data_4O9U
# 
_entry.id   4O9U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4O9U         
RCSB  RCSB084223   
WWPDB D_1000084223 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4O9U 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leung, J.H.'           1 
'Yamaguchi, M.'         2 
'Moeller, A.'           3 
'Schurig-Briccio, L.A.' 4 
'Gennis, R.B.'          5 
'Potter, C.S.'          6 
'Carragher, B.'         7 
'Stout, C.D.'           8 
# 
_citation.id                        primary 
_citation.title                     
'Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            347 
_citation.page_first                178 
_citation.page_last                 181 
_citation.year                      2015 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25574024 
_citation.pdbx_database_id_DOI      10.1126/science.1260451 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Leung, J.H.'           1 
primary 'Schurig-Briccio, L.A.' 2 
primary 'Yamaguchi, M.'         3 
primary 'Moeller, A.'           4 
primary 'Speir, J.A.'           5 
primary 'Gennis, R.B.'          6 
primary 'Stout, C.D.'           7 
# 
_cell.entry_id           4O9U 
_cell.length_a           175.331 
_cell.length_b           160.590 
_cell.length_c           139.624 
_cell.angle_alpha        90.00 
_cell.angle_beta         128.36 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4O9U 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NAD(P) transhydrogenase subunit alpha 2'          10649.571 2 1.6.1.2 ? ? ? 
2 polymer     man 'NAD(P) transhydrogenase subunit beta'             47371.906 2 1.6.1.2 ? ? ? 
3 polymer     man 'NAD/NADP transhydrogenase alpha subunit 1'        41258.828 2 ?       ? ? ? 
4 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   2 1.6.1.2 ? ? ? 
5 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                  663.425   2 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 'Nicotinamide nucleotide transhydrogenase subunit beta' 
4 'Nicotinamide nucleotide transhydrogenase subunit beta' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEFGFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVVVVGAMVVLGHAETGLEKLIGFLGVILGAANAAGGY
AVTVRMLEMFERKPGQGGGR
;
;MEFGFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVVVVGAMVVLGHAETGLEKLIGFLGVILGAANAAGGY
AVTVRMLEMFERKPGQGGGR
;
A,C ? 
2 'polypeptide(L)' no no 
;MDLIQAAYFVVAILFIVGLKRMAHPTTAKSGIVWAGWGMVLAVLATFFWPGMGNFALILLALLLGSVVAWWAAVRVAMTD
MPQMVAIYNGMGGGAAATIAAVELLKGAFENTGLMALAILGGLIGSVAFTGSLIAFAKLQGIMKSRPILFPGQKAVNALV
LALTVVIGLSLLWNDATASIVLFFLLALLFGVLMTLPIGGGDMPVAISFYNAFTGMAVGFEGFAVGNPALMVAGTLVGAA
GTLLTVLMARAMNRSVWSVLVGGFGVEQEAGEVKGSLKPIDVEDAAVMLAYAGKVVFVPGYGMALSQAQHKLKELADLLE
ARGVEVKFAIHPVAGRMPGHMNVLLAEAGVDYDKLKDLEEINPEFPTVDVAVVIGANDVVNPAARRPGSPLYGMPILDVD
KAKNVIVIKRGQGKGFAGVENELFYAENTRMLYGDAQKVLTELIQALKRL
;
;MDLIQAAYFVVAILFIVGLKRMAHPTTAKSGIVWAGWGMVLAVLATFFWPGMGNFALILLALLLGSVVAWWAAVRVAMTD
MPQMVAIYNGMGGGAAATIAAVELLKGAFENTGLMALAILGGLIGSVAFTGSLIAFAKLQGIMKSRPILFPGQKAVNALV
LALTVVIGLSLLWNDATASIVLFFLLALLFGVLMTLPIGGGDMPVAISFYNAFTGMAVGFEGFAVGNPALMVAGTLVGAA
GTLLTVLMARAMNRSVWSVLVGGFGVEQEAGEVKGSLKPIDVEDAAVMLAYAGKVVFVPGYGMALSQAQHKLKELADLLE
ARGVEVKFAIHPVAGRMPGHMNVLLAEAGVDYDKLKDLEEINPEFPTVDVAVVIGANDVVNPAARRPGSPLYGMPILDVD
KAKNVIVIKRGQGKGFAGVENELFYAENTRMLYGDAQKVLTELIQALKRL
;
B,D ? 
3 'polypeptide(L)' no no 
;MHHHHHHHHMVTVAVPKERAPGERRVALVPEVVARLVKGGARVRVERGAGEGAYHPDEAYQEAGAEVVERGELLKGAHLL
FTVQPPPEDLIQALEPGAIVVGFVQPHKNLELVRALQAKKATVIAMELIPRITRAQSMDALSSQATVAGYLAAIHAARLS
PRFFPMLTTAAGTIRPAKVMVMGVGVAGLMAIATAKRLGAQVFAYDVRKAALEQALSLGAKPIELPISAEGEGGYARELT
EEEKRIQHEALRDHVAGMDVLITTAQVPGRRAPILLTEDMVERLKPGTVVVDLAAESGGNCVLTKPGEVVEVRGVRVYGP
LNLPSELSVHASEMYAKNLYNLSSLLIEKGAFAPKWEDEIVRAALLMKEGEVLHGPTKALLGGA
;
;MHHHHHHHHMVTVAVPKERAPGERRVALVPEVVARLVKGGARVRVERGAGEGAYHPDEAYQEAGAEVVERGELLKGAHLL
FTVQPPPEDLIQALEPGAIVVGFVQPHKNLELVRALQAKKATVIAMELIPRITRAQSMDALSSQATVAGYLAAIHAARLS
PRFFPMLTTAAGTIRPAKVMVMGVGVAGLMAIATAKRLGAQVFAYDVRKAALEQALSLGAKPIELPISAEGEGGYARELT
EEEKRIQHEALRDHVAGMDVLITTAQVPGRRAPILLTEDMVERLKPGTVVVDLAAESGGNCVLTKPGEVVEVRGVRVYGP
LNLPSELSVHASEMYAKNLYNLSSLLIEKGAFAPKWEDEIVRAALLMKEGEVLHGPTKALLGGA
;
E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   PHE n 
1 4   GLY n 
1 5   PHE n 
1 6   TRP n 
1 7   SER n 
1 8   ALA n 
1 9   LEU n 
1 10  TYR n 
1 11  ILE n 
1 12  PHE n 
1 13  VAL n 
1 14  LEU n 
1 15  THR n 
1 16  ALA n 
1 17  PHE n 
1 18  LEU n 
1 19  GLY n 
1 20  TYR n 
1 21  GLU n 
1 22  LEU n 
1 23  ILE n 
1 24  THR n 
1 25  ARG n 
1 26  VAL n 
1 27  PRO n 
1 28  VAL n 
1 29  ILE n 
1 30  LEU n 
1 31  HIS n 
1 32  THR n 
1 33  PRO n 
1 34  LEU n 
1 35  MET n 
1 36  SER n 
1 37  GLY n 
1 38  SER n 
1 39  ASN n 
1 40  PHE n 
1 41  ILE n 
1 42  HIS n 
1 43  GLY n 
1 44  VAL n 
1 45  VAL n 
1 46  VAL n 
1 47  VAL n 
1 48  GLY n 
1 49  ALA n 
1 50  MET n 
1 51  VAL n 
1 52  VAL n 
1 53  LEU n 
1 54  GLY n 
1 55  HIS n 
1 56  ALA n 
1 57  GLU n 
1 58  THR n 
1 59  GLY n 
1 60  LEU n 
1 61  GLU n 
1 62  LYS n 
1 63  LEU n 
1 64  ILE n 
1 65  GLY n 
1 66  PHE n 
1 67  LEU n 
1 68  GLY n 
1 69  VAL n 
1 70  ILE n 
1 71  LEU n 
1 72  GLY n 
1 73  ALA n 
1 74  ALA n 
1 75  ASN n 
1 76  ALA n 
1 77  ALA n 
1 78  GLY n 
1 79  GLY n 
1 80  TYR n 
1 81  ALA n 
1 82  VAL n 
1 83  THR n 
1 84  VAL n 
1 85  ARG n 
1 86  MET n 
1 87  LEU n 
1 88  GLU n 
1 89  MET n 
1 90  PHE n 
1 91  GLU n 
1 92  ARG n 
1 93  LYS n 
1 94  PRO n 
1 95  GLY n 
1 96  GLN n 
1 97  GLY n 
1 98  GLY n 
1 99  GLY n 
1 100 ARG n 
2 1   MET n 
2 2   ASP n 
2 3   LEU n 
2 4   ILE n 
2 5   GLN n 
2 6   ALA n 
2 7   ALA n 
2 8   TYR n 
2 9   PHE n 
2 10  VAL n 
2 11  VAL n 
2 12  ALA n 
2 13  ILE n 
2 14  LEU n 
2 15  PHE n 
2 16  ILE n 
2 17  VAL n 
2 18  GLY n 
2 19  LEU n 
2 20  LYS n 
2 21  ARG n 
2 22  MET n 
2 23  ALA n 
2 24  HIS n 
2 25  PRO n 
2 26  THR n 
2 27  THR n 
2 28  ALA n 
2 29  LYS n 
2 30  SER n 
2 31  GLY n 
