.051 -25.455 1.00 23.24 ? 59  ASP B N    1 
ATOM   5282  C  CA   . ASP B  1 59  ? 34.239  128.787 -26.206 1.00 19.30 ? 59  ASP B CA   1 
ATOM   5283  C  C    . ASP B  1 59  ? 34.682  127.623 -25.329 1.00 21.30 ? 59  ASP B C    1 
ATOM   5284  O  O    . ASP B  1 59  ? 34.379  126.458 -25.616 1.00 22.92 ? 59  ASP B O    1 
ATOM   5285  C  CB   . ASP B  1 59  ? 35.220  128.894 -27.364 1.00 17.99 ? 59  ASP B CB   1 
ATOM   5286  C  CG   . ASP B  1 59  ? 35.317  127.600 -28.163 1.00 24.42 ? 59  ASP B CG   1 
ATOM   5287  O  OD1  . ASP B  1 59  ? 34.271  127.143 -28.665 1.00 30.32 ? 59  ASP B OD1  1 
ATOM   5288  O  OD2  . ASP B  1 59  ? 36.426  127.036 -28.279 1.00 22.61 ? 59  ASP B OD2  1 
ATOM   5289  H  H    . ASP B  1 59  ? 34.736  130.631 -25.654 1.00 27.88 ? 59  ASP B H    1 
ATOM   5290  H  HA   . ASP B  1 59  ? 33.359  128.565 -26.577 1.00 23.16 ? 59  ASP B HA   1 
ATOM   5291  H  HB2  . ASP B  1 59  ? 34.928  129.598 -27.964 1.00 21.58 ? 59  ASP B HB2  1 
ATOM   5292  H  HB3  . ASP B  1 59  ? 36.102  129.099 -27.015 1.00 21.58 ? 59  ASP B HB3  1 
ATOM   5293  N  N    . ILE B  1 60  ? 35.413  127.936 -24.270 1.00 16.62 ? 60  ILE B N    1 
ATOM   5294  C  CA   . ILE B  1 60  ? 35.809  126.924 -23.306 1.00 14.63 ? 60  ILE B CA   1 
ATOM   5295  C  C    . ILE B  1 60  ? 35.301  127.319 -21.921 1.00 20.61 ? 60  ILE B C    1 
ATOM   5296  O  O    . ILE B  1 60  ? 35.569  128.425 -21.448 1.00 19.36 ? 60  ILE B O    1 
ATOM   5297  C  CB   . ILE B  1 60  ? 37.338  126.784 -23.234 1.00 16.53 ? 60  ILE B CB   1 
ATOM   5298  C  CG1  . ILE B  1 60  ? 37.931  126.689 -24.636 1.00 18.27 ? 60  ILE B CG1  1 
ATOM   5299  C  CG2  . ILE B  1 60  ? 37.738  125.565 -22.382 1.00 21.20 ? 60  ILE B CG2  1 
ATOM   5300  C  CD1  . ILE B  1 60  ? 39.437  126.703 -24.642 1.00 21.13 ? 60  ILE B CD1  1 
ATOM   5301  H  H    . ILE B  1 60  ? 35.692  128.728 -24.086 1.00 19.94 ? 60  ILE B H    1 
ATOM   5302  H  HA   . ILE B  1 60  ? 35.422  126.058 -23.552 1.00 17.55 ? 60  ILE B HA   1 
ATOM   5303  H  HB   . ILE B  1 60  ? 37.694  127.579 -22.809 1.00 19.83 ? 60  ILE B HB   1 
ATOM   5304  H  HG12 . ILE B  1 60  ? 37.637  125.861 -25.047 1.00 21.92 ? 60  ILE B HG12 1 
ATOM   5305  H  HG13 . ILE B  1 60  ? 37.623  127.445 -25.160 1.00 21.92 ? 60  ILE B HG13 1 
ATOM   5306  H  HG21 . ILE B  1 60  ? 38.696  125.503 -22.356 1.00 25.44 ? 60  ILE B HG21 1 
ATOM   5307  H  HG22 . ILE B  1 60  ? 37.392  125.678 -21.494 1.00 25.44 ? 60  ILE B HG22 1 
ATOM   5308  H  HG23 . ILE B  1 60  ? 37.370  124.772 -22.779 1.00 25.44 ? 60  ILE B HG23 1 
ATOM   5309  H  HD11 . ILE B  1 60  ? 39.746  126.641 -25.548 1.00 25.36 ? 60  ILE B HD11 1 
ATOM   5310  H  HD12 . ILE B  1 60  ? 39.743  127.522 -24.246 1.00 25.36 ? 60  ILE B HD12 1 
ATOM   5311  H  HD13 . ILE B  1 60  ? 39.757  125.953 -24.134 1.00 25.36 ? 60  ILE B HD13 1 
ATOM   5312  N  N    . VAL B  1 61  ? 34.563  126.422 -21.283 1.00 17.35 ? 61  VAL B N    1 
ATOM   5313  C  CA   . VAL B  1 61  ? 34.126  126.659 -19.914 1.00 16.90 ? 61  VAL B CA   1 
ATOM   5314  C  C    . VAL B  1 61  ? 34.525  125.513 -19.000 1.00 14.95 ? 61  VAL B C    1 
ATOM   5315  O  O    . VAL B  1 61  ? 34.347  124.341 -19.344 1.00 20.66 ? 61  VAL B O    1 
ATOM   5316  C  CB   . VAL B  1 61  ? 32.610  126.872 -19.842 1.00 21.35 ? 61  VAL B CB   1 
ATOM   5317  C  CG1  . VAL B  1 61  ? 32.174  127.106 -18.399 1.00 24.10 ? 61  VAL B CG1  1 
ATOM   5318  C  CG2  . VAL B  1 61  ? 32.231  128.073 -20.679 1.00 19.34 ? 61  VAL B CG2  1 
ATOM   5319  H  H    . VAL B  1 61  ? 34.302  125.673 -21.616 1.00 20.83 ? 61  VAL B H    1 
ATOM   5320  H  HA   . VAL B  1 61  ? 34.559  127.473 -19.581 1.00 20.28 ? 61  VAL B HA   1 
ATOM   5321  H  HB   . VAL B  1 61  ? 32.145  126.083 -20.190 1.00 25.62 ? 61  VAL B HB   1 
ATOM   5322  H  HG11 . VAL B  1 61  ? 31.223  127.237 -18.377 1.00 28.92 ? 61  VAL B HG11 1 
ATOM   5323  H  HG12 . VAL B  1 61  ? 32.412  126.340 -17.872 1.00 28.92 ? 61  VAL B HG12 1 
ATOM   5324  H  HG13 . VAL B  1 61  ? 32.619  127.887 -18.061 1.00 28.92 ? 61  VAL B HG13 1 
ATOM   5325  H  HG21 . VAL B  1 61  ? 31.281  128.201 -20.629 1.00 23.20 ? 61  VAL B HG21 1 
ATOM   5326  H  HG22 . VAL B  1 61  ? 32.684  128.847 -20.336 1.00 23.20 ? 61  VAL B HG22 1 
ATOM   5327  H  HG23 . VAL B  1 61  ? 32.494  127.915 -21.588 1.00 23.20 ? 61  VAL B HG23 1 
ATOM   5328  N  N    . PHE B  1 62  ? 35.099  125.856 -17.851 1.00 18.33 ? 62  PHE B N    1 
ATOM   5329  C  CA   . PHE B  1 62  ? 35.396  124.855 -16.831 1.00 17.54 ? 62  PHE B CA   1 
ATOM   5330  C  C    . PHE B  1 62  ? 34.230  124.815 -15.866 1.00 17.36 ? 62  PHE B C    1 
ATOM   5331  O  O    . PHE B  1 62  ? 33.699  125.858 -15.460 1.00 18.86 ? 62  PHE B O    1 
ATOM   5332  C  CB   . PHE B  1 62  ? 36.680  125.186 -16.054 1.00 12.03 ? 62  PHE B CB   1 
ATOM   5333  C  CG   . PHE B  1 62  ? 37.965  124.979 -16.816 1.00 9.49  ? 62  PHE B CG   1 
ATOM   5334  C  CD1  . PHE B  1 62  ? 37.997  124.476 -18.111 1.00 9.65  ? 62  PHE B CD1  1 
ATOM   5335  C  CD2  . PHE B  1 62  ? 39.175  125.256 -16.200 1.00 11.35 ? 62  PHE B CD2  1 
ATOM   5336  C  CE1  . PHE B  1 62  ? 39.202  124.280 -18.763 1.00 9.12  ? 62  PHE B CE1  1 
ATOM   5337  C  CE2  . PHE B  1 62  ? 40.367  125.056 -16.846 1.00 14.94 ? 62  PHE B CE2  1 
ATOM   5338  C  CZ   . PHE B  1 62  ? 40.391  124.572 -18.123 1.00 12.31 ? 62  PHE B CZ   1 
ATOM   5339  H  H    . PHE B  1 62  ? 35.325  126.658 -17.638 1.00 21.99 ? 62  PHE B H    1 
ATOM   5340  H  HA   . PHE B  1 62  ? 35.495  123.973 -17.247 1.00 21.05 ? 62  PHE B HA   1 
ATOM   5341  H  HB2  . PHE B  1 62  ? 36.647  126.118 -15.786 1.00 14.43 ? 62  PHE B HB2  1 
ATOM   5342  H  HB3  . PHE B  1 62  ? 36.716  124.623 -15.264 1.00 14.43 ? 62  PHE B HB3  1 
ATOM   5343  H  HD1  . PHE B  1 62  ? 37.200  124.275 -18.547 1.00 11.58 ? 62  PHE B HD1  1 
ATOM   5344  H  HD2  . PHE B  1 62  ? 39.177  125.583 -15.329 1.00 13.62 ? 62  PHE B HD2  1 
ATOM   5345  H  HE1  . PHE B  1 62  ? 39.211  123.950 -19.632 1.00 10.95 ? 62  PHE B HE1  1 
ATOM   5346  H  HE2  . PHE B  1 62  ? 41.165  125.258 -16.413 1.00 17.92 ? 62  PHE B HE2  1 
ATOM   5347  H  HZ   . PHE B  1 62  ? 41.202  124.445 -18.560 1.00 14.77 ? 62  PHE B HZ   1 
ATOM   5348  N  N    . LYS B  1 63  ? 33.807  123.610 -15.517 1.00 13.97 ? 63  LYS B N    1 
ATOM   5349  C  CA   . LYS B  1 63  ? 32.875  123.433 -14.417 1.00 19.79 ? 63  LYS B CA   1 
ATOM   5350  C  C    . LYS B  1 63  ? 33.622  122.754 -13.277 1.00 14.37 ? 63  LYS B C    1 
ATOM   5351  O  O    . LYS B  1 63  ? 34.180  121.673 -13.457 1.00 11.99 ? 63  LYS B O    1 
ATOM   5352  C  CB   . LYS B  1 63  ? 31.657  122.607 -14.844 1.00 30.21 ? 63  LYS B CB   1 
ATOM   5353  C  CG   . LYS B  1 63  ? 30.383  123.045 -14.130 1.00 44.27 ? 63  LYS B CG   1 
ATOM   5354  C  CD   . LYS B  1 63  ? 29.162  122.223 -14.515 1.00 52.25 ? 63  LYS B CD   1 
ATOM   5355  C  CE   . LYS B  1 63  ? 27.990  122.504 -13.566 1.00 56.55 ? 63  LYS B CE   1 
ATOM   5356  N  NZ   . LYS B  1 63  ? 27.653  123.967 -13.470 1.00 60.81 ? 63  LYS B NZ   1 
ATOM   5357  H  H    . LYS B  1 63  ? 34.044  122.878 -15.902 1.00 16.77 ? 63  LYS B H    1 
ATOM   5358  H  HA   . LYS B  1 63  ? 32.564  124.309 -14.108 1.00 23.75 ? 63  LYS B HA   1 
ATOM   5359  H  HB2  . LYS B  1 63  ? 31.520  122.714 -15.798 1.00 36.25 ? 63  LYS B HB2  1 
ATOM   5360  H  HB3  . LYS B  1 63  ? 31.816  121.674 -14.632 1.00 36.25 ? 63  LYS B HB3  1 
ATOM   5361  H  HG2  . LYS B  1 63  ? 30.513  122.955 -13.173 1.00 53.12 ? 63  LYS B HG2  1 
ATOM   5362  H  HG3  . LYS B  1 63  ? 30.201  123.972 -14.352 1.00 53.12 ? 63  LYS B HG3  1 
ATOM   5363  H  HD2  . LYS B  1 63  ? 28.888  122.455 -15.416 1.00 62.70 ? 63  LYS B HD2  1 
ATOM   5364  H  HD3  . LYS B  1 63  ? 29.379  121.279 -14.461 1.00 62.70 ? 63  LYS B HD3  1 
ATOM   5365  H  HE2  . LYS B  1 63  ? 27.204  122.036 -13.888 1.00 67.86 ? 63  LYS B HE2  1 
ATOM   5366  H  HE3  . LYS B  1 63  ? 28.221  122.191 -12.677 1.00 67.86 ? 63  LYS B HE3  1 
ATOM   5367  H  HZ1  . LYS B  1 63  ? 26.971  124.085 -12.911 1.00 72.97 ? 63  LYS B HZ1  1 
ATOM   5368  H  HZ2  . LYS B  1 63  ? 28.356  124.421 -13.168 1.00 72.97 ? 63  LYS B HZ2  1 
ATOM   5369  H  HZ3  . LYS B  1 63  ? 27.428  124.280 -14.272 1.00 72.97 ? 63  LYS B HZ3  1 
ATOM   5370  N  N    . LEU B  1 64  ? 33.625  123.381 -12.100 1.00 18.01 ? 64  LEU B N    1 
ATOM   5371  C  CA   . LEU B  1 64  ? 34.467  122.904 -11.005 1.00 20.22 ? 64  LEU B CA   1 
ATOM   5372  C  C    . LEU B  1 64  ? 33.764  121.897 -10.083 1.00 12.29 ? 64  LEU B C    1 
ATOM   5373  O  O    . LEU B  1 64  ? 32.599  122.069 -9.710  1.00 14.00 ? 64  LEU B O    1 
ATOM   5374  C  CB   . LEU B  1 64  ? 35.015  124.094 -10.195 1.00 13.66 ? 64  LEU B CB   1 
ATOM   5375  C  CG   . LEU B  1 64  ? 35.741  125.183 -11.009 1.00 21.68 ? 64  LEU B CG   1 
ATOM   5376  C  CD1  . LEU B  1 64  ? 36.368  126.232 -10.085 1.00 15.41 ? 64  LEU B CD1  1 
ATOM   5377  C  CD2  . LEU B  1 64  ? 36.794  124.599 -11.892 1.00 21.71 ? 64  LEU B CD2  1 
ATOM   5378  H  H    . LEU B  1 64  ? 33.155  124.076 -11.912 1.00 21.61 ? 64  LEU B H    1 
ATOM   5379  H  HA   . LEU B  1 64  ? 35.238  122.443 -11.395 1.00 24.26 ? 64  LEU B HA   1 
ATOM   5380  H  HB2  . LEU B  1 64  ? 34.273  124.520 -9.738  1.00 16.39 ? 64  LEU B HB2  1 
ATOM   5381  H  HB3  . LEU B  1 64  ? 35.644  123.754 -9.540  1.00 16.39 ? 64  LEU B HB3  1 
ATOM   5382  H  HG   . LEU B  1 64  ? 35.095  125.634 -11.574 1.00 26.02 ? 64  LEU B HG   1 
ATOM   5383  H  HD11 . LEU B  1 64  ? 36.811  126.894 -10.621 1.00 18.50 ? 64  LEU B HD11 1 
ATOM   5384  H  HD12 . LEU B  1 64  ? 35.674  126.643 -9.564  1.00 18.50 ? 64  LEU B HD12 1 
ATOM   5385  H  HD13 . LEU B  1 64  ? 37.001  125.801 -9.507  1.00 18.50 ? 64  LEU B HD13 1 
ATOM   5386  H  HD21 . LEU B  1 64  ? 37.220  125.308 -12.380 1.00 26.05 ? 64  LEU B HD21 1 
ATOM   5387  H  HD22 . LEU B  1 64  ? 37.439  124.141 -11.349 1.00 26.05 ? 64  LEU B HD22 1 
ATOM   5388  H  HD23 . LEU B  1 64  ? 36.382  123.983 -12.503 1.00 26.05 ? 64  LEU B HD23 1 
ATOM   5389  N  N    . PHE B  1 65  ? 34.495  120.857 -9.708  1.00 16.13 ? 65  PHE B N    1 
ATOM   5390  C  CA   . PHE B  1 65  ? 33.971  119.815 -8.834  1.00 15.85 ? 65  PHE B CA   1 
ATOM   5391  C  C    . PHE B  1 65  ? 34.935  119.548 -7.683  1.00 10.72 ? 65  PHE B C    1 
ATOM   5392  O  O    . PHE B  1 65  ? 35.702  118.581 -7.701  1.00 14.36 ? 65  PHE B O    1 
ATOM   5393  C  CB   . PHE B  1 65  ? 33.733  118.531 -9.629  1.00 17.39 ? 65  PHE B CB   1 
ATOM   5394  C  CG   . PHE B  1 65  ? 32.606  118.625 -10.588 1.00 17.72 ? 65  PHE B CG   1 
ATOM   5395  C  CD1  . PHE B  1 65  ? 32.808  119.137 -11.858 1.00 10.26 ? 65  PHE B CD1  1 
ATOM   5396  C  CD2  . PHE B  1 65  ? 31.343  118.208 -10.231 1.00 23.25 ? 65  PHE B CD2  1 
ATOM   5397  C  CE1  . PHE B  1 65  ? 31.774  119.229 -12.752 1.00 17.90 ? 65  PHE B CE1  1 
ATOM   5398  C  CE2  . PHE B  1 65  ? 30.293  118.305 -11.123 1.00 19.39 ? 65  PHE B CE2  1 
ATOM   5399  C  CZ   . PHE B  1 65  ? 30.514  118.808 -12.385 1.00 16.36 ? 65  PHE B CZ   1 
ATOM   5400  H  H    . PHE B  1 65  ? 35.310  120.728 -9.951  1.00 19.35 ? 65  PHE B H    1 
ATOM   5401  H  HA   . PHE B  1 65  ? 33.115  120.108 -8.458  1.00 19.02 ? 65  PHE B HA   1 
ATOM   5402  H  HB2  . PHE B  1 65  ? 34.535  118.322 -10.133 1.00 20.87 ? 65  PHE B HB2  1 
ATOM   5403  H  HB3  . PHE B  1 65  ? 33.536  117.811 -9.010  1.00 20.87 ? 65  PHE B HB3  1 
ATOM   5404  H  HD1  . PHE B  1 65  ? 33.658  119.419 -12.109 1.00 12.31 ? 65  PHE B HD1  1 
ATOM   5405  H  HD2  . PHE B  1 65  ? 31.193  117.866 -9.379  1.00 27.90 ? 65  PHE B HD2  1 
ATOM   5406  H  HE1  . PHE B  1 65  ? 31.922  119.573 -13.603 1.00 21.48 ? 65  PHE B HE1  1 
ATOM   5407  H  HE2  . PHE B  1 65  ? 29.444  118.019 -10.876 1.00 23.27 ? 65  PHE B HE2  1 
ATOM   5408  H  HZ   . PHE B  1 65  ? 29.810  118.872 -12.989 1.00 19.63 ? 65  PHE B HZ   1 
ATOM   5409  N  N    . PRO B  1 66  ? 34.900  120.403 -6.659  1.00 14.31 ? 66  PRO B N    1 
ATOM   5410  C  CA   . PRO B  1 66  ? 35.737  120.213 -5.474  1.00 14.44 ? 66  PRO B CA   1 
ATOM   5411  C  C    . PRO B  1 66  ? 35.251  119.038 -4.614  1.00 13.34 ? 66  PRO B C    1 
ATOM   5412  O  O    . PRO B  1 66  ? 34.266  118.393 -4.958  1.00 13.85 ? 66  PRO B O    1 
ATOM   5413  C  CB   . PRO B  1 66  ? 35.566  121.548 -4.733  1.00 8.04  ? 66  PRO B CB   1 
ATOM   5414  C  CG   . PRO B  1 66  ? 34.218  122.010 -5.121  1.00 12.35 ? 66  PRO B CG   1 
ATOM   5415  C  CD   . PRO B  1 66  ? 34.125  121.648 -6.583  1.00 17.96 ? 66  PRO B CD   1 
ATOM   5416  H  HA   . PRO B  1 66  ? 36.676  120.084 -5.723  1.00 17.33 ? 66  PRO B HA   1 
ATOM   5417  H  HB2  . PRO B  1 66  ? 35.619  121.402 -3.776  1.00 9.64  ? 66  PRO B HB2  1 
ATOM   5418  H  HB3  . PRO B  1 66  ? 36.244  122.176 -5.026  1.00 9.64  ? 66  PRO B HB3  1 
ATOM   5419  H  HG2  . PRO B  1 66  ? 33.545  121.541 -4.604  1.00 14.81 ? 66  PRO B HG2  1 
ATOM   5420  H  HG3  . PRO B  1 66  ? 34.148  122.970 -4.996  1.00 14.81 ? 66  PRO B HG3  1 
ATOM   5421  H  HD2  . PRO B  1 66  ? 33.202  121.490 -6.836  1.00 21.55 ? 66  PRO B HD2  1 
ATOM   5422  H  HD3  . PRO B  1 66  ? 34.533  122.337 -7.130  1.00 21.55 ? 66  PRO B HD3  1 
ATOM   5423  N  N    . SER B  1 67  ? 35.943  118.761 -3.517  1.00 13.54 ? 67  SER B N    1 
ATOM   5424  C  CA   . SER B  1 67  ? 35.441  117.855 -2.497  1.00 9.42  ? 67  SER B CA   1 
ATOM   5425  C  C    . SER B  1 67  ? 35.151  116.447 -3.016  1.00 17.39 ? 67  SER B C    1 
ATOM   5426  O  O    . SER B  1 67  ? 34.238  115.782 -2.516  1.00 15.23 ? 67  SER B O    1 
ATOM   5427  C  CB   . SER B  1 67  ? 34.154  118.430 -1.863  1.00 12.62 ? 67  SER B CB   1 
ATOM   5428  O  OG   . SER B  1 67  ? 34.303  119.787 -1.458  1.00 13.08 ? 67  SER B OG   1 
ATOM   5429  H  H    . SER B  1 67  ? 36.717  119.091 -3.339  1.00 16.25 ? 67  SER B H    1 
ATOM   5430  H  HA   . SER B  1 67  ? 36.113  117.778 -1.788  1.00 11.30 ? 67  SER B HA   1 
ATOM   5431  H  HB2  . SER B  1 67  ? 33.438  118.379 -2.515  1.00 15.15 ? 67  SER B HB2  1 
ATOM   5432  H  HB3  . SER B  1 67  ? 33.926  117.897 -1.086  1.00 15.15 ? 67  SER B HB3  1 
ATOM   5433  H  HG   . SER B  1 67  ? 33.604  120.059 -1.127  1.00 15.70 ? 67  SER B HG   1 
ATOM   5434  N  N    . SER B  1 68  ? 35.919  115.991 -4.007  1.00 9.53  ? 68  SER B N    1 
ATOM   5435  C  CA   . SER B  1 68  ? 35.765  114.648 -4.555  1.00 6.89  ? 68  SER B CA   1 
ATOM   5436  C  C    . SER B  1 68  ? 34.368  114.386 -5.096  1.00 11.92 ? 68  SER B C    1 
ATOM   5437  O  O    . SER B  1 68  ? 33.904  113.244 -5.074  1.00 14.20 ? 68  SER B O    1 
ATOM   5438  C  CB   . SER B  1 68  ? 36.067  113.587 -3.493  1.00 9.78  ? 68  SER B CB   1 
ATOM   5439  O  OG   . SER B  1 68  ? 37.373  113.729 -2.962  1.00 10.74 ? 68  SER B OG   1 
ATOM   5440  H  H    . SER B  1 68  ? 36.544  116.448 -4.382  1.00 11.44 ? 68  SER B H    1 
ATOM   5441  H  HA   . SER B  1 68  ? 36.402  114.530 -5.291  1.00 8.27  ? 68  SER B HA   1 
ATOM   5442  H  HB2  . SER B  1 68  ? 35.425  113.675 -2.772  1.00 11.74 ? 68  SER B HB2  1 
ATOM   5443  H  HB3  . SER B  1 68  ? 35.988  112.709 -3.898  1.00 11.74 ? 68  SER B HB3  1 
ATOM   5444  H  HG   . SER B  1 68  ? 37.752  114.364 -3.317  1.00 12.89 ? 68  SER B HG   1 
ATOM   5445  N  N    . GLN B  1 69  ? 33.703  115.417 -5.604  1.00 16.01 ? 69  GLN B N    1 
ATOM   5446  C  CA   . GLN B  1 69  ? 32.335  115.237 -6.075  1.00 18.16 ? 69  GLN B CA   1 
ATOM   5447  C  C    . GLN B  1 69  ? 32.213  114.216 -7.202  1.00 19.29 ? 69  GLN B C    1 
ATOM   5448  O  O    . GLN B  1 69  ? 31.232  113.480 -7.255  1.00 19.94 ? 69  GLN B O    1 
ATOM   5449  C  CB   . GLN B  1 69  ? 31.731  116.560 -6.515  1.00 18.73 ? 69  GLN B CB   1 
ATOM   5450  C  CG   . GLN B  1 69  ? 31.201  117.413 -5.376  1.00 22.08 ? 69  GLN B CG   1 
ATOM   5451  C  CD   . GLN B  1 69  ? 30.762  118.778 -5.860  1.00 34.61 ? 69  GLN B CD   1 
ATOM   5452  O  OE1  . GLN B  1 69  ? 30.595  118.993 -7.060  1.00 43.27 ? 69  GLN B OE1  1 
ATOM   5453  N  NE2  . GLN B  1 69  ? 30.578  119.709 -4.934  1.00 41.09 ? 69  GLN B NE2  1 
ATOM   5454  H  H    . GLN B  1 69  ? 34.013  116.215 -5.686  1.00 19.21 ? 69  GLN B H    1 
ATOM   5455  H  HA   . GLN B  1 69  ? 31.795  114.907 -5.326  1.00 21.80 ? 69  GLN B HA   1 
ATOM   5456  H  HB2  . GLN B  1 69  ? 32.412  117.074 -6.977  1.00 22.48 ? 69  GLN B HB2  1 
ATOM   5457  H  HB3  . GLN B  1 69  ? 30.993  116.380 -7.118  1.00 22.48 ? 69  GLN B HB3  1 
ATOM   5458  H  HG2  . GLN B  1 69  ? 30.436  116.972 -4.976  1.00 26.49 ? 69  GLN B HG2  1 
ATOM   5459  H  HG3  . GLN B  1 69  ? 31.901  117.536 -4.716  1.00 26.49 ? 69  GLN B HG3  1 
ATOM   5460  H  HE21 . GLN B  1 69  ? 30.709  119.522 -4.105  1.00 49.31 ? 69  GLN B HE21 1 
ATOM   5461  H  HE22 . GLN B  1 69  ? 30.329  120.500 -5.162  1.00 49.31 ? 69  GLN B HE22 1 
ATOM   5462  N  N    . LEU B  1 70  ? 33.187  114.181 -8.110  1.00 19.23 ? 70  LEU B N    1 
ATOM   5463  C  CA   . LEU B  1 70  ? 33.122  113.260 -9.230  1.00 14.87 ? 70  LEU B CA   1 
ATOM   5464  C  C    . LEU B  1 70  ? 33.597  111.863 -8.856  1.00 20.85 ? 70  LEU B C    1 
ATOM   5465  O  O    . LEU B  1 70  ? 33.462  110.940 -9.658  1.00 15.28 ? 70  LEU B O    1 
ATOM   5466  C  CB   . LEU B  1 70  ? 33.937  113.775 -10.421 1.00 18.09 ? 70  LEU B CB   1 
ATOM   5467  C  CG   . LEU B  1 70  ? 33.338  114.965 -11.172 1.00 22.48 ? 70  LEU B CG   1 
ATOM   5468  C  CD1  . LEU B  1 70  ? 34.234  115.338 -12.341 1.00 22.76 ? 70  LEU B CD1  1 
ATOM   5469  C  CD2  . LEU B  1 70  ? 31.909  114.667 -11.658 1.00 23.09 ? 70  LEU B CD2  1 
ATOM   5470  H  H    . LEU B  1 70  ? 33.888  114.679 -8.097  1.00 23.07 ? 70  LEU B H    1 
ATOM   5471  H  HA   . LEU B  1 70  ? 32.188  113.187 -9.520  1.00 17.85 ? 70  LEU B HA   1 
ATOM   5472  H  HB2  . LEU B  1 70  ? 34.811  114.046 -10.099 1.00 21.70 ? 70  LEU B HB2  1 
ATOM   5473  H  HB3  . LEU B  1 70  ? 34.038  113.051 -11.059 1.00 21.70 ? 70  LEU B HB3  1 
ATOM   5474  H  HG   . LEU B  1 70  ? 33.297  115.726 -10.572 1.00 26.98 ? 70  LEU B HG   1 
ATOM   5475  H  HD11 . LEU B  1 70  ? 33.848  116.085 -12.804 1.00 27.32 ? 70  LEU B HD11 1 
ATOM   5476  H  HD12 . LEU B  1 70  ? 35.103  115.573 -12.006 1.00 27.32 ? 70  LEU B HD12 1 
ATOM   5477  H  HD13 . LEU B  1 70  ? 34.304  114.586 -12.934 1.00 27.32 ? 70  LEU B HD13 1 
ATOM   5478  H  HD21 . LEU B  1 70  ? 31.570  115.436 -12.122 1.00 27.70 ? 70  LEU B HD21 1 
ATOM   5479  H  HD22 . LEU B  1 70  ? 31.931  113.910 -12.248 1.00 27.70 ? 70  LEU B HD22 1 
ATOM   5480  H  HD23 . LEU B  1 70  ? 31.355  114.473 -10.898 1.00 27.70 ? 70  LEU B HD23 1 
ATOM   5481  N  N    . GLY B  1 71  ? 34.149  111.721 -7.646  1.00 15.43 ? 71  GLY B N    1 
ATOM   5482  C  CA   . GLY B  1 71  ? 34.680  110.467 -7.149  1.00 11.41 ? 71  GLY B CA   1 
ATOM   5483  C  C    . GLY B  1 71  ? 36.091  110.624 -6.614  1.00 10.48 ? 71  GLY B C    1 
ATOM   5484  O  O    . GLY B  1 71  ? 36.637  111.721 -6.590  1.00 19.30 ? 71  GLY B O    1 
ATOM   5485  H  H    . GLY B  1 71  ? 34.224  112.366 -7.082  1.00 18.52 ? 71  GLY B H    1 
ATOM   5486  H  HA2  . GLY B  1 71  ? 34.114  110.134 -6.436  1.00 13.69 ? 71  GLY B HA2  1 
ATOM   5487  H  HA3  . GLY B  1 71  ? 34.693  109.813 -7.866  1.00 13.69 ? 71  GLY B HA3  1 
ATOM   5488  N  N    . SER B  1 72  ? 36.690  109.526 -6.189  1.00 9.19  ? 72  SER B N    1 
ATOM   5489  C  CA   . SER B  1 72  ? 38.034  109.558 -5.618  1.00 11.36 ? 72  SER B CA   1 
ATOM   5490  C  C    . SER B  1 72  ? 39.025  109.918 -6.701  1.00 17.20 ? 72  SER B C    1 
ATOM   5491  O  O    . SER B  1 72  ? 38.751  109.762 -7.902  1.00 14.45 ? 72  SER B O    1 
ATOM   5492  C  CB   . SER B  1 72  ? 38.413  108.216 -5.001  1.00 12.63 ? 72  SER B CB   1 
ATOM   5493  O  OG   . SER B  1 72  ? 38.714  107.260 -6.013  1.00 16.25 ? 72  SER B OG   1 
ATOM   5494  H  H    . SER B  1 72  ? 36.340  108.741 -6.217  1.00 11.03 ? 72  SER B H    1 
ATOM   5495  H  HA   . SER B  1 72  ? 38.076  110.243 -4.919  1.00 13.64 ? 72  SER B HA   1 
ATOM   5496  H  HB2  . SER B  1 72  ? 39.193  108.337 -4.438  1.00 15.15 ? 72  SER B HB2  1 
ATOM   5497  H  HB3  . SER B  1 72  ? 37.668  107.892 -4.471  1.00 15.15 ? 72  SER B HB3  1 
ATOM   5498  H  HG   . SER B  1 72  ? 38.916  106.543 -5.669  1.00 19.50 ? 72  SER B HG   1 
ATOM   5499  N  N    . GLU B  1 73  ? 40.186  110.395 -6.269  1.00 14.88 ? 73  GLU B N    1 
ATOM   5500  C  CA   . GLU B  1 73  ? 41.199  110.877 -7.199  1.00 15.11 ? 73  GLU B CA   1 
ATOM   5501  C  C    . GLU B  1 73  ? 41.532  109.773 -8.198  1.00 13.45 ? 73  GLU B C    1 
ATOM   5502  O  O    . GLU B  1 73  ? 41.673  110.035 -9.379  1.00 11.71 ? 73  GLU B O    1 
ATOM   5503  C  CB   . GLU B  1 73  ? 42.456  111.302 -6.456  1.00 8.61  ? 73  GLU B CB   1 
ATOM   5504  C  CG   . GLU B  1 73  ? 43.386  112.225 -7.217  1.00 4.97  ? 73  GLU B CG   1 
ATOM   5505  C  CD   . GLU B  1 73  ? 44.390  112.934 -6.338  1.00 12.36 ? 73  GLU B CD   1 
ATOM   5506  O  OE1  . GLU B  1 73  ? 43.977  113.517 -5.288  1.00 8.60  ? 73  GLU B OE1  1 
ATOM   5507  O  OE2  . GLU B  1 73  ? 45.588  112.875 -6.678  1.00 7.76  ? 73  GLU B OE2  1 
ATOM   5508  H  H    . GLU B  1 73  ? 40.412  110.451 -5.441  1.00 17.86 ? 73  GLU B H    1 
ATOM   5509  H  HA   . GLU B  1 73  ? 40.852  111.650 -7.692  1.00 18.13 ? 73  GLU B HA   1 
ATOM   5510  H  HB2  . GLU B  1 73  ? 42.192  111.762 -5.644  1.00 10.33 ? 73  GLU B HB2  1 
ATOM   5511  H  HB3  . GLU B  1 73  ? 42.961  110.506 -6.228  1.00 10.33 ? 73  GLU B HB3  1 
ATOM   5512  H  HG2  . GLU B  1 73  ? 43.879  111.704 -7.870  1.00 5.97  ? 73  GLU B HG2  1 
ATOM   5513  H  HG3  . GLU B  1 73  ? 42.856  112.901 -7.668  1.00 5.97  ? 73  GLU B HG3  1 
ATOM   5514  N  N    A THR B  1 74  ? 41.641  108.542 -7.702  0.45 10.65 ? 74  THR B N    1 
ATOM   5515  N  N    B THR B  1 74  ? 41.653  108.541 -7.723  0.55 10.62 ? 74  THR B N    1 
ATOM   5516  C  CA   A THR B  1 74  ? 41.999  107.387 -8.530  0.45 12.70 ? 74  THR B CA   1 
ATOM   5517  C  CA   B THR B  1 74  ? 42.016  107.448 -8.619  0.55 13.23 ? 74  THR B CA   1 
ATOM   5518  C  C    A THR B  1 74  ? 40.874  106.999 -9.483  0.45 13.89 ? 74  THR B C    1 
ATOM   5519  C  C    B THR B  1 74  ? 40.860  107.028 -9.518  0.55 14.01 ? 74  THR B C    1 
ATOM   5520  O  O    A THR B  1 74  ? 41.132  106.686 -10.652 0.45 14.57 ? 74  THR B O    1 
ATOM   5521  O  O    B THR B  1 74  ? 41.081  106.723 -10.694 0.55 14.87 ? 74  THR B O    1 
ATOM   5522  C  CB   A THR B  1 74  ? 42.400  106.169 -7.663  0.45 14.01 ? 74  THR B CB   1 
ATOM   5523  C  CB   B THR B  1 74  ? 42.582  106.228 -7.880  0.55 13.76 ? 74  THR B CB   1 
ATOM   5524  O  OG1  A THR B  1 74  ? 43.696  106.391 -7.098  0.45 16.00 ? 74  THR B OG1  1 
ATOM   5525  O  OG1  B THR B  1 74  ? 41.684  105.808 -6.847  0.55 14.65 ? 74  THR B OG1  1 
ATOM   5526  C  CG2  A THR B  1 74  ? 42.436  104.865 -8.487  0.45 12.80 ? 74  THR B CG2  1 
ATOM   5527  C  CG2  B THR B  1 74  ? 43.925  106.552 -7.278  0.55 17.18 ? 74  THR B CG2  1 
ATOM   5528  H  H    A THR B  1 74  ? 41.511  108.346 -6.875  0.45 12.78 ? 74  THR B H    1 
ATOM   5529  H  H    B THR B  1 74  ? 41.534  108.312 -6.903  0.55 12.74 ? 74  THR B H    1 
ATOM   5530  H  HA   A THR B  1 74  ? 42.776  107.628 -9.076  0.45 15.25 ? 74  THR B HA   1 
ATOM   5531  H  HA   B THR B  1 74  ? 42.727  107.774 -9.210  0.55 15.88 ? 74  THR B HA   1 
ATOM   5532  H  HB   A THR B  1 74  ? 41.754  106.059 -6.947  0.45 16.81 ? 74  THR B HB   1 
ATOM   5533  H  HB   B THR B  1 74  ? 42.702  105.501 -8.512  0.55 16.51 ? 74  THR B HB   1 
ATOM   5534  H  HG1  A THR B  1 74  ? 44.249  106.490 -7.696  0.45 19.20 ? 74  THR B HG1  1 
ATOM   5535  H  HG1  B THR B  1 74  ? 41.575  106.415 -6.307  0.55 17.58 ? 74  THR B HG1  1 
ATOM   5536  H  HG21 A THR B  1 74  ? 42.688  104.128 -7.925  0.45 15.36 ? 74  THR B HG21 1 
ATOM   5537  H  HG21 B THR B  1 74  ? 44.273  105.784 -6.818  0.55 20.62 ? 74  THR B HG21 1 
ATOM   5538  H  HG22 A THR B  1 74  ? 41.570  104.690 -8.862  0.45 15.36 ? 74  THR B HG22 1 
ATOM   5539  H  HG22 B THR B  1 74  ? 44.542  106.807 -7.968  0.55 20.62 ? 74  THR B HG22 1 
ATOM   5540  H  HG23 A THR B  1 74  ? 43.075  104.945 -9.200  0.45 15.36 ? 74  THR B HG23 1 
ATOM   5541  H  HG23 B THR B  1 74  ? 43.838  107.276 -6.654  0.55 20.62 ? 74  THR B HG23 1 
ATOM   5542  N  N    . GLU B  1 75  ? 39.640  107.012 -8.984  1.00 10.86 ? 75  GLU B N    1 
ATOM   5543  C  CA   . GLU B  1 75  ? 38.469  106.701 -9.806  1.00 15.07 ? 75  GLU B CA   1 
ATOM   5544  C  C    . GLU B  1 75  ? 38.329  107.697 -10.949 1.00 16.05 ? 75  GLU B C    1 
ATOM   5545  O  O    . GLU B  1 75  ? 38.040  107.324 -12.089 1.00 14.52 ? 75  GLU B O    1 
ATOM   5546  C  CB   . GLU B  1 75  ? 37.199  106.709 -8.965  1.00 17.26 ? 75  GLU B CB   1 
ATOM   5547  C  CG   . GLU B  1 75  ? 37.154  105.576 -7.928  1.00 16.08 ? 75  GLU B CG   1 
ATOM   5548  C  CD   . GLU B  1 75  ? 36.127  105.811 -6.833  1.00 25.19 ? 75  GLU B CD   1 
ATOM   5549  O  OE1  . GLU B  1 75  ? 35.438  106.868 -6.851  1.00 17.71 ? 75  GLU B OE1  1 
ATOM   5550  O  OE2  . GLU B  1 75  ? 36.012  104.930 -5.943  1.00 26.36 ? 75  GLU B OE2  1 
ATOM   5551  H  H    . GLU B  1 75  ? 39.458  107.187 -8.162  0.45 13.04 ? 75  GLU B H    1 
ATOM   5552  H  HA   . GLU B  1 75  ? 38.574  105.806 -10.191 1.00 18.08 ? 75  GLU B HA   1 
ATOM   5553  H  HB2  . GLU B  1 75  ? 37.143  107.552 -8.488  1.00 20.71 ? 75  GLU B HB2  1 
ATOM   5554  H  HB3  . GLU B  1 75  ? 36.433  106.609 -9.551  1.00 20.71 ? 75  GLU B HB3  1 
ATOM   5555  H  HG2  . GLU B  1 75  ? 36.928  104.747 -8.377  1.00 19.30 ? 75  GLU B HG2  1 
ATOM   5556  H  HG3  . GLU B  1 75  ? 38.025  105.498 -7.509  1.00 19.30 ? 75  GLU B HG3  1 
ATOM   5557  N  N    . VAL B  1 76  ? 38.510  108.976 -10.641 1.00 11.54 ? 76  VAL B N    1 
ATOM   5558  C  CA   . VAL B  1 76  ? 38.378  110.019 -11.664 1.00 12.93 ? 76  VAL B CA   1 
ATOM   5559  C  C    . VAL B  1 76  ? 39.473  109.908 -12.736 1.00 11.63 ? 76  VAL B C    1 
ATOM   5560  O  O    . VAL B  1 76  ? 39.206  110.140 -13.906 1.00 16.50 ? 76  VAL B O    1 
ATOM   5561  C  CB   . VAL B  1 76  ? 38.340  111.437 -11.035 1.00 12.88 ? 76  VAL B CB   1 
ATOM   5562  C  CG1  . VAL B  1 76  ? 38.363  112.509 -12.115 1.00 16.86 ? 76  VAL B CG1  1 
ATOM   5563  C  CG2  . VAL B  1 76  ? 37.091  111.586 -10.169 1.00 14.57 ? 76  VAL B CG2  1 
ATOM   5564  H  H    . VAL B  1 76  ? 38.708  109.269 -9.857  1.00 13.85 ? 76  VAL B H    1 
ATOM   5565  H  HA   . VAL B  1 76  ? 37.521  109.887 -12.119 1.00 15.52 ? 76  VAL B HA   1 
ATOM   5566  H  HB   . VAL B  1 76  ? 39.127  111.559 -10.464 1.00 15.46 ? 76  VAL B HB   1 
ATOM   5567  H  HG11 . VAL B  1 76  ? 38.339  113.373 -11.697 1.00 20.23 ? 76  VAL B HG11 1 
ATOM   5568  H  HG12 . VAL B  1 76  ? 39.168  112.417 -12.629 1.00 20.23 ? 76  VAL B HG12 1 
ATOM   5569  H  HG13 . VAL B  1 76  ? 37.597  112.398 -12.682 1.00 20.23 ? 76  VAL B HG13 1 
ATOM   5570  H  HG21 . VAL B  1 76  ? 37.080  112.467 -9.787  1.00 17.48 ? 76  VAL B HG21 1 
ATOM   5571  H  HG22 . VAL B  1 76  ? 36.314  111.457 -10.717 1.00 17.48 ? 76  VAL B HG22 1 
ATOM   5572  H  HG23 . VAL B  1 76  ? 37.114  110.927 -9.472  1.00 17.48 ? 76  VAL B HG23 1 
ATOM   5573  N  N    . LEU B  1 77  ? 40.703  109.581 -12.351 1.00 12.36 ? 77  LEU B N    1 
ATOM   5574  C  CA   . LEU B  1 77  ? 41.751  109.377 -13.342 1.00 11.65 ? 77  LEU B CA   1 
ATOM   5575  C  C    . LEU B  1 77  ? 41.315  108.324 -14.373 1.00 14.09 ? 77  LEU B C    1 
ATOM   5576  O  O    . LEU B  1 77  ? 41.542  108.474 -15.566 1.00 12.27 ? 77  LEU B O    1 
ATOM   5577  C  CB   . LEU B  1 77  ? 43.074  108.935 -12.702 1.00 12.90 ? 77  LEU B CB   1 
ATOM   5578  C  CG   . LEU B  1 77  ? 44.254  108.870 -13.679 1.00 14.13 ? 77  LEU B CG   1 
ATOM   5579  C  CD1  . LEU B  1 77  ? 44.656  110.242 -14.159 1.00 23.32 ? 77  LEU B CD1  1 
ATOM   5580  C  CD2  . LEU B  1 77  ? 45.438  108.159 -13.048 1.00 20.04 ? 77  LEU B CD2  1 
ATOM   5581  H  H    . LEU B  1 77  ? 40.953  109.473 -11.535 1.00 14.83 ? 77  LEU B H    1 
ATOM   5582  H  HA   . LEU B  1 77  ? 41.910  110.220 -13.817 1.00 13.98 ? 77  LEU B HA   1 
ATOM   5583  H  HB2  . LEU B  1 77  ? 43.305  109.563 -12.001 1.00 15.48 ? 77  LEU B HB2  1 
ATOM   5584  H  HB3  . LEU B  1 77  ? 42.955  108.050 -12.324 1.00 15.48 ? 77  LEU B HB3  1 
ATOM   5585  H  HG   . LEU B  1 77  ? 43.984  108.356 -14.455 1.00 16.95 ? 77  LEU B HG   1 
ATOM   5586  H  HD11 . LEU B  1 77  ? 45.395  110.156 -14.766 1.00 27.99 ? 77  LEU B HD11 1 
ATOM   5587  H  HD12 . LEU B  1 77  ? 43.909  110.647 -14.607 1.00 27.99 ? 77  LEU B HD12 1 
ATOM   5588  H  HD13 . LEU B  1 77  ? 44.912  110.775 -13.403 1.00 27.99 ? 77  LEU B HD13 1 
ATOM   5589  H  HD21 . LEU B  1 77  ? 46.160  108.134 -13.681 1.00 24.05 ? 77  LEU B HD21 1 
ATOM   5590  H  HD22 . LEU B  1 77  ? 45.708  108.640 -12.262 1.00 24.05 ? 77  LEU B HD22 1 
ATOM   5591  H  HD23 . LEU B  1 77  ? 45.177  107.266 -12.813 1.00 24.05 ? 77  LEU B HD23 1 
ATOM   5592  N  N    . GLU B  1 78  ? 40.686  107.256 -13.910 1.00 13.76 ? 78  GLU B N    1 
ATOM   5593  C  CA   . GLU B  1 78  ? 40.206  106.236 -14.839 1.00 13.00 ? 78  GLU B CA   1 
ATOM   5594  C  C    . GLU B  1 78  ? 39.092  106.753 -15.743 1.00 12.50 ? 78  GLU B C    1 
ATOM   5595  O  O    . GLU B  1 78  ? 39.033  106.383 -16.905 1.00 13.56 ? 78  GLU B O    1 
ATOM   5596  C  CB   . GLU B  1 78  ? 39.758  104.993 -14.077 1.00 14.51 ? 78  GLU B CB   1 
ATOM   5597  C  CG   . GLU B  1 78  ? 40.891  104.349 -13.327 1.00 26.81 ? 78  GLU B CG   1 
ATOM   5598  C  CD   . GLU B  1 78  ? 42.010  103.922 -14.260 1.00 35.22 ? 78  GLU B CD   1 
ATOM   5599  O  OE1  . GLU B  1 78  ? 41.724  103.110 -15.168 1.00 28.54 ? 78  GLU B OE1  1 
ATOM   5600  O  OE2  . GLU B  1 78  ? 43.153  104.419 -14.104 1.00 38.10 ? 78  GLU B OE2  1 
ATOM   5601  H  H    . GLU B  1 78  ? 40.525  107.097 -13.080 1.00 16.51 ? 78  GLU B H    1 
ATOM   5602  H  HA   . GLU B  1 78  ? 40.951  105.971 -15.417 1.00 15.60 ? 78  GLU B HA   1 
ATOM   5603  H  HB2  . GLU B  1 78  ? 39.075  105.243 -13.435 1.00 17.41 ? 78  GLU B HB2  1 
ATOM   5604  H  HB3  . GLU B  1 78  ? 39.405  104.344 -14.705 1.00 17.41 ? 78  GLU B HB3  1 
ATOM   5605  H  HG2  . GLU B  1 78  ? 41.254  104.984 -12.689 1.00 32.17 ? 78  GLU B HG2  1 
ATOM   5606  H  HG3  . GLU B  1 78  ? 40.563  103.562 -12.865 1.00 32.17 ? 78  GLU B HG3  1 
ATOM   5607  N  N    . GLN B  1 79  ? 38.228  107.629 -15.239 1.00 13.97 ? 79  GLN B N    1 
ATOM   5608  C  CA   . GLN B  1 79  ? 37.177  108.198 -16.087 1.00 19.83 ? 79  GLN B CA   1 
ATOM   5609  C  C    . GLN B  1 79  ? 37.808  109.028 -17.212 1.00 17.60 ? 79  GLN B C    1 
ATOM   5610  O  O    . GLN B  1 79  ? 37.373  108.997 -18.372 1.00 16.80 ? 79  GLN B O    1 
ATOM   5611  C  CB   . GLN B  1 79  ? 36.201  109.053 -15.258 1.00 15.69 ? 79  GLN B CB   1 
ATOM   5612  C  CG   . GLN B  1 79  ? 35.453  108.270 -14.156 1.00 22.72 ? 79  GLN B CG   1 
ATOM   5613  C  CD   . GLN B  1 79  ? 34.844  109.159 -13.063 1.00 32.07 ? 79  GLN B CD   1 
ATOM   5614  O  OE1  . GLN B  1 79  ? 34.902  110.389 -13.133 1.00 32.08 ? 79  GLN B OE1  1 
ATOM   5615  N  NE2  . GLN B  1 79  ? 34.273  108.526 -12.037 1.00 29.70 ? 79  GLN B NE2  1 
ATOM   5616  H  H    . GLN B  1 79  ? 38.225  107.908 -14.425 1.00 16.76 ? 79  GLN B H    1 
ATOM   5617  H  HA   . GLN B  1 79  ? 36.667  107.468 -16.497 1.00 23.80 ? 79  GLN B HA   1 
ATOM   5618  H  HB2  . GLN B  1 79  ? 36.700  109.764 -14.827 1.00 18.83 ? 79  GLN B HB2  1 
ATOM   5619  H  HB3  . GLN B  1 79  ? 35.537  109.433 -15.853 1.00 18.83 ? 79  GLN B HB3  1 
ATOM   5620  H  HG2  . GLN B  1 79  ? 34.730  107.769 -14.566 1.00 27.27 ? 79  GLN B HG2  1 
ATOM   5621  H  HG3  . GLN B  1 79  ? 36.074  107.660 -13.729 1.00 27.27 ? 79  GLN B HG3  1 
ATOM   5622  H  HE21 . GLN B  1 79  ? 34.260  107.666 -12.015 1.00 35.64 ? 79  GLN B HE21 1 
ATOM   5623  H  HE22 . GLN B  1 79  ? 33.917  108.977 -11.397 1.00 35.64 ? 79  GLN B HE22 1 
ATOM   5624  N  N    . ALA B  1 80  ? 38.857  109.760 -16.859 1.00 15.27 ? 80  ALA B N    1 
ATOM   5625  C  CA   . ALA B  1 80  ? 39.529  110.632 -17.794 1.00 14.65 ? 80  ALA B CA   1 
ATOM   5626  C  C    . ALA B  1 80  ? 40.248  109.805 -18.844 1.00 20.86 ? 80  ALA B C    1 
ATOM   5627  O  O    . ALA B  1 80  ? 40.191  110.118 -20.034 1.00 16.32 ? 80  ALA B O    1 
ATOM   5628  C  CB   . ALA B  1 80  ? 40.511  111.497 -17.076 1.00 19.52 ? 80  ALA B CB   1 
ATOM   5629  H  H    . ALA B  1 80  ? 39.199  109.765 -16.070 1.00 18.33 ? 80  ALA B H    1 
ATOM   5630  H  HA   . ALA B  1 80  ? 38.872  111.207 -18.241 1.00 17.58 ? 80  ALA B HA   1 
ATOM   5631  H  HB1  . ALA B  1 80  ? 40.947  112.069 -17.712 1.00 23.43 ? 80  ALA B HB1  1 
ATOM   5632  H  HB2  . ALA B  1 80  ? 40.044  112.026 -16.426 1.00 23.43 ? 80  ALA B HB2  1 
ATOM   5633  H  HB3  . ALA B  1 80  ? 41.159  110.938 -16.640 1.00 23.43 ? 80  ALA B HB3  1 
ATOM   5634  N  N    . LYS B  1 81  ? 40.933  108.756 -18.402 1.00 12.64 ? 81  LYS B N    1 
ATOM   5635  C  CA   . LYS B  1 81  ? 41.693  107.926 -19.316 1.00 20.51 ? 81  LYS B CA   1 
ATOM   5636  C  C    . LYS B  1 81  ? 40.782  107.333 -20.384 1.00 19.31 ? 81  LYS B C    1 
ATOM   5637  O  O    . LYS B  1 81  ? 41.201  107.117 -21.523 1.00 18.03 ? 81  LYS B O    1 
ATOM   5638  C  CB   . LYS B  1 81  ? 42.411  106.816 -18.567 1.00 15.44 ? 81  LYS B CB   1 
ATOM   5639  C  CG   . LYS B  1 81  ? 43.307  105.993 -19.470 1.00 28.51 ? 81  LYS B CG   1 
ATOM   5640  C  CD   . LYS B  1 81  ? 43.400  104.562 -19.028 1.00 33.47 ? 81  LYS B CD   1 
ATOM   5641  C  CE   . LYS B  1 81  ? 44.191  104.395 -17.769 1.00 33.50 ? 81  LYS B CE   1 
ATOM   5642  N  NZ   . LYS B  1 81  ? 44.070  102.969 -17.319 1.00 35.51 ? 81  LYS B NZ   1 
ATOM   5643  H  H    . LYS B  1 81  ? 40.971  108.507 -17.580 1.00 15.16 ? 81  LYS B H    1 
ATOM   5644  H  HA   . LYS B  1 81  ? 42.368  108.477 -19.764 1.00 24.61 ? 81  LYS B HA   1 
ATOM   5645  H  HB2  . LYS B  1 81  ? 42.962  107.208 -17.872 1.00 18.53 ? 81  LYS B HB2  1 
ATOM   5646  H  HB3  . LYS B  1 81  ? 41.753  106.222 -18.174 1.00 18.53 ? 81  LYS B HB3  1 
ATOM   5647  H  HG2  . LYS B  1 81  ? 42.950  106.008 -20.371 1.00 34.22 ? 81  LYS B HG2  1 
ATOM   5648  H  HG3  . LYS B  1 81  ? 44.201  106.371 -19.459 1.00 34.22 ? 81  LYS B HG3  1 
ATOM   5649  H  HD2  . LYS B  1 81  ? 42.506  104.223 -18.867 1.00 40.17 ? 81  LYS B HD2  1 
ATOM   5650  H  HD3  . LYS B  1 81  ? 43.832  104.044 -19.725 1.00 40.17 ? 81  LYS B HD3  1 
ATOM   5651  H  HE2  . LYS B  1 81  ? 45.126  104.592 -17.938 1.00 40.20 ? 81  LYS B HE2  1 
ATOM   5652  H  HE3  . LYS B  1 81  ? 43.835  104.974 -17.076 1.00 40.20 ? 81  LYS B HE3  1 
ATOM   5653  H  HZ1  . LYS B  1 81  ? 44.534  102.846 -16.570 1.00 42.61 ? 81  LYS B HZ1  1 
ATOM   5654  H  HZ2  . LYS B  1 81  ? 43.216  102.770 -17.166 1.00 42.61 ? 81  LYS B HZ2  1 
ATOM   5655  H  HZ3  . LYS B  1 81  ? 44.386  102.424 -17.948 1.00 42.61 ? 81  LYS B HZ3  1 
ATOM   5656  N  N    . PHE B  1 82  ? 39.538  107.053 -20.010 1.00 22.21 ? 82  PHE B N    1 
ATOM   5657  C  CA   . PHE B  1 82  ? 38.594  106.462 -20.953 1.00 26.53 ? 82  PHE B CA   1 
ATOM   5658  C  C    . PHE B  1 82  ? 37.779  107.467 -21.762 1.00 19.20 ? 82  PHE B C    1 
ATOM   5659  O  O    . PHE B  1 82  ? 36.842  107.091 -22.459 1.00 22.56 ? 82  PHE B O    1 
ATOM   5660  C  CB   . PHE B  1 82  ? 37.715  105.424 -20.254 1.00 28.18 ? 82  PHE B CB   1 
ATOM   5661  C  CG   . PHE B  1 82  ? 38.430  104.126 -20.034 1.00 33.20 ? 82  PHE B CG   1 
ATOM   5662  C  CD1  . PHE B  1 82  ? 38.555  103.217 -21.069 1.00 40.61 ? 82  PHE B CD1  1 
ATOM   5663  C  CD2  . PHE B  1 82  ? 39.035  103.841 -18.822 1.00 33.78 ? 82  PHE B CD2  1 
ATOM   5664  C  CE1  . PHE B  1 82  ? 39.235  102.038 -20.891 1.00 40.40 ? 82  PHE B CE1  1 
ATOM   5665  C  CE2  . PHE B  1 82  ? 39.716  102.663 -18.639 1.00 37.37 ? 82  PHE B CE2  1 
ATOM   5666  C  CZ   . PHE B  1 82  ? 39.815  101.759 -19.681 1.00 39.74 ? 82  PHE B CZ   1 
ATOM   5667  H  H    . PHE B  1 82  ? 39.217  107.194 -19.224 1.00 26.66 ? 82  PHE B H    1 
ATOM   5668  H  HA   . PHE B  1 82  ? 39.126  105.964 -21.608 1.00 31.83 ? 82  PHE B HA   1 
ATOM   5669  H  HB2  . PHE B  1 82  ? 37.444  105.769 -19.388 1.00 33.81 ? 82  PHE B HB2  1 
ATOM   5670  H  HB3  . PHE B  1 82  ? 36.934  105.249 -20.802 1.00 33.81 ? 82  PHE B HB3  1 
ATOM   5671  H  HD1  . PHE B  1 82  ? 38.164  103.401 -21.892 1.00 48.73 ? 82  PHE B HD1  1 
ATOM   5672  H  HD2  . PHE B  1 82  ? 38.970  104.448 -18.120 1.00 40.53 ? 82  PHE B HD2  1 
ATOM   5673  H  HE1  . PHE B  1 82  ? 39.301  101.429 -21.590 1.00 48.48 ? 82  PHE B HE1  1 
ATOM   5674  H  HE2  . PHE B  1 82  ? 40.108  102.473 -17.818 1.00 44.85 ? 82  PHE B HE2  1 
ATOM   5675  H  HZ   . PHE B  1 82  ? 40.272  100.958 -19.559 1.00 47.69 ? 82  PHE B HZ   1 
ATOM   5676  N  N    . GLY B  1 83  ? 38.144  108.742 -21.676 1.00 18.46 ? 83  GLY B N    1 
ATOM   5677  C  CA   . GLY B  1 83  ? 37.665  109.716 -22.635 1.00 19.39 ? 83  GLY B CA   1 
ATOM   5678  C  C    . GLY B  1 83  ? 36.762  110.801 -22.098 1.00 21.68 ? 83  GLY B C    1 
ATOM   5679  O  O    . GLY B  1 83  ? 36.380  111.697 -22.838 1.00 20.74 ? 83  GLY B O    1 
ATOM   5680  H  H    . GLY B  1 83  ? 38.667  109.062 -21.073 1.00 22.15 ? 83  GLY B H    1 
ATOM   5681  H  HA2  . GLY B  1 83  ? 38.431  110.148 -23.045 1.00 23.26 ? 83  GLY B HA2  1 
ATOM   5682  H  HA3  . GLY B  1 83  ? 37.180  109.250 -23.333 1.00 23.26 ? 83  GLY B HA3  1 
ATOM   5683  N  N    . ALA B  1 84  ? 36.400  110.726 -20.823 1.00 22.37 ? 84  ALA B N    1 
ATOM   5684  C  CA   . ALA B  1 84  ? 35.525  111.737 -20.239 1.00 18.16 ? 84  ALA B CA   1 
ATOM   5685  C  C    . ALA B  1 84  ? 36.126  113.132 -20.365 1.00 16.99 ? 84  ALA B C    1 
ATOM   5686  O  O    . ALA B  1 84  ? 37.337  113.290 -20.404 1.00 17.54 ? 84  ALA B O    1 
ATOM   5687  C  CB   . ALA B  1 84  ? 35.248  111.403 -18.805 1.00 16.20 ? 84  ALA B CB   1 
ATOM   5688  H  H    . ALA B  1 84  ? 36.644  110.107 -20.278 1.00 26.85 ? 84  ALA B H    1 
ATOM   5689  H  HA   . ALA B  1 84  ? 34.671  111.733 -20.719 1.00 21.79 ? 84  ALA B HA   1 
ATOM   5690  H  HB1  . ALA B  1 84  ? 34.672  112.076 -18.434 1.00 19.44 ? 84  ALA B HB1  1 
ATOM   5691  H  HB2  . ALA B  1 84  ? 34.821  110.545 -18.762 1.00 19.44 ? 84  ALA B HB2  1 
ATOM   5692  H  HB3  . ALA B  1 84  ? 36.079  111.381 -18.324 1.00 19.44 ? 84  ALA B HB3  1 
ATOM   5693  N  N    . ASN B  1 85  ? 35.272  114.145 -20.453 1.00 14.29 ? 85  ASN B N    1 
ATOM   5694  C  CA   . ASN B  1 85  ? 35.733  115.533 -20.543 1.00 17.97 ? 85  ASN B CA   1 
ATOM   5695  C  C    . ASN B  1 85  ? 36.143  116.045 -19.173 1.00 18.40 ? 85  ASN B C    1 
ATOM   5696  O  O    . ASN B  1 85  ? 35.437  116.837 -18.547 1.00 15.47 ? 85  ASN B O    1 
ATOM   5697  C  CB   . ASN B  1 85  ? 34.635  116.421 -21.140 1.00 18.84 ? 85  ASN B CB   1 
ATOM   5698  C  CG   . ASN B  1 85  ? 33.318  116.302 -20.390 1.00 25.71 ? 85  ASN B CG   1 
ATOM   5699  O  OD1  . ASN B  1 85  ? 32.912  115.202 -20.012 1.00 30.22 ? 85  ASN B OD1  1 
ATOM   5700  N  ND2  . ASN B  1 85  ? 32.648  117.433 -20.167 1.00 22.05 ? 85  ASN B ND2  1 
ATOM   5701  H  H    . ASN B  1 85  ? 34.417  114.059 -20.464 1.00 17.15 ? 85  ASN B H    1 
ATOM   5702  H  HA   . ASN B  1 85  ? 36.515  115.576 -21.132 1.00 21.56 ? 85  ASN B HA   1 
ATOM   5703  H  HB2  . ASN B  1 85  ? 34.921  117.348 -21.100 1.00 22.61 ? 85  ASN B HB2  1 
ATOM   5704  H  HB3  . ASN B  1 85  ? 34.482  116.160 -22.061 1.00 22.61 ? 85  ASN B HB3  1 
ATOM   5705  H  HD21 . ASN B  1 85  ? 32.966  118.183 -20.444 1.00 26.46 ? 85  ASN B HD21 1 
ATOM   5706  H  HD22 . ASN B  1 85  ? 31.898  117.413 -19.747 1.00 26.46 ? 85  ASN B HD22 1 
ATOM   5707  N  N    . ILE B  1 86  ? 37.289  115.573 -18.702 1.00 14.45 ? 86  ILE B N    1 
ATOM   5708  C  CA   . ILE B  1 86  ? 37.713  115.827 -17.353 1.00 15.35 ? 86  ILE B CA   1 
ATOM   5709  C  C    . ILE B  1 86  ? 39.144  116.289 -17.339 1.00 12.77 ? 86  ILE B C    1 
ATOM   5710  O  O    . ILE B  1 86  ? 39.966  115.737 -18.054 1.00 13.09 ? 86  ILE B O    1 
ATOM   5711  C  CB   . ILE B  1 86  ? 37.623  114.551 -16.508 1.00 13.69 ? 86  ILE B CB   1 
ATOM   5712  C  CG1  . ILE B  1 86  ? 36.157  114.151 -16.298 1.00 17.99 ? 86  ILE B CG1  1 
ATOM   5713  C  CG2  . ILE B  1 86  ? 38.326  114.733 -15.182 1.00 15.67 ? 86  ILE B CG2  1 
ATOM   5714  C  CD1  . ILE B  1 86  ? 35.988  112.762 -15.668 1.00 17.44 ? 86  ILE B CD1  1 
ATOM   5715  H  H    . ILE B  1 86  ? 37.841  115.096 -19.158 1.00 17.33 ? 86  ILE B H    1 
ATOM   5716  H  HA   . ILE B  1 86  ? 37.149  116.520 -16.948 1.00 18.43 ? 86  ILE B HA   1 
ATOM   5717  H  HB   . ILE B  1 86  ? 38.066  113.836 -16.991 1.00 16.43 ? 86  ILE B HB   1 
ATOM   5718  H  HG12 . ILE B  1 86  ? 35.737  114.798 -15.709 1.00 21.59 ? 86  ILE B HG12 1 
ATOM   5719  H  HG13 . ILE B  1 86  ? 35.707  114.145 -17.157 1.00 21.59 ? 86  ILE B HG13 1 
ATOM   5720  H  HG21 . ILE B  1 86  ? 38.254  113.920 -14.676 1.00 18.81 ? 86  ILE B HG21 1 
ATOM   5721  H  HG22 . ILE B  1 86  ? 39.250  114.937 -15.344 1.00 18.81 ? 86  ILE B HG22 1 
ATOM   5722  H  HG23 . ILE B  1 86  ? 37.910  115.454 -14.704 1.00 18.81 ? 86  ILE B HG23 1 
ATOM   5723  H  HD11 . ILE B  1 86  ? 35.052  112.577 -15.565 1.00 20.92 ? 86  ILE B HD11 1 
ATOM   5724  H  HD12 . ILE B  1 86  ? 36.390  112.107 -16.244 1.00 20.92 ? 86  ILE B HD12 1 
ATOM   5725  H  HD13 . ILE B  1 86  ? 36.420  112.753 -14.810 1.00 20.92 ? 86  ILE B HD13 1 
ATOM   5726  N  N    . ILE B  1 87  ? 39.399  117.344 -16.571 1.00 7.12  ? 87  ILE B N    1 
ATOM   5727  C  CA   . ILE B  1 87  ? 40.746  117.678 -16.129 1.00 6.75  ? 87  ILE B CA   1 
ATOM   5728  C  C    . ILE B  1 87  ? 40.773  117.407 -14.628 1.00 13.53 ? 87  ILE B C    1 
ATOM   5729  O  O    . ILE B  1 87  ? 39.985  117.969 -13.887 1.00 12.30 ? 87  ILE B O    1 
ATOM   5730  C  CB   . ILE B  1 87  ? 41.101  119.154 -16.433 1.00 11.13 ? 87  ILE B CB   1 
ATOM   5731  C  CG1  . ILE B  1 87  ? 41.187  119.344 -17.954 1.00 10.54 ? 87  ILE B CG1  1 
ATOM   5732  C  CG2  . ILE B  1 87  ? 42.403  119.539 -15.749 1.00 10.37 ? 87  ILE B CG2  1 
ATOM   5733  C  CD1  . ILE B  1 87  ? 41.462  120.799 -18.396 1.00 19.32 ? 87  ILE B CD1  1 
ATOM   5734  H  H    . ILE B  1 87  ? 38.797  117.890 -16.289 1.00 8.54  ? 87  ILE B H    1 
ATOM   5735  H  HA   . ILE B  1 87  ? 41.398  117.095 -16.571 1.00 8.10  ? 87  ILE B HA   1 
ATOM   5736  H  HB   . ILE B  1 87  ? 40.392  119.720 -16.090 1.00 13.35 ? 87  ILE B HB   1 
ATOM   5737  H  HG12 . ILE B  1 87  ? 41.906  118.790 -18.296 1.00 12.65 ? 87  ILE B HG12 1 
ATOM   5738  H  HG13 . ILE B  1 87  ? 40.345  119.070 -18.350 1.00 12.65 ? 87  ILE B HG13 1 
ATOM   5739  H  HG21 . ILE B  1 87  ? 42.603  120.456 -15.951 1.00 12.45 ? 87  ILE B HG21 1 
ATOM   5740  H  HG22 . ILE B  1 87  ? 42.303  119.426 -14.801 1.00 12.45 ? 87  ILE B HG22 1 
ATOM   5741  H  HG23 . ILE B  1 87  ? 43.106  118.971 -16.074 1.00 12.45 ? 87  ILE B HG23 1 
ATOM   5742  H  HD11 . ILE B  1 87  ? 41.501  120.831 -19.355 1.00 23.18 ? 87  ILE B HD11 1 
ATOM   5743  H  HD12 . ILE B  1 87  ? 40.753  121.361 -18.077 1.00 23.18 ? 87  ILE B HD12 1 
ATOM   5744  H  HD13 . ILE B  1 87  ? 42.300  121.084 -18.024 1.00 23.18 ? 87  ILE B HD13 1 
ATOM   5745  N  N    . THR B  1 88  ? 41.649  116.512 -14.180 1.00 9.51  ? 88  THR B N    1 
ATOM   5746  C  CA   . THR B  1 88  ? 41.677  116.171 -12.776 1.00 7.87  ? 88  THR B CA   1 
ATOM   5747  C  C    . THR B  1 88  ? 43.059  116.388 -12.184 1.00 8.03  ? 88  THR B C    1 
ATOM   5748  O  O    . THR B  1 88  ? 44.089  116.198 -12.846 1.00 9.07  ? 88  THR B O    1 
ATOM   5749  C  CB   . THR B  1 88  ? 41.254  114.695 -12.517 1.00 7.29  ? 88  THR B CB   1 
ATOM   5750  O  OG1  . THR B  1 88  ? 41.330  114.406 -11.106 1.00 9.79  ? 88  THR B OG1  1 
ATOM   5751  C  CG2  . THR B  1 88  ? 42.141  113.759 -13.266 1.00 7.69  ? 88  THR B CG2  1 
ATOM   5752  H  H    . THR B  1 88  ? 42.227  116.098 -14.664 1.00 11.42 ? 88  THR B H    1 
ATOM   5753  H  HA   . THR B  1 88  ? 41.050  116.752 -12.297 1.00 9.44  ? 88  THR B HA   1 
ATOM   5754  H  HB   . THR B  1 88  ? 40.343  114.564 -12.823 1.00 8.75  ? 88  THR B HB   1 
ATOM   5755  H  HG1  . THR B  1 88  ? 42.097  114.516 -10.838 1.00 11.74 ? 88  THR B HG1  1 
ATOM   5756  H  HG21 . THR B  1 88  ? 41.873  112.852 -13.101 1.00 9.23  ? 88  THR B HG21 1 
ATOM   5757  H  HG22 . THR B  1 88  ? 42.082  113.935 -14.208 1.00 9.23  ? 88  THR B HG22 1 
ATOM   5758  H  HG23 . THR B  1 88  ? 43.051  113.872 -12.984 1.00 9.23  ? 88  THR B HG23 1 
ATOM   5759  N  N    . ILE B  1 89  ? 43.094  116.729 -10.903 1.00 4.82  ? 89  ILE B N    1 
ATOM   5760  C  CA   . ILE B  1 89  ? 44.359  116.693 -10.208 1.00 5.30  ? 89  ILE B CA   1 
ATOM   5761  C  C    . ILE B  1 89  ? 44.769  115.213 -10.179 1.00 8.83  ? 89  ILE B C    1 
ATOM   5762  O  O    . ILE B  1 89  ? 43.929  114.338 -10.269 1.00 8.13  ? 89  ILE B O    1 
ATOM   5763  C  CB   . ILE B  1 89  ? 44.226  117.313 -8.766  1.00 4.73  ? 89  ILE B CB   1 
ATOM   5764  C  CG1  . ILE B  1 89  ? 45.612  117.685 -8.219  1.00 5.18  ? 89  ILE B CG1  1 
ATOM   5765  C  CG2  . ILE B  1 89  ? 43.543  116.335 -7.837  1.00 4.68  ? 89  ILE B CG2  1 
ATOM   5766  C  CD1  . ILE B  1 89  ? 45.506  118.541 -6.957  1.00 4.45  ? 89  ILE B CD1  1 
ATOM   5767  H  H    . ILE B  1 89  ? 42.420  116.977 -10.430 1.00 5.78  ? 89  ILE B H    1 
ATOM   5768  H  HA   . ILE B  1 89  ? 45.031  117.199 -10.711 1.00 6.36  ? 89  ILE B HA   1 
ATOM   5769  H  HB   . ILE B  1 89  ? 43.687  118.117 -8.822  1.00 5.68  ? 89  ILE B HB   1 
ATOM   5770  H  HG12 . ILE B  1 89  ? 46.097  116.874 -7.997  1.00 6.22  ? 89  ILE B HG12 1 
ATOM   5771  H  HG13 . ILE B  1 89  ? 46.096  118.191 -8.891  1.00 6.22  ? 89  ILE B HG13 1 
ATOM   5772  H  HG21 . ILE B  1 89  ? 43.472  116.730 -6.965  1.00 5.61  ? 89  ILE B HG21 1 
ATOM   5773  H  HG22 . ILE B  1 89  ? 42.668  116.138 -8.180  1.00 5.61  ? 89  ILE B HG22 1 
ATOM   5774  H  HG23 . ILE B  1 89  ? 44.066  115.531 -7.791  1.00 5.61  ? 89  ILE B HG23 1 
ATOM   5775  H  HD11 . ILE B  1 89  ? 46.390  118.752 -6.647  1.00 5.34  ? 89  ILE B HD11 1 
ATOM   5776  H  HD12 . ILE B  1 89  ? 45.031  119.349 -7.167  1.00 5.34  ? 89  ILE B HD12 1 
ATOM   5777  H  HD13 . ILE B  1 89  ? 45.032  118.048 -6.284  1.00 5.34  ? 89  ILE B HD13 1 
ATOM   5778  N  N    . SER B  1 90  ? 46.066  114.959 -10.131 1.00 7.70  ? 90  SER B N    1 
ATOM   5779  C  CA   . SER B  1 90  ? 46.609  113.624 -9.929  1.00 7.85  ? 90  SER B CA   1 
ATOM   5780  C  C    . SER B  1 90  ? 47.825  113.757 -9.016  1.00 11.98 ? 90  SER B C    1 
ATOM   5781  O  O    . SER B  1 90  ? 48.015  114.768 -8.329  1.00 5.76  ? 90  SER B O    1 
ATOM   5782  C  CB   . SER B  1 90  ? 46.987  112.968 -11.275 1.00 9.95  ? 90  SER B CB   1 
ATOM   5783  O  OG   . SER B  1 90  ? 47.346  111.594 -11.127 1.00 8.73  ? 90  SER B OG   1 
ATOM   5784  H  H    . SER B  1 90  ? 46.672  115.564 -10.215 1.00 9.24  ? 90  SER B H    1 
ATOM   5785  H  HA   . SER B  1 90  ? 45.943  113.061 -9.482  1.00 9.41  ? 90  SER B HA   1 
ATOM   5786  H  HB2  . SER B  1 90  ? 46.226  113.027 -11.874 1.00 11.94 ? 90  SER B HB2  1 
ATOM   5787  H  HB3  . SER B  1 90  ? 47.740  113.447 -11.654 1.00 11.94 ? 90  SER B HB3  1 
ATOM   5788  H  HG   . SER B  1 90  ? 47.293  111.373 -10.339 1.00 10.47 ? 90  SER B HG   1 
ATOM   5789  N  N    . ASP B  1 91  ? 48.655  112.734 -9.003  1.00 7.85  ? 91  ASP B N    1 
ATOM   5790  C  CA   . ASP B  1 91  ? 49.784  112.701 -8.112  1.00 5.94  ? 91  ASP B CA   1 
ATOM   5791  C  C    . ASP B  1 91  ? 50.894  111.902 -8.740  1.00 7.65  ? 91  ASP B C    1 
ATOM   5792  O  O    . ASP B  1 91  ? 50.667  110.778 -9.232  1.00 8.01  ? 91  ASP B O    1 
ATOM   5793  C  CB   . ASP B  1 91  ? 49.367  112.051 -6.779  1.00 5.71  ? 91  ASP B CB   1 
ATOM   5794  C  CG   . ASP B  1 91  ? 50.524  111.840 -5.847  1.00 6.80  ? 91  ASP B CG   1 
ATOM   5795  O  OD1  . ASP B  1 91  ? 51.175  112.838 -5.494  1.00 6.92  ? 91  ASP B OD1  1 
ATOM   5796  O  OD2  . ASP B  1 91  ? 50.770  110.673 -5.441  1.00 9.05  ? 91  ASP B OD2  1 
ATOM   5797  H  H    . ASP B  1 91  ? 48.584  112.041 -9.507  1.00 9.42  ? 91  ASP B H    1 
ATOM   5798  H  HA   . ASP B  1 91  ? 50.103  113.612 -7.938  1.00 7.12  ? 91  ASP B HA   1 
ATOM   5799  H  HB2  . ASP B  1 91  ? 48.724  112.626 -6.334  1.00 6.85  ? 91  ASP B HB2  1 
ATOM   5800  H  HB3  . ASP B  1 91  ? 48.967  111.186 -6.961  1.00 6.85  ? 91  ASP B HB3  1 
ATOM   5801  N  N    . TYR B  1 92  ? 52.109  112.425 -8.629  1.00 3.78  ? 92  TYR B N    1 
ATOM   5802  C  CA   . TYR B  1 92  ? 53.247  111.767 -9.244  1.00 5.20  ? 92  TYR B CA   1 
ATOM   5803  C  C    . TYR B  1 92  ? 53.512  110.406 -8.618  1.00 6.08  ? 92  TYR B C    1 
ATOM   5804  O  O    . TYR B  1 92  ? 53.872  109.458 -9.323  1.00 4.84  ? 92  TYR B O    1 
ATOM   5805  C  CB   . TYR B  1 92  ? 54.475  112.655 -9.197  1.00 4.10  ? 92  TYR B CB   1 
ATOM   5806  C  CG   . TYR B  1 92  ? 54.347  113.847 -10.137 1.00 3.57  ? 92  TYR B CG   1 
ATOM   5807  C  CD1  . TYR B  1 92  ? 54.232  113.670 -11.511 1.00 3.66  ? 92  TYR B CD1  1 
ATOM   5808  C  CD2  . TYR B  1 92  ? 54.331  115.160 -9.641  1.00 4.51  ? 92  TYR B CD2  1 
ATOM   5809  C  CE1  . TYR B  1 92  ? 54.107  114.765 -12.376 1.00 3.66  ? 92  TYR B CE1  1 
ATOM   5810  C  CE2  . TYR B  1 92  ? 54.209  116.243 -10.485 1.00 6.22  ? 92  TYR B CE2  1 
ATOM   5811  C  CZ   . TYR B  1 92  ? 54.085  116.038 -11.866 1.00 5.13  ? 92  TYR B CZ   1 
ATOM   5812  O  OH   . TYR B  1 92  ? 53.953  117.099 -12.729 1.00 5.65  ? 92  TYR B OH   1 
ATOM   5813  H  H    . TYR B  1 92  ? 52.298  113.150 -8.208  1.00 4.54  ? 92  TYR B H    1 
ATOM   5814  H  HA   . TYR B  1 92  ? 53.038  111.614 -10.189 1.00 6.23  ? 92  TYR B HA   1 
ATOM   5815  H  HB2  . TYR B  1 92  ? 54.590  112.992 -8.294  1.00 4.92  ? 92  TYR B HB2  1 
ATOM   5816  H  HB3  . TYR B  1 92  ? 55.252  112.140 -9.464  1.00 4.92  ? 92  TYR B HB3  1 
ATOM   5817  H  HD1  . TYR B  1 92  ? 54.238  112.809 -11.862 1.00 4.39  ? 92  TYR B HD1  1 
ATOM   5818  H  HD2  . TYR B  1 92  ? 54.404  115.302 -8.725  1.00 5.41  ? 92  TYR B HD2  1 
ATOM   5819  H  HE1  . TYR B  1 92  ? 54.026  114.629 -13.292 1.00 4.39  ? 92  TYR B HE1  1 
ATOM   5820  H  HE2  . TYR B  1 92  ? 54.195  117.106 -10.138 1.00 7.46  ? 92  TYR B HE2  1 
ATOM   5821  H  HH   . TYR B  1 92  ? 54.604  117.594 -12.665 1.00 6.77  ? 92  TYR B HH   1 
ATOM   5822  N  N    . GLY B  1 93  ? 53.275  110.288 -7.308  1.00 7.07  ? 93  GLY B N    1 
ATOM   5823  C  CA   . GLY B  1 93  ? 53.437  109.002 -6.637  1.00 8.52  ? 93  GLY B CA   1 
ATOM   5824  C  C    . GLY B  1 93  ? 52.442  107.966 -7.110  1.00 4.23  ? 93  GLY B C    1 
ATOM   5825  O  O    . GLY B  1 93  ? 52.787  106.806 -7.312  1.00 17.62 ? 93  GLY B O    1 
ATOM   5826  H  H    . GLY B  1 93  ? 53.023  110.930 -6.794  1.00 8.49  ? 93  GLY B H    1 
ATOM   5827  H  HA2  . GLY B  1 93  ? 54.331  108.664 -6.801  1.00 10.22 ? 93  GLY B HA2  1 
ATOM   5828  H  HA3  . GLY B  1 93  ? 53.324  109.120 -5.681  1.00 10.22 ? 93  GLY B HA3  1 
ATOM   5829  N  N    . ALA B  1 94  ? 51.195  108.372 -7.327  1.00 4.33  ? 94  ALA B N    1 
ATOM   5830  C  CA   . ALA B  1 94  ? 50.209  107.502 -7.889  1.00 4.62  ? 94  ALA B CA   1 
ATOM   5831  C  C    . ALA B  1 94  ? 50.576  107.133 -9.344  1.00 9.45  ? 94  ALA B C    1 
ATOM   5832  O  O    . ALA B  1 94  ? 50.488  105.991 -9.742  1.00 12.85 ? 94  ALA B O    1 
ATOM   5833  C  CB   . ALA B  1 94  ? 48.825  108.160 -7.827  1.00 5.76  ? 94  ALA B CB   1 
ATOM   5834  H  H    . ALA B  1 94  ? 50.905  109.162 -7.148  1.00 5.19  ? 94  ALA B H    1 
ATOM   5835  H  HA   . ALA B  1 94  ? 50.175  106.674 -7.365  1.00 5.54  ? 94  ALA B HA   1 
ATOM   5836  H  HB1  . ALA B  1 94  ? 48.178  107.562 -8.208  1.00 6.91  ? 94  ALA B HB1  1 
ATOM   5837  H  HB2  . ALA B  1 94  ? 48.606  108.339 -6.910  1.00 6.91  ? 94  ALA B HB2  1 
ATOM   5838  H  HB3  . ALA B  1 94  ? 48.847  108.980 -8.325  1.00 6.91  ? 94  ALA B HB3  1 
ATOM   5839  N  N    . LEU B  1 95  ? 51.016  108.116 -10.120 1.00 4.50  ? 95  LEU B N    1 
ATOM   5840  C  CA   . LEU B  1 95  ? 51.337  107.883 -11.541 1.00 4.60  ? 95  LEU B CA   1 
ATOM   5841  C  C    . LEU B  1 95  ? 52.548  106.962 -11.726 1.00 4.62  ? 95  LEU B C    1 
ATOM   5842  O  O    . LEU B  1 95  ? 52.810  106.457 -12.852 1.00 6.41  ? 95  LEU B O    1 
ATOM   5843  C  CB   . LEU B  1 95  ? 51.552  109.219 -12.281 1.00 7.43  ? 95  LEU B CB   1 
ATOM   5844  C  CG   . LEU B  1 95  ? 50.314  110.110 -12.342 1.00 6.69  ? 95  LEU B CG   1 
ATOM   5845  C  CD1  . LEU B  1 95  ? 50.665  111.486 -12.831 1.00 8.04  ? 95  LEU B CD1  1 
ATOM   5846  C  CD2  . LEU B  1 95  ? 49.259  109.488 -13.198 1.00 5.81  ? 95  LEU B CD2  1 
ATOM   5847  H  H    . LEU B  1 95  ? 51.139  108.926 -9.859  1.00 5.40  ? 95  LEU B H    1 
ATOM   5848  H  HA   . LEU B  1 95  ? 50.570  107.439 -11.959 1.00 5.52  ? 95  LEU B HA   1 
ATOM   5849  H  HB2  . LEU B  1 95  ? 52.252  109.716 -11.828 1.00 8.91  ? 95  LEU B HB2  1 
ATOM   5850  H  HB3  . LEU B  1 95  ? 51.824  109.029 -13.192 1.00 8.91  ? 95  LEU B HB3  1 
ATOM   5851  H  HG   . LEU B  1 95  ? 49.952  110.200 -11.446 1.00 8.02  ? 95  LEU B HG   1 
ATOM   5852  H  HD11 . LEU B  1 95  ? 49.868  112.020 -12.858 1.00 9.65  ? 95  LEU B HD11 1 
ATOM   5853  H  HD12 . LEU B  1 95  ? 51.303  111.878 -12.230 1.00 9.65  ? 95  LEU B HD12 1 
ATOM   5854  H  HD13 . LEU B  1 95  ? 51.043  111.417 -13.711 1.00 9.65  ? 95  LEU B HD13 1 
ATOM   5855  H  HD21 . LEU B  1 95  ? 48.493  110.067 -13.219 1.00 6.97  ? 95  LEU B HD21 1 
ATOM   5856  H  HD22 . LEU B  1 95  ? 49.606  109.371 -14.085 1.00 6.97  ? 95  LEU B HD22 1 
ATOM   5857  H  HD23 . LEU B  1 95  ? 49.016  108.637 -12.825 1.00 6.97  ? 95  LEU B HD23 1 
ATOM   5858  N  N    . MET B  1 96  ? 53.286  106.726 -10.644 1.00 9.84  ? 96  MET B N    1 
ATOM   5859  C  CA   . MET B  1 96  ? 54.462  105.887 -10.697 1.00 8.40  ? 96  MET B CA   1 
ATOM   5860  C  C    . MET B  1 96  ? 54.084  104.388 -10.935 1.00 9.10  ? 96  MET B C    1 
ATOM   5861  O  O    . MET B  1 96  ? 54.947  103.574 -11.269 1.00 7.30  ? 96  MET B O    1 
ATOM   5862  C  CB   . MET B  1 96  ? 55.376  106.126 -9.479  1.00 14.33 ? 96  MET B CB   1 
ATOM   5863  C  CG   . MET B  1 96  ? 55.111  105.326 -8.239  1.00 20.89 ? 96  MET B CG   1 
ATOM   5864  S  SD   . MET B  1 96  ? 56.274  105.861 -6.929  1.00 13.12 ? 96  MET B SD   1 
ATOM   5865  C  CE   . MET B  1 96  ? 57.659  104.820 -7.397  1.00 15.93 ? 96  MET B CE   1 
ATOM   5866  H  H    . MET B  1 96  ? 53.119  107.046 -9.864  1.00 11.80 ? 96  MET B H    1 
ATOM   5867  H  HA   . MET B  1 96  ? 54.979  106.174 -11.478 1.00 10.08 ? 96  MET B HA   1 
ATOM   5868  H  HB2  . MET B  1 96  ? 56.288  105.936 -9.748  1.00 17.19 ? 96  MET B HB2  1 
ATOM   5869  H  HB3  . MET B  1 96  ? 55.307  107.062 -9.232  1.00 17.19 ? 96  MET B HB3  1 
ATOM   5870  H  HG2  . MET B  1 96  ? 54.203  105.484 -7.934  1.00 25.07 ? 96  MET B HG2  1 
ATOM   5871  H  HG3  . MET B  1 96  ? 55.255  104.384 -8.419  1.00 25.07 ? 96  MET B HG3  1 
ATOM   5872  H  HE1  . MET B  1 96  ? 58.386  104.979 -6.790  1.00 19.11 ? 96  MET B HE1  1 
ATOM   5873  H  HE2  . MET B  1 96  ? 57.388  103.901 -7.350  1.00 19.11 ? 96  MET B HE2  1 
ATOM   5874  H  HE3  . MET B  1 96  ? 57.925  105.039 -8.293  1.00 19.11 ? 96  MET B HE3  1 
ATOM   5875  N  N    . ASP B  1 97  ? 52.796  104.055 -10.825 1.00 7.28  ? 97  ASP B N    1 
ATOM   5876  C  CA   . ASP B  1 97  ? 52.296  102.750 -11.271 1.00 8.50  ? 97  ASP B CA   1 
ATOM   5877  C  C    . ASP B  1 97  ? 52.404  102.621 -12.796 1.00 10.42 ? 97  ASP B C    1 
ATOM   5878  O  O    . ASP B  1 97  ? 52.499  101.499 -13.316 1.00 10.37 ? 97  ASP B O    1 
ATOM   5879  C  CB   . ASP B  1 97  ? 50.816  102.530 -10.900 1.00 16.08 ? 97  ASP B CB   1 
ATOM   5880  C  CG   . ASP B  1 97  ? 50.547  102.502 -9.369  1.00 19.22 ? 97  ASP B CG   1 
ATOM   5881  O  OD1  . ASP B  1 97  ? 51.471  102.407 -8.521  1.00 13.43 ? 97  ASP B OD1  1 
ATOM   5882  O  OD2  . ASP B  1 97  ? 49.347  102.567 -9.031  1.00 16.59 ? 97  ASP B OD2  1 
ATOM   5883  H  H    . ASP B  1 97  ? 52.190  104.567 -10.495 1.00 8.74  ? 97  ASP B H    1 
ATOM   5884  H  HA   . ASP B  1 97  ? 52.829  102.037 -10.860 1.00 10.20 ? 97  ASP B HA   1 
ATOM   5885  H  HB2  . ASP B  1 97  ? 50.289  103.250 -11.280 1.00 19.30 ? 97  ASP B HB2  1 
ATOM   5886  H  HB3  . ASP B  1 97  ? 50.525  101.681 -11.268 1.00 19.30 ? 97  ASP B HB3  1 
ATOM   5887  N  N    . ILE B  1 98  ? 52.380  103.765 -13.497 1.00 7.26  ? 98  ILE B N    1 
ATOM   5888  C  CA   . ILE B  1 98  ? 52.402  103.805 -14.971 1.00 10.53 ? 98  ILE B CA   1 
ATOM   5889  C  C    . ILE B  1 98  ? 53.792  104.136 -15.515 1.00 11.74 ? 98  ILE B C    1 
ATOM   5890  O  O    . ILE B  1 98  ? 54.329  103.400 -16.368 1.00 9.48  ? 98  ILE B O    1 
ATOM   5891  C  CB   . ILE B  1 98  ? 51.374  104.814 -15.528 1.00 8.69  ? 98  ILE B CB   1 
ATOM   5892  C  CG1  . ILE B  1 98  ? 50.004  104.566 -14.881 1.00 14.28 ? 98  ILE B CG1  1 
ATOM   5893  C  CG2  . ILE B  1 98  ? 51.302  104.727 -17.083 1.00 8.37  ? 98  ILE B CG2  1 
ATOM   5894  C  CD1  . ILE B  1 98  ? 48.963  105.595 -15.227 1.00 18.42 ? 98  ILE B CD1  1 
ATOM   5895  H  H    . ILE B  1 98  ? 52.351  104.544 -13.135 1.00 8.71  ? 98  ILE B H    1 
ATOM   5896  H  HA   . ILE B  1 98  ? 52.157  102.919 -15.309 1.00 12.64 ? 98  ILE B HA   1 
ATOM   5897  H  HB   . ILE B  1 98  ? 51.665  105.708 -15.288 1.00 10.43 ? 98  ILE B HB   1 
ATOM   5898  H  HG12 . ILE B  1 98  ? 49.674  103.702 -15.173 1.00 17.14 ? 98  ILE B HG12 1 
ATOM   5899  H  HG13 . ILE B  1 98  ? 50.111  104.566 -13.917 1.00 17.14 ? 98  ILE B HG13 1 
ATOM   5900  H  HG21 . ILE B  1 98  ? 50.657  105.362 -17.402 1.00 10.04 ? 98  ILE B HG21 1 
ATOM   5901  H  HG22 . ILE B  1 98  ? 52.167  104.927 -17.447 1.00 10.04 ? 98  ILE B HG22 1 
ATOM   5902  H  HG23 . ILE B  1 98  ? 51.038  103.838 -17.334 1.00 10.04 ? 98  ILE B HG23 1 
ATOM   5903  H  HD11 . ILE B  1 98  ? 48.142  105.368 -14.785 1.00 22.11 ? 98  ILE B HD11 1 
ATOM   5904  H  HD12 . ILE B  1 98  ? 49.267  106.457 -14.932 1.00 22.11 ? 98  ILE B HD12 1 
ATOM   5905  H  HD13 . ILE B  1 98  ? 48.833  105.600 -16.178 1.00 22.11 ? 98  ILE B HD13 1 
ATOM   5906  N  N    . VAL B  1 99  ? 54.370  105.223 -15.009 1.00 6.19  ? 99  VAL B N    1 
ATOM   5907  C  CA   . VAL B  1 99  ? 55.734  105.608 -15.310 1.00 6.95  ? 99  VAL B CA   1 
ATOM   5908  C  C    . VAL B  1 99  ? 56.501  105.790 -14.012 1.00 7.13  ? 99  VAL B C    1 
ATOM   5909  O  O    . VAL B  1 99  ? 56.393  106.834 -13.355 1.00 6.01  ? 99  VAL B O    1 
ATOM   5910  C  CB   . VAL B  1 99  ? 55.813  106.916 -16.186 1.00 12.22 ? 99  VAL B CB   1 
ATOM   5911  C  CG1  . VAL B  1 99  ? 57.250  107.262 -16.466 1.00 9.70  ? 99  VAL B CG1  1 
ATOM   5912  C  CG2  . VAL B  1 99  ? 55.098  106.745 -17.497 1.00 9.27  ? 99  VAL B CG2  1 
ATOM   5913  H  H    . VAL B  1 99  ? 53.974  105.766 -14.473 1.00 7.43  ? 99  VAL B H    1 
ATOM   5914  H  HA   . VAL B  1 99  ? 56.163  104.885 -15.814 1.00 8.34  ? 99  VAL B HA   1 
ATOM   5915  H  HB   . VAL B  1 99  ? 55.401  107.662 -15.701 1.00 14.66 ? 99  VAL B HB   1 
ATOM   5916  H  HG11 . VAL B  1 99  ? 57.281  108.059 -16.999 1.00 11.64 ? 99  VAL B HG11 1 
ATOM   5917  H  HG12 . VAL B  1 99  ? 57.705  107.407 -15.633 1.00 11.64 ? 99  VAL B HG12 1 
ATOM   5918  H  HG13 . VAL B  1 99  ? 57.660  106.534 -16.940 1.00 11.64 ? 99  VAL B HG13 1 
ATOM   5919  H  HG21 . VAL B  1 99  ? 55.169  107.560 -18.000 1.00 11.12 ? 99  VAL B HG21 1 
ATOM   5920  H  HG22 . VAL B  1 99  ? 55.506  106.025 -17.983 1.00 11.12 ? 99  VAL B HG22 1 
ATOM   5921  H  HG23 . VAL B  1 99  ? 54.175  106.544 -17.326 1.00 11.12 ? 99  VAL B HG23 1 
ATOM   5922  N  N    . PRO B  1 100 ? 57.315  104.792 -13.642 1.00 7.02  ? 100 PRO B N    1 
ATOM   5923  C  CA   . PRO B  1 100 ? 57.860  104.785 -12.272 1.00 5.44  ? 100 PRO B CA   1 
ATOM   5924  C  C    . PRO B  1 100 ? 58.657  106.009 -11.874 1.00 6.44  ? 100 PRO B C    1 
ATOM   5925  O  O    . PRO B  1 100 ? 58.517  106.484 -10.745 1.00 5.56  ? 100 PRO B O    1 
ATOM   5926  C  CB   . PRO B  1 100 ? 58.779  103.573 -12.293 1.00 11.20 ? 100 PRO B CB   1 
ATOM   5927  C  CG   . PRO B  1 100 ? 58.057  102.613 -13.157 1.00 8.90  ? 100 PRO B CG   1 
ATOM   5928  C  CD   . PRO B  1 100 ? 57.465  103.463 -14.277 1.00 5.78  ? 100 PRO B CD   1 
ATOM   5929  H  HA   . PRO B  1 100 ? 57.144  104.638 -11.620 1.00 6.53  ? 100 PRO B HA   1 
ATOM   5930  H  HB2  . PRO B  1 100 ? 59.636  103.813 -12.680 1.00 13.44 ? 100 PRO B HB2  1 
ATOM   5931  H  HB3  . PRO B  1 100 ? 58.887  103.222 -11.396 1.00 13.44 ? 100 PRO B HB3  1 
ATOM   5932  H  HG2  . PRO B  1 100 ? 58.679  101.960 -13.513 1.00 10.68 ? 100 PRO B HG2  1 
ATOM   5933  H  HG3  . PRO B  1 100 ? 57.355  102.178 -12.647 1.00 10.68 ? 100 PRO B HG3  1 
ATOM   5934  H  HD2  . PRO B  1 100 ? 58.079  103.512 -15.026 1.00 6.94  ? 100 PRO B HD2  1 
ATOM   5935  H  HD3  . PRO B  1 100 ? 56.600  103.115 -14.545 1.00 6.94  ? 100 PRO B HD3  1 
ATOM   5936  N  N    . ASP B  1 101 ? 59.497  106.502 -12.766 1.00 7.96  ? 101 ASP B N    1 
ATOM   5937  C  CA   . ASP B  1 101 ? 60.387  107.615 -12.416 1.00 4.85  ? 101 ASP B CA   1 
ATOM   5938  C  C    . ASP B  1 101 ? 59.678  108.915 -12.030 1.00 5.46  ? 101 ASP B C    1 
ATOM   5939  O  O    . ASP B  1 101 ? 60.287  109.773 -11.400 1.00 3.81  ? 101 ASP B O    1 
ATOM   5940  C  CB   . ASP B  1 101 ? 61.427  107.850 -13.513 1.00 6.34  ? 101 ASP B CB   1 
ATOM   5941  C  CG   . ASP B  1 101 ? 62.537  106.791 -13.521 1.00 7.59  ? 101 ASP B CG   1 
ATOM   5942  O  OD1  . ASP B  1 101 ? 62.467  105.760 -12.790 1.00 5.71  ? 101 ASP B OD1  1 
ATOM   5943  O  OD2  . ASP B  1 101 ? 63.466  106.981 -14.324 1.00 8.17  ? 101 ASP B OD2  1 
ATOM   5944  H  H    . ASP B  1 101 ? 59.577  106.219 -13.575 1.00 9.56  ? 101 ASP B H    1 
ATOM   5945  H  HA   . ASP B  1 101 ? 60.890  107.338 -11.622 1.00 5.82  ? 101 ASP B HA   1 
ATOM   5946  H  HB2  . ASP B  1 101 ? 60.986  107.827 -14.376 1.00 7.60  ? 101 ASP B HB2  1 
ATOM   5947  H  HB3  . ASP B  1 101 ? 61.841  108.716 -13.375 1.00 7.60  ? 101 ASP B HB3  1 
ATOM   5948  N  N    . LEU B  1 102 ? 58.392  109.056 -12.349 1.00 3.96  ? 102 LEU B N    1 
ATOM   5949  C  CA   . LEU B  1 102 ? 57.683  110.251 -11.971 1.00 3.82  ? 102 LEU B CA   1 
ATOM   5950  C  C    . LEU B  1 102 ? 57.639  110.376 -10.447 1.00 5.88  ? 102 LEU B C    1 
ATOM   5951  O  O    . LEU B  1 102 ? 57.562  111.474 -9.917  1.00 4.03  ? 102 LEU B O    1 
ATOM   5952  C  CB   . LEU B  1 102 ? 56.254  110.226 -12.486 1.00 4.02  ? 102 LEU B CB   1 
ATOM   5953  C  CG   . LEU B  1 102 ? 56.079  110.483 -14.001 1.00 4.07  ? 102 LEU B CG   1 
ATOM   5954  C  CD1  . LEU B  1 102 ? 54.620  110.226 -14.443 1.00 7.29  ? 102 LEU B CD1  1 
ATOM   5955  C  CD2  . LEU B  1 102 ? 56.488  111.904 -14.330 1.00 8.23  ? 102 LEU B CD2  1 
ATOM   5956  H  H    . LEU B  1 102 ? 57.922  108.477 -12.777 1.00 4.75  ? 102 LEU B H    1 
ATOM   5957  H  HA   . LEU B  1 102 ? 58.137  111.037 -12.339 1.00 4.59  ? 102 LEU B HA   1 
ATOM   5958  H  HB2  . LEU B  1 102 ? 55.875  109.353 -12.295 1.00 4.82  ? 102 LEU B HB2  1 
ATOM   5959  H  HB3  . LEU B  1 102 ? 55.747  110.907 -12.017 1.00 4.82  ? 102 LEU B HB3  1 
ATOM   5960  H  HG   . LEU B  1 102 ? 56.655  109.879 -14.496 1.00 4.88  ? 102 LEU B HG   1 
ATOM   5961  H  HD11 . LEU B  1 102 ? 54.544  110.394 -15.385 1.00 8.74  ? 102 LEU B HD11 1 
ATOM   5962  H  HD12 . LEU B  1 102 ? 54.393  109.313 -14.253 1.00 8.74  ? 102 LEU B HD12 1 
ATOM   5963  H  HD13 . LEU B  1 102 ? 54.039  110.816 -13.957 1.00 8.74  ? 102 LEU B HD13 1 
ATOM   5964  H  HD21 . LEU B  1 102 ? 56.375  112.051 -15.272 1.00 9.88  ? 102 LEU B HD21 1 
ATOM   5965  H  HD22 . LEU B  1 102 ? 55.934  112.511 -13.835 1.00 9.88  ? 102 LEU B HD22 1 
ATOM   5966  H  HD23 . LEU B  1 102 ? 57.409  112.027 -14.087 1.00 9.88  ? 102 LEU B HD23 1 
ATOM   5967  N  N    . GLY B  1 103 ? 57.676  109.235 -9.771  1.00 4.40  ? 103 GLY B N    1 
ATOM   5968  C  CA   . GLY B  1 103 ? 57.474  109.212 -8.337  1.00 7.15  ? 103 GLY B CA   1 
ATOM   5969  C  C    . GLY B  1 103 ? 58.485  110.009 -7.546  1.00 13.07 ? 103 GLY B C    1 
ATOM   5970  O  O    . GLY B  1 103 ? 58.219  110.455 -6.431  1.00 14.73 ? 103 GLY B O    1 
ATOM   5971  H  H    . GLY B  1 103 ? 57.816  108.463 -10.122 1.00 5.28  ? 103 GLY B H    1 
ATOM   5972  H  HA2  . GLY B  1 103 ? 56.593  109.563 -8.137  1.00 8.58  ? 103 GLY B HA2  1 
ATOM   5973  H  HA3  . GLY B  1 103 ? 57.509  108.293 -8.028  1.00 8.58  ? 103 GLY B HA3  1 
ATOM   5974  N  N    . VAL B  1 104 ? 59.665  110.176 -8.109  1.00 5.44  ? 104 VAL B N    1 
ATOM   5975  C  CA   . VAL B  1 104 ? 60.746  110.809 -7.378  1.00 6.37  ? 104 VAL B CA   1 
ATOM   5976  C  C    . VAL B  1 104 ? 60.463  112.294 -7.113  1.00 7.37  ? 104 VAL B C    1 
ATOM   5977  O  O    . VAL B  1 104 ? 61.014  112.877 -6.188  1.00 8.84  ? 104 VAL B O    1 
ATOM   5978  C  CB   . VAL B  1 104 ? 62.074  110.619 -8.134  1.00 6.02  ? 104 VAL B CB   1 
ATOM   5979  C  CG1  . VAL B  1 104 ? 62.153  111.540 -9.371  1.00 4.84  ? 104 VAL B CG1  1 
ATOM   5980  C  CG2  . VAL B  1 104 ? 63.246  110.866 -7.225  1.00 11.64 ? 104 VAL B CG2  1 
ATOM   5981  H  H    . VAL B  1 104 ? 59.868  109.934 -8.909  1.00 6.53  ? 104 VAL B H    1 
ATOM   5982  H  HA   . VAL B  1 104 ? 60.835  110.366 -6.509  1.00 7.65  ? 104 VAL B HA   1 
ATOM   5983  H  HB   . VAL B  1 104 ? 62.129  109.692 -8.447  1.00 7.22  ? 104 VAL B HB   1 
ATOM   5984  H  HG11 . VAL B  1 104 ? 62.991  111.394 -9.816  1.00 5.81  ? 104 VAL B HG11 1 
ATOM   5985  H  HG12 . VAL B  1 104 ? 61.427  111.330 -9.963  1.00 5.81  ? 104 VAL B HG12 1 
ATOM   5986  H  HG13 . VAL B  1 104 ? 62.088  112.454 -9.085  1.00 5.81  ? 104 VAL B HG13 1 
ATOM   5987  H  HG21 . VAL B  1 104 ? 64.058  110.741 -7.722  1.00 13.97 ? 104 VAL B HG21 1 
ATOM   5988  H  HG22 . VAL B  1 104 ? 63.199  111.766 -6.894  1.00 13.97 ? 104 VAL B HG22 1 
ATOM   5989  H  HG23 . VAL B  1 104 ? 63.210  110.246 -6.494  1.00 13.97 ? 104 VAL B HG23 1 
ATOM   5990  N  N    . ILE B  1 105 ? 59.574  112.885 -7.905  1.00 6.44  ? 105 ILE B N    1 
ATOM   5991  C  CA   . ILE B  1 105 ? 59.353  114.335 -7.825  1.00 4.32  ? 105 ILE B CA   1 
ATOM   5992  C  C    . ILE B  1 105 ? 59.015  114.821 -6.377  1.00 3.49  ? 105 ILE B C    1 
ATOM   5993  O  O    . ILE B  1 105 ? 59.453  115.913 -5.953  1.00 3.77  ? 105 ILE B O    1 
ATOM   5994  C  CB   . ILE B  1 105 ? 58.266  114.774 -8.801  1.00 4.06  ? 105 ILE B CB   1 
ATOM   5995  C  CG1  . ILE B  1 105 ? 58.779  114.612 -10.232 1.00 8.29  ? 105 ILE B CG1  1 
ATOM   5996  C  CG2  . ILE B  1 105 ? 57.879  116.229 -8.547  1.00 3.43  ? 105 ILE B CG2  1 
ATOM   5997  C  CD1  . ILE B  1 105 ? 57.699  114.567 -11.272 1.00 8.68  ? 105 ILE B CD1  1 
ATOM   5998  H  H    . ILE B  1 105 ? 59.090  112.481 -8.491  1.00 7.73  ? 105 ILE B H    1 
ATOM   5999  H  HA   . ILE B  1 105 ? 60.181  114.784 -8.093  1.00 5.18  ? 105 ILE B HA   1 
ATOM   6000  H  HB   . ILE B  1 105 ? 57.485  114.212 -8.679  1.00 4.87  ? 105 ILE B HB   1 
ATOM   6001  H  HG12 . ILE B  1 105 ? 59.359  115.361 -10.441 1.00 9.95  ? 105 ILE B HG12 1 
ATOM   6002  H  HG13 . ILE B  1 105 ? 59.280  113.784 -10.291 1.00 9.95  ? 105 ILE B HG13 1 
ATOM   6003  H  HG21 . ILE B  1 105 ? 57.195  116.483 -9.171  1.00 4.11  ? 105 ILE B HG21 1 
ATOM   6004  H  HG22 . ILE B  1 105 ? 57.550  116.312 -7.649  1.00 4.11  ? 105 ILE B HG22 1 
ATOM   6005  H  HG23 . ILE B  1 105 ? 58.653  116.783 -8.665  1.00 4.11  ? 105 ILE B HG23 1 
ATOM   6006  H  HD11 . ILE B  1 105 ? 58.103  114.464 -12.137 1.00 10.42 ? 105 ILE B HD11 1 
ATOM   6007  H  HD12 . ILE B  1 105 ? 57.121  113.822 -11.090 1.00 10.42 ? 105 ILE B HD12 1 
ATOM   6008  H  HD13 . ILE B  1 105 ? 57.199  115.386 -11.239 1.00 10.42 ? 105 ILE B HD13 1 
ATOM   6009  N  N    . ASN B  1 106 ? 58.226  114.027 -5.650  1.00 3.50  ? 106 ASN B N    1 
ATOM   6010  C  CA   . ASN B  1 106 ? 57.831  114.368 -4.268  1.00 4.41  ? 106 ASN B CA   1 
ATOM   6011  C  C    . ASN B  1 106 ? 58.405  113.389 -3.259  1.00 5.41  ? 106 ASN B C    1 
ATOM   6012  O  O    . ASN B  1 106 ? 57.860  113.238 -2.138  1.00 8.14  ? 106 ASN B O    1 
ATOM   6013  C  CB   . ASN B  1 106 ? 56.309  114.396 -4.179  1.00 7.35  ? 106 ASN B CB   1 
ATOM   6014  C  CG   . ASN B  1 106 ? 55.731  115.553 -4.945  1.00 6.52  ? 106 ASN B CG   1 
ATOM   6015  O  OD1  . ASN B  1 106 ? 56.299  116.643 -4.939  1.00 5.63  ? 106 ASN B OD1  1 
ATOM   6016  N  ND2  . ASN B  1 106 ? 54.611  115.341 -5.588  1.00 5.79  ? 106 ASN B ND2  1 
ATOM   6017  H  H    . ASN B  1 106 ? 57.901  113.282 -5.930  1.00 4.20  ? 106 ASN B H    1 
ATOM   6018  H  HA   . ASN B  1 106 ? 58.166  115.263 -4.049  1.00 5.30  ? 106 ASN B HA   1 
ATOM   6019  H  HB2  . ASN B  1 106 ? 55.951  113.576 -4.553  1.00 8.81  ? 106 ASN B HB2  1 
ATOM   6020  H  HB3  . ASN B  1 106 ? 56.044  114.485 -3.250  1.00 8.81  ? 106 ASN B HB3  1 
ATOM   6021  H  HD21 . ASN B  1 106 ? 54.239  114.566 -5.560  1.00 6.95  ? 106 ASN B HD21 1 
ATOM   6022  H  HD22 . ASN B  1 106 ? 54.247  115.976 -6.038  1.00 6.95  ? 106 ASN B HD22 1 
ATOM   6023  N  N    . ALA B  1 107 ? 59.503  112.725 -3.633  1.00 6.62  ? 107 ALA B N    1 
ATOM   6024  C  CA   . ALA B  1 107 ? 60.201  111.814 -2.711  1.00 6.22  ? 107 ALA B CA   1 
ATOM   6025  C  C    . ALA B  1 107 ? 60.568  112.597 -1.451  1.00 3.92  ? 107 ALA B C    1 
ATOM   6026  O  O    . ALA B  1 107 ? 60.874  113.775 -1.535  1.00 7.16  ? 107 ALA B O    1 
ATOM   6027  C  CB   . ALA B  1 107 ? 61.445  111.229 -3.347  1.00 5.76  ? 107 ALA B CB   1 
ATOM   6028  H  H    . ALA B  1 107 ? 59.865  112.784 -4.411  1.00 7.94  ? 107 ALA B H    1 
ATOM   6029  H  HA   . ALA B  1 107 ? 59.603  111.079 -2.459  1.00 7.47  ? 107 ALA B HA   1 
ATOM   6030  H  HB1  . ALA B  1 107 ? 61.871  110.642 -2.718  1.00 6.91  ? 107 ALA B HB1  1 
ATOM   6031  H  HB2  . ALA B  1 107 ? 61.193  110.739 -4.133  1.00 6.91  ? 107 ALA B HB2  1 
ATOM   6032  H  HB3  . ALA B  1 107 ? 62.041  111.944 -3.583  1.00 6.91  ? 107 ALA B HB3  1 
ATOM   6033  N  N    . PRO B  1 108 ? 60.559  111.940 -0.282  1.00 6.46  ? 108 PRO B N    1 
ATOM   6034  C  CA   . PRO B  1 108 ? 60.766  112.649 0.987   1.00 7.25  ? 108 PRO B CA   1 
ATOM   6035  C  C    . PRO B  1 108 ? 62.112  113.341 1.103   1.00 10.31 ? 108 PRO B C    1 
ATOM   6036  O  O    . PRO B  1 108 ? 63.148  112.750 0.812   1.00 7.01  ? 108 PRO B O    1 
ATOM   6037  C  CB   . PRO B  1 108 ? 60.619  111.540 2.058   1.00 7.57  ? 108 PRO B CB   1 
ATOM   6038  C  CG   . PRO B  1 108 ? 60.894  110.268 1.274   1.00 5.96  ? 108 PRO B CG   1 
ATOM   6039  C  CD   . PRO B  1 108 ? 60.321  110.506 -0.076  1.00 6.95  ? 108 PRO B CD   1 
ATOM   6040  H  HA   . PRO B  1 108 ? 60.056  113.313 1.118   1.00 8.69  ? 108 PRO B HA   1 
ATOM   6041  H  HB2  . PRO B  1 108 ? 61.276  111.665 2.760   1.00 9.08  ? 108 PRO B HB2  1 
ATOM   6042  H  HB3  . PRO B  1 108 ? 59.718  111.540 2.416   1.00 9.08  ? 108 PRO B HB3  1 
ATOM   6043  H  HG2  . PRO B  1 108 ? 61.850  110.119 1.218   1.00 7.15  ? 108 PRO B HG2  1 
ATOM   6044  H  HG3  . PRO B  1 108 ? 60.454  109.518 1.704   1.00 7.15  ? 108 PRO B HG3  1 
ATOM   6045  H  HD2  . PRO B  1 108 ? 60.794  109.984 -0.743  1.00 8.34  ? 108 PRO B HD2  1 
ATOM   6046  H  HD3  . PRO B  1 108 ? 59.370  110.316 -0.080  1.00 8.34  ? 108 PRO B HD3  1 
ATOM   6047  N  N    . TYR B  1 109 ? 62.057  114.614 1.522   1.00 6.94  ? 109 TYR B N    1 
ATOM   6048  C  CA   . TYR B  1 109 ? 63.222  115.463 1.763   1.00 7.32  ? 109 TYR B CA   1 
ATOM   6049  C  C    . TYR B  1 109 ? 64.086  115.752 0.535   1.00 6.22  ? 109 TYR B C    1 
ATOM   6050  O  O    . TYR B  1 109 ? 65.246  116.169 0.652   1.00 7.63  ? 109 TYR B O    1 
ATOM   6051  C  CB   . TYR B  1 109 ? 64.042  114.935 2.939   1.00 5.89  ? 109 TYR B CB   1 
ATOM   6052  C  CG   . TYR B  1 109 ? 63.191  114.818 4.210   1.00 5.17  ? 109 TYR B CG   1 
ATOM   6053  C  CD1  . TYR B  1 109 ? 62.751  115.954 4.877   1.00 8.31  ? 109 TYR B CD1  1 
ATOM   6054  C  CD2  . TYR B  1 109 ? 62.761  113.585 4.682   1.00 5.30  ? 109 TYR B CD2  1 
ATOM   6055  C  CE1  . TYR B  1 109 ? 61.962  115.882 5.988   1.00 8.23  ? 109 TYR B CE1  1 
ATOM   6056  C  CE2  . TYR B  1 109 ? 61.981  113.487 5.792   1.00 5.97  ? 109 TYR B CE2  1 
ATOM   6057  C  CZ   . TYR B  1 109 ? 61.575  114.647 6.453   1.00 7.60  ? 109 TYR B CZ   1 
ATOM   6058  O  OH   . TYR B  1 109 ? 60.796  114.538 7.546   1.00 9.44  ? 109 TYR B OH   1 
ATOM   6059  H  H    . TYR B  1 109 ? 61.316  115.020 1.680   1.00 8.33  ? 109 TYR B H    1 
ATOM   6060  H  HA   . TYR B  1 109 ? 62.877  116.333 2.051   1.00 8.78  ? 109 TYR B HA   1 
ATOM   6061  H  HB2  . TYR B  1 109 ? 64.386  114.055 2.720   1.00 7.07  ? 109 TYR B HB2  1 
ATOM   6062  H  HB3  . TYR B  1 109 ? 64.774  115.546 3.118   1.00 7.07  ? 109 TYR B HB3  1 
ATOM   6063  H  HD1  . TYR B  1 109 ? 63.015  116.790 4.565   1.00 9.97  ? 109 TYR B HD1  1 
ATOM   6064  H  HD2  . TYR B  1 109 ? 63.033  112.809 4.246   1.00 6.36  ? 109 TYR B HD2  1 
ATOM   6065  H  HE1  . TYR B  1 109 ? 61.695  116.657 6.427   1.00 9.87  ? 109 TYR B HE1  1 
ATOM   6066  H  HE2  . TYR B  1 109 ? 61.715  112.653 6.105   1.00 7.17  ? 109 TYR B HE2  1 
ATOM   6067  H  HH   . TYR B  1 109 ? 60.083  114.924 7.422   1.00 11.33 ? 109 TYR B HH   1 
ATOM   6068  N  N    . ILE B  1 110 ? 63.539  115.548 -0.659  1.00 5.72  ? 110 ILE B N    1 
ATOM   6069  C  CA   . ILE B  1 110 ? 64.400  115.633 -1.842  1.00 10.02 ? 110 ILE B CA   1 
ATOM   6070  C  C    . ILE B  1 110 ? 64.866  117.055 -2.136  1.00 8.41  ? 110 ILE B C    1 
ATOM   6071  O  O    . ILE B  1 110 ? 65.969  117.261 -2.658  1.00 7.58  ? 110 ILE B O    1 
ATOM   6072  C  CB   . ILE B  1 110 ? 63.778  114.974 -3.096  1.00 9.19  ? 110 ILE B CB   1 
ATOM   6073  C  CG1  . ILE B  1 110 ? 64.893  114.700 -4.101  1.00 6.60  ? 110 ILE B CG1  1 
ATOM   6074  C  CG2  . ILE B  1 110 ? 62.666  115.791 -3.691  1.00 9.90  ? 110 ILE B CG2  1 
ATOM   6075  C  CD1  . ILE B  1 110 ? 64.433  113.870 -5.267  1.00 6.62  ? 110 ILE B CD1  1 
ATOM   6076  H  H    . ILE B  1 110 ? 62.713  115.367 -0.812  1.00 6.87  ? 110 ILE B H    1 
ATOM   6077  H  HA   . ILE B  1 110 ? 65.210  115.119 -1.642  1.00 12.02 ? 110 ILE B HA   1 
ATOM   6078  H  HB   . ILE B  1 110 ? 63.405  114.120 -2.828  1.00 11.03 ? 110 ILE B HB   1 
ATOM   6079  H  HG12 . ILE B  1 110 ? 65.222  115.545 -4.446  1.00 7.92  ? 110 ILE B HG12 1 
ATOM   6080  H  HG13 . ILE B  1 110 ? 65.609  114.221 -3.656  1.00 7.92  ? 110 ILE B HG13 1 
ATOM   6081  H  HG21 . ILE B  1 110 ? 62.321  115.335 -4.462  1.00 11.87 ? 110 ILE B HG21 1 
ATOM   6082  H  HG22 . ILE B  1 110 ? 61.973  115.898 -3.036  1.00 11.87 ? 110 ILE B HG22 1 
ATOM   6083  H  HG23 . ILE B  1 110 ? 63.012  116.650 -3.946  1.00 11.87 ? 110 ILE B HG23 1 
ATOM   6084  H  HD11 . ILE B  1 110 ? 65.173  113.731 -5.862  1.00 7.94  ? 110 ILE B HD11 1 
ATOM   6085  H  HD12 . ILE B  1 110 ? 64.111  113.026 -4.941  1.00 7.94  ? 110 ILE B HD12 1 
ATOM   6086  H  HD13 . ILE B  1 110 ? 63.728  114.336 -5.723  1.00 7.94  ? 110 ILE B HD13 1 
ATOM   6087  N  N    . SER B  1 111 ? 64.033  118.015 -1.756  1.00 7.07  ? 111 SER B N    1 
ATOM   6088  C  CA   . SER B  1 111 ? 64.360  119.427 -1.873  1.00 8.11  ? 111 SER B CA   1 
ATOM   6089  C  C    . SER B  1 111 ? 63.405  120.279 -1.050  1.00 11.49 ? 111 SER B C    1 
ATOM   6090  O  O    . SER B  1 111 ? 62.219  119.970 -0.946  1.00 9.84  ? 111 SER B O    1 
ATOM   6091  C  CB   . SER B  1 111 ? 64.294  119.846 -3.332  1.00 5.98  ? 111 SER B CB   1 
ATOM   6092  O  OG   . SER B  1 111 ? 64.445  121.245 -3.519  1.00 5.93  ? 111 SER B OG   1 
ATOM   6093  H  H    . SER B  1 111 ? 63.255  117.869 -1.420  1.00 8.48  ? 111 SER B H    1 
ATOM   6094  H  HA   . SER B  1 111 ? 65.271  119.579 -1.547  1.00 9.73  ? 111 SER B HA   1 
ATOM   6095  H  HB2  . SER B  1 111 ? 65.002  119.392 -3.815  1.00 7.18  ? 111 SER B HB2  1 
ATOM   6096  H  HB3  . SER B  1 111 ? 63.433  119.578 -3.691  1.00 7.18  ? 111 SER B HB3  1 
ATOM   6097  H  HG   . SER B  1 111 ? 64.546  121.615 -2.794  1.00 7.11  ? 111 SER B HG   1 
ATOM   6098  N  N    . GLN B  1 112 ? 63.914  121.374 -0.484  1.00 8.45  ? 112 GLN B N    1 
ATOM   6099  C  CA   . GLN B  1 112 ? 63.078  122.270 0.285   1.00 5.96  ? 112 GLN B CA   1 
ATOM   6100  C  C    . GLN B  1 112 ? 62.450  123.397 -0.534  1.00 9.38  ? 112 GLN B C    1 
ATOM   6101  O  O    . GLN B  1 112 ? 61.759  124.248 0.027   1.00 12.07 ? 112 GLN B O    1 
ATOM   6102  C  CB   . GLN B  1 112 ? 63.881  122.925 1.423   1.00 11.28 ? 112 GLN B CB   1 
ATOM   6103  C  CG   . GLN B  1 112 ? 64.543  121.959 2.372   1.00 13.36 ? 112 GLN B CG   1 
ATOM   6104  C  CD   . GLN B  1 112 ? 63.517  121.109 3.082   1.00 19.88 ? 112 GLN B CD   1 
ATOM   6105  O  OE1  . GLN B  1 112 ? 62.833  121.577 4.001   1.00 18.78 ? 112 GLN B OE1  1 
ATOM   6106  N  NE2  . GLN B  1 112 ? 63.362  119.876 2.630   1.00 10.08 ? 112 GLN B NE2  1 
ATOM   6107  H  H    . GLN B  1 112 ? 64.739  121.613 -0.534  1.00 10.14 ? 112 GLN B H    1 
ATOM   6108  H  HA   . GLN B  1 112 ? 62.351  121.752 0.690   1.00 7.15  ? 112 GLN B HA   1 
ATOM   6109  H  HB2  . GLN B  1 112 ? 64.577  123.475 1.032   1.00 13.53 ? 112 GLN B HB2  1 
ATOM   6110  H  HB3  . GLN B  1 112 ? 63.281  123.481 1.943   1.00 13.53 ? 112 GLN B HB3  1 
ATOM   6111  H  HG2  . GLN B  1 112 ? 65.134  121.373 1.874   1.00 16.03 ? 112 GLN B HG2  1 
ATOM   6112  H  HG3  . GLN B  1 112 ? 65.044  122.455 3.039   1.00 16.03 ? 112 GLN B HG3  1 
ATOM   6113  H  HE21 . GLN B  1 112 ? 63.833  119.599 1.966   1.00 12.09 ? 112 GLN B HE21 1 
ATOM   6114  H  HE22 . GLN B  1 112 ? 62.790  119.351 3.000   1.00 12.09 ? 112 GLN B HE22 1 
ATOM   6115  N  N    . SER B  1 113 ? 62.685  123.415 -1.842  1.00 8.46  ? 113 SER B N    1 
ATOM   6116  C  CA   . SER B  1 113 ? 62.311  124.556 -2.697  1.00 11.45 ? 113 SER B CA   1 
ATOM   6117  C  C    . SER B  1 113 ? 61.266  124.218 -3.728  1.00 11.86 ? 113 SER B C    1 
ATOM   6118  O  O    . SER B  1 113 ? 61.540  123.424 -4.664  1.00 9.22  ? 113 SER B O    1 
ATOM   6119  C  CB   . SER B  1 113 ? 63.534  125.085 -3.435  1.00 11.52 ? 113 SER B CB   1 
ATOM   6120  O  OG   . SER B  1 113 ? 63.171  126.133 -4.319  1.00 9.82  ? 113 SER B OG   1 
ATOM   6121  H  H    . SER B  1 113 ? 63.064  122.773 -2.270  1.00 10.15 ? 113 SER B H    1 
ATOM   6122  H  HA   . SER B  1 113 ? 61.960  125.276 -2.133  1.00 13.74 ? 113 SER B HA   1 
ATOM   6123  H  HB2  . SER B  1 113 ? 64.172  125.423 -2.788  1.00 13.82 ? 113 SER B HB2  1 
ATOM   6124  H  HB3  . SER B  1 113 ? 63.931  124.363 -3.947  1.00 13.82 ? 113 SER B HB3  1 
ATOM   6125  H  HG   . SER B  1 113 ? 63.835  126.412 -4.711  1.00 11.79 ? 113 SER B HG   1 
ATOM   6126  N  N    . PHE B  1 114 ? 60.074  124.800 -3.597  1.00 8.28  ? 114 PHE B N    1 
ATOM   6127  C  CA   . PHE B  1 114 ? 59.079  124.622 -4.663  1.00 8.05  ? 114 PHE B CA   1 
ATOM   6128  C  C    . PHE B  1 114 ? 59.607  125.197 -5.988  1.00 11.11 ? 114 PHE B C    1 
ATOM   6129  O  O    . PHE B  1 114 ? 59.321  124.645 -7.056  1.00 7.62  ? 114 PHE B O    1 
ATOM   6130  C  CB   . PHE B  1 114 ? 57.737  125.296 -4.358  1.00 8.48  ? 114 PHE B CB   1 
ATOM   6131  C  CG   . PHE B  1 114 ? 57.005  124.731 -3.172  1.00 11.96 ? 114 PHE B CG   1 
ATOM   6132  C  CD1  . PHE B  1 114 ? 56.445  123.462 -3.216  1.00 15.66 ? 114 PHE B CD1  1 
ATOM   6133  C  CD2  . PHE B  1 114 ? 56.848  125.495 -2.018  1.00 20.38 ? 114 PHE B CD2  1 
ATOM   6134  C  CE1  . PHE B  1 114 ? 55.760  122.961 -2.117  1.00 12.47 ? 114 PHE B CE1  1 
ATOM   6135  C  CE2  . PHE B  1 114 ? 56.167  124.994 -0.920  1.00 23.30 ? 114 PHE B CE2  1 
ATOM   6136  C  CZ   . PHE B  1 114 ? 55.619  123.720 -0.979  1.00 19.80 ? 114 PHE B CZ   1 
ATOM   6137  H  H    . PHE B  1 114 ? 59.821  125.284 -2.932  1.00 9.94  ? 114 PHE B H    1 
ATOM   6138  H  HA   . PHE B  1 114 ? 58.915  123.664 -4.791  1.00 9.66  ? 114 PHE B HA   1 
ATOM   6139  H  HB2  . PHE B  1 114 ? 57.896  126.237 -4.184  1.00 10.18 ? 114 PHE B HB2  1 
ATOM   6140  H  HB3  . PHE B  1 114 ? 57.159  125.201 -5.132  1.00 10.18 ? 114 PHE B HB3  1 
ATOM   6141  H  HD1  . PHE B  1 114 ? 56.536  122.942 -3.982  1.00 18.79 ? 114 PHE B HD1  1 
ATOM   6142  H  HD2  . PHE B  1 114 ? 57.215  126.349 -1.979  1.00 24.46 ? 114 PHE B HD2  1 
ATOM   6143  H  HE1  . PHE B  1 114 ? 55.393  122.107 -2.151  1.00 14.96 ? 114 PHE B HE1  1 
ATOM   6144  H  HE2  . PHE B  1 114 ? 56.072  125.509 -0.152  1.00 27.95 ? 114 PHE B HE2  1 
ATOM   6145  H  HZ   . PHE B  1 114 ? 55.161  123.377 -0.246  1.00 23.76 ? 114 PHE B HZ   1 
ATOM   6146  N  N    . GLU B  1 115 ? 60.367  126.292 -5.927  1.00 10.74 ? 115 GLU B N    1 
ATOM   6147  C  CA   . GLU B  1 115 ? 60.835  126.909 -7.170  1.00 13.89 ? 115 GLU B CA   1 
ATOM   6148  C  C    . GLU B  1 115 ? 61.840  126.010 -7.908  1.00 12.59 ? 115 GLU B C    1 
ATOM   6149  O  O    . GLU B  1 115 ? 61.816  125.947 -9.134  1.00 10.24 ? 115 GLU B O    1 
ATOM   6150  C  CB   . GLU B  1 115 ? 61.439  128.301 -6.950  1.00 12.72 ? 115 GLU B CB   1 
ATOM   6151  C  CG   . GLU B  1 115 ? 62.002  128.912 -8.226  1.00 25.41 ? 115 GLU B CG   1 
ATOM   6152  C  CD   . GLU B  1 115 ? 60.987  128.962 -9.381  1.00 33.14 ? 115 GLU B CD   1 
ATOM   6153  O  OE1  . GLU B  1 115 ? 61.415  128.855 -10.553 1.00 24.20 ? 115 GLU B OE1  1 
ATOM   6154  O  OE2  . GLU B  1 115 ? 59.769  129.115 -9.126  1.00 37.71 ? 115 GLU B OE2  1 
ATOM   6155  H  H    . GLU B  1 115 ? 60.618  126.686 -5.205  1.00 12.89 ? 115 GLU B H    1 
ATOM   6156  H  HA   . GLU B  1 115 ? 60.062  127.021 -7.762  1.00 16.67 ? 115 GLU B HA   1 
ATOM   6157  H  HB2  . GLU B  1 115 ? 60.749  128.894 -6.613  1.00 15.26 ? 115 GLU B HB2  1 
ATOM   6158  H  HB3  . GLU B  1 115 ? 62.161  128.233 -6.306  1.00 15.26 ? 115 GLU B HB3  1 
ATOM   6159  H  HG2  . GLU B  1 115 ? 62.286  129.821 -8.040  1.00 30.49 ? 115 GLU B HG2  1 
ATOM   6160  H  HG3  . GLU B  1 115 ? 62.761  128.384 -8.519  1.00 30.49 ? 115 GLU B HG3  1 
ATOM   6161  N  N    . LYS B  1 116 ? 62.714  125.315 -7.177  1.00 11.76 ? 116 LYS B N    1 
ATOM   6162  C  CA   . LYS B  1 116 ? 63.639  124.384 -7.824  1.00 9.16  ? 116 LYS B CA   1 
ATOM   6163  C  C    . LYS B  1 116 ? 62.889  123.227 -8.464  1.00 9.82  ? 116 LYS B C    1 
ATOM   6164  O  O    . LYS B  1 116 ? 63.207  122.832 -9.595  1.00 9.75  ? 116 LYS B O    1 
ATOM   6165  C  CB   . LYS B  1 116 ? 64.713  123.861 -6.854  1.00 16.25 ? 116 LYS B CB   1 
ATOM   6166  C  CG   . LYS B  1 116 ? 65.649  124.937 -6.356  1.00 19.36 ? 116 LYS B CG   1 
ATOM   6167  C  CD   . LYS B  1 116 ? 66.714  124.389 -5.429  1.00 20.21 ? 116 LYS B CD   1 
ATOM   6168  C  CE   . LYS B  1 116 ? 67.291  125.515 -4.583  1.00 32.41 ? 116 LYS B CE   1 
ATOM   6169  N  NZ   . LYS B  1 116 ? 68.564  125.143 -3.950  1.00 28.37 ? 116 LYS B NZ   1 
ATOM   6170  H  H    . LYS B  1 116 ? 62.790  125.362 -6.321  1.00 14.11 ? 116 LYS B H    1 
ATOM   6171  H  HA   . LYS B  1 116 ? 64.103  124.862 -8.542  1.00 10.99 ? 116 LYS B HA   1 
ATOM   6172  H  HB2  . LYS B  1 116 ? 64.275  123.468 -6.083  1.00 19.50 ? 116 LYS B HB2  1 
ATOM   6173  H  HB3  . LYS B  1 116 ? 65.246  123.190 -7.308  1.00 19.50 ? 116 LYS B HB3  1 
ATOM   6174  H  HG2  . LYS B  1 116 ? 66.092  125.348 -7.114  1.00 23.23 ? 116 LYS B HG2  1 
ATOM   6175  H  HG3  . LYS B  1 116 ? 65.138  125.601 -5.867  1.00 23.23 ? 116 LYS B HG3  1 
ATOM   6176  H  HD2  . LYS B  1 116 ? 66.322  123.727 -4.838  1.00 24.25 ? 116 LYS B HD2  1 
ATOM   6177  H  HD3  . LYS B  1 116 ? 67.431  123.997 -5.953  1.00 24.25 ? 116 LYS B HD3  1 
ATOM   6178  H  HE2  . LYS B  1 116 ? 67.450  126.287 -5.148  1.00 38.90 ? 116 LYS B HE2  1 
ATOM   6179  H  HE3  . LYS B  1 116 ? 66.660  125.739 -3.881  1.00 38.90 ? 116 LYS B HE3  1 
ATOM   6180  H  HZ1  . LYS B  1 116 ? 68.871  125.823 -3.464  1.00 34.04 ? 116 LYS B HZ1  1 
ATOM   6181  H  HZ2  . LYS B  1 116 ? 68.445  124.439 -3.419  1.00 34.04 ? 116 LYS B HZ2  1 
ATOM   6182  H  HZ3  . LYS B  1 116 ? 69.165  124.938 -4.573  1.00 34.04 ? 116 LYS B HZ3  1 
ATOM   6183  N  N    . LYS B  1 117 ? 61.890  122.699 -7.760  1.00 8.83  ? 117 LYS B N    1 
ATOM   6184  C  CA   . LYS B  1 117 ? 61.035  121.686 -8.344  1.00 11.25 ? 117 LYS B CA   1 
ATOM   6185  C  C    . LYS B  1 117 ? 60.333  122.208 -9.596  1.00 9.63  ? 117 LYS B C    1 
ATOM   6186  O  O    . LYS B  1 117 ? 60.184  121.476 -10.553 1.00 6.40  ? 117 LYS B O    1 
ATOM   6187  C  CB   . LYS B  1 117 ? 60.009  121.144 -7.345  1.00 9.21  ? 117 LYS B CB   1 
ATOM   6188  C  CG   . LYS B  1 117 ? 60.628  120.230 -6.310  1.00 7.48  ? 117 LYS B CG   1 
ATOM   6189  C  CD   . LYS B  1 117 ? 59.586  119.562 -5.410  1.00 6.92  ? 117 LYS B CD   1 
ATOM   6190  C  CE   . LYS B  1 117 ? 60.203  118.638 -4.414  1.00 7.16  ? 117 LYS B CE   1 
ATOM   6191  N  NZ   . LYS B  1 117 ? 59.155  117.697 -3.953  1.00 8.73  ? 117 LYS B NZ   1 
ATOM   6192  H  H    . LYS B  1 117 ? 61.692  122.911 -6.951  1.00 10.59 ? 117 LYS B H    1 
ATOM   6193  H  HA   . LYS B  1 117 ? 61.598  120.933 -8.619  1.00 13.51 ? 117 LYS B HA   1 
ATOM   6194  H  HB2  . LYS B  1 117 ? 59.597  121.889 -6.880  1.00 11.05 ? 117 LYS B HB2  1 
ATOM   6195  H  HB3  . LYS B  1 117 ? 59.335  120.640 -7.827  1.00 11.05 ? 117 LYS B HB3  1 
ATOM   6196  H  HG2  . LYS B  1 117 ? 61.125  119.531 -6.762  1.00 8.97  ? 117 LYS B HG2  1 
ATOM   6197  H  HG3  . LYS B  1 117 ? 61.223  120.748 -5.745  1.00 8.97  ? 117 LYS B HG3  1 
ATOM   6198  H  HD2  . LYS B  1 117 ? 59.100  120.247 -4.925  1.00 8.31  ? 117 LYS B HD2  1 
ATOM   6199  H  HD3  . LYS B  1 117 ? 58.975  119.047 -5.961  1.00 8.31  ? 117 LYS B HD3  1 
ATOM   6200  H  HE2  . LYS B  1 117 ? 60.919  118.132 -4.831  1.00 8.59  ? 117 LYS B HE2  1 
ATOM   6201  H  HE3  . LYS B  1 117 ? 60.531  119.142 -3.653  1.00 8.59  ? 117 LYS B HE3  1 
ATOM   6202  H  HZ1  . LYS B  1 117 ? 59.496  117.132 -3.356  1.00 10.48 ? 117 LYS B HZ1  1 
ATOM   6203  H  HZ2  . LYS B  1 117 ? 58.487  118.148 -3.576  1.00 10.48 ? 117 LYS B HZ2  1 
ATOM   6204  H  HZ3  . LYS B  1 117 ? 58.838  117.233 -4.642  1.00 10.48 ? 117 LYS B HZ3  1 
ATOM   6205  N  N    . SER B  1 118 ? 59.865  123.448 -9.591  1.00 8.69  ? 118 SER B N    1 
ATOM   6206  C  CA   . SER B  1 118 ? 59.239  123.993 -10.794 1.00 9.75  ? 118 SER B CA   1 
ATOM   6207  C  C    . SER B  1 118 ? 60.163  123.919 -11.986 1.00 11.74 ? 118 SER B C    1 
ATOM   6208  O  O    . SER B  1 118 ? 59.726  123.548 -13.061 1.00 8.79  ? 118 SER B O    1 
ATOM   6209  C  CB   . SER B  1 118 ? 58.789  125.440 -10.560 1.00 12.95 ? 118 SER B CB   1 
ATOM   6210  O  OG   . SER B  1 118 ? 58.070  125.958 -11.669 1.00 12.02 ? 118 SER B OG   1 
ATOM   6211  H  H    . SER B  1 118 ? 59.895  123.988 -8.921  1.00 10.43 ? 118 SER B H    1 
ATOM   6212  H  HA   . SER B  1 118 ? 58.442  123.462 -11.001 1.00 11.69 ? 118 SER B HA   1 
ATOM   6213  H  HB2  . SER B  1 118 ? 58.218  125.467 -9.777  1.00 15.54 ? 118 SER B HB2  1 
ATOM   6214  H  HB3  . SER B  1 118 ? 59.574  125.990 -10.413 1.00 15.54 ? 118 SER B HB3  1 
ATOM   6215  H  HG   . SER B  1 118 ? 58.014  125.390 -12.257 1.00 14.42 ? 118 SER B HG   1 
ATOM   6216  N  N    . LYS B  1 119 ? 61.433  124.270 -11.795 1.00 11.27 ? 119 LYS B N    1 
ATOM   6217  C  CA   . LYS B  1 119 ? 62.418  124.225 -12.863 1.00 7.52  ? 119 LYS B CA   1 
ATOM   6218  C  C    . LYS B  1 119 ? 62.678  122.776 -13.284 1.00 8.90  ? 119 LYS B C    1 
ATOM   6219  O  O    . LYS B  1 119 ? 62.830  122.486 -14.487 1.00 7.08  ? 119 LYS B O    1 
ATOM   6220  C  CB   . LYS B  1 119 ? 63.716  124.892 -12.409 1.00 14.02 ? 119 LYS B CB   1 
ATOM   6221  C  CG   . LYS B  1 119 ? 63.560  126.424 -12.149 1.00 12.86 ? 119 LYS B CG   1 
ATOM   6222  C  CD   . LYS B  1 119 ? 64.888  127.060 -11.830 1.00 22.18 ? 119 LYS B CD   1 
ATOM   6223  C  CE   . LYS B  1 119 ? 64.807  128.600 -11.837 1.00 28.24 ? 119 LYS B CE   1 
ATOM   6224  N  NZ   . LYS B  1 119 ? 64.138  129.176 -10.644 1.00 24.69 ? 119 LYS B NZ   1 
ATOM   6225  H  H    . LYS B  1 119 ? 61.750  124.541 -11.043 1.00 13.52 ? 119 LYS B H    1 
ATOM   6226  H  HA   . LYS B  1 119 ? 62.076  124.714 -13.639 1.00 9.02  ? 119 LYS B HA   1 
ATOM   6227  H  HB2  . LYS B  1 119 ? 64.011  124.477 -11.584 1.00 16.83 ? 119 LYS B HB2  1 
ATOM   6228  H  HB3  . LYS B  1 119 ? 64.388  124.773 -13.098 1.00 16.83 ? 119 LYS B HB3  1 
ATOM   6229  H  HG2  . LYS B  1 119 ? 63.201  126.850 -12.943 1.00 15.43 ? 119 LYS B HG2  1 
ATOM   6230  H  HG3  . LYS B  1 119 ? 62.966  126.563 -11.395 1.00 15.43 ? 119 LYS B HG3  1 
ATOM   6231  H  HD2  . LYS B  1 119 ? 65.173  126.776 -10.947 1.00 26.61 ? 119 LYS B HD2  1 
ATOM   6232  H  HD3  . LYS B  1 119 ? 65.540  126.789 -12.495 1.00 26.61 ? 119 LYS B HD3  1 
ATOM   6233  H  HE2  . LYS B  1 119 ? 65.707  128.959 -11.873 1.00 33.89 ? 119 LYS B HE2  1 
ATOM   6234  H  HE3  . LYS B  1 119 ? 64.309  128.882 -12.620 1.00 33.89 ? 119 LYS B HE3  1 
ATOM   6235  H  HZ1  . LYS B  1 119 ? 64.121  130.064 -10.705 1.00 29.63 ? 119 LYS B HZ1  1 
ATOM   6236  H  HZ2  . LYS B  1 119 ? 63.303  128.874 -10.589 1.00 29.63 ? 119 LYS B HZ2  1 
ATOM   6237  H  HZ3  . LYS B  1 119 ? 64.579  128.945 -9.907  1.00 29.63 ? 119 LYS B HZ3  1 
ATOM   6238  N  N    . LEU B  1 120 ? 62.721  121.861 -12.312 1.00 7.79  ? 120 LEU B N    1 
ATOM   6239  C  CA   . LEU B  1 120 ? 62.868  120.454 -12.649 1.00 6.43  ? 120 LEU B CA   1 
ATOM   6240  C  C    . LEU B  1 120 ? 61.727  120.033 -13.579 1.00 6.19  ? 120 LEU B C    1 
ATOM   6241  O  O    . LEU B  1 120 ? 61.896  119.268 -14.543 1.00 7.63  ? 120 LEU B O    1 
ATOM   6242  C  CB   . LEU B  1 120 ? 62.845  119.593 -11.367 1.00 6.28  ? 120 LEU B CB   1 
ATOM   6243  C  CG   . LEU B  1 120 ? 62.956  118.103 -11.658 1.00 6.10  ? 120 LEU B CG   1 
ATOM   6244  C  CD1  . LEU B  1 120 ? 64.373  117.792 -11.946 1.00 7.94  ? 120 LEU B CD1  1 
ATOM   6245  C  CD2  . LEU B  1 120 ? 62.445  117.294 -10.468 1.00 14.91 ? 120 LEU B CD2  1 
ATOM   6246  H  H    . LEU B  1 120 ? 62.668  122.029 -11.471 1.00 9.35  ? 120 LEU B H    1 
ATOM   6247  H  HA   . LEU B  1 120 ? 63.721  120.310 -13.110 1.00 7.71  ? 120 LEU B HA   1 
ATOM   6248  H  HB2  . LEU B  1 120 ? 63.593  119.845 -10.804 1.00 7.53  ? 120 LEU B HB2  1 
ATOM   6249  H  HB3  . LEU B  1 120 ? 62.010  119.746 -10.899 1.00 7.53  ? 120 LEU B HB3  1 
ATOM   6250  H  HG   . LEU B  1 120 ? 62.424  117.881 -12.437 1.00 7.32  ? 120 LEU B HG   1 
ATOM   6251  H  HD11 . LEU B  1 120 ? 64.455  116.854 -12.130 1.00 9.53  ? 120 LEU B HD11 1 
ATOM   6252  H  HD12 . LEU B  1 120 ? 64.656  118.303 -12.708 1.00 9.53  ? 120 LEU B HD12 1 
ATOM   6253  H  HD13 . LEU B  1 120 ? 64.905  118.024 -11.181 1.00 9.53  ? 120 LEU B HD13 1 
ATOM   6254  H  HD21 . LEU B  1 120 ? 62.523  116.358 -10.670 1.00 17.89 ? 120 LEU B HD21 1 
ATOM   6255  H  HD22 . LEU B  1 120 ? 62.974  117.507 -9.695  1.00 17.89 ? 120 LEU B HD22 1 
ATOM   6256  H  HD23 . LEU B  1 120 ? 61.526  117.519 -10.308 1.00 17.89 ? 120 LEU B HD23 1 
ATOM   6257  N  N    . LEU B  1 121 ? 60.538  120.525 -13.272 1.00 6.16  ? 121 LEU B N    1 
ATOM   6258  C  CA   . LEU B  1 121 ? 59.348  120.132 -13.977 1.00 6.03  ? 121 LEU B CA   1 
ATOM   6259  C  C    . LEU B  1 121 ? 59.192  120.844 -15.330 1.00 12.74 ? 121 LEU B C    1 
ATOM   6260  O  O    . LEU B  1 121 ? 58.187  120.647 -16.010 1.00 12.51 ? 121 LEU B O    1 
ATOM   6261  C  CB   . LEU B  1 121 ? 58.130  120.364 -13.086 1.00 6.08  ? 121 LEU B CB   1 
ATOM   6262  C  CG   . LEU B  1 121 ? 58.097  119.448 -11.851 1.00 8.30  ? 121 LEU B CG   1 
ATOM   6263  C  CD1  . LEU B  1 121 ? 57.057  119.939 -10.837 1.00 11.25 ? 121 LEU B CD1  1 
ATOM   6264  C  CD2  . LEU B  1 121 ? 57.823  118.007 -12.243 1.00 8.59  ? 121 LEU B CD2  1 
ATOM   6265  H  H    . LEU B  1 121 ? 60.399  121.098 -12.647 1.00 7.39  ? 121 LEU B H    1 
ATOM   6266  H  HA   . LEU B  1 121 ? 59.400  119.170 -14.158 1.00 7.24  ? 121 LEU B HA   1 
ATOM   6267  H  HB2  . LEU B  1 121 ? 58.138  121.283 -12.776 1.00 7.29  ? 121 LEU B HB2  1 
ATOM   6268  H  HB3  . LEU B  1 121 ? 57.326  120.197 -13.603 1.00 7.29  ? 121 LEU B HB3  1 
ATOM   6269  H  HG   . LEU B  1 121 ? 58.966  119.476 -11.420 1.00 9.96  ? 121 LEU B HG   1 
ATOM   6270  H  HD11 . LEU B  1 121 ? 57.059  119.351 -10.079 1.00 13.50 ? 121 LEU B HD11 1 
ATOM   6271  H  HD12 . LEU B  1 121 ? 57.287  120.830 -10.561 1.00 13.50 ? 121 LEU B HD12 1 
ATOM   6272  H  HD13 . LEU B  1 121 ? 56.192  119.937 -11.252 1.00 13.50 ? 121 LEU B HD13 1 
ATOM   6273  H  HD21 . LEU B  1 121 ? 57.809  117.465 -11.451 1.00 10.30 ? 121 LEU B HD21 1 
ATOM   6274  H  HD22 . LEU B  1 121 ? 56.972  117.961 -12.686 1.00 10.30 ? 121 LEU B HD22 1 
ATOM   6275  H  HD23 . LEU B  1 121 ? 58.517  117.706 -12.834 1.00 10.30 ? 121 LEU B HD23 1 
ATOM   6276  N  N    . HIS B  1 122 ? 60.196  121.636 -15.706 1.00 7.54  ? 122 HIS B N    1 
ATOM   6277  C  CA   . HIS B  1 122 ? 60.306  122.150 -17.092 1.00 7.04  ? 122 HIS B CA   1 
ATOM   6278  C  C    . HIS B  1 122 ? 61.536  121.601 -17.802 1.00 8.26  ? 122 HIS B C    1 
ATOM   6279  O  O    . HIS B  1 122 ? 61.853  122.017 -18.918 1.00 13.43 ? 122 HIS B O    1 
ATOM   6280  C  CB   . HIS B  1 122 ? 60.248  123.676 -17.129 1.00 13.78 ? 122 HIS B CB   1 
ATOM   6281  C  CG   . HIS B  1 122 ? 58.904  124.195 -16.743 1.00 20.68 ? 122 HIS B CG   1 
ATOM   6282  N  ND1  . HIS B  1 122 ? 58.533  124.390 -15.427 1.00 23.50 ? 122 HIS B ND1  1 
ATOM   6283  C  CD2  . HIS B  1 122 ? 57.805  124.460 -17.489 1.00 21.53 ? 122 HIS B CD2  1 
ATOM   6284  C  CE1  . HIS B  1 122 ? 57.276  124.789 -15.384 1.00 20.68 ? 122 HIS B CE1  1 
ATOM   6285  N  NE2  . HIS B  1 122 ? 56.811  124.841 -16.621 1.00 29.49 ? 122 HIS B NE2  1 
ATOM   6286  H  H    . HIS B  1 122 ? 60.830  121.894 -15.186 1.00 9.05  ? 122 HIS B H    1 
ATOM   6287  H  HA   . HIS B  1 122 ? 59.527  121.828 -17.591 1.00 8.45  ? 122 HIS B HA   1 
ATOM   6288  H  HB2  . HIS B  1 122 ? 60.901  124.035 -16.507 1.00 16.53 ? 122 HIS B HB2  1 
ATOM   6289  H  HB3  . HIS B  1 122 ? 60.442  123.980 -18.030 1.00 16.53 ? 122 HIS B HB3  1 
ATOM   6290  H  HD1  . HIS B  1 122 ? 59.044  124.277 -14.743 1.00 28.19 ? 122 HIS B HD1  1 
ATOM   6291  H  HD2  . HIS B  1 122 ? 57.740  124.408 -18.415 1.00 25.84 ? 122 HIS B HD2  1 
ATOM   6292  H  HE1  . HIS B  1 122 ? 56.800  125.007 -14.615 1.00 24.81 ? 122 HIS B HE1  1 
ATOM   6293  H  HE2  . HIS B  1 122 ? 56.018  125.083 -16.847 1.00 35.39 ? 122 HIS B HE2  1 
ATOM   6294  N  N    . SER B  1 123 ? 62.162  120.591 -17.207 1.00 10.02 ? 123 SER B N    1 
ATOM   6295  C  CA   . SER B  1 123 ? 63.392  120.051 -17.738 1.00 9.03  ? 123 SER B CA   1 
ATOM   6296  C  C    . SER B  1 123 ? 63.125  118.978 -18.804 1.00 9.09  ? 123 SER B C    1 
ATOM   6297  O  O    . SER B  1 123 ? 62.019  118.451 -18.905 1.00 10.64 ? 123 SER B O    1 
ATOM   6298  C  CB   . SER B  1 123 ? 64.264  119.474 -16.647 1.00 12.19 ? 123 SER B CB   1 
ATOM   6299  O  OG   . SER B  1 123 ? 63.754  118.237 -16.161 1.00 12.06 ? 123 SER B OG   1 
ATOM   6300  H  H    . SER B  1 123 ? 61.888  120.203 -16.490 1.00 12.02 ? 123 SER B H    1 
ATOM   6301  H  HA   . SER B  1 123 ? 63.892  120.776 -18.166 1.00 10.84 ? 123 SER B HA   1 
ATOM   6302  H  HB2  . SER B  1 123 ? 65.154  119.327 -17.004 1.00 14.62 ? 123 SER B HB2  1 
ATOM   6303  H  HB3  . SER B  1 123 ? 64.304  120.106 -15.913 1.00 14.62 ? 123 SER B HB3  1 
ATOM   6304  H  HG   . SER B  1 123 ? 63.065  118.042 -16.559 1.00 14.47 ? 123 SER B HG   1 
ATOM   6305  N  N    . ASP B  1 124 ? 64.151  118.667 -19.575 1.00 7.27  ? 124 ASP B N    1 
ATOM   6306  C  CA   . ASP B  1 124 ? 64.059  117.600 -20.591 1.00 10.60 ? 124 ASP B CA   1 
ATOM   6307  C  C    . ASP B  1 124 ? 63.825  116.246 -19.934 1.00 9.11  ? 124 ASP B C    1 
ATOM   6308  O  O    . ASP B  1 124 ? 63.076  115.418 -20.451 1.00 13.61 ? 124 ASP B O    1 
ATOM   6309  C  CB   . ASP B  1 124 ? 65.318  117.542 -21.444 1.00 15.85 ? 124 ASP B CB   1 
ATOM   6310  C  CG   . ASP B  1 124 ? 65.405  118.689 -22.430 1.00 20.56 ? 124 ASP B CG   1 
ATOM   6311  O  OD1  . ASP B  1 124 ? 64.365  119.308 -22.709 1.00 19.73 ? 124 ASP B OD1  1 
ATOM   6312  O  OD2  . ASP B  1 124 ? 66.520  118.946 -22.922 1.00 21.02 ? 124 ASP B OD2  1 
ATOM   6313  H  H    . ASP B  1 124 ? 64.919  119.052 -19.541 1.00 8.72  ? 124 ASP B H    1 
ATOM   6314  H  HA   . ASP B  1 124 ? 63.299  117.786 -21.182 1.00 12.72 ? 124 ASP B HA   1 
ATOM   6315  H  HB2  . ASP B  1 124 ? 66.095  117.583 -20.865 1.00 19.02 ? 124 ASP B HB2  1 
ATOM   6316  H  HB3  . ASP B  1 124 ? 65.322  116.712 -21.946 1.00 19.02 ? 124 ASP B HB3  1 
ATOM   6317  N  N    . TRP B  1 125 ? 64.472  116.038 -18.793 1.00 10.72 ? 125 TRP B N    1 
ATOM   6318  C  CA   . TRP B  1 125 ? 64.217  114.867 -17.960 1.00 10.54 ? 125 TRP B CA   1 
ATOM   6319  C  C    . TRP B  1 125 ? 62.716  114.649 -17.752 1.00 8.58  ? 125 TRP B C    1 
ATOM   6320  O  O    . TRP B  1 125 ? 62.194  113.554 -17.946 1.00 12.04 ? 125 TRP B O    1 
ATOM   6321  C  CB   . TRP B  1 125 ? 64.925  115.006 -16.611 1.00 10.83 ? 125 TRP B CB   1 
ATOM   6322  C  CG   . TRP B  1 125 ? 64.591  113.907 -15.655 1.00 11.80 ? 125 TRP B CG   1 
ATOM   6323  C  CD1  . TRP B  1 125 ? 65.110  112.668 -15.649 1.00 8.27  ? 125 TRP B CD1  1 
ATOM   6324  C  CD2  . TRP B  1 125 ? 63.640  113.957 -14.581 1.00 6.88  ? 125 TRP B CD2  1 
ATOM   6325  N  NE1  . TRP B  1 125 ? 64.568  111.916 -14.616 1.00 9.48  ? 125 TRP B NE1  1 
ATOM   6326  C  CE2  . TRP B  1 125 ? 63.646  112.684 -13.960 1.00 6.77  ? 125 TRP B CE2  1 
ATOM   6327  C  CE3  . TRP B  1 125 ? 62.781  114.942 -14.090 1.00 15.56 ? 125 TRP B CE3  1 
ATOM   6328  C  CZ2  . TRP B  1 125 ? 62.826  112.379 -12.879 1.00 7.54  ? 125 TRP B CZ2  1 
ATOM   6329  C  CZ3  . TRP B  1 125 ? 61.976  114.639 -13.024 1.00 12.62 ? 125 TRP B CZ3  1 
ATOM   6330  C  CH2  . TRP B  1 125 ? 61.994  113.346 -12.437 1.00 5.81  ? 125 TRP B CH2  1 
ATOM   6331  H  H    . TRP B  1 125 ? 65.071  116.566 -18.475 1.00 12.86 ? 125 TRP B H    1 
ATOM   6332  H  HA   . TRP B  1 125 ? 64.577  114.074 -18.410 1.00 12.65 ? 125 TRP B HA   1 
ATOM   6333  H  HB2  . TRP B  1 125 ? 65.884  114.994 -16.756 1.00 12.99 ? 125 TRP B HB2  1 
ATOM   6334  H  HB3  . TRP B  1 125 ? 64.664  115.846 -16.203 1.00 12.99 ? 125 TRP B HB3  1 
ATOM   6335  H  HD1  . TRP B  1 125 ? 65.765  112.366 -16.236 1.00 9.92  ? 125 TRP B HD1  1 
ATOM   6336  H  HE1  . TRP B  1 125 ? 64.755  111.096 -14.440 1.00 11.37 ? 125 TRP B HE1  1 
ATOM   6337  H  HE3  . TRP B  1 125 ? 62.747  115.782 -14.487 1.00 18.67 ? 125 TRP B HE3  1 
ATOM   6338  H  HZ2  . TRP B  1 125 ? 62.846  111.540 -12.479 1.00 9.05  ? 125 TRP B HZ2  1 
ATOM   6339  H  HZ3  . TRP B  1 125 ? 61.396  115.284 -12.691 1.00 15.15 ? 125 TRP B HZ3  1 
ATOM   6340  H  HH2  . TRP B  1 125 ? 61.450  113.175 -11.702 1.00 6.97  ? 125 TRP B HH2  1 
ATOM   6341  N  N    . PHE B  1 126 ? 62.029  115.683 -17.333 1.00 7.70  ? 126 PHE B N    1 
ATOM   6342  C  CA   . PHE B  1 126 ? 60.607  115.571 -17.063 1.00 8.02  ? 126 PHE B CA   1 
ATOM   6343  C  C    . PHE B  1 126 ? 59.814  115.423 -18.336 1.00 7.51  ? 126 PHE B C    1 
ATOM   6344  O  O    . PHE B  1 126 ? 58.866  114.639 -18.386 1.00 8.26  ? 126 PHE B O    1 
ATOM   6345  C  CB   . PHE B  1 126 ? 60.080  116.777 -16.277 1.00 6.32  ? 126 PHE B CB   1 
ATOM   6346  C  CG   . PHE B  1 126 ? 58.594  116.703 -16.027 1.00 6.31  ? 126 PHE B CG   1 
ATOM   6347  C  CD1  . PHE B  1 126 ? 58.094  115.825 -15.062 1.00 10.87 ? 126 PHE B CD1  1 
ATOM   6348  C  CD2  . PHE B  1 126 ? 57.710  117.409 -16.812 1.00 6.21  ? 126 PHE B CD2  1 
ATOM   6349  C  CE1  . PHE B  1 126 ? 56.744  115.727 -14.836 1.00 15.57 ? 126 PHE B CE1  1 
ATOM   6350  C  CE2  . PHE B  1 126 ? 56.345  117.313 -16.600 1.00 8.79  ? 126 PHE B CE2  1 
ATOM   6351  C  CZ   . PHE B  1 126 ? 55.868  116.450 -15.603 1.00 7.99  ? 126 PHE B CZ   1 
ATOM   6352  H  H    . PHE B  1 126 ? 62.357  116.466 -17.194 1.00 9.24  ? 126 PHE B H    1 
ATOM   6353  H  HA   . PHE B  1 126 ? 60.453  114.770 -16.520 1.00 9.63  ? 126 PHE B HA   1 
ATOM   6354  H  HB2  . PHE B  1 126 ? 60.528  116.815 -15.417 1.00 7.59  ? 126 PHE B HB2  1 
ATOM   6355  H  HB3  . PHE B  1 126 ? 60.260  117.586 -16.781 1.00 7.59  ? 126 PHE B HB3  1 
ATOM   6356  H  HD1  . PHE B  1 126 ? 58.685  115.335 -14.536 1.00 13.04 ? 126 PHE B HD1  1 
ATOM   6357  H  HD2  . PHE B  1 126 ? 58.035  117.982 -17.469 1.00 7.45  ? 126 PHE B HD2  1 
ATOM   6358  H  HE1  . PHE B  1 126 ? 56.422  115.154 -14.178 1.00 18.69 ? 126 PHE B HE1  1 
ATOM   6359  H  HE2  . PHE B  1 126 ? 55.752  117.808 -17.119 1.00 10.55 ? 126 PHE B HE2  1 
ATOM   6360  H  HZ   . PHE B  1 126 ? 54.953  116.379 -15.452 1.00 9.58  ? 126 PHE B HZ   1 
ATOM   6361  N  N    . LYS B  1 127 ? 60.185  116.214 -19.353 1.00 10.67 ? 127 LYS B N    1 
ATOM   6362  C  CA   . LYS B  1 127 ? 59.508  116.184 -20.647 1.00 12.24 ? 127 LYS B CA   1 
ATOM   6363  C  C    . LYS B  1 127 ? 59.442  114.752 -21.185 1.00 9.75  ? 127 LYS B C    1 
ATOM   6364  O  O    . LYS B  1 127 ? 58.395  114.310 -21.688 1.00 7.81  ? 127 LYS B O    1 
ATOM   6365  C  CB   . LYS B  1 127 ? 60.220  117.113 -21.638 1.00 8.41  ? 127 LYS B CB   1 
ATOM   6366  C  CG   . LYS B  1 127 ? 59.462  117.324 -22.973 1.00 32.50 ? 127 LYS B CG   1 
ATOM   6367  C  CD   . LYS B  1 127 ? 59.641  118.715 -23.667 1.00 41.47 ? 127 LYS B CD   1 
ATOM   6368  C  CE   . LYS B  1 127 ? 60.484  119.761 -22.905 1.00 46.69 ? 127 LYS B CE   1 
ATOM   6369  N  NZ   . LYS B  1 127 ? 59.883  121.137 -22.956 1.00 49.25 ? 127 LYS B NZ   1 
ATOM   6370  H  H    . LYS B  1 127 ? 60.833  116.778 -19.313 1.00 12.80 ? 127 LYS B H    1 
ATOM   6371  H  HA   . LYS B  1 127 ? 58.589  116.507 -20.534 1.00 14.68 ? 127 LYS B HA   1 
ATOM   6372  H  HB2  . LYS B  1 127 ? 60.332  117.982 -21.222 1.00 10.09 ? 127 LYS B HB2  1 
ATOM   6373  H  HB3  . LYS B  1 127 ? 61.088  116.736 -21.848 1.00 10.09 ? 127 LYS B HB3  1 
ATOM   6374  H  HG2  . LYS B  1 127 ? 59.763  116.649 -23.602 1.00 39.00 ? 127 LYS B HG2  1 
ATOM   6375  H  HG3  . LYS B  1 127 ? 58.514  117.206 -22.806 1.00 39.00 ? 127 LYS B HG3  1 
ATOM   6376  H  HD2  . LYS B  1 127 ? 60.068  118.573 -24.526 1.00 49.77 ? 127 LYS B HD2  1 
ATOM   6377  H  HD3  . LYS B  1 127 ? 58.762  119.101 -23.805 1.00 49.77 ? 127 LYS B HD3  1 
ATOM   6378  H  HE2  . LYS B  1 127 ? 60.551  119.496 -21.974 1.00 56.02 ? 127 LYS B HE2  1 
ATOM   6379  H  HE3  . LYS B  1 127 ? 61.368  119.804 -23.303 1.00 56.02 ? 127 LYS B HE3  1 
ATOM   6380  H  HZ1  . LYS B  1 127 ? 59.817  121.409 -23.800 1.00 59.10 ? 127 LYS B HZ1  1 
ATOM   6381  H  HZ2  . LYS B  1 127 ? 59.072  121.128 -22.590 1.00 59.10 ? 127 LYS B HZ2  1 
ATOM   6382  H  HZ3  . LYS B  1 127 ? 60.396  121.710 -22.507 1.00 59.10 ? 127 LYS B HZ3  1 
ATOM   6383  N  N    . ASP B  1 128 ? 60.561  114.044 -21.078 1.00 8.61  ? 128 ASP B N    1 
ATOM   6384  C  CA   . ASP B  1 128 ? 60.647  112.669 -21.581 1.00 9.11  ? 128 ASP B CA   1 
ATOM   6385  C  C    . ASP B  1 128 ? 59.713  111.733 -20.782 1.00 7.22  ? 128 ASP B C    1 
ATOM   6386  O  O    . ASP B  1 128 ? 59.143  110.796 -21.351 1.00 8.10  ? 128 ASP B O    1 
ATOM   6387  C  CB   . ASP B  1 128 ? 62.105  112.149 -21.579 1.00 12.20 ? 128 ASP B CB   1 
ATOM   6388  C  CG   . ASP B  1 128 ? 62.978  112.810 -22.649 1.00 17.83 ? 128 ASP B CG   1 
ATOM   6389  O  OD1  . ASP B  1 128 ? 62.427  113.361 -23.612 1.00 11.49 ? 128 ASP B OD1  1 
ATOM   6390  O  OD2  . ASP B  1 128 ? 64.223  112.778 -22.535 1.00 24.99 ? 128 ASP B OD2  1 
ATOM   6391  H  H    . ASP B  1 128 ? 61.287  114.333 -20.719 1.00 10.34 ? 128 ASP B H    1 
ATOM   6392  H  HA   . ASP B  1 128 ? 60.338  112.663 -22.511 1.00 10.93 ? 128 ASP B HA   1 
ATOM   6393  H  HB2  . ASP B  1 128 ? 62.504  112.330 -20.714 1.00 14.64 ? 128 ASP B HB2  1 
ATOM   6394  H  HB3  . ASP B  1 128 ? 62.099  111.193 -21.747 1.00 14.64 ? 128 ASP B HB3  1 
ATOM   6395  N  N    . LEU B  1 129 ? 59.518  111.983 -19.475 1.00 5.48  ? 129 LEU B N    1 
ATOM   6396  C  CA   . LEU B  1 129 ? 58.626  111.119 -18.711 1.00 5.33  ? 129 LEU B CA   1 
ATOM   6397  C  C    . LEU B  1 129 ? 57.176  111.425 -19.083 1.00 6.07  ? 129 LEU B C    1 
ATOM   6398  O  O    . LEU B  1 129 ? 56.336  110.538 -19.137 1.00 6.12  ? 129 LEU B O    1 
ATOM   6399  C  CB   . LEU B  1 129 ? 58.838  111.308 -17.187 1.00 5.29  ? 129 LEU B CB   1 
ATOM   6400  C  CG   . LEU B  1 129 ? 60.248  110.913 -16.710 1.00 5.49  ? 129 LEU B CG   1 
ATOM   6401  C  CD1  . LEU B  1 129 ? 60.465  111.231 -15.208 1.00 7.91  ? 129 LEU B CD1  1 
ATOM   6402  C  CD2  . LEU B  1 129 ? 60.502  109.450 -16.958 1.00 6.37  ? 129 LEU B CD2  1 
ATOM   6403  H  H    . LEU B  1 129 ? 59.878  112.624 -19.029 1.00 6.57  ? 129 LEU B H    1 
ATOM   6404  H  HA   . LEU B  1 129 ? 58.812  110.183 -18.934 1.00 6.40  ? 129 LEU B HA   1 
ATOM   6405  H  HB2  . LEU B  1 129 ? 58.700  112.242 -16.965 1.00 6.35  ? 129 LEU B HB2  1 
ATOM   6406  H  HB3  . LEU B  1 129 ? 58.197  110.758 -16.711 1.00 6.35  ? 129 LEU B HB3  1 
ATOM   6407  H  HG   . LEU B  1 129 ? 60.903  111.417 -17.217 1.00 6.59  ? 129 LEU B HG   1 
ATOM   6408  H  HD11 . LEU B  1 129 ? 61.354  110.968 -14.959 1.00 9.50  ? 129 LEU B HD11 1 
ATOM   6409  H  HD12 . LEU B  1 129 ? 60.351  112.174 -15.069 1.00 9.50  ? 129 LEU B HD12 1 
ATOM   6410  H  HD13 . LEU B  1 129 ? 59.821  110.742 -14.690 1.00 9.50  ? 129 LEU B HD13 1 
ATOM   6411  H  HD21 . LEU B  1 129 ? 61.385  109.229 -16.653 1.00 7.64  ? 129 LEU B HD21 1 
ATOM   6412  H  HD22 . LEU B  1 129 ? 59.850  108.934 -16.477 1.00 7.64  ? 129 LEU B HD22 1 
ATOM   6413  H  HD23 . LEU B  1 129 ? 60.427  109.276 -17.899 1.00 7.64  ? 129 LEU B HD23 1 
ATOM   6414  N  N    . SER B  1 130 ? 56.872  112.699 -19.298 1.00 5.29  ? 130 SER B N    1 
ATOM   6415  C  CA   . SER B  1 130 ? 55.532  113.078 -19.712 1.00 5.39  ? 130 SER B CA   1 
ATOM   6416  C  C    . SER B  1 130 ? 55.170  112.462 -21.078 1.00 5.53  ? 130 SER B C    1 
ATOM   6417  O  O    . SER B  1 130 ? 54.044  112.035 -21.299 1.00 6.81  ? 130 SER B O    1 
ATOM   6418  C  CB   . SER B  1 130 ? 55.428  114.592 -19.840 1.00 5.57  ? 130 SER B CB   1 
ATOM   6419  O  OG   . SER B  1 130 ? 54.161  114.917 -20.359 1.00 9.81  ? 130 SER B OG   1 
ATOM   6420  H  H    . SER B  1 130 ? 57.419  113.357 -19.211 1.00 6.35  ? 130 SER B H    1 
ATOM   6421  H  HA   . SER B  1 130 ? 54.881  112.773 -19.047 1.00 6.47  ? 130 SER B HA   1 
ATOM   6422  H  HB2  . SER B  1 130 ? 55.532  114.997 -18.965 1.00 6.68  ? 130 SER B HB2  1 
ATOM   6423  H  HB3  . SER B  1 130 ? 56.116  114.912 -20.445 1.00 6.68  ? 130 SER B HB3  1 
ATOM   6424  H  HG   . SER B  1 130 ? 54.089  115.731 -20.434 1.00 11.77 ? 130 SER B HG   1 
ATOM   6425  N  N    . ASP B  1 131 ? 56.127  112.440 -21.996 1.00 7.04  ? 131 ASP B N    1 
ATOM   6426  C  CA   . ASP B  1 131 ? 55.894  111.818 -23.303 1.00 10.89 ? 131 ASP B CA   1 
ATOM   6427  C  C    . ASP B  1 131 ? 55.611  110.319 -23.112 1.00 10.73 ? 131 ASP B C    1 
ATOM   6428  O  O    . ASP B  1 131 ? 54.759  109.774 -23.803 1.00 6.93  ? 131 ASP B O    1 
ATOM   6429  C  CB   . ASP B  1 131 ? 57.086  112.017 -24.224 1.00 6.24  ? 131 ASP B CB   1 
ATOM   6430  C  CG   . ASP B  1 131 ? 57.274  113.477 -24.667 1.00 10.97 ? 131 ASP B CG   1 
ATOM   6431  O  OD1  . ASP B  1 131 ? 56.331  114.292 -24.571 1.00 10.30 ? 131 ASP B OD1  1 
ATOM   6432  O  OD2  . ASP B  1 131 ? 58.375  113.790 -25.173 1.00 14.33 ? 131 ASP B OD2  1 
ATOM   6433  H  H    . ASP B  1 131 ? 56.914  112.772 -21.894 1.00 8.45  ? 131 ASP B H    1 
ATOM   6434  H  HA   . ASP B  1 131 ? 55.109  112.229 -23.722 1.00 13.06 ? 131 ASP B HA   1 
ATOM   6435  H  HB2  . ASP B  1 131 ? 57.891  111.740 -23.761 1.00 7.49  ? 131 ASP B HB2  1 
ATOM   6436  H  HB3  . ASP B  1 131 ? 56.961  111.478 -25.021 1.00 7.49  ? 131 ASP B HB3  1 
ATOM   6437  N  N    . LYS B  1 132 ? 56.302  109.669 -22.168 1.00 5.81  ? 132 LYS B N    1 
ATOM   6438  C  CA   . LYS B  1 132 ? 56.036  108.234 -21.884 1.00 5.85  ? 132 LYS B CA   1 
ATOM   6439  C  C    . LYS B  1 132 ? 54.623  108.022 -21.347 1.00 6.95  ? 132 LYS B C    1 
ATOM   6440  O  O    . LYS B  1 132 ? 53.904  107.126 -21.765 1.00 6.51  ? 132 LYS B O    1 
ATOM   6441  C  CB   . LYS B  1 132 ? 57.066  107.653 -20.931 1.00 7.18  ? 132 LYS B CB   1 
ATOM   6442  C  CG   . LYS B  1 132 ? 58.445  107.538 -21.539 1.00 8.65  ? 132 LYS B CG   1 
ATOM   6443  C  CD   . LYS B  1 132 ? 59.484  107.234 -20.482 1.00 19.82 ? 132 LYS B CD   1 
ATOM   6444  C  CE   . LYS B  1 132 ? 60.720  106.639 -21.088 1.00 31.78 ? 132 LYS B CE   1 
ATOM   6445  N  NZ   . LYS B  1 132 ? 61.687  106.193 -20.047 1.00 38.54 ? 132 LYS B NZ   1 
ATOM   6446  H  H    . LYS B  1 132 ? 56.919  110.020 -21.682 1.00 6.98  ? 132 LYS B H    1 
ATOM   6447  H  HA   . LYS B  1 132 ? 56.106  107.737 -22.726 1.00 7.02  ? 132 LYS B HA   1 
ATOM   6448  H  HB2  . LYS B  1 132 ? 57.130  108.226 -20.151 1.00 8.61  ? 132 LYS B HB2  1 
ATOM   6449  H  HB3  . LYS B  1 132 ? 56.782  106.764 -20.665 1.00 8.61  ? 132 LYS B HB3  1 
ATOM   6450  H  HG2  . LYS B  1 132 ? 58.451  106.818 -22.188 1.00 10.39 ? 132 LYS B HG2  1 
ATOM   6451  H  HG3  . LYS B  1 132 ? 58.680  108.377 -21.964 1.00 10.39 ? 132 LYS B HG3  1 
ATOM   6452  H  HD2  . LYS B  1 132 ? 59.732  108.055 -20.029 1.00 23.78 ? 132 LYS B HD2  1 
ATOM   6453  H  HD3  . LYS B  1 132 ? 59.120  106.597 -19.847 1.00 23.78 ? 132 LYS B HD3  1 
ATOM   6454  H  HE2  . LYS B  1 132 ? 60.474  105.868 -21.623 1.00 38.13 ? 132 LYS B HE2  1 
ATOM   6455  H  HE3  . LYS B  1 132 ? 61.156  107.305 -21.642 1.00 38.13 ? 132 LYS B HE3  1 
ATOM   6456  H  HZ1  . LYS B  1 132 ? 62.410  105.845 -20.432 1.00 46.25 ? 132 LYS B HZ1  1 
ATOM   6457  H  HZ2  . LYS B  1 132 ? 61.932  106.885 -19.544 1.00 46.25 ? 132 LYS B HZ2  1 
ATOM   6458  H  HZ3  . LYS B  1 132 ? 61.311  105.576 -19.526 1.00 46.25 ? 132 LYS B HZ3  1 
ATOM   6459  N  N    . LEU B  1 133 ? 54.215  108.865 -20.401 1.00 5.55  ? 133 LEU B N    1 
ATOM   6460  C  CA   . LEU B  1 133 ? 52.880  108.789 -19.861 1.00 5.70  ? 133 LEU B CA   1 
ATOM   6461  C  C    . LEU B  1 133 ? 51.787  108.984 -20.901 1.00 5.91  ? 133 LEU B C    1 
ATOM   6462  O  O    . LEU B  1 133 ? 50.741  108.335 -20.833 1.00 6.45  ? 133 LEU B O    1 
ATOM   6463  C  CB   . LEU B  1 133 ? 52.742  109.829 -18.726 1.00 5.64  ? 133 LEU B CB   1 
ATOM   6464  C  CG   . LEU B  1 133 ? 51.471  109.788 -17.899 1.00 7.06  ? 133 LEU B CG   1 
ATOM   6465  C  CD1  . LEU B  1 133 ? 51.361  108.462 -17.167 1.00 10.48 ? 133 LEU B CD1  1 
ATOM   6466  C  CD2  . LEU B  1 133 ? 51.436  110.918 -16.896 1.00 12.36 ? 133 LEU B CD2  1 
ATOM   6467  H  H    . LEU B  1 133 ? 54.699  109.489 -20.060 1.00 6.66  ? 133 LEU B H    1 
ATOM   6468  H  HA   . LEU B  1 133 ? 52.754  107.901 -19.465 1.00 6.83  ? 133 LEU B HA   1 
ATOM   6469  H  HB2  . LEU B  1 133 ? 53.484  109.707 -18.114 1.00 6.76  ? 133 LEU B HB2  1 
ATOM   6470  H  HB3  . LEU B  1 133 ? 52.797  110.713 -19.121 1.00 6.76  ? 133 LEU B HB3  1 
ATOM   6471  H  HG   . LEU B  1 133 ? 50.703  109.877 -18.485 1.00 8.48  ? 133 LEU B HG   1 
ATOM   6472  H  HD11 . LEU B  1 133 ? 50.552  108.457 -16.651 1.00 12.58 ? 133 LEU B HD11 1 
ATOM   6473  H  HD12 . LEU B  1 133 ? 51.343  107.751 -17.811 1.00 12.58 ? 133 LEU B HD12 1 
ATOM   6474  H  HD13 . LEU B  1 133 ? 52.120  108.362 -16.588 1.00 12.58 ? 133 LEU B HD13 1 
ATOM   6475  H  HD21 . LEU B  1 133 ? 50.621  110.862 -16.392 1.00 14.83 ? 133 LEU B HD21 1 
ATOM   6476  H  HD22 . LEU B  1 133 ? 52.191  110.837 -16.309 1.00 14.83 ? 133 LEU B HD22 1 
ATOM   6477  H  HD23 . LEU B  1 133 ? 51.474  111.754 -17.367 1.00 14.83 ? 133 LEU B HD23 1 
ATOM   6478  N  N    . ASP B  1 134 ? 51.997  109.896 -21.853 1.00 5.92  ? 134 ASP B N    1 
ATOM   6479  C  CA   . ASP B  1 134 ? 51.003  110.138 -22.900 1.00 9.70  ? 134 ASP B CA   1 
ATOM   6480  C  C    . ASP B  1 134 ? 50.658  108.832 -23.634 1.00 6.41  ? 134 ASP B C    1 
ATOM   6481  O  O    . ASP B  1 134 ? 49.508  108.621 -24.053 1.00 6.80  ? 134 ASP B O    1 
ATOM   6482  C  CB   . ASP B  1 134 ? 51.554  111.069 -23.985 1.00 6.37  ? 134 ASP B CB   1 
ATOM   6483  C  CG   . ASP B  1 134 ? 51.576  112.539 -23.583 1.00 10.20 ? 134 ASP B CG   1 
ATOM   6484  O  OD1  . ASP B  1 134 ? 51.099  112.889 -22.486 1.00 10.16 ? 134 ASP B OD1  1 
ATOM   6485  O  OD2  . ASP B  1 134 ? 52.084  113.340 -24.388 1.00 12.11 ? 134 ASP B OD2  1 
ATOM   6486  H  H    . ASP B  1 134 ? 52.702  110.384 -21.915 1.00 7.11  ? 134 ASP B H    1 
ATOM   6487  H  HA   . ASP B  1 134 ? 50.187  110.525 -22.518 1.00 11.64 ? 134 ASP B HA   1 
ATOM   6488  H  HB2  . ASP B  1 134 ? 52.464  110.805 -24.190 1.00 7.64  ? 134 ASP B HB2  1 
ATOM   6489  H  HB3  . ASP B  1 134 ? 51.001  110.987 -24.777 1.00 7.64  ? 134 ASP B HB3  1 
ATOM   6490  N  N    . GLN B  1 135 ? 51.675  108.005 -23.839 1.00 6.26  ? 135 GLN B N    1 
ATOM   6491  C  CA   . GLN B  1 135 ? 51.514  106.753 -24.562 1.00 6.46  ? 135 GLN B CA   1 
ATOM   6492  C  C    . GLN B  1 135 ? 50.730  105.744 -23.733 1.00 10.55 ? 135 GLN B C    1 
ATOM   6493  O  O    . GLN B  1 135 ? 50.306  104.722 -24.261 1.00 11.02 ? 135 GLN B O    1 
ATOM   6494  C  CB   . GLN B  1 135 ? 52.871  106.144 -24.896 1.00 7.39  ? 135 GLN B CB   1 
ATOM   6495  C  CG   . GLN B  1 135 ? 53.716  106.937 -25.851 1.00 8.90  ? 135 GLN B CG   1 
ATOM   6496  C  CD   . GLN B  1 135 ? 53.076  107.114 -27.205 1.00 9.83  ? 135 GLN B CD   1 
ATOM   6497  O  OE1  . GLN B  1 135 ? 52.414  106.204 -27.736 1.00 10.91 ? 135 GLN B OE1  1 
ATOM   6498  N  NE2  . GLN B  1 135 ? 53.300  108.275 -27.803 1.00 10.80 ? 135 GLN B NE2  1 
ATOM   6499  H  H    . GLN B  1 135 ? 52.478  108.149 -23.566 1.00 7.51  ? 135 GLN B H    1 
ATOM   6500  H  HA   . GLN B  1 135 ? 51.029  106.916 -25.399 1.00 7.76  ? 135 GLN B HA   1 
ATOM   6501  H  HB2  . GLN B  1 135 ? 53.375  106.048 -24.073 1.00 8.87  ? 135 GLN B HB2  1 
ATOM   6502  H  HB3  . GLN B  1 135 ? 52.727  105.271 -25.292 1.00 8.87  ? 135 GLN B HB3  1 
ATOM   6503  H  HG2  . GLN B  1 135 ? 53.871  107.818 -25.477 1.00 10.68 ? 135 GLN B HG2  1 
ATOM   6504  H  HG3  . GLN B  1 135 ? 54.561  106.478 -25.978 1.00 10.68 ? 135 GLN B HG3  1 
ATOM   6505  H  HE21 . GLN B  1 135 ? 53.784  108.871 -27.416 1.00 12.96 ? 135 GLN B HE21 1 
ATOM   6506  H  HE22 . GLN B  1 135 ? 52.960  108.432 -28.577 1.00 12.96 ? 135 GLN B HE22 1 
ATOM   6507  N  N    . HIS B  1 136 ? 50.611  105.989 -22.430 1.00 9.06  ? 136 HIS B N    1 
ATOM   6508  C  CA   . HIS B  1 136 ? 49.750  105.175 -21.574 1.00 13.43 ? 136 HIS B CA   1 
ATOM   6509  C  C    . HIS B  1 136 ? 48.434  105.907 -21.305 1.00 13.96 ? 136 HIS B C    1 
ATOM   6510  O  O    . HIS B  1 136 ? 47.771  105.682 -20.284 1.00 13.42 ? 136 HIS B O    1 
ATOM   6511  C  CB   . HIS B  1 136 ? 50.455  104.876 -20.251 1.00 13.83 ? 136 HIS B CB   1 
ATOM   6512  C  CG   . HIS B  1 136 ? 51.629  103.962 -20.396 1.00 15.92 ? 136 HIS B CG   1 
ATOM   6513  N  ND1  . HIS B  1 136 ? 51.494  102.589 -20.467 1.00 19.42 ? 136 HIS B ND1  1 
ATOM   6514  C  CD2  . HIS B  1 136 ? 52.957  104.210 -20.488 1.00 8.53  ? 136 HIS B CD2  1 
ATOM   6515  C  CE1  . HIS B  1 136 ? 52.686  102.035 -20.562 1.00 21.43 ? 136 HIS B CE1  1 
ATOM   6516  N  NE2  . HIS B  1 136 ? 53.594  102.992 -20.571 1.00 13.67 ? 136 HIS B NE2  1 
ATOM   6517  H  H    . HIS B  1 136 ? 51.019  106.623 -22.016 1.00 10.87 ? 136 HIS B H    1 
ATOM   6518  H  HA   . HIS B  1 136 ? 49.550  104.326 -22.021 1.00 16.11 ? 136 HIS B HA   1 
ATOM   6519  H  HB2  . HIS B  1 136 ? 50.772  105.709 -19.870 1.00 16.60 ? 136 HIS B HB2  1 
ATOM   6520  H  HB3  . HIS B  1 136 ? 49.823  104.456 -19.647 1.00 16.60 ? 136 HIS B HB3  1 
ATOM   6521  H  HD1  . HIS B  1 136 ? 50.749  102.161 -20.426 1.00 23.30 ? 136 HIS B HD1  1 
ATOM   6522  H  HD2  . HIS B  1 136 ? 53.366  105.045 -20.460 1.00 10.23 ? 136 HIS B HD2  1 
ATOM   6523  H  HE1  . HIS B  1 136 ? 52.858  101.123 -20.627 1.00 25.72 ? 136 HIS B HE1  1 
ATOM   6524  H  HE2  . HIS B  1 136 ? 54.443  102.876 -20.647 1.00 16.41 ? 136 HIS B HE2  1 
ATOM   6525  N  N    . ASP B  1 137 ? 48.102  106.812 -22.218 1.00 12.35 ? 137 ASP B N    1 
ATOM   6526  C  CA   . ASP B  1 137 ? 46.772  107.421 -22.322 1.00 13.96 ? 137 ASP B CA   1 
ATOM   6527  C  C    . ASP B  1 137 ? 46.427  108.526 -21.308 1.00 10.23 ? 137 ASP B C    1 
ATOM   6528  O  O    . ASP B  1 137 ? 45.262  108.916 -21.167 1.00 9.05  ? 137 ASP B O    1 
ATOM   6529  C  CB   . ASP B  1 137 ? 45.705  106.323 -22.300 1.00 21.62 ? 137 ASP B CB   1 
ATOM   6530  C  CG   . ASP B  1 137 ? 45.896  105.312 -23.420 1.00 25.16 ? 137 ASP B CG   1 
ATOM   6531  O  OD1  . ASP B  1 137 ? 46.079  105.734 -24.585 1.00 24.15 ? 137 ASP B OD1  1 
ATOM   6532  O  OD2  . ASP B  1 137 ? 45.872  104.098 -23.121 1.00 26.05 ? 137 ASP B OD2  1 
ATOM   6533  H  H    . ASP B  1 137 ? 48.651  107.103 -22.812 1.00 14.82 ? 137 ASP B H    1 
ATOM   6534  H  HA   . ASP B  1 137 ? 46.717  107.839 -23.207 1.00 16.75 ? 137 ASP B HA   1 
ATOM   6535  H  HB2  . ASP B  1 137 ? 45.753  105.850 -21.455 1.00 25.95 ? 137 ASP B HB2  1 
ATOM   6536  H  HB3  . ASP B  1 137 ? 44.830  106.729 -22.406 1.00 25.95 ? 137 ASP B HB3  1 
ATOM   6537  N  N    . ILE B  1 138 ? 47.430  109.073 -20.636 1.00 7.75  ? 138 ILE B N    1 
ATOM   6538  C  CA   . ILE B  1 138 ? 47.195  110.178 -19.689 1.00 11.21 ? 138 ILE B CA   1 
ATOM   6539  C  C    . ILE B  1 138 ? 48.147  111.307 -20.008 1.00 11.24 ? 138 ILE B C    1 
ATOM   6540  O  O    . ILE B  1 138 ? 49.358  111.064 -20.116 1.00 11.69 ? 138 ILE B O    1 
ATOM   6541  C  CB   . ILE B  1 138 ? 47.475  109.734 -18.256 1.00 13.82 ? 138 ILE B CB   1 
ATOM   6542  C  CG1  . ILE B  1 138 ? 46.401  108.742 -17.803 1.00 14.61 ? 138 ILE B CG1  1 
ATOM   6543  C  CG2  . ILE B  1 138 ? 47.574  110.946 -17.316 1.00 10.77 ? 138 ILE B CG2  1 
ATOM   6544  C  CD1  . ILE B  1 138 ? 46.747  108.008 -16.541 1.00 35.04 ? 138 ILE B CD1  1 
ATOM   6545  H  H    . ILE B  1 138 ? 48.253  108.831 -20.702 1.00 9.30  ? 138 ILE B H    1 
ATOM   6546  H  HA   . ILE B  1 138 ? 46.272  110.499 -19.758 1.00 13.45 ? 138 ILE B HA   1 
ATOM   6547  H  HB   . ILE B  1 138 ? 48.330  109.276 -18.245 1.00 16.59 ? 138 ILE B HB   1 
ATOM   6548  H  HG12 . ILE B  1 138 ? 45.575  109.226 -17.647 1.00 17.53 ? 138 ILE B HG12 1 
ATOM   6549  H  HG13 . ILE B  1 138 ? 46.269  108.083 -18.502 1.00 17.53 ? 138 ILE B HG13 1 
ATOM   6550  H  HG21 . ILE B  1 138 ? 47.750  110.637 -16.425 1.00 12.93 ? 138 ILE B HG21 1 
ATOM   6551  H  HG22 . ILE B  1 138 ? 48.289  111.514 -17.613 1.00 12.93 ? 138 ILE B HG22 1 
ATOM   6552  H  HG23 . ILE B  1 138 ? 46.743  111.427 -17.338 1.00 12.93 ? 138 ILE B HG23 1 
ATOM   6553  H  HD11 . ILE B  1 138 ? 46.030  107.408 -16.322 1.00 42.04 ? 138 ILE B HD11 1 
ATOM   6554  H  HD12 . ILE B  1 138 ? 47.558  107.513 -16.680 1.00 42.04 ? 138 ILE B HD12 1 
ATOM   6555  H  HD13 . ILE B  1 138 ? 46.870  108.645 -15.833 1.00 42.04 ? 138 ILE B HD13 1 
ATOM   6556  N  N    . HIS B  1 139 ? 47.623  112.528 -20.151 1.00 11.72 ? 139 HIS B N    1 
ATOM   6557  C  CA   . HIS B  1 139 ? 48.452  113.678 -20.497 1.00 8.51  ? 139 HIS B CA   1 
ATOM   6558  C  C    . HIS B  1 139 ? 48.498  114.724 -19.389 1.00 6.70  ? 139 HIS B C    1 
ATOM   6559  O  O    . HIS B  1 139 ? 47.467  115.186 -18.928 1.00 7.84  ? 139 HIS B O    1 
ATOM   6560  C  CB   . HIS B  1 139 ? 47.986  114.352 -21.810 1.00 8.62  ? 139 HIS B CB   1 
ATOM   6561  C  CG   . HIS B  1 139 ? 48.813  115.544 -22.192 1.00 9.25  ? 139 HIS B CG   1 
ATOM   6562  N  ND1  . HIS B  1 139 ? 50.174  115.465 -22.404 1.00 12.11 ? 139 HIS B ND1  1 
ATOM   6563  C  CD2  . HIS B  1 139 ? 48.483  116.844 -22.364 1.00 11.27 ? 139 HIS B CD2  1 
ATOM   6564  C  CE1  . HIS B  1 139 ? 50.643  116.667 -22.698 1.00 12.53 ? 139 HIS B CE1  1 
ATOM   6565  N  NE2  . HIS B  1 139 ? 49.640  117.523 -22.674 1.00 9.99  ? 139 HIS B NE2  1 
ATOM   6566  H  H    . HIS B  1 139 ? 46.789  112.713 -20.053 1.00 14.07 ? 139 HIS B H    1 
ATOM   6567  H  HA   . HIS B  1 139 ? 49.369  113.364 -20.640 1.00 10.21 ? 139 HIS B HA   1 