2 32  ILE n 
2 33  VAL n 
2 34  TRP n 
2 35  ALA n 
2 36  GLY n 
2 37  TRP n 
2 38  GLY n 
2 39  MET n 
2 40  VAL n 
2 41  LEU n 
2 42  ALA n 
2 43  VAL n 
2 44  LEU n 
2 45  ALA n 
2 46  THR n 
2 47  PHE n 
2 48  PHE n 
2 49  TRP n 
2 50  PRO n 
2 51  GLY n 
2 52  MET n 
2 53  GLY n 
2 54  ASN n 
2 55  PHE n 
2 56  ALA n 
2 57  LEU n 
2 58  ILE n 
2 59  LEU n 
2 60  LEU n 
2 61  ALA n 
2 62  LEU n 
2 63  LEU n 
2 64  LEU n 
2 65  GLY n 
2 66  SER n 
2 67  VAL n 
2 68  VAL n 
2 69  ALA n 
2 70  TRP n 
2 71  TRP n 
2 72  ALA n 
2 73  ALA n 
2 74  VAL n 
2 75  ARG n 
2 76  VAL n 
2 77  ALA n 
2 78  MET n 
2 79  THR n 
2 80  ASP n 
2 81  MET n 
2 82  PRO n 
2 83  GLN n 
2 84  MET n 
2 85  VAL n 
2 86  ALA n 
2 87  ILE n 
2 88  TYR n 
2 89  ASN n 
2 90  GLY n 
2 91  MET n 
2 92  GLY n 
2 93  GLY n 
2 94  GLY n 
2 95  ALA n 
2 96  ALA n 
2 97  ALA n 
2 98  THR n 
2 99  ILE n 
2 100 ALA n 
2 101 ALA n 
2 102 VAL n 
2 103 GLU n 
2 104 LEU n 
2 105 LEU n 
2 106 LYS n 
2 107 GLY n 
2 108 ALA n 
2 109 PHE n 
2 110 GLU n 
2 111 ASN n 
2 112 THR n 
2 113 GLY n 
2 114 LEU n 
2 115 MET n 
2 116 ALA n 
2 117 LEU n 
2 118 ALA n 
2 119 ILE n 
2 120 LEU n 
2 121 GLY n 
2 122 GLY n 
2 123 LEU n 
2 124 ILE n 
2 125 GLY n 
2 126 SER n 
2 127 VAL n 
2 128 ALA n 
2 129 PHE n 
2 130 THR n 
2 131 GLY n 
2 132 SER n 
2 133 LEU n 
2 134 ILE n 
2 135 ALA n 
2 136 PHE n 
2 137 ALA n 
2 138 LYS n 
2 139 LEU n 
2 140 GLN n 
2 141 GLY n 
2 142 ILE n 
2 143 MET n 
2 144 LYS n 
2 145 SER n 
2 146 ARG n 
2 147 PRO n 
2 148 ILE n 
2 149 LEU n 
2 150 PHE n 
2 151 PRO n 
2 152 GLY n 
2 153 GLN n 
2 154 LYS n 
2 155 ALA n 
2 156 VAL n 
2 157 ASN n 
2 158 ALA n 
2 159 LEU n 
2 160 VAL n 
2 161 LEU n 
2 162 ALA n 
2 163 LEU n 
2 164 THR n 
2 165 VAL n 
2 166 VAL n 
2 167 ILE n 
2 168 GLY n 
2 169 LEU n 
2 170 SER n 
2 171 LEU n 
2 172 LEU n 
2 173 TRP n 
2 174 ASN n 
2 175 ASP n 
2 176 ALA n 
2 177 THR n 
2 178 ALA n 
2 179 SER n 
2 180 ILE n 
2 181 VAL n 
2 182 LEU n 
2 183 PHE n 
2 184 PHE n 
2 185 LEU n 
2 186 LEU n 
2 187 ALA n 
2 188 LEU n 
2 189 LEU n 
2 190 PHE n 
2 191 GLY n 
2 192 VAL n 
2 193 LEU n 
2 194 MET n 
2 195 THR n 
2 196 LEU n 
2 197 PRO n 
2 198 ILE n 
2 199 GLY n 
2 200 GLY n 
2 201 GLY n 
2 202 ASP n 
2 203 MET n 
2 204 PRO n 
2 205 VAL n 
2 206 ALA n 
2 207 ILE n 
2 208 SER n 
2 209 PHE n 
2 210 TYR n 
2 211 ASN n 
2 212 ALA n 
2 213 PHE n 
2 214 THR n 
2 215 GLY n 
2 216 MET n 
2 217 ALA n 
2 218 VAL n 
2 219 GLY n 
2 220 PHE n 
2 221 GLU n 
2 222 GLY n 
2 223 PHE n 
2 224 ALA n 
2 225 VAL n 
2 226 GLY n 
2 227 ASN n 
2 228 PRO n 
2 229 ALA n 
2 230 LEU n 
2 231 MET n 
2 232 VAL n 
2 233 ALA n 
2 234 GLY n 
2 235 THR n 
2 236 LEU n 
2 237 VAL n 
2 238 GLY n 
2 239 ALA n 
2 240 ALA n 
2 241 GLY n 
2 242 THR n 
2 243 LEU n 
2 244 LEU n 
2 245 THR n 
2 246 VAL n 
2 247 LEU n 
2 248 MET n 
2 249 ALA n 
2 250 ARG n 
2 251 ALA n 
2 252 MET n 
2 253 ASN n 
2 254 ARG n 
2 255 SER n 
2 256 VAL n 
2 257 TRP n 
2 258 SER n 
2 259 VAL n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 GLY n 
2 264 PHE n 
2 265 GLY n 
2 266 VAL n 
2 267 GLU n 
2 268 GLN n 
2 269 GLU n 
2 270 ALA n 
2 271 GLY n 
2 272 GLU n 
2 273 VAL n 
2 274 LYS n 
2 275 GLY n 
2 276 SER n 
2 277 LEU n 
2 278 LYS n 
2 279 PRO n 
2 280 ILE n 
2 281 ASP n 
2 282 VAL n 
2 283 GLU n 
2 284 ASP n 
2 285 ALA n 
2 286 ALA n 
2 287 VAL n 
2 288 MET n 
2 289 LEU n 
2 290 ALA n 
2 291 TYR n 
2 292 ALA n 
2 293 GLY n 
2 294 LYS n 
2 295 VAL n 
2 296 VAL n 
2 297 PHE n 
2 298 VAL n 
2 299 PRO n 
2 300 GLY n 
2 301 TYR n 
2 302 GLY n 
2 303 MET n 
2 304 ALA n 
2 305 LEU n 
2 306 SER n 
2 307 GLN n 
2 308 ALA n 
2 309 GLN n 
2 310 HIS n 
2 311 LYS n 
2 312 LEU n 
2 313 LYS n 
2 314 GLU n 
2 315 LEU n 
2 316 ALA n 
2 317 ASP n 
2 318 LEU n 
2 319 LEU n 
2 320 GLU n 
2 321 ALA n 
2 322 ARG n 
2 323 GLY n 
2 324 VAL n 
2 325 GLU n 
2 326 VAL n 
2 327 LYS n 
2 328 PHE n 
2 329 ALA n 
2 330 ILE n 
2 331 HIS n 
2 332 PRO n 
2 333 VAL n 
2 334 ALA n 
2 335 GLY n 
2 336 ARG n 
2 337 MET n 
2 338 PRO n 
2 339 GLY n 
2 340 HIS n 
2 341 MET n 
2 342 ASN n 
2 343 VAL n 
2 344 LEU n 
2 345 LEU n 
2 346 ALA n 
2 347 GLU n 
2 348 ALA n 
2 349 GLY n 
2 350 VAL n 
2 351 ASP n 
2 352 TYR n 
2 353 ASP n 
2 354 LYS n 
2 355 LEU n 
2 356 LYS n 
2 357 ASP n 
2 358 LEU n 
2 359 GLU n 
2 360 GLU n 
2 361 ILE n 
2 362 ASN n 
2 363 PRO n 
2 364 GLU n 
2 365 PHE n 
2 366 PRO n 
2 367 THR n 
2 368 VAL n 
2 369 ASP n 
2 370 VAL n 
2 371 ALA n 
2 372 VAL n 
2 373 VAL n 
2 374 ILE n 
2 375 GLY n 
2 376 ALA n 
2 377 ASN n 
2 378 ASP n 
2 379 VAL n 
2 380 VAL n 
2 381 ASN n 
2 382 PRO n 
2 383 ALA n 
2 384 ALA n 
2 385 ARG n 
2 386 ARG n 
2 387 PRO n 
2 388 GLY n 
2 389 SER n 
2 390 PRO n 
2 391 LEU n 
2 392 TYR n 
2 393 GLY n 
2 394 MET n 
2 395 PRO n 
2 396 ILE n 
2 397 LEU n 
2 398 ASP n 
2 399 VAL n 
2 400 ASP n 
2 401 LYS n 
2 402 ALA n 
2 403 LYS n 
2 404 ASN n 
2 405 VAL n 
2 406 ILE n 
2 407 VAL n 
2 408 ILE n 
2 409 LYS n 
2 410 ARG n 
2 411 GLY n 
2 412 GLN n 
2 413 GLY n 
2 414 LYS n 
2 415 GLY n 
2 416 PHE n 
2 417 ALA n 
2 418 GLY n 
2 419 VAL n 
2 420 GLU n 
2 421 ASN n 
2 422 GLU n 
2 423 LEU n 
2 424 PHE n 
2 425 TYR n 
2 426 ALA n 
2 427 GLU n 
2 428 ASN n 
2 429 THR n 
2 430 ARG n 
2 431 MET n 
2 432 LEU n 
2 433 TYR n 
2 434 GLY n 
2 435 ASP n 
2 436 ALA n 
2 437 GLN n 
2 438 LYS n 
2 439 VAL n 
2 440 LEU n 
2 441 THR n 
2 442 GLU n 
2 443 LEU n 
2 444 ILE n 
2 445 GLN n 
2 446 ALA n 
2 447 LEU n 
2 448 LYS n 
2 449 ARG n 
2 450 LEU n 
3 1   MET n 
3 2   HIS n 
3 3   HIS n 
3 4   HIS n 
3 5   HIS n 
3 6   HIS n 
3 7   HIS n 
3 8   HIS n 
3 9   HIS n 
3 10  MET n 
3 11  VAL n 
3 12  THR n 
3 13  VAL n 
3 14  ALA n 
3 15  VAL n 
3 16  PRO n 
3 17  LYS n 
3 18  GLU n 
3 19  ARG n 
3 20  ALA n 
3 21  PRO n 
3 22  GLY n 
3 23  GLU n 
3 24  ARG n 
3 25  ARG n 
3 26  VAL n 
3 27  ALA n 
3 28  LEU n 
3 29  VAL n 
3 30  PRO n 
3 31  GLU n 
3 32  VAL n 
3 33  VAL n 
3 34  ALA n 
3 35  ARG n 
3 36  LEU n 
3 37  VAL n 
3 38  LYS n 
3 39  GLY n 
3 40  GLY n 
3 41  ALA n 
3 42  ARG n 
3 43  VAL n 
3 44  ARG n 
3 45  VAL n 
3 46  GLU n 
3 47  ARG n 
3 48  GLY n 
3 49  ALA n 
3 50  GLY n 
3 51  GLU n 
3 52  GLY n 
3 53  ALA n 
3 54  TYR n 
3 55  HIS n 
3 56  PRO n 
3 57  ASP n 
3 58  GLU n 
3 59  ALA n 
3 60  TYR n 
3 61  GLN n 
3 62  GLU n 
3 63  ALA n 
3 64  GLY n 
3 65  ALA n 
3 66  GLU n 
3 67  VAL n 
3 68  VAL n 
3 69  GLU n 
3 70  ARG n 
3 71  GLY n 
3 72  GLU n 
3 73  LEU n 
3 74  LEU n 
3 75  LYS n 
3 76  GLY n 
3 77  ALA n 
3 78  HIS n 
3 79  LEU n 
3 80  LEU n 
3 81  PHE n 
3 82  THR n 
3 83  VAL n 
3 84  GLN n 
3 85  PRO n 
3 86  PRO n 
3 87  PRO n 
3 88  GLU n 
3 89  ASP n 
3 90  LEU n 
3 91  ILE n 
3 92  GLN n 
3 93  ALA n 
3 94  LEU n 
3 95  GLU n 
3 96  PRO n 
3 97  GLY n 
3 98  ALA n 
3 99  ILE n 
3 100 VAL n 
3 101 VAL n 
3 102 GLY n 
3 103 PHE n 
3 104 VAL n 
3 105 GLN n 
3 106 PRO n 
3 107 HIS n 
3 108 LYS n 
3 109 ASN n 
3 110 LEU n 
3 111 GLU n 
3 112 LEU n 
3 113 VAL n 
3 114 ARG n 
3 115 ALA n 
3 116 LEU n 
3 117 GLN n 
3 118 ALA n 
3 119 LYS n 
3 120 LYS n 
3 121 ALA n 
3 122 THR n 
3 123 VAL n 
3 124 ILE n 
3 125 ALA n 
3 126 MET n 
3 127 GLU n 
3 128 LEU n 
3 129 ILE n 
3 130 PRO n 
3 131 ARG n 
3 132 ILE n 
3 133 THR n 
3 134 ARG n 
3 135 ALA n 
3 136 GLN n 
3 137 SER n 
3 138 MET n 
3 139 ASP n 
3 140 ALA n 
3 141 LEU n 
3 142 SER n 
3 143 SER n 
3 144 GLN n 
3 145 ALA n 
3 146 THR n 
3 147 VAL n 
3 148 ALA n 
3 149 GLY n 
3 150 TYR n 
3 151 LEU n 
3 152 ALA n 
3 153 ALA n 
3 154 ILE n 
3 155 HIS n 
3 156 ALA n 
3 157 ALA n 
3 158 ARG n 
3 159 LEU n 
3 160 SER n 
3 161 PRO n 
3 162 ARG n 
3 163 PHE n 
3 164 PHE n 
3 165 PRO n 
3 166 MET n 
3 167 LEU n 
3 168 THR n 
3 169 THR n 
3 170 ALA n 
3 171 ALA n 
3 172 GLY n 
3 173 THR n 
3 174 ILE n 
3 175 ARG n 
3 176 PRO n 
3 177 ALA n 
3 178 LYS n 
3 179 VAL n 
3 180 MET n 
3 181 VAL n 
3 182 MET n 
3 183 GLY n 
3 184 VAL n 
3 185 GLY n 
3 186 VAL n 
3 187 ALA n 
3 188 GLY n 
3 189 LEU n 
3 190 MET n 
3 191 ALA n 
3 192 ILE n 
3 193 ALA n 
3 194 THR n 
3 195 ALA n 
3 196 LYS n 
3 197 ARG n 
3 198 LEU n 
3 199 GLY n 
3 200 ALA n 
3 201 GLN n 
3 202 VAL n 
3 203 PHE n 
3 204 ALA n 
3 205 TYR n 
3 206 ASP n 
3 207 VAL n 
3 208 ARG n 
3 209 LYS n 
3 210 ALA n 
3 211 ALA n 
3 212 LEU n 
3 213 GLU n 
3 214 GLN n 
3 215 ALA n 
3 216 LEU n 
3 217 SER n 
3 218 LEU n 
3 219 GLY n 
3 220 ALA n 
3 221 LYS n 
3 222 PRO n 
3 223 ILE n 
3 224 GLU n 
3 225 LEU n 
3 226 PRO n 
3 227 ILE n 
3 228 SER n 
3 229 ALA n 
3 230 GLU n 
3 231 GLY n 
3 232 GLU n 
3 233 GLY n 
3 234 GLY n 
3 235 TYR n 
3 236 ALA n 
3 237 ARG n 
3 238 GLU n 
3 239 LEU n 
3 240 THR n 
3 241 GLU n 
3 242 GLU n 
3 243 GLU n 
3 244 LYS n 
3 245 ARG n 
3 246 ILE n 
3 247 GLN n 
3 248 HIS n 
3 249 GLU n 
3 250 ALA n 
3 251 LEU n 
3 252 ARG n 
3 253 ASP n 
3 254 HIS n 
3 255 VAL n 
3 256 ALA n 
3 257 GLY n 
3 258 MET n 
3 259 ASP n 
3 260 VAL n 
3 261 LEU n 
3 262 ILE n 
3 263 THR n 
3 264 THR n 
3 265 ALA n 
3 266 GLN n 
3 267 VAL n 
3 268 PRO n 
3 269 GLY n 
3 270 ARG n 
3 271 ARG n 
3 272 ALA n 
3 273 PRO n 
3 274 ILE n 
3 275 LEU n 
3 276 LEU n 
3 277 THR n 
3 278 GLU n 
3 279 ASP n 
3 280 MET n 
3 281 VAL n 
3 282 GLU n 
3 283 ARG n 
3 284 LEU n 
3 285 LYS n 
3 286 PRO n 
3 287 GLY n 
3 288 THR n 
3 289 VAL n 
3 290 VAL n 
3 291 VAL n 
3 292 ASP n 
3 293 LEU n 
3 294 ALA n 
3 295 ALA n 
3 296 GLU n 
3 297 SER n 
3 298 GLY n 
3 299 GLY n 
3 300 ASN n 
3 301 CYS n 
3 302 VAL n 
3 303 LEU n 
3 304 THR n 
3 305 LYS n 
3 306 PRO n 
3 307 GLY n 
3 308 GLU n 
3 309 VAL n 
3 310 VAL n 
3 311 GLU n 
3 312 VAL n 
3 313 ARG n 
3 314 GLY n 
3 315 VAL n 
3 316 ARG n 
3 317 VAL n 
3 318 TYR n 
3 319 GLY n 
3 320 PRO n 
3 321 LEU n 
3 322 ASN n 
3 323 LEU n 
3 324 PRO n 
3 325 SER n 
3 326 GLU n 
3 327 LEU n 
3 328 SER n 
3 329 VAL n 
3 330 HIS n 
3 331 ALA n 
3 332 SER n 
3 333 GLU n 
3 334 MET n 
3 335 TYR n 
3 336 ALA n 
3 337 LYS n 
3 338 ASN n 
3 339 LEU n 
3 340 TYR n 
3 341 ASN n 
3 342 LEU n 
3 343 SER n 
3 344 SER n 
3 345 LEU n 
3 346 LEU n 
3 347 ILE n 
3 348 GLU n 
3 349 LYS n 
3 350 GLY n 
3 351 ALA n 
3 352 PHE n 
3 353 ALA n 
3 354 PRO n 
3 355 LYS n 
3 356 TRP n 
3 357 GLU n 
3 358 ASP n 
3 359 GLU n 
3 360 ILE n 
3 361 VAL n 
3 362 ARG n 
3 363 ALA n 
3 364 ALA n 
3 365 LEU n 
3 366 LEU n 
3 367 MET n 
3 368 LYS n 
3 369 GLU n 
3 370 GLY n 
3 371 GLU n 
3 372 VAL n 
3 373 LEU n 
3 374 HIS n 
3 375 GLY n 
3 376 PRO n 
3 377 THR n 
3 378 LYS n 
3 379 ALA n 
3 380 LEU n 
3 381 LEU n 
3 382 GLY n 
3 383 GLY n 
3 384 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? TT_C1779 ? 'HB27 / ATCC BAA-163 / DSM 7039' ? ? ? ? 'Thermus thermophilus' 262724 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? ? TT_C1778 ? 'HB27 / ATCC BAA-163 / DSM 7039' ? ? ? ? 'Thermus thermophilus' 262724 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? ? ? TT_C1780 ? 'HB27 / ATCC BAA-163 / DSM 7039' ? ? ? ? 'Thermus thermophilus' 262724 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? ? ? TT_C1778 ? 'HB27 / ATCC BAA-163 / DSM 7039' ? ? ? ? 'Thermus thermophilus' 262724 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q72GR9_THET2 Q72GR9 1 
;MEFGFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVVVVGAMVVLGHAETGLEKLIGFLGVILGAANAAGGY
AVTVRMLEMFERKPGQGGGR
;
1 ? 
2 UNP Q72GS0_THET2 Q72GS0 2 
;MDLIQAAYFVVAILFIVGLKRMAHPTTAKSGIVWAGWGMVLAVLATFFWPGMGNFALILLALLLGSVVAWWAAVRVAMTD
MPQMVAIYNGMGGGAAATIAAVELLKGAFENTGLMALAILGGLIGSVAFTGSLIAFAKLQGIMKSRPILFPGQKAVNALV
LALTVVIGLSLLWNDATASIVLFFLLALLFGVLMTLPIGGGDMPVAISFYNAFTGMAVGFEGFAVGNPALMVAGTLVGAA
GTLLTVLMARAMNRSVWSVLVGGFGVEQEAGEVKGSLKPIDVEDAAVMLAYAGKVVFVPGYGMALSQAQHKLKELADLLE
ARGVEVKFAIHPVAGRMPGHMNVLLAEAGVDYDKLKDLEEINPEFPTVDVAVVIGANDVVNPAARRPGSPLYGMPILDVD
KAKNVIVIKRGQGKGFAGVENELFYAENTRMLYGDAQKVLTELIQALKRL
;
1 ? 