ATOM   6568  H  HB2  . HIS B  1 139 ? 48.042  113.707 -22.531 1.00 10.35 ? 139 HIS B HB2  1 
ATOM   6569  H  HB3  . HIS B  1 139 ? 47.069  114.648 -21.702 1.00 10.35 ? 139 HIS B HB3  1 
ATOM   6570  H  HD1  . HIS B  1 139 ? 50.644  114.747 -22.352 1.00 14.53 ? 139 HIS B HD1  1 
ATOM   6571  H  HD2  . HIS B  1 139 ? 47.633  117.213 -22.279 1.00 13.53 ? 139 HIS B HD2  1 
ATOM   6572  H  HE1  . HIS B  1 139 ? 51.529  116.873 -22.889 1.00 15.04 ? 139 HIS B HE1  1 
ATOM   6573  H  HE2  . HIS B  1 139 ? 49.696  118.365 -22.842 1.00 11.99 ? 139 HIS B HE2  1 
ATOM   6574  N  N    . ILE B  1 140 ? 49.708  115.059 -18.973 1.00 6.60  ? 140 ILE B N    1 
ATOM   6575  C  CA   . ILE B  1 140 ? 49.902  116.094 -17.968 1.00 6.48  ? 140 ILE B CA   1 
ATOM   6576  C  C    . ILE B  1 140 ? 49.804  117.442 -18.689 1.00 9.88  ? 140 ILE B C    1 
ATOM   6577  O  O    . ILE B  1 140 ? 50.592  117.715 -19.612 1.00 10.10 ? 140 ILE B O    1 
ATOM   6578  C  CB   . ILE B  1 140 ? 51.281  115.986 -17.304 1.00 6.41  ? 140 ILE B CB   1 
ATOM   6579  C  CG1  . ILE B  1 140 ? 51.380  114.682 -16.499 1.00 7.63  ? 140 ILE B CG1  1 
ATOM   6580  C  CG2  . ILE B  1 140 ? 51.557  117.225 -16.425 1.00 11.22 ? 140 ILE B CG2  1 
ATOM   6581  C  CD1  . ILE B  1 140 ? 52.765  114.272 -16.152 1.00 14.29 ? 140 ILE B CD1  1 
ATOM   6582  H  H    . ILE B  1 140 ? 50.437  114.701 -19.257 1.00 7.92  ? 140 ILE B H    1 
ATOM   6583  H  HA   . ILE B  1 140 ? 49.204  116.040 -17.282 1.00 7.77  ? 140 ILE B HA   1 
ATOM   6584  H  HB   . ILE B  1 140 ? 51.952  115.958 -18.005 1.00 7.69  ? 140 ILE B HB   1 
ATOM   6585  H  HG12 . ILE B  1 140 ? 50.890  114.793 -15.669 1.00 9.15  ? 140 ILE B HG12 1 
ATOM   6586  H  HG13 . ILE B  1 140 ? 50.982  113.966 -17.018 1.00 9.15  ? 140 ILE B HG13 1 
ATOM   6587  H  HG21 . ILE B  1 140 ? 52.424  117.134 -16.021 1.00 13.46 ? 140 ILE B HG21 1 
ATOM   6588  H  HG22 . ILE B  1 140 ? 51.533  118.010 -16.977 1.00 13.46 ? 140 ILE B HG22 1 
ATOM   6589  H  HG23 . ILE B  1 140 ? 50.883  117.281 -15.744 1.00 13.46 ? 140 ILE B HG23 1 
ATOM   6590  H  HD11 . ILE B  1 140 ? 52.732  113.453 -15.653 1.00 17.15 ? 140 ILE B HD11 1 
ATOM   6591  H  HD12 . ILE B  1 140 ? 53.263  114.142 -16.962 1.00 17.15 ? 140 ILE B HD12 1 
ATOM   6592  H  HD13 . ILE B  1 140 ? 53.172  114.962 -15.624 1.00 17.15 ? 140 ILE B HD13 1 
ATOM   6593  N  N    . ILE B  1 141 ? 48.821  118.235 -18.276 1.00 9.07  ? 141 ILE B N    1 
ATOM   6594  C  CA   . ILE B  1 141 ? 48.582  119.560 -18.829 1.00 6.68  ? 141 ILE B CA   1 
ATOM   6595  C  C    . ILE B  1 141 ? 49.427  120.631 -18.164 1.00 6.67  ? 141 ILE B C    1 
ATOM   6596  O  O    . ILE B  1 141 ? 49.984  121.517 -18.844 1.00 7.40  ? 141 ILE B O    1 
ATOM   6597  C  CB   . ILE B  1 141 ? 47.114  119.916 -18.727 1.00 6.79  ? 141 ILE B CB   1 
ATOM   6598  C  CG1  . ILE B  1 141 ? 46.303  118.951 -19.570 1.00 8.60  ? 141 ILE B CG1  1 
ATOM   6599  C  CG2  . ILE B  1 141 ? 46.890  121.379 -19.158 1.00 10.02 ? 141 ILE B CG2  1 
ATOM   6600  C  CD1  . ILE B  1 141 ? 44.829  118.949 -19.318 1.00 7.42  ? 141 ILE B CD1  1 
ATOM   6601  H  H    . ILE B  1 141 ? 48.264  118.019 -17.658 1.00 10.88 ? 141 ILE B H    1 
ATOM   6602  H  HA   . ILE B  1 141 ? 48.817  119.547 -19.780 1.00 8.02  ? 141 ILE B HA   1 
ATOM   6603  H  HB   . ILE B  1 141 ? 46.838  119.823 -17.802 1.00 8.14  ? 141 ILE B HB   1 
ATOM   6604  H  HG12 . ILE B  1 141 ? 46.437  119.174 -20.504 1.00 10.32 ? 141 ILE B HG12 1 
ATOM   6605  H  HG13 . ILE B  1 141 ? 46.627  118.052 -19.403 1.00 10.32 ? 141 ILE B HG13 1 
ATOM   6606  H  HG21 . ILE B  1 141 ? 45.955  121.585 -19.087 1.00 12.02 ? 141 ILE B HG21 1 
ATOM   6607  H  HG22 . ILE B  1 141 ? 47.398  121.955 -18.582 1.00 12.02 ? 141 ILE B HG22 1 
ATOM   6608  H  HG23 . ILE B  1 141 ? 47.181  121.484 -20.067 1.00 12.02 ? 141 ILE B HG23 1 
ATOM   6609  H  HD11 . ILE B  1 141 ? 44.414  118.308 -19.899 1.00 8.90  ? 141 ILE B HD11 1 
ATOM   6610  H  HD12 . ILE B  1 141 ? 44.669  118.712 -18.401 1.00 8.90  ? 141 ILE B HD12 1 
ATOM   6611  H  HD13 . ILE B  1 141 ? 44.480  119.826 -19.495 1.00 8.90  ? 141 ILE B HD13 1 
ATOM   6612  N  N    . VAL B  1 142 ? 49.512  120.558 -16.837 1.00 10.05 ? 142 VAL B N    1 
ATOM   6613  C  CA   . VAL B  1 142 ? 50.290  121.511 -16.060 1.00 7.24  ? 142 VAL B CA   1 
ATOM   6614  C  C    . VAL B  1 142 ? 50.973  120.671 -14.958 1.00 8.41  ? 142 VAL B C    1 
ATOM   6615  O  O    . VAL B  1 142 ? 50.337  119.883 -14.275 1.00 6.28  ? 142 VAL B O    1 
ATOM   6616  C  CB   . VAL B  1 142 ? 49.409  122.701 -15.514 1.00 11.64 ? 142 VAL B CB   1 
ATOM   6617  C  CG1  . VAL B  1 142 ? 48.191  122.217 -14.782 1.00 12.97 ? 142 VAL B CG1  1 
ATOM   6618  C  CG2  . VAL B  1 142 ? 50.208  123.640 -14.638 1.00 8.48  ? 142 VAL B CG2  1 
ATOM   6619  H  H    . VAL B  1 142 ? 49.123  119.957 -16.361 1.00 12.06 ? 142 VAL B H    1 
ATOM   6620  H  HA   . VAL B  1 142 ? 50.991  121.891 -16.629 1.00 8.68  ? 142 VAL B HA   1 
ATOM   6621  H  HB   . VAL B  1 142 ? 49.095  123.222 -16.282 1.00 13.96 ? 142 VAL B HB   1 
ATOM   6622  H  HG11 . VAL B  1 142 ? 47.692  122.977 -14.472 1.00 15.56 ? 142 VAL B HG11 1 
ATOM   6623  H  HG12 . VAL B  1 142 ? 47.654  121.694 -15.381 1.00 15.56 ? 142 VAL B HG12 1 
ATOM   6624  H  HG13 . VAL B  1 142 ? 48.468  121.681 -14.036 1.00 15.56 ? 142 VAL B HG13 1 
ATOM   6625  H  HG21 . VAL B  1 142 ? 49.634  124.345 -14.331 1.00 10.17 ? 142 VAL B HG21 1 
ATOM   6626  H  HG22 . VAL B  1 142 ? 50.555  123.149 -13.889 1.00 10.17 ? 142 VAL B HG22 1 
ATOM   6627  H  HG23 . VAL B  1 142 ? 50.931  124.007 -15.152 1.00 10.17 ? 142 VAL B HG23 1 
ATOM   6628  N  N    . PRO B  1 143 ? 52.285  120.820 -14.828 1.00 9.22  ? 143 PRO B N    1 
ATOM   6629  C  CA   . PRO B  1 143 ? 53.029  119.896 -13.976 1.00 7.09  ? 143 PRO B CA   1 
ATOM   6630  C  C    . PRO B  1 143 ? 53.326  120.370 -12.575 1.00 6.47  ? 143 PRO B C    1 
ATOM   6631  O  O    . PRO B  1 143 ? 53.693  119.543 -11.729 1.00 6.16  ? 143 PRO B O    1 
ATOM   6632  C  CB   . PRO B  1 143 ? 54.363  119.748 -14.739 1.00 6.58  ? 143 PRO B CB   1 
ATOM   6633  C  CG   . PRO B  1 143 ? 54.560  121.106 -15.372 1.00 8.33  ? 143 PRO B CG   1 
ATOM   6634  C  CD   . PRO B  1 143 ? 53.159  121.547 -15.777 1.00 9.21  ? 143 PRO B CD   1 
ATOM   6635  H  HA   . PRO B  1 143 ? 52.577  119.027 -13.938 1.00 8.51  ? 143 PRO B HA   1 
ATOM   6636  H  HB2  . PRO B  1 143 ? 55.080  119.547 -14.117 1.00 7.89  ? 143 PRO B HB2  1 
ATOM   6637  H  HB3  . PRO B  1 143 ? 54.284  119.057 -15.415 1.00 7.89  ? 143 PRO B HB3  1 
ATOM   6638  H  HG2  . PRO B  1 143 ? 54.940  121.719 -14.723 1.00 10.00 ? 143 PRO B HG2  1 
ATOM   6639  H  HG3  . PRO B  1 143 ? 55.134  121.026 -16.150 1.00 10.00 ? 143 PRO B HG3  1 
ATOM   6640  H  HD2  . PRO B  1 143 ? 53.060  122.505 -15.663 1.00 11.05 ? 143 PRO B HD2  1 
ATOM   6641  H  HD3  . PRO B  1 143 ? 52.969  121.275 -16.689 1.00 11.05 ? 143 PRO B HD3  1 
ATOM   6642  N  N    . ASP B  1 144 ? 53.188  121.671 -12.332 1.00 6.37  ? 144 ASP B N    1 
ATOM   6643  C  CA   . ASP B  1 144 ? 53.896  122.293 -11.231 1.00 11.54 ? 144 ASP B CA   1 
ATOM   6644  C  C    . ASP B  1 144 ? 53.016  123.143 -10.341 1.00 10.42 ? 144 ASP B C    1 
ATOM   6645  O  O    . ASP B  1 144 ? 53.442  124.167 -9.865  1.00 7.53  ? 144 ASP B O    1 
ATOM   6646  C  CB   . ASP B  1 144 ? 55.095  123.102 -11.739 1.00 7.13  ? 144 ASP B CB   1 
ATOM   6647  C  CG   . ASP B  1 144 ? 54.721  124.142 -12.786 1.00 8.67  ? 144 ASP B CG   1 
ATOM   6648  O  OD1  . ASP B  1 144 ? 53.638  124.045 -13.406 1.00 11.01 ? 144 ASP B OD1  1 
ATOM   6649  O  OD2  . ASP B  1 144 ? 55.546  125.050 -12.989 1.00 11.85 ? 144 ASP B OD2  1 
ATOM   6650  H  H    . ASP B  1 144 ? 52.694  122.207 -12.789 1.00 7.65  ? 144 ASP B H    1 
ATOM   6651  H  HA   . ASP B  1 144 ? 54.257  121.577 -10.668 1.00 13.85 ? 144 ASP B HA   1 
ATOM   6652  H  HB2  . ASP B  1 144 ? 55.501  123.565 -10.990 1.00 8.56  ? 144 ASP B HB2  1 
ATOM   6653  H  HB3  . ASP B  1 144 ? 55.737  122.494 -12.138 1.00 8.56  ? 144 ASP B HB3  1 
ATOM   6654  N  N    . VAL B  1 145 ? 51.793  122.707 -10.093 1.00 8.51  ? 145 VAL B N    1 
ATOM   6655  C  CA   . VAL B  1 145 ? 50.986  123.419 -9.119  1.00 8.94  ? 145 VAL B CA   1 
ATOM   6656  C  C    . VAL B  1 145 ? 51.528  123.179 -7.709  1.00 7.12  ? 145 VAL B C    1 
ATOM   6657  O  O    . VAL B  1 145 ? 51.712  122.011 -7.286  1.00 8.58  ? 145 VAL B O    1 
ATOM   6658  C  CB   . VAL B  1 145 ? 49.495  122.972 -9.179  1.00 8.39  ? 145 VAL B CB   1 
ATOM   6659  C  CG1  . VAL B  1 145 ? 48.678  123.719 -8.097  1.00 9.69  ? 145 VAL B CG1  1 
ATOM   6660  C  CG2  . VAL B  1 145 ? 48.939  123.260 -10.574 1.00 11.14 ? 145 VAL B CG2  1 
ATOM   6661  H  H    . VAL B  1 145 ? 51.417  122.027 -10.460 1.00 10.22 ? 145 VAL B H    1 
ATOM   6662  H  HA   . VAL B  1 145 ? 51.027  124.380 -9.305  1.00 10.72 ? 145 VAL B HA   1 
ATOM   6663  H  HB   . VAL B  1 145 ? 49.433  122.009 -9.010  1.00 10.07 ? 145 VAL B HB   1 
ATOM   6664  H  HG11 . VAL B  1 145 ? 47.762  123.434 -8.145  1.00 11.63 ? 145 VAL B HG11 1 
ATOM   6665  H  HG12 . VAL B  1 145 ? 49.041  123.510 -7.233  1.00 11.63 ? 145 VAL B HG12 1 
ATOM   6666  H  HG13 . VAL B  1 145 ? 48.737  124.663 -8.258  1.00 11.63 ? 145 VAL B HG13 1 
ATOM   6667  H  HG21 . VAL B  1 145 ? 48.021  122.984 -10.607 1.00 13.37 ? 145 VAL B HG21 1 
ATOM   6668  H  HG22 . VAL B  1 145 ? 49.005  124.202 -10.748 1.00 13.37 ? 145 VAL B HG22 1 
ATOM   6669  H  HG23 . VAL B  1 145 ? 49.452  122.771 -11.221 1.00 13.37 ? 145 VAL B HG23 1 
ATOM   6670  N  N    . ILE B  1 146 ? 51.750  124.261 -6.960  1.00 8.69  ? 146 ILE B N    1 
ATOM   6671  C  CA   . ILE B  1 146 ? 52.248  124.122 -5.585  1.00 7.23  ? 146 ILE B CA   1 
ATOM   6672  C  C    . ILE B  1 146 ? 51.106  123.684 -4.680  1.00 11.44 ? 146 ILE B C    1 
ATOM   6673  O  O    . ILE B  1 146 ? 50.110  124.373 -4.556  1.00 10.43 ? 146 ILE B O    1 
ATOM   6674  C  CB   . ILE B  1 146 ? 52.905  125.428 -5.066  1.00 6.80  ? 146 ILE B CB   1 
ATOM   6675  C  CG1  . ILE B  1 146 ? 54.075  125.810 -5.978  1.00 10.64 ? 146 ILE B CG1  1 
ATOM   6676  C  CG2  . ILE B  1 146 ? 53.359  125.268 -3.622  1.00 10.15 ? 146 ILE B CG2  1 
ATOM   6677  C  CD1  . ILE B  1 146 ? 54.549  127.251 -5.796  1.00 15.50 ? 146 ILE B CD1  1 
ATOM   6678  H  H    . ILE B  1 146 ? 51.624  125.072 -7.216  1.00 10.42 ? 146 ILE B H    1 
ATOM   6679  H  HA   . ILE B  1 146 ? 52.930  123.419 -5.567  1.00 8.67  ? 146 ILE B HA   1 
ATOM   6680  H  HB   . ILE B  1 146 ? 52.245  126.137 -5.103  1.00 8.16  ? 146 ILE B HB   1 
ATOM   6681  H  HG12 . ILE B  1 146 ? 54.825  125.225 -5.787  1.00 12.77 ? 146 ILE B HG12 1 
ATOM   6682  H  HG13 . ILE B  1 146 ? 53.800  125.702 -6.902  1.00 12.77 ? 146 ILE B HG13 1 
ATOM   6683  H  HG21 . ILE B  1 146 ? 53.760  126.090 -3.329  1.00 12.18 ? 146 ILE B HG21 1 
ATOM   6684  H  HG22 . ILE B  1 146 ? 52.596  125.063 -3.077  1.00 12.18 ? 146 ILE B HG22 1 
ATOM   6685  H  HG23 . ILE B  1 146 ? 53.999  124.555 -3.573  1.00 12.18 ? 146 ILE B HG23 1 
ATOM   6686  H  HD11 . ILE B  1 146 ? 55.280  127.418 -6.397  1.00 18.60 ? 146 ILE B HD11 1 
ATOM   6687  H  HD12 . ILE B  1 146 ? 53.822  127.846 -5.993  1.00 18.60 ? 146 ILE B HD12 1 
ATOM   6688  H  HD13 . ILE B  1 146 ? 54.836  127.373 -4.889  1.00 18.60 ? 146 ILE B HD13 1 
ATOM   6689  N  N    . TYR B  1 147 ? 51.243  122.496 -4.089  1.00 5.99  ? 147 TYR B N    1 
ATOM   6690  C  CA   . TYR B  1 147 ? 50.211  121.923 -3.242  1.00 5.87  ? 147 TYR B CA   1 
ATOM   6691  C  C    . TYR B  1 147 ? 50.433  122.270 -1.752  1.00 5.87  ? 147 TYR B C    1 
ATOM   6692  O  O    . TYR B  1 147 ? 49.480  122.470 -1.013  1.00 6.17  ? 147 TYR B O    1 
ATOM   6693  C  CB   . TYR B  1 147 ? 50.125  120.405 -3.475  1.00 5.71  ? 147 TYR B CB   1 
ATOM   6694  C  CG   . TYR B  1 147 ? 48.844  119.787 -2.953  1.00 5.65  ? 147 TYR B CG   1 
ATOM   6695  C  CD1  . TYR B  1 147 ? 47.644  119.975 -3.624  1.00 9.39  ? 147 TYR B CD1  1 
ATOM   6696  C  CD2  . TYR B  1 147 ? 48.835  119.027 -1.785  1.00 5.54  ? 147 TYR B CD2  1 
ATOM   6697  C  CE1  . TYR B  1 147 ? 46.471  119.440 -3.160  1.00 5.76  ? 147 TYR B CE1  1 
ATOM   6698  C  CE2  . TYR B  1 147 ? 47.646  118.462 -1.312  1.00 5.54  ? 147 TYR B CE2  1 
ATOM   6699  C  CZ   . TYR B  1 147 ? 46.466  118.692 -2.002  1.00 5.66  ? 147 TYR B CZ   1 
ATOM   6700  O  OH   . TYR B  1 147 ? 45.247  118.180 -1.585  1.00 7.13  ? 147 TYR B OH   1 
ATOM   6701  H  H    . TYR B  1 147 ? 51.940  121.998 -4.169  1.00 7.19  ? 147 TYR B H    1 
ATOM   6702  H  HA   . TYR B  1 147 ? 49.349  122.308 -3.505  1.00 7.05  ? 147 TYR B HA   1 
ATOM   6703  H  HB2  . TYR B  1 147 ? 50.172  120.231 -4.428  1.00 6.85  ? 147 TYR B HB2  1 
ATOM   6704  H  HB3  . TYR B  1 147 ? 50.868  119.975 -3.024  1.00 6.85  ? 147 TYR B HB3  1 
ATOM   6705  H  HD1  . TYR B  1 147 ? 47.633  120.487 -4.400  1.00 11.27 ? 147 TYR B HD1  1 
ATOM   6706  H  HD2  . TYR B  1 147 ? 49.628  118.886 -1.322  1.00 6.65  ? 147 TYR B HD2  1 
ATOM   6707  H  HE1  . TYR B  1 147 ? 45.678  119.584 -3.624  1.00 6.91  ? 147 TYR B HE1  1 
ATOM   6708  H  HE2  . TYR B  1 147 ? 47.643  117.963 -0.527  1.00 6.65  ? 147 TYR B HE2  1 
ATOM   6709  H  HH   . TYR B  1 147 ? 44.939  117.686 -2.161  1.00 8.56  ? 147 TYR B HH   1 
ATOM   6710  N  N    . GLY B  1 148 ? 51.696  122.390 -1.351  1.00 6.15  ? 148 GLY B N    1 
ATOM   6711  C  CA   . GLY B  1 148 ? 52.064  122.760 0.003   1.00 11.05 ? 148 GLY B CA   1 
ATOM   6712  C  C    . GLY B  1 148 ? 53.022  121.755 0.653   1.00 9.31  ? 148 GLY B C    1 
ATOM   6713  O  O    . GLY B  1 148 ? 53.357  120.687 0.090   1.00 5.70  ? 148 GLY B O    1 
ATOM   6714  H  H    . GLY B  1 148 ? 52.374  122.258 -1.864  1.00 7.39  ? 148 GLY B H    1 
ATOM   6715  H  HA2  . GLY B  1 148 ? 52.492  123.630 -0.005  1.00 13.27 ? 148 GLY B HA2  1 
ATOM   6716  H  HA3  . GLY B  1 148 ? 51.264  122.817 0.549   1.00 13.27 ? 148 GLY B HA3  1 
ATOM   6717  N  N    . THR B  1 149 ? 53.454  122.079 1.870   1.00 9.35  ? 149 THR B N    1 
ATOM   6718  C  CA   . THR B  1 149 ? 54.375  121.226 2.612   1.00 9.38  ? 149 THR B CA   1 
ATOM   6719  C  C    . THR B  1 149 ? 53.576  120.224 3.459   1.00 5.70  ? 149 THR B C    1 
ATOM   6720  O  O    . THR B  1 149 ? 52.794  120.620 4.330   1.00 6.24  ? 149 THR B O    1 
ATOM   6721  C  CB   . THR B  1 149 ? 55.271  122.087 3.528   1.00 11.62 ? 149 THR B CB   1 
ATOM   6722  O  OG1  . THR B  1 149 ? 56.092  122.962 2.726   1.00 13.57 ? 149 THR B OG1  1 
ATOM   6723  C  CG2  . THR B  1 149 ? 56.152  121.214 4.407   1.00 8.13  ? 149 THR B CG2  1 
ATOM   6724  H  H    . THR B  1 149 ? 53.225  122.794 2.290   1.00 11.22 ? 149 THR B H    1 
ATOM   6725  H  HA   . THR B  1 149 ? 54.945  120.730 1.988   1.00 11.26 ? 149 THR B HA   1 
ATOM   6726  H  HB   . THR B  1 149 ? 54.708  122.624 4.107   1.00 13.94 ? 149 THR B HB   1 
ATOM   6727  H  HG1  . THR B  1 149 ? 55.617  123.456 2.275   1.00 16.28 ? 149 THR B HG1  1 
ATOM   6728  H  HG21 . THR B  1 149 ? 56.702  121.764 4.969   1.00 9.75  ? 149 THR B HG21 1 
ATOM   6729  H  HG22 . THR B  1 149 ? 55.607  120.649 4.959   1.00 9.75  ? 149 THR B HG22 1 
ATOM   6730  H  HG23 . THR B  1 149 ? 56.717  120.664 3.860   1.00 9.75  ? 149 THR B HG23 1 
ATOM   6731  N  N    . ARG B  1 150 ? 53.789  118.941 3.217   1.00 5.48  ? 150 ARG B N    1 
ATOM   6732  C  CA   . ARG B  1 150 ? 53.072  117.907 3.932   1.00 5.36  ? 150 ARG B CA   1 
ATOM   6733  C  C    . ARG B  1 150 ? 53.665  117.667 5.307   1.00 5.35  ? 150 ARG B C    1 
ATOM   6734  O  O    . ARG B  1 150 ? 54.893  117.555 5.478   1.00 7.37  ? 150 ARG B O    1 
ATOM   6735  C  CB   . ARG B  1 150 ? 53.047  116.599 3.133   1.00 5.32  ? 150 ARG B CB   1 
ATOM   6736  C  CG   . ARG B  1 150 ? 52.467  116.725 1.727   1.00 7.00  ? 150 ARG B CG   1 
ATOM   6737  C  CD   . ARG B  1 150 ? 52.434  115.364 0.984   1.00 9.28  ? 150 ARG B CD   1 
ATOM   6738  N  NE   . ARG B  1 150 ? 51.260  114.579 1.359   1.00 5.30  ? 150 ARG B NE   1 
ATOM   6739  C  CZ   . ARG B  1 150 ? 50.082  114.657 0.761   1.00 5.32  ? 150 ARG B CZ   1 
ATOM   6740  N  NH1  . ARG B  1 150 ? 49.914  115.444 -0.307  1.00 6.46  ? 150 ARG B NH1  1 
ATOM   6741  N  NH2  . ARG B  1 150 ? 49.078  113.912 1.176   1.00 5.34  ? 150 ARG B NH2  1 
ATOM   6742  H  H    . ARG B  1 150 ? 54.349  118.643 2.637   1.00 6.58  ? 150 ARG B H    1 
ATOM   6743  H  HA   . ARG B  1 150 ? 52.144  118.197 4.055   1.00 6.43  ? 150 ARG B HA   1 
ATOM   6744  H  HB2  . ARG B  1 150 ? 53.956  116.271 3.048   1.00 6.38  ? 150 ARG B HB2  1 
ATOM   6745  H  HB3  . ARG B  1 150 ? 52.511  115.952 3.616   1.00 6.38  ? 150 ARG B HB3  1 
ATOM   6746  H  HG2  . ARG B  1 150 ? 51.558  117.058 1.787   1.00 8.40  ? 150 ARG B HG2  1 
ATOM   6747  H  HG3  . ARG B  1 150 ? 53.014  117.337 1.211   1.00 8.40  ? 150 ARG B HG3  1 
ATOM   6748  H  HD2  . ARG B  1 150 ? 52.401  115.522 0.027   1.00 11.13 ? 150 ARG B HD2  1 
ATOM   6749  H  HD3  . ARG B  1 150 ? 53.226  114.854 1.213   1.00 11.13 ? 150 ARG B HD3  1 
ATOM   6750  H  HE   . ARG B  1 150 ? 51.340  114.027 2.014   1.00 6.37  ? 150 ARG B HE   1 
ATOM   6751  H  HH11 . ARG B  1 150 ? 50.564  115.932 -0.587  1.00 7.75  ? 150 ARG B HH11 1 
ATOM   6752  H  HH12 . ARG B  1 150 ? 49.148  115.481 -0.697  1.00 7.75  ? 150 ARG B HH12 1 
ATOM   6753  H  HH21 . ARG B  1 150 ? 49.179  113.393 1.854   1.00 6.41  ? 150 ARG B HH21 1 
ATOM   6754  H  HH22 . ARG B  1 150 ? 48.318  113.952 0.775   1.00 6.41  ? 150 ARG B HH22 1 
ATOM   6755  N  N    . HIS B  1 151 ? 52.755  117.612 6.265   1.00 5.28  ? 151 HIS B N    1 
ATOM   6756  C  CA   . HIS B  1 151 ? 53.037  117.262 7.653   1.00 5.27  ? 151 HIS B CA   1 
ATOM   6757  C  C    . HIS B  1 151 ? 52.104  116.160 8.123   1.00 5.18  ? 151 HIS B C    1 
ATOM   6758  O  O    . HIS B  1 151 ? 50.990  116.015 7.622   1.00 8.51  ? 151 HIS B O    1 
ATOM   6759  C  CB   . HIS B  1 151 ? 52.782  118.479 8.539   1.00 8.05  ? 151 HIS B CB   1 
ATOM   6760  C  CG   . HIS B  1 151 ? 53.577  119.694 8.182   1.00 5.47  ? 151 HIS B CG   1 
ATOM   6761  N  ND1  . HIS B  1 151 ? 54.945  119.763 8.335   1.00 5.59  ? 151 HIS B ND1  1 
ATOM   6762  C  CD2  . HIS B  1 151 ? 53.185  120.924 7.745   1.00 5.59  ? 151 HIS B CD2  1 
ATOM   6763  C  CE1  . HIS B  1 151 ? 55.365  120.964 7.984   1.00 5.78  ? 151 HIS B CE1  1 
ATOM   6764  N  NE2  . HIS B  1 151 ? 54.313  121.695 7.650   1.00 7.05  ? 151 HIS B NE2  1 
ATOM   6765  H  H    . HIS B  1 151 ? 51.923  117.782 6.129   1.00 6.34  ? 151 HIS B H    1 
ATOM   6766  H  HA   . HIS B  1 151 ? 53.967  116.971 7.753   1.00 6.32  ? 151 HIS B HA   1 
ATOM   6767  H  HB2  . HIS B  1 151 ? 51.843  118.715 8.478   1.00 9.66  ? 151 HIS B HB2  1 
ATOM   6768  H  HB3  . HIS B  1 151 ? 53.000  118.245 9.455   1.00 9.66  ? 151 HIS B HB3  1 
ATOM   6769  H  HD1  . HIS B  1 151 ? 55.448  119.119 8.604   1.00 6.71  ? 151 HIS B HD1  1 
ATOM   6770  H  HD2  . HIS B  1 151 ? 52.313  121.197 7.569   1.00 6.71  ? 151 HIS B HD2  1 
ATOM   6771  H  HE1  . HIS B  1 151 ? 56.248  121.254 7.992   1.00 6.93  ? 151 HIS B HE1  1 
ATOM   6772  H  HE2  . HIS B  1 151 ? 54.339  122.507 7.369   1.00 8.46  ? 151 HIS B HE2  1 
ATOM   6773  N  N    . LEU B  1 152 ? 52.519  115.472 9.184   1.00 5.18  ? 152 LEU B N    1 
ATOM   6774  C  CA   . LEU B  1 152 ? 51.676  114.553 9.937   1.00 8.28  ? 152 LEU B CA   1 
ATOM   6775  C  C    . LEU B  1 152 ? 50.638  115.269 10.787  1.00 7.45  ? 152 LEU B C    1 
ATOM   6776  O  O    . LEU B  1 152 ? 50.948  116.257 11.450  1.00 8.42  ? 152 LEU B O    1 
ATOM   6777  C  CB   . LEU B  1 152 ? 52.551  113.714 10.875  1.00 8.48  ? 152 LEU B CB   1 
ATOM   6778  C  CG   . LEU B  1 152 ? 53.490  112.672 10.271  1.00 9.72  ? 152 LEU B CG   1 
ATOM   6779  C  CD1  . LEU B  1 152 ? 54.340  112.063 11.372  1.00 7.49  ? 152 LEU B CD1  1 
ATOM   6780  C  CD2  . LEU B  1 152 ? 52.711  111.584 9.544   1.00 11.97 ? 152 LEU B CD2  1 
ATOM   6781  H  H    . LEU B  1 152 ? 53.318  115.526 9.498   1.00 6.21  ? 152 LEU B H    1 
ATOM   6782  H  HA   . LEU B  1 152 ? 51.213  113.950 9.319   1.00 9.93  ? 152 LEU B HA   1 
ATOM   6783  H  HB2  . LEU B  1 152 ? 53.104  114.324 11.388  1.00 10.18 ? 152 LEU B HB2  1 
ATOM   6784  H  HB3  . LEU B  1 152 ? 51.962  113.240 11.483  1.00 10.18 ? 152 LEU B HB3  1 
ATOM   6785  H  HG   . LEU B  1 152 ? 54.080  113.103 9.633   1.00 11.66 ? 152 LEU B HG   1 
ATOM   6786  H  HD11 . LEU B  1 152 ? 54.928  111.409 10.986  1.00 8.98  ? 152 LEU B HD11 1 
ATOM   6787  H  HD12 . LEU B  1 152 ? 54.853  112.758 11.791  1.00 8.98  ? 152 LEU B HD12 1 
ATOM   6788  H  HD13 . LEU B  1 152 ? 53.764  111.646 12.017  1.00 8.98  ? 152 LEU B HD13 1 
ATOM   6789  H  HD21 . LEU B  1 152 ? 53.330  110.949 9.178   1.00 14.36 ? 152 LEU B HD21 1 
ATOM   6790  H  HD22 . LEU B  1 152 ? 52.125  111.149 10.168  1.00 14.36 ? 152 LEU B HD22 1 
ATOM   6791  H  HD23 . LEU B  1 152 ? 52.198  111.986 8.839   1.00 14.36 ? 152 LEU B HD23 1 
ATOM   6792  N  N    . LEU B  1 153 ? 49.411  114.768 10.754  1.00 10.41 ? 153 LEU B N    1 
ATOM   6793  C  CA   . LEU B  1 153 ? 48.402  115.137 11.733  1.00 5.67  ? 153 LEU B CA   1 
ATOM   6794  C  C    . LEU B  1 153 ? 47.909  113.850 12.403  1.00 5.76  ? 153 LEU B C    1 
ATOM   6795  O  O    . LEU B  1 153 ? 47.406  112.932 11.727  1.00 6.46  ? 153 LEU B O    1 
ATOM   6796  C  CB   . LEU B  1 153 ? 47.198  115.851 11.097  1.00 5.41  ? 153 LEU B CB   1 
ATOM   6797  C  CG   . LEU B  1 153 ? 46.210  116.315 12.142  1.00 8.38  ? 153 LEU B CG   1 
ATOM   6798  C  CD1  . LEU B  1 153 ? 46.750  117.637 12.750  1.00 8.08  ? 153 LEU B CD1  1 
ATOM   6799  C  CD2  . LEU B  1 153 ? 44.809  116.495 11.565  1.00 7.65  ? 153 LEU B CD2  1 
ATOM   6800  H  H    . LEU B  1 153 ? 49.135  114.206 10.165  1.00 12.50 ? 153 LEU B H    1 
ATOM   6801  H  HA   . LEU B  1 153 ? 48.795  115.721 12.414  1.00 6.81  ? 153 LEU B HA   1 
ATOM   6802  H  HB2  . LEU B  1 153 ? 47.510  116.628 10.607  1.00 6.49  ? 153 LEU B HB2  1 
ATOM   6803  H  HB3  . LEU B  1 153 ? 46.742  115.239 10.499  1.00 6.49  ? 153 LEU B HB3  1 
ATOM   6804  H  HG   . LEU B  1 153 ? 46.162  115.654 12.851  1.00 10.06 ? 153 LEU B HG   1 
ATOM   6805  H  HD11 . LEU B  1 153 ? 46.134  117.947 13.418  1.00 9.69  ? 153 LEU B HD11 1 
ATOM   6806  H  HD12 . LEU B  1 153 ? 47.607  117.470 13.148  1.00 9.69  ? 153 LEU B HD12 1 
ATOM   6807  H  HD13 . LEU B  1 153 ? 46.833  118.290 12.052  1.00 9.69  ? 153 LEU B HD13 1 
ATOM   6808  H  HD21 . LEU B  1 153 ? 44.219  116.789 12.263  1.00 9.18  ? 153 LEU B HD21 1 
ATOM   6809  H  HD22 . LEU B  1 153 ? 44.842  117.151 10.865  1.00 9.18  ? 153 LEU B HD22 1 
ATOM   6810  H  HD23 . LEU B  1 153 ? 44.507  115.655 11.213  1.00 9.18  ? 153 LEU B HD23 1 
ATOM   6811  N  N    . THR B  1 154 ? 48.042  113.783 13.732  1.00 5.15  ? 154 THR B N    1 
ATOM   6812  C  CA   . THR B  1 154 ? 47.852  112.520 14.451  1.00 5.21  ? 154 THR B CA   1 
ATOM   6813  C  C    . THR B  1 154 ? 47.134  112.736 15.783  1.00 5.24  ? 154 THR B C    1 
ATOM   6814  O  O    . THR B  1 154 ? 47.039  113.872 16.267  1.00 6.88  ? 154 THR B O    1 
ATOM   6815  C  CB   . THR B  1 154 ? 49.200  111.813 14.730  1.00 6.45  ? 154 THR B CB   1 
ATOM   6816  O  OG1  . THR B  1 154 ? 50.046  112.641 15.503  1.00 8.79  ? 154 THR B OG1  1 
ATOM   6817  C  CG2  . THR B  1 154 ? 49.939  111.468 13.434  1.00 5.92  ? 154 THR B CG2  1 
ATOM   6818  H  H    . THR B  1 154 ? 48.240  114.451 14.236  1.00 6.19  ? 154 THR B H    1 
ATOM   6819  H  HA   . THR B  1 154 ? 47.303  111.920 13.904  1.00 6.25  ? 154 THR B HA   1 
ATOM   6820  H  HB   . THR B  1 154 ? 49.034  110.988 15.213  1.00 7.74  ? 154 THR B HB   1 
ATOM   6821  H  HG1  . THR B  1 154 ? 49.689  112.815 16.220  1.00 10.55 ? 154 THR B HG1  1 
ATOM   6822  H  HG21 . THR B  1 154 ? 50.770  111.032 13.636  1.00 7.11  ? 154 THR B HG21 1 
ATOM   6823  H  HG22 . THR B  1 154 ? 49.402  110.882 12.896  1.00 7.11  ? 154 THR B HG22 1 
ATOM   6824  H  HG23 . THR B  1 154 ? 50.121  112.269 12.936  1.00 7.11  ? 154 THR B HG23 1 
ATOM   6825  N  N    . LYS B  1 155 ? 46.614  111.646 16.356  1.00 9.12  ? 155 LYS B N    1 
ATOM   6826  C  CA   . LYS B  1 155 ? 45.917  111.707 17.654  1.00 10.93 ? 155 LYS B CA   1 
ATOM   6827  C  C    . LYS B  1 155 ? 46.845  111.938 18.838  1.00 13.53 ? 155 LYS B C    1 
ATOM   6828  O  O    . LYS B  1 155 ? 46.499  112.678 19.771  1.00 12.08 ? 155 LYS B O    1 
ATOM   6829  C  CB   . LYS B  1 155 ? 45.035  110.477 17.865  1.00 13.07 ? 155 LYS B CB   1 
ATOM   6830  C  CG   . LYS B  1 155 ? 43.918  110.444 16.836  1.00 10.01 ? 155 LYS B CG   1 
ATOM   6831  C  CD   . LYS B  1 155 ? 42.960  109.292 17.003  1.00 15.95 ? 155 LYS B CD   1 
ATOM   6832  C  CE   . LYS B  1 155 ? 41.881  109.339 15.921  1.00 20.79 ? 155 LYS B CE   1 
ATOM   6833  N  NZ   . LYS B  1 155 ? 41.134  108.035 15.836  1.00 24.61 ? 155 LYS B NZ   1 
ATOM   6834  H  H    . LYS B  1 155 ? 46.649  110.857 16.016  1.00 10.94 ? 155 LYS B H    1 
ATOM   6835  H  HA   . LYS B  1 155 ? 45.312  112.477 17.624  1.00 13.12 ? 155 LYS B HA   1 
ATOM   6836  H  HB2  . LYS B  1 155 ? 45.570  109.674 17.764  1.00 15.68 ? 155 LYS B HB2  1 
ATOM   6837  H  HB3  . LYS B  1 155 ? 44.638  110.512 18.749  1.00 15.68 ? 155 LYS B HB3  1 
ATOM   6838  H  HG2  . LYS B  1 155 ? 43.406  111.265 16.905  1.00 12.02 ? 155 LYS B HG2  1 
ATOM   6839  H  HG3  . LYS B  1 155 ? 44.310  110.376 15.952  1.00 12.02 ? 155 LYS B HG3  1 
ATOM   6840  H  HD2  . LYS B  1 155 ? 43.442  108.454 16.920  1.00 19.14 ? 155 LYS B HD2  1 
ATOM   6841  H  HD3  . LYS B  1 155 ? 42.529  109.352 17.870  1.00 19.14 ? 155 LYS B HD3  1 
ATOM   6842  H  HE2  . LYS B  1 155 ? 41.246  110.041 16.131  1.00 24.95 ? 155 LYS B HE2  1 
ATOM   6843  H  HE3  . LYS B  1 155 ? 42.297  109.508 15.061  1.00 24.95 ? 155 LYS B HE3  1 
ATOM   6844  H  HZ1  . LYS B  1 155 ? 40.511  108.082 15.202  1.00 29.53 ? 155 LYS B HZ1  1 
ATOM   6845  H  HZ2  . LYS B  1 155 ? 41.697  107.374 15.641  1.00 29.53 ? 155 LYS B HZ2  1 
ATOM   6846  H  HZ3  . LYS B  1 155 ? 40.740  107.859 16.615  1.00 29.53 ? 155 LYS B HZ3  1 
ATOM   6847  N  N    . LYS B  1 156 ? 48.033  111.358 18.777  1.00 9.34  ? 156 LYS B N    1 
ATOM   6848  C  CA   . LYS B  1 156 ? 49.023  111.561 19.810  1.00 9.40  ? 156 LYS B CA   1 
ATOM   6849  C  C    . LYS B  1 156 ? 50.265  112.217 19.254  1.00 12.57 ? 156 LYS B C    1 
ATOM   6850  O  O    . LYS B  1 156 ? 50.501  112.180 18.045  1.00 10.10 ? 156 LYS B O    1 
ATOM   6851  C  CB   . LYS B  1 156 ? 49.340  110.239 20.534  1.00 14.75 ? 156 LYS B CB   1 
ATOM   6852  C  CG   . LYS B  1 156 ? 50.161  109.307 19.762  1.00 18.09 ? 156 LYS B CG   1 
ATOM   6853  C  CD   . LYS B  1 156 ? 50.637  108.137 20.600  1.00 22.71 ? 156 LYS B CD   1 
ATOM   6854  C  CE   . LYS B  1 156 ? 51.513  107.229 19.766  1.00 28.91 ? 156 LYS B CE   1 
ATOM   6855  N  NZ   . LYS B  1 156 ? 51.969  106.016 20.497  1.00 31.72 ? 156 LYS B NZ   1 
ATOM   6856  H  H    . LYS B  1 156 ? 48.288  110.839 18.141  1.00 11.20 ? 156 LYS B H    1 
ATOM   6857  H  HA   . LYS B  1 156 ? 48.648  112.173 20.477  1.00 11.28 ? 156 LYS B HA   1 
ATOM   6858  H  HB2  . LYS B  1 156 ? 49.816  110.441 21.355  1.00 17.70 ? 156 LYS B HB2  1 
ATOM   6859  H  HB3  . LYS B  1 156 ? 48.505  109.792 20.743  1.00 17.70 ? 156 LYS B HB3  1 
ATOM   6860  H  HG2  . LYS B  1 156 ? 49.637  108.957 19.024  1.00 21.70 ? 156 LYS B HG2  1 
ATOM   6861  H  HG3  . LYS B  1 156 ? 50.941  109.775 19.425  1.00 21.70 ? 156 LYS B HG3  1 
ATOM   6862  H  HD2  . LYS B  1 156 ? 51.158  108.465 21.350  1.00 27.26 ? 156 LYS B HD2  1 
ATOM   6863  H  HD3  . LYS B  1 156 ? 49.873  107.628 20.912  1.00 27.26 ? 156 LYS B HD3  1 
ATOM   6864  H  HE2  . LYS B  1 156 ? 51.012  106.937 18.988  1.00 34.70 ? 156 LYS B HE2  1 
ATOM   6865  H  HE3  . LYS B  1 156 ? 52.300  107.721 19.485  1.00 34.70 ? 156 LYS B HE3  1 
ATOM   6866  H  HZ1  . LYS B  1 156 ? 52.442  106.253 21.213  1.00 38.07 ? 156 LYS B HZ1  1 
ATOM   6867  H  HZ2  . LYS B  1 156 ? 51.267  105.537 20.760  1.00 38.07 ? 156 LYS B HZ2  1 
ATOM   6868  H  HZ3  . LYS B  1 156 ? 52.479  105.515 19.967  1.00 38.07 ? 156 LYS B HZ3  1 
ATOM   6869  N  N    . PRO B  1 157 ? 51.036  112.878 20.122  1.00 12.09 ? 157 PRO B N    1 
ATOM   6870  C  CA   . PRO B  1 157 ? 52.195  113.569 19.559  1.00 11.70 ? 157 PRO B CA   1 
ATOM   6871  C  C    . PRO B  1 157 ? 53.217  112.633 18.875  1.00 8.76  ? 157 PRO B C    1 
ATOM   6872  O  O    . PRO B  1 157 ? 53.433  111.492 19.305  1.00 15.12 ? 157 PRO B O    1 
ATOM   6873  C  CB   . PRO B  1 157 ? 52.823  114.277 20.754  1.00 14.41 ? 157 PRO B CB   1 
ATOM   6874  C  CG   . PRO B  1 157 ? 52.097  113.814 21.959  1.00 16.96 ? 157 PRO B CG   1 
ATOM   6875  C  CD   . PRO B  1 157 ? 50.798  113.221 21.538  1.00 14.75 ? 157 PRO B CD   1 
ATOM   6876  H  HA   . PRO B  1 157 ? 51.899  114.242 18.911  1.00 14.04 ? 157 PRO B HA   1 
ATOM   6877  H  HB2  . PRO B  1 157 ? 53.762  114.039 20.813  1.00 17.30 ? 157 PRO B HB2  1 
ATOM   6878  H  HB3  . PRO B  1 157 ? 52.724  115.237 20.648  1.00 17.30 ? 157 PRO B HB3  1 
ATOM   6879  H  HG2  . PRO B  1 157 ? 52.634  113.147 22.414  1.00 20.35 ? 157 PRO B HG2  1 
ATOM   6880  H  HG3  . PRO B  1 157 ? 51.942  114.572 22.545  1.00 20.35 ? 157 PRO B HG3  1 
ATOM   6881  H  HD2  . PRO B  1 157 ? 50.607  112.422 22.054  1.00 17.70 ? 157 PRO B HD2  1 
ATOM   6882  H  HD3  . PRO B  1 157 ? 50.086  113.875 21.614  1.00 17.70 ? 157 PRO B HD3  1 
ATOM   6883  N  N    . VAL B  1 158 ? 53.853  113.165 17.837  1.00 12.58 ? 158 VAL B N    1 
ATOM   6884  C  CA   . VAL B  1 158 ? 54.942  112.472 17.205  1.00 15.00 ? 158 VAL B CA   1 
ATOM   6885  C  C    . VAL B  1 158 ? 56.081  113.445 17.046  1.00 10.30 ? 158 VAL B C    1 
ATOM   6886  O  O    . VAL B  1 158 ? 55.930  114.453 16.393  1.00 10.50 ? 158 VAL B O    1 
ATOM   6887  C  CB   . VAL B  1 158 ? 54.520  111.904 15.843  1.00 11.49 ? 158 VAL B CB   1 
ATOM   6888  C  CG1  . VAL B  1 158 ? 55.744  111.393 15.095  1.00 10.08 ? 158 VAL B CG1  1 
ATOM   6889  C  CG2  . VAL B  1 158 ? 53.462  110.830 16.004  1.00 8.64  ? 158 VAL B CG2  1 
ATOM   6890  H  H    . VAL B  1 158 ? 53.667  113.928 17.487  1.00 15.09 ? 158 VAL B H    1 
ATOM   6891  H  HA   . VAL B  1 158 ? 55.238  111.732 17.775  1.00 18.00 ? 158 VAL B HA   1 
ATOM   6892  H  HB   . VAL B  1 158 ? 54.129  112.627 15.311  1.00 13.79 ? 158 VAL B HB   1 
ATOM   6893  H  HG11 . VAL B  1 158 ? 55.467  111.041 14.246  1.00 12.10 ? 158 VAL B HG11 1 
ATOM   6894  H  HG12 . VAL B  1 158 ? 56.356  112.121 14.963  1.00 12.10 ? 158 VAL B HG12 1 
ATOM   6895  H  HG13 . VAL B  1 158 ? 56.163  110.703 15.615  1.00 12.10 ? 158 VAL B HG13 1 
ATOM   6896  H  HG21 . VAL B  1 158 ? 53.221  110.496 15.137  1.00 10.37 ? 158 VAL B HG21 1 
ATOM   6897  H  HG22 . VAL B  1 158 ? 53.818  110.119 16.542  1.00 10.37 ? 158 VAL B HG22 1 
ATOM   6898  H  HG23 . VAL B  1 158 ? 52.693  111.212 16.434  1.00 10.37 ? 158 VAL B HG23 1 
ATOM   6899  N  N    . THR B  1 159 ? 57.233  113.146 17.621  1.00 8.74  ? 159 THR B N    1 
ATOM   6900  C  CA   . THR B  1 159 ? 58.385  114.044 17.509  1.00 11.54 ? 159 THR B CA   1 
ATOM   6901  C  C    . THR B  1 159 ? 59.594  113.295 16.958  1.00 9.42  ? 159 THR B C    1 
ATOM   6902  O  O    . THR B  1 159 ? 60.602  113.912 16.634  1.00 12.45 ? 159 THR B O    1 
ATOM   6903  C  CB   . THR B  1 159 ? 58.784  114.707 18.870  1.00 11.11 ? 159 THR B CB   1 
ATOM   6904  O  OG1  . THR B  1 159 ? 59.122  113.691 19.831  1.00 9.35  ? 159 THR B OG1  1 
ATOM   6905  C  CG2  . THR B  1 159 ? 57.669  115.604 19.375  1.00 10.76 ? 159 THR B CG2  1 
ATOM   6906  H  H    . THR B  1 159 ? 57.381  112.435 18.081  1.00 10.49 ? 159 THR B H    1 
ATOM   6907  H  HA   . THR B  1 159 ? 58.165  114.762 16.879  1.00 13.85 ? 159 THR B HA   1 
ATOM   6908  H  HB   . THR B  1 159 ? 59.564  115.265 18.725  1.00 13.34 ? 159 THR B HB   1 
ATOM   6909  H  HG1  . THR B  1 159 ? 58.479  113.196 19.954  1.00 11.23 ? 159 THR B HG1  1 
ATOM   6910  H  HG21 . THR B  1 159 ? 57.923  116.005 20.209  1.00 12.91 ? 159 THR B HG21 1 
ATOM   6911  H  HG22 . THR B  1 159 ? 57.492  116.298 18.736  1.00 12.91 ? 159 THR B HG22 1 
ATOM   6912  H  HG23 . THR B  1 159 ? 56.869  115.089 19.507  1.00 12.91 ? 159 THR B HG23 1 
ATOM   6913  N  N    . LYS B  1 160 ? 59.491  111.975 16.852  1.00 12.38 ? 160 LYS B N    1 
ATOM   6914  C  CA   . LYS B  1 160 ? 60.562  111.185 16.272  1.00 15.21 ? 160 LYS B CA   1 
ATOM   6915  C  C    . LYS B  1 160 ? 60.007  109.907 15.689  1.00 10.76 ? 160 LYS B C    1 
ATOM   6916  O  O    . LYS B  1 160 ? 58.865  109.521 15.962  1.00 10.26 ? 160 LYS B O    1 
ATOM   6917  C  CB   . LYS B  1 160 ? 61.638  110.870 17.298  1.00 16.19 ? 160 LYS B CB   1 
ATOM   6918  C  CG   . LYS B  1 160 ? 61.105  110.152 18.510  1.00 11.17 ? 160 LYS B CG   1 
ATOM   6919  C  CD   . LYS B  1 160 ? 62.179  109.970 19.572  1.00 27.63 ? 160 LYS B CD   1 
ATOM   6920  C  CE   . LYS B  1 160 ? 61.573  109.397 20.835  1.00 35.96 ? 160 LYS B CE   1 
ATOM   6921  N  NZ   . LYS B  1 160 ? 60.625  110.346 21.497  1.00 42.30 ? 160 LYS B NZ   1 
ATOM   6922  H  H    . LYS B  1 160 ? 58.811  111.516 17.109  1.00 14.86 ? 160 LYS B H    1 
ATOM   6923  H  HA   . LYS B  1 160 ? 60.977  111.695 15.545  1.00 18.25 ? 160 LYS B HA   1 
ATOM   6924  H  HB2  . LYS B  1 160 ? 62.310  110.304 16.887  1.00 19.43 ? 160 LYS B HB2  1 
ATOM   6925  H  HB3  . LYS B  1 160 ? 62.042  111.700 17.596  1.00 19.43 ? 160 LYS B HB3  1 
ATOM   6926  H  HG2  . LYS B  1 160 ? 60.381  110.669 18.896  1.00 13.40 ? 160 LYS B HG2  1 
ATOM   6927  H  HG3  . LYS B  1 160 ? 60.787  109.274 18.247  1.00 13.40 ? 160 LYS B HG3  1 
ATOM   6928  H  HD2  . LYS B  1 160 ? 62.854  109.354 19.247  1.00 33.15 ? 160 LYS B HD2  1 
ATOM   6929  H  HD3  . LYS B  1 160 ? 62.575  110.829 19.782  1.00 33.15 ? 160 LYS B HD3  1 
ATOM   6930  H  HE2  . LYS B  1 160 ? 61.085  108.589 20.614  1.00 43.15 ? 160 LYS B HE2  1 
ATOM   6931  H  HE3  . LYS B  1 160 ? 62.284  109.195 21.464  1.00 43.15 ? 160 LYS B HE3  1 
ATOM   6932  H  HZ1  . LYS B  1 160 ? 60.290  109.976 22.234  1.00 50.76 ? 160 LYS B HZ1  1 
ATOM   6933  H  HZ2  . LYS B  1 160 ? 61.050  111.096 21.717  1.00 50.76 ? 160 LYS B HZ2  1 
ATOM   6934  H  HZ3  . LYS B  1 160 ? 59.957  110.544 20.943  1.00 50.76 ? 160 LYS B HZ3  1 
ATOM   6935  N  N    . PRO B  1 161 ? 60.791  109.262 14.840  1.00 9.11  ? 161 PRO B N    1 
ATOM   6936  C  CA   . PRO B  1 161 ? 60.248  108.085 14.150  1.00 9.25  ? 161 PRO B CA   1 
ATOM   6937  C  C    . PRO B  1 161 ? 59.680  107.010 15.067  1.00 9.65  ? 161 PRO B C    1 
ATOM   6938  O  O    . PRO B  1 161 ? 58.652  106.415 14.716  1.00 15.81 ? 161 PRO B O    1 
ATOM   6939  C  CB   . PRO B  1 161 ? 61.461  107.560 13.368  1.00 8.80  ? 161 PRO B CB   1 
ATOM   6940  C  CG   . PRO B  1 161 ? 62.219  108.754 13.050  1.00 8.73  ? 161 PRO B CG   1 
ATOM   6941  C  CD   . PRO B  1 161 ? 62.082  109.681 14.264  1.00 15.11 ? 161 PRO B CD   1 
ATOM   6942  H  HA   . PRO B  1 161 ? 59.554  108.361 13.515  1.00 11.11 ? 161 PRO B HA   1 
ATOM   6943  H  HB2  . PRO B  1 161 ? 61.979  106.960 13.926  1.00 10.56 ? 161 PRO B HB2  1 
ATOM   6944  H  HB3  . PRO B  1 161 ? 61.164  107.114 12.560  1.00 10.56 ? 161 PRO B HB3  1 
ATOM   6945  H  HG2  . PRO B  1 161 ? 63.149  108.518 12.905  1.00 10.47 ? 161 PRO B HG2  1 
ATOM   6946  H  HG3  . PRO B  1 161 ? 61.847  109.173 12.258  1.00 10.47 ? 161 PRO B HG3  1 
ATOM   6947  H  HD2  . PRO B  1 161 ? 62.803  109.527 14.894  1.00 18.13 ? 161 PRO B HD2  1 
ATOM   6948  H  HD3  . PRO B  1 161 ? 62.044  110.609 13.981  1.00 18.13 ? 161 PRO B HD3  1 
ATOM   6949  N  N    . SER B  1 162 ? 60.315  106.772 16.213  1.00 10.05 ? 162 SER B N    1 
ATOM   6950  C  CA   . SER B  1 162 ? 59.845  105.753 17.158  1.00 13.21 ? 162 SER B CA   1 
ATOM   6951  C  C    . SER B  1 162 ? 58.432  106.032 17.685  1.00 12.18 ? 162 SER B C    1 
ATOM   6952  O  O    . SER B  1 162 ? 57.711  105.101 18.064  1.00 15.39 ? 162 SER B O    1 
ATOM   6953  C  CB   . SER B  1 162 ? 60.831  105.555 18.321  1.00 15.44 ? 162 SER B CB   1 
ATOM   6954  O  OG   . SER B  1 162 ? 60.982  106.720 19.124  1.00 15.19 ? 162 SER B OG   1 
ATOM   6955  H  H    . SER B  1 162 ? 61.023  107.187 16.470  1.00 12.07 ? 162 SER B H    1 
ATOM   6956  H  HA   . SER B  1 162 ? 59.803  104.900 16.677  1.00 15.85 ? 162 SER B HA   1 
ATOM   6957  H  HB2  . SER B  1 162 ? 60.507  104.833 18.882  1.00 18.53 ? 162 SER B HB2  1 
ATOM   6958  H  HB3  . SER B  1 162 ? 61.698  105.318 17.955  1.00 18.53 ? 162 SER B HB3  1 
ATOM   6959  H  HG   . SER B  1 162 ? 60.510  107.324 18.833  1.00 18.23 ? 162 SER B HG   1 
ATOM   6960  N  N    . ASP B  1 163 ? 58.032  107.301 17.726  1.00 10.39 ? 163 ASP B N    1 
ATOM   6961  C  CA   . ASP B  1 163 ? 56.662  107.602 18.086  1.00 9.62  ? 163 ASP B CA   1 
ATOM   6962  C  C    . ASP B  1 163 ? 55.631  107.069 17.120  1.00 12.88 ? 163 ASP B C    1 
ATOM   6963  O  O    . ASP B  1 163 ? 54.466  107.012 17.486  1.00 11.34 ? 163 ASP B O    1 
ATOM   6964  C  CB   . ASP B  1 163 ? 56.424  109.107 18.272  1.00 10.53 ? 163 ASP B CB   1 
ATOM   6965  C  CG   . ASP B  1 163 ? 57.143  109.680 19.478  1.00 16.48 ? 163 ASP B CG   1 
ATOM   6966  O  OD1  . ASP B  1 163 ? 57.240  108.999 20.530  1.00 12.61 ? 163 ASP B OD1  1 
ATOM   6967  O  OD2  . ASP B  1 163 ? 57.592  110.832 19.381  1.00 10.58 ? 163 ASP B OD2  1 
ATOM   6968  H  H    . ASP B  1 163 ? 58.524  107.986 17.554  1.00 12.47 ? 163 ASP B H    1 
ATOM   6969  H  HA   . ASP B  1 163 ? 56.483  107.178 18.951  1.00 11.55 ? 163 ASP B HA   1 
ATOM   6970  H  HB2  . ASP B  1 163 ? 56.742  109.576 17.484  1.00 12.63 ? 163 ASP B HB2  1 
ATOM   6971  H  HB3  . ASP B  1 163 ? 55.474  109.264 18.388  1.00 12.63 ? 163 ASP B HB3  1 
ATOM   6972  N  N    . LEU B  1 164 ? 56.033  106.709 15.882  1.00 8.73  ? 164 LEU B N    1 
ATOM   6973  C  CA   . LEU B  1 164 ? 55.094  106.134 14.928  1.00 8.64  ? 164 LEU B CA   1 
ATOM   6974  C  C    . LEU B  1 164 ? 54.853  104.630 15.097  1.00 8.95  ? 164 LEU B C    1 
ATOM   6975  O  O    . LEU B  1 164 ? 54.041  104.066 14.385  1.00 9.54  ? 164 LEU B O    1 
ATOM   6976  C  CB   . LEU B  1 164 ? 55.568  106.389 13.475  1.00 8.40  ? 164 LEU B CB   1 
ATOM   6977  C  CG   . LEU B  1 164 ? 55.451  107.849 13.046  1.00 8.12  ? 164 LEU B CG   1 
ATOM   6978  C  CD1  . LEU B  1 164 ? 56.024  108.092 11.641  1.00 7.94  ? 164 LEU B CD1  1 
ATOM   6979  C  CD2  . LEU B  1 164 ? 53.979  108.319 13.055  1.00 13.76 ? 164 LEU B CD2  1 
ATOM   6980  H  H    . LEU B  1 164 ? 56.835  106.791 15.585  1.00 10.47 ? 164 LEU B H    1 
ATOM   6981  H  HA   . LEU B  1 164 ? 54.229  106.583 15.038  1.00 10.37 ? 164 LEU B HA   1 
ATOM   6982  H  HB2  . LEU B  1 164 ? 56.500  106.130 13.400  1.00 10.08 ? 164 LEU B HB2  1 
ATOM   6983  H  HB3  . LEU B  1 164 ? 55.027  105.856 12.871  1.00 10.08 ? 164 LEU B HB3  1 
ATOM   6984  H  HG   . LEU B  1 164 ? 55.945  108.402 13.670  1.00 9.74  ? 164 LEU B HG   1 
ATOM   6985  H  HD11 . LEU B  1 164 ? 55.926  109.021 11.421  1.00 9.53  ? 164 LEU B HD11 1 
ATOM   6986  H  HD12 . LEU B  1 164 ? 56.953  107.851 11.637  1.00 9.53  ? 164 LEU B HD12 1 
ATOM   6987  H  HD13 . LEU B  1 164 ? 55.543  107.553 11.010  1.00 9.53  ? 164 LEU B HD13 1 
ATOM   6988  H  HD21 . LEU B  1 164 ? 53.943  109.238 12.780  1.00 16.51 ? 164 LEU B HD21 1 
ATOM   6989  H  HD22 . LEU B  1 164 ? 53.474  107.775 12.446  1.00 16.51 ? 164 LEU B HD22 1 
ATOM   6990  H  HD23 . LEU B  1 164 ? 53.628  108.228 13.944  1.00 16.51 ? 164 LEU B HD23 1 
ATOM   6991  N  N    . LYS B  1 165 ? 55.545  104.005 16.046  1.00 9.24  ? 165 LYS B N    1 
ATOM   6992  C  CA   . LYS B  1 165 ? 55.475  102.561 16.202  1.00 14.00 ? 165 LYS B CA   1 
ATOM   6993  C  C    . LYS B  1 165 ? 54.031  102.084 16.374  1.00 9.72  ? 165 LYS B C    1 
ATOM   6994  O  O    . LYS B  1 165 ? 53.331  102.468 17.334  1.00 9.81  ? 165 LYS B O    1 
ATOM   6995  C  CB   . LYS B  1 165 ? 56.323  102.150 17.386  1.00 11.69 ? 165 LYS B CB   1 
ATOM   6996  C  CG   . LYS B  1 165 ? 56.472  100.678 17.551  1.00 17.05 ? 165 LYS B CG   1 
ATOM   6997  C  CD   . LYS B  1 165 ? 57.301  100.337 18.777  1.00 22.32 ? 165 LYS B CD   1 
ATOM   6998  C  CE   . LYS B  1 165 ? 58.759  100.739 18.619  1.00 29.07 ? 165 LYS B CE   1 
ATOM   6999  N  NZ   . LYS B  1 165 ? 59.559  100.352 19.828  1.00 33.86 ? 165 LYS B NZ   1 
ATOM   7000  H  H    . LYS B  1 165 ? 56.062  104.397 16.610  1.00 11.09 ? 165 LYS B H    1 
ATOM   7001  H  HA   . LYS B  1 165 ? 55.843  102.133 15.401  1.00 16.80 ? 165 LYS B HA   1 
ATOM   7002  H  HB2  . LYS B  1 165 ? 57.211  102.526 17.277  1.00 14.03 ? 165 LYS B HB2  1 
ATOM   7003  H  HB3  . LYS B  1 165 ? 55.918  102.498 18.195  1.00 14.03 ? 165 LYS B HB3  1 
ATOM   7004  H  HG2  . LYS B  1 165 ? 55.595  100.278 17.656  1.00 20.46 ? 165 LYS B HG2  1 
ATOM   7005  H  HG3  . LYS B  1 165 ? 56.918  100.312 16.771  1.00 20.46 ? 165 LYS B HG3  1 
ATOM   7006  H  HD2  . LYS B  1 165 ? 56.940  100.807 19.545  1.00 26.78 ? 165 LYS B HD2  1 
ATOM   7007  H  HD3  . LYS B  1 165 ? 57.267  99.379  18.926  1.00 26.78 ? 165 LYS B HD3  1 
ATOM   7008  H  HE2  . LYS B  1 165 ? 59.135  100.289 17.847  1.00 34.89 ? 165 LYS B HE2  1 
ATOM   7009  H  HE3  . LYS B  1 165 ? 58.817  101.701 18.510  1.00 34.89 ? 165 LYS B HE3  1 
ATOM   7010  H  HZ1  . LYS B  1 165 ? 60.409  100.594 19.720  1.00 40.63 ? 165 LYS B HZ1  1 
ATOM   7011  H  HZ2  . LYS B  1 165 ? 59.233  100.756 20.551  1.00 40.63 ? 165 LYS B HZ2  1 
ATOM   7012  H  HZ3  . LYS B  1 165 ? 59.522  99.471  19.947  1.00 40.63 ? 165 LYS B HZ3  1 
ATOM   7013  N  N    . GLY B  1 166 ? 53.619  101.215 15.459  1.00 11.53 ? 166 GLY B N    1 
ATOM   7014  C  CA   . GLY B  1 166 ? 52.272  100.687 15.404  1.00 9.99  ? 166 GLY B CA   1 
ATOM   7015  C  C    . GLY B  1 166 ? 51.161  101.660 15.069  1.00 11.63 ? 166 GLY B C    1 
ATOM   7016  O  O    . GLY B  1 166 ? 49.987  101.280 15.092  1.00 13.98 ? 166 GLY B O    1 
ATOM   7017  H  H    . GLY B  1 166 ? 54.127  100.908 14.837  1.00 13.84 ? 166 GLY B H    1 
ATOM   7018  H  HA2  . GLY B  1 166 ? 52.248  99.979  14.742  1.00 11.99 ? 166 GLY B HA2  1 
ATOM   7019  H  HA3  . GLY B  1 166 ? 52.063  100.292 16.264  1.00 11.99 ? 166 GLY B HA3  1 
ATOM   7020  N  N    . MET B  1 167 ? 51.500  102.894 14.688  1.00 11.18 ? 167 MET B N    1 
ATOM   7021  C  CA   . MET B  1 167 ? 50.458  103.882 14.467  1.00 11.57 ? 167 MET B CA   1 
ATOM   7022  C  C    . MET B  1 167 ? 49.903  103.711 13.073  1.00 12.37 ? 167 MET B C    1 
ATOM   7023  O  O    . MET B  1 167 ? 50.672  103.672 12.133  1.00 8.96  ? 167 MET B O    1 
ATOM   7024  C  CB   . MET B  1 167 ? 50.992  105.298 14.642  1.00 11.16 ? 167 MET B CB   1 
ATOM   7025  C  CG   . MET B  1 167 ? 49.904  106.345 14.525  1.00 12.72 ? 167 MET B CG   1 
ATOM   7026  S  SD   . MET B  1 167 ? 50.503  108.007 14.785  1.00 13.74 ? 167 MET B SD   1 
ATOM   7027  C  CE   . MET B  1 167 ? 51.302  107.887 16.386  1.00 19.72 ? 167 MET B CE   1 
ATOM   7028  H  H    . MET B  1 167 ? 52.303  103.172 14.555  1.00 13.41 ? 167 MET B H    1 
ATOM   7029  H  HA   . MET B  1 167 ? 49.740  103.744 15.119  1.00 13.88 ? 167 MET B HA   1 
ATOM   7030  H  HB2  . MET B  1 167 ? 51.395  105.379 15.521  1.00 13.39 ? 167 MET B HB2  1 
ATOM   7031  H  HB3  . MET B  1 167 ? 51.654  105.475 13.955  1.00 13.39 ? 167 MET B HB3  1 
ATOM   7032  H  HG2  . MET B  1 167 ? 49.519  106.302 13.636  1.00 15.27 ? 167 MET B HG2  1 
ATOM   7033  H  HG3  . MET B  1 167 ? 49.221  106.166 15.191  1.00 15.27 ? 167 MET B HG3  1 
ATOM   7034  H  HE1  . MET B  1 167 ? 51.663  108.746 16.620  1.00 23.67 ? 167 MET B HE1  1 
ATOM   7035  H  HE2  . MET B  1 167 ? 50.653  107.616 17.039  1.00 23.67 ? 167 MET B HE2  1 
ATOM   7036  H  HE3  . MET B  1 167 ? 52.007  107.238 16.335  1.00 23.67 ? 167 MET B HE3  1 
ATOM   7037  N  N    . LYS B  1 168 ? 48.582  103.597 12.939  1.00 12.44 ? 168 LYS B N    1 
ATOM   7038  C  CA   . LYS B  1 168 ? 47.964  103.484 11.619  1.00 10.31 ? 168 LYS B CA   1 
ATOM   7039  C  C    . LYS B  1 168 ? 47.856  104.878 10.970  1.00 12.32 ? 168 LYS B C    1 
ATOM   7040  O  O    . LYS B  1 168 ? 46.970  105.669 11.293  1.00 11.12 ? 168 LYS B O    1 
ATOM   7041  C  CB   . LYS B  1 168 ? 46.586  102.847 11.728  1.00 16.93 ? 168 LYS B CB   1 
ATOM   7042  C  CG   . LYS B  1 168 ? 46.650  101.391 12.226  1.00 23.12 ? 168 LYS B CG   1 
ATOM   7043  C  CD   . LYS B  1 168 ? 45.281  100.833 12.582  1.00 26.94 ? 168 LYS B CD   1 
ATOM   7044  C  CE   . LYS B  1 168 ? 45.199  99.312  12.400  1.00 37.15 ? 168 LYS B CE   1 
ATOM   7045  N  NZ   . LYS B  1 168 ? 46.255  98.541  13.151  1.00 27.83 ? 168 LYS B NZ   1 
ATOM   7046  H  H    . LYS B  1 168 ? 48.024  103.583 13.594  1.00 14.93 ? 168 LYS B H    1 
ATOM   7047  H  HA   . LYS B  1 168 ? 48.522  102.917 11.046  1.00 12.37 ? 168 LYS B HA   1 
ATOM   7048  H  HB2  . LYS B  1 168 ? 46.050  103.356 12.355  1.00 20.31 ? 168 LYS B HB2  1 
ATOM   7049  H  HB3  . LYS B  1 168 ? 46.166  102.848 10.853  1.00 20.31 ? 168 LYS B HB3  1 
ATOM   7050  H  HG2  . LYS B  1 168 ? 47.029  100.834 11.528  1.00 27.74 ? 168 LYS B HG2  1 
ATOM   7051  H  HG3  . LYS B  1 168 ? 47.206  101.352 13.020  1.00 27.74 ? 168 LYS B HG3  1 
ATOM   7052  H  HD2  . LYS B  1 168 ? 45.088  101.036 13.511  1.00 32.32 ? 168 LYS B HD2  1 
ATOM   7053  H  HD3  . LYS B  1 168 ? 44.614  101.241 12.007  1.00 32.32 ? 168 LYS B HD3  1 
ATOM   7054  H  HE2  . LYS B  1 168 ? 44.333  99.007  12.714  1.00 44.58 ? 168 LYS B HE2  1 
ATOM   7055  H  HE3  . LYS B  1 168 ? 45.298  99.105  11.458  1.00 44.58 ? 168 LYS B HE3  1 
ATOM   7056  H  HZ1  . LYS B  1 168 ? 47.065  98.789  12.877  1.00 33.40 ? 168 LYS B HZ1  1 
ATOM   7057  H  HZ2  . LYS B  1 168 ? 46.184  98.700  14.024  1.00 33.40 ? 168 LYS B HZ2  1 
ATOM   7058  H  HZ3  . LYS B  1 168 ? 46.155  97.669  13.006  1.00 33.40 ? 168 LYS B HZ3  1 
ATOM   7059  N  N    . VAL B  1 169 ? 48.760  105.165 10.050  1.00 8.73  ? 169 VAL B N    1 
ATOM   7060  C  CA   . VAL B  1 169 ? 48.799  106.480 9.424   1.00 8.45  ? 169 VAL B CA   1 
ATOM   7061  C  C    . VAL B  1 169 ? 48.226  106.349 8.029   1.00 8.94  ? 169 VAL B C    1 
ATOM   7062  O  O    . VAL B  1 169 ? 48.719  105.545 7.212   1.00 9.09  ? 169 VAL B O    1 
ATOM   7063  C  CB   . VAL B  1 169 ? 50.230  107.027 9.351   1.00 8.16  ? 169 VAL B CB   1 
ATOM   7064  C  CG1  . VAL B  1 169 ? 50.233  108.411 8.663   1.00 8.53  ? 169 VAL B CG1  1 
ATOM   7065  C  CG2  . VAL B  1 169 ? 50.800  107.127 10.775  1.00 10.32 ? 169 VAL B CG2  1 
ATOM   7066  H  H    . VAL B  1 169 ? 49.363  104.620 9.769   1.00 10.47 ? 169 VAL B H    1 
ATOM   7067  H  HA   . VAL B  1 169 ? 48.246  107.108 9.935   1.00 10.14 ? 169 VAL B HA   1 
ATOM   7068  H  HB   . VAL B  1 169 ? 50.791  106.416 8.830   1.00 9.79  ? 169 VAL B HB   1 
ATOM   7069  H  HG11 . VAL B  1 169 ? 51.134  108.739 8.625   1.00 10.24 ? 169 VAL B HG11 1 
ATOM   7070  H  HG12 . VAL B  1 169 ? 49.880  108.319 7.775   1.00 10.24 ? 169 VAL B HG12 1 
ATOM   7071  H  HG13 . VAL B  1 169 ? 49.686  109.014 9.172   1.00 10.24 ? 169 VAL B HG13 1 
ATOM   7072  H  HG21 . VAL B  1 169 ? 51.696  107.469 10.729  1.00 12.39 ? 169 VAL B HG21 1 
ATOM   7073  H  HG22 . VAL B  1 169 ? 50.249  107.719 11.291  1.00 12.39 ? 169 VAL B HG22 1 
ATOM   7074  H  HG23 . VAL B  1 169 ? 50.804  106.253 11.171  1.00 12.39 ? 169 VAL B HG23 1 
ATOM   7075  N  N    . ARG B  1 170 ? 47.150  107.078 7.767   1.00 12.18 ? 170 ARG B N    1 
ATOM   7076  C  CA   . ARG B  1 170 ? 46.528  107.001 6.455   1.00 12.75 ? 170 ARG B CA   1 
ATOM   7077  C  C    . ARG B  1 170 ? 47.434  107.625 5.421   1.00 8.77  ? 170 ARG B C    1 
ATOM   7078  O  O    . ARG B  1 170 ? 48.109  108.624 5.691   1.00 8.53  ? 170 ARG B O    1 
ATOM   7079  C  CB   . ARG B  1 170 ? 45.161  107.674 6.435   1.00 13.80 ? 170 ARG B CB   1 
ATOM   7080  C  CG   . ARG B  1 170 ? 44.558  107.820 5.049   1.00 10.77 ? 170 ARG B CG   1 
ATOM   7081  C  CD   . ARG B  1 170 ? 44.969  109.079 4.346   1.00 8.81  ? 170 ARG B CD   1 
ATOM   7082  N  NE   . ARG B  1 170 ? 44.408  109.134 2.994   1.00 10.79 ? 170 ARG B NE   1 
ATOM   7083  C  CZ   . ARG B  1 170 ? 44.490  110.185 2.188   1.00 8.92  ? 170 ARG B CZ   1 
ATOM   7084  N  NH1  . ARG B  1 170 ? 45.136  111.279 2.559   1.00 8.62  ? 170 ARG B NH1  1 
ATOM   7085  N  NH2  . ARG B  1 170 ? 43.928  110.141 1.002   1.00 9.83  ? 170 ARG B NH2  1 
ATOM   7086  H  H    . ARG B  1 170 ? 46.767  107.613 8.320   1.00 14.62 ? 170 ARG B H    1 
ATOM   7087  H  HA   . ARG B  1 170 ? 46.403  106.059 6.218   1.00 15.30 ? 170 ARG B HA   1 
ATOM   7088  H  HB2  . ARG B  1 170 ? 44.547  107.146 6.969   1.00 16.56 ? 170 ARG B HB2  1 
ATOM   7089  H  HB3  . ARG B  1 170 ? 45.245  108.562 6.815   1.00 16.56 ? 170 ARG B HB3  1 
ATOM   7090  H  HG2  . ARG B  1 170 ? 44.840  107.069 4.504   1.00 12.92 ? 170 ARG B HG2  1 
ATOM   7091  H  HG3  . ARG B  1 170 ? 43.591  107.825 5.127   1.00 12.92 ? 170 ARG B HG3  1 
ATOM   7092  H  HD2  . ARG B  1 170 ? 44.644  109.846 4.843   1.00 10.57 ? 170 ARG B HD2  1 
ATOM   7093  H  HD3  . ARG B  1 170 ? 45.936  109.107 4.276   1.00 10.57 ? 170 ARG B HD3  1 
ATOM   7094  H  HE   . ARG B  1 170 ? 43.997  108.438 2.703   1.00 12.95 ? 170 ARG B HE   1 
ATOM   7095  H  HH11 . ARG B  1 170 ? 45.502  111.320 3.336   1.00 10.35 ? 170 ARG B HH11 1 
ATOM   7096  H  HH12 . ARG B  1 170 ? 45.186  111.951 2.024   1.00 10.35 ? 170 ARG B HH12 1 
ATOM   7097  H  HH21 . ARG B  1 170 ? 43.512  109.431 0.750   1.00 11.80 ? 170 ARG B HH21 1 
ATOM   7098  H  HH22 . ARG B  1 170 ? 43.989  110.814 0.471   1.00 11.80 ? 170 ARG B HH22 1 
ATOM   7099  N  N    . VAL B  1 171 ? 47.465  106.998 4.250   1.00 8.53  ? 171 VAL B N    1 
ATOM   7100  C  CA   . VAL B  1 171 ? 48.008  107.624 3.043   1.00 8.37  ? 171 VAL B CA   1 
ATOM   7101  C  C    . VAL B  1 171 ? 47.013  107.488 1.913   1.00 8.65  ? 171 VAL B C    1 
ATOM   7102  O  O    . VAL B  1 171 ? 46.116  106.668 1.956   1.00 12.06 ? 171 VAL B O    1 
ATOM   7103  C  CB   . VAL B  1 171 ? 49.385  107.027 2.597   1.00 9.62  ? 171 VAL B CB   1 
ATOM   7104  C  CG1  . VAL B  1 171 ? 50.450  107.293 3.654   1.00 9.49  ? 171 VAL B CG1  1 
ATOM   7105  C  CG2  . VAL B  1 171 ? 49.300  105.535 2.329   1.00 8.56  ? 171 VAL B CG2  1 
ATOM   7106  H  H    . VAL B  1 171 ? 47.175  106.198 4.125   1.00 10.23 ? 171 VAL B H    1 
ATOM   7107  H  HA   . VAL B  1 171 ? 48.137  108.580 3.215   1.00 10.05 ? 171 VAL B HA   1 
ATOM   7108  H  HB   . VAL B  1 171 ? 49.668  107.466 1.768   1.00 11.55 ? 171 VAL B HB   1 
ATOM   7109  H  HG11 . VAL B  1 171 ? 51.283  106.919 3.358   1.00 11.39 ? 171 VAL B HG11 1 
ATOM   7110  H  HG12 . VAL B  1 171 ? 50.541  108.242 3.773   1.00 11.39 ? 171 VAL B HG12 1 
ATOM   7111  H  HG13 . VAL B  1 171 ? 50.181  106.883 4.478   1.00 11.39 ? 171 VAL B HG13 1 
ATOM   7112  H  HG21 . VAL B  1 171 ? 50.164  105.216 2.061   1.00 10.27 ? 171 VAL B HG21 1 
ATOM   7113  H  HG22 . VAL B  1 171 ? 49.021  105.089 3.133   1.00 10.27 ? 171 VAL B HG22 1 
ATOM   7114  H  HG23 . VAL B  1 171 ? 48.661  105.380 1.630   1.00 10.27 ? 171 VAL B HG23 1 
ATOM   7115  N  N    . GLN B  1 172 ? 47.163  108.304 0.877   1.00 8.58  ? 172 GLN B N    1 
ATOM   7116  C  CA   . GLN B  1 172 ? 46.342  108.108 -0.310  1.00 8.90  ? 172 GLN B CA   1 
ATOM   7117  C  C    . GLN B  1 172 ? 46.862  106.876 -1.016  1.00 9.05  ? 172 GLN B C    1 
ATOM   7118  O  O    . GLN B  1 172 ? 47.836  106.268 -0.586  1.00 8.91  ? 172 GLN B O    1 
ATOM   7119  C  CB   . GLN B  1 172 ? 46.443  109.306 -1.244  1.00 8.82  ? 172 GLN B CB   1 
ATOM   7120  C  CG   . GLN B  1 172 ? 47.762  109.424 -1.934  1.00 8.60  ? 172 GLN B CG   1 
ATOM   7121  C  CD   . GLN B  1 172 ? 47.960  110.826 -2.444  1.00 8.73  ? 172 GLN B CD   1 
ATOM   7122  O  OE1  . GLN B  1 172 ? 47.772  111.124 -3.640  1.00 12.16 ? 172 GLN B OE1  1 
ATOM   7123  N  NE2  . GLN B  1 172 ? 48.318  111.709 -1.535  1.00 8.22  ? 172 GLN B NE2  1 
ATOM   7124  H  H    . GLN B  1 172 ? 47.717  108.961 0.834   1.00 10.29 ? 172 GLN B H    1 
ATOM   7125  H  HA   . GLN B  1 172 ? 45.405  107.968 -0.058  1.00 10.68 ? 172 GLN B HA   1 
ATOM   7126  H  HB2  . GLN B  1 172 ? 45.758  109.229 -1.926  1.00 10.58 ? 172 GLN B HB2  1 
ATOM   7127  H  HB3  . GLN B  1 172 ? 46.304  110.116 -0.729  1.00 10.58 ? 172 GLN B HB3  1 
ATOM   7128  H  HG2  . GLN B  1 172 ? 48.474  109.221 -1.308  1.00 10.32 ? 172 GLN B HG2  1 
ATOM   7129  H  HG3  . GLN B  1 172 ? 47.789  108.815 -2.688  1.00 10.32 ? 172 GLN B HG3  1 
ATOM   7130  H  HE21 . GLN B  1 172 ? 48.422  111.466 -0.716  1.00 9.86  ? 172 GLN B HE21 1 
ATOM   7131  H  HE22 . GLN B  1 172 ? 48.447  112.529 -1.760  1.00 9.86  ? 172 GLN B HE22 1 
ATOM   7132  N  N    . HIS B  1 173 ? 46.235  106.550 -2.135  1.00 9.40  ? 173 HIS B N    1 
ATOM   7133  C  CA   . HIS B  1 173 ? 46.710  105.470 -2.987  1.00 17.27 ? 173 HIS B CA   1 
ATOM   7134  C  C    . HIS B  1 173 ? 47.939  105.930 -3.755  1.00 16.66 ? 173 HIS B C    1 
ATOM   7135  O  O    . HIS B  1 173 ? 47.849  106.664 -4.744  1.00 19.20 ? 173 HIS B O    1 
ATOM   7136  C  CB   . HIS B  1 173 ? 45.549  104.984 -3.855  1.00 13.32 ? 173 HIS B CB   1 
ATOM   7137  C  CG   . HIS B  1 173 ? 44.494  104.269 -3.064  1.00 20.99 ? 173 HIS B CG   1 
ATOM   7138  N  ND1  . HIS B  1 173 ? 44.649  102.971 -2.611  1.00 25.44 ? 173 HIS B ND1  1 
ATOM   7139  C  CD2  . HIS B  1 173 ? 43.299  104.690 -2.584  1.00 29.48 ? 173 HIS B CD2  1 
ATOM   7140  C  CE1  . HIS B  1 173 ? 43.577  102.613 -1.932  1.00 29.15 ? 173 HIS B CE1  1 
ATOM   7141  N  NE2  . HIS B  1 173 ? 42.746  103.642 -1.893  1.00 29.01 ? 173 HIS B NE2  1 
ATOM   7142  H  H    . HIS B  1 173 ? 45.527  106.940 -2.426  1.00 11.28 ? 173 HIS B H    1 
ATOM   7143  H  HA   . HIS B  1 173 ? 46.983  104.721 -2.417  1.00 20.72 ? 173 HIS B HA   1 
ATOM   7144  H  HB2  . HIS B  1 173 ? 45.134  105.749 -4.285  1.00 15.98 ? 173 HIS B HB2  1 
ATOM   7145  H  HB3  . HIS B  1 173 ? 45.890  104.371 -4.524  1.00 15.98 ? 173 HIS B HB3  1 
ATOM   7146  H  HD1  . HIS B  1 173 ? 45.326  102.466 -2.773  1.00 30.53 ? 173 HIS B HD1  1 
ATOM   7147  H  HD2  . HIS B  1 173 ? 42.916  105.527 -2.715  1.00 35.38 ? 173 HIS B HD2  1 
ATOM   7148  H  HE1  . HIS B  1 173 ? 43.437  101.785 -1.533  1.00 34.98 ? 173 HIS B HE1  1 
ATOM   7149  H  HE2  . HIS B  1 173 ? 41.980  103.650 -1.502  1.00 34.81 ? 173 HIS B HE2  1 
ATOM   7150  N  N    . SER B  1 174 ? 49.098  105.574 -3.214  1.00 9.92  ? 174 SER B N    1 
ATOM   7151  C  CA   . SER B  1 174 ? 50.370  106.052 -3.725  1.00 13.39 ? 174 SER B CA   1 
ATOM   7152  C  C    . SER B  1 174 ? 51.486  105.220 -3.179  1.00 12.70 ? 174 SER B C    1 
ATOM   7153  O  O    . SER B  1 174 ? 51.688  105.144 -1.974  1.00 10.28 ? 174 SER B O    1 
ATOM   7154  C  CB   . SER B  1 174 ? 50.637  107.505 -3.328  1.00 10.73 ? 174 SER B CB   1 
ATOM   7155  O  OG   . SER B  1 174 ? 52.021  107.794 -3.507  1.00 9.51  ? 174 SER B OG   1 
ATOM   7156  H  H    . SER B  1 174 ? 49.173  105.048 -2.538  1.00 11.91 ? 174 SER B H    1 
ATOM   7157  H  HA   . SER B  1 174 ? 50.379  105.987 -4.703  1.00 16.07 ? 174 SER B HA   1 
ATOM   7158  H  HB2  . SER B  1 174 ? 50.111  108.094 -3.892  1.00 12.88 ? 174 SER B HB2  1 
ATOM   7159  H  HB3  . SER B  1 174 ? 50.401  107.632 -2.396  1.00 12.88 ? 174 SER B HB3  1 
ATOM   7160  H  HG   . SER B  1 174 ? 52.175  108.571 -3.296  1.00 11.42 ? 174 SER B HG   1 
ATOM   7161  N  N    . ARG B  1 175 ? 52.209  104.570 -4.066  1.00 11.26 ? 175 ARG B N    1 
ATOM   7162  C  CA   . ARG B  1 175 ? 53.320  103.752 -3.662  1.00 14.88 ? 175 ARG B CA   1 
ATOM   7163  C  C    . ARG B  1 175 ? 54.365  104.614 -2.982  1.00 12.07 ? 175 ARG B C    1 
ATOM   7164  O  O    . ARG B  1 175 ? 54.973  104.214 -2.003  1.00 8.73  ? 175 ARG B O    1 
ATOM   7165  C  CB   . ARG B  1 175 ? 53.917  103.081 -4.883  1.00 24.33 ? 175 ARG B CB   1 
ATOM   7166  C  CG   . ARG B  1 175 ? 55.125  102.300 -4.547  1.00 24.75 ? 175 ARG B CG   1 
ATOM   7167  C  CD   . ARG B  1 175 ? 55.031  100.931 -5.133  1.00 15.71 ? 175 ARG B CD   1 
ATOM   7168  N  NE   . ARG B  1 175 ? 56.383  100.458 -5.331  1.00 10.64 ? 175 ARG B NE   1 
ATOM   7169  C  CZ   . ARG B  1 175 ? 57.050  99.697  -4.477  1.00 7.85  ? 175 ARG B CZ   1 
ATOM   7170  N  NH1  . ARG B  1 175 ? 56.498  99.310  -3.313  1.00 11.60 ? 175 ARG B NH1  1 
ATOM   7171  N  NH2  . ARG B  1 175 ? 58.286  99.343  -4.781  1.00 11.65 ? 175 ARG B NH2  1 
ATOM   7172  H  H    . ARG B  1 175 ? 52.073  104.588 -4.915  1.00 13.52 ? 175 ARG B H    1 
ATOM   7173  H  HA   . ARG B  1 175 ? 53.018  103.063 -3.034  1.00 17.85 ? 175 ARG B HA   1 
ATOM   7174  H  HB2  . ARG B  1 175 ? 53.262  102.477 -5.266  1.00 29.20 ? 175 ARG B HB2  1 
ATOM   7175  H  HB3  . ARG B  1 175 ? 54.165  103.760 -5.530  1.00 29.20 ? 175 ARG B HB3  1 
ATOM   7176  H  HG2  . ARG B  1 175 ? 55.908  102.739 -4.915  1.00 29.70 ? 175 ARG B HG2  1 
ATOM   7177  H  HG3  . ARG B  1 175 ? 55.201  102.218 -3.584  1.00 29.70 ? 175 ARG B HG3  1 
ATOM   7178  H  HD2  . ARG B  1 175 ? 54.574  100.336 -4.518  1.00 18.85 ? 175 ARG B HD2  1 
ATOM   7179  H  HD3  . ARG B  1 175 ? 54.578  100.966 -5.990  1.00 18.85 ? 175 ARG B HD3  1 
ATOM   7180  H  HE   . ARG B  1 175 ? 56.784  100.687 -6.057  1.00 12.77 ? 175 ARG B HE   1 
ATOM   7181  H  HH11 . ARG B  1 175 ? 55.695  99.547  -3.118  1.00 13.92 ? 175 ARG B HH11 1 
ATOM   7182  H  HH12 . ARG B  1 175 ? 56.946  98.818  -2.767  1.00 13.92 ? 175 ARG B HH12 1 
ATOM   7183  H  HH21 . ARG B  1 175 ? 58.634  99.596  -5.526  1.00 13.98 ? 175 ARG B HH21 1 
ATOM   7184  H  HH22 . ARG B  1 175 ? 58.738  98.851  -4.241  1.00 13.98 ? 175 ARG B HH22 1 
ATOM   7185  N  N    . LEU B  1 176 ? 54.566  105.829 -3.486  1.00 6.45  ? 176 LEU B N    1 
ATOM   7186  C  CA   . LEU B  1 176 ? 55.584  106.674 -2.904  1.00 5.66  ? 176 LEU B CA   1 
ATOM   7187  C  C    . LEU B  1 176 ? 55.266  106.950 -1.398  1.00 5.54  ? 176 LEU B C    1 
ATOM   7188  O  O    . LEU B  1 176 ? 56.129  106.820 -0.533  1.00 7.57  ? 176 LEU B O    1 
ATOM   7189  C  CB   . LEU B  1 176 ? 55.648  108.014 -3.628  1.00 5.54  ? 176 LEU B CB   1 
ATOM   7190  C  CG   . LEU B  1 176 ? 56.684  108.955 -3.037  1.00 7.25  ? 176 LEU B CG   1 
ATOM   7191  C  CD1  . LEU B  1 176 ? 58.095  108.538 -3.316  1.00 6.83  ? 176 LEU B CD1  1 
ATOM   7192  C  CD2  . LEU B  1 176 ? 56.407  110.372 -3.567  1.00 20.85 ? 176 LEU B CD2  1 
ATOM   7193  H  H    . LEU B  1 176 ? 54.136  106.174 -4.146  1.00 7.74  ? 176 LEU B H    1 
ATOM   7194  H  HA   . LEU B  1 176 ? 56.458  106.236 -2.969  1.00 6.79  ? 176 LEU B HA   1 
ATOM   7195  H  HB2  . LEU B  1 176 ? 55.878  107.859 -4.557  1.00 6.65  ? 176 LEU B HB2  1 
ATOM   7196  H  HB3  . LEU B  1 176 ? 54.782  108.446 -3.568  1.00 6.65  ? 176 LEU B HB3  1 
ATOM   7197  H  HG   . LEU B  1 176 ? 56.570  108.975 -2.074  1.00 8.70  ? 176 LEU B HG   1 
ATOM   7198  H  HD11 . LEU B  1 176 ? 58.693  109.174 -2.916  1.00 8.20  ? 176 LEU B HD11 1 
ATOM   7199  H  HD12 . LEU B  1 176 ? 58.243  107.668 -2.940  1.00 8.20  ? 176 LEU B HD12 1 
ATOM   7200  H  HD13 . LEU B  1 176 ? 58.231  108.513 -4.266  1.00 8.20  ? 176 LEU B HD13 1 
ATOM   7201  H  HD21 . LEU B  1 176 ? 57.057  110.975 -3.199  1.00 25.03 ? 176 LEU B HD21 1 
ATOM   7202  H  HD22 . LEU B  1 176 ? 56.470  110.365 -4.524  1.00 25.03 ? 176 LEU B HD22 1 
ATOM   7203  H  HD23 . LEU B  1 176 ? 55.524  110.638 -3.298  1.00 25.03 ? 176 LEU B HD23 1 
ATOM   7204  N  N    . PHE B  1 177 ? 54.020  107.291 -1.120  1.00 5.58  ? 177 PHE B N    1 
ATOM   7205  C  CA   . PHE B  1 177 ? 53.675  107.679 0.250   1.00 5.72  ? 177 PHE B CA   1 
ATOM   7206  C  C    . PHE B  1 177 ? 53.505  106.481 1.146   1.00 5.64  ? 177 PHE B C    1 
ATOM   7207  O  O    . PHE B  1 177 ? 53.823  106.590 2.324   1.00 7.80  ? 177 PHE B O    1 
ATOM   7208  C  CB   . PHE B  1 177 ? 52.443  108.575 0.319   1.00 5.50  ? 177 PHE B CB   1 
ATOM   7209  C  CG   . PHE B  1 177 ? 52.681  109.981 -0.207  1.00 6.19  ? 177 PHE B CG   1 
ATOM   7210  C  CD1  . PHE B  1 177 ? 53.961  110.536 -0.209  1.00 10.95 ? 177 PHE B CD1  1 
ATOM   7211  C  CD2  . PHE B  1 177 ? 51.633  110.721 -0.691  1.00 9.60  ? 177 PHE B CD2  1 
ATOM   7212  C  CE1  . PHE B  1 177 ? 54.176  111.832 -0.668  1.00 13.30 ? 177 PHE B CE1  1 
ATOM   7213  C  CE2  . PHE B  1 177 ? 51.843  112.022 -1.185  1.00 10.92 ? 177 PHE B CE2  1 
ATOM   7214  C  CZ   . PHE B  1 177 ? 53.107  112.567 -1.159  1.00 9.79  ? 177 PHE B CZ   1 
ATOM   7215  H  H    . PHE B  1 177 ? 53.369  107.308 -1.681  1.00 6.69  ? 177 PHE B H    1 
ATOM   7216  H  HA   . PHE B  1 177 ? 54.423  108.199 0.611   1.00 6.86  ? 177 PHE B HA   1 
ATOM   7217  H  HB2  . PHE B  1 177 ? 51.736  108.175 -0.212  1.00 6.60  ? 177 PHE B HB2  1 
ATOM   7218  H  HB3  . PHE B  1 177 ? 52.160  108.647 1.244   1.00 6.60  ? 177 PHE B HB3  1 
ATOM   7219  H  HD1  . PHE B  1 177 ? 54.675  110.044 0.128   1.00 13.13 ? 177 PHE B HD1  1 
ATOM   7220  H  HD2  . PHE B  1 177 ? 50.778  110.357 -0.702  1.00 11.52 ? 177 PHE B HD2  1 
ATOM   7221  H  HE1  . PHE B  1 177 ? 55.033  112.194 -0.666  1.00 15.96 ? 177 PHE B HE1  1 
ATOM   7222  H  HE2  . PHE B  1 177 ? 51.126  112.521 -1.506  1.00 13.10 ? 177 PHE B HE2  1 
ATOM   7223  H  HZ   . PHE B  1 177 ? 53.247  113.427 -1.482  1.00 11.75 ? 177 PHE B HZ   1 
ATOM   7224  N  N    . LEU B  1 178 ? 52.987  105.373 0.627   1.00 5.88  ? 178 LEU B N    1 
ATOM   7225  C  CA   . LEU B  1 178 ? 52.940  104.136 1.419   1.00 6.08  ? 178 LEU B CA   1 
ATOM   7226  C  C    . LEU B  1 178 ? 54.348  103.816 1.922   1.00 5.98  ? 178 LEU B C    1 
ATOM   7227  O  O    . LEU B  1 178 ? 54.559  103.593 3.132   1.00 7.68  ? 178 LEU B O    1 
ATOM   7228  C  CB   . LEU B  1 178 ? 52.387  102.983 0.574   1.00 8.24  ? 178 LEU B CB   1 
ATOM   7229  C  CG   . LEU B  1 178 ? 52.121  101.648 1.297   1.00 14.45 ? 178 LEU B CG   1 
ATOM   7230  C  CD1  . LEU B  1 178 ? 51.283  100.730 0.412   1.00 23.05 ? 178 LEU B CD1  1 
ATOM   7231  C  CD2  . LEU B  1 178 ? 53.410  100.933 1.689   1.00 24.11 ? 178 LEU B CD2  1 
ATOM   7232  H  H    . LEU B  1 178 ? 52.660  105.305 -0.166  1.00 7.06  ? 178 LEU B H    1 
ATOM   7233  H  HA   . LEU B  1 178 ? 52.353  104.263 2.193   1.00 7.30  ? 178 LEU B HA   1 
ATOM   7234  H  HB2  . LEU B  1 178 ? 51.546  103.270 0.185   1.00 9.89  ? 178 LEU B HB2  1 
ATOM   7235  H  HB3  . LEU B  1 178 ? 53.021  102.800 -0.138  1.00 9.89  ? 178 LEU B HB3  1 
ATOM   7236  H  HG   . LEU B  1 178 ? 51.617  101.824 2.108   1.00 17.34 ? 178 LEU B HG   1 
ATOM   7237  H  HD11 . LEU B  1 178 ? 51.127  99.905  0.878   1.00 27.66 ? 178 LEU B HD11 1 
ATOM   7238  H  HD12 . LEU B  1 178 ? 50.447  101.160 0.219   1.00 27.66 ? 178 LEU B HD12 1 
ATOM   7239  H  HD13 . LEU B  1 178 ? 51.761  100.561 -0.403  1.00 27.66 ? 178 LEU B HD13 1 
ATOM   7240  H  HD21 . LEU B  1 178 ? 53.189  100.111 2.134   1.00 28.93 ? 178 LEU B HD21 1 
ATOM   7241  H  HD22 . LEU B  1 178 ? 53.919  100.749 0.895   1.00 28.93 ? 178 LEU B HD22 1 
ATOM   7242  H  HD23 . LEU B  1 178 ? 53.915  101.499 2.278   1.00 28.93 ? 178 LEU B HD23 1 
ATOM   7243  N  N    . GLN B  1 179 ? 55.303  103.759 1.003   1.00 5.93  ? 179 GLN B N    1 
ATOM   7244  C  CA   . GLN B  1 179 ? 56.685  103.418 1.338   1.00 5.89  ? 179 GLN B CA   1 
ATOM   7245  C  C    . GLN B  1 179 ? 57.364  104.456 2.224   1.00 5.65  ? 179 GLN B C    1 
ATOM   7246  O  O    . GLN B  1 179 ? 58.191  104.093 3.065   1.00 5.67  ? 179 GLN B O    1 
ATOM   7247  C  CB   . GLN B  1 179 ? 57.517  103.195 0.067   1.00 8.89  ? 179 GLN B CB   1 
ATOM   7248  C  CG   . GLN B  1 179 ? 57.139  101.933 -0.720  1.00 10.16 ? 179 GLN B CG   1 
ATOM   7249  C  CD   . GLN B  1 179 ? 57.087  100.688 0.143   1.00 21.28 ? 179 GLN B CD   1 
ATOM   7250  O  OE1  . GLN B  1 179 ? 58.018  100.383 0.883   1.00 18.49 ? 179 GLN B OE1  1 
ATOM   7251  N  NE2  . GLN B  1 179 ? 55.986  99.955  0.044   1.00 34.04 ? 179 GLN B NE2  1 
ATOM   7252  H  H    . GLN B  1 179 ? 55.177  103.916 0.167   1.00 7.12  ? 179 GLN B H    1 
ATOM   7253  H  HA   . GLN B  1 179 ? 56.680  102.572 1.834   1.00 7.07  ? 179 GLN B HA   1 
ATOM   7254  H  HB2  . GLN B  1 179 ? 57.397  103.957 -0.521  1.00 10.66 ? 179 GLN B HB2  1 
ATOM   7255  H  HB3  . GLN B  1 179 ? 58.452  103.119 0.316   1.00 10.66 ? 179 GLN B HB3  1 
ATOM   7256  H  HG2  . GLN B  1 179 ? 56.262  102.059 -1.116  1.00 12.19 ? 179 GLN B HG2  1 
ATOM   7257  H  HG3  . GLN B  1 179 ? 57.798  101.787 -1.417  1.00 12.19 ? 179 GLN B HG3  1 
ATOM   7258  H  HE21 . GLN B  1 179 ? 55.354  100.196 -0.487  1.00 40.85 ? 179 GLN B HE21 1 
ATOM   7259  H  HE22 . GLN B  1 179 ? 55.904  99.237  0.511   1.00 40.85 ? 179 GLN B HE22 1 
ATOM   7260  N  N    . THR B  1 180 ? 57.068  105.742 2.008   1.00 7.60  ? 180 THR B N    1 
ATOM   7261  C  CA   . THR B  1 180 ? 57.628  106.770 2.856   1.00 7.64  ? 180 THR B CA   1 
ATOM   7262  C  C    . THR B  1 180 ? 57.172  106.601 4.300   1.00 7.51  ? 180 THR B C    1 
ATOM   7263  O  O    . THR B  1 180 ? 58.002  106.655 5.202   1.00 7.41  ? 180 THR B O    1 
ATOM   7264  C  CB   . THR B  1 180 ? 57.292  108.175 2.370   1.00 8.48  ? 180 THR B CB   1 
ATOM   7265  O  OG1  . THR B  1 180 ? 57.822  108.349 1.059   1.00 9.06  ? 180 THR B OG1  1 
ATOM   7266  C  CG2  . THR B  1 180 ? 57.899  109.214 3.267   1.00 6.67  ? 180 THR B CG2  1 
ATOM   7267  H  H    . THR B  1 180 ? 56.552  106.032 1.384   1.00 9.11  ? 180 THR B H    1 
ATOM   7268  H  HA   . THR B  1 180 ? 58.604  106.682 2.844   1.00 9.17  ? 180 THR B HA   1 
ATOM   7269  H  HB   . THR B  1 180 ? 56.329  108.298 2.355   1.00 10.17 ? 180 THR B HB   1 
ATOM   7270  H  HG1  . THR B  1 180 ? 57.494  107.797 0.548   1.00 10.87 ? 180 THR B HG1  1 
ATOM   7271  H  HG21 . THR B  1 180 ? 57.679  110.092 2.948   1.00 8.01  ? 180 THR B HG21 1 
ATOM   7272  H  HG22 . THR B  1 180 ? 57.563  109.113 4.160   1.00 8.01  ? 180 THR B HG22 1 
ATOM   7273  H  HG23 . THR B  1 180 ? 58.855  109.117 3.280   1.00 8.01  ? 180 THR B HG23 1 
ATOM   7274  N  N    . ILE B  1 181 ? 55.868  106.403 4.508   1.00 6.04  ? 181 ILE B N    1 
ATOM   7275  C  CA   . ILE B  1 181 ? 55.318  106.269 5.843   1.00 6.36  ? 181 ILE B CA   1 
ATOM   7276  C  C    . ILE B  1 181 ? 55.830  105.017 6.503   1.00 14.61 ? 181 ILE B C    1 
ATOM   7277  O  O    . ILE B  1 181 ? 56.101  105.001 7.714   1.00 11.71 ? 181 ILE B O    1 
ATOM   7278  C  CB   . ILE B  1 181 ? 53.766  106.318 5.834   1.00 9.40  ? 181 ILE B CB   1 
ATOM   7279  C  CG1  . ILE B  1 181 ? 53.279  107.744 5.536   1.00 10.62 ? 181 ILE B CG1  1 
ATOM   7280  C  CG2  . ILE B  1 181 ? 53.183  105.837 7.197   1.00 11.87 ? 181 ILE B CG2  1 
ATOM   7281  C  CD1  . ILE B  1 181 ? 53.740  108.791 6.497   1.00 17.69 ? 181 ILE B CD1  1 
ATOM   7282  H  H    . ILE B  1 181 ? 55.282  106.344 3.881   1.00 7.25  ? 181 ILE B H    1 
ATOM   7283  H  HA   . ILE B  1 181 ? 55.629  107.028 6.380   1.00 7.63  ? 181 ILE B HA   1 
ATOM   7284  H  HB   . ILE B  1 181 ? 53.442  105.729 5.135   1.00 11.28 ? 181 ILE B HB   1 
ATOM   7285  H  HG12 . ILE B  1 181 ? 53.594  107.999 4.655   1.00 12.75 ? 181 ILE B HG12 1 
ATOM   7286  H  HG13 . ILE B  1 181 ? 52.309  107.746 5.547   1.00 12.75 ? 181 ILE B HG13 1 
ATOM   7287  H  HG21 . ILE B  1 181 ? 52.225  105.880 7.159   1.00 14.25 ? 181 ILE B HG21 1 
ATOM   7288  H  HG22 . ILE B  1 181 ? 53.465  104.933 7.355   1.00 14.25 ? 181 ILE B HG22 1 
ATOM   7289  H  HG23 . ILE B  1 181 ? 53.509  106.409 7.895   1.00 14.25 ? 181 ILE B HG23 1 
ATOM   7290  H  HD11 . ILE B  1 181 ? 53.386  109.641 6.226   1.00 21.23 ? 181 ILE B HD11 1 
ATOM   7291  H  HD12 . ILE B  1 181 ? 53.425  108.569 7.376   1.00 21.23 ? 181 ILE B HD12 1 
ATOM   7292  H  HD13 . ILE B  1 181 ? 54.700  108.820 6.490   1.00 21.23 ? 181 ILE B HD13 1 
ATOM   7293  N  N    . ASN B  1 182 ? 55.995  103.968 5.706   1.00 5.80  ? 182 ASN B N    1 
ATOM   7294  C  CA   . ASN B  1 182 ? 56.528  102.746 6.241   1.00 6.99  ? 182 ASN B CA   1 
ATOM   7295  C  C    . ASN B  1 182 ? 57.966  102.962 6.719   1.00 15.78 ? 182 ASN B C    1 
ATOM   7296  O  O    . ASN B  1 182 ? 58.371  102.492 7.780   1.00 8.10  ? 182 ASN B O    1 
ATOM   7297  C  CB   . ASN B  1 182 ? 56.472  101.626 5.219   1.00 7.55  ? 182 ASN B CB   1 
ATOM   7298  C  CG   . ASN B  1 182 ? 56.897  100.331 5.813   1.00 19.27 ? 182 ASN B CG   1 
ATOM   7299  O  OD1  . ASN B  1 182 ? 56.195  99.784  6.662   1.00 23.90 ? 182 ASN B OD1  1 
ATOM   7300  N  ND2  . ASN B  1 182 ? 58.082  99.883  5.466   1.00 15.35 ? 182 ASN B ND2  1 
ATOM   7301  H  H    . ASN B  1 182 ? 55.807  103.946 4.867   1.00 6.96  ? 182 ASN B H    1 
ATOM   7302  H  HA   . ASN B  1 182 ? 55.990  102.476 7.014   1.00 8.39  ? 182 ASN B HA   1 
ATOM   7303  H  HB2  . ASN B  1 182 ? 55.562  101.529 4.898   1.00 9.06  ? 182 ASN B HB2  1 
ATOM   7304  H  HB3  . ASN B  1 182 ? 57.069  101.833 4.483   1.00 9.06  ? 182 ASN B HB3  1 
ATOM   7305  H  HD21 . ASN B  1 182 ? 58.570  100.335 4.921   1.00 18.42 ? 182 ASN B HD21 1 
ATOM   7306  H  HD22 . ASN B  1 182 ? 58.370  99.138  5.785   1.00 18.42 ? 182 ASN B HD22 1 
ATOM   7307  N  N    . ALA B  1 183 ? 58.733  103.714 5.946   1.00 7.42  ? 183 ALA B N    1 
ATOM   7308  C  CA   . ALA B  1 183 ? 60.126  103.954 6.289   1.00 8.72  ? 183 ALA B CA   1 
ATOM   7309  C  C    . ALA B  1 183 ? 60.271  104.836 7.553   1.00 6.59  ? 183 ALA B C    1 
ATOM   7310  O  O    . ALA B  1 183 ? 61.178  104.627 8.374   1.00 12.26 ? 183 ALA B O    1 
ATOM   7311  C  CB   . ALA B  1 183 ? 60.823  104.587 5.146   1.00 13.19 ? 183 ALA B CB   1 
ATOM   7312  H  H    . ALA B  1 183 ? 58.474  104.095 5.220   1.00 8.90  ? 183 ALA B H    1 
ATOM   7313  H  HA   . ALA B  1 183 ? 60.561  103.095 6.470   1.00 10.46 ? 183 ALA B HA   1 
ATOM   7314  H  HB1  . ALA B  1 183 ? 61.740  104.739 5.386   1.00 15.82 ? 183 ALA B HB1  1 
ATOM   7315  H  HB2  . ALA B  1 183 ? 60.776  103.999 4.388   1.00 15.82 ? 183 ALA B HB2  1 
ATOM   7316  H  HB3  . ALA B  1 183 ? 60.394  105.421 4.942   1.00 15.82 ? 183 ALA B HB3  1 
ATOM   7317  N  N    . MET B  1 184 ? 59.397  105.819 7.668   1.00 7.58  ? 184 MET B N    1 
ATOM   7318  C  CA   . MET B  1 184 ? 59.394  106.762 8.799   1.00 9.41  ? 184 MET B CA   1 
ATOM   7319  C  C    . MET B  1 184 ? 59.039  106.062 10.094  1.00 18.62 ? 184 MET B C    1 
ATOM   7320  O  O    . MET B  1 184 ? 59.354  106.561 11.162  1.00 16.51 ? 184 MET B O    1 
ATOM   7321  C  CB   . MET B  1 184 ? 58.394  107.878 8.561   1.00 10.63 ? 184 MET B CB   1 
ATOM   7322  C  CG   . MET B  1 184 ? 58.888  108.941 7.585   1.00 12.63 ? 184 MET B CG   1 
ATOM   7323  S  SD   . MET B  1 184 ? 57.700  110.177 7.031   1.00 19.40 ? 184 MET B SD   1 
ATOM   7324  C  CE   . MET B  1 184 ? 57.519  111.257 8.457   1.00 26.57 ? 184 MET B CE   1 
ATOM   7325  H  H    . MET B  1 184 ? 58.775  105.974 7.094   1.00 9.09  ? 184 MET B H    1 
ATOM   7326  H  HA   . MET B  1 184 ? 60.284  107.162 8.884   1.00 11.29 ? 184 MET B HA   1 
ATOM   7327  H  HB2  . MET B  1 184 ? 57.579  107.497 8.198   1.00 12.76 ? 184 MET B HB2  1 
ATOM   7328  H  HB3  . MET B  1 184 ? 58.206  108.316 9.406   1.00 12.76 ? 184 MET B HB3  1 
ATOM   7329  H  HG2  . MET B  1 184 ? 59.619  109.419 8.007   1.00 15.15 ? 184 MET B HG2  1 
ATOM   7330  H  HG3  . MET B  1 184 ? 59.219  108.490 6.792   1.00 15.15 ? 184 MET B HG3  1 
ATOM   7331  H  HE1  . MET B  1 184 ? 56.893  111.953 8.244   1.00 31.88 ? 184 MET B HE1  1 
ATOM   7332  H  HE2  . MET B  1 184 ? 57.194  110.741 9.199   1.00 31.88 ? 184 MET B HE2  1 
ATOM   7333  H  HE3  . MET B  1 184 ? 58.373  111.638 8.671   1.00 31.88 ? 184 MET B HE3  1 
ATOM   7334  N  N    . GLY B  1 185 ? 58.369  104.921 9.991   1.00 13.16 ? 185 GLY B N    1 
ATOM   7335  C  CA   . GLY B  1 185 ? 58.154  104.087 11.152  1.00 11.90 ? 185 GLY B CA   1 
ATOM   7336  C  C    . GLY B  1 185 ? 56.711  103.773 11.480  1.00 8.77  ? 185 GLY B C    1 
ATOM   7337  O  O    . GLY B  1 185 ? 56.433  103.145 12.511  1.00 10.04 ? 185 GLY B O    1 
ATOM   7338  H  H    . GLY B  1 185 ? 58.032  104.612 9.263   1.00 15.79 ? 185 GLY B H    1 
ATOM   7339  H  HA2  . GLY B  1 185 ? 58.617  103.245 11.021  1.00 14.27 ? 185 GLY B HA2  1 
ATOM   7340  H  HA3  . GLY B  1 185 ? 58.545  104.523 11.925  1.00 14.27 ? 185 GLY B HA3  1 
ATOM   7341  N  N    . GLY B  1 186 ? 55.803  104.164 10.600  1.00 6.59  ? 186 GLY B N    1 
ATOM   7342  C  CA   . GLY B  1 186 ? 54.390  103.930 10.802  1.00 6.50  ? 186 GLY B CA   1 
ATOM   7343  C  C    . GLY B  1 186 ? 53.854  102.736 10.025  1.00 7.96  ? 186 GLY B C    1 
ATOM   7344  O  O    . GLY B  1 186 ? 54.569  102.037 9.322   1.00 10.10 ? 186 GLY B O    1 
ATOM   7345  H  H    . GLY B  1 186 ? 55.987  104.573 9.866   1.00 7.90  ? 186 GLY B H    1 
ATOM   7346  H  HA2  . GLY B  1 186 ? 54.223  103.777 11.746  1.00 7.80  ? 186 GLY B HA2  1 
ATOM   7347  H  HA3  . GLY B  1 186 ? 53.894  104.717 10.529  1.00 7.80  ? 186 GLY B HA3  1 
ATOM   7348  N  N    . VAL B  1 187 ? 52.565  102.512 10.193  1.00 10.62 ? 187 VAL B N    1 
ATOM   7349  C  CA   . VAL B  1 187 ? 51.827  101.490 9.497   1.00 8.27  ? 187 VAL B CA   1 
ATOM   7350  C  C    . VAL B  1 187 ? 50.918  102.171 8.504   1.00 9.85  ? 187 VAL B C    1 
ATOM   7351  O  O    . VAL B  1 187 ? 49.835  102.612 8.839   1.00 7.37  ? 187 VAL B O    1 
ATOM   7352  C  CB   . VAL B  1 187 ? 50.983  100.655 10.507  1.00 12.39 ? 187 VAL B CB   1 
ATOM   7353  C  CG1  . VAL B  1 187 ? 50.182  99.589  9.803   1.00 12.89 ? 187 VAL B CG1  1 
ATOM   7354  C  CG2  . VAL B  1 187 ? 51.906  100.015 11.559  1.00 15.11 ? 187 VAL B CG2  1 
ATOM   7355  H  H    . VAL B  1 187 ? 52.076  102.967 10.735  1.00 12.75 ? 187 VAL B H    1 
ATOM   7356  H  HA   . VAL B  1 187 ? 52.441  100.895 9.018   1.00 9.92  ? 187 VAL B HA   1 
ATOM   7357  H  HB   . VAL B  1 187 ? 50.358  101.250 10.971  1.00 14.87 ? 187 VAL B HB   1 
ATOM   7358  H  HG11 . VAL B  1 187 ? 49.677  99.097  10.454  1.00 15.47 ? 187 VAL B HG11 1 
ATOM   7359  H  HG12 . VAL B  1 187 ? 49.588  100.008 9.176   1.00 15.47 ? 187 VAL B HG12 1 
ATOM   7360  H  HG13 . VAL B  1 187 ? 50.783  99.000  9.341   1.00 15.47 ? 187 VAL B HG13 1 
ATOM   7361  H  HG21 . VAL B  1 187 ? 51.373  99.505  12.172  1.00 18.13 ? 187 VAL B HG21 1 
ATOM   7362  H  HG22 . VAL B  1 187 ? 52.535  99.441  11.114  1.00 18.13 ? 187 VAL B HG22 1 
ATOM   7363  H  HG23 . VAL B  1 187 ? 52.373  100.710 12.029  1.00 18.13 ? 187 VAL B HG23 1 
ATOM   7364  N  N    . PRO B  1 188 ? 51.372  102.278 7.249   1.00 11.17 ? 188 PRO B N    1 
ATOM   7365  C  CA   . PRO B  1 188 ? 50.607  103.068 6.279   1.00 6.58  ? 188 PRO B CA   1 
ATOM   7366  C  C    . PRO B  1 188 ? 49.315  102.348 5.953   1.00 8.36  ? 188 PRO B C    1 
ATOM   7367  O  O    . PRO B  1 188 ? 49.312  101.106 5.777   1.00 8.63  ? 188 PRO B O    1 
ATOM   7368  C  CB   . PRO B  1 188 ? 51.522  103.090 5.049   1.00 8.42  ? 188 PRO B CB   1 
ATOM   7369  C  CG   . PRO B  1 188 ? 52.352  101.854 5.159   1.00 11.94 ? 188 PRO B CG   1 
ATOM   7370  C  CD   . PRO B  1 188 ? 52.547  101.625 6.652   1.00 11.74 ? 188 PRO B CD   1 
ATOM   7371  H  HA   . PRO B  1 188 ? 50.432  103.977 6.603   1.00 7.90  ? 188 PRO B HA   1 
ATOM   7372  H  HB2  . PRO B  1 188 ? 50.984  103.072 4.241   1.00 10.10 ? 188 PRO B HB2  1 
ATOM   7373  H  HB3  . PRO B  1 188 ? 52.081  103.882 5.071   1.00 10.10 ? 188 PRO B HB3  1 
ATOM   7374  H  HG2  . PRO B  1 188 ? 51.879  101.107 4.758   1.00 14.33 ? 188 PRO B HG2  1 
ATOM   7375  H  HG3  . PRO B  1 188 ? 53.205  101.994 4.720   1.00 14.33 ? 188 PRO B HG3  1 
ATOM   7376  H  HD2  . PRO B  1 188 ? 52.546  100.676 6.853   1.00 14.09 ? 188 PRO B HD2  1 
ATOM   7377  H  HD3  . PRO B  1 188 ? 53.363  102.052 6.956   1.00 14.09 ? 188 PRO B HD3  1 
ATOM   7378  N  N    . THR B  1 189 ? 48.240  103.110 5.870   1.00 6.98  ? 189 THR B N    1 
ATOM   7379  C  CA   . THR B  1 189 ? 46.906  102.581 5.599   1.00 8.26  ? 189 THR B CA   1 
ATOM   7380  C  C    . THR B  1 189 ? 46.292  103.353 4.416   1.00 11.10 ? 189 THR B C    1 
ATOM   7381  O  O    . THR B  1 189 ? 45.830  104.472 4.559   1.00 11.35 ? 189 THR B O    1 
ATOM   7382  C  CB   . THR B  1 189 ? 46.041  102.714 6.860   1.00 16.75 ? 189 THR B CB   1 
ATOM   7383  O  OG1  . THR B  1 189 ? 46.797  102.232 7.980   1.00 18.08 ? 189 THR B OG1  1 
ATOM   7384  C  CG2  . THR B  1 189 ? 44.761  101.940 6.716   1.00 21.53 ? 189 THR B CG2  1 
ATOM   7385  H  H    . THR B  1 189 ? 48.253  103.964 5.969   1.00 8.38  ? 189 THR B H    1 
ATOM   7386  H  HA   . THR B  1 189 ? 46.969  101.633 5.358   1.00 9.92  ? 189 THR B HA   1 
ATOM   7387  H  HB   . THR B  1 189 ? 45.819  103.647 7.001   1.00 20.10 ? 189 THR B HB   1 
ATOM   7388  H  HG1  . THR B  1 189 ? 46.999  101.446 7.865   1.00 21.69 ? 189 THR B HG1  1 
ATOM   7389  H  HG21 . THR B  1 189 ? 44.231  102.032 7.511   1.00 25.84 ? 189 THR B HG21 1 
ATOM   7390  H  HG22 . THR B  1 189 ? 44.261  102.272 5.967   1.00 25.84 ? 189 THR B HG22 1 
ATOM   7391  H  HG23 . THR B  1 189 ? 44.954  101.011 6.575   1.00 25.84 ? 189 THR B HG23 1 
ATOM   7392  N  N    . PRO B  1 190 ? 46.304  102.755 3.220   1.00 9.92  ? 190 PRO B N    1 
ATOM   7393  C  CA   . PRO B  1 190 ? 45.815  103.497 2.046   1.00 10.10 ? 190 PRO B CA   1 
ATOM   7394  C  C    . PRO B  1 190 ? 44.295  103.684 2.076   1.00 12.66 ? 190 PRO B C    1 
ATOM   7395  O  O    . PRO B  1 190 ? 43.537  102.760 2.368   1.00 14.63 ? 190 PRO B O    1 
ATOM   7396  C  CB   . PRO B  1 190 ? 46.217  102.605 0.863   1.00 12.82 ? 190 PRO B CB   1 
ATOM   7397  C  CG   . PRO B  1 190 ? 47.292  101.688 1.404   1.00 14.21 ? 190 PRO B CG   1 
ATOM   7398  C  CD   . PRO B  1 190 ? 46.931  101.473 2.855   1.00 12.20 ? 190 PRO B CD   1 
ATOM   7399  H  HA   . PRO B  1 190 ? 46.258  104.368 1.972   1.00 12.12 ? 190 PRO B HA   1 
ATOM   7400  H  HB2  . PRO B  1 190 ? 45.449  102.094 0.563   1.00 15.39 ? 190 PRO B HB2  1 
ATOM   7401  H  HB3  . PRO B  1 190 ? 46.565  103.155 0.143   1.00 15.39 ? 190 PRO B HB3  1 
ATOM   7402  H  HG2  . PRO B  1 190 ? 47.280  100.848 0.920   1.00 17.05 ? 190 PRO B HG2  1 
ATOM   7403  H  HG3  . PRO B  1 190 ? 48.158  102.117 1.326   1.00 17.05 ? 190 PRO B HG3  1 
ATOM   7404  H  HD2  . PRO B  1 190 ? 46.296  100.745 2.945   1.00 14.64 ? 190 PRO B HD2  1 
ATOM   7405  H  HD3  . PRO B  1 190 ? 47.729  101.321 3.386   1.00 14.64 ? 190 PRO B HD3  1 
ATOM   7406  N  N    . MET B  1 191 ? 43.853  104.898 1.787   1.00 8.15  ? 191 MET B N    1 
ATOM   7407  C  CA   . MET B  1 191 ? 42.450  105.231 1.905   1.00 8.78  ? 191 MET B CA   1 
ATOM   7408  C  C    . MET B  1 191 ? 42.175  106.495 1.132   1.00 14.52 ? 191 MET B C    1 
ATOM   7409  O  O    . MET B  1 191 ? 42.993  107.403 1.167   1.00 11.68 ? 191 MET B O    1 
ATOM   7410  C  CB   . MET B  1 191 ? 42.152  105.466 3.399   1.00 11.09 ? 191 MET B CB   1 
ATOM   7411  C  CG   . MET B  1 191 ? 40.769  105.938 3.717   1.00 23.33 ? 191 MET B CG   1 
ATOM   7412  S  SD   . MET B  1 191 ? 40.489  106.059 5.499   1.00 18.78 ? 191 MET B SD   1 
ATOM   7413  C  CE   . MET B  1 191 ? 41.487  104.744 6.081   1.00 15.22 ? 191 MET B CE   1 
ATOM   7414  H  H    . MET B  1 191 ? 44.350  105.548 1.520   1.00 9.79  ? 191 MET B H    1 
ATOM   7415  H  HA   . MET B  1 191 ? 41.893  104.496 1.571   1.00 10.54 ? 191 MET B HA   1 
ATOM   7416  H  HB2  . MET B  1 191 ? 42.290  104.631 3.874   1.00 13.30 ? 191 MET B HB2  1 
ATOM   7417  H  HB3  . MET B  1 191 ? 42.771  106.134 3.733   1.00 13.30 ? 191 MET B HB3  1 
ATOM   7418  H  HG2  . MET B  1 191 ? 40.636  106.818 3.330   1.00 28.00 ? 191 MET B HG2  1 
ATOM   7419  H  HG3  . MET B  1 191 ? 40.126  105.311 3.351   1.00 28.00 ? 191 MET B HG3  1 
ATOM   7420  H  HE1  . MET B  1 191 ? 41.422  104.702 7.038   1.00 18.27 ? 191 MET B HE1  1 
ATOM   7421  H  HE2  . MET B  1 191 ? 41.177  103.921 5.696   1.00 18.27 ? 191 MET B HE2  1 
ATOM   7422  H  HE3  . MET B  1 191 ? 42.398  104.904 5.821   1.00 18.27 ? 191 MET B HE3  1 
ATOM   7423  N  N    . SER B  1 192 ? 41.028  106.565 0.457   1.00 12.46 ? 192 SER B N    1 
ATOM   7424  C  CA   . SER B  1 192 ? 40.634  107.758 -0.267  1.00 10.63 ? 192 SER B CA   1 
ATOM   7425  C  C    . SER B  1 192 ? 40.382  108.929 0.673   1.00 12.59 ? 192 SER B C    1 
ATOM   7426  O  O    . SER B  1 192 ? 39.944  108.759 1.816   1.00 9.74  ? 192 SER B O    1 
ATOM   7427  C  CB   . SER B  1 192 ? 39.375  107.491 -1.084  1.00 10.36 ? 192 SER B CB   1 
ATOM   7428  O  OG   . SER B  1 192 ? 39.695  106.629 -2.190  1.00 18.80 ? 192 SER B OG   1 
ATOM   7429  H  H    . SER B  1 192 ? 40.458  105.924 0.407   1.00 14.95 ? 192 SER B H    1 
ATOM   7430  H  HA   . SER B  1 192 ? 41.351  108.010 -0.885  1.00 12.76 ? 192 SER B HA   1 
ATOM   7431  H  HB2  . SER B  1 192 ? 38.714  107.058 -0.521  1.00 12.43 ? 192 SER B HB2  1 
ATOM   7432  H  HB3  . SER B  1 192 ? 39.029  108.331 -1.422  1.00 12.43 ? 192 SER B HB3  1 
ATOM   7433  H  HG   . SER B  1 192 ? 40.493  106.441 -2.177  1.00 22.56 ? 192 SER B HG   1 
ATOM   7434  N  N    . LEU B  1 193 ? 40.620  110.129 0.167   1.00 9.88  ? 193 LEU B N    1 
ATOM   7435  C  CA   . LEU B  1 193 ? 40.537  111.329 0.997   1.00 11.53 ? 193 LEU B CA   1 
ATOM   7436  C  C    . LEU B  1 193 ? 39.175  111.516 1.683   1.00 10.38 ? 193 LEU B C    1 
ATOM   7437  O  O    . LEU B  1 193 ? 39.093  111.873 2.872   1.00 9.54  ? 193 LEU B O    1 
ATOM   7438  C  CB   . LEU B  1 193 ? 40.863  112.568 0.163   1.00 7.39  ? 193 LEU B CB   1 
ATOM   7439  C  CG   . LEU B  1 193 ? 40.874  113.847 1.001   1.00 8.26  ? 193 LEU B CG   1 
ATOM   7440  C  CD1  . LEU B  1 193 ? 41.919  113.751 2.106   1.00 10.83 ? 193 LEU B CD1  1 
ATOM   7441  C  CD2  . LEU B  1 193 ? 41.104  115.091 0.144   1.00 16.99 ? 193 LEU B CD2  1 
ATOM   7442  H  H    . LEU B  1 193 ? 40.832  110.279 -0.653  1.00 11.85 ? 193 LEU B H    1 
ATOM   7443  H  HA   . LEU B  1 193 ? 41.213  111.264 1.703   1.00 13.84 ? 193 LEU B HA   1 
ATOM   7444  H  HB2  . LEU B  1 193 ? 41.742  112.460 -0.234  1.00 8.87  ? 193 LEU B HB2  1 
ATOM   7445  H  HB3  . LEU B  1 193 ? 40.194  112.668 -0.532  1.00 8.87  ? 193 LEU B HB3  1 
ATOM   7446  H  HG   . LEU B  1 193 ? 40.008  113.942 1.426   1.00 9.91  ? 193 LEU B HG   1 
ATOM   7447  H  HD11 . LEU B  1 193 ? 41.907  114.563 2.617   1.00 13.00 ? 193 LEU B HD11 1 
ATOM   7448  H  HD12 . LEU B  1 193 ? 41.707  113.004 2.671   1.00 13.00 ? 193 LEU B HD12 1 
ATOM   7449  H  HD13 . LEU B  1 193 ? 42.783  113.626 1.708   1.00 13.00 ? 193 LEU B HD13 1 
ATOM   7450  H  HD21 . LEU B  1 193 ? 41.102  115.865 0.712   1.00 20.38 ? 193 LEU B HD21 1 
ATOM   7451  H  HD22 . LEU B  1 193 ? 41.951  115.012 -0.300  1.00 20.38 ? 193 LEU B HD22 1 
ATOM   7452  H  HD23 . LEU B  1 193 ? 40.399  115.158 -0.504  1.00 20.38 ? 193 LEU B HD23 1 
ATOM   7453  N  N    . SER B  1 194 ? 38.094  111.285 0.944   1.00 12.54 ? 194 SER B N    1 
ATOM   7454  C  CA   . SER B  1 194 ? 36.758  111.463 1.507   1.00 13.89 ? 194 SER B CA   1 
ATOM   7455  C  C    . SER B  1 194 ? 36.451  110.438 2.616   1.00 12.73 ? 194 SER B C    1 
ATOM   7456  O  O    . SER B  1 194 ? 35.500  110.600 3.366   1.00 15.10 ? 194 SER B O    1 
ATOM   7457  C  CB   . SER B  1 194 ? 35.710  111.371 0.397   1.00 15.25 ? 194 SER B CB   1 
ATOM   7458  O  OG   . SER B  1 194 ? 35.593  110.032 -0.065  1.00 25.77 ? 194 SER B OG   1 
ATOM   7459  H  H    . SER B  1 194 ? 38.105  111.028 0.123   1.00 15.05 ? 194 SER B H    1 
ATOM   7460  H  HA   . SER B  1 194 ? 36.698  112.357 1.902   1.00 16.66 ? 194 SER B HA   1 
ATOM   7461  H  HB2  . SER B  1 194 ? 34.852  111.662 0.745   1.00 18.30 ? 194 SER B HB2  1 
ATOM   7462  H  HB3  . SER B  1 194 ? 35.979  111.939 -0.342  1.00 18.30 ? 194 SER B HB3  1 
ATOM   7463  H  HG   . SER B  1 194 ? 35.030  109.988 -0.660  1.00 30.93 ? 194 SER B HG   1 
ATOM   7464  N  N    . ASP B  1 195 ? 37.259  109.389 2.714   1.00 9.26  ? 195 ASP B N    1 
ATOM   7465  C  CA   . ASP B  1 195 ? 37.068  108.371 3.754   1.00 13.38 ? 195 ASP B CA   1 
ATOM   7466  C  C    . ASP B  1 195 ? 37.881  108.639 5.034   1.00 15.74 ? 195 ASP B C    1 
ATOM   7467  O  O    . ASP B  1 195 ? 37.737  107.925 6.049   1.00 13.86 ? 195 ASP B O    1 
ATOM   7468  C  CB   . ASP B  1 195 ? 37.412  106.980 3.198   1.00 9.96  ? 195 ASP B CB   1 
ATOM   7469  C  CG   . ASP B  1 195 ? 36.350  106.445 2.280   1.00 21.89 ? 195 ASP B CG   1 
ATOM   7470  O  OD1  . ASP B  1 195 ? 35.182  106.854 2.433   1.00 19.13 ? 195 ASP B OD1  1 
ATOM   7471  O  OD2  . ASP B  1 195 ? 36.690  105.615 1.408   1.00 27.87 ? 195 ASP B OD2  1 
ATOM   7472  H  H    . ASP B  1 195 ? 37.927  109.240 2.194   1.00 11.11 ? 195 ASP B H    1 
ATOM   7473  H  HA   . ASP B  1 195 ? 36.121  108.361 4.006   1.00 16.06 ? 195 ASP B HA   1 
ATOM   7474  H  HB2  . ASP B  1 195 ? 38.241  107.036 2.698   1.00 11.95 ? 195 ASP B HB2  1 
ATOM   7475  H  HB3  . ASP B  1 195 ? 37.511  106.360 3.937   1.00 11.95 ? 195 ASP B HB3  1 
ATOM   7476  N  N    . VAL B  1 196 ? 38.748  109.643 4.992   1.00 14.62 ? 196 VAL B N    1 
ATOM   7477  C  CA   . VAL B  1 196 ? 39.688  109.850 6.083   1.00 11.57 ? 196 VAL B CA   1 
ATOM   7478  C  C    . VAL B  1 196 ? 38.991  110.322 7.351   1.00 15.61 ? 196 VAL B C    1 
ATOM   7479  O  O    . VAL B  1 196 ? 39.298  109.836 8.426   1.00 12.07 ? 196 VAL B O    1 
ATOM   7480  C  CB   . VAL B  1 196 ? 40.775  110.849 5.730   1.00 10.81 ? 196 VAL B CB   1 
ATOM   7481  C  CG1  . VAL B  1 196 ? 41.674  111.093 6.906   1.00 17.46 ? 196 VAL B CG1  1 
ATOM   7482  C  CG2  . VAL B  1 196 ? 41.578  110.315 4.519   1.00 7.87  ? 196 VAL B CG2  1 
ATOM   7483  H  H    . VAL B  1 196 ? 38.811  110.213 4.351   1.00 17.55 ? 196 VAL B H    1 
ATOM   7484  H  HA   . VAL B  1 196 ? 40.125  108.996 6.284   1.00 13.89 ? 196 VAL B HA   1 
ATOM   7485  H  HB   . VAL B  1 196 ? 40.362  111.701 5.475   1.00 12.98 ? 196 VAL B HB   1 
ATOM   7486  H  HG11 . VAL B  1 196 ? 42.350  111.727 6.655   1.00 20.95 ? 196 VAL B HG11 1 
ATOM   7487  H  HG12 . VAL B  1 196 ? 41.151  111.441 7.632   1.00 20.95 ? 196 VAL B HG12 1 
ATOM   7488  H  HG13 . VAL B  1 196 ? 42.082  110.264 7.164   1.00 20.95 ? 196 VAL B HG13 1 
ATOM   7489  H  HG21 . VAL B  1 196 ? 42.265  110.948 4.297   1.00 9.44  ? 196 VAL B HG21 1 
ATOM   7490  H  HG22 . VAL B  1 196 ? 41.973  109.472 4.754   1.00 9.44  ? 196 VAL B HG22 1 
ATOM   7491  H  HG23 . VAL B  1 196 ? 40.983  110.202 3.774   1.00 9.44  ? 196 VAL B HG23 1 
ATOM   7492  N  N    . TYR B  1 197 ? 38.074  111.278 7.223   1.00 16.61 ? 197 TYR B N    1 
ATOM   7493  C  CA   . TYR B  1 197 ? 37.446  111.837 8.412   1.00 17.25 ? 197 TYR B CA   1 
ATOM   7494  C  C    . TYR B  1 197 ? 36.693  110.721 9.171   1.00 19.52 ? 197 TYR B C    1 
ATOM   7495  O  O    . TYR B  1 197 ? 36.969  110.468 10.348  1.00 13.27 ? 197 TYR B O    1 
ATOM   7496  C  CB   . TYR B  1 197 ? 36.578  113.063 8.062   1.00 10.50 ? 197 TYR B CB   1 
ATOM   7497  C  CG   . TYR B  1 197 ? 36.021  113.778 9.309   1.00 10.43 ? 197 TYR B CG   1 
ATOM   7498  C  CD1  . TYR B  1 197 ? 34.947  113.250 10.003  1.00 17.13 ? 197 TYR B CD1  1 
ATOM   7499  C  CD2  . TYR B  1 197 ? 36.556  114.994 9.745   1.00 9.54  ? 197 TYR B CD2  1 
ATOM   7500  C  CE1  . TYR B  1 197 ? 34.444  113.885 11.153  1.00 17.58 ? 197 TYR B CE1  1 
ATOM   7501  C  CE2  . TYR B  1 197 ? 36.057  115.640 10.890  1.00 16.41 ? 197 TYR B CE2  1 
ATOM   7502  C  CZ   . TYR B  1 197 ? 34.995  115.090 11.576  1.00 12.43 ? 197 TYR B CZ   1 
ATOM   7503  O  OH   . TYR B  1 197 ? 34.510  115.740 12.700  1.00 14.77 ? 197 TYR B OH   1 
ATOM   7504  H  H    . TYR B  1 197 ? 37.804  111.611 6.478   1.00 19.93 ? 197 TYR B H    1 
ATOM   7505  H  HA   . TYR B  1 197 ? 38.157  112.154 9.007   1.00 20.70 ? 197 TYR B HA   1 
ATOM   7506  H  HB2  . TYR B  1 197 ? 37.117  113.700 7.567   1.00 12.60 ? 197 TYR B HB2  1 
ATOM   7507  H  HB3  . TYR B  1 197 ? 35.826  112.775 7.521   1.00 12.60 ? 197 TYR B HB3  1 
ATOM   7508  H  HD1  . TYR B  1 197 ? 34.579  112.442 9.728   1.00 20.55 ? 197 TYR B HD1  1 
ATOM   7509  H  HD2  . TYR B  1 197 ? 37.276  115.365 9.289   1.00 11.45 ? 197 TYR B HD2  1 
ATOM   7510  H  HE1  . TYR B  1 197 ? 33.726  113.514 11.614  1.00 21.09 ? 197 TYR B HE1  1 
ATOM   7511  H  HE2  . TYR B  1 197 ? 36.429  116.444 11.173  1.00 19.69 ? 197 TYR B HE2  1 
ATOM   7512  H  HH   . TYR B  1 197 ? 34.235  116.485 12.497  1.00 17.72 ? 197 TYR B HH   1 
ATOM   7513  N  N    . PRO B  1 198 ? 35.777  110.001 8.503   1.00 15.47 ? 198 PRO B N    1 
ATOM   7514  C  CA   . PRO B  1 198 ? 35.100  108.932 9.277   1.00 23.28 ? 198 PRO B CA   1 
ATOM   7515  C  C    . PRO B  1 198 ? 36.066  107.858 9.788   1.00 17.74 ? 198 PRO B C    1 
ATOM   7516  O  O    . PRO B  1 198 ? 35.845  107.249 10.843  1.00 16.30 ? 198 PRO B O    1 
ATOM   7517  C  CB   . PRO B  1 198 ? 34.124  108.318 8.263   1.00 25.27 ? 198 PRO B CB   1 
ATOM   7518  C  CG   . PRO B  1 198 ? 34.031  109.284 7.157   1.00 25.18 ? 198 PRO B CG   1 
ATOM   7519  C  CD   . PRO B  1 198 ? 35.292  110.073 7.120   1.00 19.33 ? 198 PRO B CD   1 
ATOM   7520  H  HA   . PRO B  1 198 ? 34.599  109.313 10.029  1.00 27.94 ? 198 PRO B HA   1 
ATOM   7521  H  HB2  . PRO B  1 198 ? 34.474  107.471 7.947   1.00 30.32 ? 198 PRO B HB2  1 
ATOM   7522  H  HB3  . PRO B  1 198 ? 33.257  108.195 8.681   1.00 30.32 ? 198 PRO B HB3  1 
ATOM   7523  H  HG2  . PRO B  1 198 ? 33.915  108.802 6.323   1.00 30.22 ? 198 PRO B HG2  1 
ATOM   7524  H  HG3  . PRO B  1 198 ? 33.275  109.871 7.310   1.00 30.22 ? 198 PRO B HG3  1 
ATOM   7525  H  HD2  . PRO B  1 198 ? 35.930  109.663 6.516   1.00 23.19 ? 198 PRO B HD2  1 
ATOM   7526  H  HD3  . PRO B  1 198 ? 35.108  110.993 6.874   1.00 23.19 ? 198 PRO B HD3  1 
ATOM   7527  N  N    . GLY B  1 199 ? 37.144  107.647 9.052   1.00 13.34 ? 199 GLY B N    1 
ATOM   7528  C  CA   . GLY B  1 199 ? 38.180  106.697 9.427   1.00 13.86 ? 199 GLY B CA   1 
ATOM   7529  C  C    . GLY B  1 199 ? 38.810  107.041 10.764  1.00 13.94 ? 199 GLY B C    1 
ATOM   7530  O  O    . GLY B  1 199 ? 39.014  106.169 11.600  1.00 13.07 ? 199 GLY B O    1 
ATOM   7531  H  H    . GLY B  1 199 ? 37.304  108.053 8.311   1.00 16.01 ? 199 GLY B H    1 
ATOM   7532  H  HA2  . GLY B  1 199 ? 37.799  105.808 9.485   1.00 16.63 ? 199 GLY B HA2  1 
ATOM   7533  H  HA3  . GLY B  1 199 ? 38.875  106.692 8.751   1.00 16.63 ? 199 GLY B HA3  1 
ATOM   7534  N  N    . LEU B  1 200 ? 39.115  108.319 10.964  1.00 11.40 ? 200 LEU B N    1 
ATOM   7535  C  CA   . LEU B  1 200 ? 39.641  108.808 12.239  1.00 12.80 ? 200 LEU B CA   1 
ATOM   7536  C  C    . LEU B  1 200 ? 38.572  108.691 13.335  1.00 15.25 ? 200 LEU B C    1 
ATOM   7537  O  O    . LEU B  1 200 ? 38.824  108.208 14.455  1.00 16.18 ? 200 LEU B O    1 
ATOM   7538  C  CB   . LEU B  1 200 ? 40.070  110.280 12.095  1.00 8.33  ? 200 LEU B CB   1 
ATOM   7539  C  CG   . LEU B  1 200 ? 41.274  110.558 11.199  1.00 10.25 ? 200 LEU B CG   1 
ATOM   7540  C  CD1  . LEU B  1 200 ? 41.359  112.029 10.806  1.00 15.06 ? 200 LEU B CD1  1 
ATOM   7541  C  CD2  . LEU B  1 200 ? 42.534  110.114 11.900  1.00 10.40 ? 200 LEU B CD2  1 
ATOM   7542  H  H    . LEU B  1 200 ? 39.027  108.933 10.369  1.00 13.69 ? 200 LEU B H    1 
ATOM   7543  H  HA   . LEU B  1 200 ? 40.421  108.276 12.502  1.00 15.35 ? 200 LEU B HA   1 
ATOM   7544  H  HB2  . LEU B  1 200 ? 39.322  110.780 11.733  1.00 10.00 ? 200 LEU B HB2  1 
ATOM   7545  H  HB3  . LEU B  1 200 ? 40.285  110.620 12.978  1.00 10.00 ? 200 LEU B HB3  1 
ATOM   7546  H  HG   . LEU B  1 200 ? 41.186  110.037 10.386  1.00 12.30 ? 200 LEU B HG   1 
ATOM   7547  H  HD11 . LEU B  1 200 ? 42.127  112.158 10.245  1.00 18.07 ? 200 LEU B HD11 1 
ATOM   7548  H  HD12 . LEU B  1 200 ? 40.561  112.272 10.331  1.00 18.07 ? 200 LEU B HD12 1 
ATOM   7549  H  HD13 . LEU B  1 200 ? 41.441  112.560 11.601  1.00 18.07 ? 200 LEU B HD13 1 
ATOM   7550  H  HD21 . LEU B  1 200 ? 43.286  110.292 11.331  1.00 12.48 ? 200 LEU B HD21 1 
ATOM   7551  H  HD22 . LEU B  1 200 ? 42.622  110.603 12.722  1.00 12.48 ? 200 LEU B HD22 1 
ATOM   7552  H  HD23 . LEU B  1 200 ? 42.475  109.174 12.082  1.00 12.48 ? 200 LEU B HD23 1 
ATOM   7553  N  N    . SER B  1 201 ? 37.369  109.118 12.992  1.00 18.77 ? 201 SER B N    1 
ATOM   7554  C  CA   . SER B  1 201 ? 36.259  109.125 13.931  1.00 24.38 ? 201 SER B CA   1 
ATOM   7555  C  C    . SER B  1 201 ? 35.995  107.732 14.496  1.00 28.74 ? 201 SER B C    1 
ATOM   7556  O  O    . SER B  1 201 ? 35.729  107.569 15.687  1.00 23.47 ? 201 SER B O    1 
ATOM   7557  C  CB   . SER B  1 201 ? 35.004  109.676 13.250  1.00 22.14 ? 201 SER B CB   1 
ATOM   7558  O  OG   . SER B  1 201 ? 34.034  110.030 14.213  1.00 40.85 ? 201 SER B OG   1 
ATOM   7559  H  H    . SER B  1 201 ? 37.165  109.412 12.210  1.00 22.52 ? 201 SER B H    1 
ATOM   7560  H  HA   . SER B  1 201 ? 36.481  109.717 14.680  1.00 29.26 ? 201 SER B HA   1 
ATOM   7561  H  HB2  . SER B  1 201 ? 35.242  110.463 12.736  1.00 26.57 ? 201 SER B HB2  1 
ATOM   7562  H  HB3  . SER B  1 201 ? 34.637  108.995 12.666  1.00 26.57 ? 201 SER B HB3  1 
ATOM   7563  H  HG   . SER B  1 201 ? 33.364  110.324 13.842  1.00 49.02 ? 201 SER B HG   1 
ATOM   7564  N  N    . GLU B  1 202 ? 36.097  106.730 13.636  1.00 20.23 ? 202 GLU B N    1 
ATOM   7565  C  CA   . GLU B  1 202 ? 35.766  105.357 13.982  1.00 20.83 ? 202 GLU B CA   1 
ATOM   7566  C  C    . GLU B  1 202 ? 36.972  104.563 14.462  1.00 20.15 ? 202 GLU B C    1 
ATOM   7567  O  O    . GLU B  1 202 ? 36.845  103.378 14.783  1.00 23.74 ? 202 GLU B O    1 
ATOM   7568  C  CB   . GLU B  1 202 ? 35.157  104.676 12.770  1.00 24.89 ? 202 GLU B CB   1 
ATOM   7569  C  CG   . GLU B  1 202 ? 33.926  105.385 12.252  1.00 34.24 ? 202 GLU B CG   1 
ATOM   7570  C  CD   . GLU B  1 202 ? 33.495  104.860 10.912  1.00 40.16 ? 202 GLU B CD   1 
ATOM   7571  O  OE1  . GLU B  1 202 ? 34.093  103.864 10.451  1.00 42.89 ? 202 GLU B OE1  1 
ATOM   7572  O  OE2  . GLU B  1 202 ? 32.567  105.449 10.319  1.00 44.59 ? 202 GLU B OE2  1 
ATOM   7573  H  H    . GLU B  1 202 ? 36.362  106.824 12.824  1.00 24.28 ? 202 GLU B H    1 
ATOM   7574  H  HA   . GLU B  1 202 ? 35.097  105.358 14.698  1.00 25.00 ? 202 GLU B HA   1 
ATOM   7575  H  HB2  . GLU B  1 202 ? 35.814  104.657 12.056  1.00 29.87 ? 202 GLU B HB2  1 
ATOM   7576  H  HB3  . GLU B  1 202 ? 34.903  103.772 13.010  1.00 29.87 ? 202 GLU B HB3  1 
ATOM   7577  H  HG2  . GLU B  1 202 ? 33.196  105.253 12.877  1.00 41.09 ? 202 GLU B HG2  1 
ATOM   7578  H  HG3  . GLU B  1 202 ? 34.119  106.331 12.159  1.00 41.09 ? 202 GLU B HG3  1 
ATOM   7579  N  N    . GLY B  1 203 ? 38.127  105.225 14.534  1.00 21.36 ? 203 GLY B N    1 
ATOM   7580  C  CA   . GLY B  1 203 ? 39.357  104.622 15.027  1.00 22.14 ? 203 GLY B CA   1 
ATOM   7581  C  C    . GLY B  1 203 ? 40.037  103.618 14.105  1.00 16.11 ? 203 GLY B C    1 
ATOM   7582  O  O    . GLY B  1 203 ? 40.860  102.827 14.553  1.00 23.18 ? 203 GLY B O    1 
ATOM   7583  H  H    . GLY B  1 203 ? 38.222  106.045 14.295  1.00 25.63 ? 203 GLY B H    1 
ATOM   7584  H  HA2  . GLY B  1 203 ? 39.995  105.328 15.214  1.00 26.57 ? 203 GLY B HA2  1 
ATOM   7585  H  HA3  . GLY B  1 203 ? 39.165  104.168 15.863  1.00 26.57 ? 203 GLY B HA3  1 
ATOM   7586  N  N    . ILE B  1 204 ? 39.692  103.659 12.825  1.00 15.28 ? 204 ILE B N    1 
ATOM   7587  C  CA   . ILE B  1 204 ? 40.285  102.810 11.798  1.00 15.94 ? 204 ILE B CA   1 
ATOM   7588  C  C    . ILE B  1 204 ? 41.727  103.267 11.544  1.00 15.13 ? 204 ILE B C    1 
ATOM   7589  O  O    . ILE B  1 204 ? 42.608  102.460 11.245  1.00 17.54 ? 204 ILE B O    1 
ATOM   7590  C  CB   . ILE B  1 204 ? 39.466  102.930 10.491  1.00 21.45 ? 204 ILE B CB   1 
ATOM   7591  C  CG1  . ILE B  1 204 ? 38.036  102.456 10.749  1.00 26.30 ? 204 ILE B CG1  1 
ATOM   7592  C  CG2  . ILE B  1 204 ? 40.114  102.138 9.339   1.00 24.09 ? 204 ILE B CG2  1 
ATOM   7593  C  CD1  . ILE B  1 204 ? 37.143  102.536 9.544   1.00 34.04 ? 204 ILE B CD1  1 
ATOM   7594  H  H    . ILE B  1 204 ? 39.093  104.192 12.514  1.00 18.33 ? 204 ILE B H    1 
ATOM   7595  H  HA   . ILE B  1 204 ? 40.290  101.875 12.092  1.00 19.13 ? 204 ILE B HA   1 
ATOM   7596  H  HB   . ILE B  1 204 ? 39.434  103.865 10.237  1.00 25.74 ? 204 ILE B HB   1 
ATOM   7597  H  HG12 . ILE B  1 204 ? 38.062  101.530 11.037  1.00 31.56 ? 204 ILE B HG12 1 
ATOM   7598  H  HG13 . ILE B  1 204 ? 37.645  103.006 11.445  1.00 31.56 ? 204 ILE B HG13 1 
ATOM   7599  H  HG21 . ILE B  1 204 ? 39.576  102.239 8.550   1.00 28.91 ? 204 ILE B HG21 1 
ATOM   7600  H  HG22 . ILE B  1 204 ? 40.996  102.483 9.180   1.00 28.91 ? 204 ILE B HG22 1 
ATOM   7601  H  HG23 . ILE B  1 204 ? 40.164  101.212 9.585   1.00 28.91 ? 204 ILE B HG23 1 
ATOM   7602  H  HD11 . ILE B  1 204 ? 36.267  102.223 9.784   1.00 40.85 ? 204 ILE B HD11 1 
ATOM   7603  H  HD12 . ILE B  1 204 ? 37.095  103.449 9.251   1.00 40.85 ? 204 ILE B HD12 1 
ATOM   7604  H  HD13 . ILE B  1 204 ? 37.508  101.986 8.847   1.00 40.85 ? 204 ILE B HD13 1 
ATOM   7605  N  N    . ILE B  1 205 ? 41.937  104.580 11.639  1.00 11.14 ? 205 ILE B N    1 
ATOM   7606  C  CA   . ILE B  1 205 ? 43.254  105.195 11.472  1.00 14.71 ? 205 ILE B CA   1 
ATOM   7607  C  C    . ILE B  1 205 ? 43.514  106.189 12.607  1.00 9.61  ? 205 ILE B C    1 
ATOM   7608  O  O    . ILE B  1 205 ? 42.575  106.673 13.226  1.00 9.83  ? 205 ILE B O    1 
ATOM   7609  C  CB   . ILE B  1 205 ? 43.351  105.955 10.143  1.00 7.99  ? 205 ILE B CB   1 
ATOM   7610  C  CG1  . ILE B  1 205 ? 42.042  106.705 9.876   1.00 7.93  ? 205 ILE B CG1  1 
ATOM   7611  C  CG2  . ILE B  1 205 ? 43.636  104.988 9.015   1.00 9.94  ? 205 ILE B CG2  1 
ATOM   7612  C  CD1  . ILE B  1 205 ? 42.163  107.808 8.865   1.00 7.90  ? 205 ILE B CD1  1 
ATOM   7613  H  H    . ILE B  1 205 ? 41.314  105.150 11.804  1.00 13.36 ? 205 ILE B H    1 
ATOM   7614  H  HA   . ILE B  1 205 ? 43.948  104.504 11.492  1.00 17.65 ? 205 ILE B HA   1 
ATOM   7615  H  HB   . ILE B  1 205 ? 44.077  106.596 10.199  1.00 9.59  ? 205 ILE B HB   1 
ATOM   7616  H  HG12 . ILE B  1 205 ? 41.383  106.074 9.547   1.00 9.52  ? 205 ILE B HG12 1 
ATOM   7617  H  HG13 . ILE B  1 205 ? 41.734  107.099 10.707  1.00 9.52  ? 205 ILE B HG13 1 
ATOM   7618  H  HG21 . ILE B  1 205 ? 43.694  105.478 8.191   1.00 11.93 ? 205 ILE B HG21 1 
ATOM   7619  H  HG22 . ILE B  1 205 ? 44.467  104.540 9.189   1.00 11.93 ? 205 ILE B HG22 1 
ATOM   7620  H  HG23 . ILE B  1 205 ? 42.923  104.347 8.965   1.00 11.93 ? 205 ILE B HG23 1 
ATOM   7621  H  HD11 . ILE B  1 205 ? 41.306  108.226 8.755   1.00 9.49  ? 205 ILE B HD11 1 
ATOM   7622  H  HD12 . ILE B  1 205 ? 42.804  108.450 9.179   1.00 9.49  ? 205 ILE B HD12 1 
ATOM   7623  H  HD13 . ILE B  1 205 ? 42.456  107.435 8.030   1.00 9.49  ? 205 ILE B HD13 1 
ATOM   7624  N  N    . ASP B  1 206 ? 44.796  106.483 12.856  1.00 7.78  ? 206 ASP B N    1 
ATOM   7625  C  CA   . ASP B  1 206 ? 45.254  107.301 13.959  1.00 10.63 ? 206 ASP B CA   1 
ATOM   7626  C  C    . ASP B  1 206 ? 45.783  108.650 13.462  1.00 8.36  ? 206 ASP B C    1 
ATOM   7627  O  O    . ASP B  1 206 ? 46.124  109.528 14.250  1.00 9.71  ? 206 ASP B O    1 
ATOM   7628  C  CB   . ASP B  1 206 ? 46.379  106.570 14.691  1.00 16.83 ? 206 ASP B CB   1 
ATOM   7629  C  CG   . ASP B  1 206 ? 45.920  105.236 15.279  1.00 22.64 ? 206 ASP B CG   1 
ATOM   7630  O  OD1  . ASP B  1 206 ? 44.843  105.214 15.914  1.00 27.73 ? 206 ASP B OD1  1 
ATOM   7631  O  OD2  . ASP B  1 206 ? 46.629  104.224 15.107  1.00 18.42 ? 206 ASP B OD2  1 
ATOM   7632  H  H    . ASP B  1 206 ? 45.444  106.198 12.366  1.00 9.33  ? 206 ASP B H    1 
ATOM   7633  H  HA   . ASP B  1 206 ? 44.517  107.460 14.585  1.00 12.75 ? 206 ASP B HA   1 
ATOM   7634  H  HB2  . ASP B  1 206 ? 47.101  106.392 14.068  1.00 20.20 ? 206 ASP B HB2  1 
ATOM   7635  H  HB3  . ASP B  1 206 ? 46.698  107.127 15.419  1.00 20.20 ? 206 ASP B HB3  1 
ATOM   7636  N  N    . GLY B  1 207 ? 45.902  108.808 12.144  1.00 6.82  ? 207 GLY B N    1 
ATOM   7637  C  CA   . GLY B  1 207 ? 46.282  110.100 11.624  1.00 9.90  ? 207 GLY B CA   1 
ATOM   7638  C  C    . GLY B  1 207 ? 46.459  110.022 10.140  1.00 9.26  ? 207 GLY B C    1 
ATOM   7639  O  O    . GLY B  1 207 ? 46.044  109.033 9.489   1.00 8.51  ? 207 GLY B O    1 
ATOM   7640  H  H    . GLY B  1 207 ? 45.770  108.198 11.553  1.00 8.19  ? 207 GLY B H    1 
ATOM   7641  H  HA2  . GLY B  1 207 ? 45.595  110.754 11.826  1.00 11.88 ? 207 GLY B HA2  1 
ATOM   7642  H  HA3  . GLY B  1 207 ? 47.117  110.386 12.027  1.00 11.88 ? 207 GLY B HA3  1 
ATOM   7643  N  N    . LEU B  1 208 ? 47.042  111.077 9.592   1.00 6.66  ? 208 LEU B N    1 
ATOM   7644  C  CA   . LEU B  1 208 ? 47.216  111.184 8.142   1.00 7.44  ? 208 LEU B CA   1 
ATOM   7645  C  C    . LEU B  1 208 ? 48.301  112.232 7.879   1.00 10.57 ? 208 LEU B C    1 
ATOM   7646  O  O    . LEU B  1 208 ? 48.947  112.679 8.808   1.00 7.96  ? 208 LEU B O    1 
ATOM   7647  C  CB   . LEU B  1 208 ? 45.898  111.581 7.473   1.00 6.36  ? 208 LEU B CB   1 
ATOM   7648  C  CG   . LEU B  1 208 ? 45.502  113.068 7.645   1.00 6.19  ? 208 LEU B CG   1 
ATOM   7649  C  CD1  . LEU B  1 208 ? 44.906  113.632 6.336   1.00 10.59 ? 208 LEU B CD1  1 
ATOM   7650  C  CD2  . LEU B  1 208 ? 44.544  113.326 8.777   1.00 11.20 ? 208 LEU B CD2  1 
ATOM   7651  H  H    . LEU B  1 208 ? 47.349  111.748 10.034  1.00 7.99  ? 208 LEU B H    1 
ATOM   7652  H  HA   . LEU B  1 208 ? 47.510  110.323 7.777   1.00 8.93  ? 208 LEU B HA   1 
ATOM   7653  H  HB2  . LEU B  1 208 ? 45.969  111.406 6.521   1.00 7.64  ? 208 LEU B HB2  1 
ATOM   7654  H  HB3  . LEU B  1 208 ? 45.185  111.043 7.850   1.00 7.64  ? 208 LEU B HB3  1 
ATOM   7655  H  HG   . LEU B  1 208 ? 46.308  113.574 7.833   1.00 7.43  ? 208 LEU B HG   1 
ATOM   7656  H  HD11 . LEU B  1 208 ? 44.671  114.553 6.471   1.00 12.70 ? 208 LEU B HD11 1 
ATOM   7657  H  HD12 . LEU B  1 208 ? 45.562  113.561 5.638   1.00 12.70 ? 208 LEU B HD12 1 
ATOM   7658  H  HD13 . LEU B  1 208 ? 44.125  113.125 6.104   1.00 12.70 ? 208 LEU B HD13 1 
ATOM   7659  H  HD21 . LEU B  1 208 ? 44.352  114.266 8.815   1.00 13.44 ? 208 LEU B HD21 1 
ATOM   7660  H  HD22 . LEU B  1 208 ? 43.736  112.832 8.621   1.00 13.44 ? 208 LEU B HD22 1 
ATOM   7661  H  HD23 . LEU B  1 208 ? 44.949  113.041 9.600   1.00 13.44 ? 208 LEU B HD23 1 
ATOM   7662  N  N    . GLU B  1 209 ? 48.531  112.602 6.619   1.00 5.77  ? 209 GLU B N    1 
ATOM   7663  C  CA   . GLU B  1 209 ? 49.447  113.696 6.364   1.00 5.41  ? 209 GLU B CA   1 
ATOM   7664  C  C    . GLU B  1 209 ? 48.994  114.537 5.148   1.00 5.41  ? 209 GLU B C    1 
ATOM   7665  O  O    . GLU B  1 209 ? 48.345  114.052 4.232   1.00 9.36  ? 209 GLU B O    1 
ATOM   7666  C  CB   . GLU B  1 209 ? 50.900  113.182 6.227   1.00 8.84  ? 209 GLU B CB   1 
ATOM   7667  C  CG   . GLU B  1 209 ? 51.092  111.917 5.332   1.00 6.60  ? 209 GLU B CG   1 
ATOM   7668  C  CD   . GLU B  1 209 ? 51.055  112.226 3.839   1.00 5.25  ? 209 GLU B CD   1 
ATOM   7669  O  OE1  . GLU B  1 209 ? 50.128  111.755 3.155   1.00 6.92  ? 209 GLU B OE1  1 
ATOM   7670  O  OE2  . GLU B  1 209 ? 51.924  112.984 3.385   1.00 6.31  ? 209 GLU B OE2  1 
ATOM   7671  H  H    . GLU B  1 209 ? 48.179  112.246 5.920   1.00 6.93  ? 209 GLU B H    1 
ATOM   7672  H  HA   . GLU B  1 209 ? 49.429  114.291 7.143   1.00 6.49  ? 209 GLU B HA   1 
ATOM   7673  H  HB2  . GLU B  1 209 ? 51.441  113.891 5.845   1.00 10.60 ? 209 GLU B HB2  1 
ATOM   7674  H  HB3  . GLU B  1 209 ? 51.232  112.964 7.112   1.00 10.60 ? 209 GLU B HB3  1 
ATOM   7675  H  HG2  . GLU B  1 209 ? 51.952  111.517 5.533   1.00 7.92  ? 209 GLU B HG2  1 
ATOM   7676  H  HG3  . GLU B  1 209 ? 50.381  111.286 5.524   1.00 7.92  ? 209 GLU B HG3  1 
ATOM   7677  N  N    . ASN B  1 210 ? 49.286  115.839 5.214   1.00 9.19  ? 210 ASN B N    1 
ATOM   7678  C  CA   . ASN B  1 210 ? 48.859  116.781 4.192   1.00 6.04  ? 210 ASN B CA   1 
ATOM   7679  C  C    . ASN B  1 210 ? 49.351  118.153 4.580   1.00 5.37  ? 210 ASN B C    1 
ATOM   7680  O  O    . ASN B  1 210 ? 49.773  118.361 5.723   1.00 5.34  ? 210 ASN B O    1 
ATOM   7681  C  CB   . ASN B  1 210 ? 47.323  116.794 4.081   1.00 5.99  ? 210 ASN B CB   1 
ATOM   7682  C  CG   . ASN B  1 210 ? 46.807  116.046 2.869   1.00 6.77  ? 210 ASN B CG   1 
ATOM   7683  O  OD1  . ASN B  1 210 ? 47.246  116.288 1.735   1.00 5.89  ? 210 ASN B OD1  1 
ATOM   7684  N  ND2  . ASN B  1 210 ? 45.784  115.228 3.083   1.00 7.75  ? 210 ASN B ND2  1 
ATOM   7685  H  H    . ASN B  1 210 ? 49.735  116.199 5.852   1.00 11.03 ? 210 ASN B H    1 
ATOM   7686  H  HA   . ASN B  1 210 ? 49.242  116.535 3.324   1.00 7.25  ? 210 ASN B HA   1 
ATOM   7687  H  HB2  . ASN B  1 210 ? 46.947  116.377 4.872   1.00 7.19  ? 210 ASN B HB2  1 
ATOM   7688  H  HB3  . ASN B  1 210 ? 47.021  117.713 4.015   1.00 7.19  ? 210 ASN B HB3  1 
ATOM   7689  H  HD21 . ASN B  1 210 ? 45.455  115.149 3.873   1.00 9.29  ? 210 ASN B HD21 1 
ATOM   7690  H  HD22 . ASN B  1 210 ? 45.450  114.778 2.430   1.00 9.29  ? 210 ASN B HD22 1 
ATOM   7691  N  N    . PRO B  1 211 ? 49.304  119.101 3.651   1.00 5.34  ? 211 PRO B N    1 
ATOM   7692  C  CA   . PRO B  1 211 ? 49.636  120.464 4.044   1.00 6.86  ? 211 PRO B CA   1 
ATOM   7693  C  C    . PRO B  1 211 ? 48.598  121.039 4.991   1.00 5.53  ? 211 PRO B C    1 
ATOM   7694  O  O    . PRO B  1 211 ? 47.433  120.605 4.979   1.00 6.73  ? 211 PRO B O    1 
ATOM   7695  C  CB   . PRO B  1 211 ? 49.586  121.233 2.721   1.00 5.85  ? 211 PRO B CB   1 
ATOM   7696  C  CG   . PRO B  1 211 ? 49.759  120.227 1.684   1.00 6.88  ? 211 PRO B CG   1 
ATOM   7697  C  CD   . PRO B  1 211 ? 49.158  118.964 2.196   1.00 5.36  ? 211 PRO B CD   1 
ATOM   7698  H  HA   . PRO B  1 211 ? 50.531  120.517 4.438   1.00 8.23  ? 211 PRO B HA   1 
ATOM   7699  H  HB2  . PRO B  1 211 ? 48.726  121.673 2.631   1.00 7.01  ? 211 PRO B HB2  1 
ATOM   7700  H  HB3  . PRO B  1 211 ? 50.307  121.881 2.693   1.00 7.01  ? 211 PRO B HB3  1 
ATOM   7701  H  HG2  . PRO B  1 211 ? 49.302  120.515 0.878   1.00 8.25  ? 211 PRO B HG2  1 
ATOM   7702  H  HG3  . PRO B  1 211 ? 50.705  120.105 1.510   1.00 8.25  ? 211 PRO B HG3  1 
ATOM   7703  H  HD2  . PRO B  1 211 ? 48.221  118.909 1.952   1.00 6.44  ? 211 PRO B HD2  1 
ATOM   7704  H  HD3  . PRO B  1 211 ? 49.657  118.196 1.876   1.00 6.44  ? 211 PRO B HD3  1 
ATOM   7705  N  N    . THR B  1 212 ? 48.994  122.066 5.729   1.00 9.69  ? 212 THR B N    1 
ATOM   7706  C  CA   . THR B  1 212 ? 48.090  122.713 6.666   1.00 6.92  ? 212 THR B CA   1 
ATOM   7707  C  C    . THR B  1 212 ? 46.768  123.126 6.013   1.00 5.97  ? 212 THR B C    1 
ATOM   7708  O  O    . THR B  1 212 ? 45.724  122.938 6.599   1.00 6.97  ? 212 THR B O    1 
ATOM   7709  C  CB   . THR B  1 212 ? 48.745  123.949 7.324   1.00 9.40  ? 212 THR B CB   1 
ATOM   7710  O  OG1  . THR B  1 212 ? 49.241  124.822 6.309   1.00 9.61  ? 212 THR B OG1  1 
ATOM   7711  C  CG2  . THR B  1 212 ? 49.882  123.555 8.237   1.00 6.60  ? 212 THR B CG2  1 
ATOM   7712  H  H    . THR B  1 212 ? 49.783  122.408 5.707   1.00 11.63 ? 212 THR B H    1 
ATOM   7713  H  HA   . THR B  1 212 ? 47.878  122.077 7.381   1.00 8.30  ? 212 THR B HA   1 
ATOM   7714  H  HB   . THR B  1 212 ? 48.081  124.419 7.852   1.00 11.28 ? 212 THR B HB   1 
ATOM   7715  H  HG1  . THR B  1 212 ? 49.590  125.480 6.651   1.00 11.53 ? 212 THR B HG1  1 
ATOM   7716  H  HG21 . THR B  1 212 ? 50.271  124.339 8.633   1.00 7.92  ? 212 THR B HG21 1 
ATOM   7717  H  HG22 . THR B  1 212 ? 49.557  122.982 8.936   1.00 7.92  ? 212 THR B HG22 1 
ATOM   7718  H  HG23 . THR B  1 212 ? 50.557  123.089 7.739   1.00 7.92  ? 212 THR B HG23 1 
ATOM   7719  N  N    . VAL B  1 213 ? 46.795  123.673 4.785   1.00 5.99  ? 213 VAL B N    1 
ATOM   7720  C  CA   . VAL B  1 213 ? 45.555  124.145 4.197   1.00 6.23  ? 213 VAL B CA   1 
ATOM   7721  C  C    . VAL B  1 213 ? 44.529  123.070 3.950   1.00 6.33  ? 213 VAL B C    1 
ATOM   7722  O  O    . VAL B  1 213 ? 43.329  123.340 3.994   1.00 11.75 ? 213 VAL B O    1 
ATOM   7723  C  CB   . VAL B  1 213 ? 45.753  124.970 2.912   1.00 6.27  ? 213 VAL B CB   1 
ATOM   7724  C  CG1  . VAL B  1 213 ? 46.529  126.238 3.238   1.00 8.12  ? 213 VAL B CG1  1 
ATOM   7725  C  CG2  . VAL B  1 213 ? 46.437  124.116 1.836   1.00 9.04  ? 213 VAL B CG2  1 
ATOM   7726  H  H    . VAL B  1 213 ? 47.495  123.775 4.297   1.00 7.19  ? 213 VAL B H    1 
ATOM   7727  H  HA   . VAL B  1 213 ? 45.150  124.756 4.847   1.00 7.48  ? 213 VAL B HA   1 
ATOM   7728  H  HB   . VAL B  1 213 ? 44.875  125.237 2.569   1.00 7.53  ? 213 VAL B HB   1 
ATOM   7729  H  HG11 . VAL B  1 213 ? 46.649  126.746 2.433   1.00 9.75  ? 213 VAL B HG11 1 
ATOM   7730  H  HG12 . VAL B  1 213 ? 46.033  126.751 3.880   1.00 9.75  ? 213 VAL B HG12 1 
ATOM   7731  H  HG13 . VAL B  1 213 ? 47.384  125.995 3.603   1.00 9.75  ? 213 VAL B HG13 1 
ATOM   7732  H  HG21 . VAL B  1 213 ? 46.552  124.646 1.044   1.00 10.85 ? 213 VAL B HG21 1 
ATOM   7733  H  HG22 . VAL B  1 213 ? 47.291  123.827 2.164   1.00 10.85 ? 213 VAL B HG22 1 
ATOM   7734  H  HG23 . VAL B  1 213 ? 45.884  123.355 1.644   1.00 10.85 ? 213 VAL B HG23 1 
ATOM   7735  N  N    . VAL B  1 214 ? 45.006  121.873 3.646   1.00 6.76  ? 214 VAL B N    1 
ATOM   7736  C  CA   . VAL B  1 214 ? 44.161  120.709 3.375   1.00 6.44  ? 214 VAL B CA   1 
ATOM   7737  C  C    . VAL B  1 214 ? 43.651  120.074 4.705   1.00 6.36  ? 214 VAL B C    1 
ATOM   7738  O  O    . VAL B  1 214 ? 42.502  119.647 4.819   1.00 9.14  ? 214 VAL B O    1 
ATOM   7739  C  CB   . VAL B  1 214 ? 44.959  119.692 2.555   1.00 6.23  ? 214 VAL B CB   1 
ATOM   7740  C  CG1  . VAL B  1 214 ? 44.119  118.502 2.209   1.00 7.88  ? 214 VAL B CG1  1 
ATOM   7741  C  CG2  . VAL B  1 214 ? 45.461  120.349 1.230   1.00 8.90  ? 214 VAL B CG2  1 
ATOM   7742  H  H    . VAL B  1 214 ? 45.846  121.700 3.587   1.00 8.11  ? 214 VAL B H    1 
ATOM   7743  H  HA   . VAL B  1 214 ? 43.383  120.988 2.849   1.00 7.73  ? 214 VAL B HA   1 
ATOM   7744  H  HB   . VAL B  1 214 ? 45.736  119.389 3.069   1.00 7.47  ? 214 VAL B HB   1 
ATOM   7745  H  HG11 . VAL B  1 214 ? 44.647  117.886 1.696   1.00 9.45  ? 214 VAL B HG11 1 
ATOM   7746  H  HG12 . VAL B  1 214 ? 43.822  118.083 3.020   1.00 9.45  ? 214 VAL B HG12 1 
ATOM   7747  H  HG13 . VAL B  1 214 ? 43.363  118.792 1.694   1.00 9.45  ? 214 VAL B HG13 1 
ATOM   7748  H  HG21 . VAL B  1 214 ? 45.958  119.699 0.728   1.00 10.68 ? 214 VAL B HG21 1 
ATOM   7749  H  HG22 . VAL B  1 214 ? 44.702  120.645 0.722   1.00 10.68 ? 214 VAL B HG22 1 
ATOM   7750  H  HG23 . VAL B  1 214 ? 46.023  121.096 1.446   1.00 10.68 ? 214 VAL B HG23 1 
ATOM   7751  N  N    . LEU B  1 215 ? 44.533  120.002 5.680   1.00 6.64  ? 215 LEU B N    1 
ATOM   7752  C  CA   . LEU B  1 215 ? 44.170  119.537 7.021   1.00 6.59  ? 215 LEU B CA   1 
ATOM   7753  C  C    . LEU B  1 215 ? 43.076  120.431 7.606   1.00 12.29 ? 215 LEU B C    1 
ATOM   7754  O  O    . LEU B  1 215 ? 42.115  119.946 8.165   1.00 11.67 ? 215 LEU B O    1 
ATOM   7755  C  CB   . LEU B  1 215 ? 45.382  119.541 7.933   1.00 6.09  ? 215 LEU B CB   1 
ATOM   7756  C  CG   . LEU B  1 215 ? 46.529  118.629 7.521   1.00 5.84  ? 215 LEU B CG   1 
ATOM   7757  C  CD1  . LEU B  1 215 ? 47.728  118.909 8.374   1.00 9.66  ? 215 LEU B CD1  1 
ATOM   7758  C  CD2  . LEU B  1 215 ? 46.115  117.183 7.621   1.00 8.65  ? 215 LEU B CD2  1 
ATOM   7759  H  H    . LEU B  1 215 ? 45.362  120.217 5.599   1.00 7.97  ? 215 LEU B H    1 
ATOM   7760  H  HA   . LEU B  1 215 ? 43.825  118.621 6.966   1.00 7.91  ? 215 LEU B HA   1 
ATOM   7761  H  HB2  . LEU B  1 215 ? 45.731  120.445 7.973   1.00 7.31  ? 215 LEU B HB2  1 
ATOM   7762  H  HB3  . LEU B  1 215 ? 45.098  119.266 8.819   1.00 7.31  ? 215 LEU B HB3  1 
ATOM   7763  H  HG   . LEU B  1 215 ? 46.766  118.813 6.599   1.00 7.01  ? 215 LEU B HG   1 
ATOM   7764  H  HD11 . LEU B  1 215 ? 48.444  118.329 8.106   1.00 11.59 ? 215 LEU B HD11 1 
ATOM   7765  H  HD12 . LEU B  1 215 ? 47.988  119.826 8.258   1.00 11.59 ? 215 LEU B HD12 1 
ATOM   7766  H  HD13 . LEU B  1 215 ? 47.502  118.746 9.293   1.00 11.59 ? 215 LEU B HD13 1 
ATOM   7767  H  HD21 . LEU B  1 215 ? 46.853  116.628 7.357   1.00 10.38 ? 215 LEU B HD21 1 
ATOM   7768  H  HD22 . LEU B  1 215 ? 45.868  116.990 8.528   1.00 10.38 ? 215 LEU B HD22 1 
ATOM   7769  H  HD23 . LEU B  1 215 ? 45.367  117.032 7.038   1.00 10.38 ? 215 LEU B HD23 1 
ATOM   7770  N  N    . PHE B  1 216 ? 43.212  121.739 7.443   1.00 11.36 ? 216 PHE B N    1 
ATOM   7771  C  CA   . PHE B  1 216 ? 42.196  122.673 7.945   1.00 7.89  ? 216 PHE B CA   1 
ATOM   7772  C  C    . PHE B  1 216 ? 40.929  122.643 7.091   1.00 12.65 ? 216 PHE B C    1 
ATOM   7773  O  O    . PHE B  1 216 ? 39.827  122.543 7.620   1.00 10.67 ? 216 PHE B O    1 
ATOM   7774  C  CB   . PHE B  1 216 ? 42.737  124.102 8.037   1.00 7.35  ? 216 PHE B CB   1 
ATOM   7775  C  CG   . PHE B  1 216 ? 41.802  125.057 8.766   1.00 11.01 ? 216 PHE B CG   1 
ATOM   7776  C  CD1  . PHE B  1 216 ? 41.565  124.917 10.124  1.00 11.49 ? 216 PHE B CD1  1 
ATOM   7777  C  CD2  . PHE B  1 216 ? 41.156  126.080 8.079   1.00 19.07 ? 216 PHE B CD2  1 
ATOM   7778  C  CE1  . PHE B  1 216 ? 40.710  125.769 10.800  1.00 18.92 ? 216 PHE B CE1  1 
ATOM   7779  C  CE2  . PHE B  1 216 ? 40.290  126.942 8.751   1.00 18.12 ? 216 PHE B CE2  1 
ATOM   7780  C  CZ   . PHE B  1 216 ? 40.068  126.782 10.110  1.00 23.38 ? 216 PHE B CZ   1 
ATOM   7781  H  H    . PHE B  1 216 ? 43.876  122.116 7.048   1.00 13.63 ? 216 PHE B H    1 
ATOM   7782  H  HA   . PHE B  1 216 ? 41.945  122.397 8.851   1.00 9.46  ? 216 PHE B HA   1 
ATOM   7783  H  HB2  . PHE B  1 216 ? 43.581  124.088 8.516   1.00 8.82  ? 216 PHE B HB2  1 
ATOM   7784  H  HB3  . PHE B  1 216 ? 42.872  124.445 7.140   1.00 8.82  ? 216 PHE B HB3  1 
ATOM   7785  H  HD1  . PHE B  1 216 ? 41.990  124.235 10.591  1.00 13.79 ? 216 PHE B HD1  1 
ATOM   7786  H  HD2  . PHE B  1 216 ? 41.298  126.187 7.167   1.00 22.88 ? 216 PHE B HD2  1 
ATOM   7787  H  HE1  . PHE B  1 216 ? 40.565  125.659 11.712  1.00 22.70 ? 216 PHE B HE1  1 
ATOM   7788  H  HE2  . PHE B  1 216 ? 39.862  127.625 8.287   1.00 21.74 ? 216 PHE B HE2  1 
ATOM   7789  H  HZ   . PHE B  1 216 ? 39.496  127.361 10.559  1.00 28.05 ? 216 PHE B HZ   1 
ATOM   7790  N  N    . GLY B  1 217 ? 41.076  122.735 5.764   1.00 11.63 ? 217 GLY B N    1 
ATOM   7791  C  CA   . GLY B  1 217 ? 39.919  122.645 4.883   1.00 13.32 ? 217 GLY B CA   1 
ATOM   7792  C  C    . GLY B  1 217 ? 39.084  121.388 5.115   1.00 11.90 ? 217 GLY B C    1 
ATOM   7793  O  O    . GLY B  1 217 ? 37.855  121.432 5.031   1.00 14.68 ? 217 GLY B O    1 
ATOM   7794  H  H    . GLY B  1 217 ? 41.826  122.848 5.358   1.00 13.96 ? 217 GLY B H    1 
ATOM   7795  H  HA2  . GLY B  1 217 ? 39.350  123.419 5.022   1.00 15.98 ? 217 GLY B HA2  1 
ATOM   7796  H  HA3  . GLY B  1 217 ? 40.217  122.648 3.960   1.00 15.98 ? 217 GLY B HA3  1 
ATOM   7797  N  N    . GLY B  1 218 ? 39.736  120.258 5.386   1.00 11.87 ? 218 GLY B N    1 
ATOM   7798  C  CA   . GLY B  1 218 ? 39.026  119.004 5.598   1.00 9.49  ? 218 GLY B CA   1 
ATOM   7799  C  C    . GLY B  1 218 ? 38.515  118.763 7.018   1.00 14.68 ? 218 GLY B C    1 
ATOM   7800  O  O    . GLY B  1 218 ? 37.902  117.737 7.308   1.00 12.44 ? 218 GLY B O    1 
ATOM   7801  H  H    . GLY B  1 218 ? 40.591  120.194 5.452   1.00 14.25 ? 218 GLY B H    1 
ATOM   7802  H  HA2  . GLY B  1 218 ? 38.264  118.972 5.000   1.00 11.38 ? 218 GLY B HA2  1 
ATOM   7803  H  HA3  . GLY B  1 218 ? 39.616  118.270 5.368   1.00 11.38 ? 218 GLY B HA3  1 
ATOM   7804  N  N    . LYS B  1 219 ? 38.733  119.736 7.882   1.00 9.40  ? 219 LYS B N    1 
ATOM   7805  C  CA   . LYS B  1 219 ? 38.268  119.677 9.274   1.00 10.77 ? 219 LYS B CA   1 
ATOM   7806  C  C    . LYS B  1 219 ? 38.801  118.493 10.068  1.00 14.98 ? 219 LYS B C    1 
ATOM   7807  O  O    . LYS B  1 219 ? 38.160  118.038 11.033  1.00 15.49 ? 219 LYS B O    1 
ATOM   7808  C  CB   . LYS B  1 219 ? 36.727  119.710 9.317   1.00 14.92 ? 219 LYS B CB   1 
ATOM   7809  C  CG   . LYS B  1 219 ? 36.195  121.019 8.773   1.00 19.47 ? 219 LYS B CG   1 
ATOM   7810  C  CD   . LYS B  1 219 ? 34.725  121.191 9.010   1.00 35.37 ? 219 LYS B CD   1 
ATOM   7811  C  CE   . LYS B  1 219 ? 34.351  122.671 8.989   1.00 42.98 ? 219 LYS B CE   1 
ATOM   7812  N  NZ   . LYS B  1 219 ? 32.876  122.881 9.116   1.00 44.97 ? 219 LYS B NZ   1 
ATOM   7813  H  H    . LYS B  1 219 ? 39.156  120.461 7.691   1.00 11.28 ? 219 LYS B H    1 
ATOM   7814  H  HA   . LYS B  1 219 ? 38.582  120.486 9.729   1.00 12.93 ? 219 LYS B HA   1 
ATOM   7815  H  HB2  . LYS B  1 219 ? 36.375  118.987 8.774   1.00 17.91 ? 219 LYS B HB2  1 
ATOM   7816  H  HB3  . LYS B  1 219 ? 36.429  119.618 10.236  1.00 17.91 ? 219 LYS B HB3  1 
ATOM   7817  H  HG2  . LYS B  1 219 ? 36.657  121.753 9.207   1.00 23.37 ? 219 LYS B HG2  1 
ATOM   7818  H  HG3  . LYS B  1 219 ? 36.350  121.050 7.815   1.00 23.37 ? 219 LYS B HG3  1 
ATOM   7819  H  HD2  . LYS B  1 219 ? 34.229  120.739 8.310   1.00 42.45 ? 219 LYS B HD2  1 
ATOM   7820  H  HD3  . LYS B  1 219 ? 34.493  120.828 9.879   1.00 42.45 ? 219 LYS B HD3  1 
ATOM   7821  H  HE2  . LYS B  1 219 ? 34.785  123.120 9.732   1.00 51.58 ? 219 LYS B HE2  1 
ATOM   7822  H  HE3  . LYS B  1 219 ? 34.640  123.061 8.149   1.00 51.58 ? 219 LYS B HE3  1 
ATOM   7823  H  HZ1  . LYS B  1 219 ? 32.690  123.751 9.101   1.00 53.96 ? 219 LYS B HZ1  1 
ATOM   7824  H  HZ2  . LYS B  1 219 ? 32.453  122.483 8.442   1.00 53.96 ? 219 LYS B HZ2  1 
ATOM   7825  H  HZ3  . LYS B  1 219 ? 32.585  122.537 9.884   1.00 53.96 ? 219 LYS B HZ3  1 
ATOM   7826  N  N    . PHE B  1 220 ? 39.991  118.026 9.699   1.00 16.28 ? 220 PHE B N    1 
ATOM   7827  C  CA   . PHE B  1 220 ? 40.596  116.878 10.346  1.00 16.31 ? 220 PHE B CA   1 
ATOM   7828  C  C    . PHE B  1 220 ? 41.005  117.165 11.803  1.00 14.08 ? 220 PHE B C    1 
ATOM   7829  O  O    . PHE B  1 220 ? 41.124  116.224 12.590  1.00 13.05 ? 220 PHE B O    1 
ATOM   7830  C  CB   . PHE B  1 220 ? 41.778  116.384 9.537   1.00 11.25 ? 220 PHE B CB   1 
ATOM   7831  C  CG   . PHE B  1 220 ? 41.401  115.943 8.155   1.00 8.73  ? 220 PHE B CG   1 
ATOM   7832  C  CD1  . PHE B  1 220 ? 40.591  114.840 7.960   1.00 10.95 ? 220 PHE B CD1  1 
ATOM   7833  C  CD2  . PHE B  1 220 ? 41.837  116.643 7.044   1.00 16.43 ? 220 PHE B CD2  1 
ATOM   7834  C  CE1  . PHE B  1 220 ? 40.241  114.431 6.682   1.00 16.61 ? 220 PHE B CE1  1 
ATOM   7835  C  CE2  . PHE B  1 220 ? 41.494  116.239 5.763   1.00 20.14 ? 220 PHE B CE2  1 
ATOM   7836  C  CZ   . PHE B  1 220 ? 40.686  115.142 5.579   1.00 12.34 ? 220 PHE B CZ   1 
ATOM   7837  H  H    . PHE B  1 220 ? 40.469  118.364 9.069   1.00 19.53 ? 220 PHE B H    1 
ATOM   7838  H  HA   . PHE B  1 220 ? 39.935  116.155 10.367  1.00 19.57 ? 220 PHE B HA   1 
ATOM   7839  H  HB2  . PHE B  1 220 ? 42.426  117.102 9.456   1.00 13.51 ? 220 PHE B HB2  1 
ATOM   7840  H  HB3  . PHE B  1 220 ? 42.179  115.628 9.994   1.00 13.51 ? 220 PHE B HB3  1 
ATOM   7841  H  HD1  . PHE B  1 220 ? 40.286  114.359 8.695   1.00 13.14 ? 220 PHE B HD1  1 
ATOM   7842  H  HD2  . PHE B  1 220 ? 42.382  117.388 7.158   1.00 19.72 ? 220 PHE B HD2  1 
ATOM   7843  H  HE1  . PHE B  1 220 ? 39.696  113.686 6.565   1.00 19.94 ? 220 PHE B HE1  1 
ATOM   7844  H  HE2  . PHE B  1 220 ? 41.797  116.721 5.027   1.00 24.17 ? 220 PHE B HE2  1 
ATOM   7845  H  HZ   . PHE B  1 220 ? 40.454  114.870 4.721   1.00 14.81 ? 220 PHE B HZ   1 
ATOM   7846  N  N    . PHE B  1 221 ? 41.201  118.444 12.145  1.00 9.05  ? 221 PHE B N    1 
ATOM   7847  C  CA   . PHE B  1 221 ? 41.530  118.862 13.511  1.00 9.89  ? 221 PHE B CA   1 
ATOM   7848  C  C    . PHE B  1 221 ? 40.435  118.494 14.487  1.00 12.88 ? 221 PHE B C    1 
ATOM   7849  O  O    . PHE B  1 221 ? 40.678  118.435 15.692  1.00 13.82 ? 221 PHE B O    1 
ATOM   7850  C  CB   . PHE B  1 221 ? 41.777  120.377 13.555  1.00 10.72 ? 221 PHE B CB   1 
ATOM   7851  C  CG   . PHE B  1 221 ? 40.612  121.190 13.044  1.00 14.15 ? 221 PHE B CG   1 
ATOM   7852  C  CD1  . PHE B  1 221 ? 39.509  121.402 13.844  1.00 16.54 ? 221 PHE B CD1  1 
ATOM   7853  C  CD2  . PHE B  1 221 ? 40.623  121.742 11.757  1.00 13.08 ? 221 PHE B CD2  1 
ATOM   7854  C  CE1  . PHE B  1 221 ? 38.424  122.131 13.394  1.00 19.86 ? 221 PHE B CE1  1 