3 UNP Q72GR8_THET2 Q72GR8 3 
;MVTVAVPKERAPGERRVALVPEVVARLVKGGARVRVERGAGEGAYHPDEAYQEAGAEVVERGELLKGAHLLFTVQPPPED
LIQALEPGAIVVGFVQPHKNLELVRALQAKKATVIAMELIPRITRAQSMDALSSQATVAGYLAAIHAARLSPRFFPMLTT
AAGTIRPAKVMVMGVGVAGLMAIATAKRLGAQVFAYDVRKAALEQALSLGAKPIELPISAEGEGGYARELTEEEKRIQHE
ALRDHVAGMDVLITTAQVPGRRAPILLTEDMVERLKPGTVVVDLAAESGGNCVLTKPGEVVEVRGVRVYGPLNLPSELSV
HASEMYAKNLYNLSSLLIEKGAFAPKWEDEIVRAALLMKEGEVLHGPTKALLGGA
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4O9U A 1  ? 100 ? Q72GR9 1 ? 100 ? 1 100 
2 2 4O9U B 1  ? 450 ? Q72GS0 1 ? 450 ? 1 450 
3 1 4O9U C 1  ? 100 ? Q72GR9 1 ? 100 ? 1 100 
4 2 4O9U D 1  ? 450 ? Q72GS0 1 ? 450 ? 1 450 
5 3 4O9U E 10 ? 384 ? Q72GR8 1 ? 375 ? 1 375 
6 3 4O9U F 10 ? 384 ? Q72GR8 1 ? 375 ? 1 375 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
5 4O9U MET E 1 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -8 1  
5 4O9U HIS E 2 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -7 2  
5 4O9U HIS E 3 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -6 3  
5 4O9U HIS E 4 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -5 4  
5 4O9U HIS E 5 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -4 5  
5 4O9U HIS E 6 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -3 6  
5 4O9U HIS E 7 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -2 7  
5 4O9U HIS E 8 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -1 8  
5 4O9U HIS E 9 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' 0  9  
6 4O9U MET F 1 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -8 10 
6 4O9U HIS F 2 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -7 11 
6 4O9U HIS F 3 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -6 12 
6 4O9U HIS F 4 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -5 13 
6 4O9U HIS F 5 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -4 14 
6 4O9U HIS F 6 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -3 15 
6 4O9U HIS F 7 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -2 16 
6 4O9U HIS F 8 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' -1 17 
6 4O9U HIS F 9 ? UNP Q72GR8 ? ? 'EXPRESSION TAG' 0  18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE                  ?                                            
'C21 H27 N7 O14 P2' 663.425 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                                            
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4O9U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.93 
_exptl_crystal.density_percent_sol   68.70 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
;50 mM MgCl2, 0.5 M trimethylamine N-oxide, 26% polyethylenglycol 400, 2% octyl glucoside, 0.1mM NADP, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Side scattering I-beam bent single crystal; asymmetric cut 4.9650 deg.' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.12709 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.12709 
# 
_reflns.entry_id                     4O9U 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             38.9 
_reflns.d_resolution_high            6.926 
_reflns.number_obs                   4922 
_reflns.number_all                   5015 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 4O9U 
_refine.ls_number_reflns_obs                     4694 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.9 
_refine.ls_d_res_high                            6.926 
_refine.ls_percent_reflns_obs                    98.11 
_refine.ls_R_factor_obs                          0.21598 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21271 
_refine.ls_R_factor_R_free                       0.28372 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  228 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.854 
_refine.correlation_coeff_Fo_to_Fc_free          0.858 
_refine.B_iso_mean                               160.054 
_refine.aniso_B[1][1]                            -21.34 
_refine.aniso_B[2][2]                            -16.37 
_refine.aniso_B[3][3]                            23.52 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -9.66 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  3.424 
_refine.overall_SU_ML                            2.702 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             331.290 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13434 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         184 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               13618 
_refine_hist.d_res_high                       6.926 
_refine_hist.d_res_low                        38.9 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.006  0.019  ? 13900 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.102  1.999  ? 18905 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 4.964  5.000  ? 1794  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 37.520 23.424 ? 476   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 19.273 15.000 ? 2288  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 14.192 15.000 ? 79    ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.064  0.200  ? 2246  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.004  0.021  ? 10135 ? 'X-RAY DIFFRACTION' 
r_mcbond_it            5.088  15.857 ? 7203  ? 'X-RAY DIFFRACTION' 
r_mcangle_it           9.321  23.773 ? 8988  ? 'X-RAY DIFFRACTION' 
r_scbond_it            3.848  16.233 ? 6697  ? 'X-RAY DIFFRACTION' 
r_long_range_B_refined 23.161 ?      ? 21097 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       6.926 
_refine_ls_shell.d_res_low                        7.105 
_refine_ls_shell.number_reflns_R_work             298 
_refine_ls_shell.R_factor_R_work                  0.296 
_refine_ls_shell.percent_reflns_obs               86.78 
_refine_ls_shell.R_factor_R_free                  0.414 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             17 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4O9U 
_struct.title                     'Mechanism of transhydrogenase coupling proton translocation and hydride transfer' 
_struct.pdbx_descriptor           
;NAD(P) transhydrogenase subunit alpha 2 (E.C.1.6.1.2), NAD(P) transhydrogenase subunit beta (E.C.1.6.1.2), NAD/NADP transhydrogenase alpha subunit 1
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4O9U 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            
;Nicotinamide nucleotide transhydrogenase, Couples proton motive, Hydride transfer, Holo-transhydrogease from Thermus thermophilus assembled from subunits alpha1, alpha2, truncated beta, and domain III as a dimer, Respiratory proton pump enzyme forming cytosolic NADP(H), Protons and NAD(H), NADP(H), Proton translocation and hydride transfer, Periplasmic membrane and cytosol, membrane protein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 4   ? THR A 24  ? GLY A 4   THR A 24  1 ? 21 
HELX_P HELX_P2  2  THR A 32  ? HIS A 42  ? THR A 32  HIS A 42  1 ? 11 
HELX_P HELX_P3  3  VAL A 44  ? HIS A 55  ? VAL A 44  HIS A 55  1 ? 12 
HELX_P HELX_P4  4  GLY A 59  ? GLU A 88  ? GLY A 59  GLU A 88  1 ? 30 
HELX_P HELX_P5  5  ASP B 2   ? MET B 22  ? ASP B 2   MET B 22  1 ? 21 
HELX_P HELX_P6  6  THR B 27  ? PHE B 47  ? THR B 27  PHE B 47  1 ? 21 
HELX_P HELX_P7  7  ASN B 54  ? ARG B 75  ? ASN B 54  ARG B 75  1 ? 22 
HELX_P HELX_P8  8  ASP B 80  ? GLY B 107 ? ASP B 80  GLY B 107 1 ? 28 
HELX_P HELX_P9  9  ASN B 111 ? GLN B 140 ? ASN B 111 GLN B 140 1 ? 30 
HELX_P HELX_P10 10 VAL B 156 ? SER B 170 ? VAL B 156 SER B 170 1 ? 15 
HELX_P HELX_P11 11 ILE B 180 ? MET B 194 ? ILE B 180 MET B 194 1 ? 15 
HELX_P HELX_P12 12 ASP B 202 ? VAL B 225 ? ASP B 202 VAL B 225 1 ? 24 
HELX_P HELX_P13 13 ASN B 227 ? MET B 252 ? ASN B 227 MET B 252 1 ? 26 
HELX_P HELX_P14 14 SER B 255 ? LEU B 260 ? SER B 255 LEU B 260 1 ? 6  
HELX_P HELX_P15 15 ASP B 281 ? ALA B 290 ? ASP B 281 ALA B 290 1 ? 10 
HELX_P HELX_P16 16 GLY B 300 ? GLN B 307 ? GLY B 300 GLN B 307 1 ? 8  
HELX_P HELX_P17 17 ALA B 308 ? ARG B 322 ? ALA B 308 ARG B 322 1 ? 15 
HELX_P HELX_P18 18 GLY B 339 ? GLY B 349 ? GLY B 339 GLY B 349 1 ? 11 
HELX_P HELX_P19 19 ASP B 351 ? ASP B 353 ? ASP B 351 ASP B 353 5 ? 3  
HELX_P HELX_P20 20 ASP B 357 ? VAL B 368 ? ASP B 357 VAL B 368 5 ? 12 
HELX_P HELX_P21 21 ASP B 398 ? ALA B 402 ? ASP B 398 ALA B 402 5 ? 5  
HELX_P HELX_P22 22 ASP B 435 ? ARG B 449 ? ASP B 435 ARG B 449 1 ? 15 
HELX_P HELX_P23 23 GLY C 4   ? THR C 24  ? GLY C 4   THR C 24  1 ? 21 
HELX_P HELX_P24 24 ARG C 25  ? VAL C 26  ? ARG C 25  VAL C 26  5 ? 2  
HELX_P HELX_P25 25 PRO C 27  ? ILE C 29  ? PRO C 27  ILE C 29  5 ? 3  
HELX_P HELX_P26 26 LEU C 30  ? HIS C 42  ? LEU C 30  HIS C 42  1 ? 13 
HELX_P HELX_P27 27 VAL C 44  ? GLY C 54  ? VAL C 44  GLY C 54  1 ? 11 
HELX_P HELX_P28 28 LEU C 60  ? MET C 89  ? LEU C 60  MET C 89  1 ? 30 
HELX_P HELX_P29 29 ILE D 4   ? HIS D 24  ? ILE D 4   HIS D 24  1 ? 21 
HELX_P HELX_P30 30 THR D 27  ? THR D 46  ? THR D 27  THR D 46  1 ? 20 
HELX_P HELX_P31 31 PHE D 47  ? TRP D 49  ? PHE D 47  TRP D 49  5 ? 3  
HELX_P HELX_P32 32 ASN D 54  ? ARG D 75  ? ASN D 54  ARG D 75  1 ? 22 
HELX_P HELX_P33 33 ALA D 77  ? ASP D 80  ? ALA D 77  ASP D 80  5 ? 4  
HELX_P HELX_P34 34 MET D 81  ? LYS D 106 ? MET D 81  LYS D 106 1 ? 26 
HELX_P HELX_P35 35 ASN D 111 ? GLY D 141 ? ASN D 111 GLY D 141 1 ? 31 
HELX_P HELX_P36 36 GLY D 152 ? SER D 170 ? GLY D 152 SER D 170 1 ? 19 
HELX_P HELX_P37 37 ALA D 176 ? THR D 195 ? ALA D 176 THR D 195 1 ? 20 
HELX_P HELX_P38 38 MET D 203 ? GLY D 226 ? MET D 203 GLY D 226 1 ? 24 
HELX_P HELX_P39 39 ASN D 227 ? ALA D 251 ? ASN D 227 ALA D 251 1 ? 25 
HELX_P HELX_P40 40 ASP D 281 ? ALA D 292 ? ASP D 281 ALA D 292 1 ? 12 
HELX_P HELX_P41 41 GLY D 300 ? GLN D 307 ? GLY D 300 GLN D 307 1 ? 8  
HELX_P HELX_P42 42 ALA D 308 ? GLY D 323 ? ALA D 308 GLY D 323 1 ? 16 
HELX_P HELX_P43 43 GLY D 339 ? ALA D 348 ? GLY D 339 ALA D 348 1 ? 10 
HELX_P HELX_P44 44 LEU D 358 ? ASN D 362 ? LEU D 358 ASN D 362 1 ? 5  
HELX_P HELX_P45 45 PRO D 363 ? VAL D 368 ? PRO D 363 VAL D 368 5 ? 6  
HELX_P HELX_P46 46 ASN D 377 ? ARG D 386 ? ASN D 377 ARG D 386 5 ? 10 
HELX_P HELX_P47 47 ASP D 435 ? LYS D 448 ? ASP D 435 LYS D 448 1 ? 14 
HELX_P HELX_P48 48 VAL E 29  ? LYS E 38  ? VAL E 20  LYS E 29  1 ? 10 
HELX_P HELX_P49 49 ALA E 49  ? TYR E 54  ? ALA E 40  TYR E 45  5 ? 6  
HELX_P HELX_P50 50 PRO E 56  ? GLU E 62  ? PRO E 47  GLU E 53  1 ? 7  
HELX_P HELX_P51 51 PRO E 87  ? GLN E 92  ? PRO E 78  GLN E 83  1 ? 6  
HELX_P HELX_P52 52 ASN E 109 ? ALA E 118 ? ASN E 100 ALA E 109 1 ? 10 
HELX_P HELX_P53 53 GLU E 127 ? ILE E 129 ? GLU E 118 ILE E 120 5 ? 3  
HELX_P HELX_P54 54 THR E 133 ? SER E 137 ? THR E 124 SER E 128 5 ? 5  
HELX_P HELX_P55 55 ASP E 139 ? SER E 160 ? ASP E 130 SER E 151 1 ? 22 
HELX_P HELX_P56 56 GLY E 185 ? GLY E 199 ? GLY E 176 GLY E 190 1 ? 15 
HELX_P HELX_P57 57 ALA E 210 ? SER E 217 ? ALA E 201 SER E 208 1 ? 8  
HELX_P HELX_P58 58 ARG E 245 ? GLY E 257 ? ARG E 236 GLY E 248 1 ? 13 
HELX_P HELX_P59 59 THR E 277 ? ARG E 283 ? THR E 268 ARG E 274 1 ? 7  
HELX_P HELX_P60 60 ALA E 294 ? SER E 297 ? ALA E 285 SER E 288 5 ? 4  
HELX_P HELX_P61 61 LEU E 327 ? ASN E 341 ? LEU E 318 ASN E 332 1 ? 15 
HELX_P HELX_P62 62 LEU E 342 ? LEU E 346 ? LEU E 333 LEU E 337 5 ? 5  
HELX_P HELX_P63 63 HIS E 374 ? LEU E 380 ? HIS E 365 LEU E 371 1 ? 7  
HELX_P HELX_P64 64 VAL F 29  ? LYS F 38  ? VAL F 20  LYS F 29  1 ? 10 
HELX_P HELX_P65 65 PRO F 56  ? GLU F 62  ? PRO F 47  GLU F 53  1 ? 7  
HELX_P HELX_P66 66 GLY F 71  ? LYS F 75  ? GLY F 62  LYS F 66  5 ? 5  
HELX_P HELX_P67 67 PRO F 87  ? GLN F 92  ? PRO F 78  GLN F 83  1 ? 6  
HELX_P HELX_P68 68 GLN F 105 ? LYS F 120 ? GLN F 96  LYS F 111 1 ? 16 
HELX_P HELX_P69 69 ILE F 132 ? GLN F 136 ? ILE F 123 GLN F 127 5 ? 5  
HELX_P HELX_P70 70 ASP F 139 ? GLN F 144 ? ASP F 130 GLN F 135 1 ? 6  
HELX_P HELX_P71 71 ALA F 145 ? SER F 160 ? ALA F 136 SER F 151 1 ? 16 
HELX_P HELX_P72 72 GLY F 185 ? GLY F 199 ? GLY F 176 GLY F 190 1 ? 15 
HELX_P HELX_P73 73 LYS F 209 ? GLY F 219 ? LYS F 200 GLY F 210 1 ? 11 
HELX_P HELX_P74 74 ILE F 246 ? LEU F 251 ? ILE F 237 LEU F 242 1 ? 6  
HELX_P HELX_P75 75 ARG F 252 ? ASP F 253 ? ARG F 243 ASP F 244 5 ? 2  
HELX_P HELX_P76 76 HIS F 254 ? MET F 258 ? HIS F 245 MET F 249 5 ? 5  
HELX_P HELX_P77 77 ALA F 294 ? GLY F 298 ? ALA F 285 GLY F 289 5 ? 5  
HELX_P HELX_P78 78 ASN F 322 ? LEU F 327 ? ASN F 313 LEU F 318 1 ? 6  
HELX_P HELX_P79 79 LEU F 327 ? SER F 343 ? LEU F 318 SER F 334 1 ? 17 
HELX_P HELX_P80 80 ASP F 358 ? ALA F 363 ? ASP F 349 ALA F 354 1 ? 6  
HELX_P HELX_P81 81 GLY F 375 ? ALA F 379 ? GLY F 366 ALA F 370 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 3   A . ? PHE 3   A GLY 4   A ? GLY 4   A 1 -5.98  
2 LEU 225 F . ? LEU 216 F PRO 226 F ? PRO 217 F 1 -12.51 
3 GLU 230 F . ? GLU 221 F GLY 231 F ? GLY 222 F 1 0.53   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
C ? 6 ? 