ATOM   7855  C  CE2  . PHE B  1 221 ? 39.543  122.470 11.304  1.00 13.47 ? 221 PHE B CE2  1 
ATOM   7856  C  CZ   . PHE B  1 221 ? 38.438  122.671 12.132  1.00 15.01 ? 221 PHE B CZ   1 
ATOM   7857  H  H    . PHE B  1 221 ? 41.148  119.099 11.591  1.00 10.86 ? 221 PHE B H    1 
ATOM   7858  H  HA   . PHE B  1 221 ? 42.354  118.411 13.793  1.00 11.87 ? 221 PHE B HA   1 
ATOM   7859  H  HB2  . PHE B  1 221 ? 41.945  120.641 14.473  1.00 12.86 ? 221 PHE B HB2  1 
ATOM   7860  H  HB3  . PHE B  1 221 ? 42.549  120.586 13.005  1.00 12.86 ? 221 PHE B HB3  1 
ATOM   7861  H  HD1  . PHE B  1 221 ? 39.490  121.038 14.700  1.00 19.85 ? 221 PHE B HD1  1 
ATOM   7862  H  HD2  . PHE B  1 221 ? 41.357  121.608 11.202  1.00 15.70 ? 221 PHE B HD2  1 
ATOM   7863  H  HE1  . PHE B  1 221 ? 37.690  122.264 13.949  1.00 23.84 ? 221 PHE B HE1  1 
ATOM   7864  H  HE2  . PHE B  1 221 ? 39.555  122.836 10.449  1.00 16.17 ? 221 PHE B HE2  1 
ATOM   7865  H  HZ   . PHE B  1 221 ? 37.711  123.166 11.828  1.00 18.01 ? 221 PHE B HZ   1 
ATOM   7866  N  N    . GLU B  1 222 ? 39.223  118.264 13.987  1.00 10.79 ? 222 GLU B N    1 
ATOM   7867  C  CA   . GLU B  1 222 ? 38.109  117.874 14.844  1.00 11.46 ? 222 GLU B CA   1 
ATOM   7868  C  C    . GLU B  1 222 ? 38.357  116.497 15.488  1.00 8.56  ? 222 GLU B C    1 
ATOM   7869  O  O    . GLU B  1 222 ? 37.895  116.224 16.594  1.00 13.68 ? 222 GLU B O    1 
ATOM   7870  C  CB   . GLU B  1 222 ? 36.791  117.896 14.058  1.00 14.33 ? 222 GLU B CB   1 
ATOM   7871  C  CG   . GLU B  1 222 ? 36.361  119.287 13.638  1.00 18.03 ? 222 GLU B CG   1 
ATOM   7872  C  CD   . GLU B  1 222 ? 35.020  119.308 12.934  1.00 14.59 ? 222 GLU B CD   1 
ATOM   7873  O  OE1  . GLU B  1 222 ? 34.473  118.227 12.632  1.00 13.16 ? 222 GLU B OE1  1 
ATOM   7874  O  OE2  . GLU B  1 222 ? 34.506  120.418 12.700  1.00 21.46 ? 222 GLU B OE2  1 
ATOM   7875  H  H    . GLU B  1 222 ? 39.020  118.327 13.154  1.00 12.94 ? 222 GLU B H    1 
ATOM   7876  H  HA   . GLU B  1 222 ? 38.031  118.529 15.569  1.00 13.75 ? 222 GLU B HA   1 
ATOM   7877  H  HB2  . GLU B  1 222 ? 36.895  117.361 13.256  1.00 17.19 ? 222 GLU B HB2  1 
ATOM   7878  H  HB3  . GLU B  1 222 ? 36.088  117.523 14.614  1.00 17.19 ? 222 GLU B HB3  1 
ATOM   7879  H  HG2  . GLU B  1 222 ? 36.293  119.848 14.426  1.00 21.63 ? 222 GLU B HG2  1 
ATOM   7880  H  HG3  . GLU B  1 222 ? 37.024  119.650 13.029  1.00 21.63 ? 222 GLU B HG3  1 
ATOM   7881  N  N    . VAL B  1 223 ? 39.136  115.656 14.818  1.00 11.31 ? 223 VAL B N    1 
ATOM   7882  C  CA   . VAL B  1 223 ? 39.318  114.295 15.276  1.00 12.20 ? 223 VAL B CA   1 
ATOM   7883  C  C    . VAL B  1 223 ? 40.785  113.879 15.442  1.00 17.42 ? 223 VAL B C    1 
ATOM   7884  O  O    . VAL B  1 223 ? 41.054  112.740 15.810  1.00 24.12 ? 223 VAL B O    1 
ATOM   7885  C  CB   . VAL B  1 223 ? 38.607  113.296 14.329  1.00 16.55 ? 223 VAL B CB   1 
ATOM   7886  C  CG1  . VAL B  1 223 ? 37.101  113.295 14.577  1.00 19.10 ? 223 VAL B CG1  1 
ATOM   7887  C  CG2  . VAL B  1 223 ? 38.892  113.641 12.892  1.00 18.18 ? 223 VAL B CG2  1 
ATOM   7888  H  H    . VAL B  1 223 ? 39.567  115.851 14.100  1.00 13.57 ? 223 VAL B H    1 
ATOM   7889  H  HA   . VAL B  1 223 ? 38.894  114.212 16.156  1.00 14.63 ? 223 VAL B HA   1 
ATOM   7890  H  HB   . VAL B  1 223 ? 38.947  112.393 14.500  1.00 19.86 ? 223 VAL B HB   1 
ATOM   7891  H  HG11 . VAL B  1 223 ? 36.687  112.669 13.978  1.00 22.92 ? 223 VAL B HG11 1 
ATOM   7892  H  HG12 . VAL B  1 223 ? 36.935  113.038 15.487  1.00 22.92 ? 223 VAL B HG12 1 
ATOM   7893  H  HG13 . VAL B  1 223 ? 36.758  114.177 14.418  1.00 22.92 ? 223 VAL B HG13 1 
ATOM   7894  H  HG21 . VAL B  1 223 ? 38.443  113.010 12.325  1.00 21.82 ? 223 VAL B HG21 1 
ATOM   7895  H  HG22 . VAL B  1 223 ? 38.571  114.528 12.714  1.00 21.82 ? 223 VAL B HG22 1 
ATOM   7896  H  HG23 . VAL B  1 223 ? 39.840  113.599 12.743  1.00 21.82 ? 223 VAL B HG23 1 
ATOM   7897  N  N    . ALA B  1 224 ? 41.722  114.783 15.152  1.00 12.22 ? 224 ALA B N    1 
ATOM   7898  C  CA   . ALA B  1 224 ? 43.152  114.544 15.371  1.00 9.70  ? 224 ALA B CA   1 
ATOM   7899  C  C    . ALA B  1 224 ? 43.804  115.912 15.625  1.00 10.03 ? 224 ALA B C    1 
ATOM   7900  O  O    . ALA B  1 224 ? 43.725  116.812 14.776  1.00 8.64  ? 224 ALA B O    1 
ATOM   7901  C  CB   . ALA B  1 224 ? 43.790  113.849 14.138  1.00 9.02  ? 224 ALA B CB   1 
ATOM   7902  H  H    . ALA B  1 224 ? 41.551  115.558 14.821  1.00 14.66 ? 224 ALA B H    1 
ATOM   7903  H  HA   . ALA B  1 224 ? 43.280  113.977 16.160  1.00 11.64 ? 224 ALA B HA   1 
ATOM   7904  H  HB1  . ALA B  1 224 ? 44.723  113.705 14.310  1.00 10.83 ? 224 ALA B HB1  1 
ATOM   7905  H  HB2  . ALA B  1 224 ? 43.350  113.008 13.991  1.00 10.83 ? 224 ALA B HB2  1 
ATOM   7906  H  HB3  . ALA B  1 224 ? 43.681  114.415 13.370  1.00 10.83 ? 224 ALA B HB3  1 
ATOM   7907  N  N    . LYS B  1 225 ? 44.445  116.065 16.784  1.00 10.35 ? 225 LYS B N    1 
ATOM   7908  C  CA   . LYS B  1 225 ? 44.892  117.382 17.218  1.00 7.08  ? 225 LYS B CA   1 
ATOM   7909  C  C    . LYS B  1 225 ? 46.385  117.536 17.464  1.00 7.32  ? 225 LYS B C    1 
ATOM   7910  O  O    . LYS B  1 225 ? 46.792  118.455 18.166  1.00 11.19 ? 225 LYS B O    1 
ATOM   7911  C  CB   . LYS B  1 225 ? 44.125  117.798 18.489  1.00 16.24 ? 225 LYS B CB   1 
ATOM   7912  C  CG   . LYS B  1 225 ? 42.638  118.047 18.258  1.00 21.17 ? 225 LYS B CG   1 
ATOM   7913  C  CD   . LYS B  1 225 ? 41.924  118.365 19.570  1.00 23.81 ? 225 LYS B CD   1 
ATOM   7914  C  CE   . LYS B  1 225 ? 40.537  118.903 19.324  1.00 21.14 ? 225 LYS B CE   1 
ATOM   7915  N  NZ   . LYS B  1 225 ? 39.770  118.049 18.384  1.00 18.07 ? 225 LYS B NZ   1 
ATOM   7916  H  H    . LYS B  1 225 ? 44.631  115.428 17.330  1.00 12.42 ? 225 LYS B H    1 
ATOM   7917  H  HA   . LYS B  1 225 ? 44.653  118.024 16.518  1.00 8.49  ? 225 LYS B HA   1 
ATOM   7918  H  HB2  . LYS B  1 225 ? 44.208  117.092 19.149  1.00 19.49 ? 225 LYS B HB2  1 
ATOM   7919  H  HB3  . LYS B  1 225 ? 44.513  118.617 18.834  1.00 19.49 ? 225 LYS B HB3  1 
ATOM   7920  H  HG2  . LYS B  1 225 ? 42.527  118.802 17.659  1.00 25.40 ? 225 LYS B HG2  1 
ATOM   7921  H  HG3  . LYS B  1 225 ? 42.234  117.252 17.875  1.00 25.40 ? 225 LYS B HG3  1 
ATOM   7922  H  HD2  . LYS B  1 225 ? 41.846  117.554 20.098  1.00 28.57 ? 225 LYS B HD2  1 
ATOM   7923  H  HD3  . LYS B  1 225 ? 42.429  119.035 20.056  1.00 28.57 ? 225 LYS B HD3  1 
ATOM   7924  H  HE2  . LYS B  1 225 ? 40.055  118.937 20.164  1.00 25.37 ? 225 LYS B HE2  1 
ATOM   7925  H  HE3  . LYS B  1 225 ? 40.604  119.791 18.940  1.00 25.37 ? 225 LYS B HE3  1 
ATOM   7926  H  HZ1  . LYS B  1 225 ? 38.958  118.390 18.257  1.00 21.68 ? 225 LYS B HZ1  1 
ATOM   7927  H  HZ2  . LYS B  1 225 ? 40.191  118.005 17.601  1.00 21.68 ? 225 LYS B HZ2  1 
ATOM   7928  H  HZ3  . LYS B  1 225 ? 39.690  117.227 18.716  1.00 21.68 ? 225 LYS B HZ3  1 
ATOM   7929  N  N    . ASN B  1 226 ? 47.218  116.658 16.922  1.00 6.59  ? 226 ASN B N    1 
ATOM   7930  C  CA   . ASN B  1 226 ? 48.658  116.907 16.941  1.00 6.36  ? 226 ASN B CA   1 
ATOM   7931  C  C    . ASN B  1 226 ? 49.198  117.083 15.536  1.00 6.09  ? 226 ASN B C    1 
ATOM   7932  O  O    . ASN B  1 226 ? 49.228  116.131 14.763  1.00 6.00  ? 226 ASN B O    1 
ATOM   7933  C  CB   . ASN B  1 226 ? 49.430  115.778 17.609  1.00 6.36  ? 226 ASN B CB   1 
ATOM   7934  C  CG   . ASN B  1 226 ? 49.262  115.787 19.106  1.00 6.62  ? 226 ASN B CG   1 
ATOM   7935  O  OD1  . ASN B  1 226 ? 50.012  116.476 19.818  1.00 6.63  ? 226 ASN B OD1  1 
ATOM   7936  N  ND2  . ASN B  1 226 ? 48.267  115.062 19.591  1.00 12.96 ? 226 ASN B ND2  1 
ATOM   7937  H  H    . ASN B  1 226 ? 46.984  115.922 16.544  1.00 7.91  ? 226 ASN B H    1 
ATOM   7938  H  HA   . ASN B  1 226 ? 48.833  117.732 17.440  1.00 7.64  ? 226 ASN B HA   1 
ATOM   7939  H  HB2  . ASN B  1 226 ? 49.104  114.928 17.274  1.00 7.63  ? 226 ASN B HB2  1 
ATOM   7940  H  HB3  . ASN B  1 226 ? 50.374  115.876 17.410  1.00 7.63  ? 226 ASN B HB3  1 
ATOM   7941  H  HD21 . ASN B  1 226 ? 47.759  114.619 19.058  1.00 15.55 ? 226 ASN B HD21 1 
ATOM   7942  H  HD22 . ASN B  1 226 ? 48.129  115.034 20.439  1.00 15.55 ? 226 ASN B HD22 1 
ATOM   7943  N  N    . LEU B  1 227 ? 49.610  118.302 15.220  1.00 9.34  ? 227 LEU B N    1 
ATOM   7944  C  CA   . LEU B  1 227 ? 50.305  118.591 13.973  1.00 9.25  ? 227 LEU B CA   1 
ATOM   7945  C  C    . LEU B  1 227 ? 51.810  118.462 14.207  1.00 7.73  ? 227 LEU B C    1 
ATOM   7946  O  O    . LEU B  1 227 ? 52.417  119.230 14.929  1.00 9.12  ? 227 LEU B O    1 
ATOM   7947  C  CB   . LEU B  1 227 ? 49.957  119.992 13.441  1.00 6.89  ? 227 LEU B CB   1 
ATOM   7948  C  CG   . LEU B  1 227 ? 50.558  120.399 12.111  1.00 7.28  ? 227 LEU B CG   1 
ATOM   7949  C  CD1  . LEU B  1 227 ? 49.864  119.677 11.006  1.00 7.92  ? 227 LEU B CD1  1 
ATOM   7950  C  CD2  . LEU B  1 227 ? 50.388  121.920 11.896  1.00 13.24 ? 227 LEU B CD2  1 
ATOM   7951  H  H    . LEU B  1 227 ? 49.496  118.993 15.720  1.00 11.21 ? 227 LEU B H    1 
ATOM   7952  H  HA   . LEU B  1 227 ? 50.042  117.932 13.297  1.00 11.10 ? 227 LEU B HA   1 
ATOM   7953  H  HB2  . LEU B  1 227 ? 48.993  120.046 13.346  1.00 8.27  ? 227 LEU B HB2  1 
ATOM   7954  H  HB3  . LEU B  1 227 ? 50.250  120.643 14.097  1.00 8.27  ? 227 LEU B HB3  1 
ATOM   7955  H  HG   . LEU B  1 227 ? 51.502  120.179 12.090  1.00 8.74  ? 227 LEU B HG   1 
ATOM   7956  H  HD11 . LEU B  1 227 ? 50.251  119.942 10.168  1.00 9.51  ? 227 LEU B HD11 1 
ATOM   7957  H  HD12 . LEU B  1 227 ? 49.973  118.732 11.133  1.00 9.51  ? 227 LEU B HD12 1 
ATOM   7958  H  HD13 . LEU B  1 227 ? 48.931  119.904 11.022  1.00 9.51  ? 227 LEU B HD13 1 
ATOM   7959  H  HD21 . LEU B  1 227 ? 50.773  122.161 11.051  1.00 15.89 ? 227 LEU B HD21 1 
ATOM   7960  H  HD22 . LEU B  1 227 ? 49.452  122.134 11.902  1.00 15.89 ? 227 LEU B HD22 1 
ATOM   7961  H  HD23 . LEU B  1 227 ? 50.835  122.388 12.605  1.00 15.89 ? 227 LEU B HD23 1 
ATOM   7962  N  N    . ASN B  1 228 ? 52.414  117.453 13.599  1.00 5.50  ? 228 ASN B N    1 
ATOM   7963  C  CA   . ASN B  1 228 ? 53.853  117.194 13.766  1.00 5.41  ? 228 ASN B CA   1 
ATOM   7964  C  C    . ASN B  1 228 ? 54.605  117.615 12.499  1.00 6.42  ? 228 ASN B C    1 
ATOM   7965  O  O    . ASN B  1 228 ? 54.363  117.052 11.410  1.00 8.54  ? 228 ASN B O    1 
ATOM   7966  C  CB   . ASN B  1 228 ? 54.041  115.688 14.071  1.00 8.90  ? 228 ASN B CB   1 
ATOM   7967  C  CG   . ASN B  1 228 ? 52.956  115.162 15.015  1.00 9.59  ? 228 ASN B CG   1 
ATOM   7968  O  OD1  . ASN B  1 228 ? 52.834  115.613 16.174  1.00 8.25  ? 228 ASN B OD1  1 
ATOM   7969  N  ND2  . ASN B  1 228 ? 52.111  114.274 14.504  1.00 7.89  ? 228 ASN B ND2  1 
ATOM   7970  H  H    . ASN B  1 228 ? 52.017  116.894 13.079  1.00 6.61  ? 228 ASN B H    1 
ATOM   7971  H  HA   . ASN B  1 228 ? 54.197  117.713 14.523  1.00 6.49  ? 228 ASN B HA   1 
ATOM   7972  H  HB2  . ASN B  1 228 ? 53.991  115.185 13.243  1.00 10.68 ? 228 ASN B HB2  1 
ATOM   7973  H  HB3  . ASN B  1 228 ? 54.903  115.553 14.495  1.00 10.68 ? 228 ASN B HB3  1 
ATOM   7974  H  HD21 . ASN B  1 228 ? 52.191  114.026 13.685  1.00 9.47  ? 228 ASN B HD21 1 
ATOM   7975  H  HD22 . ASN B  1 228 ? 51.483  113.948 14.993  1.00 9.47  ? 228 ASN B HD22 1 
ATOM   7976  N  N    . LEU B  1 229 ? 55.487  118.615 12.630  1.00 5.43  ? 229 LEU B N    1 
ATOM   7977  C  CA   . LEU B  1 229 ? 56.032  119.343 11.461  1.00 7.60  ? 229 LEU B CA   1 
ATOM   7978  C  C    . LEU B  1 229 ? 57.192  118.611 10.763  1.00 5.70  ? 229 LEU B C    1 
ATOM   7979  O  O    . LEU B  1 229 ? 58.341  119.051 10.753  1.00 7.30  ? 229 LEU B O    1 
ATOM   7980  C  CB   . LEU B  1 229 ? 56.469  120.738 11.912  1.00 5.30  ? 229 LEU B CB   1 
ATOM   7981  C  CG   . LEU B  1 229 ? 55.337  121.615 12.423  1.00 7.88  ? 229 LEU B CG   1 
ATOM   7982  C  CD1  . LEU B  1 229 ? 55.894  122.935 12.868  1.00 10.14 ? 229 LEU B CD1  1 
ATOM   7983  C  CD2  . LEU B  1 229 ? 54.249  121.844 11.401  1.00 9.59  ? 229 LEU B CD2  1 
ATOM   7984  H  H    . LEU B  1 229 ? 55.789  118.896 13.385  1.00 6.51  ? 229 LEU B H    1 
ATOM   7985  H  HA   . LEU B  1 229 ? 55.315  119.455 10.802  1.00 9.12  ? 229 LEU B HA   1 
ATOM   7986  H  HB2  . LEU B  1 229 ? 57.115  120.644 12.630  1.00 6.36  ? 229 LEU B HB2  1 
ATOM   7987  H  HB3  . LEU B  1 229 ? 56.879  121.194 11.161  1.00 6.36  ? 229 LEU B HB3  1 
ATOM   7988  H  HG   . LEU B  1 229 ? 54.934  121.187 13.194  1.00 9.45  ? 229 LEU B HG   1 
ATOM   7989  H  HD11 . LEU B  1 229 ? 55.174  123.485 13.189  1.00 12.17 ? 229 LEU B HD11 1 
ATOM   7990  H  HD12 . LEU B  1 229 ? 56.530  122.785 13.571  1.00 12.17 ? 229 LEU B HD12 1 
ATOM   7991  H  HD13 . LEU B  1 229 ? 56.323  123.361 12.123  1.00 12.17 ? 229 LEU B HD13 1 
ATOM   7992  H  HD21 . LEU B  1 229 ? 53.571  122.403 11.788  1.00 11.51 ? 229 LEU B HD21 1 
ATOM   7993  H  HD22 . LEU B  1 229 ? 54.629  122.275 10.632  1.00 11.51 ? 229 LEU B HD22 1 
ATOM   7994  H  HD23 . LEU B  1 229 ? 53.873  120.998 11.150  1.00 11.51 ? 229 LEU B HD23 1 
ATOM   7995  N  N    . THR B  1 230 ? 56.881  117.422 10.260  1.00 6.22  ? 230 THR B N    1 
ATOM   7996  C  CA   . THR B  1 230 ? 57.847  116.596 9.565   1.00 4.99  ? 230 THR B CA   1 
ATOM   7997  C  C    . THR B  1 230 ? 58.306  117.208 8.223   1.00 4.84  ? 230 THR B C    1 
ATOM   7998  O  O    . THR B  1 230 ? 59.441  117.027 7.831   1.00 5.63  ? 230 THR B O    1 
ATOM   7999  C  CB   . THR B  1 230 ? 57.284  115.200 9.324   1.00 4.88  ? 230 THR B CB   1 
ATOM   8000  O  OG1  . THR B  1 230 ? 55.971  115.307 8.743   1.00 6.19  ? 230 THR B OG1  1 
ATOM   8001  C  CG2  . THR B  1 230 ? 57.215  114.432 10.655  1.00 5.96  ? 230 THR B CG2  1 
ATOM   8002  H  H    . THR B  1 230 ? 56.099  117.068 10.311  1.00 7.47  ? 230 THR B H    1 
ATOM   8003  H  HA   . THR B  1 230 ? 58.640  116.501 10.133  1.00 5.99  ? 230 THR B HA   1 
ATOM   8004  H  HB   . THR B  1 230 ? 57.867  114.716 8.719   1.00 5.85  ? 230 THR B HB   1 
ATOM   8005  H  HG1  . THR B  1 230 ? 55.472  115.715 9.249   1.00 7.43  ? 230 THR B HG1  1 
ATOM   8006  H  HG21 . THR B  1 230 ? 56.860  113.552 10.507  1.00 7.15  ? 230 THR B HG21 1 
ATOM   8007  H  HG22 . THR B  1 230 ? 58.093  114.355 11.035  1.00 7.15  ? 230 THR B HG22 1 
ATOM   8008  H  HG23 . THR B  1 230 ? 56.647  114.897 11.273  1.00 7.15  ? 230 THR B HG23 1 
ATOM   8009  N  N    . ALA B  1 231 ? 57.417  117.930 7.553   1.00 4.99  ? 231 ALA B N    1 
ATOM   8010  C  CA   . ALA B  1 231 ? 57.771  118.694 6.365   1.00 8.69  ? 231 ALA B CA   1 
ATOM   8011  C  C    . ALA B  1 231 ? 58.444  117.767 5.374   1.00 8.11  ? 231 ALA B C    1 
ATOM   8012  O  O    . ALA B  1 231 ? 59.443  118.130 4.748   1.00 6.34  ? 231 ALA B O    1 
ATOM   8013  C  CB   . ALA B  1 231 ? 58.676  119.836 6.702   1.00 12.65 ? 231 ALA B CB   1 
ATOM   8014  H  H    . ALA B  1 231 ? 56.587  117.995 7.771   1.00 5.99  ? 231 ALA B H    1 
ATOM   8015  H  HA   . ALA B  1 231 ? 56.958  119.053 5.952   1.00 10.43 ? 231 ALA B HA   1 
ATOM   8016  H  HB1  . ALA B  1 231 ? 58.888  120.315 5.897   1.00 15.18 ? 231 ALA B HB1  1 
ATOM   8017  H  HB2  . ALA B  1 231 ? 58.228  120.417 7.321   1.00 15.18 ? 231 ALA B HB2  1 
ATOM   8018  H  HB3  . ALA B  1 231 ? 59.479  119.491 7.099   1.00 15.18 ? 231 ALA B HB3  1 
ATOM   8019  N  N    . HIS B  1 232 ? 57.887  116.569 5.252   1.00 7.59  ? 232 HIS B N    1 
ATOM   8020  C  CA   . HIS B  1 232 ? 58.558  115.484 4.524   1.00 9.54  ? 232 HIS B CA   1 
ATOM   8021  C  C    . HIS B  1 232 ? 58.464  115.661 3.008   1.00 8.91  ? 232 HIS B C    1 
ATOM   8022  O  O    . HIS B  1 232 ? 59.307  115.143 2.278   1.00 9.19  ? 232 HIS B O    1 
ATOM   8023  C  CB   . HIS B  1 232 ? 58.051  114.109 4.973   1.00 9.09  ? 232 HIS B CB   1 
ATOM   8024  C  CG   . HIS B  1 232 ? 56.558  113.985 5.010   1.00 7.33  ? 232 HIS B CG   1 
ATOM   8025  N  ND1  . HIS B  1 232 ? 55.807  114.283 6.125   1.00 8.83  ? 232 HIS B ND1  1 
ATOM   8026  C  CD2  . HIS B  1 232 ? 55.678  113.589 4.068   1.00 9.14  ? 232 HIS B CD2  1 
ATOM   8027  C  CE1  . HIS B  1 232 ? 54.528  114.065 5.872   1.00 5.31  ? 232 HIS B CE1  1 
ATOM   8028  N  NE2  . HIS B  1 232 ? 54.422  113.651 4.617   1.00 6.31  ? 232 HIS B NE2  1 
ATOM   8029  H  H    . HIS B  1 232 ? 57.122  116.353 5.580   1.00 9.11  ? 232 HIS B H    1 
ATOM   8030  H  HA   . HIS B  1 232 ? 59.511  115.520 4.751   1.00 11.45 ? 232 HIS B HA   1 
ATOM   8031  H  HB2  . HIS B  1 232 ? 58.388  113.438 4.360   1.00 10.91 ? 232 HIS B HB2  1 
ATOM   8032  H  HB3  . HIS B  1 232 ? 58.384  113.932 5.867   1.00 10.91 ? 232 HIS B HB3  1 
ATOM   8033  H  HD1  . HIS B  1 232 ? 56.123  114.556 6.877   1.00 10.60 ? 232 HIS B HD1  1 
ATOM   8034  H  HD2  . HIS B  1 232 ? 55.885  113.323 3.201   1.00 10.97 ? 232 HIS B HD2  1 
ATOM   8035  H  HE1  . HIS B  1 232 ? 53.823  114.199 6.465   1.00 6.37  ? 232 HIS B HE1  1 
ATOM   8036  H  HE2  . HIS B  1 232 ? 53.689  113.447 4.217   1.00 7.57  ? 232 HIS B HE2  1 
ATOM   8037  N  N    . THR B  1 233 ? 57.439  116.358 2.532   1.00 4.73  ? 233 THR B N    1 
ATOM   8038  C  CA   . THR B  1 233 ? 57.267  116.559 1.086   1.00 7.98  ? 233 THR B CA   1 
ATOM   8039  C  C    . THR B  1 233 ? 56.883  117.992 0.772   1.00 11.15 ? 233 THR B C    1 
ATOM   8040  O  O    . THR B  1 233 ? 55.906  118.491 1.310   1.00 10.25 ? 233 THR B O    1 
ATOM   8041  C  CB   . THR B  1 233 ? 56.141  115.682 0.544   1.00 11.48 ? 233 THR B CB   1 
ATOM   8042  O  OG1  . THR B  1 233 ? 56.466  114.315 0.779   1.00 20.92 ? 233 THR B OG1  1 
ATOM   8043  C  CG2  . THR B  1 233 ? 55.960  115.908 -0.973  1.00 5.87  ? 233 THR B CG2  1 
ATOM   8044  H  H    . THR B  1 233 ? 56.831  116.726 3.016   1.00 5.67  ? 233 THR B H    1 
ATOM   8045  H  HA   . THR B  1 233 ? 58.099  116.340 0.615   1.00 9.57  ? 233 THR B HA   1 
ATOM   8046  H  HB   . THR B  1 233 ? 55.310  115.902 0.993   1.00 13.78 ? 233 THR B HB   1 
ATOM   8047  H  HG1  . THR B  1 233 ? 57.167  114.125 0.400   1.00 25.10 ? 233 THR B HG1  1 
ATOM   8048  H  HG21 . THR B  1 233 ? 55.251  115.353 -1.305  1.00 7.04  ? 233 THR B HG21 1 
ATOM   8049  H  HG22 . THR B  1 233 ? 55.743  116.827 -1.144  1.00 7.04  ? 233 THR B HG22 1 
ATOM   8050  H  HG23 . THR B  1 233 ? 56.772  115.687 -1.436  1.00 7.04  ? 233 THR B HG23 1 
ATOM   8051  N  N    . LYS B  1 234 ? 57.668  118.665 -0.058  1.00 6.80  ? 234 LYS B N    1 
ATOM   8052  C  CA   . LYS B  1 234 ? 57.213  119.926 -0.653  1.00 10.53 ? 234 LYS B CA   1 
ATOM   8053  C  C    . LYS B  1 234 ? 56.423  119.574 -1.911  1.00 6.51  ? 234 LYS B C    1 
ATOM   8054  O  O    . LYS B  1 234 ? 57.004  119.327 -2.945  1.00 5.14  ? 234 LYS B O    1 
ATOM   8055  C  CB   . LYS B  1 234 ? 58.404  120.802 -1.035  1.00 11.84 ? 234 LYS B CB   1 
ATOM   8056  C  CG   . LYS B  1 234 ? 59.258  121.285 0.117   1.00 12.01 ? 234 LYS B CG   1 
ATOM   8057  C  CD   . LYS B  1 234 ? 58.615  122.295 0.985   1.00 20.61 ? 234 LYS B CD   1 
ATOM   8058  C  CE   . LYS B  1 234 ? 59.416  122.366 2.290   1.00 24.09 ? 234 LYS B CE   1 
ATOM   8059  N  NZ   . LYS B  1 234 ? 58.850  123.324 3.224   1.00 22.55 ? 234 LYS B NZ   1 
ATOM   8060  H  H    . LYS B  1 234 ? 58.458  118.422 -0.294  1.00 8.16  ? 234 LYS B H    1 
ATOM   8061  H  HA   . LYS B  1 234 ? 56.636  120.412 -0.029  1.00 12.64 ? 234 LYS B HA   1 
ATOM   8062  H  HB2  . LYS B  1 234 ? 58.979  120.295 -1.629  1.00 14.20 ? 234 LYS B HB2  1 
ATOM   8063  H  HB3  . LYS B  1 234 ? 58.071  121.586 -1.498  1.00 14.20 ? 234 LYS B HB3  1 
ATOM   8064  H  HG2  . LYS B  1 234 ? 59.487  120.524 0.674   1.00 14.41 ? 234 LYS B HG2  1 
ATOM   8065  H  HG3  . LYS B  1 234 ? 60.068  121.680 -0.242  1.00 14.41 ? 234 LYS B HG3  1 
ATOM   8066  H  HD2  . LYS B  1 234 ? 58.636  123.164 0.554   1.00 24.73 ? 234 LYS B HD2  1 
ATOM   8067  H  HD3  . LYS B  1 234 ? 57.705  122.028 1.187   1.00 24.73 ? 234 LYS B HD3  1 
ATOM   8068  H  HE2  . LYS B  1 234 ? 59.414  121.493 2.713   1.00 28.91 ? 234 LYS B HE2  1 
ATOM   8069  H  HE3  . LYS B  1 234 ? 60.326  122.638 2.091   1.00 28.91 ? 234 LYS B HE3  1 
ATOM   8070  H  HZ1  . LYS B  1 234 ? 59.335  123.344 3.971   1.00 27.06 ? 234 LYS B HZ1  1 
ATOM   8071  H  HZ2  . LYS B  1 234 ? 58.846  124.137 2.861   1.00 27.06 ? 234 LYS B HZ2  1 
ATOM   8072  H  HZ3  . LYS B  1 234 ? 58.015  123.094 3.428   1.00 27.06 ? 234 LYS B HZ3  1 
ATOM   8073  N  N    . HIS B  1 235 ? 55.104  119.517 -1.824  1.00 5.60  ? 235 HIS B N    1 
ATOM   8074  C  CA   . HIS B  1 235 ? 54.360  118.707 -2.768  1.00 6.75  ? 235 HIS B CA   1 
ATOM   8075  C  C    . HIS B  1 235 ? 53.999  119.506 -4.023  1.00 5.23  ? 235 HIS B C    1 
ATOM   8076  O  O    . HIS B  1 235 ? 53.354  120.550 -3.929  1.00 6.31  ? 235 HIS B O    1 
ATOM   8077  C  CB   . HIS B  1 235 ? 53.108  118.188 -2.087  1.00 9.49  ? 235 HIS B CB   1 
ATOM   8078  C  CG   . HIS B  1 235 ? 52.327  117.192 -2.881  1.00 7.96  ? 235 HIS B CG   1 
ATOM   8079  N  ND1  . HIS B  1 235 ? 52.205  115.863 -2.514  1.00 5.19  ? 235 HIS B ND1  1 
ATOM   8080  C  CD2  . HIS B  1 235 ? 51.562  117.356 -3.984  1.00 5.36  ? 235 HIS B CD2  1 
ATOM   8081  C  CE1  . HIS B  1 235 ? 51.418  115.251 -3.388  1.00 6.07  ? 235 HIS B CE1  1 
ATOM   8082  N  NE2  . HIS B  1 235 ? 51.021  116.139 -4.285  1.00 8.06  ? 235 HIS B NE2  1 
ATOM   8083  H  H    . HIS B  1 235 ? 54.625  119.930 -1.241  1.00 6.72  ? 235 HIS B H    1 
ATOM   8084  H  HA   . HIS B  1 235 ? 54.905  117.938 -3.037  1.00 8.09  ? 235 HIS B HA   1 
ATOM   8085  H  HB2  . HIS B  1 235 ? 53.363  117.762 -1.254  1.00 11.38 ? 235 HIS B HB2  1 
ATOM   8086  H  HB3  . HIS B  1 235 ? 52.522  118.939 -1.903  1.00 11.38 ? 235 HIS B HB3  1 
ATOM   8087  H  HD1  . HIS B  1 235 ? 52.586  115.493 -1.837  1.00 6.23  ? 235 HIS B HD1  1 
ATOM   8088  H  HD2  . HIS B  1 235 ? 51.439  118.147 -4.458  1.00 6.43  ? 235 HIS B HD2  1 
ATOM   8089  H  HE1  . HIS B  1 235 ? 51.189  114.350 -3.376  1.00 7.28  ? 235 HIS B HE1  1 
ATOM   8090  H  HE2  . HIS B  1 235 ? 50.506  115.974 -4.954  1.00 9.67  ? 235 HIS B HE2  1 
ATOM   8091  N  N    . MET B  1 236 ? 54.402  118.996 -5.181  1.00 5.46  ? 236 MET B N    1 
ATOM   8092  C  CA   . MET B  1 236 ? 54.008  119.566 -6.469  1.00 8.26  ? 236 MET B CA   1 
ATOM   8093  C  C    . MET B  1 236 ? 52.936  118.675 -7.107  1.00 8.21  ? 236 MET B C    1 
ATOM   8094  O  O    . MET B  1 236 ? 53.039  117.454 -7.039  1.00 6.23  ? 236 MET B O    1 
ATOM   8095  C  CB   . MET B  1 236 ? 55.198  119.595 -7.405  1.00 5.52  ? 236 MET B CB   1 
ATOM   8096  C  CG   . MET B  1 236 ? 56.342  120.346 -6.912  1.00 9.39  ? 236 MET B CG   1 
ATOM   8097  S  SD   . MET B  1 236 ? 55.919  122.070 -6.593  1.00 21.51 ? 236 MET B SD   1 
ATOM   8098  C  CE   . MET B  1 236 ? 55.548  122.642 -8.189  1.00 14.32 ? 236 MET B CE   1 
ATOM   8099  H  H    . MET B  1 236 ? 54.912  118.307 -5.251  1.00 6.55  ? 236 MET B H    1 
ATOM   8100  H  HA   . MET B  1 236 ? 53.667  120.477 -6.348  1.00 9.91  ? 236 MET B HA   1 
ATOM   8101  H  HB2  . MET B  1 236 ? 55.491  118.684 -7.562  1.00 6.63  ? 236 MET B HB2  1 
ATOM   8102  H  HB3  . MET B  1 236 ? 54.922  119.998 -8.243  1.00 6.63  ? 236 MET B HB3  1 
ATOM   8103  H  HG2  . MET B  1 236 ? 56.650  119.950 -6.082  1.00 11.26 ? 236 MET B HG2  1 
ATOM   8104  H  HG3  . MET B  1 236 ? 57.048  120.324 -7.577  1.00 11.26 ? 236 MET B HG3  1 
ATOM   8105  H  HE1  . MET B  1 236 ? 55.304  123.569 -8.139  1.00 17.18 ? 236 MET B HE1  1 
ATOM   8106  H  HE2  . MET B  1 236 ? 56.322  122.536 -8.746  1.00 17.18 ? 236 MET B HE2  1 
ATOM   8107  H  HE3  . MET B  1 236 ? 54.817  122.129 -8.542  1.00 17.18 ? 236 MET B HE3  1 
ATOM   8108  N  N    . SER B  1 237 ? 51.911  119.279 -7.693  1.00 5.74  ? 237 SER B N    1 
ATOM   8109  C  CA   . SER B  1 237 ? 50.778  118.540 -8.238  1.00 5.89  ? 237 SER B CA   1 
ATOM   8110  C  C    . SER B  1 237 ? 50.618  118.721 -9.756  1.00 6.12  ? 237 SER B C    1 
ATOM   8111  O  O    . SER B  1 237 ? 50.594  119.858 -10.204 1.00 7.47  ? 237 SER B O    1 
ATOM   8112  C  CB   . SER B  1 237 ? 49.507  119.059 -7.618  1.00 5.98  ? 237 SER B CB   1 
ATOM   8113  O  OG   . SER B  1 237 ? 49.423  118.632 -6.262  1.00 5.83  ? 237 SER B OG   1 
ATOM   8114  H  H    . SER B  1 237 ? 51.845  120.131 -7.788  1.00 6.89  ? 237 SER B H    1 
ATOM   8115  H  HA   . SER B  1 237 ? 50.868  117.585 -8.036  1.00 7.07  ? 237 SER B HA   1 
ATOM   8116  H  HB2  . SER B  1 237 ? 49.511  120.029 -7.647  1.00 7.17  ? 237 SER B HB2  1 
ATOM   8117  H  HB3  . SER B  1 237 ? 48.746  118.712 -8.109  1.00 7.17  ? 237 SER B HB3  1 
ATOM   8118  H  HG   . SER B  1 237 ? 48.732  118.913 -5.921  1.00 6.99  ? 237 SER B HG   1 
ATOM   8119  N  N    . PRO B  1 238 ? 50.419  117.616 -10.526 1.00 6.24  ? 238 PRO B N    1 
ATOM   8120  C  CA   . PRO B  1 238 ? 50.032  117.706 -11.939 1.00 6.51  ? 238 PRO B CA   1 
ATOM   8121  C  C    . PRO B  1 238 ? 48.502  117.740 -12.094 1.00 6.74  ? 238 PRO B C    1 
ATOM   8122  O  O    . PRO B  1 238 ? 47.807  117.201 -11.231 1.00 6.71  ? 238 PRO B O    1 
ATOM   8123  C  CB   . PRO B  1 238 ? 50.566  116.401 -12.515 1.00 6.56  ? 238 PRO B CB   1 
ATOM   8124  C  CG   . PRO B  1 238 ? 50.312  115.425 -11.406 1.00 6.42  ? 238 PRO B CG   1 
ATOM   8125  C  CD   . PRO B  1 238 ? 50.538  116.211 -10.107 1.00 9.15  ? 238 PRO B CD   1 
ATOM   8126  H  HA   . PRO B  1 238 ? 50.446  118.476 -12.382 1.00 7.82  ? 238 PRO B HA   1 
ATOM   8127  H  HB2  . PRO B  1 238 ? 50.071  116.161 -13.314 1.00 7.87  ? 238 PRO B HB2  1 
ATOM   8128  H  HB3  . PRO B  1 238 ? 51.515  116.482 -12.700 1.00 7.87  ? 238 PRO B HB3  1 
ATOM   8129  H  HG2  . PRO B  1 238 ? 49.398  115.105 -11.457 1.00 7.70  ? 238 PRO B HG2  1 
ATOM   8130  H  HG3  . PRO B  1 238 ? 50.937  114.687 -11.472 1.00 7.70  ? 238 PRO B HG3  1 
ATOM   8131  H  HD2  . PRO B  1 238 ? 49.851  115.994 -9.457  1.00 10.98 ? 238 PRO B HD2  1 
ATOM   8132  H  HD3  . PRO B  1 238 ? 51.426  116.038 -9.758  1.00 10.98 ? 238 PRO B HD3  1 
ATOM   8133  N  N    . PHE B  1 239 ? 47.998  118.463 -13.090 1.00 6.99  ? 239 PHE B N    1 
ATOM   8134  C  CA   . PHE B  1 239 ? 46.620  118.300 -13.555 1.00 7.29  ? 239 PHE B CA   1 
ATOM   8135  C  C    . PHE B  1 239 ? 46.664  117.621 -14.908 1.00 7.62  ? 239 PHE B C    1 
ATOM   8136  O  O    . PHE B  1 239 ? 47.468  118.009 -15.777 1.00 9.42  ? 239 PHE B O    1 
ATOM   8137  C  CB   . PHE B  1 239 ? 45.910  119.644 -13.609 1.00 7.44  ? 239 PHE B CB   1 
ATOM   8138  C  CG   . PHE B  1 239 ? 45.461  120.122 -12.228 1.00 7.72  ? 239 PHE B CG   1 
ATOM   8139  C  CD1  . PHE B  1 239 ? 46.382  120.620 -11.317 1.00 7.00  ? 239 PHE B CD1  1 
ATOM   8140  C  CD2  . PHE B  1 239 ? 44.137  120.027 -11.846 1.00 9.13  ? 239 PHE B CD2  1 
ATOM   8141  C  CE1  . PHE B  1 239 ? 45.974  121.007 -10.042 1.00 8.12  ? 239 PHE B CE1  1 
ATOM   8142  C  CE2  . PHE B  1 239 ? 43.736  120.415 -10.573 1.00 7.38  ? 239 PHE B CE2  1 
ATOM   8143  C  CZ   . PHE B  1 239 ? 44.648  120.914 -9.695  1.00 7.08  ? 239 PHE B CZ   1 
ATOM   8144  H  H    . PHE B  1 239 ? 48.439  119.063 -13.520 1.00 8.39  ? 239 PHE B H    1 
ATOM   8145  H  HA   . PHE B  1 239 ? 46.134  117.719 -12.934 1.00 8.75  ? 239 PHE B HA   1 
ATOM   8146  H  HB2  . PHE B  1 239 ? 46.515  120.308 -13.975 1.00 8.93  ? 239 PHE B HB2  1 
ATOM   8147  H  HB3  . PHE B  1 239 ? 45.124  119.564 -14.171 1.00 8.93  ? 239 PHE B HB3  1 
ATOM   8148  H  HD1  . PHE B  1 239 ? 47.280  120.679 -11.553 1.00 8.40  ? 239 PHE B HD1  1 
ATOM   8149  H  HD2  . PHE B  1 239 ? 43.510  119.683 -12.440 1.00 10.95 ? 239 PHE B HD2  1 
ATOM   8150  H  HE1  . PHE B  1 239 ? 46.592  121.351 -9.438  1.00 9.74  ? 239 PHE B HE1  1 
ATOM   8151  H  HE2  . PHE B  1 239 ? 42.840  120.357 -10.330 1.00 8.86  ? 239 PHE B HE2  1 
ATOM   8152  H  HZ   . PHE B  1 239 ? 44.373  121.183 -8.848  1.00 8.50  ? 239 PHE B HZ   1 
ATOM   8153  N  N    . VAL B  1 240 ? 45.790  116.641 -15.100 1.00 10.95 ? 240 VAL B N    1 
ATOM   8154  C  CA   . VAL B  1 240 ? 45.882  115.741 -16.244 1.00 10.12 ? 240 VAL B CA   1 
ATOM   8155  C  C    . VAL B  1 240 ? 44.527  115.533 -16.896 1.00 13.30 ? 240 VAL B C    1 
ATOM   8156  O  O    . VAL B  1 240 ? 43.497  115.803 -16.286 1.00 11.48 ? 240 VAL B O    1 
ATOM   8157  C  CB   . VAL B  1 240 ? 46.478  114.378 -15.805 1.00 12.28 ? 240 VAL B CB   1 
ATOM   8158  C  CG1  . VAL B  1 240 ? 47.749  114.611 -15.011 1.00 8.86  ? 240 VAL B CG1  1 
ATOM   8159  C  CG2  . VAL B  1 240 ? 45.474  113.567 -15.000 1.00 11.87 ? 240 VAL B CG2  1 
ATOM   8160  H  H    . VAL B  1 240 ? 45.128  116.474 -14.578 1.00 13.14 ? 240 VAL B H    1 
ATOM   8161  H  HA   . VAL B  1 240 ? 46.482  116.133 -16.912 1.00 12.14 ? 240 VAL B HA   1 
ATOM   8162  H  HB   . VAL B  1 240 ? 46.712  113.861 -16.604 1.00 14.73 ? 240 VAL B HB   1 
ATOM   8163  H  HG11 . VAL B  1 240 ? 48.110  113.763 -14.744 1.00 10.63 ? 240 VAL B HG11 1 
ATOM   8164  H  HG12 . VAL B  1 240 ? 48.381  115.078 -15.563 1.00 10.63 ? 240 VAL B HG12 1 
ATOM   8165  H  HG13 . VAL B  1 240 ? 47.540  115.138 -14.236 1.00 10.63 ? 240 VAL B HG13 1 
ATOM   8166  H  HG21 . VAL B  1 240 ? 45.878  112.734 -14.747 1.00 14.25 ? 240 VAL B HG21 1 
ATOM   8167  H  HG22 . VAL B  1 240 ? 45.229  114.064 -14.216 1.00 14.25 ? 240 VAL B HG22 1 
ATOM   8168  H  HG23 . VAL B  1 240 ? 44.698  113.405 -15.541 1.00 14.25 ? 240 VAL B HG23 1 
ATOM   8169  N  N    . ALA B  1 241 ? 44.548  115.112 -18.159 1.00 8.74  ? 241 ALA B N    1 
ATOM   8170  C  CA   . ALA B  1 241 ? 43.351  114.662 -18.860 1.00 12.55 ? 241 ALA B CA   1 
ATOM   8171  C  C    . ALA B  1 241 ? 43.720  113.392 -19.623 1.00 10.26 ? 241 ALA B C    1 
ATOM   8172  O  O    . ALA B  1 241 ? 44.888  113.086 -19.790 1.00 12.12 ? 241 ALA B O    1 
ATOM   8173  C  CB   . ALA B  1 241 ? 42.865  115.732 -19.826 1.00 13.72 ? 241 ALA B CB   1 
ATOM   8174  H  H    . ALA B  1 241 ? 45.260  115.077 -18.640 1.00 10.49 ? 241 ALA B H    1 
ATOM   8175  H  HA   . ALA B  1 241 ? 42.639  114.458 -18.218 1.00 15.06 ? 241 ALA B HA   1 
ATOM   8176  H  HB1  . ALA B  1 241 ? 42.078  115.413 -20.274 1.00 16.47 ? 241 ALA B HB1  1 
ATOM   8177  H  HB2  . ALA B  1 241 ? 42.660  116.529 -19.332 1.00 16.47 ? 241 ALA B HB2  1 
ATOM   8178  H  HB3  . ALA B  1 241 ? 43.557  115.912 -20.467 1.00 16.47 ? 241 ALA B HB3  1 
ATOM   8179  N  N    . GLY B  1 242 ? 42.734  112.640 -20.073 1.00 11.16 ? 242 GLY B N    1 
ATOM   8180  C  CA   . GLY B  1 242 ? 43.021  111.527 -20.960 1.00 10.09 ? 242 GLY B CA   1 
ATOM   8181  C  C    . GLY B  1 242 ? 43.525  112.077 -22.282 1.00 13.77 ? 242 GLY B C    1 
ATOM   8182  O  O    . GLY B  1 242 ? 43.078  113.123 -22.731 1.00 16.48 ? 242 GLY B O    1 
ATOM   8183  H  H    . GLY B  1 242 ? 41.901  112.748 -19.885 1.00 13.40 ? 242 GLY B H    1 
ATOM   8184  H  HA2  . GLY B  1 242 ? 43.701  110.956 -20.571 1.00 12.11 ? 242 GLY B HA2  1 
ATOM   8185  H  HA3  . GLY B  1 242 ? 42.217  111.007 -21.116 1.00 12.11 ? 242 GLY B HA3  1 
ATOM   8186  N  N    . THR B  1 243 ? 44.483  111.387 -22.890 1.00 10.29 ? 243 THR B N    1 
ATOM   8187  C  CA   . THR B  1 243 ? 44.988  111.770 -24.219 1.00 14.00 ? 243 THR B CA   1 
ATOM   8188  C  C    . THR B  1 243 ? 43.886  111.776 -25.282 1.00 19.55 ? 243 THR B C    1 
ATOM   8189  O  O    . THR B  1 243 ? 43.835  112.667 -26.152 1.00 23.18 ? 243 THR B O    1 
ATOM   8190  C  CB   . THR B  1 243 ? 46.119  110.833 -24.624 1.00 17.42 ? 243 THR B CB   1 
ATOM   8191  O  OG1  . THR B  1 243 ? 45.626  109.497 -24.676 1.00 20.09 ? 243 THR B OG1  1 
ATOM   8192  C  CG2  . THR B  1 243 ? 47.260  110.921 -23.613 1.00 15.62 ? 243 THR B CG2  1 
ATOM   8193  H  H    . THR B  1 243 ? 44.863  110.690 -22.559 1.00 12.35 ? 243 THR B H    1 
ATOM   8194  H  HA   . THR B  1 243 ? 45.356  112.677 -24.167 1.00 16.80 ? 243 THR B HA   1 
ATOM   8195  H  HB   . THR B  1 243 ? 46.458  111.089 -25.496 1.00 20.91 ? 243 THR B HB   1 
ATOM   8196  H  HG1  . THR B  1 243 ? 45.019  109.443 -25.225 1.00 24.11 ? 243 THR B HG1  1 
ATOM   8197  H  HG21 . THR B  1 243 ? 47.971  110.330 -23.869 1.00 18.74 ? 243 THR B HG21 1 
ATOM   8198  H  HG22 . THR B  1 243 ? 47.597  111.819 -23.577 1.00 18.74 ? 243 THR B HG22 1 
ATOM   8199  H  HG23 . THR B  1 243 ? 46.945  110.671 -22.741 1.00 18.74 ? 243 THR B HG23 1 
ATOM   8200  N  N    . ALA B  1 244 ? 42.983  110.808 -25.191 1.00 20.81 ? 244 ALA B N    1 
ATOM   8201  C  CA   . ALA B  1 244 ? 41.836  110.746 -26.083 1.00 29.84 ? 244 ALA B CA   1 
ATOM   8202  C  C    . ALA B  1 244 ? 41.113  112.089 -26.100 1.00 23.15 ? 244 ALA B C    1 
ATOM   8203  O  O    . ALA B  1 244 ? 40.908  112.695 -27.161 1.00 29.28 ? 244 ALA B O    1 
ATOM   8204  C  CB   . ALA B  1 244 ? 40.887  109.638 -25.640 1.00 34.06 ? 244 ALA B CB   1 
ATOM   8205  H  H    . ALA B  1 244 ? 43.013  110.170 -24.615 1.00 24.97 ? 244 ALA B H    1 
ATOM   8206  H  HA   . ALA B  1 244 ? 42.142  110.548 -26.992 1.00 35.81 ? 244 ALA B HA   1 
ATOM   8207  H  HB1  . ALA B  1 244 ? 40.138  109.612 -26.239 1.00 40.87 ? 244 ALA B HB1  1 
ATOM   8208  H  HB2  . ALA B  1 244 ? 41.355  108.800 -25.663 1.00 40.87 ? 244 ALA B HB2  1 
ATOM   8209  H  HB3  . ALA B  1 244 ? 40.587  109.822 -24.747 1.00 40.87 ? 244 ALA B HB3  1 
ATOM   8210  N  N    . PHE B  1 245 ? 40.749  112.563 -24.917 1.00 21.84 ? 245 PHE B N    1 
ATOM   8211  C  CA   . PHE B  1 245 ? 40.027  113.807 -24.808 1.00 21.98 ? 245 PHE B CA   1 
ATOM   8212  C  C    . PHE B  1 245 ? 40.912  114.970 -25.221 1.00 22.22 ? 245 PHE B C    1 
ATOM   8213  O  O    . PHE B  1 245 ? 40.510  115.831 -25.993 1.00 18.28 ? 245 PHE B O    1 
ATOM   8214  C  CB   . PHE B  1 245 ? 39.535  114.020 -23.366 1.00 16.94 ? 245 PHE B CB   1 
ATOM   8215  C  CG   . PHE B  1 245 ? 38.882  115.339 -23.150 1.00 24.15 ? 245 PHE B CG   1 
ATOM   8216  C  CD1  . PHE B  1 245 ? 37.661  115.627 -23.741 1.00 20.45 ? 245 PHE B CD1  1 
ATOM   8217  C  CD2  . PHE B  1 245 ? 39.485  116.304 -22.359 1.00 24.11 ? 245 PHE B CD2  1 
ATOM   8218  C  CE1  . PHE B  1 245 ? 37.062  116.837 -23.540 1.00 24.04 ? 245 PHE B CE1  1 
ATOM   8219  C  CE2  . PHE B  1 245 ? 38.889  117.517 -22.170 1.00 28.59 ? 245 PHE B CE2  1 
ATOM   8220  C  CZ   . PHE B  1 245 ? 37.675  117.785 -22.764 1.00 20.17 ? 245 PHE B CZ   1 
ATOM   8221  H  H    . PHE B  1 245 ? 40.910  112.179 -24.164 1.00 26.21 ? 245 PHE B H    1 
ATOM   8222  H  HA   . PHE B  1 245 ? 39.247  113.785 -25.402 1.00 26.38 ? 245 PHE B HA   1 
ATOM   8223  H  HB2  . PHE B  1 245 ? 38.890  113.329 -23.150 1.00 20.33 ? 245 PHE B HB2  1 
ATOM   8224  H  HB3  . PHE B  1 245 ? 40.294  113.961 -22.765 1.00 20.33 ? 245 PHE B HB3  1 
ATOM   8225  H  HD1  . PHE B  1 245 ? 37.244  114.988 -24.272 1.00 24.55 ? 245 PHE B HD1  1 
ATOM   8226  H  HD2  . PHE B  1 245 ? 40.307  116.126 -21.962 1.00 28.93 ? 245 PHE B HD2  1 
ATOM   8227  H  HE1  . PHE B  1 245 ? 36.244  117.023 -23.942 1.00 28.85 ? 245 PHE B HE1  1 
ATOM   8228  H  HE2  . PHE B  1 245 ? 39.300  118.159 -21.637 1.00 34.31 ? 245 PHE B HE2  1 
ATOM   8229  H  HZ   . PHE B  1 245 ? 37.265  118.608 -22.629 1.00 24.20 ? 245 PHE B HZ   1 
ATOM   8230  N  N    . TRP B  1 246 ? 42.114  115.014 -24.664 1.00 21.35 ? 246 TRP B N    1 
ATOM   8231  C  CA   . TRP B  1 246 ? 42.983  116.162 -24.873 1.00 15.34 ? 246 TRP B CA   1 
ATOM   8232  C  C    . TRP B  1 246 ? 43.273  116.360 -26.361 1.00 12.41 ? 246 TRP B C    1 
ATOM   8233  O  O    . TRP B  1 246 ? 43.221  117.476 -26.838 1.00 12.20 ? 246 TRP B O    1 
ATOM   8234  C  CB   . TRP B  1 246 ? 44.280  115.995 -24.082 1.00 20.00 ? 246 TRP B CB   1 
ATOM   8235  C  CG   . TRP B  1 246 ? 45.203  117.134 -24.207 1.00 15.26 ? 246 TRP B CG   1 
ATOM   8236  C  CD1  . TRP B  1 246 ? 46.362  117.169 -24.902 1.00 13.55 ? 246 TRP B CD1  1 
ATOM   8237  C  CD2  . TRP B  1 246 ? 45.056  118.428 -23.598 1.00 14.52 ? 246 TRP B CD2  1 
ATOM   8238  N  NE1  . TRP B  1 246 ? 46.952  118.414 -24.784 1.00 15.73 ? 246 TRP B NE1  1 
ATOM   8239  C  CE2  . TRP B  1 246 ? 46.168  119.200 -23.984 1.00 16.58 ? 246 TRP B CE2  1 
ATOM   8240  C  CE3  . TRP B  1 246 ? 44.088  119.005 -22.775 1.00 16.26 ? 246 TRP B CE3  1 
ATOM   8241  C  CZ2  . TRP B  1 246 ? 46.343  120.525 -23.567 1.00 16.10 ? 246 TRP B CZ2  1 
ATOM   8242  C  CZ3  . TRP B  1 246 ? 44.267  120.326 -22.353 1.00 18.47 ? 246 TRP B CZ3  1 
ATOM   8243  C  CH2  . TRP B  1 246 ? 45.379  121.064 -22.752 1.00 13.50 ? 246 TRP B CH2  1 
ATOM   8244  H  H    . TRP B  1 246 ? 42.449  114.398 -24.165 1.00 25.62 ? 246 TRP B H    1 
ATOM   8245  H  HA   . TRP B  1 246 ? 42.530  116.967 -24.544 1.00 18.41 ? 246 TRP B HA   1 
ATOM   8246  H  HB2  . TRP B  1 246 ? 44.062  115.891 -23.143 1.00 24.00 ? 246 TRP B HB2  1 
ATOM   8247  H  HB3  . TRP B  1 246 ? 44.741  115.204 -24.402 1.00 24.00 ? 246 TRP B HB3  1 
ATOM   8248  H  HD1  . TRP B  1 246 ? 46.705  116.463 -25.399 1.00 16.26 ? 246 TRP B HD1  1 
ATOM   8249  H  HE1  . TRP B  1 246 ? 47.695  118.652 -25.146 1.00 18.88 ? 246 TRP B HE1  1 
ATOM   8250  H  HE3  . TRP B  1 246 ? 43.344  118.518 -22.504 1.00 19.51 ? 246 TRP B HE3  1 
ATOM   8251  H  HZ2  . TRP B  1 246 ? 47.086  121.020 -23.830 1.00 19.32 ? 246 TRP B HZ2  1 
ATOM   8252  H  HZ3  . TRP B  1 246 ? 43.628  120.722 -21.805 1.00 22.17 ? 246 TRP B HZ3  1 
ATOM   8253  H  HH2  . TRP B  1 246 ? 45.470  121.942 -22.461 1.00 16.20 ? 246 TRP B HH2  1 
ATOM   8254  N  N    . ASN B  1 247 ? 43.588  115.277 -27.068 1.00 11.84 ? 247 ASN B N    1 
ATOM   8255  C  CA   . ASN B  1 247 ? 43.985  115.359 -28.480 1.00 15.97 ? 247 ASN B CA   1 
ATOM   8256  C  C    . ASN B  1 247 ? 42.849  115.789 -29.381 1.00 20.81 ? 247 ASN B C    1 
ATOM   8257  O  O    . ASN B  1 247 ? 43.074  116.250 -30.491 1.00 27.94 ? 247 ASN B O    1 
ATOM   8258  C  CB   . ASN B  1 247 ? 44.528  114.011 -28.983 1.00 19.77 ? 247 ASN B CB   1 
ATOM   8259  C  CG   . ASN B  1 247 ? 45.957  113.759 -28.549 1.00 32.33 ? 247 ASN B CG   1 
ATOM   8260  O  OD1  . ASN B  1 247 ? 46.702  114.701 -28.268 1.00 42.61 ? 247 ASN B OD1  1 
ATOM   8261  N  ND2  . ASN B  1 247 ? 46.355  112.485 -28.501 1.00 25.88 ? 247 ASN B ND2  1 
ATOM   8262  H  H    . ASN B  1 247 ? 43.580  114.476 -26.755 1.00 14.21 ? 247 ASN B H    1 
ATOM   8263  H  HA   . ASN B  1 247 ? 44.702  116.021 -28.567 1.00 19.16 ? 247 ASN B HA   1 
ATOM   8264  H  HB2  . ASN B  1 247 ? 43.977  113.296 -28.629 1.00 23.72 ? 247 ASN B HB2  1 
ATOM   8265  H  HB3  . ASN B  1 247 ? 44.503  114.002 -29.952 1.00 23.72 ? 247 ASN B HB3  1 
ATOM   8266  H  HD21 . ASN B  1 247 ? 45.807  111.856 -28.711 1.00 31.05 ? 247 ASN B HD21 1 
ATOM   8267  H  HD22 . ASN B  1 247 ? 47.158  112.294 -28.260 1.00 31.05 ? 247 ASN B HD22 1 
ATOM   8268  N  N    . ASN B  1 248 ? 41.627  115.617 -28.897 1.00 27.34 ? 248 ASN B N    1 
ATOM   8269  C  CA   . ASN B  1 248 ? 40.442  115.965 -29.664 1.00 23.78 ? 248 ASN B CA   1 
ATOM   8270  C  C    . ASN B  1 248 ? 40.161  117.465 -29.591 1.00 26.61 ? 248 ASN B C    1 
ATOM   8271  O  O    . ASN B  1 248 ? 39.503  118.030 -30.473 1.00 20.39 ? 248 ASN B O    1 
ATOM   8272  C  CB   . ASN B  1 248 ? 39.264  115.167 -29.129 1.00 32.98 ? 248 ASN B CB   1 
ATOM   8273  C  CG   . ASN B  1 248 ? 38.122  115.091 -30.095 1.00 48.98 ? 248 ASN B CG   1 
ATOM   8274  O  OD1  . ASN B  1 248 ? 37.201  115.907 -30.056 1.00 49.74 ? 248 ASN B OD1  1 
ATOM   8275  N  ND2  . ASN B  1 248 ? 38.161  114.089 -30.965 1.00 57.35 ? 248 ASN B ND2  1 
ATOM   8276  H  H    . ASN B  1 248 ? 41.457  115.296 -28.118 1.00 32.81 ? 248 ASN B H    1 
ATOM   8277  H  HA   . ASN B  1 248 ? 40.579  115.722 -30.603 1.00 28.53 ? 248 ASN B HA   1 
ATOM   8278  H  HB2  . ASN B  1 248 ? 39.557  114.261 -28.940 1.00 39.58 ? 248 ASN B HB2  1 
ATOM   8279  H  HB3  . ASN B  1 248 ? 38.942  115.587 -28.316 1.00 39.58 ? 248 ASN B HB3  1 
ATOM   8280  H  HD21 . ASN B  1 248 ? 38.816  113.532 -30.950 1.00 68.82 ? 248 ASN B HD21 1 
ATOM   8281  H  HD22 . ASN B  1 248 ? 37.531  113.997 -31.543 1.00 68.82 ? 248 ASN B HD22 1 
ATOM   8282  N  N    . LEU B  1 249 ? 40.661  118.124 -28.546 1.00 23.54 ? 249 LEU B N    1 
ATOM   8283  C  CA   . LEU B  1 249 ? 40.577  119.586 -28.476 1.00 18.06 ? 249 LEU B CA   1 
ATOM   8284  C  C    . LEU B  1 249 ? 41.380  120.216 -29.610 1.00 22.13 ? 249 LEU B C    1 
ATOM   8285  O  O    . LEU B  1 249 ? 42.352  119.635 -30.089 1.00 25.80 ? 249 LEU B O    1 
ATOM   8286  C  CB   . LEU B  1 249 ? 41.112  120.093 -27.135 1.00 18.32 ? 249 LEU B CB   1 
ATOM   8287  C  CG   . LEU B  1 249 ? 40.452  119.529 -25.877 1.00 22.61 ? 249 LEU B CG   1 
ATOM   8288  C  CD1  . LEU B  1 249 ? 41.110  120.096 -24.616 1.00 24.08 ? 249 LEU B CD1  1 
ATOM   8289  C  CD2  . LEU B  1 249 ? 38.942  119.815 -25.883 1.00 25.70 ? 249 LEU B CD2  1 
ATOM   8290  H  H    . LEU B  1 249 ? 41.048  117.755 -27.872 1.00 28.24 ? 249 LEU B H    1 
ATOM   8291  H  HA   . LEU B  1 249 ? 39.642  119.865 -28.564 1.00 21.67 ? 249 LEU B HA   1 
ATOM   8292  H  HB2  . LEU B  1 249 ? 42.057  119.878 -27.085 1.00 21.98 ? 249 LEU B HB2  1 
ATOM   8293  H  HB3  . LEU B  1 249 ? 41.001  121.057 -27.110 1.00 21.98 ? 249 LEU B HB3  1 
ATOM   8294  H  HG   . LEU B  1 249 ? 40.571  118.566 -25.867 1.00 27.14 ? 249 LEU B HG   1 
ATOM   8295  H  HD11 . LEU B  1 249 ? 40.676  119.725 -23.844 1.00 28.90 ? 249 LEU B HD11 1 
ATOM   8296  H  HD12 . LEU B  1 249 ? 42.040  119.858 -24.615 1.00 28.90 ? 249 LEU B HD12 1 
ATOM   8297  H  HD13 . LEU B  1 249 ? 41.016  121.051 -24.617 1.00 28.90 ? 249 LEU B HD13 1 
ATOM   8298  H  HD21 . LEU B  1 249 ? 38.553  119.451 -25.085 1.00 30.84 ? 249 LEU B HD21 1 
ATOM   8299  H  HD22 . LEU B  1 249 ? 38.805  120.764 -25.911 1.00 30.84 ? 249 LEU B HD22 1 
ATOM   8300  H  HD23 . LEU B  1 249 ? 38.549  119.404 -26.656 1.00 30.84 ? 249 LEU B HD23 1 
ATOM   8301  N  N    . THR B  1 250 ? 40.981  121.403 -30.052 1.00 21.88 ? 250 THR B N    1 
ATOM   8302  C  CA   . THR B  1 250 ? 41.736  122.080 -31.100 1.00 16.06 ? 250 THR B CA   1 
ATOM   8303  C  C    . THR B  1 250 ? 43.041  122.553 -30.511 1.00 19.37 ? 250 THR B C    1 
ATOM   8304  O  O    . THR B  1 250 ? 43.149  122.716 -29.289 1.00 18.62 ? 250 THR B O    1 
ATOM   8305  C  CB   . THR B  1 250 ? 40.991  123.286 -31.685 1.00 21.29 ? 250 THR B CB   1 
ATOM   8306  O  OG1  . THR B  1 250 ? 41.019  124.382 -30.754 1.00 17.51 ? 250 THR B OG1  1 
ATOM   8307  C  CG2  . THR B  1 250 ? 39.545  122.912 -32.021 1.00 16.89 ? 250 THR B CG2  1 
ATOM   8308  H  H    . THR B  1 250 ? 40.291  121.831 -29.769 1.00 26.26 ? 250 THR B H    1 
ATOM   8309  H  HA   . THR B  1 250 ? 41.930  121.450 -31.826 1.00 19.28 ? 250 THR B HA   1 
ATOM   8310  H  HB   . THR B  1 250 ? 41.429  123.559 -32.506 1.00 25.55 ? 250 THR B HB   1 
ATOM   8311  H  HG1  . THR B  1 250 ? 40.621  125.027 -31.068 1.00 21.01 ? 250 THR B HG1  1 
ATOM   8312  H  HG21 . THR B  1 250 ? 39.086  123.672 -32.386 1.00 20.27 ? 250 THR B HG21 1 
ATOM   8313  H  HG22 . THR B  1 250 ? 39.532  122.201 -32.666 1.00 20.27 ? 250 THR B HG22 1 
ATOM   8314  H  HG23 . THR B  1 250 ? 39.088  122.623 -31.228 1.00 20.27 ? 250 THR B HG23 1 
ATOM   8315  N  N    . PRO B  1 251 ? 44.042  122.779 -31.366 1.00 14.69 ? 251 PRO B N    1 
ATOM   8316  C  CA   . PRO B  1 251 ? 45.325  123.303 -30.910 1.00 20.87 ? 251 PRO B CA   1 
ATOM   8317  C  C    . PRO B  1 251 ? 45.137  124.653 -30.237 1.00 23.28 ? 251 PRO B C    1 
ATOM   8318  O  O    . PRO B  1 251 ? 45.852  124.969 -29.297 1.00 18.84 ? 251 PRO B O    1 
ATOM   8319  C  CB   . PRO B  1 251 ? 46.121  123.461 -32.216 1.00 22.31 ? 251 PRO B CB   1 
ATOM   8320  C  CG   . PRO B  1 251 ? 45.491  122.522 -33.158 1.00 19.47 ? 251 PRO B CG   1 
ATOM   8321  C  CD   . PRO B  1 251 ? 44.046  122.504 -32.818 1.00 18.88 ? 251 PRO B CD   1 
ATOM   8322  H  HA   . PRO B  1 251 ? 45.776  122.676 -30.307 1.00 25.05 ? 251 PRO B HA   1 
ATOM   8323  H  HB2  . PRO B  1 251 ? 46.046  124.373 -32.537 1.00 26.78 ? 251 PRO B HB2  1 
ATOM   8324  H  HB3  . PRO B  1 251 ? 47.049  123.225 -32.064 1.00 26.78 ? 251 PRO B HB3  1 
ATOM   8325  H  HG2  . PRO B  1 251 ? 45.623  122.837 -34.066 1.00 23.37 ? 251 PRO B HG2  1 
ATOM   8326  H  HG3  . PRO B  1 251 ? 45.879  121.640 -33.044 1.00 23.37 ? 251 PRO B HG3  1 
ATOM   8327  H  HD2  . PRO B  1 251 ? 43.576  123.205 -33.297 1.00 22.66 ? 251 PRO B HD2  1 
ATOM   8328  H  HD3  . PRO B  1 251 ? 43.666  121.631 -32.999 1.00 22.66 ? 251 PRO B HD3  1 
ATOM   8329  N  N    . GLU B  1 252 ? 44.184  125.438 -30.734 1.00 23.10 ? 252 GLU B N    1 
ATOM   8330  C  CA   . GLU B  1 252 ? 43.937  126.769 -30.204 1.00 23.48 ? 252 GLU B CA   1 
ATOM   8331  C  C    . GLU B  1 252 ? 43.363  126.671 -28.793 1.00 18.06 ? 252 GLU B C    1 
ATOM   8332  O  O    . GLU B  1 252 ? 43.725  127.455 -27.918 1.00 15.66 ? 252 GLU B O    1 
ATOM   8333  C  CB   . GLU B  1 252 ? 42.987  127.537 -31.125 1.00 19.49 ? 252 GLU B CB   1 
ATOM   8334  C  CG   . GLU B  1 252 ? 43.626  127.927 -32.435 1.00 25.32 ? 252 GLU B CG   1 
ATOM   8335  C  CD   . GLU B  1 252 ? 43.822  126.757 -33.391 1.00 34.59 ? 252 GLU B CD   1 
ATOM   8336  O  OE1  . GLU B  1 252 ? 43.013  125.811 -33.352 1.00 17.22 ? 252 GLU B OE1  1 
ATOM   8337  O  OE2  . GLU B  1 252 ? 44.785  126.783 -34.190 1.00 45.89 ? 252 GLU B OE2  1 
ATOM   8338  H  H    . GLU B  1 252 ? 43.665  125.218 -31.384 1.00 27.71 ? 252 GLU B H    1 
ATOM   8339  H  HA   . GLU B  1 252 ? 44.784  127.261 -30.157 1.00 28.18 ? 252 GLU B HA   1 
ATOM   8340  H  HB2  . GLU B  1 252 ? 42.219  126.978 -31.322 1.00 23.39 ? 252 GLU B HB2  1 
ATOM   8341  H  HB3  . GLU B  1 252 ? 42.701  128.348 -30.677 1.00 23.39 ? 252 GLU B HB3  1 
ATOM   8342  H  HG2  . GLU B  1 252 ? 43.061  128.581 -32.876 1.00 30.39 ? 252 GLU B HG2  1 
ATOM   8343  H  HG3  . GLU B  1 252 ? 44.498  128.314 -32.255 1.00 30.39 ? 252 GLU B HG3  1 
ATOM   8344  N  N    . GLN B  1 253 ? 42.470  125.703 -28.590 1.00 16.18 ? 253 GLN B N    1 
ATOM   8345  C  CA   . GLN B  1 253 ? 41.852  125.468 -27.295 1.00 18.07 ? 253 GLN B CA   1 
ATOM   8346  C  C    . GLN B  1 253 ? 42.904  124.978 -26.312 1.00 16.14 ? 253 GLN B C    1 
ATOM   8347  O  O    . GLN B  1 253 ? 42.933  125.416 -25.167 1.00 12.33 ? 253 GLN B O    1 
ATOM   8348  C  CB   . GLN B  1 253 ? 40.736  124.429 -27.403 1.00 16.57 ? 253 GLN B CB   1 
ATOM   8349  C  CG   . GLN B  1 253 ? 39.405  124.981 -27.851 1.00 18.74 ? 253 GLN B CG   1 
ATOM   8350  C  CD   . GLN B  1 253 ? 38.357  123.898 -28.036 1.00 17.48 ? 253 GLN B CD   1 
ATOM   8351  O  OE1  . GLN B  1 253 ? 38.680  122.736 -28.308 1.00 19.47 ? 253 GLN B OE1  1 
ATOM   8352  N  NE2  . GLN B  1 253 ? 37.084  124.281 -27.914 1.00 19.98 ? 253 GLN B NE2  1 
ATOM   8353  H  H    . GLN B  1 253 ? 42.204  125.161 -29.201 1.00 19.42 ? 253 GLN B H    1 
ATOM   8354  H  HA   . GLN B  1 253 ? 41.471  126.304 -26.954 1.00 21.68 ? 253 GLN B HA   1 
ATOM   8355  H  HB2  . GLN B  1 253 ? 41.004  123.752 -28.044 1.00 19.89 ? 253 GLN B HB2  1 
ATOM   8356  H  HB3  . GLN B  1 253 ? 40.607  124.021 -26.533 1.00 19.89 ? 253 GLN B HB3  1 
ATOM   8357  H  HG2  . GLN B  1 253 ? 39.079  125.603 -27.181 1.00 22.49 ? 253 GLN B HG2  1 
ATOM   8358  H  HG3  . GLN B  1 253 ? 39.520  125.436 -28.699 1.00 22.49 ? 253 GLN B HG3  1 
ATOM   8359  H  HE21 . GLN B  1 253 ? 36.897  125.102 -27.739 1.00 23.98 ? 253 GLN B HE21 1 
ATOM   8360  H  HE22 . GLN B  1 253 ? 36.451  123.707 -28.010 1.00 23.98 ? 253 GLN B HE22 1 
ATOM   8361  N  N    . GLN B  1 254 ? 43.774  124.083 -26.775 1.00 17.40 ? 254 GLN B N    1 
ATOM   8362  C  CA   . GLN B  1 254 ? 44.846  123.559 -25.937 1.00 16.45 ? 254 GLN B CA   1 
ATOM   8363  C  C    . GLN B  1 254 ? 45.715  124.704 -25.464 1.00 16.34 ? 254 GLN B C    1 
ATOM   8364  O  O    . GLN B  1 254 ? 46.029  124.827 -24.279 1.00 13.99 ? 254 GLN B O    1 
ATOM   8365  C  CB   . GLN B  1 254 ? 45.695  122.546 -26.686 1.00 12.83 ? 254 GLN B CB   1 
ATOM   8366  C  CG   . GLN B  1 254 ? 45.013  121.199 -26.941 1.00 18.97 ? 254 GLN B CG   1 
ATOM   8367  C  CD   . GLN B  1 254 ? 45.782  120.322 -27.938 1.00 26.73 ? 254 GLN B CD   1 
ATOM   8368  O  OE1  . GLN B  1 254 ? 46.755  120.757 -28.557 1.00 27.37 ? 254 GLN B OE1  1 
ATOM   8369  N  NE2  . GLN B  1 254 ? 45.327  119.095 -28.108 1.00 25.81 ? 254 GLN B NE2  1 
ATOM   8370  H  H    . GLN B  1 254 ? 43.764  123.763 -27.573 1.00 20.88 ? 254 GLN B H    1 
ATOM   8371  H  HA   . GLN B  1 254 ? 44.459  123.119 -25.151 1.00 19.74 ? 254 GLN B HA   1 
ATOM   8372  H  HB2  . GLN B  1 254 ? 45.935  122.921 -27.547 1.00 15.39 ? 254 GLN B HB2  1 
ATOM   8373  H  HB3  . GLN B  1 254 ? 46.498  122.374 -26.170 1.00 15.39 ? 254 GLN B HB3  1 
ATOM   8374  H  HG2  . GLN B  1 254 ? 44.947  120.714 -26.104 1.00 22.77 ? 254 GLN B HG2  1 
ATOM   8375  H  HG3  . GLN B  1 254 ? 44.127  121.358 -27.304 1.00 22.77 ? 254 GLN B HG3  1 
ATOM   8376  H  HE21 . GLN B  1 254 ? 44.636  118.828 -27.672 1.00 30.97 ? 254 GLN B HE21 1 
ATOM   8377  H  HE22 . GLN B  1 254 ? 45.722  118.562 -28.656 1.00 30.97 ? 254 GLN B HE22 1 
ATOM   8378  N  N    . LYS B  1 255 ? 46.063  125.577 -26.396 1.00 11.34 ? 255 LYS B N    1 
ATOM   8379  C  CA   . LYS B  1 255 ? 46.976  126.665 -26.082 1.00 12.57 ? 255 LYS B CA   1 
ATOM   8380  C  C    . LYS B  1 255 ? 46.379  127.597 -25.039 1.00 13.66 ? 255 LYS B C    1 
ATOM   8381  O  O    . LYS B  1 255 ? 47.084  128.052 -24.157 1.00 16.91 ? 255 LYS B O    1 
ATOM   8382  C  CB   . LYS B  1 255 ? 47.330  127.447 -27.352 1.00 14.94 ? 255 LYS B CB   1 
ATOM   8383  C  CG   . LYS B  1 255 ? 48.393  128.514 -27.142 1.00 23.28 ? 255 LYS B CG   1 
ATOM   8384  C  CD   . LYS B  1 255 ? 48.575  129.349 -28.411 1.00 32.87 ? 255 LYS B CD   1 
ATOM   8385  C  CE   . LYS B  1 255 ? 49.760  130.296 -28.315 1.00 37.85 ? 255 LYS B CE   1 
ATOM   8386  N  NZ   . LYS B  1 255 ? 49.630  131.253 -27.190 1.00 40.30 ? 255 LYS B NZ   1 
ATOM   8387  H  H    . LYS B  1 255 ? 45.788  125.564 -27.211 1.00 13.61 ? 255 LYS B H    1 
ATOM   8388  H  HA   . LYS B  1 255 ? 47.804  126.291 -25.716 1.00 15.09 ? 255 LYS B HA   1 
ATOM   8389  H  HB2  . LYS B  1 255 ? 47.661  126.826 -28.020 1.00 17.93 ? 255 LYS B HB2  1 
ATOM   8390  H  HB3  . LYS B  1 255 ? 46.530  127.887 -27.681 1.00 17.93 ? 255 LYS B HB3  1 
ATOM   8391  H  HG2  . LYS B  1 255 ? 48.120  129.105 -26.423 1.00 27.94 ? 255 LYS B HG2  1 
ATOM   8392  H  HG3  . LYS B  1 255 ? 49.238  128.090 -26.930 1.00 27.94 ? 255 LYS B HG3  1 
ATOM   8393  H  HD2  . LYS B  1 255 ? 48.725  128.755 -29.163 1.00 39.44 ? 255 LYS B HD2  1 
ATOM   8394  H  HD3  . LYS B  1 255 ? 47.777  129.880 -28.560 1.00 39.44 ? 255 LYS B HD3  1 
ATOM   8395  H  HE2  . LYS B  1 255 ? 50.569  129.778 -28.178 1.00 45.42 ? 255 LYS B HE2  1 
ATOM   8396  H  HE3  . LYS B  1 255 ? 49.826  130.805 -29.138 1.00 45.42 ? 255 LYS B HE3  1 
ATOM   8397  H  HZ1  . LYS B  1 255 ? 50.340  131.790 -27.165 1.00 48.36 ? 255 LYS B HZ1  1 
ATOM   8398  H  HZ2  . LYS B  1 255 ? 48.898  131.747 -27.294 1.00 48.36 ? 255 LYS B HZ2  1 
ATOM   8399  H  HZ3  . LYS B  1 255 ? 49.574  130.811 -26.420 1.00 48.36 ? 255 LYS B HZ3  1 
ATOM   8400  N  N    . ILE B  1 256 ? 45.083  127.861 -25.143 1.00 11.22 ? 256 ILE B N    1 
ATOM   8401  C  CA   . ILE B  1 256 ? 44.419  128.740 -24.214 1.00 11.21 ? 256 ILE B CA   1 
ATOM   8402  C  C    . ILE B  1 256 ? 44.456  128.113 -22.820 1.00 10.79 ? 256 ILE B C    1 
ATOM   8403  O  O    . ILE B  1 256 ? 44.705  128.795 -21.838 1.00 10.72 ? 256 ILE B O    1 
ATOM   8404  C  CB   . ILE B  1 256 ? 42.956  129.024 -24.630 1.00 13.03 ? 256 ILE B CB   1 
ATOM   8405  C  CG1  . ILE B  1 256 ? 42.915  129.996 -25.823 1.00 19.54 ? 256 ILE B CG1  1 
ATOM   8406  C  CG2  . ILE B  1 256 ? 42.191  129.625 -23.442 1.00 13.85 ? 256 ILE B CG2  1 
ATOM   8407  C  CD1  . ILE B  1 256 ? 41.541  130.168 -26.431 1.00 19.70 ? 256 ILE B CD1  1 
ATOM   8408  H  H    . ILE B  1 256 ? 44.567  127.537 -25.750 1.00 13.46 ? 256 ILE B H    1 
ATOM   8409  H  HA   . ILE B  1 256 ? 44.898  129.594 -24.178 1.00 13.45 ? 256 ILE B HA   1 
ATOM   8410  H  HB   . ILE B  1 256 ? 42.534  128.190 -24.888 1.00 15.64 ? 256 ILE B HB   1 
ATOM   8411  H  HG12 . ILE B  1 256 ? 43.217  130.869 -25.524 1.00 23.44 ? 256 ILE B HG12 1 
ATOM   8412  H  HG13 . ILE B  1 256 ? 43.506  129.664 -26.516 1.00 23.44 ? 256 ILE B HG13 1 
ATOM   8413  H  HG21 . ILE B  1 256 ? 41.286  129.798 -23.709 1.00 16.62 ? 256 ILE B HG21 1 
ATOM   8414  H  HG22 . ILE B  1 256 ? 42.205  129.000 -22.713 1.00 16.62 ? 256 ILE B HG22 1 
ATOM   8415  H  HG23 . ILE B  1 256 ? 42.617  130.444 -23.179 1.00 16.62 ? 256 ILE B HG23 1 
ATOM   8416  H  HD11 . ILE B  1 256 ? 41.600  130.785 -27.164 1.00 23.64 ? 256 ILE B HD11 1 
ATOM   8417  H  HD12 . ILE B  1 256 ? 41.230  129.315 -26.745 1.00 23.64 ? 256 ILE B HD12 1 
ATOM   8418  H  HD13 . ILE B  1 256 ? 40.944  130.509 -25.762 1.00 23.64 ? 256 ILE B HD13 1 
ATOM   8419  N  N    . ILE B  1 257 ? 44.235  126.806 -22.744 1.00 10.55 ? 257 ILE B N    1 
ATOM   8420  C  CA   . ILE B  1 257 ? 44.176  126.131 -21.443 1.00 10.46 ? 257 ILE B CA   1 
ATOM   8421  C  C    . ILE B  1 257 ? 45.551  126.125 -20.796 1.00 11.38 ? 257 ILE B C    1 
ATOM   8422  O  O    . ILE B  1 257 ? 45.698  126.414 -19.587 1.00 14.09 ? 257 ILE B O    1 
ATOM   8423  C  CB   . ILE B  1 257 ? 43.644  124.710 -21.599 1.00 10.40 ? 257 ILE B CB   1 
ATOM   8424  C  CG1  . ILE B  1 257 ? 42.157  124.760 -21.981 1.00 10.27 ? 257 ILE B CG1  1 
ATOM   8425  C  CG2  . ILE B  1 257 ? 43.832  123.896 -20.303 1.00 9.71  ? 257 ILE B CG2  1 
ATOM   8426  C  CD1  . ILE B  1 257 ? 41.619  123.458 -22.504 1.00 14.45 ? 257 ILE B CD1  1 
ATOM   8427  H  H    . ILE B  1 257 ? 44.117  126.288 -23.420 1.00 12.65 ? 257 ILE B H    1 
ATOM   8428  H  HA   . ILE B  1 257 ? 43.565  126.622 -20.855 1.00 12.55 ? 257 ILE B HA   1 
ATOM   8429  H  HB   . ILE B  1 257 ? 44.133  124.272 -22.313 1.00 12.49 ? 257 ILE B HB   1 
ATOM   8430  H  HG12 . ILE B  1 257 ? 41.641  125.000 -21.195 1.00 12.33 ? 257 ILE B HG12 1 
ATOM   8431  H  HG13 . ILE B  1 257 ? 42.035  125.430 -22.671 1.00 12.33 ? 257 ILE B HG13 1 
ATOM   8432  H  HG21 . ILE B  1 257 ? 43.487  123.010 -20.438 1.00 11.65 ? 257 ILE B HG21 1 
ATOM   8433  H  HG22 . ILE B  1 257 ? 44.768  123.855 -20.093 1.00 11.65 ? 257 ILE B HG22 1 
ATOM   8434  H  HG23 . ILE B  1 257 ? 43.355  124.328 -19.591 1.00 11.65 ? 257 ILE B HG23 1 
ATOM   8435  H  HD11 . ILE B  1 257 ? 40.690  123.569 -22.719 1.00 17.34 ? 257 ILE B HD11 1 
ATOM   8436  H  HD12 . ILE B  1 257 ? 42.110  123.211 -23.290 1.00 17.34 ? 257 ILE B HD12 1 
ATOM   8437  H  HD13 . ILE B  1 257 ? 41.720  122.784 -21.828 1.00 17.34 ? 257 ILE B HD13 1 
ATOM   8438  N  N    . VAL B  1 258 ? 46.552  125.785 -21.597 1.00 10.10 ? 258 VAL B N    1 
ATOM   8439  C  CA   . VAL B  1 258 ? 47.938  125.736 -21.154 1.00 10.03 ? 258 VAL B CA   1 
ATOM   8440  C  C    . VAL B  1 258 ? 48.448  127.121 -20.752 1.00 10.19 ? 258 VAL B C    1 
ATOM   8441  O  O    . VAL B  1 258 ? 49.009  127.287 -19.675 1.00 10.07 ? 258 VAL B O    1 
ATOM   8442  C  CB   . VAL B  1 258 ? 48.857  125.097 -22.214 1.00 10.94 ? 258 VAL B CB   1 
ATOM   8443  C  CG1  . VAL B  1 258 ? 50.317  125.237 -21.817 1.00 16.75 ? 258 VAL B CG1  1 
ATOM   8444  C  CG2  . VAL B  1 258 ? 48.525  123.620 -22.342 1.00 11.33 ? 258 VAL B CG2  1 
ATOM   8445  H  H    . VAL B  1 258 ? 46.450  125.572 -22.424 1.00 12.12 ? 258 VAL B H    1 
ATOM   8446  H  HA   . VAL B  1 258 ? 47.983  125.170 -20.355 1.00 12.04 ? 258 VAL B HA   1 
ATOM   8447  H  HB   . VAL B  1 258 ? 48.719  125.531 -23.082 1.00 13.12 ? 258 VAL B HB   1 
ATOM   8448  H  HG11 . VAL B  1 258 ? 50.865  124.832 -22.493 1.00 20.10 ? 258 VAL B HG11 1 
ATOM   8449  H  HG12 . VAL B  1 258 ? 50.531  126.170 -21.737 1.00 20.10 ? 258 VAL B HG12 1 
ATOM   8450  H  HG13 . VAL B  1 258 ? 50.455  124.796 -20.975 1.00 20.10 ? 258 VAL B HG13 1 
ATOM   8451  H  HG21 . VAL B  1 258 ? 49.099  123.228 -23.004 1.00 13.60 ? 258 VAL B HG21 1 
ATOM   8452  H  HG22 . VAL B  1 258 ? 48.663  123.194 -21.493 1.00 13.60 ? 258 VAL B HG22 1 
ATOM   8453  H  HG23 . VAL B  1 258 ? 47.607  123.529 -22.609 1.00 13.60 ? 258 VAL B HG23 1 
ATOM   8454  N  N    . ASP B  1 259 ? 48.280  128.116 -21.623 1.00 10.54 ? 259 ASP B N    1 
ATOM   8455  C  CA   . ASP B  1 259 ? 48.702  129.467 -21.266 1.00 10.78 ? 259 ASP B CA   1 
ATOM   8456  C  C    . ASP B  1 259 ? 48.053  129.927 -19.940 1.00 13.44 ? 259 ASP B C    1 
ATOM   8457  O  O    . ASP B  1 259 ? 48.698  130.545 -19.105 1.00 10.70 ? 259 ASP B O    1 
ATOM   8458  C  CB   . ASP B  1 259 ? 48.337  130.460 -22.366 1.00 14.09 ? 259 ASP B CB   1 
ATOM   8459  C  CG   . ASP B  1 259 ? 49.171  130.287 -23.638 1.00 15.12 ? 259 ASP B CG   1 
ATOM   8460  O  OD1  . ASP B  1 259 ? 50.206  129.593 -23.630 1.00 15.71 ? 259 ASP B OD1  1 
ATOM   8461  O  OD2  . ASP B  1 259 ? 48.805  130.919 -24.643 1.00 16.20 ? 259 ASP B OD2  1 
ATOM   8462  H  H    . ASP B  1 259 ? 47.934  128.037 -22.407 1.00 12.64 ? 259 ASP B H    1 
ATOM   8463  H  HA   . ASP B  1 259 ? 49.675  129.481 -21.151 1.00 12.94 ? 259 ASP B HA   1 
ATOM   8464  H  HB2  . ASP B  1 259 ? 47.404  130.338 -22.603 1.00 16.91 ? 259 ASP B HB2  1 
ATOM   8465  H  HB3  . ASP B  1 259 ? 48.480  131.361 -22.036 1.00 16.91 ? 259 ASP B HB3  1 
ATOM   8466  N  N    . ALA B  1 260 ? 46.760  129.692 -19.800 1.00 10.53 ? 260 ALA B N    1 
ATOM   8467  C  CA   . ALA B  1 260 ? 46.062  130.061 -18.599 1.00 10.45 ? 260 ALA B CA   1 
ATOM   8468  C  C    . ALA B  1 260 ? 46.603  129.285 -17.416 1.00 10.09 ? 260 ALA B C    1 
ATOM   8469  O  O    . ALA B  1 260 ? 46.668  129.812 -16.292 1.00 10.08 ? 260 ALA B O    1 
ATOM   8470  C  CB   . ALA B  1 260 ? 44.567  129.825 -18.757 1.00 10.46 ? 260 ALA B CB   1 
ATOM   8471  H  H    . ALA B  1 260 ? 46.265  129.317 -20.395 1.00 12.64 ? 260 ALA B H    1 
ATOM   8472  H  HA   . ALA B  1 260 ? 46.203  131.015 -18.427 1.00 12.54 ? 260 ALA B HA   1 
ATOM   8473  H  HB1  . ALA B  1 260 ? 44.124  130.078 -17.944 1.00 12.56 ? 260 ALA B HB1  1 
ATOM   8474  H  HB2  . ALA B  1 260 ? 44.243  130.357 -19.487 1.00 12.56 ? 260 ALA B HB2  1 
ATOM   8475  H  HB3  . ALA B  1 260 ? 44.416  128.894 -18.937 1.00 12.56 ? 260 ALA B HB3  1 
ATOM   8476  N  N    . SER B  1 261 ? 46.967  128.032 -17.636 1.00 9.83  ? 261 SER B N    1 
ATOM   8477  C  CA   . SER B  1 261 ? 47.397  127.194 -16.525 1.00 12.10 ? 261 SER B CA   1 
ATOM   8478  C  C    . SER B  1 261 ? 48.716  127.741 -15.941 1.00 9.83  ? 261 SER B C    1 
ATOM   8479  O  O    . SER B  1 261 ? 48.937  127.647 -14.726 1.00 10.50 ? 261 SER B O    1 
ATOM   8480  C  CB   . SER B  1 261 ? 47.539  125.733 -16.967 1.00 9.44  ? 261 SER B CB   1 
ATOM   8481  O  OG   . SER B  1 261 ? 48.801  125.493 -17.552 1.00 12.10 ? 261 SER B OG   1 
ATOM   8482  H  H    . SER B  1 261 ? 46.976  127.647 -18.405 1.00 11.80 ? 261 SER B H    1 
ATOM   8483  H  HA   . SER B  1 261 ? 46.718  127.230 -15.820 1.00 14.52 ? 261 SER B HA   1 
ATOM   8484  H  HB2  . SER B  1 261 ? 47.437  125.159 -16.192 1.00 11.33 ? 261 SER B HB2  1 
ATOM   8485  H  HB3  . SER B  1 261 ? 46.848  125.533 -17.618 1.00 11.33 ? 261 SER B HB3  1 
ATOM   8486  H  HG   . SER B  1 261 ? 49.245  126.183 -17.554 1.00 14.51 ? 261 SER B HG   1 
ATOM   8487  N  N    . ARG B  1 262 ? 49.543  128.368 -16.786 1.00 12.26 ? 262 ARG B N    1 
ATOM   8488  C  CA   . ARG B  1 262 ? 50.805  128.976 -16.330 1.00 11.23 ? 262 ARG B CA   1 
ATOM   8489  C  C    . ARG B  1 262 ? 50.537  130.140 -15.365 1.00 12.88 ? 262 ARG B C    1 
ATOM   8490  O  O    . ARG B  1 262 ? 51.248  130.318 -14.353 1.00 11.40 ? 262 ARG B O    1 
ATOM   8491  C  CB   . ARG B  1 262 ? 51.628  129.514 -17.513 1.00 13.80 ? 262 ARG B CB   1 
ATOM   8492  C  CG   . ARG B  1 262 ? 52.052  128.469 -18.541 1.00 24.00 ? 262 ARG B CG   1 
ATOM   8493  C  CD   . ARG B  1 262 ? 52.515  127.187 -17.902 1.00 28.41 ? 262 ARG B CD   1 
ATOM   8494  N  NE   . ARG B  1 262 ? 53.658  127.388 -17.017 1.00 36.79 ? 262 ARG B NE   1 
ATOM   8495  C  CZ   . ARG B  1 262 ? 53.912  126.658 -15.933 1.00 33.22 ? 262 ARG B CZ   1 
ATOM   8496  N  NH1  . ARG B  1 262 ? 53.106  125.670 -15.584 1.00 16.96 ? 262 ARG B NH1  1 
ATOM   8497  N  NH2  . ARG B  1 262 ? 54.979  126.919 -15.197 1.00 38.90 ? 262 ARG B NH2  1 
ATOM   8498  H  H    . ARG B  1 262 ? 49.398  128.455 -17.629 1.00 14.72 ? 262 ARG B H    1 