D ? 2 ? 
E ? 7 ? 
F ? 8 ? 
G ? 2 ? 
H ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? anti-parallel 
F 7 8 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU B 355 ? LYS B 356 ? LEU B 355 LYS B 356 
A 2 GLU B 325 ? ALA B 329 ? GLU B 325 ALA B 329 
A 3 LYS B 294 ? PRO B 299 ? LYS B 294 PRO B 299 
A 4 VAL B 370 ? ILE B 374 ? VAL B 370 ILE B 374 
A 5 ASN B 404 ? ILE B 408 ? ASN B 404 ILE B 408 
A 6 THR B 429 ? LEU B 432 ? THR B 429 LEU B 432 
B 1 LEU D 355 ? ASP D 357 ? LEU D 355 ASP D 357 
B 2 GLU D 325 ? ILE D 330 ? GLU D 325 ILE D 330 
B 3 LYS D 294 ? PRO D 299 ? LYS D 294 PRO D 299 
B 4 VAL D 370 ? ILE D 374 ? VAL D 370 ILE D 374 
B 5 VAL D 405 ? LYS D 409 ? VAL D 405 LYS D 409 
B 6 THR D 429 ? TYR D 433 ? THR D 429 TYR D 433 
C 1 GLU E 66  ? VAL E 68  ? GLU E 57  VAL E 59  
C 2 ARG E 42  ? GLU E 46  ? ARG E 33  GLU E 37  
C 3 THR E 12  ? VAL E 15  ? THR E 3   VAL E 6   
C 4 LEU E 79  ? PHE E 81  ? LEU E 70  PHE E 72  
C 5 ILE E 99  ? GLY E 102 ? ILE E 90  GLY E 93  
C 6 THR E 122 ? ALA E 125 ? THR E 113 ALA E 116 
D 1 LEU E 167 ? THR E 168 ? LEU E 158 THR E 159 
D 2 THR E 173 ? ILE E 174 ? THR E 164 ILE E 165 
E 1 LYS E 221 ? ILE E 223 ? LYS E 212 ILE E 214 
E 2 GLN E 201 ? TYR E 205 ? GLN E 192 TYR E 196 
E 3 LYS E 178 ? MET E 182 ? LYS E 169 MET E 173 
E 4 VAL E 260 ? THR E 263 ? VAL E 251 THR E 254 
E 5 VAL E 289 ? ASP E 292 ? VAL E 280 ASP E 283 
E 6 VAL E 315 ? TYR E 318 ? VAL E 306 TYR E 309 
E 7 VAL E 310 ? VAL E 312 ? VAL E 301 VAL E 303 
F 1 ALA F 65  ? VAL F 68  ? ALA F 56  VAL F 59  
F 2 ARG F 42  ? GLU F 46  ? ARG F 33  GLU F 37  
F 3 THR F 12  ? VAL F 15  ? THR F 3   VAL F 6   
F 4 LEU F 79  ? PHE F 81  ? LEU F 70  PHE F 72  
F 5 ILE F 99  ? VAL F 101 ? ILE F 90  VAL F 92  
F 6 THR F 122 ? ILE F 124 ? THR F 113 ILE F 115 
F 7 LEU F 365 ? LYS F 368 ? LEU F 356 LYS F 359 
F 8 GLU F 371 ? VAL F 372 ? GLU F 362 VAL F 363 
G 1 LEU F 167 ? THR F 169 ? LEU F 158 THR F 160 
G 2 GLY F 172 ? ILE F 174 ? GLY F 163 ILE F 165 
H 1 GLN F 201 ? TYR F 205 ? GLN F 192 TYR F 196 
H 2 LYS F 178 ? MET F 182 ? LYS F 169 MET F 173 
H 3 VAL F 260 ? THR F 263 ? VAL F 251 THR F 254 
H 4 VAL F 289 ? ASP F 292 ? VAL F 280 ASP F 283 
H 5 VAL F 315 ? TYR F 318 ? VAL F 306 TYR F 309 
H 6 VAL F 309 ? VAL F 312 ? VAL F 300 VAL F 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS B 356 ? O LYS B 356 N PHE B 328 ? N PHE B 328 
A 2 3 O GLU B 325 ? O GLU B 325 N VAL B 295 ? N VAL B 295 
A 3 4 N VAL B 298 ? N VAL B 298 O ILE B 374 ? O ILE B 374 
A 4 5 N ALA B 371 ? N ALA B 371 O ILE B 406 ? O ILE B 406 
A 5 6 N VAL B 405 ? N VAL B 405 O ARG B 430 ? O ARG B 430 
B 1 2 O LYS D 356 ? O LYS D 356 N ILE D 330 ? N ILE D 330 
B 2 3 O GLU D 325 ? O GLU D 325 N VAL D 295 ? N VAL D 295 
B 3 4 N VAL D 298 ? N VAL D 298 O VAL D 372 ? O VAL D 372 
B 4 5 N VAL D 373 ? N VAL D 373 O ILE D 406 ? O ILE D 406 
B 5 6 N VAL D 407 ? N VAL D 407 O LEU D 432 ? O LEU D 432 
C 1 2 O GLU E 66  ? O GLU E 57  N VAL E 45  ? N VAL E 36  
C 2 3 O ARG E 44  ? O ARG E 35  N VAL E 13  ? N VAL E 4   
C 3 4 N ALA E 14  ? N ALA E 5   O LEU E 79  ? O LEU E 70  
C 4 5 N LEU E 80  ? N LEU E 71  O VAL E 101 ? O VAL E 92  
C 5 6 N VAL E 100 ? N VAL E 91  O THR E 122 ? O THR E 113 
D 1 2 N LEU E 167 ? N LEU E 158 O ILE E 174 ? O ILE E 165 
E 1 2 O ILE E 223 ? O ILE E 214 N ALA E 204 ? N ALA E 195 
E 2 3 O TYR E 205 ? O TYR E 196 N VAL E 181 ? N VAL E 172 
E 3 4 N MET E 180 ? N MET E 171 O VAL E 260 ? O VAL E 251 
E 4 5 N LEU E 261 ? N LEU E 252 O VAL E 289 ? O VAL E 280 
E 5 6 N VAL E 290 ? N VAL E 281 O ARG E 316 ? O ARG E 307 
E 6 7 O VAL E 317 ? O VAL E 308 N VAL E 310 ? N VAL E 301 
F 1 2 O VAL F 68  ? O VAL F 59  N VAL F 45  ? N VAL F 36  
F 2 3 O ARG F 44  ? O ARG F 35  N VAL F 13  ? N VAL F 4   
F 3 4 N ALA F 14  ? N ALA F 5   O LEU F 79  ? O LEU F 70  
F 4 5 N LEU F 80  ? N LEU F 71  O VAL F 101 ? O VAL F 92  
F 5 6 N VAL F 100 ? N VAL F 91  O ILE F 124 ? O ILE F 115 
F 6 7 N VAL F 123 ? N VAL F 114 O MET F 367 ? O MET F 358 
F 7 8 N LYS F 368 ? N LYS F 359 O GLU F 371 ? O GLU F 362 
G 1 2 N LEU F 167 ? N LEU F 158 O ILE F 174 ? O ILE F 165 
H 1 2 O GLN F 201 ? O GLN F 192 N VAL F 179 ? N VAL F 170 
H 2 3 N MET F 180 ? N MET F 171 O ILE F 262 ? O ILE F 253 
H 3 4 N THR F 263 ? N THR F 254 O VAL F 291 ? O VAL F 282 
H 4 5 N ASP F 292 ? N ASP F 283 O TYR F 318 ? O TYR F 309 
H 5 6 O VAL F 315 ? O VAL F 306 N VAL F 312 ? N VAL F 303 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE NAP B 500' 
AC2 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE NAP D 500' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE NAD E 500' 
AC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE NAD F 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 26 GLY B 302 ? GLY B 302 . ? 1_555 ? 