ATOM   8499  H  HA   . ARG B  1 262 ? 51.340  128.302 -15.861 1.00 13.47 ? 262 ARG B HA   1 
ATOM   8500  H  HB2  . ARG B  1 262 ? 51.100  130.182 -17.977 1.00 16.57 ? 262 ARG B HB2  1 
ATOM   8501  H  HB3  . ARG B  1 262 ? 52.435  129.924 -17.165 1.00 16.57 ? 262 ARG B HB3  1 
ATOM   8502  H  HG2  . ARG B  1 262 ? 51.296  128.264 -19.114 1.00 28.80 ? 262 ARG B HG2  1 
ATOM   8503  H  HG3  . ARG B  1 262 ? 52.784  128.823 -19.070 1.00 28.80 ? 262 ARG B HG3  1 
ATOM   8504  H  HD2  . ARG B  1 262 ? 51.789  126.814 -17.376 1.00 34.10 ? 262 ARG B HD2  1 
ATOM   8505  H  HD3  . ARG B  1 262 ? 52.777  126.563 -18.596 1.00 34.10 ? 262 ARG B HD3  1 
ATOM   8506  H  HE   . ARG B  1 262 ? 54.206  128.022 -17.209 1.00 44.15 ? 262 ARG B HE   1 
ATOM   8507  H  HH11 . ARG B  1 262 ? 52.410  125.494 -16.059 1.00 20.35 ? 262 ARG B HH11 1 
ATOM   8508  H  HH12 . ARG B  1 262 ? 53.276  125.203 -14.883 1.00 20.35 ? 262 ARG B HH12 1 
ATOM   8509  H  HH21 . ARG B  1 262 ? 55.508  127.560 -15.418 1.00 46.69 ? 262 ARG B HH21 1 
ATOM   8510  H  HH22 . ARG B  1 262 ? 55.144  126.448 -14.496 1.00 46.69 ? 262 ARG B HH22 1 
ATOM   8511  N  N    . GLU B  1 263 ? 49.519  130.938 -15.688 1.00 11.67 ? 263 GLU B N    1 
ATOM   8512  C  CA   . GLU B  1 263 ? 49.128  132.079 -14.850 1.00 10.67 ? 263 GLU B CA   1 
ATOM   8513  C  C    . GLU B  1 263 ? 48.529  131.532 -13.546 1.00 10.36 ? 263 GLU B C    1 
ATOM   8514  O  O    . GLU B  1 263 ? 48.792  132.051 -12.445 1.00 10.47 ? 263 GLU B O    1 
ATOM   8515  C  CB   . GLU B  1 263 ? 48.144  132.985 -15.589 1.00 11.00 ? 263 GLU B CB   1 
ATOM   8516  C  CG   . GLU B  1 263 ? 48.806  133.654 -16.811 1.00 11.39 ? 263 GLU B CG   1 
ATOM   8517  C  CD   . GLU B  1 263 ? 47.831  134.393 -17.734 1.00 32.63 ? 263 GLU B CD   1 
ATOM   8518  O  OE1  . GLU B  1 263 ? 48.206  135.473 -18.219 1.00 33.96 ? 263 GLU B OE1  1 
ATOM   8519  O  OE2  . GLU B  1 263 ? 46.715  133.888 -18.006 1.00 24.77 ? 263 GLU B OE2  1 
ATOM   8520  H  H    . GLU B  1 263 ? 49.034  130.841 -16.392 1.00 14.00 ? 263 GLU B H    1 
ATOM   8521  H  HA   . GLU B  1 263 ? 49.924  132.605 -14.627 1.00 12.81 ? 263 GLU B HA   1 
ATOM   8522  H  HB2  . GLU B  1 263 ? 47.393  132.456 -15.901 1.00 13.20 ? 263 GLU B HB2  1 
ATOM   8523  H  HB3  . GLU B  1 263 ? 47.837  133.683 -14.989 1.00 13.20 ? 263 GLU B HB3  1 
ATOM   8524  H  HG2  . GLU B  1 263 ? 49.459  134.298 -16.497 1.00 13.67 ? 263 GLU B HG2  1 
ATOM   8525  H  HG3  . GLU B  1 263 ? 49.248  132.970 -17.338 1.00 13.67 ? 263 GLU B HG3  1 
ATOM   8526  N  N    . MET B  1 264 ? 47.731  130.475 -13.684 1.00 10.03 ? 264 MET B N    1 
ATOM   8527  C  CA   . MET B  1 264 ? 47.151  129.786 -12.508 1.00 9.74  ? 264 MET B CA   1 
ATOM   8528  C  C    . MET B  1 264 ? 48.224  129.318 -11.525 1.00 9.57  ? 264 MET B C    1 
ATOM   8529  O  O    . MET B  1 264 ? 48.061  129.449 -10.299 1.00 9.54  ? 264 MET B O    1 
ATOM   8530  C  CB   . MET B  1 264 ? 46.305  128.576 -12.950 1.00 9.46  ? 264 MET B CB   1 
ATOM   8531  C  CG   . MET B  1 264 ? 45.751  127.737 -11.778 1.00 13.59 ? 264 MET B CG   1 
ATOM   8532  S  SD   . MET B  1 264 ? 46.862  126.438 -11.237 1.00 9.52  ? 264 MET B SD   1 
ATOM   8533  C  CE   . MET B  1 264 ? 46.814  125.335 -12.654 1.00 8.77  ? 264 MET B CE   1 
ATOM   8534  H  H    . MET B  1 264 ? 47.505  130.132 -14.439 1.00 12.03 ? 264 MET B H    1 
ATOM   8535  H  HA   . MET B  1 264 ? 46.555  130.410 -12.044 1.00 11.68 ? 264 MET B HA   1 
ATOM   8536  H  HB2  . MET B  1 264 ? 45.550  128.896 -13.468 1.00 11.35 ? 264 MET B HB2  1 
ATOM   8537  H  HB3  . MET B  1 264 ? 46.855  127.994 -13.497 1.00 11.35 ? 264 MET B HB3  1 
ATOM   8538  H  HG2  . MET B  1 264 ? 45.589  128.323 -11.022 1.00 16.31 ? 264 MET B HG2  1 
ATOM   8539  H  HG3  . MET B  1 264 ? 44.920  127.321 -12.056 1.00 16.31 ? 264 MET B HG3  1 
ATOM   8540  H  HE1  . MET B  1 264 ? 47.383  124.581 -12.482 1.00 10.53 ? 264 MET B HE1  1 
ATOM   8541  H  HE2  . MET B  1 264 ? 45.910  125.039 -12.788 1.00 10.53 ? 264 MET B HE2  1 
ATOM   8542  H  HE3  . MET B  1 264 ? 47.122  125.809 -13.430 1.00 10.53 ? 264 MET B HE3  1 
ATOM   8543  N  N    . VAL B  1 265 ? 49.295  128.734 -12.052 1.00 9.50  ? 265 VAL B N    1 
ATOM   8544  C  CA   . VAL B  1 265 ? 50.385  128.302 -11.204 1.00 9.43  ? 265 VAL B CA   1 
ATOM   8545  C  C    . VAL B  1 265 ? 51.022  129.476 -10.433 1.00 10.42 ? 265 VAL B C    1 
ATOM   8546  O  O    . VAL B  1 265 ? 51.273  129.389 -9.237  1.00 9.71  ? 265 VAL B O    1 
ATOM   8547  C  CB   . VAL B  1 265 ? 51.428  127.534 -12.007 1.00 10.37 ? 265 VAL B CB   1 
ATOM   8548  C  CG1  . VAL B  1 265 ? 52.754  127.453 -11.256 1.00 10.17 ? 265 VAL B CG1  1 
ATOM   8549  C  CG2  . VAL B  1 265 ? 50.893  126.143 -12.330 1.00 9.88  ? 265 VAL B CG2  1 
ATOM   8550  H  H    . VAL B  1 265 ? 49.409  128.580 -12.890 1.00 11.40 ? 265 VAL B H    1 
ATOM   8551  H  HA   . VAL B  1 265 ? 50.023  127.682 -10.536 1.00 11.31 ? 265 VAL B HA   1 
ATOM   8552  H  HB   . VAL B  1 265 ? 51.587  128.001 -12.854 1.00 12.45 ? 265 VAL B HB   1 
ATOM   8553  H  HG11 . VAL B  1 265 ? 53.386  126.964 -11.789 1.00 12.21 ? 265 VAL B HG11 1 
ATOM   8554  H  HG12 . VAL B  1 265 ? 53.078  128.342 -11.098 1.00 12.21 ? 265 VAL B HG12 1 
ATOM   8555  H  HG13 . VAL B  1 265 ? 52.613  127.002 -10.420 1.00 12.21 ? 265 VAL B HG13 1 
ATOM   8556  H  HG21 . VAL B  1 265 ? 51.553  125.664 -12.836 1.00 11.85 ? 265 VAL B HG21 1 
ATOM   8557  H  HG22 . VAL B  1 265 ? 50.710  125.681 -11.509 1.00 11.85 ? 265 VAL B HG22 1 
ATOM   8558  H  HG23 . VAL B  1 265 ? 50.086  126.231 -12.844 1.00 11.85 ? 265 VAL B HG23 1 
ATOM   8559  N  N    . THR B  1 266 ? 51.285  130.577 -11.121 1.00 10.12 ? 266 THR B N    1 
ATOM   8560  C  CA   . THR B  1 266 ? 51.842  131.748 -10.465 1.00 10.53 ? 266 THR B CA   1 
ATOM   8561  C  C    . THR B  1 266 ? 50.865  132.309 -9.431  1.00 10.59 ? 266 THR B C    1 
ATOM   8562  O  O    . THR B  1 266 ? 51.258  132.636 -8.315  1.00 10.73 ? 266 THR B O    1 
ATOM   8563  C  CB   . THR B  1 266 ? 52.194  132.824 -11.513 1.00 13.35 ? 266 THR B CB   1 
ATOM   8564  O  OG1  . THR B  1 266 ? 53.097  132.257 -12.460 1.00 11.89 ? 266 THR B OG1  1 
ATOM   8565  C  CG2  . THR B  1 266 ? 52.855  134.013 -10.865 1.00 11.49 ? 266 THR B CG2  1 
ATOM   8566  H  H    . THR B  1 266 ? 51.151  130.672 -11.965 1.00 12.15 ? 266 THR B H    1 
ATOM   8567  H  HA   . THR B  1 266 ? 52.666  131.494 -9.999  1.00 12.64 ? 266 THR B HA   1 
ATOM   8568  H  HB   . THR B  1 266 ? 51.388  133.121 -11.964 1.00 16.01 ? 266 THR B HB   1 
ATOM   8569  H  HG1  . THR B  1 266 ? 53.296  132.815 -13.027 1.00 14.27 ? 266 THR B HG1  1 
ATOM   8570  H  HG21 . THR B  1 266 ? 53.067  134.673 -11.530 1.00 13.79 ? 266 THR B HG21 1 
ATOM   8571  H  HG22 . THR B  1 266 ? 52.265  134.403 -10.216 1.00 13.79 ? 266 THR B HG22 1 
ATOM   8572  H  HG23 . THR B  1 266 ? 53.664  133.740 -10.427 1.00 13.79 ? 266 THR B HG23 1 
ATOM   8573  N  N    . TYR B  1 267 ? 49.589  132.392 -9.794  1.00 10.52 ? 267 TYR B N    1 
ATOM   8574  C  CA   . TYR B  1 267 ? 48.556  132.875 -8.901  1.00 11.15 ? 267 TYR B CA   1 
ATOM   8575  C  C    . TYR B  1 267 ? 48.543  132.016 -7.636  1.00 10.32 ? 267 TYR B C    1 
ATOM   8576  O  O    . TYR B  1 267 ? 48.557  132.520 -6.504  1.00 10.51 ? 267 TYR B O    1 
ATOM   8577  C  CB   . TYR B  1 267 ? 47.182  132.812 -9.584  1.00 13.27 ? 267 TYR B CB   1 
ATOM   8578  C  CG   . TYR B  1 267 ? 46.015  133.270 -8.711  1.00 12.41 ? 267 TYR B CG   1 
ATOM   8579  C  CD1  . TYR B  1 267 ? 45.824  134.602 -8.408  1.00 14.56 ? 267 TYR B CD1  1 
ATOM   8580  C  CD2  . TYR B  1 267 ? 45.092  132.352 -8.215  1.00 16.17 ? 267 TYR B CD2  1 
ATOM   8581  C  CE1  . TYR B  1 267 ? 44.729  135.019 -7.596  1.00 14.73 ? 267 TYR B CE1  1 
ATOM   8582  C  CE2  . TYR B  1 267 ? 44.017  132.746 -7.433  1.00 21.29 ? 267 TYR B CE2  1 
ATOM   8583  C  CZ   . TYR B  1 267 ? 43.844  134.081 -7.118  1.00 11.26 ? 267 TYR B CZ   1 
ATOM   8584  O  OH   . TYR B  1 267 ? 42.755  134.456 -6.356  1.00 16.39 ? 267 TYR B OH   1 
ATOM   8585  H  H    . TYR B  1 267 ? 49.295  132.168 -10.571 1.00 12.63 ? 267 TYR B H    1 
ATOM   8586  H  HA   . TYR B  1 267 ? 48.742  133.803 -8.650  1.00 13.38 ? 267 TYR B HA   1 
ATOM   8587  H  HB2  . TYR B  1 267 ? 47.201  133.380 -10.370 1.00 15.93 ? 267 TYR B HB2  1 
ATOM   8588  H  HB3  . TYR B  1 267 ? 47.009  131.895 -9.848  1.00 15.93 ? 267 TYR B HB3  1 
ATOM   8589  H  HD1  . TYR B  1 267 ? 46.426  135.236 -8.726  1.00 17.47 ? 267 TYR B HD1  1 
ATOM   8590  H  HD2  . TYR B  1 267 ? 45.199  131.450 -8.414  1.00 19.41 ? 267 TYR B HD2  1 
ATOM   8591  H  HE1  . TYR B  1 267 ? 44.609  135.920 -7.398  1.00 17.68 ? 267 TYR B HE1  1 
ATOM   8592  H  HE2  . TYR B  1 267 ? 43.417  132.111 -7.113  1.00 25.55 ? 267 TYR B HE2  1 
ATOM   8593  H  HH   . TYR B  1 267 ? 42.274  134.965 -6.783  1.00 19.67 ? 267 TYR B HH   1 
ATOM   8594  N  N    . GLY B  1 268 ? 48.494  130.713 -7.848  1.00 9.88  ? 268 GLY B N    1 
ATOM   8595  C  CA   . GLY B  1 268 ? 48.481  129.720 -6.766  1.00 9.58  ? 268 GLY B CA   1 
ATOM   8596  C  C    . GLY B  1 268 ? 49.701  129.767 -5.867  1.00 9.66  ? 268 GLY B C    1 
ATOM   8597  O  O    . GLY B  1 268 ? 49.598  129.574 -4.646  1.00 11.05 ? 268 GLY B O    1 
ATOM   8598  H  H    . GLY B  1 268 ? 48.466  130.360 -8.631  1.00 11.86 ? 268 GLY B H    1 
ATOM   8599  H  HA2  . GLY B  1 268 ? 47.695  129.862 -6.215  1.00 11.49 ? 268 GLY B HA2  1 
ATOM   8600  H  HA3  . GLY B  1 268 ? 48.425  128.832 -7.151  1.00 11.49 ? 268 GLY B HA3  1 
ATOM   8601  N  N    . GLY B  1 269 ? 50.857  130.029 -6.456  1.00 9.83  ? 269 GLY B N    1 
ATOM   8602  C  CA   . GLY B  1 269 ? 52.054  130.294 -5.689  1.00 10.05 ? 269 GLY B CA   1 
ATOM   8603  C  C    . GLY B  1 269 ? 51.857  131.475 -4.734  1.00 10.83 ? 269 GLY B C    1 
ATOM   8604  O  O    . GLY B  1 269 ? 52.311  131.445 -3.598  1.00 13.73 ? 269 GLY B O    1 
ATOM   8605  H  H    . GLY B  1 269 ? 50.973  130.058 -7.307  1.00 11.79 ? 269 GLY B H    1 
ATOM   8606  H  HA2  . GLY B  1 269 ? 52.288  129.510 -5.168  1.00 12.06 ? 269 GLY B HA2  1 
ATOM   8607  H  HA3  . GLY B  1 269 ? 52.788  130.499 -6.289  1.00 12.06 ? 269 GLY B HA3  1 
ATOM   8608  N  N    . GLY B  1 270 ? 51.187  132.515 -5.204  1.00 13.59 ? 270 GLY B N    1 
ATOM   8609  C  CA   . GLY B  1 270 ? 50.906  133.656 -4.342  1.00 11.76 ? 270 GLY B CA   1 
ATOM   8610  C  C    . GLY B  1 270 ? 49.941  133.286 -3.234  1.00 11.74 ? 270 GLY B C    1 
ATOM   8611  O  O    . GLY B  1 270 ? 50.122  133.660 -2.065  1.00 13.95 ? 270 GLY B O    1 
ATOM   8612  H  H    . GLY B  1 270 ? 50.886  132.587 -6.007  1.00 16.31 ? 270 GLY B H    1 
ATOM   8613  H  HA2  . GLY B  1 270 ? 51.731  133.974 -3.942  1.00 14.11 ? 270 GLY B HA2  1 
ATOM   8614  H  HA3  . GLY B  1 270 ? 50.518  134.374 -4.866  1.00 14.11 ? 270 GLY B HA3  1 
ATOM   8615  N  N    . LEU B  1 271 ? 48.900  132.544 -3.586  1.00 11.62 ? 271 LEU B N    1 
ATOM   8616  C  CA   . LEU B  1 271 ? 47.946  132.079 -2.598  1.00 18.37 ? 271 LEU B CA   1 
ATOM   8617  C  C    . LEU B  1 271 ? 48.640  131.285 -1.501  1.00 16.72 ? 271 LEU B C    1 
ATOM   8618  O  O    . LEU B  1 271 ? 48.413  131.527 -0.314  1.00 12.70 ? 271 LEU B O    1 
ATOM   8619  C  CB   . LEU B  1 271 ? 46.896  131.187 -3.253  1.00 16.09 ? 271 LEU B CB   1 
ATOM   8620  C  CG   . LEU B  1 271 ? 45.890  131.828 -4.204  1.00 14.14 ? 271 LEU B CG   1 
ATOM   8621  C  CD1  . LEU B  1 271 ? 45.025  130.715 -4.771  1.00 16.08 ? 271 LEU B CD1  1 
ATOM   8622  C  CD2  . LEU B  1 271 ? 45.018  132.870 -3.520  1.00 14.90 ? 271 LEU B CD2  1 
ATOM   8623  H  H    . LEU B  1 271 ? 48.726  132.297 -4.391  1.00 13.95 ? 271 LEU B H    1 
ATOM   8624  H  HA   . LEU B  1 271 ? 47.494  132.847 -2.190  1.00 22.04 ? 271 LEU B HA   1 
ATOM   8625  H  HB2  . LEU B  1 271 ? 47.362  130.502 -3.757  1.00 19.31 ? 271 LEU B HB2  1 
ATOM   8626  H  HB3  . LEU B  1 271 ? 46.384  130.764 -2.546  1.00 19.31 ? 271 LEU B HB3  1 
ATOM   8627  H  HG   . LEU B  1 271 ? 46.363  132.254 -4.936  1.00 16.97 ? 271 LEU B HG   1 
ATOM   8628  H  HD11 . LEU B  1 271 ? 44.383  131.096 -5.375  1.00 19.29 ? 271 LEU B HD11 1 
ATOM   8629  H  HD12 . LEU B  1 271 ? 45.586  130.092 -5.240  1.00 19.29 ? 271 LEU B HD12 1 
ATOM   8630  H  HD13 . LEU B  1 271 ? 44.574  130.272 -4.049  1.00 19.29 ? 271 LEU B HD13 1 
ATOM   8631  H  HD21 . LEU B  1 271 ? 44.407  133.237 -4.164  1.00 17.87 ? 271 LEU B HD21 1 
ATOM   8632  H  HD22 . LEU B  1 271 ? 44.530  132.450 -2.808  1.00 17.87 ? 271 LEU B HD22 1 
ATOM   8633  H  HD23 . LEU B  1 271 ? 45.579  133.564 -3.168  1.00 17.87 ? 271 LEU B HD23 1 
ATOM   8634  N  N    . ILE B  1 272 ? 49.463  130.318 -1.914  1.00 10.76 ? 272 ILE B N    1 
ATOM   8635  C  CA   . ILE B  1 272 ? 50.070  129.370 -0.978  1.00 12.30 ? 272 ILE B CA   1 
ATOM   8636  C  C    . ILE B  1 272 ? 51.120  129.994 -0.088  1.00 14.04 ? 272 ILE B C    1 
ATOM   8637  O  O    . ILE B  1 272 ? 51.285  129.608 1.087   1.00 12.14 ? 272 ILE B O    1 
ATOM   8638  C  CB   . ILE B  1 272 ? 50.693  128.175 -1.733  1.00 12.73 ? 272 ILE B CB   1 
ATOM   8639  C  CG1  . ILE B  1 272 ? 49.660  127.068 -1.912  1.00 24.92 ? 272 ILE B CG1  1 
ATOM   8640  C  CG2  . ILE B  1 272 ? 51.873  127.604 -0.941  1.00 21.31 ? 272 ILE B CG2  1 
ATOM   8641  C  CD1  . ILE B  1 272 ? 49.343  126.322 -0.628  1.00 23.50 ? 272 ILE B CD1  1 
ATOM   8642  H  H    . ILE B  1 272 ? 49.686  130.190 -2.735  1.00 12.91 ? 272 ILE B H    1 
ATOM   8643  H  HA   . ILE B  1 272 ? 49.365  129.016 -0.397  1.00 14.76 ? 272 ILE B HA   1 
ATOM   8644  H  HB   . ILE B  1 272 ? 51.003  128.470 -2.604  1.00 15.28 ? 272 ILE B HB   1 
ATOM   8645  H  HG12 . ILE B  1 272 ? 48.835  127.459 -2.240  1.00 29.91 ? 272 ILE B HG12 1 
ATOM   8646  H  HG13 . ILE B  1 272 ? 49.998  126.424 -2.554  1.00 29.91 ? 272 ILE B HG13 1 
ATOM   8647  H  HG21 . ILE B  1 272 ? 52.245  126.864 -1.425  1.00 25.57 ? 272 ILE B HG21 1 
ATOM   8648  H  HG22 . ILE B  1 272 ? 52.535  128.290 -0.829  1.00 25.57 ? 272 ILE B HG22 1 
ATOM   8649  H  HG23 . ILE B  1 272 ? 51.559  127.310 -0.083  1.00 25.57 ? 272 ILE B HG23 1 
ATOM   8650  H  HD11 . ILE B  1 272 ? 48.689  125.644 -0.814  1.00 28.20 ? 272 ILE B HD11 1 
ATOM   8651  H  HD12 . ILE B  1 272 ? 50.148  125.919 -0.295  1.00 28.20 ? 272 ILE B HD12 1 
ATOM   8652  H  HD13 . ILE B  1 272 ? 48.996  126.944 0.016   1.00 28.20 ? 272 ILE B HD13 1 
ATOM   8653  N  N    . GLU B  1 273 ? 51.823  130.974 -0.635  1.00 15.81 ? 273 GLU B N    1 
ATOM   8654  C  CA   . GLU B  1 273 ? 52.837  131.697 0.111   1.00 10.98 ? 273 GLU B CA   1 
ATOM   8655  C  C    . GLU B  1 273 ? 52.250  132.268 1.406   1.00 12.10 ? 273 GLU B C    1 
ATOM   8656  O  O    . GLU B  1 273 ? 52.928  132.339 2.409   1.00 15.94 ? 273 GLU B O    1 
ATOM   8657  C  CB   . GLU B  1 273 ? 53.413  132.814 -0.769  1.00 14.28 ? 273 GLU B CB   1 
ATOM   8658  C  CG   . GLU B  1 273 ? 54.259  133.828 -0.046  1.00 17.99 ? 273 GLU B CG   1 
ATOM   8659  C  CD   . GLU B  1 273 ? 55.469  133.246 0.638   1.00 18.52 ? 273 GLU B CD   1 
ATOM   8660  O  OE1  . GLU B  1 273 ? 55.950  132.167 0.229   1.00 23.33 ? 273 GLU B OE1  1 
ATOM   8661  O  OE2  . GLU B  1 273 ? 55.937  133.888 1.602   1.00 18.01 ? 273 GLU B OE2  1 
ATOM   8662  H  H    . GLU B  1 273 ? 51.730  131.241 -1.447  1.00 18.97 ? 273 GLU B H    1 
ATOM   8663  H  HA   . GLU B  1 273 ? 53.565  131.084 0.347   1.00 13.17 ? 273 GLU B HA   1 
ATOM   8664  H  HB2  . GLU B  1 273 ? 53.965  132.410 -1.456  1.00 17.14 ? 273 GLU B HB2  1 
ATOM   8665  H  HB3  . GLU B  1 273 ? 52.676  133.290 -1.183  1.00 17.14 ? 273 GLU B HB3  1 
ATOM   8666  H  HG2  . GLU B  1 273 ? 54.570  134.487 -0.687  1.00 21.59 ? 273 GLU B HG2  1 
ATOM   8667  H  HG3  . GLU B  1 273 ? 53.715  134.261 0.631   1.00 21.59 ? 273 GLU B HG3  1 
ATOM   8668  N  N    . GLN B  1 274 ? 50.989  132.672 1.357   1.00 14.80 ? 274 GLN B N    1 
ATOM   8669  C  CA   . GLN B  1 274 ? 50.330  133.243 2.512   1.00 20.42 ? 274 GLN B CA   1 
ATOM   8670  C  C    . GLN B  1 274 ? 49.629  132.154 3.317   1.00 17.53 ? 274 GLN B C    1 
ATOM   8671  O  O    . GLN B  1 274 ? 49.667  132.135 4.564   1.00 16.53 ? 274 GLN B O    1 
ATOM   8672  C  CB   . GLN B  1 274 ? 49.317  134.291 2.045   1.00 25.22 ? 274 GLN B CB   1 
ATOM   8673  C  CG   . GLN B  1 274 ? 49.987  135.455 1.335   1.00 40.97 ? 274 GLN B CG   1 
ATOM   8674  C  CD   . GLN B  1 274 ? 50.864  136.269 2.283   1.00 35.48 ? 274 GLN B CD   1 
ATOM   8675  O  OE1  . GLN B  1 274 ? 50.482  136.553 3.420   1.00 37.86 ? 274 GLN B OE1  1 
ATOM   8676  N  NE2  . GLN B  1 274 ? 52.045  136.641 1.815   1.00 26.97 ? 274 GLN B NE2  1 
ATOM   8677  H  H    . GLN B  1 274 ? 50.491  132.624 0.658   1.00 17.77 ? 274 GLN B H    1 
ATOM   8678  H  HA   . GLN B  1 274 ? 50.992  133.681 3.087   1.00 24.51 ? 274 GLN B HA   1 
ATOM   8679  H  HB2  . GLN B  1 274 ? 48.694  133.878 1.427   1.00 30.26 ? 274 GLN B HB2  1 
ATOM   8680  H  HB3  . GLN B  1 274 ? 48.842  134.640 2.815   1.00 30.26 ? 274 GLN B HB3  1 
ATOM   8681  H  HG2  . GLN B  1 274 ? 50.548  135.113 0.621   1.00 49.17 ? 274 GLN B HG2  1 
ATOM   8682  H  HG3  . GLN B  1 274 ? 49.305  136.042 0.973   1.00 49.17 ? 274 GLN B HG3  1 
ATOM   8683  H  HE21 . GLN B  1 274 ? 52.280  136.422 1.017   1.00 32.37 ? 274 GLN B HE21 1 
ATOM   8684  H  HE22 . GLN B  1 274 ? 52.577  137.101 2.309   1.00 32.37 ? 274 GLN B HE22 1 
ATOM   8685  N  N    . ALA B  1 275 ? 49.019  131.235 2.588   1.00 14.01 ? 275 ALA B N    1 
ATOM   8686  C  CA   . ALA B  1 275 ? 47.987  130.394 3.147   1.00 10.51 ? 275 ALA B CA   1 
ATOM   8687  C  C    . ALA B  1 275 ? 48.480  129.304 4.111   1.00 10.28 ? 275 ALA B C    1 
ATOM   8688  O  O    . ALA B  1 275 ? 47.739  128.946 5.002   1.00 12.76 ? 275 ALA B O    1 
ATOM   8689  C  CB   . ALA B  1 275 ? 47.141  129.806 2.057   1.00 17.63 ? 275 ALA B CB   1 
ATOM   8690  H  H    . ALA B  1 275 ? 49.189  131.080 1.760   1.00 16.81 ? 275 ALA B H    1 
ATOM   8691  H  HA   . ALA B  1 275 ? 47.395  130.973 3.671   1.00 12.61 ? 275 ALA B HA   1 
ATOM   8692  H  HB1  . ALA B  1 275 ? 46.464  129.252 2.452   1.00 21.16 ? 275 ALA B HB1  1 
ATOM   8693  H  HB2  . ALA B  1 275 ? 46.733  130.518 1.559   1.00 21.16 ? 275 ALA B HB2  1 
ATOM   8694  H  HB3  . ALA B  1 275 ? 47.699  129.280 1.479   1.00 21.16 ? 275 ALA B HB3  1 
ATOM   8695  N  N    . GLU B  1 276 ? 49.699  128.794 3.943   1.00 11.64 ? 276 GLU B N    1 
ATOM   8696  C  CA   . GLU B  1 276 ? 50.135  127.663 4.755   1.00 14.70 ? 276 GLU B CA   1 
ATOM   8697  C  C    . GLU B  1 276 ? 50.302  128.116 6.199   1.00 12.12 ? 276 GLU B C    1 
ATOM   8698  O  O    . GLU B  1 276 ? 49.968  127.381 7.096   1.00 11.07 ? 276 GLU B O    1 
ATOM   8699  C  CB   . GLU B  1 276 ? 51.425  127.018 4.240   1.00 11.39 ? 276 GLU B CB   1 
ATOM   8700  C  CG   . GLU B  1 276 ? 51.333  126.594 2.775   1.00 12.31 ? 276 GLU B CG   1 
ATOM   8701  C  CD   . GLU B  1 276 ? 52.335  125.523 2.411   1.00 9.92  ? 276 GLU B CD   1 
ATOM   8702  O  OE1  . GLU B  1 276 ? 53.409  125.836 1.907   1.00 15.47 ? 276 GLU B OE1  1 
ATOM   8703  O  OE2  . GLU B  1 276 ? 52.073  124.359 2.701   1.00 11.15 ? 276 GLU B OE2  1 
ATOM   8704  H  H    . GLU B  1 276 ? 50.281  129.078 3.377   1.00 13.97 ? 276 GLU B H    1 
ATOM   8705  H  HA   . GLU B  1 276 ? 49.435  126.978 4.738   1.00 17.64 ? 276 GLU B HA   1 
ATOM   8706  H  HB2  . GLU B  1 276 ? 52.152  127.656 4.322   1.00 13.67 ? 276 GLU B HB2  1 
ATOM   8707  H  HB3  . GLU B  1 276 ? 51.616  126.228 4.770   1.00 13.67 ? 276 GLU B HB3  1 
ATOM   8708  H  HG2  . GLU B  1 276 ? 50.445  126.244 2.603   1.00 14.77 ? 276 GLU B HG2  1 
ATOM   8709  H  HG3  . GLU B  1 276 ? 51.500  127.365 2.212   1.00 14.77 ? 276 GLU B HG3  1 
ATOM   8710  N  N    . ASN B  1 277 ? 50.854  129.306 6.409   1.00 10.78 ? 277 ASN B N    1 
ATOM   8711  C  CA   . ASN B  1 277 ? 51.020  129.805 7.791   1.00 13.06 ? 277 ASN B CA   1 
ATOM   8712  C  C    . ASN B  1 277 ? 49.710  130.246 8.392   1.00 14.37 ? 277 ASN B C    1 
ATOM   8713  O  O    . ASN B  1 277 ? 49.467  130.029 9.583   1.00 12.44 ? 277 ASN B O    1 
ATOM   8714  C  CB   . ASN B  1 277 ? 52.037  130.929 7.835   1.00 17.46 ? 277 ASN B CB   1 
ATOM   8715  C  CG   . ASN B  1 277 ? 53.454  130.419 7.720   1.00 25.95 ? 277 ASN B CG   1 
ATOM   8716  O  OD1  . ASN B  1 277 ? 53.720  129.225 7.923   1.00 30.45 ? 277 ASN B OD1  1 
ATOM   8717  N  ND2  . ASN B  1 277 ? 54.378  131.314 7.385   1.00 19.12 ? 277 ASN B ND2  1 
ATOM   8718  H  H    . ASN B  1 277 ? 51.137  129.837 5.795   1.00 12.94 ? 277 ASN B H    1 
ATOM   8719  H  HA   . ASN B  1 277 ? 51.365  129.074 8.344   1.00 15.68 ? 277 ASN B HA   1 
ATOM   8720  H  HB2  . ASN B  1 277 ? 51.874  131.536 7.096   1.00 20.96 ? 277 ASN B HB2  1 
ATOM   8721  H  HB3  . ASN B  1 277 ? 51.954  131.400 8.679   1.00 20.96 ? 277 ASN B HB3  1 
ATOM   8722  H  HD21 . ASN B  1 277 ? 54.154  132.133 7.246   1.00 22.94 ? 277 ASN B HD21 1 
ATOM   8723  H  HD22 . ASN B  1 277 ? 55.201  131.074 7.306   1.00 22.94 ? 277 ASN B HD22 1 
ATOM   8724  N  N    . GLU B  1 278 ? 48.867  130.872 7.583   1.00 12.90 ? 278 GLU B N    1 
ATOM   8725  C  CA   . GLU B  1 278 ? 47.533  131.231 8.018   1.00 17.66 ? 278 GLU B CA   1 
ATOM   8726  C  C    . GLU B  1 278 ? 46.816  129.996 8.529   1.00 11.30 ? 278 GLU B C    1 
ATOM   8727  O  O    . GLU B  1 278 ? 46.197  130.021 9.602   1.00 13.95 ? 278 GLU B O    1 
ATOM   8728  C  CB   . GLU B  1 278 ? 46.745  131.843 6.873   1.00 20.52 ? 278 GLU B CB   1 
ATOM   8729  C  CG   . GLU B  1 278 ? 45.420  132.412 7.264   1.00 33.37 ? 278 GLU B CG   1 
ATOM   8730  C  CD   . GLU B  1 278 ? 44.668  132.933 6.060   1.00 34.93 ? 278 GLU B CD   1 
ATOM   8731  O  OE1  . GLU B  1 278 ? 44.766  132.314 4.982   1.00 43.39 ? 278 GLU B OE1  1 
ATOM   8732  O  OE2  . GLU B  1 278 ? 43.993  133.964 6.183   1.00 32.66 ? 278 GLU B OE2  1 
ATOM   8733  H  H    . GLU B  1 278 ? 49.047  131.100 6.773   1.00 15.48 ? 278 GLU B H    1 
ATOM   8734  H  HA   . GLU B  1 278 ? 47.588  131.885 8.746   1.00 21.19 ? 278 GLU B HA   1 
ATOM   8735  H  HB2  . GLU B  1 278 ? 47.269  132.560 6.484   1.00 24.62 ? 278 GLU B HB2  1 
ATOM   8736  H  HB3  . GLU B  1 278 ? 46.584  131.158 6.206   1.00 24.62 ? 278 GLU B HB3  1 
ATOM   8737  H  HG2  . GLU B  1 278 ? 44.884  131.720 7.682   1.00 40.04 ? 278 GLU B HG2  1 
ATOM   8738  H  HG3  . GLU B  1 278 ? 45.556  133.149 7.880   1.00 40.04 ? 278 GLU B HG3  1 
ATOM   8739  N  N    . ALA B  1 279 ? 46.902  128.900 7.772   1.00 12.10 ? 279 ALA B N    1 
ATOM   8740  C  CA   . ALA B  1 279 ? 46.187  127.689 8.145   1.00 12.05 ? 279 ALA B CA   1 
ATOM   8741  C  C    . ALA B  1 279 ? 46.768  127.059 9.408   1.00 11.26 ? 279 ALA B C    1 
ATOM   8742  O  O    . ALA B  1 279 ? 46.049  126.440 10.183  1.00 10.82 ? 279 ALA B O    1 
ATOM   8743  C  CB   . ALA B  1 279 ? 46.209  126.676 6.995   1.00 9.98  ? 279 ALA B CB   1 
ATOM   8744  H  H    . ALA B  1 279 ? 47.363  128.837 7.048   1.00 14.52 ? 279 ALA B H    1 
ATOM   8745  H  HA   . ALA B  1 279 ? 45.252  127.917 8.327   1.00 14.46 ? 279 ALA B HA   1 
ATOM   8746  H  HB1  . ALA B  1 279 ? 45.732  125.887 7.265   1.00 11.97 ? 279 ALA B HB1  1 
ATOM   8747  H  HB2  . ALA B  1 279 ? 45.787  127.067 6.227   1.00 11.97 ? 279 ALA B HB2  1 
ATOM   8748  H  HB3  . ALA B  1 279 ? 47.120  126.454 6.791   1.00 11.97 ? 279 ALA B HB3  1 
ATOM   8749  N  N    . LEU B  1 280 ? 48.072  127.223 9.608   1.00 11.02 ? 280 LEU B N    1 
ATOM   8750  C  CA   . LEU B  1 280 ? 48.731  126.710 10.789  1.00 10.74 ? 280 LEU B CA   1 
ATOM   8751  C  C    . LEU B  1 280 ? 48.134  127.420 12.001  1.00 13.46 ? 280 LEU B C    1 
ATOM   8752  O  O    . LEU B  1 280 ? 47.734  126.772 12.958  1.00 11.25 ? 280 LEU B O    1 
ATOM   8753  C  CB   . LEU B  1 280 ? 50.245  126.939 10.728  1.00 12.63 ? 280 LEU B CB   1 
ATOM   8754  C  CG   . LEU B  1 280 ? 51.058  126.562 11.969  1.00 18.04 ? 280 LEU B CG   1 
ATOM   8755  C  CD1  . LEU B  1 280 ? 51.242  125.074 12.022  1.00 25.09 ? 280 LEU B CD1  1 
ATOM   8756  C  CD2  . LEU B  1 280 ? 52.409  127.235 11.981  1.00 27.02 ? 280 LEU B CD2  1 
ATOM   8757  H  H    . LEU B  1 280 ? 48.598  127.632 9.064   1.00 13.22 ? 280 LEU B H    1 
ATOM   8758  H  HA   . LEU B  1 280 ? 48.561  125.748 10.871  1.00 12.88 ? 280 LEU B HA   1 
ATOM   8759  H  HB2  . LEU B  1 280 ? 50.599  126.421 9.988   1.00 15.16 ? 280 LEU B HB2  1 
ATOM   8760  H  HB3  . LEU B  1 280 ? 50.401  127.881 10.561  1.00 15.16 ? 280 LEU B HB3  1 
ATOM   8761  H  HG   . LEU B  1 280 ? 50.575  126.837 12.764  1.00 21.65 ? 280 LEU B HG   1 
ATOM   8762  H  HD11 . LEU B  1 280 ? 51.753  124.851 12.804  1.00 30.10 ? 280 LEU B HD11 1 
ATOM   8763  H  HD12 . LEU B  1 280 ? 50.380  124.654 12.063  1.00 30.10 ? 280 LEU B HD12 1 
ATOM   8764  H  HD13 . LEU B  1 280 ? 51.709  124.789 11.233  1.00 30.10 ? 280 LEU B HD13 1 
ATOM   8765  H  HD21 . LEU B  1 280 ? 52.882  126.971 12.773  1.00 32.43 ? 280 LEU B HD21 1 
ATOM   8766  H  HD22 . LEU B  1 280 ? 52.899  126.964 11.201  1.00 32.43 ? 280 LEU B HD22 1 
ATOM   8767  H  HD23 . LEU B  1 280 ? 52.284  128.187 11.975  1.00 32.43 ? 280 LEU B HD23 1 
ATOM   8768  N  N    . GLU B  1 281 ? 48.039  128.744 11.915  1.00 14.53 ? 281 GLU B N    1 
ATOM   8769  C  CA   . GLU B  1 281 ? 47.423  129.535 12.963  1.00 13.56 ? 281 GLU B CA   1 
ATOM   8770  C  C    . GLU B  1 281 ? 45.972  129.134 13.208  1.00 17.24 ? 281 GLU B C    1 
ATOM   8771  O  O    . GLU B  1 281 ? 45.529  129.031 14.366  1.00 12.70 ? 281 GLU B O    1 
ATOM   8772  C  CB   . GLU B  1 281 ? 47.489  131.033 12.630  1.00 13.38 ? 281 GLU B CB   1 
ATOM   8773  C  CG   . GLU B  1 281 ? 48.870  131.633 12.781  1.00 18.45 ? 281 GLU B CG   1 
ATOM   8774  C  CD   . GLU B  1 281 ? 49.561  131.238 14.061  1.00 32.98 ? 281 GLU B CD   1 
ATOM   8775  O  OE1  . GLU B  1 281 ? 48.956  131.364 15.163  1.00 37.02 ? 281 GLU B OE1  1 
ATOM   8776  O  OE2  . GLU B  1 281 ? 50.722  130.800 13.958  1.00 28.39 ? 281 GLU B OE2  1 
ATOM   8777  H  H    . GLU B  1 281 ? 48.329  129.209 11.251  1.00 17.44 ? 281 GLU B H    1 
ATOM   8778  H  HA   . GLU B  1 281 ? 47.917  129.392 13.797  1.00 16.28 ? 281 GLU B HA   1 
ATOM   8779  H  HB2  . GLU B  1 281 ? 47.209  131.161 11.710  1.00 16.06 ? 281 GLU B HB2  1 
ATOM   8780  H  HB3  . GLU B  1 281 ? 46.891  131.512 13.225  1.00 16.06 ? 281 GLU B HB3  1 
ATOM   8781  H  HG2  . GLU B  1 281 ? 49.423  131.337 12.041  1.00 22.14 ? 281 GLU B HG2  1 
ATOM   8782  H  HG3  . GLU B  1 281 ? 48.795  132.600 12.770  1.00 22.14 ? 281 GLU B HG3  1 
ATOM   8783  N  N    . ASN B  1 282 ? 45.234  128.905 12.131  1.00 11.81 ? 282 ASN B N    1 
ATOM   8784  C  CA   . ASN B  1 282 ? 43.841  128.507 12.252  1.00 13.95 ? 282 ASN B CA   1 
ATOM   8785  C  C    . ASN B  1 282 ? 43.692  127.135 12.901  1.00 18.86 ? 282 ASN B C    1 
ATOM   8786  O  O    . ASN B  1 282 ? 42.761  126.919 13.683  1.00 13.51 ? 282 ASN B O    1 
ATOM   8787  C  CB   . ASN B  1 282 ? 43.158  128.499 10.913  1.00 14.20 ? 282 ASN B CB   1 
ATOM   8788  C  CG   . ASN B  1 282 ? 42.864  129.897 10.405  1.00 24.72 ? 282 ASN B CG   1 
ATOM   8789  O  OD1  . ASN B  1 282 ? 42.737  130.840 11.188  1.00 24.43 ? 282 ASN B OD1  1 
ATOM   8790  N  ND2  . ASN B  1 282 ? 42.764  130.037 9.085   1.00 20.45 ? 282 ASN B ND2  1 
ATOM   8791  H  H    . ASN B  1 282 ? 45.515  128.973 11.321  1.00 14.17 ? 282 ASN B H    1 
ATOM   8792  H  HA   . ASN B  1 282 ? 43.377  129.157 12.820  1.00 16.73 ? 282 ASN B HA   1 
ATOM   8793  H  HB2  . ASN B  1 282 ? 43.732  128.058 10.267  1.00 17.04 ? 282 ASN B HB2  1 
ATOM   8794  H  HB3  . ASN B  1 282 ? 42.316  128.023 10.989  1.00 17.04 ? 282 ASN B HB3  1 
ATOM   8795  H  HD21 . ASN B  1 282 ? 42.865  129.355 8.572   1.00 24.54 ? 282 ASN B HD21 1 
ATOM   8796  H  HD22 . ASN B  1 282 ? 42.598  130.810 8.746   1.00 24.54 ? 282 ASN B HD22 1 
ATOM   8797  N  N    . LEU B  1 283 ? 44.602  126.214 12.571  1.00 11.12 ? 283 LEU B N    1 
ATOM   8798  C  CA   . LEU B  1 283 ? 44.612  124.901 13.230  1.00 10.94 ? 283 LEU B CA   1 
ATOM   8799  C  C    . LEU B  1 283 ? 44.832  125.074 14.738  1.00 14.09 ? 283 LEU B C    1 
ATOM   8800  O  O    . LEU B  1 283 ? 44.134  124.459 15.555  1.00 11.78 ? 283 LEU B O    1 
ATOM   8801  C  CB   . LEU B  1 283 ? 45.683  123.970 12.635  1.00 12.31 ? 283 LEU B CB   1 
ATOM   8802  C  CG   . LEU B  1 283 ? 45.364  123.362 11.259  1.00 11.45 ? 283 LEU B CG   1 
ATOM   8803  C  CD1  . LEU B  1 283 ? 46.640  122.820 10.570  1.00 9.78  ? 283 LEU B CD1  1 
ATOM   8804  C  CD2  . LEU B  1 283 ? 44.323  122.244 11.348  1.00 12.78 ? 283 LEU B CD2  1 
ATOM   8805  H  H    . LEU B  1 283 ? 45.215  126.320 11.978  1.00 13.34 ? 283 LEU B H    1 
ATOM   8806  H  HA   . LEU B  1 283 ? 43.738  124.476 13.100  1.00 13.12 ? 283 LEU B HA   1 
ATOM   8807  H  HB2  . LEU B  1 283 ? 46.507  124.474 12.544  1.00 14.77 ? 283 LEU B HB2  1 
ATOM   8808  H  HB3  . LEU B  1 283 ? 45.822  123.234 13.251  1.00 14.77 ? 283 LEU B HB3  1 
ATOM   8809  H  HG   . LEU B  1 283 ? 44.998  124.058 10.691  1.00 13.74 ? 283 LEU B HG   1 
ATOM   8810  H  HD11 . LEU B  1 283 ? 46.402  122.450 9.717   1.00 11.73 ? 283 LEU B HD11 1 
ATOM   8811  H  HD12 . LEU B  1 283 ? 47.261  123.543 10.452  1.00 11.73 ? 283 LEU B HD12 1 
ATOM   8812  H  HD13 . LEU B  1 283 ? 47.030  122.141 11.125  1.00 11.73 ? 283 LEU B HD13 1 
ATOM   8813  H  HD21 . LEU B  1 283 ? 44.159  121.899 10.467  1.00 15.34 ? 283 LEU B HD21 1 
ATOM   8814  H  HD22 . LEU B  1 283 ? 44.660  121.548 11.915  1.00 15.34 ? 283 LEU B HD22 1 
ATOM   8815  H  HD23 . LEU B  1 283 ? 43.511  122.603 11.715  1.00 15.34 ? 283 LEU B HD23 1 
ATOM   8816  N  N    . LYS B  1 284 ? 45.771  125.943 15.111  1.00 14.16 ? 284 LYS B N    1 
ATOM   8817  C  CA   . LYS B  1 284 ? 46.049  126.202 16.525  1.00 12.17 ? 284 LYS B CA   1 
ATOM   8818  C  C    . LYS B  1 284 ? 44.833  126.745 17.231  1.00 12.62 ? 284 LYS B C    1 
ATOM   8819  O  O    . LYS B  1 284 ? 44.512  126.310 18.336  1.00 13.27 ? 284 LYS B O    1 
ATOM   8820  C  CB   . LYS B  1 284 ? 47.202  127.186 16.685  1.00 16.34 ? 284 LYS B CB   1 
ATOM   8821  C  CG   . LYS B  1 284 ? 48.575  126.594 16.428  1.00 18.27 ? 284 LYS B CG   1 
ATOM   8822  C  CD   . LYS B  1 284 ? 49.650  127.622 16.710  1.00 32.30 ? 284 LYS B CD   1 
ATOM   8823  C  CE   . LYS B  1 284 ? 50.862  127.426 15.815  1.00 46.81 ? 284 LYS B CE   1 
ATOM   8824  N  NZ   . LYS B  1 284 ? 51.427  128.737 15.363  1.00 50.56 ? 284 LYS B NZ   1 
ATOM   8825  H  H    . LYS B  1 284 ? 46.261  126.394 14.567  1.00 16.99 ? 284 LYS B H    1 
ATOM   8826  H  HA   . LYS B  1 284 ? 46.303  125.361 16.961  1.00 14.61 ? 284 LYS B HA   1 
ATOM   8827  H  HB2  . LYS B  1 284 ? 47.075  127.917 16.061  1.00 19.61 ? 284 LYS B HB2  1 
ATOM   8828  H  HB3  . LYS B  1 284 ? 47.194  127.528 17.593  1.00 19.61 ? 284 LYS B HB3  1 
ATOM   8829  H  HG2  . LYS B  1 284 ? 48.715  125.833 17.013  1.00 21.93 ? 284 LYS B HG2  1 
ATOM   8830  H  HG3  . LYS B  1 284 ? 48.643  126.324 15.498  1.00 21.93 ? 284 LYS B HG3  1 
ATOM   8831  H  HD2  . LYS B  1 284 ? 49.294  128.510 16.548  1.00 38.76 ? 284 LYS B HD2  1 
ATOM   8832  H  HD3  . LYS B  1 284 ? 49.938  127.539 17.633  1.00 38.76 ? 284 LYS B HD3  1 
ATOM   8833  H  HE2  . LYS B  1 284 ? 51.550  126.951 16.306  1.00 56.17 ? 284 LYS B HE2  1 
ATOM   8834  H  HE3  . LYS B  1 284 ? 50.601  126.920 15.029  1.00 56.17 ? 284 LYS B HE3  1 
ATOM   8835  H  HZ1  . LYS B  1 284 ? 52.134  128.599 14.841  1.00 60.68 ? 284 LYS B HZ1  1 
ATOM   8836  H  HZ2  . LYS B  1 284 ? 50.813  129.190 14.906  1.00 60.68 ? 284 LYS B HZ2  1 
ATOM   8837  H  HZ3  . LYS B  1 284 ? 51.677  129.219 16.068  1.00 60.68 ? 284 LYS B HZ3  1 
ATOM   8838  N  N    . LYS B  1 285 ? 44.157  127.685 16.590  1.00 19.25 ? 285 LYS B N    1 
ATOM   8839  C  CA   . LYS B  1 285 ? 42.966  128.310 17.160  1.00 20.57 ? 285 LYS B CA   1 
ATOM   8840  C  C    . LYS B  1 285 ? 41.853  127.285 17.350  1.00 19.84 ? 285 LYS B C    1 
ATOM   8841  O  O    . LYS B  1 285 ? 41.022  127.403 18.260  1.00 18.22 ? 285 LYS B O    1 
ATOM   8842  C  CB   . LYS B  1 285 ? 42.484  129.438 16.247  1.00 20.97 ? 285 LYS B CB   1 
ATOM   8843  C  CG   . LYS B  1 285 ? 42.678  130.813 16.839  1.00 35.55 ? 285 LYS B CG   1 
ATOM   8844  C  CD   . LYS B  1 285 ? 42.468  131.899 15.791  1.00 41.77 ? 285 LYS B CD   1 
ATOM   8845  C  CE   . LYS B  1 285 ? 43.787  132.342 15.175  1.00 44.46 ? 285 LYS B CE   1 
ATOM   8846  N  NZ   . LYS B  1 285 ? 43.576  132.844 13.778  1.00 51.92 ? 285 LYS B NZ   1 
ATOM   8847  H  H    . LYS B  1 285 ? 44.367  127.985 15.812  1.00 23.10 ? 285 LYS B H    1 
ATOM   8848  H  HA   . LYS B  1 285 ? 43.186  128.693 18.034  1.00 24.68 ? 285 LYS B HA   1 
ATOM   8849  H  HB2  . LYS B  1 285 ? 42.979  129.400 15.413  1.00 25.16 ? 285 LYS B HB2  1 
ATOM   8850  H  HB3  . LYS B  1 285 ? 41.537  129.319 16.074  1.00 25.16 ? 285 LYS B HB3  1 
ATOM   8851  H  HG2  . LYS B  1 285 ? 42.035  130.949 17.553  1.00 42.66 ? 285 LYS B HG2  1 
ATOM   8852  H  HG3  . LYS B  1 285 ? 43.582  130.890 17.181  1.00 42.66 ? 285 LYS B HG3  1 
ATOM   8853  H  HD2  . LYS B  1 285 ? 41.901  131.555 15.083  1.00 50.12 ? 285 LYS B HD2  1 
ATOM   8854  H  HD3  . LYS B  1 285 ? 42.053  132.670 16.208  1.00 50.12 ? 285 LYS B HD3  1 
ATOM   8855  H  HE2  . LYS B  1 285 ? 44.166  133.060 15.706  1.00 53.36 ? 285 LYS B HE2  1 
ATOM   8856  H  HE3  . LYS B  1 285 ? 44.396  131.588 15.142  1.00 53.36 ? 285 LYS B HE3  1 
ATOM   8857  H  HZ1  . LYS B  1 285 ? 44.353  133.101 13.427  1.00 62.31 ? 285 LYS B HZ1  1 
ATOM   8858  H  HZ2  . LYS B  1 285 ? 43.229  132.200 13.272  1.00 62.31 ? 285 LYS B HZ2  1 
ATOM   8859  H  HZ3  . LYS B  1 285 ? 43.019  133.538 13.785  1.00 62.31 ? 285 LYS B HZ3  1 
ATOM   8860  N  N    . ALA B  1 286 ? 41.840  126.285 16.483  1.00 20.06 ? 286 ALA B N    1 
ATOM   8861  C  CA   . ALA B  1 286 ? 40.856  125.216 16.541  1.00 18.66 ? 286 ALA B CA   1 
ATOM   8862  C  C    . ALA B  1 286 ? 41.220  124.118 17.536  1.00 13.74 ? 286 ALA B C    1 
ATOM   8863  O  O    . ALA B  1 286 ? 40.458  123.167 17.701  1.00 16.70 ? 286 ALA B O    1 
ATOM   8864  C  CB   . ALA B  1 286 ? 40.661  124.604 15.145  1.00 17.19 ? 286 ALA B CB   1 
ATOM   8865  H  H    . ALA B  1 286 ? 42.404  126.201 15.839  1.00 24.08 ? 286 ALA B H    1 
ATOM   8866  H  HA   . ALA B  1 286 ? 39.998  125.596 16.820  1.00 22.40 ? 286 ALA B HA   1 
ATOM   8867  H  HB1  . ALA B  1 286 ? 40.010  123.901 15.200  1.00 20.63 ? 286 ALA B HB1  1 
ATOM   8868  H  HB2  . ALA B  1 286 ? 40.356  125.288 14.544  1.00 20.63 ? 286 ALA B HB2  1 
ATOM   8869  H  HB3  . ALA B  1 286 ? 41.500  124.251 14.839  1.00 20.63 ? 286 ALA B HB3  1 
ATOM   8870  N  N    . GLY B  1 287 ? 42.363  124.235 18.208  1.00 12.37 ? 287 GLY B N    1 
ATOM   8871  C  CA   . GLY B  1 287 ? 42.704  123.281 19.254  1.00 14.85 ? 287 GLY B CA   1 
ATOM   8872  C  C    . GLY B  1 287 ? 43.874  122.349 18.977  1.00 14.81 ? 287 GLY B C    1 
ATOM   8873  O  O    . GLY B  1 287 ? 44.206  121.482 19.791  1.00 11.97 ? 287 GLY B O    1 
ATOM   8874  H  H    . GLY B  1 287 ? 42.951  124.849 18.079  1.00 14.84 ? 287 GLY B H    1 
ATOM   8875  H  HA2  . GLY B  1 287 ? 42.908  123.773 20.064  1.00 17.82 ? 287 GLY B HA2  1 
ATOM   8876  H  HA3  . GLY B  1 287 ? 41.927  122.729 19.432  1.00 17.82 ? 287 GLY B HA3  1 
ATOM   8877  N  N    . VAL B  1 288 ? 44.532  122.539 17.847  1.00 11.09 ? 288 VAL B N    1 
ATOM   8878  C  CA   . VAL B  1 288 ? 45.650  121.689 17.497  1.00 8.64  ? 288 VAL B CA   1 
ATOM   8879  C  C    . VAL B  1 288 ? 46.916  122.145 18.207  1.00 8.59  ? 288 VAL B C    1 
ATOM   8880  O  O    . VAL B  1 288 ? 47.173  123.340 18.339  1.00 11.42 ? 288 VAL B O    1 
ATOM   8881  C  CB   . VAL B  1 288 ? 45.855  121.672 15.939  1.00 8.10  ? 288 VAL B CB   1 
ATOM   8882  C  CG1  . VAL B  1 288 ? 47.034  120.812 15.538  1.00 7.77  ? 288 VAL B CG1  1 
ATOM   8883  C  CG2  . VAL B  1 288 ? 44.589  121.203 15.244  1.00 8.59  ? 288 VAL B CG2  1 
ATOM   8884  H  H    . VAL B  1 288 ? 44.352  123.150 17.270  1.00 13.31 ? 288 VAL B H    1 
ATOM   8885  H  HA   . VAL B  1 288 ? 45.456  120.773 17.785  1.00 10.37 ? 288 VAL B HA   1 
ATOM   8886  H  HB   . VAL B  1 288 ? 46.038  122.586 15.638  1.00 9.72  ? 288 VAL B HB   1 
ATOM   8887  H  HG11 . VAL B  1 288 ? 47.123  120.830 14.583  1.00 9.33  ? 288 VAL B HG11 1 
ATOM   8888  H  HG12 . VAL B  1 288 ? 47.829  121.161 15.948  1.00 9.33  ? 288 VAL B HG12 1 
ATOM   8889  H  HG13 . VAL B  1 288 ? 46.880  119.912 15.837  1.00 9.33  ? 288 VAL B HG13 1 
ATOM   8890  H  HG21 . VAL B  1 288 ? 44.737  121.201 14.295  1.00 10.31 ? 288 VAL B HG21 1 
ATOM   8891  H  HG22 . VAL B  1 288 ? 44.378  120.317 15.545  1.00 10.31 ? 288 VAL B HG22 1 
ATOM   8892  H  HG23 . VAL B  1 288 ? 43.872  121.803 15.463  1.00 10.31 ? 288 VAL B HG23 1 
ATOM   8893  N  N    . THR B  1 289 ? 47.688  121.166 18.655  1.00 8.62  ? 289 THR B N    1 
ATOM   8894  C  CA   . THR B  1 289 ? 49.006  121.358 19.228  1.00 8.60  ? 289 THR B CA   1 
ATOM   8895  C  C    . THR B  1 289 ? 50.028  121.098 18.132  1.00 8.10  ? 289 THR B C    1 
ATOM   8896  O  O    . THR B  1 289 ? 49.934  120.081 17.410  1.00 7.91  ? 289 THR B O    1 
ATOM   8897  C  CB   . THR B  1 289 ? 49.258  120.346 20.362  1.00 11.50 ? 289 THR B CB   1 
ATOM   8898  O  OG1  . THR B  1 289 ? 48.356  120.599 21.446  1.00 12.65 ? 289 THR B OG1  1 
ATOM   8899  C  CG2  . THR B  1 289 ? 50.674  120.456 20.904  1.00 9.00  ? 289 THR B CG2  1 
ATOM   8900  H  H    . THR B  1 289 ? 47.453  120.339 18.634  1.00 10.35 ? 289 THR B H    1 
ATOM   8901  H  HA   . THR B  1 289 ? 49.109  122.271 19.569  1.00 10.32 ? 289 THR B HA   1 
ATOM   8902  H  HB   . THR B  1 289 ? 49.123  119.445 20.031  1.00 13.80 ? 289 THR B HB   1 
ATOM   8903  H  HG1  . THR B  1 289 ? 48.470  121.359 21.734  1.00 15.18 ? 289 THR B HG1  1 
ATOM   8904  H  HG21 . THR B  1 289 ? 50.806  119.816 21.607  1.00 10.80 ? 289 THR B HG21 1 
ATOM   8905  H  HG22 . THR B  1 289 ? 51.307  120.284 20.203  1.00 10.80 ? 289 THR B HG22 1 
ATOM   8906  H  HG23 . THR B  1 289 ? 50.824  121.338 21.251  1.00 10.80 ? 289 THR B HG23 1 
ATOM   8907  N  N    . VAL B  1 290 ? 50.976  122.016 17.989  1.00 10.50 ? 290 VAL B N    1 
ATOM   8908  C  CA   . VAL B  1 290 ? 51.957  121.921 16.921  1.00 8.49  ? 290 VAL B CA   1 
ATOM   8909  C  C    . VAL B  1 290 ? 53.239  121.477 17.570  1.00 11.17 ? 290 VAL B C    1 
ATOM   8910  O  O    . VAL B  1 290 ? 53.734  122.123 18.499  1.00 10.86 ? 290 VAL B O    1 
ATOM   8911  C  CB   . VAL B  1 290 ? 52.164  123.290 16.223  1.00 9.38  ? 290 VAL B CB   1 
ATOM   8912  C  CG1  . VAL B  1 290 ? 53.154  123.171 15.106  1.00 15.78 ? 290 VAL B CG1  1 
ATOM   8913  C  CG2  . VAL B  1 290 ? 50.851  123.828 15.741  1.00 7.84  ? 290 VAL B CG2  1 
ATOM   8914  H  H    . VAL B  1 290 ? 51.072  122.702 18.498  1.00 12.60 ? 290 VAL B H    1 
ATOM   8915  H  HA   . VAL B  1 290 ? 51.679  121.255 16.259  1.00 10.19 ? 290 VAL B HA   1 
ATOM   8916  H  HB   . VAL B  1 290 ? 52.525  123.925 16.876  1.00 11.26 ? 290 VAL B HB   1 
ATOM   8917  H  HG11 . VAL B  1 290 ? 53.263  124.030 14.693  1.00 18.93 ? 290 VAL B HG11 1 
ATOM   8918  H  HG12 . VAL B  1 290 ? 53.993  122.871 15.464  1.00 18.93 ? 290 VAL B HG12 1 
ATOM   8919  H  HG13 . VAL B  1 290 ? 52.826  122.537 14.464  1.00 18.93 ? 290 VAL B HG13 1 
ATOM   8920  H  HG21 . VAL B  1 290 ? 50.998  124.674 15.312  1.00 9.41  ? 290 VAL B HG21 1 
ATOM   8921  H  HG22 . VAL B  1 290 ? 50.468  123.206 15.118  1.00 9.41  ? 290 VAL B HG22 1 
ATOM   8922  H  HG23 . VAL B  1 290 ? 50.265  123.939 16.494  1.00 9.41  ? 290 VAL B HG23 1 
ATOM   8923  N  N    . ASN B  1 291 ? 53.730  120.321 17.132  1.00 8.85  ? 291 ASN B N    1 
ATOM   8924  C  CA   . ASN B  1 291 ? 54.981  119.771 17.609  1.00 8.55  ? 291 ASN B CA   1 
ATOM   8925  C  C    . ASN B  1 291 ? 56.075  119.869 16.580  1.00 13.16 ? 291 ASN B C    1 
ATOM   8926  O  O    . ASN B  1 291 ? 55.911  119.373 15.470  1.00 10.17 ? 291 ASN B O    1 
ATOM   8927  C  CB   . ASN B  1 291 ? 54.777  118.289 17.945  1.00 11.95 ? 291 ASN B CB   1 
ATOM   8928  C  CG   . ASN B  1 291 ? 53.589  118.073 18.855  1.00 8.12  ? 291 ASN B CG   1 
ATOM   8929  O  OD1  . ASN B  1 291 ? 53.566  118.567 19.986  1.00 8.49  ? 291 ASN B OD1  1 
ATOM   8930  N  ND2  . ASN B  1 291 ? 52.593  117.371 18.365  1.00 10.67 ? 291 ASN B ND2  1 
ATOM   8931  H  H    . ASN B  1 291 ? 53.342  119.829 16.543  1.00 10.62 ? 291 ASN B H    1 
ATOM   8932  H  HA   . ASN B  1 291 ? 55.265  120.244 18.420  1.00 10.26 ? 291 ASN B HA   1 
ATOM   8933  H  HB2  . ASN B  1 291 ? 54.623  117.795 17.125  1.00 14.35 ? 291 ASN B HB2  1 
ATOM   8934  H  HB3  . ASN B  1 291 ? 55.567  117.952 18.395  1.00 14.35 ? 291 ASN B HB3  1 
ATOM   8935  H  HD21 . ASN B  1 291 ? 52.638  117.061 17.564  1.00 12.81 ? 291 ASN B HD21 1 
ATOM   8936  H  HD22 . ASN B  1 291 ? 51.895  117.221 18.845  1.00 12.81 ? 291 ASN B HD22 1 
ATOM   8937  N  N    . ASP B  1 292 ? 57.194  120.481 16.953  1.00 12.67 ? 292 ASP B N    1 
ATOM   8938  C  CA   . ASP B  1 292 ? 58.423  120.320 16.185  1.00 9.73  ? 292 ASP B CA   1 
ATOM   8939  C  C    . ASP B  1 292 ? 58.922  118.883 16.326  1.00 8.24  ? 292 ASP B C    1 
ATOM   8940  O  O    . ASP B  1 292 ? 58.776  118.250 17.386  1.00 8.63  ? 292 ASP B O    1 
ATOM   8941  C  CB   . ASP B  1 292 ? 59.518  121.263 16.668  1.00 13.08 ? 292 ASP B CB   1 
ATOM   8942  C  CG   . ASP B  1 292 ? 59.069  122.699 16.721  1.00 20.74 ? 292 ASP B CG   1 
ATOM   8943  O  OD1  . ASP B  1 292 ? 58.538  123.202 15.714  1.00 19.86 ? 292 ASP B OD1  1 
ATOM   8944  O  OD2  . ASP B  1 292 ? 59.230  123.321 17.789  1.00 28.56 ? 292 ASP B OD2  1 
ATOM   8945  H  H    . ASP B  1 292 ? 57.269  120.992 17.641  1.00 15.20 ? 292 ASP B H    1 
ATOM   8946  H  HA   . ASP B  1 292 ? 58.247  120.501 15.238  1.00 11.68 ? 292 ASP B HA   1 
ATOM   8947  H  HB2  . ASP B  1 292 ? 59.790  121.000 17.561  1.00 15.69 ? 292 ASP B HB2  1 
ATOM   8948  H  HB3  . ASP B  1 292 ? 60.273  121.207 16.061  1.00 15.69 ? 292 ASP B HB3  1 
ATOM   8949  N  N    . VAL B  1 293 ? 59.553  118.383 15.268  1.00 7.76  ? 293 VAL B N    1 
ATOM   8950  C  CA   . VAL B  1 293 ? 60.090  117.036 15.277  1.00 12.34 ? 293 VAL B CA   1 
ATOM   8951  C  C    . VAL B  1 293 ? 61.606  117.044 15.145  1.00 10.49 ? 293 VAL B C    1 
ATOM   8952  O  O    . VAL B  1 293 ? 62.222  118.084 14.869  1.00 10.50 ? 293 VAL B O    1 
ATOM   8953  C  CB   . VAL B  1 293 ? 59.479  116.163 14.153  1.00 9.14  ? 293 VAL B CB   1 
ATOM   8954  C  CG1  . VAL B  1 293 ? 57.948  116.292 14.138  1.00 9.61  ? 293 VAL B CG1  1 
ATOM   8955  C  CG2  . VAL B  1 293 ? 60.052  116.504 12.738  1.00 6.41  ? 293 VAL B CG2  1 
ATOM   8956  H  H    . VAL B  1 293 ? 59.682  118.808 14.532  1.00 9.31  ? 293 VAL B H    1 
ATOM   8957  H  HA   . VAL B  1 293 ? 59.868  116.616 16.135  1.00 14.81 ? 293 VAL B HA   1 
ATOM   8958  H  HB   . VAL B  1 293 ? 59.693  115.224 14.338  1.00 10.97 ? 293 VAL B HB   1 
ATOM   8959  H  HG11 . VAL B  1 293 ? 57.595  115.743 13.434  1.00 11.54 ? 293 VAL B HG11 1 
ATOM   8960  H  HG12 . VAL B  1 293 ? 57.602  116.002 14.985  1.00 11.54 ? 293 VAL B HG12 1 
ATOM   8961  H  HG13 . VAL B  1 293 ? 57.714  117.211 13.985  1.00 11.54 ? 293 VAL B HG13 1 
ATOM   8962  H  HG21 . VAL B  1 293 ? 59.637  115.933 12.087  1.00 7.69  ? 293 VAL B HG21 1 
ATOM   8963  H  HG22 . VAL B  1 293 ? 59.860  117.423 12.537  1.00 7.69  ? 293 VAL B HG22 1 
ATOM   8964  H  HG23 . VAL B  1 293 ? 61.001  116.361 12.742  1.00 7.69  ? 293 VAL B HG23 1 
ATOM   8965  N  N    . ASP B  1 294 ? 62.185  115.859 15.325  1.00 9.29  ? 294 ASP B N    1 
ATOM   8966  C  CA   . ASP B  1 294 ? 63.613  115.629 15.168  1.00 7.57  ? 294 ASP B CA   1 
ATOM   8967  C  C    . ASP B  1 294 ? 63.795  115.442 13.683  1.00 8.65  ? 294 ASP B C    1 
ATOM   8968  O  O    . ASP B  1 294 ? 63.686  114.328 13.199  1.00 9.50  ? 294 ASP B O    1 
ATOM   8969  C  CB   . ASP B  1 294 ? 64.011  114.342 15.900  1.00 9.73  ? 294 ASP B CB   1 
ATOM   8970  C  CG   . ASP B  1 294 ? 65.517  114.094 15.902  1.00 17.47 ? 294 ASP B CG   1 
ATOM   8971  O  OD1  . ASP B  1 294 ? 66.220  114.535 14.974  1.00 16.35 ? 294 ASP B OD1  1 
ATOM   8972  O  OD2  . ASP B  1 294 ? 66.003  113.445 16.855  1.00 18.36 ? 294 ASP B OD2  1 
ATOM   8973  H  H    . ASP B  1 294 ? 61.752  115.150 15.546  1.00 11.15 ? 294 ASP B H    1 
ATOM   8974  H  HA   . ASP B  1 294 ? 64.141  116.390 15.489  1.00 9.09  ? 294 ASP B HA   1 
ATOM   8975  H  HB2  . ASP B  1 294 ? 63.717  114.400 16.822  1.00 11.68 ? 294 ASP B HB2  1 
ATOM   8976  H  HB3  . ASP B  1 294 ? 63.585  113.587 15.464  1.00 11.68 ? 294 ASP B HB3  1 
ATOM   8977  N  N    . LEU B  1 295 ? 64.014  116.527 12.940  1.00 7.80  ? 295 LEU B N    1 
ATOM   8978  C  CA   . LEU B  1 295 ? 64.125  116.398 11.478  1.00 7.18  ? 295 LEU B CA   1 
ATOM   8979  C  C    . LEU B  1 295 ? 65.308  115.568 10.996  1.00 6.65  ? 295 LEU B C    1 
ATOM   8980  O  O    . LEU B  1 295 ? 65.159  114.809 10.060  1.00 9.60  ? 295 LEU B O    1 
ATOM   8981  C  CB   . LEU B  1 295 ? 64.178  117.780 10.832  1.00 6.39  ? 295 LEU B CB   1 
ATOM   8982  C  CG   . LEU B  1 295 ? 62.863  118.542 10.890  1.00 7.58  ? 295 LEU B CG   1 
ATOM   8983  C  CD1  . LEU B  1 295 ? 63.064  120.021 10.469  1.00 12.35 ? 295 LEU B CD1  1 
ATOM   8984  C  CD2  . LEU B  1 295 ? 61.792  117.888 10.055  1.00 9.70  ? 295 LEU B CD2  1 
ATOM   8985  H  H    . LEU B  1 295 ? 64.101  117.328 13.242  1.00 9.37  ? 295 LEU B H    1 
ATOM   8986  H  HA   . LEU B  1 295 ? 63.313  115.958 11.151  1.00 8.62  ? 295 LEU B HA   1 
ATOM   8987  H  HB2  . LEU B  1 295 ? 64.848  118.312 11.288  1.00 7.67  ? 295 LEU B HB2  1 
ATOM   8988  H  HB3  . LEU B  1 295 ? 64.419  117.678 9.898   1.00 7.67  ? 295 LEU B HB3  1 
ATOM   8989  H  HG   . LEU B  1 295 ? 62.552  118.543 11.809  1.00 9.10  ? 295 LEU B HG   1 
ATOM   8990  H  HD11 . LEU B  1 295 ? 62.221  120.476 10.515  1.00 14.82 ? 295 LEU B HD11 1 
ATOM   8991  H  HD12 . LEU B  1 295 ? 63.692  120.433 11.067  1.00 14.82 ? 295 LEU B HD12 1 
ATOM   8992  H  HD13 . LEU B  1 295 ? 63.402  120.046 9.570   1.00 14.82 ? 295 LEU B HD13 1 
ATOM   8993  H  HD21 . LEU B  1 295 ? 60.985  118.403 10.123  1.00 11.63 ? 295 LEU B HD21 1 
ATOM   8994  H  HD22 . LEU B  1 295 ? 62.085  117.856 9.141   1.00 11.63 ? 295 LEU B HD22 1 
ATOM   8995  H  HD23 . LEU B  1 295 ? 61.642  116.997 10.381  1.00 11.63 ? 295 LEU B HD23 1 
ATOM   8996  N  N    . PRO B  1 296 ? 66.487  115.714 11.607  1.00 9.79  ? 296 PRO B N    1 
ATOM   8997  C  CA   . PRO B  1 296 ? 67.542  114.796 11.149  1.00 10.42 ? 296 PRO B CA   1 
ATOM   8998  C  C    . PRO B  1 296 ? 67.144  113.315 11.271  1.00 11.57 ? 296 PRO B C    1 
ATOM   8999  O  O    . PRO B  1 296 ? 67.524  112.511 10.418  1.00 9.43  ? 296 PRO B O    1 
ATOM   9000  C  CB   . PRO B  1 296 ? 68.723  115.118 12.074  1.00 8.91  ? 296 PRO B CB   1 
ATOM   9001  C  CG   . PRO B  1 296 ? 68.471  116.501 12.556  1.00 11.55 ? 296 PRO B CG   1 
ATOM   9002  C  CD   . PRO B  1 296 ? 66.974  116.682 12.608  1.00 13.38 ? 296 PRO B CD   1 
ATOM   9003  H  HA   . PRO B  1 296 ? 67.790  114.993 10.222  1.00 12.50 ? 296 PRO B HA   1 
ATOM   9004  H  HB2  . PRO B  1 296 ? 68.738  114.493 12.815  1.00 10.69 ? 296 PRO B HB2  1 
ATOM   9005  H  HB3  . PRO B  1 296 ? 69.552  115.076 11.572  1.00 10.69 ? 296 PRO B HB3  1 
ATOM   9006  H  HG2  . PRO B  1 296 ? 68.854  116.608 13.440  1.00 13.85 ? 296 PRO B HG2  1 
ATOM   9007  H  HG3  . PRO B  1 296 ? 68.866  117.134 11.937  1.00 13.85 ? 296 PRO B HG3  1 
ATOM   9008  H  HD2  . PRO B  1 296 ? 66.636  116.458 13.489  1.00 16.05 ? 296 PRO B HD2  1 
ATOM   9009  H  HD3  . PRO B  1 296 ? 66.733  117.586 12.351  1.00 16.05 ? 296 PRO B HD3  1 
ATOM   9010  N  N    . ALA B  1 297 ? 66.427  112.950 12.339  1.00 13.80 ? 297 ALA B N    1 
ATOM   9011  C  CA   . ALA B  1 297 ? 65.966  111.573 12.504  1.00 8.14  ? 297 ALA B CA   1 
ATOM   9012  C  C    . ALA B  1 297 ? 64.954  111.166 11.428  1.00 7.03  ? 297 ALA B C    1 
ATOM   9013  O  O    . ALA B  1 297 ? 65.029  110.064 10.879  1.00 7.04  ? 297 ALA B O    1 
ATOM   9014  C  CB   . ALA B  1 297 ? 65.370  111.365 13.891  1.00 8.02  ? 297 ALA B CB   1 
ATOM   9015  H  H    . ALA B  1 297 ? 66.197  113.479 12.977  1.00 16.56 ? 297 ALA B H    1 
ATOM   9016  H  HA   . ALA B  1 297 ? 66.738  110.975 12.422  1.00 9.77  ? 297 ALA B HA   1 
ATOM   9017  H  HB1  . ALA B  1 297 ? 65.076  110.454 13.971  1.00 9.62  ? 297 ALA B HB1  1 
ATOM   9018  H  HB2  . ALA B  1 297 ? 66.042  111.552 14.551  1.00 9.62  ? 297 ALA B HB2  1 
ATOM   9019  H  HB3  . ALA B  1 297 ? 64.625  111.961 14.003  1.00 9.62  ? 297 ALA B HB3  1 
ATOM   9020  N  N    . PHE B  1 298 ? 64.010  112.048 11.107  1.00 10.01 ? 298 PHE B N    1 
ATOM   9021  C  CA   . PHE B  1 298 ? 63.048  111.721 10.064  1.00 8.68  ? 298 PHE B CA   1 
ATOM   9022  C  C    . PHE B  1 298 ? 63.715  111.634 8.681   1.00 6.88  ? 298 PHE B C    1 
ATOM   9023  O  O    . PHE B  1 298 ? 63.408  110.742 7.898   1.00 8.09  ? 298 PHE B O    1 
ATOM   9024  C  CB   . PHE B  1 298 ? 61.860  112.673 10.064  1.00 9.29  ? 298 PHE B CB   1 
ATOM   9025  C  CG   . PHE B  1 298 ? 60.789  112.245 11.016  1.00 6.76  ? 298 PHE B CG   1 
ATOM   9026  C  CD1  . PHE B  1 298 ? 59.944  111.225 10.695  1.00 7.76  ? 298 PHE B CD1  1 
ATOM   9027  C  CD2  . PHE B  1 298 ? 60.665  112.836 12.247  1.00 6.61  ? 298 PHE B CD2  1 
ATOM   9028  C  CE1  . PHE B  1 298 ? 58.995  110.784 11.581  1.00 13.46 ? 298 PHE B CE1  1 
ATOM   9029  C  CE2  . PHE B  1 298 ? 59.699  112.430 13.118  1.00 7.46  ? 298 PHE B CE2  1 
ATOM   9030  C  CZ   . PHE B  1 298 ? 58.857  111.412 12.797  1.00 9.79  ? 298 PHE B CZ   1 
ATOM   9031  H  H    . PHE B  1 298 ? 63.908  112.822 11.468  1.00 12.01 ? 298 PHE B H    1 
ATOM   9032  H  HA   . PHE B  1 298 ? 62.691  110.829 10.259  1.00 10.42 ? 298 PHE B HA   1 
ATOM   9033  H  HB2  . PHE B  1 298 ? 62.161  113.557 10.327  1.00 11.15 ? 298 PHE B HB2  1 
ATOM   9034  H  HB3  . PHE B  1 298 ? 61.477  112.703 9.173   1.00 11.15 ? 298 PHE B HB3  1 
ATOM   9035  H  HD1  . PHE B  1 298 ? 60.034  110.799 9.874   1.00 9.32  ? 298 PHE B HD1  1 
ATOM   9036  H  HD2  . PHE B  1 298 ? 61.231  113.536 12.481  1.00 7.93  ? 298 PHE B HD2  1 
ATOM   9037  H  HE1  . PHE B  1 298 ? 58.415  110.097 11.341  1.00 16.16 ? 298 PHE B HE1  1 
ATOM   9038  H  HE2  . PHE B  1 298 ? 59.622  112.846 13.946  1.00 8.95  ? 298 PHE B HE2  1 
ATOM   9039  H  HZ   . PHE B  1 298 ? 58.206  111.133 13.400  1.00 11.75 ? 298 PHE B HZ   1 
ATOM   9040  N  N    . GLU B  1 299 ? 64.600  112.576 8.392   1.00 7.55  ? 299 GLU B N    1 
ATOM   9041  C  CA   . GLU B  1 299 ? 65.403  112.471 7.175   1.00 10.54 ? 299 GLU B CA   1 
ATOM   9042  C  C    . GLU B  1 299 ? 66.173  111.144 7.129   1.00 12.38 ? 299 GLU B C    1 
ATOM   9043  O  O    . GLU B  1 299 ? 66.202  110.454 6.102   1.00 6.26  ? 299 GLU B O    1 
ATOM   9044  C  CB   . GLU B  1 299 ? 66.373  113.646 7.128   1.00 15.48 ? 299 GLU B CB   1 
ATOM   9045  C  CG   . GLU B  1 299 ? 67.026  113.872 5.819   1.00 17.76 ? 299 GLU B CG   1 
ATOM   9046  C  CD   . GLU B  1 299 ? 68.030  115.017 5.908   1.00 22.64 ? 299 GLU B CD   1 
ATOM   9047  O  OE1  . GLU B  1 299 ? 68.733  115.130 6.952   1.00 22.68 ? 299 GLU B OE1  1 
ATOM   9048  O  OE2  . GLU B  1 299 ? 68.090  115.789 4.952   1.00 27.55 ? 299 GLU B OE2  1 
ATOM   9049  H  H    . GLU B  1 299 ? 64.756  113.274 8.870   1.00 9.06  ? 299 GLU B H    1 
ATOM   9050  H  HA   . GLU B  1 299 ? 64.817  112.519 6.391   1.00 12.65 ? 299 GLU B HA   1 
ATOM   9051  H  HB2  . GLU B  1 299 ? 65.888  114.454 7.356   1.00 18.58 ? 299 GLU B HB2  1 
ATOM   9052  H  HB3  . GLU B  1 299 ? 67.074  113.492 7.781   1.00 18.58 ? 299 GLU B HB3  1 
ATOM   9053  H  HG2  . GLU B  1 299 ? 67.500  113.069 5.552   1.00 21.31 ? 299 GLU B HG2  1 
ATOM   9054  H  HG3  . GLU B  1 299 ? 66.355  114.104 5.159   1.00 21.31 ? 299 GLU B HG3  1 
ATOM   9055  N  N    . ALA B  1 300 ? 66.796  110.776 8.239   1.00 12.83 ? 300 ALA B N    1 
ATOM   9056  C  CA   . ALA B  1 300 ? 67.616  109.569 8.279   1.00 9.75  ? 300 ALA B CA   1 
ATOM   9057  C  C    . ALA B  1 300 ? 66.764  108.323 8.045   1.00 7.49  ? 300 ALA B C    1 
ATOM   9058  O  O    . ALA B  1 300 ? 67.224  107.331 7.432   1.00 9.72  ? 300 ALA B O    1 
ATOM   9059  C  CB   . ALA B  1 300 ? 68.411  109.479 9.625   1.00 7.44  ? 300 ALA B CB   1 
ATOM   9060  H  H    . ALA B  1 300 ? 66.761  111.206 8.983   1.00 15.39 ? 300 ALA B H    1 
ATOM   9061  H  HA   . ALA B  1 300 ? 68.273  109.617 7.553   1.00 11.70 ? 300 ALA B HA   1 
ATOM   9062  H  HB1  . ALA B  1 300 ? 68.940  108.678 9.622   1.00 8.92  ? 300 ALA B HB1  1 
ATOM   9063  H  HB2  . ALA B  1 300 ? 68.981  110.248 9.702   1.00 8.92  ? 300 ALA B HB2  1 
ATOM   9064  H  HB3  . ALA B  1 300 ? 67.788  109.458 10.354  1.00 8.92  ? 300 ALA B HB3  1 
ATOM   9065  N  N    . SER B  1 301 ? 65.513  108.378 8.500   1.00 8.35  ? 301 SER B N    1 
ATOM   9066  C  CA   . SER B  1 301 ? 64.668  107.207 8.462   1.00 9.32  ? 301 SER B CA   1 
ATOM   9067  C  C    . SER B  1 301 ? 64.305  106.807 7.034   1.00 8.27  ? 301 SER B C    1 
ATOM   9068  O  O    . SER B  1 301 ? 64.011  105.626 6.797   1.00 8.00  ? 301 SER B O    1 
ATOM   9069  C  CB   . SER B  1 301 ? 63.395  107.377 9.304   1.00 10.66 ? 301 SER B CB   1 
ATOM   9070  O  OG   . SER B  1 301 ? 62.452  108.195 8.663   1.00 10.36 ? 301 SER B OG   1 
ATOM   9071  H  H    . SER B  1 301 ? 65.139  109.079 8.831   1.00 10.01 ? 301 SER B H    1 
ATOM   9072  H  HA   . SER B  1 301 ? 65.170  106.460 8.850   1.00 11.18 ? 301 SER B HA   1 
ATOM   9073  H  HB2  . SER B  1 301 ? 63.001  106.504 9.455   1.00 12.79 ? 301 SER B HB2  1 
ATOM   9074  H  HB3  . SER B  1 301 ? 63.634  107.781 10.153  1.00 12.79 ? 301 SER B HB3  1 
ATOM   9075  H  HG   . SER B  1 301 ? 62.744  108.446 7.939   1.00 12.43 ? 301 SER B HG   1 
ATOM   9076  N  N    . VAL B  1 302 ? 64.358  107.756 6.098   1.00 6.30  ? 302 VAL B N    1 
ATOM   9077  C  CA   . VAL B  1 302 ? 64.059  107.443 4.701   1.00 6.08  ? 302 VAL B CA   1 
ATOM   9078  C  C    . VAL B  1 302 ? 65.259  107.186 3.790   1.00 6.16  ? 302 VAL B C    1 
ATOM   9079  O  O    . VAL B  1 302 ? 65.053  106.914 2.617   1.00 7.11  ? 302 VAL B O    1 
ATOM   9080  C  CB   . VAL B  1 302 ? 63.128  108.486 4.032   1.00 9.42  ? 302 VAL B CB   1 
ATOM   9081  C  CG1  . VAL B  1 302 ? 61.834  108.593 4.807   1.00 14.38 ? 302 VAL B CG1  1 
ATOM   9082  C  CG2  . VAL B  1 302 ? 63.791  109.819 3.881   1.00 7.19  ? 302 VAL B CG2  1 
ATOM   9083  H  H    . VAL B  1 302 ? 64.561  108.579 6.244   1.00 7.56  ? 302 VAL B H    1 
ATOM   9084  H  HA   . VAL B  1 302 ? 63.553  106.604 4.709   1.00 7.29  ? 302 VAL B HA   1 
ATOM   9085  H  HB   . VAL B  1 302 ? 62.904  108.167 3.132   1.00 11.31 ? 302 VAL B HB   1 
ATOM   9086  H  HG11 . VAL B  1 302 ? 61.268  109.241 4.381   1.00 17.25 ? 302 VAL B HG11 1 
ATOM   9087  H  HG12 . VAL B  1 302 ? 61.402  107.735 4.814   1.00 17.25 ? 302 VAL B HG12 1 
ATOM   9088  H  HG13 . VAL B  1 302 ? 62.030  108.868 5.705   1.00 17.25 ? 302 VAL B HG13 1 
ATOM   9089  H  HG21 . VAL B  1 302 ? 63.177  110.427 3.464   1.00 8.62  ? 302 VAL B HG21 1 
ATOM   9090  H  HG22 . VAL B  1 302 ? 64.037  110.145 4.750   1.00 8.62  ? 302 VAL B HG22 1 
ATOM   9091  H  HG23 . VAL B  1 302 ? 64.574  109.718 3.335   1.00 8.62  ? 302 VAL B HG23 1 
ATOM   9092  N  N    . ALA B  1 303 ? 66.475  107.203 4.333   1.00 8.54  ? 303 ALA B N    1 
ATOM   9093  C  CA   . ALA B  1 303 ? 67.694  107.031 3.542   1.00 9.03  ? 303 ALA B CA   1 
ATOM   9094  C  C    . ALA B  1 303 ? 67.719  105.729 2.753   1.00 8.96  ? 303 ALA B C    1 
ATOM   9095  O  O    . ALA B  1 303 ? 68.199  105.697 1.633   1.00 10.83 ? 303 ALA B O    1 
ATOM   9096  C  CB   . ALA B  1 303 ? 68.916  107.078 4.429   1.00 8.92  ? 303 ALA B CB   1 
ATOM   9097  H  H    . ALA B  1 303 ? 66.623  107.315 5.173   1.00 10.25 ? 303 ALA B H    1 
ATOM   9098  H  HA   . ALA B  1 303 ? 67.761  107.770 2.901   1.00 10.83 ? 303 ALA B HA   1 
ATOM   9099  H  HB1  . ALA B  1 303 ? 69.700  106.963 3.888   1.00 10.71 ? 303 ALA B HB1  1 
ATOM   9100  H  HB2  . ALA B  1 303 ? 68.946  107.929 4.874   1.00 10.71 ? 303 ALA B HB2  1 
ATOM   9101  H  HB3  . ALA B  1 303 ? 68.858  106.372 5.077   1.00 10.71 ? 303 ALA B HB3  1 
ATOM   9102  N  N    . ASP B  1 304 ? 67.262  104.643 3.370   1.00 6.93  ? 304 ASP B N    1 
ATOM   9103  C  CA   . ASP B  1 304 ? 67.244  103.364 2.661   1.00 6.99  ? 304 ASP B CA   1 
ATOM   9104  C  C    . ASP B  1 304 ? 66.174  103.292 1.588   1.00 6.68  ? 304 ASP B C    1 
ATOM   9105  O  O    . ASP B  1 304 ? 66.435  102.793 0.492   1.00 12.16 ? 304 ASP B O    1 
ATOM   9106  C  CB   . ASP B  1 304 ? 67.104  102.169 3.619   1.00 10.27 ? 304 ASP B CB   1 
ATOM   9107  C  CG   . ASP B  1 304 ? 68.351  101.929 4.446   1.00 21.93 ? 304 ASP B CG   1 
ATOM   9108  O  OD1  . ASP B  1 304 ? 69.438  102.393 4.048   1.00 32.75 ? 304 ASP B OD1  1 
ATOM   9109  O  OD2  . ASP B  1 304 ? 68.244  101.255 5.496   1.00 34.96 ? 304 ASP B OD2  1 
ATOM   9110  H  H    . ASP B  1 304 ? 66.965  104.617 4.177   1.00 8.32  ? 304 ASP B H    1 
ATOM   9111  H  HA   . ASP B  1 304 ? 68.106  103.263 2.207   1.00 8.38  ? 304 ASP B HA   1 
ATOM   9112  H  HB2  . ASP B  1 304 ? 66.368  102.337 4.228   1.00 12.32 ? 304 ASP B HB2  1 
ATOM   9113  H  HB3  . ASP B  1 304 ? 66.929  101.367 3.101   1.00 12.32 ? 304 ASP B HB3  1 
ATOM   9114  N  N    . VAL B  1 305 ? 64.966  103.726 1.901   1.00 6.44  ? 305 VAL B N    1 
ATOM   9115  C  CA   . VAL B  1 305 ? 63.855  103.522 0.998   1.00 6.66  ? 305 VAL B CA   1 
ATOM   9116  C  C    . VAL B  1 305 ? 64.051  104.349 -0.271  1.00 9.60  ? 305 VAL B C    1 
ATOM   9117  O  O    . VAL B  1 305 ? 63.709  103.886 -1.358  1.00 7.06  ? 305 VAL B O    1 
ATOM   9118  C  CB   . VAL B  1 305 ? 62.513  103.850 1.644   1.00 8.08  ? 305 VAL B CB   1 
ATOM   9119  C  CG1  . VAL B  1 305 ? 62.347  105.359 1.896   1.00 8.66  ? 305 VAL B CG1  1 
ATOM   9120  C  CG2  . VAL B  1 305 ? 61.374  103.293 0.815   1.00 8.76  ? 305 VAL B CG2  1 
ATOM   9121  H  H    . VAL B  1 305 ? 64.766  104.141 2.627   1.00 7.73  ? 305 VAL B H    1 
ATOM   9122  H  HA   . VAL B  1 305 ? 63.834  102.578 0.736   1.00 8.00  ? 305 VAL B HA   1 
ATOM   9123  H  HB   . VAL B  1 305 ? 62.479  103.407 2.518   1.00 9.69  ? 305 VAL B HB   1 
ATOM   9124  H  HG11 . VAL B  1 305 ? 61.491  105.516 2.302   1.00 10.39 ? 305 VAL B HG11 1 
ATOM   9125  H  HG12 . VAL B  1 305 ? 63.047  105.657 2.481   1.00 10.39 ? 305 VAL B HG12 1 
ATOM   9126  H  HG13 . VAL B  1 305 ? 62.402  105.823 1.057   1.00 10.39 ? 305 VAL B HG13 1 
ATOM   9127  H  HG21 . VAL B  1 305 ? 60.542  103.512 1.241   1.00 10.51 ? 305 VAL B HG21 1 
ATOM   9128  H  HG22 . VAL B  1 305 ? 61.406  103.684 -0.061  1.00 10.51 ? 305 VAL B HG22 1 
ATOM   9129  H  HG23 . VAL B  1 305 ? 61.470  102.340 0.753   1.00 10.51 ? 305 VAL B HG23 1 
ATOM   9130  N  N    . ILE B  1 306 ? 64.615  105.553 -0.142  1.00 8.29  ? 306 ILE B N    1 
ATOM   9131  C  CA   . ILE B  1 306 ? 64.835  106.358 -1.345  1.00 11.37 ? 306 ILE B CA   1 
ATOM   9132  C  C    . ILE B  1 306 ? 65.910  105.797 -2.288  1.00 10.60 ? 306 ILE B C    1 
ATOM   9133  O  O    . ILE B  1 306 ? 65.878  106.015 -3.510  1.00 10.56 ? 306 ILE B O    1 
ATOM   9134  C  CB   . ILE B  1 306 ? 65.140  107.813 -1.024  1.00 8.88  ? 306 ILE B CB   1 
ATOM   9135  C  CG1  . ILE B  1 306 ? 66.413  107.922 -0.170  1.00 5.85  ? 306 ILE B CG1  1 
ATOM   9136  C  CG2  . ILE B  1 306 ? 63.918  108.428 -0.340  1.00 13.64 ? 306 ILE B CG2  1 
ATOM   9137  C  CD1  . ILE B  1 306 ? 66.698  109.321 0.394   1.00 13.83 ? 306 ILE B CD1  1 
ATOM   9138  H  H    . ILE B  1 306 ? 64.869  105.913 0.597   1.00 9.95  ? 306 ILE B H    1 
ATOM   9139  H  HA   . ILE B  1 306 ? 63.997  106.357 -1.852  1.00 13.64 ? 306 ILE B HA   1 
ATOM   9140  H  HB   . ILE B  1 306 ? 65.292  108.284 -1.858  1.00 10.65 ? 306 ILE B HB   1 
ATOM   9141  H  HG12 . ILE B  1 306 ? 66.334  107.314 0.582   1.00 7.02  ? 306 ILE B HG12 1 