2  AC1 26 LEU B 305 ? LEU B 305 . ? 1_555 ? 
3  AC1 26 SER B 306 ? SER B 306 . ? 1_555 ? 
4  AC1 26 VAL B 333 ? VAL B 333 . ? 1_555 ? 
5  AC1 26 ALA B 334 ? ALA B 334 . ? 1_555 ? 
6  AC1 26 GLY B 335 ? GLY B 335 . ? 1_555 ? 
7  AC1 26 ARG B 336 ? ARG B 336 . ? 1_555 ? 
8  AC1 26 MET B 337 ? MET B 337 . ? 1_555 ? 
9  AC1 26 PRO B 338 ? PRO B 338 . ? 1_555 ? 
10 AC1 26 GLY B 375 ? GLY B 375 . ? 1_555 ? 
11 AC1 26 ALA B 376 ? ALA B 376 . ? 1_555 ? 
12 AC1 26 ASN B 377 ? ASN B 377 . ? 1_555 ? 
13 AC1 26 ASP B 378 ? ASP B 378 . ? 1_555 ? 
14 AC1 26 VAL B 379 ? VAL B 379 . ? 1_555 ? 
15 AC1 26 LYS B 409 ? LYS B 409 . ? 1_555 ? 
16 AC1 26 ARG B 410 ? ARG B 410 . ? 1_555 ? 
17 AC1 26 GLY B 411 ? GLY B 411 . ? 1_555 ? 
18 AC1 26 GLY B 413 ? GLY B 413 . ? 1_555 ? 
19 AC1 26 LYS B 414 ? LYS B 414 . ? 1_555 ? 
20 AC1 26 GLY B 415 ? GLY B 415 . ? 1_555 ? 
21 AC1 26 PHE B 416 ? PHE B 416 . ? 1_555 ? 
22 AC1 26 GLY B 434 ? GLY B 434 . ? 1_555 ? 
23 AC1 26 ASP B 435 ? ASP B 435 . ? 1_555 ? 
24 AC1 26 ALA B 436 ? ALA B 436 . ? 1_555 ? 
25 AC1 26 THR E 133 ? THR E 124 . ? 1_555 ? 
26 AC1 26 GLN E 136 ? GLN E 127 . ? 1_555 ? 
27 AC2 29 GLY D 201 ? GLY D 201 . ? 1_555 ? 
28 AC2 29 ASP D 202 ? ASP D 202 . ? 1_555 ? 
29 AC2 29 PRO D 204 ? PRO D 204 . ? 1_555 ? 
30 AC2 29 MET D 252 ? MET D 252 . ? 1_555 ? 
31 AC2 29 ASN D 253 ? ASN D 253 . ? 1_555 ? 
32 AC2 29 ARG D 254 ? ARG D 254 . ? 1_555 ? 
33 AC2 29 GLY D 302 ? GLY D 302 . ? 1_555 ? 
34 AC2 29 LEU D 305 ? LEU D 305 . ? 1_555 ? 
35 AC2 29 SER D 306 ? SER D 306 . ? 1_555 ? 
36 AC2 29 VAL D 333 ? VAL D 333 . ? 1_555 ? 
37 AC2 29 ALA D 334 ? ALA D 334 . ? 1_555 ? 
38 AC2 29 GLY D 335 ? GLY D 335 . ? 1_555 ? 
39 AC2 29 ARG D 336 ? ARG D 336 . ? 1_555 ? 
40 AC2 29 MET D 337 ? MET D 337 . ? 1_555 ? 
41 AC2 29 GLY D 375 ? GLY D 375 . ? 1_555 ? 
42 AC2 29 ALA D 376 ? ALA D 376 . ? 1_555 ? 
43 AC2 29 ASN D 377 ? ASN D 377 . ? 1_555 ? 
44 AC2 29 ASP D 378 ? ASP D 378 . ? 1_555 ? 
45 AC2 29 VAL D 379 ? VAL D 379 . ? 1_555 ? 
46 AC2 29 LYS D 409 ? LYS D 409 . ? 1_555 ? 
47 AC2 29 ARG D 410 ? ARG D 410 . ? 1_555 ? 
48 AC2 29 GLY D 411 ? GLY D 411 . ? 1_555 ? 
49 AC2 29 GLY D 413 ? GLY D 413 . ? 1_555 ? 
50 AC2 29 LYS D 414 ? LYS D 414 . ? 1_555 ? 
51 AC2 29 GLY D 415 ? GLY D 415 . ? 1_555 ? 
52 AC2 29 PHE D 416 ? PHE D 416 . ? 1_555 ? 
53 AC2 29 GLY D 434 ? GLY D 434 . ? 1_555 ? 
54 AC2 29 ASP D 435 ? ASP D 435 . ? 1_555 ? 
55 AC2 29 ALA D 436 ? ALA D 436 . ? 1_555 ? 
56 AC3 10 LEU E 141 ? LEU E 132 . ? 1_555 ? 
57 AC3 10 GLY E 183 ? GLY E 174 . ? 1_555 ? 
58 AC3 10 VAL E 184 ? VAL E 175 . ? 1_555 ? 
59 AC3 10 GLY E 185 ? GLY E 176 . ? 1_555 ? 
60 AC3 10 TYR E 205 ? TYR E 196 . ? 1_555 ? 
61 AC3 10 ASP E 206 ? ASP E 197 . ? 1_555 ? 
62 AC3 10 LYS E 244 ? LYS E 235 . ? 1_555 ? 
63 AC3 10 THR E 264 ? THR E 255 . ? 1_555 ? 
64 AC3 10 ALA E 265 ? ALA E 256 . ? 1_555 ? 
65 AC3 10 LEU E 275 ? LEU E 266 . ? 1_555 ? 
66 AC4 14 ARG F 131 ? ARG F 122 . ? 1_555 ? 
67 AC4 14 GLN F 136 ? GLN F 127 . ? 1_555 ? 
68 AC4 14 GLY F 183 ? GLY F 174 . ? 1_555 ? 
69 AC4 14 VAL F 184 ? VAL F 175 . ? 1_555 ? 
70 AC4 14 GLY F 185 ? GLY F 176 . ? 1_555 ? 
71 AC4 14 VAL F 186 ? VAL F 177 . ? 1_555 ? 
72 AC4 14 TYR F 205 ? TYR F 196 . ? 1_555 ? 
73 AC4 14 ASP F 206 ? ASP F 197 . ? 1_555 ? 
74 AC4 14 ARG F 208 ? ARG F 199 . ? 1_555 ? 
75 AC4 14 GLN F 247 ? GLN F 238 . ? 1_555 ? 
76 AC4 14 THR F 264 ? THR F 255 . ? 1_555 ? 
77 AC4 14 ALA F 265 ? ALA F 256 . ? 1_555 ? 
78 AC4 14 GLN F 266 ? GLN F 257 . ? 1_555 ? 
79 AC4 14 LEU F 275 ? LEU F 266 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4O9U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4O9U 
_atom_sites.fract_transf_matrix[1][1]   0.005703 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004514 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006227 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009134 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 1   ? 168.459 -8.885   46.291  1.00 308.68 ? 1   MET A N   1 
ATOM   2     C CA  . MET A 1 1   ? 167.218 -9.160   47.075  1.00 308.52 ? 1   MET A CA  1 
ATOM   3     C C   . MET A 1 1   ? 166.190 -8.018   47.008  1.00 304.71 ? 1   MET A C   1 
ATOM   4     O O   . MET A 1 1   ? 165.393 -7.842   47.933  1.00 294.11 ? 1   MET A O   1 
ATOM   5     C CB  . MET A 1 1   ? 167.572 -9.468   48.537  1.00 296.53 ? 1   MET A CB  1 
ATOM   6     C CG  . MET A 1 1   ? 168.134 -10.860  48.793  1.00 287.74 ? 1   MET A CG  1 
ATOM   7     S SD  . MET A 1 1   ? 169.764 -11.157  48.079  1.00 278.14 ? 1   MET A SD  1 
ATOM   8     C CE  . MET A 1 1   ? 170.524 -12.111  49.392  1.00 275.66 ? 1   MET A CE  1 
ATOM   9     N N   . GLU A 1 2   ? 166.215 -7.248   45.916  1.00 316.18 ? 2   GLU A N   1 
ATOM   10    C CA  . GLU A 1 2   ? 165.264 -6.143   45.683  1.00 328.68 ? 2   GLU A CA  1 
ATOM   11    C C   . GLU A 1 2   ? 165.195 -5.770   44.192  1.00 332.52 ? 2   GLU A C   1 
ATOM   12    O O   . GLU A 1 2   ? 166.130 -6.047   43.436  1.00 320.29 ? 2   GLU A O   1 
ATOM   13    C CB  . GLU A 1 2   ? 165.618 -4.919   46.550  1.00 338.45 ? 2   GLU A CB  1 
ATOM   14    C CG  . GLU A 1 2   ? 164.565 -3.808   46.602  1.00 332.83 ? 2   GLU A CG  1 
ATOM   15    C CD  . GLU A 1 2   ? 163.252 -4.225   47.255  1.00 328.71 ? 2   GLU A CD  1 
ATOM   16    O OE1 . GLU A 1 2   ? 162.193 -3.700   46.841  1.00 324.36 ? 2   GLU A OE1 1 
ATOM   17    O OE2 . GLU A 1 2   ? 163.267 -5.071   48.178  1.00 326.77 ? 2   GLU A OE2 1 
ATOM   18    N N   . PHE A 1 3   ? 164.084 -5.144   43.786  1.00 326.48 ? 3   PHE A N   1 
ATOM   19    C CA  . PHE A 1 3   ? 163.802 -4.784   42.383  1.00 304.89 ? 3   PHE A CA  1 
ATOM   20    C C   . PHE A 1 3   ? 163.501 -6.029   41.520  1.00 300.23 ? 3   PHE A C   1 
ATOM   21    O O   . PHE A 1 3   ? 164.087 -6.177   40.450  1.00 298.04 ? 3   PHE A O   1 
ATOM   22    C CB  . PHE A 1 3   ? 164.966 -3.946   41.789  1.00 289.81 ? 3   PHE A CB  1 
ATOM   23    C CG  . PHE A 1 3   ? 164.594 -3.093   40.593  1.00 270.28 ? 3   PHE A CG  1 
ATOM   24    C CD1 . PHE A 1 3   ? 164.698 -3.593   39.294  1.00 262.43 ? 3   PHE A CD1 1 
ATOM   25    C CD2 . PHE A 1 3   ? 164.194 -1.770   40.762  1.00 262.37 ? 3   PHE A CD2 1 
ATOM   26    C CE1 . PHE A 1 3   ? 164.375 -2.807   38.197  1.00 253.49 ? 3   PHE A CE1 1 
ATOM   27    C CE2 . PHE A 1 3   ? 163.872 -0.978   39.668  1.00 254.67 ? 3   PHE A CE2 1 
ATOM   28    C CZ  . PHE A 1 3   ? 163.962 -1.497   38.385  1.00 251.95 ? 3   PHE A CZ  1 
ATOM   29    N N   . GLY A 1 4   ? 162.622 -6.940   41.960  1.00 291.32 ? 4   GLY A N   1 
ATOM   30    C CA  . GLY A 1 4   ? 161.970 -6.951   43.281  1.00 278.67 ? 4   GLY A CA  1 
ATOM   31    C C   . GLY A 1 4   ? 162.541 -8.046   44.175  1.00 264.85 ? 4   GLY A C   1 
ATOM   32    O O   . GLY A 1 4   ? 163.350 -8.859   43.719  1.00 268.11 ? 4   GLY A O   1 
ATOM   33    N N   . PHE A 1 5   ? 162.107 -8.076   45.438  1.00 246.17 ? 5   PHE A N   1 
ATOM   34    C CA  . PHE A 1 5   ? 162.719 -8.919   46.487  1.00 227.43 ? 5   PHE A CA  1 
ATOM   35    C C   . PHE A 1 5   ? 163.177 -10.315  46.050  1.00 212.03 ? 5   PHE A C   1 
ATOM   36    O O   . PHE A 1 5   ? 164.341 -10.677  46.234  1.00 206.67 ? 5   PHE A O   1 
ATOM   37    C CB  . PHE A 1 5   ? 161.815 -9.012   47.730  1.00 229.30 ? 5   PHE A CB  1 
ATOM   38    C CG  . PHE A 1 5   ? 162.343 -9.933   48.804  1.00 230.79 ? 5   PHE A CG  1 
ATOM   39    C CD1 . PHE A 1 5   ? 163.372 -9.527   49.652  1.00 231.67 ? 5   PHE A CD1 1 
ATOM   40    C CD2 . PHE A 1 5   ? 161.808 -11.205  48.972  1.00 231.19 ? 5   PHE A CD2 1 
ATOM   41    C CE1 . PHE A 1 5   ? 163.859 -10.374  50.638  1.00 231.97 ? 5   PHE A CE1 1 
ATOM   42    C CE2 . PHE A 1 5   ? 162.291 -12.056  49.956  1.00 231.85 ? 5   PHE A CE2 1 
ATOM   43    C CZ  . PHE A 1 5   ? 163.317 -11.640  50.791  1.00 232.23 ? 5   PHE A CZ  1 
ATOM   44    N N   . TRP A 1 6   ? 162.258 -11.091  45.483  1.00 196.31 ? 6   TRP A N   1 
ATOM   45    C CA  . TRP A 1 6   ? 162.540 -12.476  45.109  1.00 183.03 ? 6   TRP A CA  1 
ATOM   46    C C   . TRP A 1 6   ? 163.406 -12.586  43.864  1.00 173.78 ? 6   TRP A C   1 
ATOM   47    O O   . TRP A 1 6   ? 164.308 -13.423  43.802  1.00 170.08 ? 6   TRP A O   1 
ATOM   48    C CB  . TRP A 1 6   ? 161.238 -13.257  44.930  1.00 184.44 ? 6   TRP A CB  1 
ATOM   49    C CG  . TRP A 1 6   ? 160.488 -13.385  46.207  1.00 186.27 ? 6   TRP A CG  1 
ATOM   50    C CD1 . TRP A 1 6   ? 159.335 -12.743  46.550  1.00 186.85 ? 6   TRP A CD1 1 
ATOM   51    C CD2 . TRP A 1 6   ? 160.857 -14.183  47.336  1.00 188.11 ? 6   TRP A CD2 1 
ATOM   52    N NE1 . TRP A 1 6   ? 158.953 -13.103  47.820  1.00 188.37 ? 6   TRP A NE1 1 
ATOM   53    C CE2 . TRP A 1 6   ? 159.870 -13.986  48.326  1.00 189.16 ? 6   TRP A CE2 1 
ATOM   54    C CE3 . TRP A 1 6   ? 161.922 -15.052  47.605  1.00 190.38 ? 6   TRP A CE3 1 
ATOM   55    C CZ2 . TRP A 1 6   ? 159.915 -14.628  49.567  1.00 191.36 ? 6   TRP A CZ2 1 
ATOM   56    C CZ3 . TRP A 1 6   ? 161.967 -15.689  48.839  1.00 193.30 ? 6   TRP A CZ3 1 
ATOM   57    C CH2 . TRP A 1 6   ? 160.969 -15.471  49.805  1.00 192.79 ? 6   TRP A CH2 1 
ATOM   58    N N   . SER A 1 7   ? 163.126 -11.726  42.887  1.00 165.42 ? 7   SER A N   1 
ATOM   59    C CA  . SER A 1 7   ? 163.843 -11.700  41.614  1.00 158.51 ? 7   SER A CA  1 
ATOM   60    C C   . SER A 1 7   ? 165.357 -11.636  41.804  1.00 153.59 ? 7   SER A C   1 
ATOM   61    O O   . SER A 1 7   ? 166.094 -12.423  41.212  1.00 154.76 ? 7   SER A O   1 
ATOM   62    C CB  . SER A 1 7   ? 163.372 -10.517  40.763  1.00 158.06 ? 7   SER A CB  1 
ATOM   63    O OG  . SER A 1 7   ? 161.959 -10.461  40.678  1.00 156.75 ? 7   SER A OG  1 
ATOM   64    N N   . ALA A 1 8   ? 165.809 -10.704  42.639  1.00 146.44 ? 8   ALA A N   1 
ATOM   65    C CA  . ALA A 1 8   ? 167.238 -10.501  42.871  1.00 138.88 ? 8   ALA A CA  1 
ATOM   66    C C   . ALA A 1 8   ? 167.815 -11.442  43.928  1.00 132.26 ? 8   ALA A C   1 
ATOM   67    O O   . ALA A 1 8   ? 169.035 -11.585  44.040  1.00 129.74 ? 8   ALA A O   1 
ATOM   68    C CB  . ALA A 1 8   ? 167.521 -9.050   43.220  1.00 142.25 ? 8   ALA A CB  1 
ATOM   69    N N   . LEU A 1 9   ? 166.936 -12.074  44.701  1.00 126.22 ? 9   LEU A N   1 
ATOM   70    C CA  . LEU A 1 9   ? 167.351 -13.127  45.617  1.00 123.25 ? 9   LEU A CA  1 
ATOM   71    C C   . LEU A 1 9   ? 167.719 -14.375  44.816  1.00 122.97 ? 9   LEU A C   1 
ATOM   72    O O   . LEU A 1 9   ? 168.701 -15.051  45.132  1.00 121.66 ? 9   LEU A O   1 
ATOM   73    C CB  . LEU A 1 9   ? 166.255 -13.422  46.640  1.00 123.04 ? 9   LEU A CB  1 
ATOM   74    C CG  . LEU A 1 9   ? 166.482 -14.510  47.697  1.00 124.19 ? 9   LEU A CG  1 
ATOM   75    C CD1 . LEU A 1 9   ? 167.866 -14.463  48.334  1.00 124.38 ? 9   LEU A CD1 1 
ATOM   76    C CD2 . LEU A 1 9   ? 165.405 -14.403  48.763  1.00 126.01 ? 9   LEU A CD2 1 
ATOM   77    N N   . TYR A 1 10  ? 166.923 -14.667  43.786  1.00 124.44 ? 10  TYR A N   1 
ATOM   78    C CA  . TYR A 1 10  ? 167.302 -15.642  42.766  1.00 126.76 ? 10  TYR A CA  1 
ATOM   79    C C   . TYR A 1 10  ? 168.662 -15.237  42.217  1.00 128.09 ? 10  TYR A C   1 
ATOM   80    O O   . TYR A 1 10  ? 169.642 -15.964  42.383  1.00 128.26 ? 10  TYR A O   1 
ATOM   81    C CB  . TYR A 1 10  ? 166.287 -15.668  41.617  1.00 127.06 ? 10  TYR A CB  1 
ATOM   82    C CG  . TYR A 1 10  ? 165.101 -16.587  41.808  1.00 126.73 ? 10  TYR A CG  1 
ATOM   83    C CD1 . TYR A 1 10  ? 165.236 -17.968  41.676  1.00 126.97 ? 10  TYR A CD1 1 
ATOM   84    C CD2 . TYR A 1 10  ? 163.837 -16.073  42.088  1.00 126.46 ? 10  TYR A CD2 1 
ATOM   85    C CE1 . TYR A 1 10  ? 164.148 -18.813  41.839  1.00 126.73 ? 10  TYR A CE1 1 
ATOM   86    C CE2 . TYR A 1 10  ? 162.744 -16.909  42.254  1.00 126.07 ? 10  TYR A CE2 1 
ATOM   87    C CZ  . TYR A 1 10  ? 162.904 -18.277  42.125  1.00 126.18 ? 10  TYR A CZ  1 
ATOM   88    O OH  . TYR A 1 10  ? 161.826 -19.117  42.287  1.00 125.60 ? 10  TYR A OH  1 
ATOM   89    N N   . ILE A 1 11  ? 168.707 -14.054  41.596  1.00 129.47 ? 11  ILE A N   1 
ATOM   90    C CA  . ILE A 1 11  ? 169.926 -13.479  41.014  1.00 129.53 ? 11  ILE A CA  1 
ATOM   91    C C   . ILE A 1 11  ? 171.147 -13.723  41.899  1.00 129.03 ? 11  ILE A C   1 
ATOM   92    O O   . ILE A 1 11  ? 172.159 -14.238  41.430  1.00 129.06 ? 11  ILE A O   1 
ATOM   93    C CB  . ILE A 1 11  ? 169.760 -11.965  40.704  1.00 130.03 ? 11  ILE A CB  1 
ATOM   94    C CG1 . ILE A 1 11  ? 168.829 -11.761  39.500  1.00 130.63 ? 11  ILE A CG1 1 
ATOM   95    C CG2 . ILE A 1 11  ? 171.109 -11.296  40.451  1.00 129.58 ? 11  ILE A CG2 1 
ATOM   96    C CD1 . ILE A 1 11  ? 168.377 -10.329  39.282  1.00 130.84 ? 11  ILE A CD1 1 
ATOM   97    N N   . PHE A 1 12  ? 171.028 -13.373  43.178  1.00 128.46 ? 12  PHE A N   1 
ATOM   98    C CA  . PHE A 1 12  ? 172.104 -13.556  44.147  1.00 128.41 ? 12  PHE A CA  1 
ATOM   99    C C   . PHE A 1 12  ? 172.618 -14.998  44.202  1.00 125.21 ? 12  PHE A C   1 
ATOM   100   O O   . PHE A 1 12  ? 173.815 -15.238  44.032  1.00 122.97 ? 12  PHE A O   1 
ATOM   101   C CB  . PHE A 1 12  ? 171.651 -13.089  45.533  1.00 133.12 ? 12  PHE A CB  1 
ATOM   102   C CG  . PHE A 1 12  ? 172.544 -13.547  46.648  1.00 138.77 ? 12  PHE A CG  1 
ATOM   103   C CD1 . PHE A 1 12  ? 173.776 -12.939  46.863  1.00 140.77 ? 12  PHE A CD1 1 
ATOM   104   C CD2 . PHE A 1 12  ? 172.154 -14.589  47.484  1.00 141.79 ? 12  PHE A CD2 1 
ATOM   105   C CE1 . PHE A 1 12  ? 174.603 -13.363  47.891  1.00 144.08 ? 12  PHE A CE1 1 
ATOM   106   C CE2 . PHE A 1 12  ? 172.976 -15.017  48.514  1.00 144.20 ? 12  PHE A CE2 1 
ATOM   107   C CZ  . PHE A 1 12  ? 174.203 -14.403  48.718  1.00 145.10 ? 12  PHE A CZ  1 
ATOM   108   N N   . VAL A 1 13  ? 171.709 -15.943  44.441  1.00 122.83 ? 13  VAL A N   1 
ATOM   109   C CA  . VAL A 1 13  ? 172.052 -17.366  44.525  1.00 121.52 ? 13  VAL A CA  1 
ATOM   110   C C   . VAL A 1 13  ? 172.447 -17.932  43.161  1.00 124.55 ? 13  VAL A C   1 
ATOM   111   O O   . VAL A 1 13  ? 173.322 -18.797  43.071  1.00 124.55 ? 13  VAL A O   1 