ATOM   9142  H  HG13 . ILE B  1 306 ? 67.173  107.666 -0.716  1.00 7.02  ? 306 ILE B HG13 1 
ATOM   9143  H  HG21 . ILE B  1 306 ? 64.104  109.347 -0.135  1.00 16.37 ? 306 ILE B HG21 1 
ATOM   9144  H  HG22 . ILE B  1 306 ? 63.166  108.371 -0.935  1.00 16.37 ? 306 ILE B HG22 1 
ATOM   9145  H  HG23 . ILE B  1 306 ? 63.734  107.942 0.467   1.00 16.37 ? 306 ILE B HG23 1 
ATOM   9146  H  HD11 . ILE B  1 306 ? 67.507  109.291 0.909   1.00 16.59 ? 306 ILE B HD11 1 
ATOM   9147  H  HD12 . ILE B  1 306 ? 66.796  109.937 -0.336  1.00 16.59 ? 306 ILE B HD12 1 
ATOM   9148  H  HD13 . ILE B  1 306 ? 65.963  109.588 0.951   1.00 16.59 ? 306 ILE B HD13 1 
ATOM   9149  N  N    . SER B  1 307 ? 66.838  105.046 -1.728  1.00 9.67  ? 307 SER B N    1 
ATOM   9150  C  CA   . SER B  1 307 ? 67.922  104.503 -2.516  1.00 12.86 ? 307 SER B CA   1 
ATOM   9151  C  C    . SER B  1 307 ? 67.530  103.175 -3.178  1.00 10.60 ? 307 SER B C    1 
ATOM   9152  O  O    . SER B  1 307 ? 67.701  103.026 -4.392  1.00 14.20 ? 307 SER B O    1 
ATOM   9153  C  CB   . SER B  1 307 ? 69.183  104.385 -1.651  1.00 18.62 ? 307 SER B CB   1 
ATOM   9154  O  OG   . SER B  1 307 ? 70.106  103.499 -2.256  1.00 31.39 ? 307 SER B OG   1 
ATOM   9155  H  H    . SER B  1 307 ? 66.863  104.837 -0.895  1.00 11.60 ? 307 SER B H    1 
ATOM   9156  H  HA   . SER B  1 307 ? 68.124  105.136 -3.237  1.00 15.43 ? 307 SER B HA   1 
ATOM   9157  H  HB2  . SER B  1 307 ? 69.593  105.260 -1.565  1.00 22.34 ? 307 SER B HB2  1 
ATOM   9158  H  HB3  . SER B  1 307 ? 68.939  104.043 -0.777  1.00 22.34 ? 307 SER B HB3  1 
ATOM   9159  H  HG   . SER B  1 307 ? 70.779  103.437 -1.793  1.00 37.66 ? 307 SER B HG   1 
ATOM   9160  N  N    . THR B  1 308 ? 66.978  102.229 -2.412  1.00 7.57  ? 308 THR B N    1 
ATOM   9161  C  CA   . THR B  1 308 ? 66.681  100.887 -2.933  1.00 14.84 ? 308 THR B CA   1 
ATOM   9162  C  C    . THR B  1 308 ? 65.242  100.391 -2.669  1.00 12.01 ? 308 THR B C    1 
ATOM   9163  O  O    . THR B  1 308 ? 64.865  99.276  -3.077  1.00 13.38 ? 308 THR B O    1 
ATOM   9164  C  CB   . THR B  1 308 ? 67.671  99.848  -2.350  1.00 15.30 ? 308 THR B CB   1 
ATOM   9165  O  OG1  . THR B  1 308 ? 67.604  99.870  -0.919  1.00 21.66 ? 308 THR B OG1  1 
ATOM   9166  C  CG2  . THR B  1 308 ? 69.088  100.173 -2.788  1.00 24.71 ? 308 THR B CG2  1 
ATOM   9167  H  H    . THR B  1 308 ? 66.764  102.339 -1.586  1.00 9.08  ? 308 THR B H    1 
ATOM   9168  H  HA   . THR B  1 308 ? 66.810  100.900 -3.905  1.00 17.80 ? 308 THR B HA   1 
ATOM   9169  H  HB   . THR B  1 308 ? 67.442  98.963  -2.673  1.00 18.36 ? 308 THR B HB   1 
ATOM   9170  H  HG1  . THR B  1 308 ? 66.844  99.685  -0.671  1.00 26.00 ? 308 THR B HG1  1 
ATOM   9171  H  HG21 . THR B  1 308 ? 69.699  99.528  -2.425  1.00 29.66 ? 308 THR B HG21 1 
ATOM   9172  H  HG22 . THR B  1 308 ? 69.147  100.154 -3.746  1.00 29.66 ? 308 THR B HG22 1 
ATOM   9173  H  HG23 . THR B  1 308 ? 69.335  101.047 -2.477  1.00 29.66 ? 308 THR B HG23 1 
ATOM   9174  N  N    . GLY B  1 309 ? 64.414  101.231 -2.067  1.00 10.47 ? 309 GLY B N    1 
ATOM   9175  C  CA   . GLY B  1 309 ? 63.049  100.850 -1.730  1.00 10.52 ? 309 GLY B CA   1 
ATOM   9176  C  C    . GLY B  1 309 ? 62.023  100.913 -2.841  1.00 7.95  ? 309 GLY B C    1 
ATOM   9177  O  O    . GLY B  1 309 ? 60.873  100.469 -2.661  1.00 8.47  ? 309 GLY B O    1 
ATOM   9178  H  H    . GLY B  1 309 ? 64.619  102.035 -1.841  1.00 12.57 ? 309 GLY B H    1 
ATOM   9179  H  HA2  . GLY B  1 309 ? 63.058  99.940  -1.394  1.00 12.63 ? 309 GLY B HA2  1 
ATOM   9180  H  HA3  . GLY B  1 309 ? 62.738  101.425 -1.013  1.00 12.63 ? 309 GLY B HA3  1 
ATOM   9181  N  N    . PHE B  1 310 ? 62.431  101.465 -3.992  1.00 6.08  ? 310 PHE B N    1 
ATOM   9182  C  CA   . PHE B  1 310 ? 61.614  101.511 -5.179  1.00 7.01  ? 310 PHE B CA   1 
ATOM   9183  C  C    . PHE B  1 310 ? 62.372  100.817 -6.320  1.00 8.92  ? 310 PHE B C    1 
ATOM   9184  O  O    . PHE B  1 310 ? 63.037  101.452 -7.154  1.00 8.16  ? 310 PHE B O    1 
ATOM   9185  C  CB   . PHE B  1 310 ? 61.243  102.962 -5.535  1.00 5.63  ? 310 PHE B CB   1 
ATOM   9186  C  CG   . PHE B  1 310 ? 60.502  103.679 -4.426  1.00 7.04  ? 310 PHE B CG   1 
ATOM   9187  C  CD1  . PHE B  1 310 ? 59.138  103.481 -4.236  1.00 5.69  ? 310 PHE B CD1  1 
ATOM   9188  C  CD2  . PHE B  1 310 ? 61.163  104.559 -3.601  1.00 6.50  ? 310 PHE B CD2  1 
ATOM   9189  C  CE1  . PHE B  1 310 ? 58.458  104.139 -3.229  1.00 13.83 ? 310 PHE B CE1  1 
ATOM   9190  C  CE2  . PHE B  1 310 ? 60.493  105.206 -2.598  1.00 5.30  ? 310 PHE B CE2  1 
ATOM   9191  C  CZ   . PHE B  1 310 ? 59.135  105.002 -2.421  1.00 5.27  ? 310 PHE B CZ   1 
ATOM   9192  H  H    . PHE B  1 310 ? 63.204  101.826 -4.098  1.00 7.30  ? 310 PHE B H    1 
ATOM   9193  H  HA   . PHE B  1 310 ? 60.784  101.015 -5.017  1.00 8.41  ? 310 PHE B HA   1 
ATOM   9194  H  HB2  . PHE B  1 310 ? 62.056  103.458 -5.720  1.00 6.76  ? 310 PHE B HB2  1 
ATOM   9195  H  HB3  . PHE B  1 310 ? 60.673  102.958 -6.319  1.00 6.76  ? 310 PHE B HB3  1 
ATOM   9196  H  HD1  . PHE B  1 310 ? 58.679  102.893 -4.791  1.00 6.83  ? 310 PHE B HD1  1 
ATOM   9197  H  HD2  . PHE B  1 310 ? 62.075  104.703 -3.714  1.00 7.81  ? 310 PHE B HD2  1 
ATOM   9198  H  HE1  . PHE B  1 310 ? 57.547  103.998 -3.108  1.00 16.59 ? 310 PHE B HE1  1 
ATOM   9199  H  HE2  . PHE B  1 310 ? 60.948  105.798 -2.044  1.00 6.36  ? 310 PHE B HE2  1 
ATOM   9200  H  HZ   . PHE B  1 310 ? 58.686  105.446 -1.739  1.00 6.32  ? 310 PHE B HZ   1 
ATOM   9201  N  N    . PRO B  1 311 ? 62.314  99.484  -6.323  1.00 6.43  ? 311 PRO B N    1 
ATOM   9202  C  CA   . PRO B  1 311 ? 62.949  98.674  -7.371  1.00 7.18  ? 311 PRO B CA   1 
ATOM   9203  C  C    . PRO B  1 311 ? 62.555  99.089  -8.799  1.00 7.77  ? 311 PRO B C    1 
ATOM   9204  O  O    . PRO B  1 311 ? 63.322  98.840  -9.733  1.00 16.47 ? 311 PRO B O    1 
ATOM   9205  C  CB   . PRO B  1 311 ? 62.467  97.258  -7.066  1.00 12.69 ? 311 PRO B CB   1 
ATOM   9206  C  CG   . PRO B  1 311 ? 61.954  97.283  -5.661  1.00 9.52  ? 311 PRO B CG   1 
ATOM   9207  C  CD   . PRO B  1 311 ? 61.606  98.684  -5.313  1.00 6.59  ? 311 PRO B CD   1 
ATOM   9208  H  HA   . PRO B  1 311 ? 63.924  98.709  -7.282  1.00 8.61  ? 311 PRO B HA   1 
ATOM   9209  H  HB2  . PRO B  1 311 ? 61.757  97.017  -7.682  1.00 15.23 ? 311 PRO B HB2  1 
ATOM   9210  H  HB3  . PRO B  1 311 ? 63.210  96.639  -7.145  1.00 15.23 ? 311 PRO B HB3  1 
ATOM   9211  H  HG2  . PRO B  1 311 ? 61.166  96.720  -5.600  1.00 11.43 ? 311 PRO B HG2  1 
ATOM   9212  H  HG3  . PRO B  1 311 ? 62.645  96.954  -5.065  1.00 11.43 ? 311 PRO B HG3  1 
ATOM   9213  H  HD2  . PRO B  1 311 ? 60.649  98.822  -5.386  1.00 7.91  ? 311 PRO B HD2  1 
ATOM   9214  H  HD3  . PRO B  1 311 ? 61.929  98.901  -4.425  1.00 7.91  ? 311 PRO B HD3  1 
ATOM   9215  N  N    . GLU B  1 312 ? 61.366  99.668  -8.967  1.00 10.64 ? 312 GLU B N    1 
ATOM   9216  C  CA   . GLU B  1 312 ? 60.899  100.133 -10.274 1.00 10.16 ? 312 GLU B CA   1 
ATOM   9217  C  C    . GLU B  1 312 ? 61.666  101.352 -10.826 1.00 13.48 ? 312 GLU B C    1 
ATOM   9218  O  O    . GLU B  1 312 ? 61.679  101.580 -12.058 1.00 8.28  ? 312 GLU B O    1 
ATOM   9219  C  CB   . GLU B  1 312 ? 59.389  100.431 -10.242 1.00 10.76 ? 312 GLU B CB   1 
ATOM   9220  C  CG   . GLU B  1 312 ? 58.939  101.524 -9.341  1.00 11.35 ? 312 GLU B CG   1 
ATOM   9221  C  CD   . GLU B  1 312 ? 58.463  101.025 -8.005  1.00 8.60  ? 312 GLU B CD   1 
ATOM   9222  O  OE1  . GLU B  1 312 ? 59.284  100.449 -7.280  1.00 12.22 ? 312 GLU B OE1  1 
ATOM   9223  O  OE2  . GLU B  1 312 ? 57.265  101.186 -7.713  1.00 10.57 ? 312 GLU B OE2  1 
ATOM   9224  H  H    . GLU B  1 312 ? 60.804  99.804  -8.331  1.00 12.77 ? 312 GLU B H    1 
ATOM   9225  H  HA   . GLU B  1 312 ? 61.031  99.403  -10.915 1.00 12.19 ? 312 GLU B HA   1 
ATOM   9226  H  HB2  . GLU B  1 312 ? 59.109  100.667 -11.140 1.00 12.91 ? 312 GLU B HB2  1 
ATOM   9227  H  HB3  . GLU B  1 312 ? 58.928  99.624  -9.966  1.00 12.91 ? 312 GLU B HB3  1 
ATOM   9228  H  HG2  . GLU B  1 312 ? 59.680  102.131 -9.186  1.00 13.62 ? 312 GLU B HG2  1 
ATOM   9229  H  HG3  . GLU B  1 312 ? 58.205  101.998 -9.762  1.00 13.62 ? 312 GLU B HG3  1 
ATOM   9230  N  N    . TRP B  1 313 ? 62.288  102.131 -9.946  1.00 9.39  ? 313 TRP B N    1 
ATOM   9231  C  CA   . TRP B  1 313 ? 63.034  103.326 -10.371 1.00 11.21 ? 313 TRP B CA   1 
ATOM   9232  C  C    . TRP B  1 313 ? 64.323  103.006 -11.127 1.00 9.48  ? 313 TRP B C    1 
ATOM   9233  O  O    . TRP B  1 313 ? 65.006  102.012 -10.843 1.00 6.38  ? 313 TRP B O    1 
ATOM   9234  C  CB   . TRP B  1 313 ? 63.415  104.198 -9.169  1.00 8.73  ? 313 TRP B CB   1 
ATOM   9235  C  CG   . TRP B  1 313 ? 62.353  105.045 -8.665  1.00 5.45  ? 313 TRP B CG   1 
ATOM   9236  C  CD1  . TRP B  1 313 ? 61.117  105.221 -9.199  1.00 6.70  ? 313 TRP B CD1  1 
ATOM   9237  C  CD2  . TRP B  1 313 ? 62.400  105.854 -7.474  1.00 5.31  ? 313 TRP B CD2  1 
ATOM   9238  N  NE1  . TRP B  1 313 ? 60.394  106.093 -8.407  1.00 7.53  ? 313 TRP B NE1  1 
ATOM   9239  C  CE2  . TRP B  1 313 ? 61.164  106.489 -7.353  1.00 5.10  ? 313 TRP B CE2  1 
ATOM   9240  C  CE3  . TRP B  1 313 ? 63.379  106.101 -6.516  1.00 5.39  ? 313 TRP B CE3  1 
ATOM   9241  C  CZ2  . TRP B  1 313 ? 60.855  107.341 -6.274  1.00 6.67  ? 313 TRP B CZ2  1 
ATOM   9242  C  CZ3  . TRP B  1 313 ? 63.080  106.963 -5.462  1.00 7.95  ? 313 TRP B CZ3  1 
ATOM   9243  C  CH2  . TRP B  1 313 ? 61.827  107.568 -5.364  1.00 7.58  ? 313 TRP B CH2  1 
ATOM   9244  H  H    . TRP B  1 313 ? 62.296  101.994 -9.097  1.00 11.26 ? 313 TRP B H    1 
ATOM   9245  H  HA   . TRP B  1 313 ? 62.464  103.861 -10.961 1.00 13.45 ? 313 TRP B HA   1 
ATOM   9246  H  HB2  . TRP B  1 313 ? 63.695  103.618 -8.444  1.00 10.47 ? 313 TRP B HB2  1 
ATOM   9247  H  HB3  . TRP B  1 313 ? 64.151  104.774 -9.428  1.00 10.47 ? 313 TRP B HB3  1 
ATOM   9248  H  HD1  . TRP B  1 313 ? 60.803  104.811 -9.972  1.00 8.04  ? 313 TRP B HD1  1 
ATOM   9249  H  HE1  . TRP B  1 313 ? 59.583  106.340 -8.552  1.00 9.03  ? 313 TRP B HE1  1 
ATOM   9250  H  HE3  . TRP B  1 313 ? 64.210  105.688 -6.570  1.00 6.47  ? 313 TRP B HE3  1 
ATOM   9251  H  HZ2  . TRP B  1 313 ? 60.031  107.768 -6.217  1.00 8.01  ? 313 TRP B HZ2  1 
ATOM   9252  H  HZ3  . TRP B  1 313 ? 63.722  107.129 -4.810  1.00 9.53  ? 313 TRP B HZ3  1 
ATOM   9253  H  HH2  . TRP B  1 313 ? 61.657  108.144 -4.654  1.00 9.09  ? 313 TRP B HH2  1 
ATOM   9254  N  N    . SER B  1 314 ? 64.661  103.872 -12.092 1.00 6.68  ? 314 SER B N    1 
ATOM   9255  C  CA   . SER B  1 314 ? 66.017  103.916 -12.600 1.00 7.54  ? 314 SER B CA   1 
ATOM   9256  C  C    . SER B  1 314 ? 67.025  103.960 -11.463 1.00 9.64  ? 314 SER B C    1 
ATOM   9257  O  O    . SER B  1 314 ? 66.812  104.629 -10.450 1.00 7.56  ? 314 SER B O    1 
ATOM   9258  C  CB   . SER B  1 314 ? 66.199  105.131 -13.520 1.00 11.58 ? 314 SER B CB   1 
ATOM   9259  O  OG   . SER B  1 314 ? 65.329  105.037 -14.626 1.00 12.05 ? 314 SER B OG   1 
ATOM   9260  H  H    . SER B  1 314 ? 64.124  104.435 -12.459 1.00 8.02  ? 314 SER B H    1 
ATOM   9261  H  HA   . SER B  1 314 ? 66.188  103.107 -13.127 1.00 9.04  ? 314 SER B HA   1 
ATOM   9262  H  HB2  . SER B  1 314 ? 65.996  105.939 -13.023 1.00 13.90 ? 314 SER B HB2  1 
ATOM   9263  H  HB3  . SER B  1 314 ? 67.116  105.155 -13.837 1.00 13.90 ? 314 SER B HB3  1 
ATOM   9264  H  HG   . SER B  1 314 ? 65.427  105.687 -15.116 1.00 14.46 ? 314 SER B HG   1 
ATOM   9265  N  N    . PRO B  1 315 ? 68.157  103.265 -11.635 1.00 14.46 ? 315 PRO B N    1 
ATOM   9266  C  CA   . PRO B  1 315 ? 69.238  103.305 -10.641 1.00 18.81 ? 315 PRO B CA   1 
ATOM   9267  C  C    . PRO B  1 315 ? 69.648  104.744 -10.273 1.00 6.96  ? 315 PRO B C    1 
ATOM   9268  O  O    . PRO B  1 315 ? 69.786  105.601 -11.156 1.00 11.76 ? 315 PRO B O    1 
ATOM   9269  C  CB   . PRO B  1 315 ? 70.394  102.606 -11.362 1.00 26.74 ? 315 PRO B CB   1 
ATOM   9270  C  CG   . PRO B  1 315 ? 69.725  101.679 -12.336 1.00 30.42 ? 315 PRO B CG   1 
ATOM   9271  C  CD   . PRO B  1 315 ? 68.454  102.360 -12.762 1.00 20.36 ? 315 PRO B CD   1 
ATOM   9272  H  HA   . PRO B  1 315 ? 68.994  102.806 -9.834  1.00 22.57 ? 315 PRO B HA   1 
ATOM   9273  H  HB2  . PRO B  1 315 ? 70.937  103.262 -11.827 1.00 32.09 ? 315 PRO B HB2  1 
ATOM   9274  H  HB3  . PRO B  1 315 ? 70.927  102.107 -10.722 1.00 32.09 ? 315 PRO B HB3  1 
ATOM   9275  H  HG2  . PRO B  1 315 ? 70.307  101.538 -13.100 1.00 36.50 ? 315 PRO B HG2  1 
ATOM   9276  H  HG3  . PRO B  1 315 ? 69.528  100.836 -11.898 1.00 36.50 ? 315 PRO B HG3  1 
ATOM   9277  H  HD2  . PRO B  1 315 ? 68.599  102.868 -13.575 1.00 24.43 ? 315 PRO B HD2  1 
ATOM   9278  H  HD3  . PRO B  1 315 ? 67.743  101.709 -12.871 1.00 24.43 ? 315 PRO B HD3  1 
ATOM   9279  N  N    . ASN B  1 316 ? 69.847  104.983 -8.983  1.00 7.10  ? 316 ASN B N    1 
ATOM   9280  C  CA   . ASN B  1 316 ? 70.345  106.260 -8.476  1.00 11.94 ? 316 ASN B CA   1 
ATOM   9281  C  C    . ASN B  1 316 ? 69.413  107.430 -8.744  1.00 9.35  ? 316 ASN B C    1 
ATOM   9282  O  O    . ASN B  1 316 ? 69.858  108.569 -8.765  1.00 8.69  ? 316 ASN B O    1 
ATOM   9283  C  CB   . ASN B  1 316 ? 71.721  106.574 -9.081  1.00 14.81 ? 316 ASN B CB   1 
ATOM   9284  C  CG   . ASN B  1 316 ? 72.649  105.359 -9.074  1.00 12.45 ? 316 ASN B CG   1 
ATOM   9285  O  OD1  . ASN B  1 316 ? 72.691  104.606 -8.100  1.00 17.52 ? 316 ASN B OD1  1 
ATOM   9286  N  ND2  . ASN B  1 316 ? 73.360  105.145 -10.180 1.00 11.33 ? 316 ASN B ND2  1 
ATOM   9287  H  H    . ASN B  1 316 ? 69.697  104.406 -8.363  1.00 8.52  ? 316 ASN B H    1 
ATOM   9288  H  HA   . ASN B  1 316 ? 70.457  106.188 -7.505  1.00 14.33 ? 316 ASN B HA   1 
ATOM   9289  H  HB2  . ASN B  1 316 ? 71.605  106.860 -10.000 1.00 17.77 ? 316 ASN B HB2  1 
ATOM   9290  H  HB3  . ASN B  1 316 ? 72.142  107.278 -8.563  1.00 17.77 ? 316 ASN B HB3  1 
ATOM   9291  H  HD21 . ASN B  1 316 ? 73.283  105.677 -10.851 1.00 13.60 ? 316 ASN B HD21 1 
ATOM   9292  H  HD22 . ASN B  1 316 ? 73.896  104.473 -10.223 1.00 13.60 ? 316 ASN B HD22 1 
ATOM   9293  N  N    . LEU B  1 317 ? 68.130  107.177 -8.957  1.00 6.52  ? 317 LEU B N    1 
ATOM   9294  C  CA   . LEU B  1 317 ? 67.210  108.262 -9.311  1.00 6.66  ? 317 LEU B CA   1 
ATOM   9295  C  C    . LEU B  1 317 ? 67.159  109.425 -8.329  1.00 6.14  ? 317 LEU B C    1 
ATOM   9296  O  O    . LEU B  1 317 ? 67.201  110.568 -8.734  1.00 8.29  ? 317 LEU B O    1 
ATOM   9297  C  CB   . LEU B  1 317 ? 65.799  107.723 -9.554  1.00 5.76  ? 317 LEU B CB   1 
ATOM   9298  C  CG   . LEU B  1 317 ? 64.797  108.703 -10.181 1.00 5.56  ? 317 LEU B CG   1 
ATOM   9299  C  CD1  . LEU B  1 317 ? 65.196  109.198 -11.531 1.00 5.99  ? 317 LEU B CD1  1 
ATOM   9300  C  CD2  . LEU B  1 317 ? 63.425  108.073 -10.240 1.00 6.02  ? 317 LEU B CD2  1 
ATOM   9301  H  H    . LEU B  1 317 ? 67.766  106.400 -8.905  1.00 7.83  ? 317 LEU B H    1 
ATOM   9302  H  HA   . LEU B  1 317 ? 67.515  108.635 -10.165 1.00 7.99  ? 317 LEU B HA   1 
ATOM   9303  H  HB2  . LEU B  1 317 ? 65.864  106.957 -10.147 1.00 6.91  ? 317 LEU B HB2  1 
ATOM   9304  H  HB3  . LEU B  1 317 ? 65.431  107.439 -8.702  1.00 6.91  ? 317 LEU B HB3  1 
ATOM   9305  H  HG   . LEU B  1 317 ? 64.731  109.478 -9.602  1.00 6.67  ? 317 LEU B HG   1 
ATOM   9306  H  HD11 . LEU B  1 317 ? 64.523  109.802 -11.853 1.00 7.19  ? 317 LEU B HD11 1 
ATOM   9307  H  HD12 . LEU B  1 317 ? 66.038  109.654 -11.459 1.00 7.19  ? 317 LEU B HD12 1 
ATOM   9308  H  HD13 . LEU B  1 317 ? 65.278  108.450 -12.126 1.00 7.19  ? 317 LEU B HD13 1 
ATOM   9309  H  HD21 . LEU B  1 317 ? 62.811  108.697 -10.634 1.00 7.23  ? 317 LEU B HD21 1 
ATOM   9310  H  HD22 . LEU B  1 317 ? 63.470  107.276 -10.773 1.00 7.23  ? 317 LEU B HD22 1 
ATOM   9311  H  HD23 . LEU B  1 317 ? 63.143  107.854 -9.348  1.00 7.23  ? 317 LEU B HD23 1 
ATOM   9312  N  N    . TYR B  1 318 ? 67.064  109.145 -7.033  1.00 7.60  ? 318 TYR B N    1 
ATOM   9313  C  CA   . TYR B  1 318 ? 66.921  110.196 -6.064  1.00 6.54  ? 318 TYR B CA   1 
ATOM   9314  C  C    . TYR B  1 318 ? 68.142  111.082 -6.045  1.00 7.38  ? 318 TYR B C    1 
ATOM   9315  O  O    . TYR B  1 318 ? 68.028  112.319 -6.098  1.00 9.78  ? 318 TYR B O    1 
ATOM   9316  C  CB   . TYR B  1 318 ? 66.657  109.543 -4.702  1.00 5.61  ? 318 TYR B CB   1 
ATOM   9317  C  CG   . TYR B  1 318 ? 66.385  110.497 -3.583  1.00 6.42  ? 318 TYR B CG   1 
ATOM   9318  C  CD1  . TYR B  1 318 ? 67.426  111.135 -2.950  1.00 6.98  ? 318 TYR B CD1  1 
ATOM   9319  C  CD2  . TYR B  1 318 ? 65.083  110.725 -3.134  1.00 7.16  ? 318 TYR B CD2  1 
ATOM   9320  C  CE1  . TYR B  1 318 ? 67.183  112.022 -1.872  1.00 9.75  ? 318 TYR B CE1  1 
ATOM   9321  C  CE2  . TYR B  1 318 ? 64.827  111.576 -2.053  1.00 8.66  ? 318 TYR B CE2  1 
ATOM   9322  C  CZ   . TYR B  1 318 ? 65.872  112.227 -1.446  1.00 7.35  ? 318 TYR B CZ   1 
ATOM   9323  O  OH   . TYR B  1 318 ? 65.605  113.037 -0.378  1.00 7.93  ? 318 TYR B OH   1 
ATOM   9324  H  H    . TYR B  1 318 ? 67.081  108.352 -6.700  1.00 9.12  ? 318 TYR B H    1 
ATOM   9325  H  HA   . TYR B  1 318 ? 66.144  110.748 -6.296  1.00 7.85  ? 318 TYR B HA   1 
ATOM   9326  H  HB2  . TYR B  1 318 ? 65.886  108.960 -4.784  1.00 6.74  ? 318 TYR B HB2  1 
ATOM   9327  H  HB3  . TYR B  1 318 ? 67.436  109.018 -4.457  1.00 6.74  ? 318 TYR B HB3  1 
ATOM   9328  H  HD1  . TYR B  1 318 ? 68.297  110.992 -3.241  1.00 8.37  ? 318 TYR B HD1  1 
ATOM   9329  H  HD2  . TYR B  1 318 ? 64.375  110.282 -3.543  1.00 8.59  ? 318 TYR B HD2  1 
ATOM   9330  H  HE1  . TYR B  1 318 ? 67.890  112.448 -1.444  1.00 11.69 ? 318 TYR B HE1  1 
ATOM   9331  H  HE2  . TYR B  1 318 ? 63.955  111.718 -1.765  1.00 10.39 ? 318 TYR B HE2  1 
ATOM   9332  H  HH   . TYR B  1 318 ? 65.224  112.610 0.210   1.00 9.52  ? 318 TYR B HH   1 
ATOM   9333  N  N    . LYS B  1 319 ? 69.320  110.456 -5.987  1.00 8.30  ? 319 LYS B N    1 
ATOM   9334  C  CA   . LYS B  1 319 ? 70.556  111.216 -6.056  1.00 9.50  ? 319 LYS B CA   1 
ATOM   9335  C  C    . LYS B  1 319 ? 70.686  112.030 -7.352  1.00 10.02 ? 319 LYS B C    1 
ATOM   9336  O  O    . LYS B  1 319 ? 71.125  113.174 -7.330  1.00 9.61  ? 319 LYS B O    1 
ATOM   9337  C  CB   . LYS B  1 319 ? 71.773  110.320 -5.845  1.00 9.52  ? 319 LYS B CB   1 
ATOM   9338  C  CG   . LYS B  1 319 ? 71.837  109.780 -4.411  1.00 19.74 ? 319 LYS B CG   1 
ATOM   9339  C  CD   . LYS B  1 319 ? 73.140  109.059 -4.086  1.00 29.64 ? 319 LYS B CD   1 
ATOM   9340  C  CE   . LYS B  1 319 ? 73.125  108.548 -2.632  1.00 29.47 ? 319 LYS B CE   1 
ATOM   9341  N  NZ   . LYS B  1 319 ? 73.220  109.644 -1.618  1.00 34.74 ? 319 LYS B NZ   1 
ATOM   9342  H  H    . LYS B  1 319 ? 69.424  109.606 -5.908  1.00 9.96  ? 319 LYS B H    1 
ATOM   9343  H  HA   . LYS B  1 319 ? 70.550  111.861 -5.318  1.00 11.40 ? 319 LYS B HA   1 
ATOM   9344  H  HB2  . LYS B  1 319 ? 71.723  109.565 -6.452  1.00 11.43 ? 319 LYS B HB2  1 
ATOM   9345  H  HB3  . LYS B  1 319 ? 72.580  110.832 -6.013  1.00 11.43 ? 319 LYS B HB3  1 
ATOM   9346  H  HG2  . LYS B  1 319 ? 71.746  110.522 -3.793  1.00 23.69 ? 319 LYS B HG2  1 
ATOM   9347  H  HG3  . LYS B  1 319 ? 71.109  109.152 -4.280  1.00 23.69 ? 319 LYS B HG3  1 
ATOM   9348  H  HD2  . LYS B  1 319 ? 73.245  108.298 -4.678  1.00 35.57 ? 319 LYS B HD2  1 
ATOM   9349  H  HD3  . LYS B  1 319 ? 73.884  109.673 -4.188  1.00 35.57 ? 319 LYS B HD3  1 
ATOM   9350  H  HE2  . LYS B  1 319 ? 72.296  108.068 -2.476  1.00 35.36 ? 319 LYS B HE2  1 
ATOM   9351  H  HE3  . LYS B  1 319 ? 73.880  107.953 -2.501  1.00 35.36 ? 319 LYS B HE3  1 
ATOM   9352  H  HZ1  . LYS B  1 319 ? 73.208  109.301 -0.797  1.00 41.68 ? 319 LYS B HZ1  1 
ATOM   9353  H  HZ2  . LYS B  1 319 ? 73.978  110.097 -1.730  1.00 41.68 ? 319 LYS B HZ2  1 
ATOM   9354  H  HZ3  . LYS B  1 319 ? 72.533  110.203 -1.708  1.00 41.68 ? 319 LYS B HZ3  1 
ATOM   9355  N  N    . ASN B  1 320 ? 70.319  111.423 -8.476  1.00 8.57  ? 320 ASN B N    1 
ATOM   9356  C  CA   . ASN B  1 320 ? 70.361  112.107 -9.744  1.00 8.25  ? 320 ASN B CA   1 
ATOM   9357  C  C    . ASN B  1 320 ? 69.460  113.348 -9.736  1.00 7.24  ? 320 ASN B C    1 
ATOM   9358  O  O    . ASN B  1 320 ? 69.905  114.438 -10.092 1.00 11.14 ? 320 ASN B O    1 
ATOM   9359  C  CB   . ASN B  1 320 ? 69.981  111.112 -10.844 1.00 15.37 ? 320 ASN B CB   1 
ATOM   9360  C  CG   . ASN B  1 320 ? 69.726  111.763 -12.155 1.00 21.01 ? 320 ASN B CG   1 
ATOM   9361  O  OD1  . ASN B  1 320 ? 70.280  112.817 -12.456 1.00 25.30 ? 320 ASN B OD1  1 
ATOM   9362  N  ND2  . ASN B  1 320 ? 68.875  111.143 -12.959 1.00 26.59 ? 320 ASN B ND2  1 
ATOM   9363  H  H    . ASN B  1 320 ? 70.041  110.610 -8.523  1.00 10.28 ? 320 ASN B H    1 
ATOM   9364  H  HA   . ASN B  1 320 ? 71.279  112.404 -9.913  1.00 9.91  ? 320 ASN B HA   1 
ATOM   9365  H  HB2  . ASN B  1 320 ? 70.706  110.479 -10.961 1.00 18.44 ? 320 ASN B HB2  1 
ATOM   9366  H  HB3  . ASN B  1 320 ? 69.173  110.644 -10.580 1.00 18.44 ? 320 ASN B HB3  1 
ATOM   9367  H  HD21 . ASN B  1 320 ? 68.506  110.407 -12.710 1.00 31.91 ? 320 ASN B HD21 1 
ATOM   9368  H  HD22 . ASN B  1 320 ? 68.691  111.476 -13.730 1.00 31.91 ? 320 ASN B HD22 1 
ATOM   9369  N  N    . VAL B  1 321 ? 68.216  113.203 -9.280  1.00 8.38  ? 321 VAL B N    1 
ATOM   9370  C  CA   . VAL B  1 321 ? 67.287  114.325 -9.303  1.00 9.59  ? 321 VAL B CA   1 
ATOM   9371  C  C    . VAL B  1 321 ? 67.711  115.376 -8.258  1.00 16.95 ? 321 VAL B C    1 
ATOM   9372  O  O    . VAL B  1 321 ? 67.581  116.581 -8.485  1.00 11.51 ? 321 VAL B O    1 
ATOM   9373  C  CB   . VAL B  1 321 ? 65.848  113.830 -9.156  1.00 7.35  ? 321 VAL B CB   1 
ATOM   9374  C  CG1  . VAL B  1 321 ? 64.892  114.982 -8.924  1.00 9.15  ? 321 VAL B CG1  1 
ATOM   9375  C  CG2  . VAL B  1 321 ? 65.444  113.012 -10.388 1.00 11.22 ? 321 VAL B CG2  1 
ATOM   9376  H  H    . VAL B  1 321 ? 67.891  112.475 -8.958  1.00 10.06 ? 321 VAL B H    1 
ATOM   9377  H  HA   . VAL B  1 321 ? 67.353  114.754 -10.181 1.00 11.50 ? 321 VAL B HA   1 
ATOM   9378  H  HB   . VAL B  1 321 ? 65.797  113.239 -8.376  1.00 8.82  ? 321 VAL B HB   1 
ATOM   9379  H  HG11 . VAL B  1 321 ? 64.001  114.635 -8.837  1.00 10.98 ? 321 VAL B HG11 1 
ATOM   9380  H  HG12 . VAL B  1 321 ? 65.145  115.441 -8.120  1.00 10.98 ? 321 VAL B HG12 1 
ATOM   9381  H  HG13 . VAL B  1 321 ? 64.939  115.581 -9.673  1.00 10.98 ? 321 VAL B HG13 1 
ATOM   9382  H  HG21 . VAL B  1 321 ? 64.539  112.709 -10.279 1.00 13.47 ? 321 VAL B HG21 1 
ATOM   9383  H  HG22 . VAL B  1 321 ? 65.512  113.568 -11.168 1.00 13.47 ? 321 VAL B HG22 1 
ATOM   9384  H  HG23 . VAL B  1 321 ? 66.034  112.259 -10.470 1.00 13.47 ? 321 VAL B HG23 1 
ATOM   9385  N  N    . GLN B  1 322 ? 68.286  114.937 -7.144  1.00 16.02 ? 322 GLN B N    1 
ATOM   9386  C  CA   . GLN B  1 322 ? 68.943  115.899 -6.233  1.00 19.84 ? 322 GLN B CA   1 
ATOM   9387  C  C    . GLN B  1 322 ? 70.012  116.750 -6.938  1.00 21.03 ? 322 GLN B C    1 
ATOM   9388  O  O    . GLN B  1 322 ? 70.096  117.972 -6.753  1.00 20.67 ? 322 GLN B O    1 
ATOM   9389  C  CB   . GLN B  1 322 ? 69.627  115.150 -5.104  1.00 22.01 ? 322 GLN B CB   1 
ATOM   9390  C  CG   . GLN B  1 322 ? 68.847  114.965 -3.863  1.00 18.21 ? 322 GLN B CG   1 
ATOM   9391  C  CD   . GLN B  1 322 ? 69.742  114.378 -2.764  1.00 19.78 ? 322 GLN B CD   1 
ATOM   9392  O  OE1  . GLN B  1 322 ? 70.527  113.463 -3.008  1.00 18.98 ? 322 GLN B OE1  1 
ATOM   9393  N  NE2  . GLN B  1 322 ? 69.632  114.909 -1.581  1.00 23.56 ? 322 GLN B NE2  1 
ATOM   9394  H  H    . GLN B  1 322 ? 68.315  114.117 -6.889  1.00 19.23 ? 322 GLN B H    1 
ATOM   9395  H  HA   . GLN B  1 322 ? 68.271  116.499 -5.847  1.00 23.81 ? 322 GLN B HA   1 
ATOM   9396  H  HB2  . GLN B  1 322 ? 69.866  114.267 -5.427  1.00 26.41 ? 322 GLN B HB2  1 
ATOM   9397  H  HB3  . GLN B  1 322 ? 70.434  115.633 -4.866  1.00 26.41 ? 322 GLN B HB3  1 
ATOM   9398  H  HG2  . GLN B  1 322 ? 68.508  115.823 -3.561  1.00 21.85 ? 322 GLN B HG2  1 
ATOM   9399  H  HG3  . GLN B  1 322 ? 68.116  114.349 -4.028  1.00 21.85 ? 322 GLN B HG3  1 
ATOM   9400  H  HE21 . GLN B  1 322 ? 69.079  115.554 -1.448  1.00 28.27 ? 322 GLN B HE21 1 
ATOM   9401  H  HE22 . GLN B  1 322 ? 70.113  114.614 -0.931  1.00 28.27 ? 322 GLN B HE22 1 
ATOM   9402  N  N    . GLU B  1 323 ? 70.857  116.085 -7.715  1.00 20.79 ? 323 GLU B N    1 
ATOM   9403  C  CA   . GLU B  1 323 ? 71.896  116.746 -8.501  1.00 30.38 ? 323 GLU B CA   1 
ATOM   9404  C  C    . GLU B  1 323 ? 71.270  117.785 -9.423  1.00 30.64 ? 323 GLU B C    1 
ATOM   9405  O  O    . GLU B  1 323 ? 71.728  118.939 -9.483  1.00 25.74 ? 323 GLU B O    1 
ATOM   9406  C  CB   . GLU B  1 323 ? 72.680  115.722 -9.329  1.00 34.76 ? 323 GLU B CB   1 
ATOM   9407  C  CG   . GLU B  1 323 ? 73.973  116.241 -10.004 1.00 45.22 ? 323 GLU B CG   1 
ATOM   9408  C  CD   . GLU B  1 323 ? 73.806  116.736 -11.465 1.00 50.74 ? 323 GLU B CD   1 
ATOM   9409  O  OE1  . GLU B  1 323 ? 72.712  116.604 -12.060 1.00 48.93 ? 323 GLU B OE1  1 
ATOM   9410  O  OE2  . GLU B  1 323 ? 74.798  117.265 -12.022 1.00 50.50 ? 323 GLU B OE2  1 
ATOM   9411  H  H    . GLU B  1 323 ? 70.849  115.230 -7.807  1.00 24.95 ? 323 GLU B H    1 
ATOM   9412  H  HA   . GLU B  1 323 ? 72.520  117.201 -7.899  1.00 36.45 ? 323 GLU B HA   1 
ATOM   9413  H  HB2  . GLU B  1 323 ? 72.933  114.988 -8.747  1.00 41.71 ? 323 GLU B HB2  1 
ATOM   9414  H  HB3  . GLU B  1 323 ? 72.101  115.390 -10.033 1.00 41.71 ? 323 GLU B HB3  1 
ATOM   9415  H  HG2  . GLU B  1 323 ? 74.316  116.983 -9.482  1.00 54.26 ? 323 GLU B HG2  1 
ATOM   9416  H  HG3  . GLU B  1 323 ? 74.625  115.523 -10.013 1.00 54.26 ? 323 GLU B HG3  1 
ATOM   9417  N  N    . LYS B  1 324 ? 70.219  117.383 -10.136 1.00 13.82 ? 324 LYS B N    1 
ATOM   9418  C  CA   . LYS B  1 324 ? 69.538  118.318 -11.023 1.00 16.01 ? 324 LYS B CA   1 
ATOM   9419  C  C    . LYS B  1 324 ? 69.023  119.510 -10.229 1.00 16.92 ? 324 LYS B C    1 
ATOM   9420  O  O    . LYS B  1 324 ? 69.207  120.661 -10.629 1.00 18.11 ? 324 LYS B O    1 
ATOM   9421  C  CB   . LYS B  1 324 ? 68.371  117.633 -11.720 1.00 14.72 ? 324 LYS B CB   1 
ATOM   9422  C  CG   . LYS B  1 324 ? 68.801  116.508 -12.644 1.00 16.87 ? 324 LYS B CG   1 
ATOM   9423  C  CD   . LYS B  1 324 ? 67.594  115.900 -13.342 1.00 17.86 ? 324 LYS B CD   1 
ATOM   9424  C  CE   . LYS B  1 324 ? 67.938  114.613 -14.104 1.00 23.36 ? 324 LYS B CE   1 
ATOM   9425  N  NZ   . LYS B  1 324 ? 68.881  114.871 -15.197 1.00 21.28 ? 324 LYS B NZ   1 
ATOM   9426  H  H    . LYS B  1 324 ? 69.887  116.590 -10.124 1.00 16.58 ? 324 LYS B H    1 
ATOM   9427  H  HA   . LYS B  1 324 ? 70.163  118.641 -11.705 1.00 19.21 ? 324 LYS B HA   1 
ATOM   9428  H  HB2  . LYS B  1 324 ? 67.780  117.258 -11.049 1.00 17.67 ? 324 LYS B HB2  1 
ATOM   9429  H  HB3  . LYS B  1 324 ? 67.893  118.289 -12.252 1.00 17.67 ? 324 LYS B HB3  1 
ATOM   9430  H  HG2  . LYS B  1 324 ? 69.403  116.857 -13.320 1.00 20.24 ? 324 LYS B HG2  1 
ATOM   9431  H  HG3  . LYS B  1 324 ? 69.238  115.815 -12.126 1.00 20.24 ? 324 LYS B HG3  1 
ATOM   9432  H  HD2  . LYS B  1 324 ? 66.920  115.684 -12.678 1.00 21.43 ? 324 LYS B HD2  1 
ATOM   9433  H  HD3  . LYS B  1 324 ? 67.241  116.540 -13.979 1.00 21.43 ? 324 LYS B HD3  1 
ATOM   9434  H  HE2  . LYS B  1 324 ? 68.346  113.979 -13.494 1.00 28.03 ? 324 LYS B HE2  1 
ATOM   9435  H  HE3  . LYS B  1 324 ? 67.128  114.240 -14.484 1.00 28.03 ? 324 LYS B HE3  1 
ATOM   9436  H  HZ1  . LYS B  1 324 ? 69.066  114.113 -15.624 1.00 25.53 ? 324 LYS B HZ1  1 
ATOM   9437  H  HZ2  . LYS B  1 324 ? 68.527  115.449 -15.774 1.00 25.53 ? 324 LYS B HZ2  1 
ATOM   9438  H  HZ3  . LYS B  1 324 ? 69.637  115.212 -14.872 1.00 25.53 ? 324 LYS B HZ3  1 
ATOM   9439  N  N    . LEU B  1 325 ? 68.381  119.236 -9.104  1.00 12.13 ? 325 LEU B N    1 
ATOM   9440  C  CA   . LEU B  1 325 ? 67.761  120.305 -8.308  1.00 13.68 ? 325 LEU B CA   1 
ATOM   9441  C  C    . LEU B  1 325 ? 68.800  121.334 -7.837  1.00 23.70 ? 325 LEU B C    1 
ATOM   9442  O  O    . LEU B  1 325 ? 68.487  122.521 -7.705  1.00 18.84 ? 325 LEU B O    1 
ATOM   9443  C  CB   . LEU B  1 325 ? 66.970  119.703 -7.165  1.00 10.62 ? 325 LEU B CB   1 
ATOM   9444  C  CG   . LEU B  1 325 ? 65.686  119.018 -7.638  1.00 12.91 ? 325 LEU B CG   1 
ATOM   9445  C  CD1  . LEU B  1 325 ? 65.185  118.067 -6.582  1.00 11.20 ? 325 LEU B CD1  1 
ATOM   9446  C  CD2  . LEU B  1 325 ? 64.626  120.051 -8.009  1.00 12.20 ? 325 LEU B CD2  1 
ATOM   9447  H  H    . LEU B  1 325 ? 68.286  118.447 -8.775  1.00 14.56 ? 325 LEU B H    1 
ATOM   9448  H  HA   . LEU B  1 325 ? 67.124  120.781 -8.881  1.00 16.41 ? 325 LEU B HA   1 
ATOM   9449  H  HB2  . LEU B  1 325 ? 67.517  119.039 -6.716  1.00 12.75 ? 325 LEU B HB2  1 
ATOM   9450  H  HB3  . LEU B  1 325 ? 66.724  120.407 -6.544  1.00 12.75 ? 325 LEU B HB3  1 
ATOM   9451  H  HG   . LEU B  1 325 ? 65.884  118.499 -8.433  1.00 15.49 ? 325 LEU B HG   1 
ATOM   9452  H  HD11 . LEU B  1 325 ? 64.381  117.648 -6.896  1.00 13.44 ? 325 LEU B HD11 1 
ATOM   9453  H  HD12 . LEU B  1 325 ? 65.858  117.403 -6.416  1.00 13.44 ? 325 LEU B HD12 1 
ATOM   9454  H  HD13 . LEU B  1 325 ? 65.006  118.561 -5.778  1.00 13.44 ? 325 LEU B HD13 1 
ATOM   9455  H  HD21 . LEU B  1 325 ? 63.833  119.594 -8.302  1.00 14.64 ? 325 LEU B HD21 1 
ATOM   9456  H  HD22 . LEU B  1 325 ? 64.429  120.587 -7.238  1.00 14.64 ? 325 LEU B HD22 1 
ATOM   9457  H  HD23 . LEU B  1 325 ? 64.964  120.606 -8.716  1.00 14.64 ? 325 LEU B HD23 1 
ATOM   9458  N  N    . SER B  1 326 ? 70.051  120.902 -7.696  1.00 23.03 ? 326 SER B N    1 
ATOM   9459  C  CA   . SER B  1 326 ? 71.112  121.760 -7.180  1.00 26.67 ? 326 SER B CA   1 
ATOM   9460  C  C    . SER B  1 326 ? 71.691  122.686 -8.234  1.00 30.57 ? 326 SER B C    1 
ATOM   9461  O  O    . SER B  1 326 ? 72.261  123.724 -7.907  1.00 32.20 ? 326 SER B O    1 
ATOM   9462  C  CB   . SER B  1 326 ? 72.236  120.912 -6.577  1.00 34.72 ? 326 SER B CB   1 
ATOM   9463  O  OG   . SER B  1 326 ? 73.198  120.544 -7.554  1.00 31.00 ? 326 SER B OG   1 
ATOM   9464  H  H    . SER B  1 326 ? 70.313  120.108 -7.895  1.00 27.64 ? 326 SER B H    1 
ATOM   9465  H  HA   . SER B  1 326 ? 70.743  122.318 -6.464  1.00 32.01 ? 326 SER B HA   1 
ATOM   9466  H  HB2  . SER B  1 326 ? 72.677  121.426 -5.882  1.00 41.67 ? 326 SER B HB2  1 
ATOM   9467  H  HB3  . SER B  1 326 ? 71.851  120.107 -6.197  1.00 41.67 ? 326 SER B HB3  1 
ATOM   9468  H  HG   . SER B  1 326 ? 72.987  120.850 -8.285  1.00 37.20 ? 326 SER B HG   1 
ATOM   9469  N  N    . GLN B  1 327 ? 71.559  122.315 -9.500  1.00 24.02 ? 327 GLN B N    1 
ATOM   9470  C  CA   . GLN B  1 327 ? 72.060  123.154 -10.567 1.00 31.49 ? 327 GLN B CA   1 
ATOM   9471  C  C    . GLN B  1 327 ? 71.186  124.393 -10.682 1.00 29.64 ? 327 GLN B C    1 
ATOM   9472  O  O    . GLN B  1 327 ? 71.577  125.378 -11.311 1.00 32.35 ? 327 GLN B O    1 
ATOM   9473  C  CB   . GLN B  1 327 ? 72.137  122.365 -11.874 1.00 33.38 ? 327 GLN B CB   1 
ATOM   9474  C  CG   . GLN B  1 327 ? 73.233  121.309 -11.835 1.00 40.47 ? 327 GLN B CG   1 
ATOM   9475  C  CD   . GLN B  1 327 ? 74.536  121.875 -11.286 1.00 47.08 ? 327 GLN B CD   1 
ATOM   9476  O  OE1  . GLN B  1 327 ? 75.194  122.686 -11.943 1.00 46.31 ? 327 GLN B OE1  1 
ATOM   9477  N  NE2  . GLN B  1 327 ? 74.896  121.479 -10.061 1.00 44.25 ? 327 GLN B NE2  1 
ATOM   9478  H  H    . GLN B  1 327 ? 71.186  121.587 -9.762  1.00 28.82 ? 327 GLN B H    1 
ATOM   9479  H  HA   . GLN B  1 327 ? 72.967  123.447 -10.340 1.00 37.79 ? 327 GLN B HA   1 
ATOM   9480  H  HB2  . GLN B  1 327 ? 71.290  121.918 -12.027 1.00 40.05 ? 327 GLN B HB2  1 
ATOM   9481  H  HB3  . GLN B  1 327 ? 72.331  122.975 -12.603 1.00 40.05 ? 327 GLN B HB3  1 
ATOM   9482  H  HG2  . GLN B  1 327 ? 72.953  120.579 -11.260 1.00 48.56 ? 327 GLN B HG2  1 
ATOM   9483  H  HG3  . GLN B  1 327 ? 73.397  120.984 -12.734 1.00 48.56 ? 327 GLN B HG3  1 
ATOM   9484  H  HE21 . GLN B  1 327 ? 74.400  120.931 -9.623  1.00 53.11 ? 327 GLN B HE21 1 
ATOM   9485  H  HE22 . GLN B  1 327 ? 75.625  121.773 -9.711  1.00 53.11 ? 327 GLN B HE22 1 
ATOM   9486  N  N    . PHE B  1 328 ? 70.019  124.354 -10.037 1.00 23.38 ? 328 PHE B N    1 
ATOM   9487  C  CA   . PHE B  1 328 ? 69.198  125.542 -9.883  1.00 27.61 ? 328 PHE B CA   1 
ATOM   9488  C  C    . PHE B  1 328 ? 69.606  126.219 -8.576  1.00 26.67 ? 328 PHE B C    1 
ATOM   9489  O  O    . PHE B  1 328 ? 69.469  127.430 -8.417  1.00 41.44 ? 328 PHE B O    1 
ATOM   9490  C  CB   . PHE B  1 328 ? 67.703  125.195 -9.867  1.00 24.97 ? 328 PHE B CB   1 
ATOM   9491  C  CG   . PHE B  1 328 ? 67.274  124.240 -10.945 1.00 20.54 ? 328 PHE B CG   1 
ATOM   9492  C  CD1  . PHE B  1 328 ? 67.608  124.458 -12.279 1.00 21.06 ? 328 PHE B CD1  1 
ATOM   9493  C  CD2  . PHE B  1 328 ? 66.539  123.104 -10.630 1.00 19.80 ? 328 PHE B CD2  1 
ATOM   9494  C  CE1  . PHE B  1 328 ? 67.218  123.575 -13.262 1.00 19.14 ? 328 PHE B CE1  1 
ATOM   9495  C  CE2  . PHE B  1 328 ? 66.141  122.211 -11.630 1.00 15.93 ? 328 PHE B CE2  1 
ATOM   9496  C  CZ   . PHE B  1 328 ? 66.476  122.452 -12.939 1.00 20.92 ? 328 PHE B CZ   1 
ATOM   9497  H  H    . PHE B  1 328 ? 69.684  123.646 -9.681  1.00 28.06 ? 328 PHE B H    1 
ATOM   9498  H  HA   . PHE B  1 328 ? 69.369  126.161 -10.624 1.00 33.13 ? 328 PHE B HA   1 
ATOM   9499  H  HB2  . PHE B  1 328 ? 67.488  124.789 -9.013  1.00 29.97 ? 328 PHE B HB2  1 
ATOM   9500  H  HB3  . PHE B  1 328 ? 67.193  126.013 -9.978  1.00 29.97 ? 328 PHE B HB3  1 
ATOM   9501  H  HD1  . PHE B  1 328 ? 68.103  125.211 -12.510 1.00 25.27 ? 328 PHE B HD1  1 
ATOM   9502  H  HD2  . PHE B  1 328 ? 66.305  122.939 -9.745  1.00 23.75 ? 328 PHE B HD2  1 
ATOM   9503  H  HE1  . PHE B  1 328 ? 67.446  123.739 -14.149 1.00 22.96 ? 328 PHE B HE1  1 
ATOM   9504  H  HE2  . PHE B  1 328 ? 65.645  121.456 -11.408 1.00 19.12 ? 328 PHE B HE2  1 
ATOM   9505  H  HZ   . PHE B  1 328 ? 66.215  121.858 -13.604 1.00 25.10 ? 328 PHE B HZ   1 
ATOM   9506  N  N    . GLU C  1 26  ? 20.158  120.041 23.124  1.00 19.93 ? 26  GLU C N    1 
ATOM   9507  C  CA   . GLU C  1 26  ? 20.517  120.243 24.536  1.00 25.51 ? 26  GLU C CA   1 
ATOM   9508  C  C    . GLU C  1 26  ? 21.170  118.996 25.090  1.00 24.75 ? 26  GLU C C    1 
ATOM   9509  O  O    . GLU C  1 26  ? 20.609  117.908 25.004  1.00 32.88 ? 26  GLU C O    1 
ATOM   9510  C  CB   . GLU C  1 26  ? 19.292  120.563 25.377  1.00 28.90 ? 26  GLU C CB   1 
ATOM   9511  C  CG   . GLU C  1 26  ? 19.601  120.788 26.853  1.00 25.88 ? 26  GLU C CG   1 
ATOM   9512  C  CD   . GLU C  1 26  ? 18.408  121.304 27.624  1.00 31.48 ? 26  GLU C CD   1 
ATOM   9513  O  OE1  . GLU C  1 26  ? 17.811  120.522 28.384  1.00 23.25 ? 26  GLU C OE1  1 
ATOM   9514  O  OE2  . GLU C  1 26  ? 18.057  122.489 27.471  1.00 37.78 ? 26  GLU C OE2  1 
ATOM   9515  H  HA   . GLU C  1 26  ? 21.151  120.987 24.611  1.00 30.62 ? 26  GLU C HA   1 
ATOM   9516  H  HB2  . GLU C  1 26  ? 18.880  121.371 25.034  1.00 34.68 ? 26  GLU C HB2  1 
ATOM   9517  H  HB3  . GLU C  1 26  ? 18.668  119.823 25.314  1.00 34.68 ? 26  GLU C HB3  1 
ATOM   9518  H  HG2  . GLU C  1 26  ? 19.875  119.947 27.251  1.00 31.06 ? 26  GLU C HG2  1 
ATOM   9519  H  HG3  . GLU C  1 26  ? 20.314  121.440 26.931  1.00 31.06 ? 26  GLU C HG3  1 
ATOM   9520  N  N    . THR C  1 27  ? 22.349  119.156 25.677  1.00 14.12 ? 27  THR C N    1 
ATOM   9521  C  CA   . THR C  1 27  ? 23.138  118.012 26.086  1.00 15.91 ? 27  THR C CA   1 
ATOM   9522  C  C    . THR C  1 27  ? 23.401  118.125 27.569  1.00 18.10 ? 27  THR C C    1 
ATOM   9523  O  O    . THR C  1 27  ? 24.238  118.924 27.999  1.00 18.21 ? 27  THR C O    1 
ATOM   9524  C  CB   . THR C  1 27  ? 24.459  117.948 25.330  1.00 16.61 ? 27  THR C CB   1 
ATOM   9525  O  OG1  . THR C  1 27  ? 24.189  117.874 23.917  1.00 19.49 ? 27  THR C OG1  1 
ATOM   9526  C  CG2  . THR C  1 27  ? 25.227  116.721 25.758  1.00 17.06 ? 27  THR C CG2  1 
ATOM   9527  H  H    . THR C  1 27  ? 22.711  119.917 25.847  1.00 16.94 ? 27  THR C H    1 
ATOM   9528  H  HA   . THR C  1 27  ? 22.638  117.187 25.916  1.00 19.09 ? 27  THR C HA   1 
ATOM   9529  H  HB   . THR C  1 27  ? 24.991  118.736 25.525  1.00 19.93 ? 27  THR C HB   1 
ATOM   9530  H  HG1  . THR C  1 27  ? 23.770  118.537 23.677  1.00 23.39 ? 27  THR C HG1  1 
ATOM   9531  H  HG21 . THR C  1 27  ? 26.061  116.675 25.285  1.00 20.48 ? 27  THR C HG21 1 
ATOM   9532  H  HG22 . THR C  1 27  ? 25.404  116.757 26.701  1.00 20.48 ? 27  THR C HG22 1 
ATOM   9533  H  HG23 . THR C  1 27  ? 24.715  115.932 25.567  1.00 20.48 ? 27  THR C HG23 1 
ATOM   9534  N  N    . GLU C  1 28  ? 22.645  117.354 28.340  1.00 16.57 ? 28  GLU C N    1 
ATOM   9535  C  CA   . GLU C  1 28  ? 22.812  117.309 29.788  1.00 14.12 ? 28  GLU C CA   1 
ATOM   9536  C  C    . GLU C  1 28  ? 23.884  116.309 30.148  1.00 15.30 ? 28  GLU C C    1 
ATOM   9537  O  O    . GLU C  1 28  ? 23.927  115.216 29.580  1.00 17.78 ? 28  GLU C O    1 
ATOM   9538  C  CB   . GLU C  1 28  ? 21.495  116.909 30.460  1.00 14.78 ? 28  GLU C CB   1 
ATOM   9539  C  CG   . GLU C  1 28  ? 21.543  116.888 31.964  1.00 29.58 ? 28  GLU C CG   1 
ATOM   9540  C  CD   . GLU C  1 28  ? 20.196  116.532 32.546  1.00 40.01 ? 28  GLU C CD   1 
ATOM   9541  O  OE1  . GLU C  1 28  ? 19.173  117.053 32.036  1.00 40.50 ? 28  GLU C OE1  1 
ATOM   9542  O  OE2  . GLU C  1 28  ? 20.172  115.715 33.489  1.00 43.10 ? 28  GLU C OE2  1 
ATOM   9543  H  H    . GLU C  1 28  ? 22.021  116.841 28.046  1.00 19.89 ? 28  GLU C H    1 
ATOM   9544  H  HA   . GLU C  1 28  ? 23.079  118.192 30.118  1.00 16.95 ? 28  GLU C HA   1 
ATOM   9545  H  HB2  . GLU C  1 28  ? 20.808  117.541 30.196  1.00 17.74 ? 28  GLU C HB2  1 
ATOM   9546  H  HB3  . GLU C  1 28  ? 21.252  116.019 30.161  1.00 17.74 ? 28  GLU C HB3  1 
ATOM   9547  H  HG2  . GLU C  1 28  ? 22.187  116.224 32.256  1.00 35.50 ? 28  GLU C HG2  1 
ATOM   9548  H  HG3  . GLU C  1 28  ? 21.793  117.767 32.290  1.00 35.50 ? 28  GLU C HG3  1 
ATOM   9549  N  N    . ILE C  1 29  ? 24.771  116.700 31.059  1.00 12.02 ? 29  ILE C N    1 
ATOM   9550  C  CA   . ILE C  1 29  ? 25.873  115.844 31.491  1.00 11.61 ? 29  ILE C CA   1 
ATOM   9551  C  C    . ILE C  1 29  ? 25.915  115.820 33.001  1.00 15.10 ? 29  ILE C C    1 
ATOM   9552  O  O    . ILE C  1 29  ? 25.933  116.872 33.616  1.00 12.38 ? 29  ILE C O    1 
ATOM   9553  C  CB   . ILE C  1 29  ? 27.221  116.340 30.957  1.00 8.65  ? 29  ILE C CB   1 
ATOM   9554  C  CG1  . ILE C  1 29  ? 27.175  116.421 29.424  1.00 15.85 ? 29  ILE C CG1  1 
ATOM   9555  C  CG2  . ILE C  1 29  ? 28.352  115.398 31.400  1.00 11.13 ? 29  ILE C CG2  1 
ATOM   9556  C  CD1  . ILE C  1 29  ? 28.449  116.928 28.811  1.00 15.53 ? 29  ILE C CD1  1 
ATOM   9557  H  H    . ILE C  1 29  ? 24.755  117.467 31.448  1.00 14.42 ? 29  ILE C H    1 
ATOM   9558  H  HA   . ILE C  1 29  ? 25.726  114.931 31.167  1.00 13.93 ? 29  ILE C HA   1 
ATOM   9559  H  HB   . ILE C  1 29  ? 27.392  117.225 31.313  1.00 10.38 ? 29  ILE C HB   1 
ATOM   9560  H  HG12 . ILE C  1 29  ? 27.006  115.535 29.068  1.00 19.02 ? 29  ILE C HG12 1 
ATOM   9561  H  HG13 . ILE C  1 29  ? 26.460  117.022 29.163  1.00 19.02 ? 29  ILE C HG13 1 
ATOM   9562  H  HG21 . ILE C  1 29  ? 29.185  115.727 31.055  1.00 13.36 ? 29  ILE C HG21 1 
ATOM   9563  H  HG22 . ILE C  1 29  ? 28.381  115.374 32.359  1.00 13.36 ? 29  ILE C HG22 1 
ATOM   9564  H  HG23 . ILE C  1 29  ? 28.179  114.518 31.055  1.00 13.36 ? 29  ILE C HG23 1 
ATOM   9565  H  HD11 . ILE C  1 29  ? 28.348  116.952 27.857  1.00 18.64 ? 29  ILE C HD11 1 
ATOM   9566  H  HD12 . ILE C  1 29  ? 28.625  117.811 29.145  1.00 18.64 ? 29  ILE C HD12 1 
ATOM   9567  H  HD13 . ILE C  1 29  ? 29.167  116.337 29.050  1.00 18.64 ? 29  ILE C HD13 1 
ATOM   9568  N  N    . MET C  1 30  ? 25.928  114.623 33.590  1.00 10.68 ? 30  MET C N    1 
ATOM   9569  C  CA   . MET C  1 30  ? 25.989  114.477 35.038  1.00 12.33 ? 30  MET C CA   1 
ATOM   9570  C  C    . MET C  1 30  ? 27.456  114.472 35.465  1.00 12.06 ? 30  MET C C    1 
ATOM   9571  O  O    . MET C  1 30  ? 28.266  113.714 34.921  1.00 14.43 ? 30  MET C O    1 
ATOM   9572  C  CB   . MET C  1 30  ? 25.299  113.181 35.468  1.00 18.21 ? 30  MET C CB   1 
ATOM   9573  C  CG   . MET C  1 30  ? 23.864  113.067 34.947  1.00 28.75 ? 30  MET C CG   1 
ATOM   9574  S  SD   . MET C  1 30  ? 22.979  111.633 35.583  1.00 24.82 ? 30  MET C SD   1 
ATOM   9575  C  CE   . MET C  1 30  ? 23.836  110.289 34.761  1.00 20.97 ? 30  MET C CE   1 
ATOM   9576  H  H    . MET C  1 30  ? 25.902  113.875 33.165  1.00 12.82 ? 30  MET C H    1 
ATOM   9577  H  HA   . MET C  1 30  ? 25.528  115.231 35.463  1.00 14.80 ? 30  MET C HA   1 
ATOM   9578  H  HB2  . MET C  1 30  ? 25.802  112.427 35.124  1.00 21.85 ? 30  MET C HB2  1 
ATOM   9579  H  HB3  . MET C  1 30  ? 25.269  113.145 36.436  1.00 21.85 ? 30  MET C HB3  1 
ATOM   9580  H  HG2  . MET C  1 30  ? 23.372  113.861 35.210  1.00 34.50 ? 30  MET C HG2  1 
ATOM   9581  H  HG3  . MET C  1 30  ? 23.886  112.998 33.980  1.00 34.50 ? 30  MET C HG3  1 
ATOM   9582  H  HE1  . MET C  1 30  ? 23.441  109.457 35.031  1.00 25.17 ? 30  MET C HE1  1 
ATOM   9583  H  HE2  . MET C  1 30  ? 23.752  110.400 33.811  1.00 25.17 ? 30  MET C HE2  1 
ATOM   9584  H  HE3  . MET C  1 30  ? 24.762  110.309 35.013  1.00 25.17 ? 30  MET C HE3  1 
ATOM   9585  N  N    . VAL C  1 31  ? 27.796  115.338 36.411  1.00 11.81 ? 31  VAL C N    1 
ATOM   9586  C  CA   . VAL C  1 31  ? 29.159  115.442 36.918  1.00 7.18  ? 31  VAL C CA   1 
ATOM   9587  C  C    . VAL C  1 31  ? 29.286  114.881 38.344  1.00 8.84  ? 31  VAL C C    1 
ATOM   9588  O  O    . VAL C  1 31  ? 28.677  115.398 39.286  1.00 13.02 ? 31  VAL C O    1 
ATOM   9589  C  CB   . VAL C  1 31  ? 29.629  116.896 36.920  1.00 6.94  ? 31  VAL C CB   1 
ATOM   9590  C  CG1  . VAL C  1 31  ? 31.072  116.968 37.387  1.00 7.36  ? 31  VAL C CG1  1 
ATOM   9591  C  CG2  . VAL C  1 31  ? 29.455  117.511 35.518  1.00 17.31 ? 31  VAL C CG2  1 
ATOM   9592  H  H    . VAL C  1 31  ? 27.246  115.885 36.781  1.00 14.17 ? 31  VAL C H    1 
ATOM   9593  H  HA   . VAL C  1 31  ? 29.758  114.929 36.335  1.00 8.61  ? 31  VAL C HA   1 
ATOM   9594  H  HB   . VAL C  1 31  ? 29.080  117.409 37.548  1.00 8.33  ? 31  VAL C HB   1 
ATOM   9595  H  HG11 . VAL C  1 31  ? 31.356  117.885 37.383  1.00 8.84  ? 31  VAL C HG11 1 
ATOM   9596  H  HG12 . VAL C  1 31  ? 31.131  116.610 38.276  1.00 8.84  ? 31  VAL C HG12 1 
ATOM   9597  H  HG13 . VAL C  1 31  ? 31.620  116.453 36.790  1.00 8.84  ? 31  VAL C HG13 1 
ATOM   9598  H  HG21 . VAL C  1 31  ? 29.755  118.423 35.538  1.00 20.78 ? 31  VAL C HG21 1 
ATOM   9599  H  HG22 . VAL C  1 31  ? 29.978  117.008 34.889  1.00 20.78 ? 31  VAL C HG22 1 
ATOM   9600  H  HG23 . VAL C  1 31  ? 28.527  117.476 35.275  1.00 20.78 ? 31  VAL C HG23 1 
ATOM   9601  N  N    . ALA C  1 32  ? 30.084  113.826 38.475  1.00 11.40 ? 32  ALA C N    1 
ATOM   9602  C  CA   . ALA C  1 32  ? 30.124  112.983 39.679  1.00 11.66 ? 32  ALA C CA   1 
ATOM   9603  C  C    . ALA C  1 32  ? 31.423  113.111 40.488  1.00 8.32  ? 32  ALA C C    1 
ATOM   9604  O  O    . ALA C  1 32  ? 32.512  113.083 39.931  1.00 9.49  ? 32  ALA C O    1 
ATOM   9605  C  CB   . ALA C  1 32  ? 29.912  111.539 39.286  1.00 9.39  ? 32  ALA C CB   1 
ATOM   9606  H  H    . ALA C  1 32  ? 30.630  113.567 37.864  1.00 13.68 ? 32  ALA C H    1 
ATOM   9607  H  HA   . ALA C  1 32  ? 29.383  113.243 40.267  1.00 13.99 ? 32  ALA C HA   1 
ATOM   9608  H  HB1  . ALA C  1 32  ? 29.939  110.993 40.076  1.00 11.27 ? 32  ALA C HB1  1 
ATOM   9609  H  HB2  . ALA C  1 32  ? 29.056  111.454 38.858  1.00 11.27 ? 32  ALA C HB2  1 
ATOM   9610  H  HB3  . ALA C  1 32  ? 30.609  111.275 38.681  1.00 11.27 ? 32  ALA C HB3  1 
ATOM   9611  N  N    . TYR C  1 33  ? 31.307  113.256 41.812  1.00 7.67  ? 33  TYR C N    1 
ATOM   9612  C  CA   . TYR C  1 33  ? 32.475  113.362 42.679  1.00 5.52  ? 33  TYR C CA   1 
ATOM   9613  C  C    . TYR C  1 33  ? 32.011  113.091 44.120  1.00 7.88  ? 33  TYR C C    1 
ATOM   9614  O  O    . TYR C  1 33  ? 30.809  113.012 44.390  1.00 6.92  ? 33  TYR C O    1 
ATOM   9615  C  CB   . TYR C  1 33  ? 33.195  114.724 42.536  1.00 6.61  ? 33  TYR C CB   1 
ATOM   9616  C  CG   . TYR C  1 33  ? 32.265  115.928 42.580  1.00 6.47  ? 33  TYR C CG   1 
ATOM   9617  C  CD1  . TYR C  1 33  ? 31.458  116.242 41.519  1.00 7.93  ? 33  TYR C CD1  1 
ATOM   9618  C  CD2  . TYR C  1 33  ? 32.158  116.715 43.735  1.00 8.08  ? 33  TYR C CD2  1 
ATOM   9619  C  CE1  . TYR C  1 33  ? 30.583  117.342 41.562  1.00 11.36 ? 33  TYR C CE1  1 
ATOM   9620  C  CE2  . TYR C  1 33  ? 31.308  117.797 43.781  1.00 8.33  ? 33  TYR C CE2  1 
ATOM   9621  C  CZ   . TYR C  1 33  ? 30.514  118.108 42.716  1.00 9.94  ? 33  TYR C CZ   1 
ATOM   9622  O  OH   . TYR C  1 33  ? 29.663  119.198 42.792  1.00 11.35 ? 33  TYR C OH   1 
ATOM   9623  H  H    . TYR C  1 33  ? 30.557  113.296 42.230  1.00 9.20  ? 33  TYR C H    1 
ATOM   9624  H  HA   . TYR C  1 33  ? 33.114  112.660 42.433  1.00 6.62  ? 33  TYR C HA   1 
ATOM   9625  H  HB2  . TYR C  1 33  ? 33.832  114.817 43.262  1.00 7.93  ? 33  TYR C HB2  1 
ATOM   9626  H  HB3  . TYR C  1 33  ? 33.662  114.743 41.686  1.00 7.93  ? 33  TYR C HB3  1 
ATOM   9627  H  HD1  . TYR C  1 33  ? 31.504  115.728 40.746  1.00 9.52  ? 33  TYR C HD1  1 
ATOM   9628  H  HD2  . TYR C  1 33  ? 32.690  116.520 44.473  1.00 9.69  ? 33  TYR C HD2  1 
ATOM   9629  H  HE1  . TYR C  1 33  ? 30.050  117.547 40.829  1.00 13.63 ? 33  TYR C HE1  1 
ATOM   9630  H  HE2  . TYR C  1 33  ? 31.260  118.310 44.555  1.00 10.00 ? 33  TYR C HE2  1 
ATOM   9631  H  HH   . TYR C  1 33  ? 30.094  119.881 42.935  1.00 13.62 ? 33  TYR C HH   1 
ATOM   9632  N  N    . GLY C  1 34  ? 32.969  112.920 45.017  1.00 7.64  ? 34  GLY C N    1 
ATOM   9633  C  CA   . GLY C  1 34  ? 32.687  112.474 46.376  1.00 12.85 ? 34  GLY C CA   1 
ATOM   9634  C  C    . GLY C  1 34  ? 32.707  113.590 47.402  1.00 11.72 ? 34  GLY C C    1 
ATOM   9635  O  O    . GLY C  1 34  ? 32.263  113.417 48.534  1.00 11.54 ? 34  GLY C O    1 
ATOM   9636  H  H    . GLY C  1 34  ? 33.804  113.056 44.863  1.00 9.17  ? 34  GLY C H    1 
ATOM   9637  H  HA2  . GLY C  1 34  ? 31.811  112.057 46.399  1.00 15.42 ? 34  GLY C HA2  1 
ATOM   9638  H  HA3  . GLY C  1 34  ? 33.345  111.811 46.636  1.00 15.42 ? 34  GLY C HA3  1 
ATOM   9639  N  N    . ASN C  1 35  ? 33.198  114.748 46.992  1.00 8.18  ? 35  ASN C N    1 
ATOM   9640  C  CA   . ASN C  1 35  ? 33.367  115.890 47.884  1.00 8.38  ? 35  ASN C CA   1 
ATOM   9641  C  C    . ASN C  1 35  ? 32.043  116.525 48.224  1.00 12.25 ? 35  ASN C C    1 
ATOM   9642  O  O    . ASN C  1 35  ? 31.070  116.397 47.471  1.00 9.21  ? 35  ASN C O    1 
ATOM   9643  C  CB   . ASN C  1 35  ? 34.307  116.884 47.227  1.00 10.69 ? 35  ASN C CB   1 
ATOM   9644  C  CG   . ASN C  1 35  ? 35.602  116.231 46.828  1.00 8.56  ? 35  ASN C CG   1 
ATOM   9645  O  OD1  . ASN C  1 35  ? 35.754  115.759 45.687  1.00 7.93  ? 35  ASN C OD1  1 
ATOM   9646  N  ND2  . ASN C  1 35  ? 36.495  116.078 47.799  1.00 6.71  ? 35  ASN C ND2  1 
ATOM   9647  H  H    . ASN C  1 35  ? 33.448  114.903 46.183  1.00 9.81  ? 35  ASN C H    1 
ATOM   9648  H  HA   . ASN C  1 35  ? 33.781  115.586 48.719  1.00 10.06 ? 35  ASN C HA   1 
ATOM   9649  H  HB2  . ASN C  1 35  ? 33.888  117.243 46.429  1.00 12.83 ? 35  ASN C HB2  1 
ATOM   9650  H  HB3  . ASN C  1 35  ? 34.507  117.599 47.853  1.00 12.83 ? 35  ASN C HB3  1 
ATOM   9651  H  HD21 . ASN C  1 35  ? 36.314  116.346 48.596  1.00 8.06  ? 35  ASN C HD21 1 
ATOM   9652  H  HD22 . ASN C  1 35  ? 37.254  115.710 47.631  1.00 8.06  ? 35  ASN C HD22 1 
ATOM   9653  N  N    . GLN C  1 36  ? 31.995  117.198 49.375  1.00 10.31 ? 36  GLN C N    1 
ATOM   9654  C  CA   . GLN C  1 36  ? 30.755  117.766 49.857  1.00 12.29 ? 36  GLN C CA   1 
ATOM   9655  C  C    . GLN C  1 36  ? 30.549  119.157 49.268  1.00 10.74 ? 36  GLN C C    1 
ATOM   9656  O  O    . GLN C  1 36  ? 31.492  119.834 48.925  1.00 9.84  ? 36  GLN C O    1 
ATOM   9657  C  CB   . GLN C  1 36  ? 30.777  117.849 51.392  1.00 12.82 ? 36  GLN C CB   1 
ATOM   9658  C  CG   . GLN C  1 36  ? 30.971  116.497 52.085  1.00 8.31  ? 36  GLN C CG   1 
ATOM   9659  C  CD   . GLN C  1 36  ? 29.823  115.572 51.808  1.00 8.27  ? 36  GLN C CD   1 
ATOM   9660  O  OE1  . GLN C  1 36  ? 28.681  116.016 51.689  1.00 16.27 ? 36  GLN C OE1  1 
ATOM   9661  N  NE2  . GLN C  1 36  ? 30.097  114.280 51.722  1.00 13.05 ? 36  GLN C NE2  1 
ATOM   9662  H  H    . GLN C  1 36  ? 32.670  117.334 49.889  1.00 12.38 ? 36  GLN C H    1 
ATOM   9663  H  HA   . GLN C  1 36  ? 30.005  117.197 49.585  1.00 14.75 ? 36  GLN C HA   1 
ATOM   9664  H  HB2  . GLN C  1 36  ? 31.506  118.429 51.663  1.00 15.38 ? 36  GLN C HB2  1 
ATOM   9665  H  HB3  . GLN C  1 36  ? 29.933  118.219 51.696  1.00 15.38 ? 36  GLN C HB3  1 
ATOM   9666  H  HG2  . GLN C  1 36  ? 31.783  116.081 51.754  1.00 9.98  ? 36  GLN C HG2  1 
ATOM   9667  H  HG3  . GLN C  1 36  ? 31.029  116.633 53.043  1.00 9.98  ? 36  GLN C HG3  1 
ATOM   9668  H  HE21 . GLN C  1 36  ? 30.905  114.004 51.823  1.00 15.66 ? 36  GLN C HE21 1 
ATOM   9669  H  HE22 . GLN C  1 36  ? 29.467  113.716 51.564  1.00 15.66 ? 36  GLN C HE22 1 
ATOM   9670  N  N    . PRO C  1 37  ? 29.296  119.592 49.192  1.00 9.74  ? 37  PRO C N    1 
ATOM   9671  C  CA   . PRO C  1 37  ? 29.050  120.962 48.751  1.00 8.95  ? 37  PRO C CA   1 
ATOM   9672  C  C    . PRO C  1 37  ? 29.937  121.942 49.512  1.00 10.05 ? 37  PRO C C    1 
ATOM   9673  O  O    . PRO C  1 37  ? 30.114  121.862 50.761  1.00 9.51  ? 37  PRO C O    1 
ATOM   9674  C  CB   . PRO C  1 37  ? 27.563  121.157 49.048  1.00 16.38 ? 37  PRO C CB   1 
ATOM   9675  C  CG   . PRO C  1 37  ? 26.993  119.765 48.921  1.00 14.22 ? 37  PRO C CG   1 
ATOM   9676  C  CD   . PRO C  1 37  ? 28.049  118.874 49.501  1.00 17.46 ? 37  PRO C CD   1 
ATOM   9677  H  HA   . PRO C  1 37  ? 29.210  121.050 47.788  1.00 10.74 ? 37  PRO C HA   1 
ATOM   9678  H  HB2  . PRO C  1 37  ? 27.446  121.500 49.948  1.00 19.65 ? 37  PRO C HB2  1 
ATOM   9679  H  HB3  . PRO C  1 37  ? 27.169  121.755 48.393  1.00 19.65 ? 37  PRO C HB3  1 
ATOM   9680  H  HG2  . PRO C  1 37  ? 26.170  119.699 49.429  1.00 17.07 ? 37  PRO C HG2  1 
ATOM   9681  H  HG3  . PRO C  1 37  ? 26.841  119.556 47.987  1.00 17.07 ? 37  PRO C HG3  1 
ATOM   9682  H  HD2  . PRO C  1 37  ? 27.934  118.791 50.460  1.00 20.96 ? 37  PRO C HD2  1 
ATOM   9683  H  HD3  . PRO C  1 37  ? 28.039  118.008 49.064  1.00 20.96 ? 37  PRO C HD3  1 
ATOM   9684  N  N    . GLY C  1 38  ? 30.536  122.851 48.759  1.00 10.79 ? 38  GLY C N    1 
ATOM   9685  C  CA   . GLY C  1 38  ? 31.342  123.910 49.318  1.00 8.87  ? 38  GLY C CA   1 
ATOM   9686  C  C    . GLY C  1 38  ? 32.821  123.630 49.473  1.00 7.80  ? 38  GLY C C    1 
ATOM   9687  O  O    . GLY C  1 38  ? 33.581  124.537 49.752  1.00 12.41 ? 38  GLY C O    1 
ATOM   9688  H  H    . GLY C  1 38  ? 30.486  122.871 47.901  1.00 12.95 ? 38  GLY C H    1 
ATOM   9689  H  HA2  . GLY C  1 38  ? 31.250  124.695 48.757  1.00 10.64 ? 38  GLY C HA2  1 
ATOM   9690  H  HA3  . GLY C  1 38  ? 30.993  124.132 50.195  1.00 10.64 ? 38  GLY C HA3  1 
ATOM   9691  N  N    . GLU C  1 39  ? 33.235  122.377 49.310  1.00 7.28  ? 39  GLU C N    1 
ATOM   9692  C  CA   . GLU C  1 39  ? 34.655  122.046 49.222  1.00 5.44  ? 39  GLU C CA   1 
ATOM   9693  C  C    . GLU C  1 39  ? 35.203  122.601 47.918  1.00 5.17  ? 39  GLU C C    1 
ATOM   9694  O  O    . GLU C  1 39  ? 34.432  122.909 47.020  1.00 12.76 ? 39  GLU C O    1 
ATOM   9695  C  CB   . GLU C  1 39  ? 34.846  120.516 49.216  1.00 9.64  ? 39  GLU C CB   1 
ATOM   9696  C  CG   . GLU C  1 39  ? 34.820  119.826 50.563  1.00 10.70 ? 39  GLU C CG   1 
ATOM   9697  C  CD   . GLU C  1 39  ? 35.117  118.341 50.463  1.00 10.61 ? 39  GLU C CD   1 
ATOM   9698  O  OE1  . GLU C  1 39  ? 36.154  117.937 49.876  1.00 7.02  ? 39  GLU C OE1  1 
ATOM   9699  O  OE2  . GLU C  1 39  ? 34.298  117.556 50.963  1.00 11.71 ? 39  GLU C OE2  1 
ATOM   9700  H  H    . GLU C  1 39  ? 32.712  121.698 49.247  1.00 8.73  ? 39  GLU C H    1 
ATOM   9701  H  HA   . GLU C  1 39  ? 35.147  122.435 49.976  1.00 6.53  ? 39  GLU C HA   1 
ATOM   9702  H  HB2  . GLU C  1 39  ? 34.140  120.124 48.679  1.00 11.57 ? 39  GLU C HB2  1 
ATOM   9703  H  HB3  . GLU C  1 39  ? 35.705  120.319 48.809  1.00 11.57 ? 39  GLU C HB3  1 
ATOM   9704  H  HG2  . GLU C  1 39  ? 35.489  120.229 51.138  1.00 12.84 ? 39  GLU C HG2  1 
ATOM   9705  H  HG3  . GLU C  1 39  ? 33.938  119.931 50.955  1.00 12.84 ? 39  GLU C HG3  1 
ATOM   9706  N  N    . PRO C  1 40  ? 36.537  122.737 47.813  1.00 7.33  ? 40  PRO C N    1 
ATOM   9707  C  CA   . PRO C  1 40  ? 37.184  123.234 46.595  1.00 9.33  ? 40  PRO C CA   1 
ATOM   9708  C  C    . PRO C  1 40  ? 36.796  122.488 45.334  1.00 6.64  ? 40  PRO C C    1 
ATOM   9709  O  O    . PRO C  1 40  ? 36.584  123.118 44.284  1.00 9.12  ? 40  PRO C O    1 
ATOM   9710  C  CB   . PRO C  1 40  ? 38.683  123.084 46.901  1.00 6.82  ? 40  PRO C CB   1 
ATOM   9711  C  CG   . PRO C  1 40  ? 38.745  123.195 48.401  1.00 9.30  ? 40  PRO C CG   1 
ATOM   9712  C  CD   . PRO C  1 40  ? 37.507  122.523 48.901  1.00 10.08 ? 40  PRO C CD   1 
ATOM   9713  H  HA   . PRO C  1 40  ? 36.979  124.185 46.474  1.00 11.20 ? 40  PRO C HA   1 
ATOM   9714  H  HB2  . PRO C  1 40  ? 38.998  122.216 46.603  1.00 8.18  ? 40  PRO C HB2  1 
ATOM   9715  H  HB3  . PRO C  1 40  ? 39.182  123.800 46.478  1.00 8.18  ? 40  PRO C HB3  1 
ATOM   9716  H  HG2  . PRO C  1 40  ? 39.537  122.742 48.729  1.00 11.16 ? 40  PRO C HG2  1 
ATOM   9717  H  HG3  . PRO C  1 40  ? 38.754  124.130 48.658  1.00 11.16 ? 40  PRO C HG3  1 
ATOM   9718  H  HD2  . PRO C  1 40  ? 37.666  121.575 49.031  1.00 12.10 ? 40  PRO C HD2  1 
ATOM   9719  H  HD3  . PRO C  1 40  ? 37.199  122.947 49.717  1.00 12.10 ? 40  PRO C HD3  1 
ATOM   9720  N  N    . ILE C  1 41  ? 36.672  121.169 45.394  1.00 6.60  ? 41  ILE C N    1 
ATOM   9721  C  CA   . ILE C  1 41  ? 36.308  120.451 44.192  1.00 4.21  ? 41  ILE C CA   1 
ATOM   9722  C  C    . ILE C  1 41  ? 34.888  120.813 43.754  1.00 4.80  ? 41  ILE C C    1 
ATOM   9723  O  O    . ILE C  1 41  ? 34.613  120.993 42.573  1.00 9.41  ? 41  ILE C O    1 
ATOM   9724  C  CB   . ILE C  1 41  ? 36.478  118.911 44.374  1.00 5.12  ? 41  ILE C CB   1 
ATOM   9725  C  CG1  . ILE C  1 41  ? 37.968  118.533 44.316  1.00 3.39  ? 41  ILE C CG1  1 
ATOM   9726  C  CG2  . ILE C  1 41  ? 35.663  118.166 43.369  1.00 5.59  ? 41  ILE C CG2  1 
ATOM   9727  C  CD1  . ILE C  1 41  ? 38.659  118.707 42.939  1.00 8.28  ? 41  ILE C CD1  1 
ATOM   9728  H  H    . ILE C  1 41  ? 36.790  120.683 46.094  1.00 7.92  ? 41  ILE C H    1 
ATOM   9729  H  HA   . ILE C  1 41  ? 36.914  120.728 43.474  1.00 5.05  ? 41  ILE C HA   1 
ATOM   9730  H  HB   . ILE C  1 41  ? 36.147  118.678 45.255  1.00 6.15  ? 41  ILE C HB   1 
ATOM   9731  H  HG12 . ILE C  1 41  ? 38.448  119.086 44.953  1.00 4.07  ? 41  ILE C HG12 1 
ATOM   9732  H  HG13 . ILE C  1 41  ? 38.056  117.601 44.568  1.00 4.07  ? 41  ILE C HG13 1 
ATOM   9733  H  HG21 . ILE C  1 41  ? 35.787  117.223 43.505  1.00 6.71  ? 41  ILE C HG21 1 
ATOM   9734  H  HG22 . ILE C  1 41  ? 34.738  118.395 43.486  1.00 6.71  ? 41  ILE C HG22 1 
ATOM   9735  H  HG23 . ILE C  1 41  ? 35.954  118.411 42.488  1.00 6.71  ? 41  ILE C HG23 1 
ATOM   9736  H  HD11 . ILE C  1 41  ? 39.579  118.444 43.016  1.00 9.94  ? 41  ILE C HD11 1 
ATOM   9737  H  HD12 . ILE C  1 41  ? 38.213  118.153 42.294  1.00 9.94  ? 41  ILE C HD12 1 
ATOM   9738  H  HD13 . ILE C  1 41  ? 38.603  119.628 42.675  1.00 9.94  ? 41  ILE C HD13 1 
ATOM   9739  N  N    . ASP C  1 42  ? 33.988  120.963 44.714  1.00 5.45  ? 42  ASP C N    1 
ATOM   9740  C  CA   . ASP C  1 42  ? 32.615  121.309 44.409  1.00 5.83  ? 42  ASP C CA   1 
ATOM   9741  C  C    . ASP C  1 42  ? 32.531  122.733 43.817  1.00 6.79  ? 42  ASP C C    1 
ATOM   9742  O  O    . ASP C  1 42  ? 31.764  122.968 42.886  1.00 8.72  ? 42  ASP C O    1 
ATOM   9743  C  CB   . ASP C  1 42  ? 31.767  121.200 45.683  1.00 6.76  ? 42  ASP C CB   1 
ATOM   9744  C  CG   . ASP C  1 42  ? 30.304  121.555 45.461  1.00 6.94  ? 42  ASP C CG   1 
ATOM   9745  O  OD1  . ASP C  1 42  ? 29.508  120.766 44.895  1.00 11.96 ? 42  ASP C OD1  1 
ATOM   9746  O  OD2  . ASP C  1 42  ? 29.914  122.631 45.918  1.00 11.59 ? 42  ASP C OD2  1 
ATOM   9747  H  H    . ASP C  1 42  ? 34.150  120.869 45.553  1.00 6.53  ? 42  ASP C H    1 
ATOM   9748  H  HA   . ASP C  1 42  ? 32.260  120.679 43.748  1.00 7.00  ? 42  ASP C HA   1 
ATOM   9749  H  HB2  . ASP C  1 42  ? 31.806  120.288 46.010  1.00 8.12  ? 42  ASP C HB2  1 
ATOM   9750  H  HB3  . ASP C  1 42  ? 32.123  121.807 46.350  1.00 8.12  ? 42  ASP C HB3  1 
ATOM   9751  N  N    . LYS C  1 43  ? 33.309  123.661 44.362  1.00 8.33  ? 43  LYS C N    1 
ATOM   9752  C  CA   . LYS C  1 43  ? 33.361  125.028 43.835  1.00 9.70  ? 43  LYS C CA   1 
ATOM   9753  C  C    . LYS C  1 43  ? 33.912  125.029 42.421  1.00 12.06 ? 43  LYS C C    1 
ATOM   9754  O  O    . LYS C  1 43  ? 33.449  125.770 41.554  1.00 10.27 ? 43  LYS C O    1 
ATOM   9755  C  CB   . LYS C  1 43  ? 34.210  125.937 44.727  1.00 8.41  ? 43  LYS C CB   1 
ATOM   9756  C  CG   . LYS C  1 43  ? 33.581  126.215 46.096  1.00 7.96  ? 43  LYS C CG   1 
ATOM   9757  C  CD   . LYS C  1 43  ? 34.251  127.380 46.834  1.00 14.28 ? 43  LYS C CD   1 
ATOM   9758  C  CE   . LYS C  1 43  ? 33.551  127.669 48.159  1.00 14.00 ? 43  LYS C CE   1 
ATOM   9759  N  NZ   . LYS C  1 43  ? 33.858  129.012 48.747  1.00 17.66 ? 43  LYS C NZ   1 
ATOM   9760  H  H    . LYS C  1 43  ? 33.821  123.528 45.040  1.00 10.00 ? 43  LYS C H    1 
ATOM   9761  H  HA   . LYS C  1 43  ? 32.452  125.394 43.807  1.00 11.64 ? 43  LYS C HA   1 
ATOM   9762  H  HB2  . LYS C  1 43  ? 35.071  125.515 44.876  1.00 10.09 ? 43  LYS C HB2  1 
ATOM   9763  H  HB3  . LYS C  1 43  ? 34.334  126.789 44.279  1.00 10.09 ? 43  LYS C HB3  1 
ATOM   9764  H  HG2  . LYS C  1 43  ? 32.645  126.436 45.975  1.00 9.55  ? 43  LYS C HG2  1 
ATOM   9765  H  HG3  . LYS C  1 43  ? 33.666  125.422 46.649  1.00 9.55  ? 43  LYS C HG3  1 
ATOM   9766  H  HD2  . LYS C  1 43  ? 35.175  127.153 47.021  1.00 17.13 ? 43  LYS C HD2  1 
ATOM   9767  H  HD3  . LYS C  1 43  ? 34.203  128.178 46.284  1.00 17.13 ? 43  LYS C HD3  1 
ATOM   9768  H  HE2  . LYS C  1 43  ? 32.592  127.621 48.020  1.00 16.80 ? 43  LYS C HE2  1 
ATOM   9769  H  HE3  . LYS C  1 43  ? 33.820  126.997 48.805  1.00 16.80 ? 43  LYS C HE3  1 
ATOM   9770  H  HZ1  . LYS C  1 43  ? 33.420  129.115 49.514  1.00 21.19 ? 43  LYS C HZ1  1 
ATOM   9771  H  HZ2  . LYS C  1 43  ? 34.732  129.084 48.900  1.00 21.19 ? 43  LYS C HZ2  1 
ATOM   9772  H  HZ3  . LYS C  1 43  ? 33.610  129.654 48.183  1.00 21.19 ? 43  LYS C HZ3  1 
ATOM   9773  N  N    . ALA C  1 44  ? 34.931  124.208 42.198  1.00 9.39  ? 44  ALA C N    1 
ATOM   9774  C  CA   . ALA C  1 44  ? 35.524  124.139 40.878  1.00 7.97  ? 44  ALA C CA   1 
ATOM   9775  C  C    . ALA C  1 44  ? 34.553  123.542 39.886  1.00 12.66 ? 44  ALA C C    1 
ATOM   9776  O  O    . ALA C  1 44  ? 34.571  123.909 38.706  1.00 9.05  ? 44  ALA C O    1 
ATOM   9777  C  CB   . ALA C  1 44  ? 36.835  123.331 40.920  1.00 10.93 ? 44  ALA C CB   1 
ATOM   9778  H  H    . ALA C  1 44  ? 35.290  123.691 42.785  1.00 11.26 ? 44  ALA C H    1 
ATOM   9779  H  HA   . ALA C  1 44  ? 35.739  125.047 40.579  1.00 9.56  ? 44  ALA C HA   1 
ATOM   9780  H  HB1  . ALA C  1 44  ? 37.210  123.298 40.036  1.00 13.11 ? 44  ALA C HB1  1 
ATOM   9781  H  HB2  . ALA C  1 44  ? 37.448  123.761 41.520  1.00 13.11 ? 44  ALA C HB2  1 
ATOM   9782  H  HB3  . ALA C  1 44  ? 36.644  122.442 41.228  1.00 13.11 ? 44  ALA C HB3  1 
ATOM   9783  N  N    . MET C  1 45  ? 33.737  122.583 40.330  1.00 9.15  ? 45  MET C N    1 
ATOM   9784  C  CA   . MET C  1 45  ? 32.770  121.950 39.451  1.00 8.41  ? 45  MET C CA   1 
ATOM   9785  C  C    . MET C  1 45  ? 31.662  122.951 39.069  1.00 10.00 ? 45  MET C C    1 
ATOM   9786  O  O    . MET C  1 45  ? 31.182  122.995 37.922  1.00 10.03 ? 45  MET C O    1 
ATOM   9787  C  CB   . MET C  1 45  ? 32.199  120.680 40.104  1.00 9.68  ? 45  MET C CB   1 
ATOM   9788  C  CG   . MET C  1 45  ? 33.204  119.528 40.219  1.00 5.31  ? 45  MET C CG   1 
ATOM   9789  S  SD   . MET C  1 45  ? 33.929  119.047 38.603  1.00 8.56  ? 45  MET C SD   1 
ATOM   9790  C  CE   . MET C  1 45  ? 35.566  119.767 38.778  1.00 7.99  ? 45  MET C CE   1 
ATOM   9791  H  H    . MET C  1 45  ? 33.728  122.286 41.137  1.00 10.98 ? 45  MET C H    1 
ATOM   9792  H  HA   . MET C  1 45  ? 33.232  121.675 38.632  1.00 10.10 ? 45  MET C HA   1 
ATOM   9793  H  HB2  . MET C  1 45  ? 31.898  120.899 41.000  1.00 11.61 ? 45  MET C HB2  1 
ATOM   9794  H  HB3  . MET C  1 45  ? 31.450  120.367 39.573  1.00 11.61 ? 45  MET C HB3  1 
ATOM   9795  H  HG2  . MET C  1 45  ? 33.929  119.799 40.803  1.00 6.37  ? 45  MET C HG2  1 
ATOM   9796  H  HG3  . MET C  1 45  ? 32.753  118.752 40.587  1.00 6.37  ? 45  MET C HG3  1 
ATOM   9797  H  HE1  . MET C  1 45  ? 36.072  119.588 37.982  1.00 9.59  ? 45  MET C HE1  1 
ATOM   9798  H  HE2  . MET C  1 45  ? 35.479  120.715 38.905  1.00 9.59  ? 45  MET C HE2  1 
ATOM   9799  H  HE3  . MET C  1 45  ? 36.001  119.373 39.538  1.00 9.59  ? 45  MET C HE3  1 
ATOM   9800  N  N    . HIS C  1 46  ? 31.286  123.799 40.015  1.00 12.12 ? 46  HIS C N    1 
ATOM   9801  C  CA   . HIS C  1 46  ? 30.330  124.842 39.703  1.00 10.36 ? 46  HIS C CA   1 
ATOM   9802  C  C    . HIS C  1 46  ? 30.914  125.836 38.722  1.00 11.17 ? 46  HIS C C    1 
ATOM   9803  O  O    . HIS C  1 46  ? 30.212  126.314 37.827  1.00 10.52 ? 46  HIS C O    1 
ATOM   9804  C  CB   . HIS C  1 46  ? 29.877  125.563 40.982  1.00 8.60  ? 46  HIS C CB   1 
ATOM   9805  C  CG   . HIS C  1 46  ? 28.757  124.873 41.672  1.00 14.55 ? 46  HIS C CG   1 
ATOM   9806  N  ND1  . HIS C  1 46  ? 28.947  124.012 42.733  1.00 19.58 ? 46  HIS C ND1  1 
ATOM   9807  C  CD2  . HIS C  1 46  ? 27.424  124.891 41.434  1.00 14.98 ? 46  HIS C CD2  1 
ATOM   9808  C  CE1  . HIS C  1 46  ? 27.778  123.542 43.127  1.00 13.16 ? 46  HIS C CE1  1 
ATOM   9809  N  NE2  . HIS C  1 46  ? 26.838  124.064 42.360  1.00 25.94 ? 46  HIS C NE2  1 
ATOM   9810  H  H    . HIS C  1 46  ? 31.563  123.792 40.828  1.00 14.55 ? 46  HIS C H    1 
ATOM   9811  H  HA   . HIS C  1 46  ? 29.540  124.437 39.288  1.00 12.43 ? 46  HIS C HA   1 
ATOM   9812  H  HB2  . HIS C  1 46  ? 30.625  125.609 41.599  1.00 10.32 ? 46  HIS C HB2  1 
ATOM   9813  H  HB3  . HIS C  1 46  ? 29.582  126.458 40.752  1.00 10.32 ? 46  HIS C HB3  1 
ATOM   9814  H  HD1  . HIS C  1 46  ? 29.707  123.817 43.086  1.00 23.50 ? 46  HIS C HD1  1 
ATOM   9815  H  HD2  . HIS C  1 46  ? 26.986  125.382 40.776  1.00 17.98 ? 46  HIS C HD2  1 
ATOM   9816  H  HE1  . HIS C  1 46  ? 27.640  122.949 43.830  1.00 15.79 ? 46  HIS C HE1  1 
ATOM   9817  H  HE2  . HIS C  1 46  ? 25.995  123.904 42.424  1.00 31.13 ? 46  HIS C HE2  1 
ATOM   9818  N  N    . PHE C  1 47  ? 32.200  126.143 38.872  1.00 9.61  ? 47  PHE C N    1 
ATOM   9819  C  CA   . PHE C  1 47  ? 32.864  127.072 37.957  1.00 6.44  ? 47  PHE C CA   1 
ATOM   9820  C  C    . PHE C  1 47  ? 32.833  126.483 36.547  1.00 9.81  ? 47  PHE C C    1 
ATOM   9821  O  O    . PHE C  1 47  ? 32.488  127.139 35.559  1.00 8.59  ? 47  PHE C O    1 
ATOM   9822  C  CB   . PHE C  1 47  ? 34.296  127.301 38.445  1.00 5.89  ? 47  PHE C CB   1 
ATOM   9823  C  CG   . PHE C  1 47  ? 35.114  128.179 37.544  1.00 8.13  ? 47  PHE C CG   1 
ATOM   9824  C  CD1  . PHE C  1 47  ? 35.656  127.673 36.378  1.00 7.19  ? 47  PHE C CD1  1 
ATOM   9825  C  CD2  . PHE C  1 47  ? 35.322  129.522 37.858  1.00 16.81 ? 47  PHE C CD2  1 
ATOM   9826  C  CE1  . PHE C  1 47  ? 36.413  128.450 35.557  1.00 11.73 ? 47  PHE C CE1  1 
ATOM   9827  C  CE2  . PHE C  1 47  ? 36.075  130.327 37.007  1.00 11.75 ? 47  PHE C CE2  1 
ATOM   9828  C  CZ   . PHE C  1 47  ? 36.626  129.789 35.875  1.00 14.63 ? 47  PHE C CZ   1 
ATOM   9829  H  H    . PHE C  1 47  ? 32.708  125.830 39.491  1.00 11.54 ? 47  PHE C H    1 
ATOM   9830  H  HA   . PHE C  1 47  ? 32.390  127.930 37.953  1.00 7.72  ? 47  PHE C HA   1 
ATOM   9831  H  HB2  . PHE C  1 47  ? 34.265  127.720 39.319  1.00 7.07  ? 47  PHE C HB2  1 
ATOM   9832  H  HB3  . PHE C  1 47  ? 34.744  126.443 38.508  1.00 7.07  ? 47  PHE C HB3  1 
ATOM   9833  H  HD1  . PHE C  1 47  ? 35.528  126.776 36.167  1.00 8.63  ? 47  PHE C HD1  1 
ATOM   9834  H  HD2  . PHE C  1 47  ? 34.956  129.880 38.634  1.00 20.18 ? 47  PHE C HD2  1 
ATOM   9835  H  HE1  . PHE C  1 47  ? 36.775  128.092 34.779  1.00 14.07 ? 47  PHE C HE1  1 
ATOM   9836  H  HE2  . PHE C  1 47  ? 36.224  131.220 37.219  1.00 14.11 ? 47  PHE C HE2  1 
ATOM   9837  H  HZ   . PHE C  1 47  ? 37.129  130.325 35.306  1.00 17.56 ? 47  PHE C HZ   1 
ATOM   9838  N  N    . TRP C  1 48  ? 33.181  125.212 36.455  1.00 10.98 ? 48  TRP C N    1 
ATOM   9839  C  CA   . TRP C  1 48  ? 33.163  124.517 35.180  1.00 9.29  ? 48  TRP C CA   1 
ATOM   9840  C  C    . TRP C  1 48  ? 31.775  124.541 34.524  1.00 9.50  ? 48  TRP C C    1 
ATOM   9841  O  O    . TRP C  1 48  ? 31.625  124.867 33.320  1.00 7.58  ? 48  TRP C O    1 
ATOM   9842  C  CB   . TRP C  1 48  ? 33.612  123.094 35.413  1.00 5.74  ? 48  TRP C CB   1 
ATOM   9843  C  CG   . TRP C  1 48  ? 34.113  122.391 34.179  1.00 5.78  ? 48  TRP C CG   1 
ATOM   9844  C  CD1  . TRP C  1 48  ? 34.247  122.900 32.918  1.00 7.62  ? 48  TRP C CD1  1 
ATOM   9845  C  CD2  . TRP C  1 48  ? 34.550  121.032 34.112  1.00 7.08  ? 48  TRP C CD2  1 
ATOM   9846  N  NE1  . TRP C  1 48  ? 34.739  121.938 32.075  1.00 10.17 ? 48  TRP C NE1  1 
ATOM   9847  C  CE2  . TRP C  1 48  ? 34.931  120.780 32.781  1.00 8.49  ? 48  TRP C CE2  1 
ATOM   9848  C  CE3  . TRP C  1 48  ? 34.632  119.999 35.042  1.00 8.16  ? 48  TRP C CE3  1 
ATOM   9849  C  CZ2  . TRP C  1 48  ? 35.394  119.534 32.371  1.00 14.24 ? 48  TRP C CZ2  1 
ATOM   9850  C  CZ3  . TRP C  1 48  ? 35.091  118.789 34.651  1.00 7.18  ? 48  TRP C CZ3  1 
ATOM   9851  C  CH2  . TRP C  1 48  ? 35.473  118.553 33.330  1.00 11.08 ? 48  TRP C CH2  1 
ATOM   9852  H  H    . TRP C  1 48  ? 33.434  124.726 37.118  1.00 13.17 ? 48  TRP C H    1 
ATOM   9853  H  HA   . TRP C  1 48  ? 33.799  124.944 34.569  1.00 11.14 ? 48  TRP C HA   1 
ATOM   9854  H  HB2  . TRP C  1 48  ? 34.332  123.098 36.063  1.00 6.88  ? 48  TRP C HB2  1 
ATOM   9855  H  HB3  . TRP C  1 48  ? 32.862  122.585 35.759  1.00 6.88  ? 48  TRP C HB3  1 
ATOM   9856  H  HD1  . TRP C  1 48  ? 34.044  123.773 32.670  1.00 9.14  ? 48  TRP C HD1  1 
ATOM   9857  H  HE1  . TRP C  1 48  ? 34.902  122.044 31.237  1.00 12.20 ? 48  TRP C HE1  1 
ATOM   9858  H  HE3  . TRP C  1 48  ? 34.384  120.144 35.926  1.00 9.80  ? 48  TRP C HE3  1 
ATOM   9859  H  HZ2  . TRP C  1 48  ? 35.650  119.376 31.492  1.00 17.09 ? 48  TRP C HZ2  1 
ATOM   9860  H  HZ3  . TRP C  1 48  ? 35.155  118.102 35.274  1.00 8.62  ? 48  TRP C HZ3  1 
ATOM   9861  H  HH2  . TRP C  1 48  ? 35.783  117.709 33.092  1.00 13.29 ? 48  TRP C HH2  1 
ATOM   9862  N  N    . ALA C  1 49  ? 30.774  124.153 35.302  1.00 9.19  ? 49  ALA C N    1 
ATOM   9863  C  CA   . ALA C  1 49  ? 29.393  124.145 34.858  1.00 10.02 ? 49  ALA C CA   1 
ATOM   9864  C  C    . ALA C  1 49  ? 28.932  125.509 34.341  1.00 10.15 ? 49  ALA C C    1 
ATOM   9865  O  O    . ALA C  1 49  ? 28.365  125.608 33.245  1.00 12.01 ? 49  ALA C O    1 
ATOM   9866  C  CB   . ALA C  1 49  ? 28.484  123.679 35.954  1.00 13.45 ? 49  ALA C CB   1 
ATOM   9867  H  H    . ALA C  1 49  ? 30.875  123.884 36.112  1.00 11.03 ? 49  ALA C H    1 
ATOM   9868  H  HA   . ALA C  1 49  ? 29.311  123.508 34.117  1.00 12.02 ? 49  ALA C HA   1 
ATOM   9869  H  HB1  . ALA C  1 49  ? 27.579  123.684 35.632  1.00 16.14 ? 49  ALA C HB1  1 
ATOM   9870  H  HB2  . ALA C  1 49  ? 28.735  122.789 36.211  1.00 16.14 ? 49  ALA C HB2  1 
ATOM   9871  H  HB3  . ALA C  1 49  ? 28.568  124.273 36.703  1.00 16.14 ? 49  ALA C HB3  1 
ATOM   9872  N  N    . ASP C  1 50  ? 29.137  126.551 35.143  1.00 10.44 ? 50  ASP C N    1 
ATOM   9873  C  CA   . ASP C  1 50  ? 28.749  127.890 34.713  1.00 13.66 ? 50  ASP C CA   1 
ATOM   9874  C  C    . ASP C  1 50  ? 29.433  128.288 33.407  1.00 9.37  ? 50  ASP C C    1 
ATOM   9875  O  O    . ASP C  1 50  ? 28.787  128.806 32.511  1.00 11.65 ? 50  ASP C O    1 
ATOM   9876  C  CB   . ASP C  1 50  ? 29.078  128.919 35.780  1.00 14.41 ? 50  ASP C CB   1 
ATOM   9877  C  CG   . ASP C  1 50  ? 28.318  128.678 37.082  1.00 20.68 ? 50  ASP C CG   1 
ATOM   9878  O  OD1  . ASP C  1 50  ? 27.394  127.836 37.097  1.00 22.51 ? 50  ASP C OD1  1 
ATOM   9879  O  OD2  . ASP C  1 50  ? 28.648  129.344 38.083  1.00 22.56 ? 50  ASP C OD2  1 
ATOM   9880  H  H    . ASP C  1 50  ? 29.492  126.511 35.926  1.00 12.53 ? 50  ASP C H    1 
ATOM   9881  H  HA   . ASP C  1 50  ? 27.781  127.908 34.565  1.00 16.39 ? 50  ASP C HA   1 
ATOM   9882  H  HB2  . ASP C  1 50  ? 30.028  128.880 35.975  1.00 17.29 ? 50  ASP C HB2  1 
ATOM   9883  H  HB3  . ASP C  1 50  ? 28.842  129.801 35.453  1.00 17.29 ? 50  ASP C HB3  1 
ATOM   9884  N  N    . LYS C  1 51  ? 30.750  128.069 33.311  1.00 10.66 ? 51  LYS C N    1 
ATOM   9885  C  CA   . LYS C  1 51  ? 31.507  128.447 32.125  1.00 10.75 ? 51  LYS C CA   1 
ATOM   9886  C  C    . LYS C  1 51  ? 31.060  127.709 30.859  1.00 16.50 ? 51  LYS C C    1 
ATOM   9887  O  O    . LYS C  1 51  ? 30.930  128.314 29.770  1.00 9.46  ? 51  LYS C O    1 
ATOM   9888  C  CB   . LYS C  1 51  ? 33.005  128.265 32.396  1.00 13.45 ? 51  LYS C CB   1 
ATOM   9889  C  CG   . LYS C  1 51  ? 33.925  128.665 31.251  1.00 18.95 ? 51  LYS C CG   1 
ATOM   9890  C  CD   . LYS C  1 51  ? 33.998  130.200 31.061  1.00 24.23 ? 51  LYS C CD   1 
ATOM   9891  C  CE   . LYS C  1 51  ? 34.615  130.913 32.258  1.00 31.06 ? 51  LYS C CE   1 
ATOM   9892  N  NZ   . LYS C  1 51  ? 34.607  132.404 32.097  1.00 24.93 ? 51  LYS C NZ   1 
ATOM   9893  H  H    . LYS C  1 51  ? 31.226  127.702 33.926  1.00 12.79 ? 51  LYS C H    1 
ATOM   9894  H  HA   . LYS C  1 51  ? 31.359  129.402 31.964  1.00 12.90 ? 51  LYS C HA   1 
ATOM   9895  H  HB2  . LYS C  1 51  ? 33.245  128.805 33.166  1.00 16.14 ? 51  LYS C HB2  1 
ATOM   9896  H  HB3  . LYS C  1 51  ? 33.171  127.330 32.591  1.00 16.14 ? 51  LYS C HB3  1 
ATOM   9897  H  HG2  . LYS C  1 51  ? 34.821  128.341 31.437  1.00 22.74 ? 51  LYS C HG2  1 
ATOM   9898  H  HG3  . LYS C  1 51  ? 33.594  128.275 30.427  1.00 22.74 ? 51  LYS C HG3  1 
ATOM   9899  H  HD2  . LYS C  1 51  ? 34.541  130.396 30.282  1.00 29.07 ? 51  LYS C HD2  1 
ATOM   9900  H  HD3  . LYS C  1 51  ? 33.101  130.546 30.936  1.00 29.07 ? 51  LYS C HD3  1 
ATOM   9901  H  HE2  . LYS C  1 51  ? 34.109  130.692 33.055  1.00 37.28 ? 51  LYS C HE2  1 
ATOM   9902  H  HE3  . LYS C  1 51  ? 35.536  130.626 32.358  1.00 37.28 ? 51  LYS C HE3  1 
ATOM   9903  H  HZ1  . LYS C  1 51  ? 33.770  132.696 32.009  1.00 29.92 ? 51  LYS C HZ1  1 
ATOM   9904  H  HZ2  . LYS C  1 51  ? 34.973  132.789 32.811  1.00 29.92 ? 51  LYS C HZ2  1 
ATOM   9905  H  HZ3  . LYS C  1 51  ? 35.071  132.635 31.374  1.00 29.92 ? 51  LYS C HZ3  1 
ATOM   9906  N  N    . VAL C  1 52  ? 30.808  126.412 30.995  1.00 9.45  ? 52  VAL C N    1 
ATOM   9907  C  CA   . VAL C  1 52  ? 30.362  125.593 29.881  1.00 8.40  ? 52  VAL C CA   1 
ATOM   9908  C  C    . VAL C  1 52  ? 28.959  126.034 29.470  1.00 11.02 ? 52  VAL C C    1 
ATOM   9909  O  O    . VAL C  1 52  ? 28.623  126.069 28.282  1.00 13.18 ? 52  VAL C O    1 
ATOM   9910  C  CB   . VAL C  1 52  ? 30.376  124.093 30.292  1.00 13.45 ? 52  VAL C CB   1 
ATOM   9911  C  CG1  . VAL C  1 52  ? 29.434  123.278 29.449  1.00 22.40 ? 52  VAL C CG1  1 
ATOM   9912  C  CG2  . VAL C  1 52  ? 31.808  123.548 30.270  1.00 11.19 ? 52  VAL C CG2  1 
ATOM   9913  H  H    . VAL C  1 52  ? 30.890  125.979 31.734  1.00 11.34 ? 52  VAL C H    1 
ATOM   9914  H  HA   . VAL C  1 52  ? 30.966  125.715 29.119  1.00 10.09 ? 52  VAL C HA   1 
ATOM   9915  H  HB   . VAL C  1 52  ? 30.059  124.030 31.217  1.00 16.14 ? 52  VAL C HB   1 
ATOM   9916  H  HG11 . VAL C  1 52  ? 29.473  122.362 29.735  1.00 26.87 ? 52  VAL C HG11 1 
ATOM   9917  H  HG12 . VAL C  1 52  ? 28.543  123.617 29.559  1.00 26.87 ? 52  VAL C HG12 1 
ATOM   9918  H  HG13 . VAL C  1 52  ? 29.700  123.346 28.529  1.00 26.87 ? 52  VAL C HG13 1 
ATOM   9919  H  HG21 . VAL C  1 52  ? 31.793  122.623 30.527  1.00 13.42 ? 52  VAL C HG21 1 
ATOM   9920  H  HG22 . VAL C  1 52  ? 32.162  123.636 29.383  1.00 13.42 ? 52  VAL C HG22 1 
ATOM   9921  H  HG23 . VAL C  1 52  ? 32.342  124.050 30.889  1.00 13.42 ? 52  VAL C HG23 1 
ATOM   9922  N  N    . LYS C  1 53  ? 28.151  126.427 30.450  1.00 9.71  ? 53  LYS C N    1 
ATOM   9923  C  CA   . LYS C  1 53  ? 26.808  126.889 30.151  1.00 11.20 ? 53  LYS C CA   1 
ATOM   9924  C  C    . LYS C  1 53  ? 26.904  128.187 29.344  1.00 14.03 ? 53  LYS C C    1 
ATOM   9925  O  O    . LYS C  1 53  ? 26.253  128.341 28.303  1.00 17.23 ? 53  LYS C O    1 
ATOM   9926  C  CB   . LYS C  1 53  ? 25.999  127.144 31.424  1.00 12.56 ? 53  LYS C CB   1 
ATOM   9927  C  CG   . LYS C  1 53  ? 24.557  127.468 31.116  1.00 24.86 ? 53  LYS C CG   1 
ATOM   9928  C  CD   . LYS C  1 53  ? 23.755  127.724 32.365  1.00 25.57 ? 53  LYS C CD   1 
ATOM   9929  C  CE   . LYS C  1 53  ? 22.274  127.793 32.025  1.00 37.04 ? 53  LYS C CE   1 
ATOM   9930  N  NZ   . LYS C  1 53  ? 21.475  128.471 33.094  1.00 42.50 ? 53  LYS C NZ   1 
ATOM   9931  H  H    . LYS C  1 53  ? 28.356  126.435 31.285  1.00 11.65 ? 53  LYS C H    1 
ATOM   9932  H  HA   . LYS C  1 53  ? 26.340  126.218 29.611  1.00 13.44 ? 53  LYS C HA   1 
ATOM   9933  H  HB2  . LYS C  1 53  ? 26.019  126.349 31.979  1.00 15.07 ? 53  LYS C HB2  1 
ATOM   9934  H  HB3  . LYS C  1 53  ? 26.384  127.895 31.902  1.00 15.07 ? 53  LYS C HB3  1 
ATOM   9935  H  HG2  . LYS C  1 53  ? 24.521  128.266 30.565  1.00 29.84 ? 53  LYS C HG2  1 
ATOM   9936  H  HG3  . LYS C  1 53  ? 24.156  126.720 30.647  1.00 29.84 ? 53  LYS C HG3  1 
ATOM   9937  H  HD2  . LYS C  1 53  ? 23.894  127.000 32.995  1.00 30.68 ? 53  LYS C HD2  1 
ATOM   9938  H  HD3  . LYS C  1 53  ? 24.022  128.572 32.755  1.00 30.68 ? 53  LYS C HD3  1 
ATOM   9939  H  HE2  . LYS C  1 53  ? 22.160  128.292 31.201  1.00 44.45 ? 53  LYS C HE2  1 
ATOM   9940  H  HE3  . LYS C  1 53  ? 21.931  126.891 31.919  1.00 44.45 ? 53  LYS C HE3  1 
ATOM   9941  H  HZ1  . LYS C  1 53  ? 20.615  128.493 32.864  1.00 50.99 ? 53  LYS C HZ1  1 
ATOM   9942  H  HZ2  . LYS C  1 53  ? 21.557  128.028 33.862  1.00 50.99 ? 53  LYS C HZ2  1 
ATOM   9943  H  HZ3  . LYS C  1 53  ? 21.765  129.304 33.209  1.00 50.99 ? 53  LYS C HZ3  1 
ATOM   9944  N  N    . GLU C  1 54  ? 27.753  129.094 29.809  1.00 14.40 ? 54  GLU C N    1 
ATOM   9945  C  CA   . GLU C  1 54  ? 27.954  130.386 29.150  1.00 14.77 ? 54  GLU C CA   1 
ATOM   9946  C  C    . GLU C  1 54  ? 28.425  130.197 27.704  1.00 17.32 ? 54  GLU C C    1 
ATOM   9947  O  O    . GLU C  1 54  ? 27.815  130.708 26.766  1.00 20.44 ? 54  GLU C O    1 
ATOM   9948  C  CB   . GLU C  1 54  ? 28.950  131.219 29.966  1.00 20.58 ? 54  GLU C CB   1 
ATOM   9949  C  CG   . GLU C  1 54  ? 29.476  132.490 29.313  1.00 35.46 ? 54  GLU C CG   1 
ATOM   9950  C  CD   . GLU C  1 54  ? 30.531  133.186 30.175  1.00 44.92 ? 54  GLU C CD   1 
ATOM   9951  O  OE1  . GLU C  1 54  ? 30.586  132.916 31.396  1.00 43.96 ? 54  GLU C OE1  1 
ATOM   9952  O  OE2  . GLU C  1 54  ? 31.314  133.994 29.631  1.00 51.99 ? 54  GLU C OE2  1 
ATOM   9953  H  H    . GLU C  1 54  ? 28.234  128.987 30.515  1.00 17.28 ? 54  GLU C H    1 
ATOM   9954  H  HA   . GLU C  1 54  ? 27.102  130.869 29.129  1.00 17.72 ? 54  GLU C HA   1 
ATOM   9955  H  HB2  . GLU C  1 54  ? 28.518  131.481 30.794  1.00 24.69 ? 54  GLU C HB2  1 
ATOM   9956  H  HB3  . GLU C  1 54  ? 29.718  130.662 30.168  1.00 24.69 ? 54  GLU C HB3  1 
ATOM   9957  H  HG2  . GLU C  1 54  ? 29.883  132.265 28.462  1.00 42.55 ? 54  GLU C HG2  1 
ATOM   9958  H  HG3  . GLU C  1 54  ? 28.740  133.107 29.179  1.00 42.55 ? 54  GLU C HG3  1 
ATOM   9959  N  N    . LYS C  1 55  ? 29.498  129.434 27.529  1.00 12.47 ? 55  LYS C N    1 
ATOM   9960  C  CA   . LYS C  1 55  ? 30.165  129.313 26.245  1.00 15.00 ? 55  LYS C CA   1 
ATOM   9961  C  C    . LYS C  1 55  ? 29.346  128.548 25.213  1.00 17.15 ? 55  LYS C C    1 
ATOM   9962  O  O    . LYS C  1 55  ? 29.527  128.744 24.008  1.00 17.18 ? 55  LYS C O    1 
ATOM   9963  C  CB   . LYS C  1 55  ? 31.561  128.696 26.452  1.00 11.83 ? 55  LYS C CB   1 
ATOM   9964  C  CG   . LYS C  1 55  ? 32.551  129.619 27.206  1.00 19.82 ? 55  LYS C CG   1 
ATOM   9965  C  CD   . LYS C  1 55  ? 32.857  130.910 26.428  1.00 27.75 ? 55  LYS C CD   1 
ATOM   9966  C  CE   . LYS C  1 55  ? 33.707  131.876 27.256  1.00 36.93 ? 55  LYS C CE   1 
ATOM   9967  N  NZ   . LYS C  1 55  ? 33.842  133.216 26.621  1.00 39.82 ? 55  LYS C NZ   1 
ATOM   9968  H  H    . LYS C  1 55  ? 29.863  128.969 28.153  1.00 14.97 ? 55  LYS C H    1 
ATOM   9969  H  HA   . LYS C  1 55  ? 30.301  130.216 25.889  1.00 17.99 ? 55  LYS C HA   1 
ATOM   9970  H  HB2  . LYS C  1 55  ? 31.468  127.879 26.967  1.00 14.19 ? 55  LYS C HB2  1 
ATOM   9971  H  HB3  . LYS C  1 55  ? 31.946  128.495 25.585  1.00 14.19 ? 55  LYS C HB3  1 
ATOM   9972  H  HG2  . LYS C  1 55  ? 32.166  129.868 28.061  1.00 23.78 ? 55  LYS C HG2  1 
ATOM   9973  H  HG3  . LYS C  1 55  ? 33.386  129.145 27.342  1.00 23.78 ? 55  LYS C HG3  1 
ATOM   9974  H  HD2  . LYS C  1 55  ? 33.348  130.688 25.621  1.00 33.30 ? 55  LYS C HD2  1 
ATOM   9975  H  HD3  . LYS C  1 55  ? 32.024  131.353 26.203  1.00 33.30 ? 55  LYS C HD3  1 
ATOM   9976  H  HE2  . LYS C  1 55  ? 33.292  131.997 28.124  1.00 44.32 ? 55  LYS C HE2  1 
ATOM   9977  H  HE3  . LYS C  1 55  ? 34.596  131.504 27.362  1.00 44.32 ? 55  LYS C HE3  1 
ATOM   9978  H  HZ1  . LYS C  1 55  ? 34.341  133.746 27.133  1.00 47.78 ? 55  LYS C HZ1  1 
ATOM   9979  H  HZ2  . LYS C  1 55  ? 34.228  133.137 25.823  1.00 47.78 ? 55  LYS C HZ2  1 
ATOM   9980  H  HZ3  . LYS C  1 55  ? 33.039  133.586 26.518  1.00 47.78 ? 55  LYS C HZ3  1 
ATOM   9981  N  N    . SER C  1 56  ? 28.431  127.707 25.678  1.00 13.43 ? 56  SER C N    1 
ATOM   9982  C  CA   . SER C  1 56  ? 27.570  126.929 24.799  1.00 10.98 ? 56  SER C CA   1 
ATOM   9983  C  C    . SER C  1 56  ? 26.207  127.577 24.630  1.00 14.01 ? 56  SER C C    1 
ATOM   9984  O  O    . SER C  1 56  ? 25.310  127.006 24.011  1.00 15.03 ? 56  SER C O    1 
ATOM   9985  C  CB   . SER C  1 56  ? 27.393  125.515 25.333  1.00 11.54 ? 56  SER C CB   1 
ATOM   9986  O  OG   . SER C  1 56  ? 26.657  125.479 26.546  1.00 12.59 ? 56  SER C OG   1 
ATOM   9987  H  H    . SER C  1 56  ? 28.288  127.567 26.515  1.00 16.11 ? 56  SER C H    1 
ATOM   9988  H  HA   . SER C  1 56  ? 27.988  126.869 23.915  1.00 13.17 ? 56  SER C HA   1 
ATOM   9989  H  HB2  . SER C  1 56  ? 26.921  124.989 24.669  1.00 13.85 ? 56  SER C HB2  1 
ATOM   9990  H  HB3  . SER C  1 56  ? 28.270  125.131 25.491  1.00 13.85 ? 56  SER C HB3  1 
ATOM   9991  H  HG   . SER C  1 56  ? 26.443  126.238 26.767  1.00 15.11 ? 56  SER C HG   1 
ATOM   9992  N  N    . ASN C  1 57  ? 26.040  128.764 25.204  1.00 14.74 ? 57  ASN C N    1 
ATOM   9993  C  CA   . ASN C  1 57  ? 24.733  129.404 25.235  1.00 20.06 ? 57  ASN C CA   1 
ATOM   9994  C  C    . ASN C  1 57  ? 23.632  128.479 25.718  1.00 20.13 ? 57  ASN C C    1 
ATOM   9995  O  O    . ASN C  1 57  ? 22.557  128.415 25.125  1.00 18.87 ? 57  ASN C O    1 
ATOM   9996  C  CB   . ASN C  1 57  ? 24.395  129.949 23.863  1.00 20.06 ? 57  ASN C CB   1 
ATOM   9997  C  CG   . ASN C  1 57  ? 25.378  130.996 23.409  1.00 29.67 ? 57  ASN C CG   1 
ATOM   9998  O  OD1  . ASN C  1 57  ? 25.761  131.883 24.177  1.00 34.36 ? 57  ASN C OD1  1 
ATOM   9999  N  ND2  . ASN C  1 57  ? 25.810  130.893 22.162  1.00 33.23 ? 57  ASN C ND2  1 
ATOM   10000 H  H    . ASN C  1 57  ? 26.666  129.218 25.580  1.00 17.69 ? 57  ASN C H    1 
ATOM   10001 H  HA   . ASN C  1 57  ? 24.773  130.163 25.853  1.00 24.07 ? 57  ASN C HA   1 
ATOM   10002 H  HB2  . ASN C  1 57  ? 24.409  129.223 23.220  1.00 24.07 ? 57  ASN C HB2  1 
ATOM   10003 H  HB3  . ASN C  1 57  ? 23.514  130.354 23.890  1.00 24.07 ? 57  ASN C HB3  1 
ATOM   10004 H  HD21 . ASN C  1 57  ? 25.528  130.254 21.661  1.00 39.88 ? 57  ASN C HD21 1 
ATOM   10005 H  HD22 . ASN C  1 57  ? 26.373  131.466 21.854  1.00 39.88 ? 57  ASN C HD22 1 
ATOM   10006 N  N    . GLY C  1 58  ? 23.902  127.781 26.813  1.00 18.69 ? 58  GLY C N    1 
ATOM   10007 C  CA   . GLY C  1 58  ? 22.897  126.970 27.474  1.00 22.67 ? 58  GLY C CA   1 
ATOM   10008 C  C    . GLY C  1 58  ? 22.670  125.619 26.834  1.00 18.68 ? 58  GLY C C    1 
ATOM   10009 O  O    . GLY C  1 58  ? 21.830  124.848 27.289  1.00 20.14 ? 58  GLY C O    1 
ATOM   10010 H  H    . GLY C  1 58  ? 24.671  127.762 27.197  1.00 22.43 ? 58  GLY C H    1 
ATOM   10011 H  HA2  . GLY C  1 58  ? 23.163  126.825 28.396  1.00 27.20 ? 58  GLY C HA2  1 
ATOM   10012 H  HA3  . GLY C  1 58  ? 22.054  127.448 27.475  1.00 27.20 ? 58  GLY C HA3  1 
ATOM   10013 N  N    . ASP C  1 59  ? 23.416  125.320 25.780  1.00 16.95 ? 59  ASP C N    1 
ATOM   10014 C  CA   . ASP C  1 59  ? 23.231  124.051 25.087  1.00 15.06 ? 59  ASP C CA   1 
ATOM   10015 C  C    . ASP C  1 59  ? 23.807  122.874 25.873  1.00 17.41 ? 59  ASP C C    1 
ATOM   10016 O  O    . ASP C  1 59  ? 23.252  121.778 25.855  1.00 20.39 ? 59  ASP C O    1 
ATOM   10017 C  CB   . ASP C  1 59  ? 23.858  124.085 23.706  1.00 13.10 ? 59  ASP C CB   1 
ATOM   10018 C  CG   . ASP C  1 59  ? 23.574  122.832 22.934  1.00 20.85 ? 59  ASP C CG   1 
ATOM   10019 O  OD1  . ASP C  1 59  ? 22.383  122.561 22.682  1.00 19.76 ? 59  ASP C OD1  1 
ATOM   10020 O  OD2  . ASP C  1 59  ? 24.535  122.103 22.631  1.00 24.87 ? 59  ASP C OD2  1 
ATOM   10021 H  H    . ASP C  1 59  ? 24.028  125.826 25.448  1.00 20.34 ? 59  ASP C H    1 
ATOM   10022 H  HA   . ASP C  1 59  ? 22.271  123.892 24.974  1.00 18.07 ? 59  ASP C HA   1 
ATOM   10023 H  HB2  . ASP C  1 59  ? 23.496  124.836 23.210  1.00 15.72 ? 59  ASP C HB2  1 
ATOM   10024 H  HB3  . ASP C  1 59  ? 24.820  124.175 23.795  1.00 15.72 ? 59  ASP C HB3  1 
ATOM   10025 N  N    . ILE C  1 60  ? 24.926  123.101 26.545  1.00 15.16 ? 60  ILE C N    1 
ATOM   10026 C  CA   . ILE C  1 60  ? 25.532  122.063 27.361  1.00 15.34 ? 60  ILE C CA   1 
ATOM   10027 C  C    . ILE C  1 60  ? 25.227  122.346 28.817  1.00 15.92 ? 60  ILE C C    1 
ATOM   10028 O  O    . ILE C  1 60  ? 25.589  123.401 29.340  1.00 15.75 ? 60  ILE C O    1 
ATOM   10029 C  CB   . ILE C  1 60  ? 27.062  122.011 27.162  1.00 10.25 ? 60  ILE C CB   1 
ATOM   10030 C  CG1  . ILE C  1 60  ? 27.409  121.834 25.692  1.00 10.11 ? 60  ILE C CG1  1 
ATOM   10031 C  CG2  . ILE C  1 60  ? 27.663  120.853 27.934  1.00 13.19 ? 60  ILE C CG2  1 
ATOM   10032 C  CD1  . ILE C  1 60  ? 28.912  121.861 25.441  1.00 14.03 ? 60  ILE C CD1  1 
ATOM   10033 H  H    . ILE C  1 60  ? 25.354  123.848 26.545  1.00 18.20 ? 60  ILE C H    1 
ATOM   10034 H  HA   . ILE C  1 60  ? 25.153  121.191 27.123  1.00 18.41 ? 60  ILE C HA   1 
ATOM   10035 H  HB   . ILE C  1 60  ? 27.452  122.840 27.482  1.00 12.30 ? 60  ILE C HB   1 
ATOM   10036 H  HG12 . ILE C  1 60  ? 27.068  120.979 25.386  1.00 12.13 ? 60  ILE C HG12 1 
ATOM   10037 H  HG13 . ILE C  1 60  ? 27.006  122.554 25.182  1.00 12.13 ? 60  ILE C HG13 1 
ATOM   10038 H  HG21 . ILE C  1 60  ? 28.613  120.843 27.793  1.00 15.83 ? 60  ILE C HG21 1 
ATOM   10039 H  HG22 . ILE C  1 60  ? 27.471  120.967 28.868  1.00 15.83 ? 60  ILE C HG22 1 
ATOM   10040 H  HG23 . ILE C  1 60  ? 27.277  120.033 27.618  1.00 15.83 ? 60  ILE C HG23 1 
ATOM   10041 H  HD11 . ILE C  1 60  ? 29.074  121.745 24.501  1.00 16.84 ? 60  ILE C HD11 1 
ATOM   10042 H  HD12 . ILE C  1 60  ? 29.263  122.706 25.732  1.00 16.84 ? 60  ILE C HD12 1 
ATOM   10043 H  HD13 . ILE C  1 60  ? 29.324  121.147 25.934  1.00 16.84 ? 60  ILE C HD13 1 
ATOM   10044 N  N    . VAL C  1 61  ? 24.593  121.385 29.477  1.00 11.27 ? 61  VAL C N    1 
ATOM   10045 C  CA   . VAL C  1 61  ? 24.100  121.586 30.829  1.00 10.42 ? 61  VAL C CA   1 
ATOM   10046 C  C    . VAL C  1 61  ? 24.648  120.560 31.818  1.00 17.75 ? 61  VAL C C    1 
ATOM   10047 O  O    . VAL C  1 61  ? 24.207  119.406 31.839  1.00 15.48 ? 61  VAL C O    1 
ATOM   10048 C  CB   . VAL C  1 61  ? 22.561  121.499 30.884  1.00 11.25 ? 61  VAL C CB   1 
ATOM   10049 C  CG1  . VAL C  1 61  ? 22.058  121.699 32.329  1.00 16.54 ? 61  VAL C CG1  1 
ATOM   10050 C  CG2  . VAL C  1 61  ? 21.925  122.518 29.948  1.00 28.48 ? 61  VAL C CG2  1 
ATOM   10051 H  H    . VAL C  1 61  ? 24.434  120.602 29.159  1.00 13.52 ? 61  VAL C H    1 
ATOM   10052 H  HA   . VAL C  1 61  ? 24.366  122.478 31.137  1.00 12.50 ? 61  VAL C HA   1 
ATOM   10053 H  HB   . VAL C  1 61  ? 22.284  120.606 30.590  1.00 13.50 ? 61  VAL C HB   1 
ATOM   10054 H  HG11 . VAL C  1 61  ? 21.100  121.640 32.337  1.00 19.85 ? 61  VAL C HG11 1 
ATOM   10055 H  HG12 . VAL C  1 61  ? 22.433  121.014 32.887  1.00 19.85 ? 61  VAL C HG12 1 
ATOM   10056 H  HG13 . VAL C  1 61  ? 22.336  122.564 32.639  1.00 19.85 ? 61  VAL C HG13 1 
ATOM   10057 H  HG21 . VAL C  1 61  ? 20.970  122.440 30.004  1.00 34.18 ? 61  VAL C HG21 1 
ATOM   10058 H  HG22 . VAL C  1 61  ? 22.198  123.399 30.214  1.00 34.18 ? 61  VAL C HG22 1 
ATOM   10059 H  HG23 . VAL C  1 61  ? 22.217  122.342 29.050  1.00 34.18 ? 61  VAL C HG23 1 
ATOM   10060 N  N    . PHE C  1 62  ? 25.602  121.000 32.634  1.00 13.26 ? 62  PHE C N    1 
ATOM   10061 C  CA   . PHE C  1 62  ? 26.185  120.174 33.668  1.00 14.56 ? 62  PHE C CA   1 
ATOM   10062 C  C    . PHE C  1 62  ? 25.225  120.154 34.847  1.00 14.85 ? 62  PHE C C    1 
ATOM   10063 O  O    . PHE C  1 62  ? 24.799  121.214 35.334  1.00 12.91 ? 62  PHE C O    1 
ATOM   10064 C  CB   . PHE C  1 62  ? 27.527  120.757 34.157  1.00 12.22 ? 62  PHE C CB   1 
ATOM   10065 C  CG   . PHE C  1 62  ? 28.719  120.454 33.281  1.00 10.73 ? 62  PHE C CG   1 
ATOM   10066 C  CD1  . PHE C  1 62  ? 28.595  119.922 31.993  1.00 8.86  ? 62  PHE C CD1  1 
ATOM   10067 C  CD2  . PHE C  1 62  ? 29.993  120.703 33.769  1.00 16.19 ? 62  PHE C CD2  1 
ATOM   10068 C  CE1  . PHE C  1 62  ? 29.725  119.660 31.244  1.00 13.76 ? 62  PHE C CE1  1 
ATOM   10069 C  CE2  . PHE C  1 62  ? 31.106  120.458 33.021  1.00 11.49 ? 62  PHE C CE2  1 
ATOM   10070 C  CZ   . PHE C  1 62  ? 30.986  119.937 31.763  1.00 14.30 ? 62  PHE C CZ   1 
ATOM   10071 H  H    . PHE C  1 62  ? 25.931  121.794 32.602  1.00 15.91 ? 62  PHE C H    1 
ATOM   10072 H  HA   . PHE C  1 62  ? 26.323  119.260 33.342  1.00 17.47 ? 62  PHE C HA   1 
ATOM   10073 H  HB2  . PHE C  1 62  ? 27.442  121.721 34.211  1.00 14.66 ? 62  PHE C HB2  1 
ATOM   10074 H  HB3  . PHE C  1 62  ? 27.715  120.398 35.038  1.00 14.66 ? 62  PHE C HB3  1 
ATOM   10075 H  HD1  . PHE C  1 62  ? 27.753  119.740 31.644  1.00 10.63 ? 62  PHE C HD1  1 
ATOM   10076 H  HD2  . PHE C  1 62  ? 30.090  121.062 34.622  1.00 19.43 ? 62  PHE C HD2  1 
ATOM   10077 H  HE1  . PHE C  1 62  ? 29.643  119.311 30.386  1.00 16.51 ? 62  PHE C HE1  1 
ATOM   10078 H  HE2  . PHE C  1 62  ? 31.949  120.635 33.372  1.00 13.79 ? 62  PHE C HE2  1 
ATOM   10079 H  HZ   . PHE C  1 62  ? 31.747  119.762 31.257  1.00 17.16 ? 62  PHE C HZ   1 
ATOM   10080 N  N    . LYS C  1 63  ? 24.889  118.953 35.303  1.00 10.16 ? 63  LYS C N    1 
ATOM   10081 C  CA   . LYS C  1 63  ? 24.193  118.774 36.568  1.00 11.53 ? 63  LYS C CA   1 
ATOM   10082 C  C    . LYS C  1 63  ? 25.149  118.134 37.553  1.00 15.50 ? 63  LYS C C    1 
ATOM   10083 O  O    . LYS C  1 63  ? 25.757  117.092 37.264  1.00 9.38  ? 63  LYS C O    1 
ATOM   10084 C  CB   . LYS C  1 63  ? 22.941  117.893 36.423  1.00 15.71 ? 63  LYS C CB   1 
ATOM   10085 C  CG   . LYS C  1 63  ? 21.950  118.094 37.584  1.00 31.70 ? 63  LYS C CG   1 
ATOM   10086 C  CD   . LYS C  1 63  ? 20.683  117.254 37.454  1.00 39.71 ? 63  LYS C CD   1 
ATOM   10087 C  CE   . LYS C  1 63  ? 19.651  117.623 38.534  1.00 48.07 ? 63  LYS C CE   1 
ATOM   10088 N  NZ   . LYS C  1 63  ? 19.106  119.019 38.385  1.00 53.99 ? 63  LYS C NZ   1 
ATOM   10089 H  H    . LYS C  1 63  ? 25.056  118.217 34.891  1.00 12.19 ? 63  LYS C H    1 
ATOM   10090 H  HA   . LYS C  1 63  ? 23.920  119.647 36.919  1.00 13.83 ? 63  LYS C HA   1 
ATOM   10091 H  HB2  . LYS C  1 63  ? 22.487  118.120 35.596  1.00 18.86 ? 63  LYS C HB2  1 
ATOM   10092 H  HB3  . LYS C  1 63  ? 23.208  116.961 36.412  1.00 18.86 ? 63  LYS C HB3  1 
ATOM   10093 H  HG2  . LYS C  1 63  ? 22.387  117.848 38.415  1.00 38.04 ? 63  LYS C HG2  1 
ATOM   10094 H  HG3  . LYS C  1 63  ? 21.687  119.027 37.614  1.00 38.04 ? 63  LYS C HG3  1 
ATOM   10095 H  HD2  . LYS C  1 63  ? 20.283  117.410 36.585  1.00 47.65 ? 63  LYS C HD2  1 
ATOM   10096 H  HD3  . LYS C  1 63  ? 20.909  116.316 37.557  1.00 47.65 ? 63  LYS C HD3  1 
ATOM   10097 H  HE2  . LYS C  1 63  ? 18.905  117.005 38.480  1.00 57.68 ? 63  LYS C HE2  1 
ATOM   10098 H  HE3  . LYS C  1 63  ? 20.071  117.558 39.406  1.00 57.68 ? 63  LYS C HE3  1 
ATOM   10099 H  HZ1  . LYS C  1 63  ? 18.515  119.185 39.030  1.00 64.78 ? 63  LYS C HZ1  1 
ATOM   10100 H  HZ2  . LYS C  1 63  ? 19.768  119.611 38.440  1.00 64.78 ? 63  LYS C HZ2  1 
ATOM   10101 H  HZ3  . LYS C  1 63  ? 18.705  119.106 37.596  1.00 64.78 ? 63  LYS C HZ3  1 
ATOM   10102 N  N    . LEU C  1 64  ? 25.278  118.748 38.730  1.00 14.07 ? 64  LEU C N    1 
ATOM   10103 C  CA   . LEU C  1 64  ? 26.299  118.330 39.687  1.00 13.96 ? 64  LEU C CA   1 
ATOM   10104 C  C    . LEU C  1 64  ? 25.771  117.322 40.717  1.00 11.42 ? 64  LEU C C    1 
ATOM   10105 O  O    . LEU C  1 64  ? 24.699  117.494 41.287  1.00 13.56 ? 64  LEU C O    1 
ATOM   10106 C  CB   . LEU C  1 64  ? 26.890  119.544 40.412  1.00 14.44 ? 64  LEU C CB   1 
ATOM   10107 C  CG   . LEU C  1 64  ? 27.400  120.658 39.502  1.00 17.59 ? 64  LEU C CG   1 
ATOM   10108 C  CD1  . LEU C  1 64  ? 28.056  121.759 40.323  1.00 21.14 ? 64  LEU C CD1  1 
ATOM   10109 C  CD2  . LEU C  1 64  ? 28.343  120.108 38.462  1.00 19.99 ? 64  LEU C CD2  1 
ATOM   10110 H  H    . LEU C  1 64  ? 24.791  119.405 38.995  1.00 16.88 ? 64  LEU C H    1 
ATOM   10111 H  HA   . LEU C  1 64  ? 27.028  117.895 39.196  1.00 16.75 ? 64  LEU C HA   1 
ATOM   10112 H  HB2  . LEU C  1 64  ? 26.205  119.925 40.983  1.00 17.32 ? 64  LEU C HB2  1 
ATOM   10113 H  HB3  . LEU C  1 64  ? 27.636  119.246 40.955  1.00 17.32 ? 64  LEU C HB3  1 
ATOM   10114 H  HG   . LEU C  1 64  ? 26.644  121.048 39.036  1.00 21.11 ? 64  LEU C HG   1 
ATOM   10115 H  HD11 . LEU C  1 64  ? 28.368  122.446 39.730  1.00 25.37 ? 64  LEU C HD11 1 
ATOM   10116 H  HD12 . LEU C  1 64  ? 27.409  122.121 40.933  1.00 25.37 ? 64  LEU C HD12 1 
ATOM   10117 H  HD13 . LEU C  1 64  ? 28.794  121.386 40.810  1.00 25.37 ? 64  LEU C HD13 1 
ATOM   10118 H  HD21 . LEU C  1 64  ? 28.647  120.828 37.905  1.00 23.98 ? 64  LEU C HD21 1 
ATOM   10119 H  HD22 . LEU C  1 64  ? 29.090  119.698 38.905  1.00 23.98 ? 64  LEU C HD22 1 
ATOM   10120 H  HD23 . LEU C  1 64  ? 27.878  119.457 37.932  1.00 23.98 ? 64  LEU C HD23 1 
ATOM   10121 N  N    . PHE C  1 65  ? 26.551  116.275 40.939  1.00 10.17 ? 65  PHE C N    1 
ATOM   10122 C  CA   . PHE C  1 65  ? 26.233  115.230 41.907  1.00 11.44 ? 65  PHE C CA   1 
ATOM   10123 C  C    . PHE C  1 65  ? 27.376  115.023 42.887  1.00 16.75 ? 65  PHE C C    1 
ATOM   10124 O  O    . PHE C  1 65  ? 28.143  114.066 42.763  1.00 11.48 ? 65  PHE C O    1 
ATOM   10125 C  CB   . PHE C  1 65  ? 25.947  113.927 41.169  1.00 10.68 ? 65  PHE C CB   1 
ATOM   10126 C  CG   . PHE C  1 65  ? 24.689  113.971 40.364  1.00 12.47 ? 65  PHE C CG   1 
ATOM   10127 C  CD1  . PHE C  1 65  ? 24.696  114.509 39.084  1.00 9.93  ? 65  PHE C CD1  1 
ATOM   10128 C  CD2  . PHE C  1 65  ? 23.491  113.527 40.906  1.00 11.44 ? 65  PHE C CD2  1 
ATOM   10129 C  CE1  . PHE C  1 65  ? 23.540  114.562 38.334  1.00 15.42 ? 65  PHE C CE1  1 
ATOM   10130 C  CE2  . PHE C  1 65  ? 22.322  113.587 40.184  1.00 10.95 ? 65  PHE C CE2  1 
ATOM   10131 C  CZ   . PHE C  1 65  ? 22.350  114.098 38.865  1.00 13.67 ? 65  PHE C CZ   1 
ATOM   10132 H  H    . PHE C  1 65  ? 27.294  116.141 40.529  1.00 12.21 ? 65  PHE C H    1 
ATOM   10133 H  HA   . PHE C  1 65  ? 25.432  115.484 42.411  1.00 13.73 ? 65  PHE C HA   1 
ATOM   10134 H  HB2  . PHE C  1 65  ? 26.683  113.739 40.565  1.00 12.81 ? 65  PHE C HB2  1 
ATOM   10135 H  HB3  . PHE C  1 65  ? 25.862  113.211 41.818  1.00 12.81 ? 65  PHE C HB3  1 
ATOM   10136 H  HD1  . PHE C  1 65  ? 25.496  114.809 38.717  1.00 11.91 ? 65  PHE C HD1  1 
ATOM   10137 H  HD2  . PHE C  1 65  ? 23.480  113.179 41.769  1.00 13.73 ? 65  PHE C HD2  1 
ATOM   10138 H  HE1  . PHE C  1 65  ? 23.560  114.911 37.472  1.00 18.51 ? 65  PHE C HE1  1 
ATOM   10139 H  HE2  . PHE C  1 65  ? 21.527  113.270 40.548  1.00 13.14 ? 65  PHE C HE2  1 
ATOM   10140 H  HZ   . PHE C  1 65  ? 21.566  114.145 38.366  1.00 16.41 ? 65  PHE C HZ   1 
ATOM   10141 N  N    . PRO C  1 66  ? 27.492  115.931 43.862  1.00 16.00 ? 66  PRO C N    1 
ATOM   10142 C  CA   . PRO C  1 66  ? 28.484  115.838 44.930  1.00 13.05 ? 66  PRO C CA   1 
ATOM   10143 C  C    . PRO C  1 66  ? 28.137  114.689 45.872  1.00 12.20 ? 66  PRO C C    1 
ATOM   10144 O  O    . PRO C  1 66  ? 27.102  114.039 45.683  1.00 13.93 ? 66  PRO C O    1 
ATOM   10145 C  CB   . PRO C  1 66  ? 28.352  117.188 45.644  1.00 12.57 ? 66  PRO C CB   1 
ATOM   10146 C  CG   . PRO C  1 66  ? 26.938  117.619 45.380  1.00 15.33 ? 66  PRO C CG   1 
ATOM   10147 C  CD   . PRO C  1 66  ? 26.626  117.117 44.008  1.00 17.33 ? 66  PRO C CD   1 
ATOM   10148 H  HA   . PRO C  1 66  ? 29.389  115.728 44.570  1.00 15.66 ? 66  PRO C HA   1 
ATOM   10149 H  HB2  . PRO C  1 66  ? 28.505  117.073 46.595  1.00 15.08 ? 66  PRO C HB2  1 
ATOM   10150 H  HB3  . PRO C  1 66  ? 28.981  117.823 45.267  1.00 15.08 ? 66  PRO C HB3  1 
ATOM   10151 H  HG2  . PRO C  1 66  ? 26.346  117.217 46.035  1.00 18.39 ? 66  PRO C HG2  1 
ATOM   10152 H  HG3  . PRO C  1 66  ? 26.880  118.587 45.413  1.00 18.39 ? 66  PRO C HG3  1 
ATOM   10153 H  HD2  . PRO C  1 66  ? 25.692  116.863 43.947  1.00 20.79 ? 66  PRO C HD2  1 
ATOM   10154 H  HD3  . PRO C  1 66  ? 26.855  117.786 43.344  1.00 20.79 ? 66  PRO C HD3  1 
ATOM   10155 N  N    . SER C  1 67  ? 29.004  114.441 46.843  1.00 10.46 ? 67  SER C N    1 
ATOM   10156 C  CA   . SER C  1 67  ? 28.674  113.562 47.964  1.00 7.61  ? 67  SER C CA   1 
ATOM   10157 C  C    . SER C  1 67  ? 28.347  112.143 47.495  1.00 15.20 ? 67  SER C C    1 
ATOM   10158 O  O    . SER C  1 67  ? 27.536  111.457 48.113  1.00 11.86 ? 67  SER C O    1 
ATOM   10159 C  CB   . SER C  1 67  ? 27.489  114.138 48.752  1.00 12.36 ? 67  SER C CB   1 
ATOM   10160 O  OG   . SER C  1 67  ? 27.689  115.515 49.067  1.00 17.60 ? 67  SER C OG   1 
ATOM   10161 H  H    . SER C  1 67  ? 29.797  114.770 46.880  1.00 12.56 ? 67  SER C H    1 
ATOM   10162 H  HA   . SER C  1 67  ? 29.444  113.511 48.568  1.00 9.13  ? 67  SER C HA   1 
ATOM   10163 H  HB2  . SER C  1 67  ? 26.685  114.053 48.216  1.00 14.84 ? 67  SER C HB2  1 
ATOM   10164 H  HB3  . SER C  1 67  ? 27.389  113.639 49.578  1.00 14.84 ? 67  SER C HB3  1 
ATOM   10165 H  HG   . SER C  1 67  ? 27.046  115.803 49.487  1.00 21.12 ? 67  SER C HG   1 
ATOM   10166 N  N    . SER C  1 68  ? 28.966  111.717 46.396  1.00 8.40  ? 68  SER C N    1 
ATOM   10167 C  CA   . SER C  1 68  ? 28.750  110.384 45.844  1.00 8.31  ? 68  SER C CA   1 
ATOM   10168 C  C    . SER C  1 68  ? 27.279  110.098 45.553  1.00 9.73  ? 68  SER C C    1 
ATOM   10169 O  O    . SER C  1 68  ? 26.851  108.949 45.596  1.00 15.82 ? 68  SER C O    1 
ATOM   10170 C  CB   . SER C  1 68  ? 29.264  109.302 46.790  1.00 8.99  ? 68  SER C CB   1 
ATOM   10171 O  OG   . SER C  1 68  ? 30.643  109.450 47.108  1.00 13.03 ? 68  SER C OG   1 
ATOM   10172 H  H    . SER C  1 68  ? 29.524  112.191 45.946  1.00 10.07 ? 68  SER C H    1 
ATOM   10173 H  HA   . SER C  1 68  ? 29.245  110.306 45.002  1.00 9.97  ? 68  SER C HA   1 
ATOM   10174 H  HB2  . SER C  1 68  ? 28.751  109.343 47.613  1.00 10.79 ? 68  SER C HB2  1 
ATOM   10175 H  HB3  . SER C  1 68  ? 29.135  108.437 46.370  1.00 10.79 ? 68  SER C HB3  1 
ATOM   10176 H  HG   . SER C  1 68  ? 30.950  110.106 46.725  1.00 15.64 ? 68  SER C HG   1 
ATOM   10177 N  N    . GLN C  1 69  ? 26.496  111.116 45.248  1.00 9.41  ? 69  GLN C N    1 
ATOM   10178 C  CA   . GLN C  1 69  ? 25.077  110.877 44.983  1.00 13.58 ? 69  GLN C CA   1 
ATOM   10179 C  C    . GLN C  1 69  ? 24.824  109.832 43.896  1.00 18.20 ? 69  GLN C C    1 
ATOM   10180 O  O    . GLN C  1 69  ? 23.867  109.074 43.993  1.00 15.18 ? 69  GLN C O    1 
ATOM   10181 C  CB   . GLN C  1 69  ? 24.376  112.171 44.626  1.00 22.21 ? 69  GLN C CB   1 
ATOM   10182 C  CG   . GLN C  1 69  ? 24.125  113.063 45.832  1.00 24.03 ? 69  GLN C CG   1 
ATOM   10183 C  CD   . GLN C  1 69  ? 23.482  114.375 45.444  1.00 33.75 ? 69  GLN C CD   1 
ATOM   10184 O  OE1  . GLN C  1 69  ? 23.029  114.542 44.320  1.00 39.94 ? 69  GLN C OE1  1 
ATOM   10185 N  NE2  . GLN C  1 69  ? 23.447  115.311 46.367  1.00 36.45 ? 69  GLN C NE2  1 
ATOM   10186 H  H    . GLN C  1 69  ? 26.745  111.937 45.187  1.00 11.29 ? 69  GLN C H    1 
ATOM   10187 H  HA   . GLN C  1 69  ? 24.665  110.542 45.807  1.00 16.30 ? 69  GLN C HA   1 
ATOM   10188 H  HB2  . GLN C  1 69  ? 24.927  112.665 43.998  1.00 26.65 ? 69  GLN C HB2  1 
ATOM   10189 H  HB3  . GLN C  1 69  ? 23.518  111.965 44.222  1.00 26.65 ? 69  GLN C HB3  1 
ATOM   10190 H  HG2  . GLN C  1 69  ? 23.531  112.606 46.448  1.00 28.84 ? 69  GLN C HG2  1 
ATOM   10191 H  HG3  . GLN C  1 69  ? 24.971  113.257 46.266  1.00 28.84 ? 69  GLN C HG3  1 
ATOM   10192 H  HE21 . GLN C  1 69  ? 23.780  115.160 47.146  1.00 43.74 ? 69  GLN C HE21 1 
ATOM   10193 H  HE22 . GLN C  1 69  ? 23.091  116.074 46.193  1.00 43.74 ? 69  GLN C HE22 1 
ATOM   10194 N  N    . LEU C  1 70  ? 25.670  109.803 42.857  1.00 16.14 ? 70  LEU C N    1 
ATOM   10195 C  CA   . LEU C  1 70  ? 25.456  108.901 41.727  1.00 19.56 ? 70  LEU C CA   1 
ATOM   10196 C  C    . LEU C  1 70  ? 25.945  107.473 41.994  1.00 12.79 ? 70  LEU C C    1 
ATOM   10197 O  O    . LEU C  1 70  ? 25.656  106.561 41.230  1.00 23.28 ? 70  LEU C O    1 
ATOM   10198 C  CB   . LEU C  1 70  ? 26.132  109.446 40.458  1.00 17.03 ? 70  LEU C CB   1 
ATOM   10199 C  CG   . LEU C  1 70  ? 25.426  110.545 39.669  1.00 25.71 ? 70  LEU C CG   1 
ATOM   10200 C  CD1  . LEU C  1 70  ? 26.096  110.748 38.294  1.00 21.76 ? 70  LEU C CD1  1 
ATOM   10201 C  CD2  . LEU C  1 70  ? 23.954  110.236 39.486  1.00 27.80 ? 70  LEU C CD2  1 
ATOM   10202 H  H    . LEU C  1 70  ? 26.372  110.294 42.787  1.00 19.37 ? 70  LEU C H    1 
ATOM   10203 H  HA   . LEU C  1 70  ? 24.494  108.853 41.549  1.00 23.48 ? 70  LEU C HA   1 
ATOM   10204 H  HB2  . LEU C  1 70  ? 26.999  109.797 40.713  1.00 20.44 ? 70  LEU C HB2  1 
ATOM   10205 H  HB3  . LEU C  1 70  ? 26.260  108.702 39.848  1.00 20.44 ? 70  LEU C HB3  1 
ATOM   10206 H  HG   . LEU C  1 70  ? 25.496  111.379 40.161  1.00 30.85 ? 70  LEU C HG   1 
ATOM   10207 H  HD11 . LEU C  1 70  ? 25.632  111.443 37.821  1.00 26.11 ? 70  LEU C HD11 1 
ATOM   10208 H  HD12 . LEU C  1 70  ? 27.013  110.998 38.427  1.00 26.11 ? 70  LEU C HD12 1 
ATOM   10209 H  HD13 . LEU C  1 70  ? 26.048  109.927 37.799  1.00 26.11 ? 70  LEU C HD13 1 
ATOM   10210 H  HD21 . LEU C  1 70  ? 23.545  110.948 38.988  1.00 33.35 ? 70  LEU C HD21 1 
ATOM   10211 H  HD22 . LEU C  1 70  ? 23.865  109.408 39.009  1.00 33.35 ? 70  LEU C HD22 1 
ATOM   10212 H  HD23 . LEU C  1 70  ? 23.541  110.162 40.350  1.00 33.35 ? 70  LEU C HD23 1 
ATOM   10213 N  N    . GLY C  1 71  ? 26.687  107.279 43.084  1.00 13.37 ? 71  GLY C N    1 
ATOM   10214 C  CA   . GLY C  1 71  ? 27.262  105.987 43.373  1.00 16.27 ? 71  GLY C CA   1 
ATOM   10215 C  C    . GLY C  1 71  ? 28.668  106.187 43.837  1.00 16.55 ? 71  GLY C C    1 
ATOM   10216 O  O    . GLY C  1 71  ? 29.167  107.313 43.897  1.00 15.52 ? 71  GLY C O    1 
ATOM   10217 H  H    . GLY C  1 71  ? 26.868  107.885 43.666  1.00 16.04 ? 71  GLY C H    1 
ATOM   10218 H  HA2  . GLY C  1 71  ? 26.755  105.542 44.069  1.00 19.52 ? 71  GLY C HA2  1 
ATOM   10219 H  HA3  . GLY C  1 71  ? 27.264  105.435 42.575  1.00 19.52 ? 71  GLY C HA3  1 
ATOM   10220 N  N    . SER C  1 72  ? 29.336  105.104 44.164  1.00 15.25 ? 72  SER C N    1 
ATOM   10221 C  CA   . SER C  1 72  ? 30.738  105.227 44.516  1.00 14.46 ? 72  SER C CA   1 
ATOM   10222 C  C    . SER C  1 72  ? 31.531  105.614 43.270  1.00 14.21 ? 72  SER C C    1 
ATOM   10223 O  O    . SER C  1 72  ? 31.054  105.475 42.140  1.00 15.46 ? 72  SER C O    1 
ATOM   10224 C  CB   . SER C  1 72  ? 31.267  103.923 45.086  1.00 16.76 ? 72  SER C CB   1 
ATOM   10225 O  OG   . SER C  1 72  ? 31.463  102.981 44.058  1.00 18.60 ? 72  SER C OG   1 
ATOM   10226 H  H    . SER C  1 72  ? 29.017  104.306 44.191  1.00 18.30 ? 72  SER C H    1 
ATOM   10227 H  HA   . SER C  1 72  ? 30.848  105.931 45.189  1.00 17.36 ? 72  SER C HA   1 
ATOM   10228 H  HB2  . SER C  1 72  ? 32.114  104.091 45.528  1.00 20.11 ? 72  SER C HB2  1 
ATOM   10229 H  HB3  . SER C  1 72  ? 30.624  103.570 45.721  1.00 20.11 ? 72  SER C HB3  1 
ATOM   10230 H  HG   . SER C  1 72  ? 31.748  102.279 44.371  1.00 22.32 ? 72  SER C HG   1 
ATOM   10231 N  N    . GLU C  1 73  ? 32.759  106.069 43.491  1.00 12.84 ? 73  GLU C N    1 
ATOM   10232 C  CA   . GLU C  1 73  ? 33.621  106.536 42.429  1.00 13.89 ? 73  GLU C CA   1 
ATOM   10233 C  C    . GLU C  1 73  ? 33.838  105.396 41.437  1.00 13.82 ? 73  GLU C C    1 
ATOM   10234 O  O    . GLU C  1 73  ? 33.872  105.604 40.204  1.00 12.71 ? 73  GLU C O    1 
ATOM   10235 C  CB   . GLU C  1 73  ? 34.948  107.027 43.032  1.00 14.67 ? 73  GLU C CB   1 
ATOM   10236 C  CG   . GLU C  1 73  ? 35.831  107.832 42.055  1.00 7.30  ? 73  GLU C CG   1 
ATOM   10237 C  CD   . GLU C  1 73  ? 36.935  108.593 42.753  1.00 11.11 ? 73  GLU C CD   1 
ATOM   10238 O  OE1  . GLU C  1 73  ? 36.667  109.194 43.840  1.00 9.03  ? 73  GLU C OE1  1 
ATOM   10239 O  OE2  . GLU C  1 73  ? 38.093  108.545 42.269  1.00 7.54  ? 73  GLU C OE2  1 
ATOM   10240 H  H    . GLU C  1 73  ? 33.118  106.116 44.271  1.00 15.41 ? 73  GLU C H    1 
ATOM   10241 H  HA   . GLU C  1 73  ? 33.193  107.283 41.961  1.00 16.66 ? 73  GLU C HA   1 
ATOM   10242 H  HB2  . GLU C  1 73  ? 34.752  107.598 43.791  1.00 17.61 ? 73  GLU C HB2  1 
ATOM   10243 H  HB3  . GLU C  1 73  ? 35.459  106.257 43.326  1.00 17.61 ? 73  GLU C HB3  1 
ATOM   10244 H  HG2  . GLU C  1 73  ? 36.241  107.221 41.423  1.00 8.76  ? 73  GLU C HG2  1 
ATOM   10245 H  HG3  . GLU C  1 73  ? 35.276  108.474 41.584  1.00 8.76  ? 73  GLU C HG3  1 
ATOM   10246 N  N    . THR C  1 74  ? 33.972  104.189 41.977  1.00 11.61 ? 74  THR C N    1 
ATOM   10247 C  CA   . THR C  1 74  ? 34.235  102.999 41.171  1.00 14.84 ? 74  THR C CA   1 
ATOM   10248 C  C    . THR C  1 74  ? 32.981  102.589 40.405  1.00 15.29 ? 74  THR C C    1 
ATOM   10249 O  O    . THR C  1 74  ? 33.049  102.293 39.207  1.00 15.95 ? 74  THR C O    1 
ATOM   10250 C  CB   . THR C  1 74  ? 34.734  101.827 42.040  1.00 18.14 ? 74  THR C CB   1 
ATOM   10251 O  OG1  . THR C  1 74  ? 36.036  102.141 42.541  1.00 22.76 ? 74  THR C OG1  1 
ATOM   10252 C  CG2  . THR C  1 74  ? 34.836  100.531 41.217  1.00 18.59 ? 74  THR C CG2  1 
ATOM   10253 H  H    . THR C  1 74  ? 33.913  104.031 42.820  1.00 13.93 ? 74  THR C H    1 
ATOM   10254 H  HA   . THR C  1 74  ? 34.934  103.207 40.516  1.00 17.80 ? 74  THR C HA   1 
ATOM   10255 H  HB   . THR C  1 74  ? 34.123  101.682 42.780  1.00 21.77 ? 74  THR C HB   1 
ATOM   10256 H  HG1  . THR C  1 74  ? 36.555  102.259 41.917  1.00 27.31 ? 74  THR C HG1  1 
ATOM   10257 H  HG21 . THR C  1 74  ? 35.147  99.814  41.773  1.00 22.30 ? 74  THR C HG21 1 
ATOM   10258 H  HG22 . THR C  1 74  ? 33.974  100.300 40.863  1.00 22.30 ? 74  THR C HG22 1 
ATOM   10259 H  HG23 . THR C  1 74  ? 35.450  100.652 40.490  1.00 22.30 ? 74  THR C HG23 1 
ATOM   10260 N  N    . GLU C  1 75  ? 31.836  102.592 41.075  1.00 19.47 ? 75  GLU C N    1 
ATOM   10261 C  CA   . GLU C  1 75  ? 30.573  102.275 40.403  1.00 17.94 ? 75  GLU C CA   1 
ATOM   10262 C  C    . GLU C  1 75  ? 30.306  103.235 39.246  1.00 15.27 ? 75  GLU C C    1 
ATOM   10263 O  O    . GLU C  1 75  ? 29.837  102.839 38.191  1.00 11.97 ? 75  GLU C O    1 
ATOM   10264 C  CB   . GLU C  1 75  ? 29.397  102.331 41.382  1.00 24.94 ? 75  GLU C CB   1 
ATOM   10265 C  CG   . GLU C  1 75  ? 29.263  101.103 42.259  1.00 26.26 ? 75  GLU C CG   1 
ATOM   10266 C  CD   . GLU C  1 75  ? 28.632  101.400 43.604  1.00 26.04 ? 75  GLU C CD   1 
ATOM   10267 O  OE1  . GLU C  1 75  ? 28.096  102.522 43.811  1.00 19.44 ? 75  GLU C OE1  1 
ATOM   10268 O  OE2  . GLU C  1 75  ? 28.674  100.491 44.470  1.00 30.74 ? 75  GLU C OE2  1 
ATOM   10269 H  H    . GLU C  1 75  ? 31.759  102.771 41.912  1.00 23.36 ? 75  GLU C H    1 
ATOM   10270 H  HA   . GLU C  1 75  ? 30.623  101.366 40.039  1.00 21.53 ? 75  GLU C HA   1 
ATOM   10271 H  HB2  . GLU C  1 75  ? 29.513  103.098 41.964  1.00 29.93 ? 75  GLU C HB2  1 
ATOM   10272 H  HB3  . GLU C  1 75  ? 28.575  102.425 40.876  1.00 29.93 ? 75  GLU C HB3  1 
ATOM   10273 H  HG2  . GLU C  1 75  ? 28.706  100.452 41.805  1.00 31.51 ? 75  GLU C HG2  1 
ATOM   10274 H  HG3  . GLU C  1 75  ? 30.144  100.732 42.417  1.00 31.51 ? 75  GLU C HG3  1 
ATOM   10275 N  N    . VAL C  1 76  ? 30.580  104.513 39.457  1.00 11.37 ? 76  VAL C N    1 
ATOM   10276 C  CA   . VAL C  1 76  ? 30.246  105.515 38.474  1.00 13.14 ? 76  VAL C CA   1 
ATOM   10277 C  C    . VAL C  1 76  ? 31.149  105.404 37.228  1.00 11.52 ? 76  VAL C C    1 
ATOM   10278 O  O    . VAL C  1 76  ? 30.696  105.634 36.110  1.00 15.83 ? 76  VAL C O    1 
ATOM   10279 C  CB   . VAL C  1 76  ? 30.321  106.932 39.103  1.00 15.10 ? 76  VAL C CB   1 
ATOM   10280 C  CG1  . VAL C  1 76  ? 30.290  107.995 38.025  1.00 15.79 ? 76  VAL C CG1  1 
ATOM   10281 C  CG2  . VAL C  1 76  ? 29.169  107.128 40.112  1.00 10.09 ? 76  VAL C CG2  1 
ATOM   10282 H  H    . VAL C  1 76  ? 30.960  104.822 40.164  1.00 13.64 ? 76  VAL C H    1 
ATOM   10283 H  HA   . VAL C  1 76  ? 29.321  105.369 38.183  1.00 15.77 ? 76  VAL C HA   1 
ATOM   10284 H  HB   . VAL C  1 76  ? 31.167  107.020 39.590  1.00 18.12 ? 76  VAL C HB   1 
ATOM   10285 H  HG11 . VAL C  1 76  ? 30.338  108.860 38.437  1.00 18.95 ? 76  VAL C HG11 1 
ATOM   10286 H  HG12 . VAL C  1 76  ? 31.042  107.868 37.440  1.00 18.95 ? 76  VAL C HG12 1 
ATOM   10287 H  HG13 . VAL C  1 76  ? 29.472  107.912 37.529  1.00 18.95 ? 76  VAL C HG13 1 
ATOM   10288 H  HG21 . VAL C  1 76  ? 29.231  108.008 40.490  1.00 12.11 ? 76  VAL C HG21 1 
ATOM   10289 H  HG22 . VAL C  1 76  ? 28.332  107.027 39.652  1.00 12.11 ? 76  VAL C HG22 1 
ATOM   10290 H  HG23 . VAL C  1 76  ? 29.244  106.467 40.804  1.00 12.11 ? 76  VAL C HG23 1 
ATOM   10291 N  N    . LEU C  1 77  ? 32.429  105.091 37.411  1.00 7.96  ? 77  LEU C N    1 
ATOM   10292 C  CA   . LEU C  1 77  ? 33.299  104.906 36.251  1.00 13.05 ? 77  LEU C CA   1 
ATOM   10293 C  C    . LEU C  1 77  ? 32.735  103.806 35.371  1.00 19.29 ? 77  LEU C C    1 
ATOM   10294 O  O    . LEU C  1 77  ? 32.740  103.927 34.158  1.00 19.90 ? 77  LEU C O    1 
ATOM   10295 C  CB   . LEU C  1 77  ? 34.726  104.560 36.640  1.00 11.70 ? 77  LEU C CB   1 
ATOM   10296 C  CG   . LEU C  1 77  ? 35.692  104.509 35.458  1.00 15.06 ? 77  LEU C CG   1 
ATOM   10297 C  CD1  . LEU C  1 77  ? 35.885  105.907 34.840  1.00 19.68 ? 77  LEU C CD1  1 
ATOM   10298 C  CD2  . LEU C  1 77  ? 37.003  103.955 35.898  1.00 17.40 ? 77  LEU C CD2  1 
ATOM   10299 H  H    . LEU C  1 77  ? 32.811  104.983 38.173  1.00 9.55  ? 77  LEU C H    1 
ATOM   10300 H  HA   . LEU C  1 77  ? 33.318  105.735 35.728  1.00 15.66 ? 77  LEU C HA   1 
ATOM   10301 H  HB2  . LEU C  1 77  ? 35.052  105.230 37.261  1.00 14.04 ? 77  LEU C HB2  1 
ATOM   10302 H  HB3  . LEU C  1 77  ? 34.731  103.688 37.065  1.00 14.04 ? 77  LEU C HB3  1 
ATOM   10303 H  HG   . LEU C  1 77  ? 35.329  103.924 34.775  1.00 18.08 ? 77  LEU C HG   1 
ATOM   10304 H  HD11 . LEU C  1 77  ? 36.495  105.841 34.102  1.00 23.62 ? 77  LEU C HD11 1 
ATOM   10305 H  HD12 . LEU C  1 77  ? 35.035  106.234 34.534  1.00 23.62 ? 77  LEU C HD12 1 
ATOM   10306 H  HD13 . LEU C  1 77  ? 36.241  106.497 35.508  1.00 23.62 ? 77  LEU C HD13 1 
ATOM   10307 H  HD21 . LEU C  1 77  ? 37.599  103.929 35.146  1.00 20.88 ? 77  LEU C HD21 1 
ATOM   10308 H  HD22 . LEU C  1 77  ? 37.365  104.520 36.585  1.00 20.88 ? 77  LEU C HD22 1 
ATOM   10309 H  HD23 . LEU C  1 77  ? 36.868  103.068 36.240  1.00 20.88 ? 77  LEU C HD23 1 
ATOM   10310 N  N    . GLU C  1 78  ? 32.250  102.729 35.982  1.00 18.34 ? 78  GLU C N    1 
ATOM   10311 C  CA   . GLU C  1 78  ? 31.639  101.660 35.204  1.00 15.70 ? 78  GLU C CA   1 
ATOM   10312 C  C    . GLU C  1 78  ? 30.430  102.170 34.444  1.00 13.12 ? 78  GLU C C    1 
ATOM   10313 O  O    . GLU C  1 78  ? 30.218  101.794 33.312  1.00 16.30 ? 78  GLU C O    1 
ATOM   10314 C  CB   . GLU C  1 78  ? 31.230  100.481 36.101  1.00 17.24 ? 78  GLU C CB   1 
ATOM   10315 C  CG   . GLU C  1 78  ? 32.413  99.678  36.575  1.00 29.87 ? 78  GLU C CG   1 
ATOM   10316 C  CD   . GLU C  1 78  ? 33.242  99.158  35.421  1.00 39.43 ? 78  GLU C CD   1 
ATOM   10317 O  OE1  . GLU C  1 78  ? 32.683  98.435  34.568  1.00 44.57 ? 78  GLU C OE1  1 
ATOM   10318 O  OE2  . GLU C  1 78  ? 34.446  99.490  35.360  1.00 42.83 ? 78  GLU C OE2  1 
ATOM   10319 H  H    . GLU C  1 78  ? 32.261  102.595 36.831  1.00 22.01 ? 78  GLU C H    1 
ATOM   10320 H  HA   . GLU C  1 78  ? 32.291  101.330 34.550  1.00 18.84 ? 78  GLU C HA   1 
ATOM   10321 H  HB2  . GLU C  1 78  ? 30.767  100.823 36.882  1.00 20.69 ? 78  GLU C HB2  1 
ATOM   10322 H  HB3  . GLU C  1 78  ? 30.647  99.890  35.601  1.00 20.69 ? 78  GLU C HB3  1 
ATOM   10323 H  HG2  . GLU C  1 78  ? 32.980  100.241 37.126  1.00 35.84 ? 78  GLU C HG2  1 
ATOM   10324 H  HG3  . GLU C  1 78  ? 32.097  98.918  37.088  1.00 35.84 ? 78  GLU C HG3  1 
ATOM   10325 N  N    . GLN C  1 79  ? 29.638  103.030 35.059  1.00 17.36 ? 79  GLN C N    1 
ATOM   10326 C  CA   . GLN C  1 79  ? 28.511  103.608 34.352  1.00 20.82 ? 79  GLN C CA   1 
ATOM   10327 C  C    . GLN C  1 79  ? 28.994  104.418 33.137  1.00 20.08 ? 79  GLN C C    1 
ATOM   10328 O  O    . GLN C  1 79  ? 28.433  104.318 32.043  1.00 17.22 ? 79  GLN C O    1 
ATOM   10329 C  CB   . GLN C  1 79  ? 27.690  104.489 35.299  1.00 23.16 ? 79  GLN C CB   1 
ATOM   10330 C  CG   . GLN C  1 79  ? 26.600  103.745 36.056  1.00 30.12 ? 79  GLN C CG   1 
ATOM   10331 C  CD   . GLN C  1 79  ? 26.235  104.413 37.379  1.00 42.36 ? 79  GLN C CD   1 
ATOM   10332 O  OE1  . GLN C  1 79  ? 26.170  103.750 38.415  1.00 45.25 ? 79  GLN C OE1  1 
ATOM   10333 N  NE2  . GLN C  1 79  ? 26.000  105.720 37.352  1.00 48.42 ? 79  GLN C NE2  1 
ATOM   10334 H  H    . GLN C  1 79  ? 29.729  103.293 35.873  1.00 20.83 ? 79  GLN C H    1 
ATOM   10335 H  HA   . GLN C  1 79  ? 27.933  102.887 34.027  1.00 24.98 ? 79  GLN C HA   1 
ATOM   10336 H  HB2  . GLN C  1 79  ? 28.287  104.884 35.953  1.00 27.79 ? 79  GLN C HB2  1 
ATOM   10337 H  HB3  . GLN C  1 79  ? 27.263  105.189 34.780  1.00 27.79 ? 79  GLN C HB3  1 
ATOM   10338 H  HG2  . GLN C  1 79  ? 25.801  103.710 35.507  1.00 36.15 ? 79  GLN C HG2  1 
ATOM   10339 H  HG3  . GLN C  1 79  ? 26.909  102.846 36.250  1.00 36.15 ? 79  GLN C HG3  1 
ATOM   10340 H  HE21 . GLN C  1 79  ? 26.057  106.153 36.611  1.00 58.10 ? 79  GLN C HE21 1 
ATOM   10341 H  HE22 . GLN C  1 79  ? 25.791  106.134 38.076  1.00 58.10 ? 79  GLN C HE22 1 
ATOM   10342 N  N    . ALA C  1 80  ? 30.032  105.227 33.334  1.00 14.32 ? 80  ALA C N    1 
ATOM   10343 C  CA   . ALA C  1 80  ? 30.504  106.108 32.262  1.00 14.30 ? 80  ALA C CA   1 
ATOM   10344 C  C    . ALA C  1 80  ? 31.097  105.268 31.132  1.00 14.54 ? 80  ALA C C    1 
ATOM   10345 O  O    . ALA C  1 80  ? 30.919  105.583 29.945  1.00 16.32 ? 80  ALA C O    1 
ATOM   10346 C  CB   . ALA C  1 80  ? 31.531  107.087 32.786  1.00 17.80 ? 80  ALA C CB   1 
ATOM   10347 H  H    . ALA C  1 80  ? 30.476  105.286 34.068  1.00 17.18 ? 80  ALA C H    1 
ATOM   10348 H  HA   . ALA C  1 80  ? 29.747  106.617 31.903  1.00 17.16 ? 80  ALA C HA   1 
ATOM   10349 H  HB1  . ALA C  1 80  ? 31.822  107.650 32.064  1.00 21.36 ? 80  ALA C HB1  1 
ATOM   10350 H  HB2  . ALA C  1 80  ? 31.131  107.620 33.476  1.00 21.36 ? 80  ALA C HB2  1 
ATOM   10351 H  HB3  . ALA C  1 80  ? 32.277  106.597 33.140  1.00 21.36 ? 80  ALA C HB3  1 
ATOM   10352 N  N    . LYS C  1 81  ? 31.814  104.210 31.509  1.00 14.18 ? 81  LYS C N    1 
ATOM   10353 C  CA   . LYS C  1 81  ? 32.477  103.336 30.554  1.00 18.29 ? 81  LYS C CA   1 
ATOM   10354 C  C    . LYS C  1 81  ? 31.432  102.730 29.625  1.00 22.44 ? 81  LYS C C    1 
ATOM   10355 O  O    . LYS C  1 81  ? 31.685  102.509 28.434  1.00 23.31 ? 81  LYS C O    1 
ATOM   10356 C  CB   . LYS C  1 81  ? 33.236  102.239 31.301  1.00 20.93 ? 81  LYS C CB   1 
ATOM   10357 C  CG   . LYS C  1 81  ? 34.099  101.349 30.432  1.00 26.72 ? 81  LYS C CG   1 
ATOM   10358 C  CD   . LYS C  1 81  ? 34.761  100.235 31.252  1.00 38.36 ? 81  LYS C CD   1 
ATOM   10359 C  CE   . LYS C  1 81  ? 36.027  100.727 31.940  1.00 41.36 ? 81  LYS C CE   1 
ATOM   10360 N  NZ   . LYS C  1 81  ? 36.641  99.694  32.831  1.00 43.02 ? 81  LYS C NZ   1 
ATOM   10361 H  H    . LYS C  1 81  ? 31.931  103.976 32.329  1.00 17.01 ? 81  LYS C H    1 
ATOM   10362 H  HA   . LYS C  1 81  ? 33.115  103.853 30.019  1.00 21.94 ? 81  LYS C HA   1 
ATOM   10363 H  HB2  . LYS C  1 81  ? 33.815  102.656 31.958  1.00 25.12 ? 81  LYS C HB2  1 
ATOM   10364 H  HB3  . LYS C  1 81  ? 32.591  101.670 31.751  1.00 25.12 ? 81  LYS C HB3  1 
ATOM   10365 H  HG2  . LYS C  1 81  ? 33.547  100.937 29.749  1.00 32.06 ? 81  LYS C HG2  1 
ATOM   10366 H  HG3  . LYS C  1 81  ? 34.798  101.882 30.023  1.00 32.06 ? 81  LYS C HG3  1 
ATOM   10367 H  HD2  . LYS C  1 81  ? 34.143  99.929  31.935  1.00 46.03 ? 81  LYS C HD2  1 
ATOM   10368 H  HD3  . LYS C  1 81  ? 35.000  99.502  30.663  1.00 46.03 ? 81  LYS C HD3  1 
ATOM   10369 H  HE2  . LYS C  1 81  ? 36.681  100.968 31.264  1.00 49.64 ? 81  LYS C HE2  1 
ATOM   10370 H  HE3  . LYS C  1 81  ? 35.811  101.502 32.483  1.00 49.64 ? 81  LYS C HE3  1 
ATOM   10371 H  HZ1  . LYS C  1 81  ? 37.376  100.020 33.212  1.00 51.63 ? 81  LYS C HZ1  1 
ATOM   10372 H  HZ2  . LYS C  1 81  ? 36.064  99.460  33.467  1.00 51.63 ? 81  LYS C HZ2  1 
ATOM   10373 H  HZ3  . LYS C  1 81  ? 36.857  98.973  32.356  1.00 51.63 ? 81  LYS C HZ3  1 
ATOM   10374 N  N    . PHE C  1 82  ? 30.240  102.498 30.156  1.00 21.52 ? 82  PHE C N    1 
ATOM   10375 C  CA   . PHE C  1 82  ? 29.210  101.879 29.346  1.00 28.80 ? 82  PHE C CA   1 
ATOM   10376 C  C    . PHE C  1 82  ? 28.348  102.874 28.570  1.00 29.13 ? 82  PHE C C    1 
ATOM   10377 O  O    . PHE C  1 82  ? 27.420  102.476 27.860  1.00 25.64 ? 82  PHE C O    1 
ATOM   10378 C  CB   . PHE C  1 82  ? 28.399  100.885 30.176  1.00 31.47 ? 82  PHE C CB   1 
ATOM   10379 C  CG   . PHE C  1 82  ? 29.091  99.562  30.320  1.00 44.57 ? 82  PHE C CG   1 
ATOM   10380 C  CD1  . PHE C  1 82  ? 28.948  98.587  29.345  1.00 45.85 ? 82  PHE C CD1  1 
ATOM   10381 C  CD2  . PHE C  1 82  ? 29.932  99.311  31.398  1.00 51.00 ? 82  PHE C CD2  1 
ATOM   10382 C  CE1  . PHE C  1 82  ? 29.607  97.374  29.458  1.00 50.69 ? 82  PHE C CE1  1 
ATOM   10383 C  CE2  . PHE C  1 82  ? 30.589  98.103  31.521  1.00 51.11 ? 82  PHE C CE2  1 
ATOM   10384 C  CZ   . PHE C  1 82  ? 30.429  97.132  30.546  1.00 51.32 ? 82  PHE C CZ   1 
ATOM   10385 H  H    . PHE C  1 82  ? 30.008  102.685 30.963  1.00 25.82 ? 82  PHE C H    1 
ATOM   10386 H  HA   . PHE C  1 82  ? 29.670  101.343 28.667  1.00 34.56 ? 82  PHE C HA   1 
ATOM   10387 H  HB2  . PHE C  1 82  ? 28.261  101.252 31.064  1.00 37.77 ? 82  PHE C HB2  1 
ATOM   10388 H  HB3  . PHE C  1 82  ? 27.544  100.733 29.742  1.00 37.77 ? 82  PHE C HB3  1 
ATOM   10389 H  HD1  . PHE C  1 82  ? 28.398  98.746  28.613  1.00 55.01 ? 82  PHE C HD1  1 
ATOM   10390 H  HD2  . PHE C  1 82  ? 30.042  99.961  32.054  1.00 61.20 ? 82  PHE C HD2  1 
ATOM   10391 H  HE1  . PHE C  1 82  ? 29.496  96.722  28.804  1.00 60.82 ? 82  PHE C HE1  1 
ATOM   10392 H  HE2  . PHE C  1 82  ? 31.141  97.944  32.252  1.00 61.34 ? 82  PHE C HE2  1 
ATOM   10393 H  HZ   . PHE C  1 82  ? 30.868  96.316  30.625  1.00 61.58 ? 82  PHE C HZ   1 
ATOM   10394 N  N    . GLY C  1 83  ? 28.681  104.164 28.663  1.00 18.26 ? 83  GLY C N    1 
ATOM   10395 C  CA   . GLY C  1 83  ? 28.132  105.129 27.728  1.00 21.72 ? 83  GLY C CA   1 
ATOM   10396 C  C    . GLY C  1 83  ? 27.220  106.168 28.335  1.00 19.00 ? 83  GLY C C    1 
ATOM   10397 O  O    . GLY C  1 83  ? 26.653  106.987 27.605  1.00 17.86 ? 83  GLY C O    1 
ATOM   10398 H  H    . GLY C  1 83  ? 29.215  104.496 29.250  1.00 21.91 ? 83  GLY C H    1 
ATOM   10399 H  HA2  . GLY C  1 83  ? 28.863  105.594 27.292  1.00 26.06 ? 83  GLY C HA2  1 
ATOM   10400 H  HA3  . GLY C  1 83  ? 27.631  104.654 27.047  1.00 26.06 ? 83  GLY C HA3  1 
ATOM   10401 N  N    . ALA C  1 84  ? 27.066  106.138 29.654  1.00 19.77 ? 84  ALA C N    1 
ATOM   10402 C  CA   . ALA C  1 84  ? 26.217  107.095 30.330  1.00 17.48 ? 84  ALA C CA   1 
ATOM   10403 C  C    . ALA C  1 84  ? 26.758  108.505 30.105  1.00 15.75 ? 84  ALA C C    1 
ATOM   10404 O  O    . ALA C  1 84  ? 27.970  108.690 29.864  1.00 12.70 ? 84  ALA C O    1 
ATOM   10405 C  CB   . ALA C  1 84  ? 26.140  106.786 31.835  1.00 19.30 ? 84  ALA C CB   1 
ATOM   10406 H  H    . ALA C  1 84  ? 27.445  105.571 30.177  1.00 23.73 ? 84  ALA C H    1 
ATOM   10407 H  HA   . ALA C  1 84  ? 25.311  107.048 29.958  1.00 20.97 ? 84  ALA C HA   1 
ATOM   10408 H  HB1  . ALA C  1 84  ? 25.572  107.434 32.258  1.00 23.16 ? 84  ALA C HB1  1 
ATOM   10409 H  HB2  . ALA C  1 84  ? 25.778  105.905 31.954  1.00 23.16 ? 84  ALA C HB2  1 
ATOM   10410 H  HB3  . ALA C  1 84  ? 27.023  106.831 32.208  1.00 23.16 ? 84  ALA C HB3  1 
ATOM   10411 N  N    . ASN C  1 85  ? 25.850  109.476 30.197  1.00 19.47 ? 85  ASN C N    1 
ATOM   10412 C  CA   . ASN C  1 85  ? 26.159  110.906 30.074  1.00 18.12 ? 85  ASN C CA   1 
ATOM   10413 C  C    . ASN C  1 85  ? 26.796  111.443 31.346  1.00 15.93 ? 85  ASN C C    1 
ATOM   10414 O  O    . ASN C  1 85  ? 26.215  112.247 32.087  1.00 19.87 ? 85  ASN C O    1 
ATOM   10415 C  CB   . ASN C  1 85  ? 24.903  111.720 29.700  1.00 14.44 ? 85  ASN C CB   1 
ATOM   10416 C  CG   . ASN C  1 85  ? 23.755  111.562 30.707  1.00 20.06 ? 85  ASN C CG   1 
ATOM   10417 O  OD1  . ASN C  1 85  ? 23.522  110.478 31.245  1.00 23.36 ? 85  ASN C OD1  1 
ATOM   10418 N  ND2  . ASN C  1 85  ? 23.031  112.651 30.954  1.00 18.58 ? 85  ASN C ND2  1 
ATOM   10419 H  H    . ASN C  1 85  ? 25.015  109.326 30.337  1.00 23.37 ? 85  ASN C H    1 
ATOM   10420 H  HA   . ASN C  1 85  ? 26.809  111.020 29.349  1.00 21.74 ? 85  ASN C HA   1 
ATOM   10421 H  HB2  . ASN C  1 85  ? 25.138  112.660 29.661  1.00 17.32 ? 85  ASN C HB2  1 
ATOM   10422 H  HB3  . ASN C  1 85  ? 24.582  111.423 28.834  1.00 17.32 ? 85  ASN C HB3  1 
ATOM   10423 H  HD21 . ASN C  1 85  ? 23.218  113.390 30.556  1.00 22.30 ? 85  ASN C HD21 1 
ATOM   10424 H  HD22 . ASN C  1 85  ? 22.377  112.615 31.510  1.00 22.30 ? 85  ASN C HD22 1 
ATOM   10425 N  N    . ILE C  1 86  ? 28.017  110.992 31.590  1.00 13.10 ? 86  ILE C N    1 
ATOM   10426 C  CA   . ILE C  1 86  ? 28.688  111.253 32.847  1.00 11.90 ? 86  ILE C CA   1 
ATOM   10427 C  C    . ILE C  1 86  ? 30.111  111.754 32.640  1.00 13.78 ? 86  ILE C C    1 
ATOM   10428 O  O    . ILE C  1 86  ? 30.880  111.167 31.881  1.00 14.30 ? 86  ILE C O