ATOM   112   C CB  . VAL A 1 13  ? 170.917 -18.186  45.184  1.00 118.32 ? 13  VAL A CB  1 
ATOM   113   C CG1 . VAL A 1 13  ? 170.883 -19.626  44.684  1.00 115.95 ? 13  VAL A CG1 1 
ATOM   114   C CG2 . VAL A 1 13  ? 171.067 -18.150  46.696  1.00 117.41 ? 13  VAL A CG2 1 
ATOM   115   N N   . LEU A 1 14  ? 171.809 -17.425  42.108  1.00 129.17 ? 14  LEU A N   1 
ATOM   116   C CA  . LEU A 1 14  ? 172.150 -17.791  40.732  1.00 134.38 ? 14  LEU A CA  1 
ATOM   117   C C   . LEU A 1 14  ? 173.530 -17.267  40.320  1.00 137.75 ? 14  LEU A C   1 
ATOM   118   O O   . LEU A 1 14  ? 174.136 -17.784  39.378  1.00 141.34 ? 14  LEU A O   1 
ATOM   119   C CB  . LEU A 1 14  ? 171.083 -17.287  39.754  1.00 134.12 ? 14  LEU A CB  1 
ATOM   120   C CG  . LEU A 1 14  ? 169.673 -17.886  39.804  1.00 133.84 ? 14  LEU A CG  1 
ATOM   121   C CD1 . LEU A 1 14  ? 168.720 -17.045  38.971  1.00 133.44 ? 14  LEU A CD1 1 
ATOM   122   C CD2 . LEU A 1 14  ? 169.655 -19.334  39.341  1.00 134.17 ? 14  LEU A CD2 1 
ATOM   123   N N   . THR A 1 15  ? 174.010 -16.238  41.022  1.00 138.32 ? 15  THR A N   1 
ATOM   124   C CA  . THR A 1 15  ? 175.355 -15.694  40.811  1.00 137.39 ? 15  THR A CA  1 
ATOM   125   C C   . THR A 1 15  ? 176.351 -16.336  41.778  1.00 134.73 ? 15  THR A C   1 
ATOM   126   O O   . THR A 1 15  ? 177.550 -16.411  41.493  1.00 132.91 ? 15  THR A O   1 
ATOM   127   C CB  . THR A 1 15  ? 175.389 -14.159  40.986  1.00 138.75 ? 15  THR A CB  1 
ATOM   128   O OG1 . THR A 1 15  ? 174.253 -13.571  40.339  1.00 140.15 ? 15  THR A OG1 1 
ATOM   129   C CG2 . THR A 1 15  ? 176.662 -13.570  40.385  1.00 140.04 ? 15  THR A CG2 1 
ATOM   130   N N   . ALA A 1 16  ? 175.843 -16.795  42.920  1.00 133.01 ? 16  ALA A N   1 
ATOM   131   C CA  . ALA A 1 16  ? 176.660 -17.480  43.918  1.00 133.01 ? 16  ALA A CA  1 
ATOM   132   C C   . ALA A 1 16  ? 177.151 -18.840  43.419  1.00 136.62 ? 16  ALA A C   1 
ATOM   133   O O   . ALA A 1 16  ? 178.318 -19.186  43.615  1.00 136.77 ? 16  ALA A O   1 
ATOM   134   C CB  . ALA A 1 16  ? 175.879 -17.645  45.213  1.00 20.00  ? 16  ALA A CB  1 
ATOM   135   N N   . PHE A 1 17  ? 176.259 -19.599  42.779  1.00 141.27 ? 17  PHE A N   1 
ATOM   136   C CA  . PHE A 1 17  ? 176.595 -20.913  42.214  1.00 144.15 ? 17  PHE A CA  1 
ATOM   137   C C   . PHE A 1 17  ? 177.361 -20.822  40.890  1.00 148.83 ? 17  PHE A C   1 
ATOM   138   O O   . PHE A 1 17  ? 178.219 -21.664  40.610  1.00 153.36 ? 17  PHE A O   1 
ATOM   139   C CB  . PHE A 1 17  ? 175.337 -21.773  42.022  1.00 139.08 ? 17  PHE A CB  1 
ATOM   140   C CG  . PHE A 1 17  ? 174.913 -22.529  43.251  1.00 133.56 ? 17  PHE A CG  1 
ATOM   141   C CD1 . PHE A 1 17  ? 175.560 -23.706  43.623  1.00 130.66 ? 17  PHE A CD1 1 
ATOM   142   C CD2 . PHE A 1 17  ? 173.853 -22.075  44.027  1.00 131.69 ? 17  PHE A CD2 1 
ATOM   143   C CE1 . PHE A 1 17  ? 175.167 -24.405  44.754  1.00 128.33 ? 17  PHE A CE1 1 
ATOM   144   C CE2 . PHE A 1 17  ? 173.454 -22.771  45.158  1.00 130.10 ? 17  PHE A CE2 1 
ATOM   145   C CZ  . PHE A 1 17  ? 174.113 -23.935  45.523  1.00 128.66 ? 17  PHE A CZ  1 
ATOM   146   N N   . LEU A 1 18  ? 177.037 -19.812  40.079  1.00 149.08 ? 18  LEU A N   1 
ATOM   147   C CA  . LEU A 1 18  ? 177.677 -19.618  38.773  1.00 145.51 ? 18  LEU A CA  1 
ATOM   148   C C   . LEU A 1 18  ? 179.150 -19.238  38.909  1.00 151.50 ? 18  LEU A C   1 
ATOM   149   O O   . LEU A 1 18  ? 179.995 -19.785  38.202  1.00 153.92 ? 18  LEU A O   1 
ATOM   150   C CB  . LEU A 1 18  ? 176.910 -18.590  37.928  1.00 134.24 ? 18  LEU A CB  1 
ATOM   151   C CG  . LEU A 1 18  ? 177.368 -18.257  36.502  1.00 125.39 ? 18  LEU A CG  1 
ATOM   152   C CD1 . LEU A 1 18  ? 177.656 -19.505  35.681  1.00 120.50 ? 18  LEU A CD1 1 
ATOM   153   C CD2 . LEU A 1 18  ? 176.321 -17.391  35.821  1.00 122.03 ? 18  LEU A CD2 1 
ATOM   154   N N   . GLY A 1 19  ? 179.446 -18.312  39.821  1.00 157.12 ? 19  GLY A N   1 
ATOM   155   C CA  . GLY A 1 19  ? 180.824 -17.925  40.130  1.00 163.51 ? 19  GLY A CA  1 
ATOM   156   C C   . GLY A 1 19  ? 181.627 -19.050  40.765  1.00 168.46 ? 19  GLY A C   1 
ATOM   157   O O   . GLY A 1 19  ? 182.836 -19.152  40.558  1.00 169.15 ? 19  GLY A O   1 
ATOM   158   N N   . TYR A 1 20  ? 180.940 -19.892  41.536  1.00 173.42 ? 20  TYR A N   1 
ATOM   159   C CA  . TYR A 1 20  ? 181.530 -21.067  42.181  1.00 177.94 ? 20  TYR A CA  1 
ATOM   160   C C   . TYR A 1 20  ? 182.001 -22.098  41.149  1.00 177.64 ? 20  TYR A C   1 
ATOM   161   O O   . TYR A 1 20  ? 183.180 -22.457  41.113  1.00 172.80 ? 20  TYR A O   1 
ATOM   162   C CB  . TYR A 1 20  ? 180.507 -21.680  43.152  1.00 182.91 ? 20  TYR A CB  1 
ATOM   163   C CG  . TYR A 1 20  ? 180.895 -22.998  43.796  1.00 187.01 ? 20  TYR A CG  1 
ATOM   164   C CD1 . TYR A 1 20  ? 181.599 -23.031  45.000  1.00 189.55 ? 20  TYR A CD1 1 
ATOM   165   C CD2 . TYR A 1 20  ? 180.523 -24.214  43.219  1.00 187.11 ? 20  TYR A CD2 1 
ATOM   166   C CE1 . TYR A 1 20  ? 181.944 -24.237  45.596  1.00 190.98 ? 20  TYR A CE1 1 
ATOM   167   C CE2 . TYR A 1 20  ? 180.863 -25.422  43.808  1.00 187.94 ? 20  TYR A CE2 1 
ATOM   168   C CZ  . TYR A 1 20  ? 181.572 -25.429  44.996  1.00 189.83 ? 20  TYR A CZ  1 
ATOM   169   O OH  . TYR A 1 20  ? 181.903 -26.635  45.575  1.00 189.72 ? 20  TYR A OH  1 
ATOM   170   N N   . GLU A 1 21  ? 181.075 -22.554  40.307  1.00 181.77 ? 21  GLU A N   1 
ATOM   171   C CA  . GLU A 1 21  ? 181.362 -23.565  39.288  1.00 186.90 ? 21  GLU A CA  1 
ATOM   172   C C   . GLU A 1 21  ? 182.406 -23.090  38.271  1.00 189.79 ? 21  GLU A C   1 
ATOM   173   O O   . GLU A 1 21  ? 183.157 -23.899  37.724  1.00 188.02 ? 21  GLU A O   1 
ATOM   174   C CB  . GLU A 1 21  ? 180.069 -23.995  38.581  1.00 188.99 ? 21  GLU A CB  1 
ATOM   175   C CG  . GLU A 1 21  ? 180.160 -25.298  37.790  1.00 190.47 ? 21  GLU A CG  1 
ATOM   176   C CD  . GLU A 1 21  ? 180.185 -26.548  38.660  1.00 190.09 ? 21  GLU A CD  1 
ATOM   177   O OE1 . GLU A 1 21  ? 180.631 -27.605  38.162  1.00 188.73 ? 21  GLU A OE1 1 
ATOM   178   O OE2 . GLU A 1 21  ? 179.757 -26.489  39.835  1.00 190.36 ? 21  GLU A OE2 1 
ATOM   179   N N   . LEU A 1 22  ? 182.451 -21.779  38.032  1.00 197.19 ? 22  LEU A N   1 
ATOM   180   C CA  . LEU A 1 22  ? 183.445 -21.176  37.140  1.00 204.81 ? 22  LEU A CA  1 
ATOM   181   C C   . LEU A 1 22  ? 184.867 -21.286  37.689  1.00 202.53 ? 22  LEU A C   1 
ATOM   182   O O   . LEU A 1 22  ? 185.836 -21.242  36.929  1.00 202.67 ? 22  LEU A O   1 
ATOM   183   C CB  . LEU A 1 22  ? 183.111 -19.703  36.866  1.00 214.99 ? 22  LEU A CB  1 
ATOM   184   C CG  . LEU A 1 22  ? 182.014 -19.365  35.848  1.00 222.65 ? 22  LEU A CG  1 
ATOM   185   C CD1 . LEU A 1 22  ? 181.604 -17.904  35.961  1.00 225.98 ? 22  LEU A CD1 1 
ATOM   186   C CD2 . LEU A 1 22  ? 182.440 -19.697  34.424  1.00 227.45 ? 22  LEU A CD2 1 
ATOM   187   N N   . ILE A 1 23  ? 184.982 -21.431  39.007  1.00 200.77 ? 23  ILE A N   1 
ATOM   188   C CA  . ILE A 1 23  ? 186.283 -21.453  39.676  1.00 202.68 ? 23  ILE A CA  1 
ATOM   189   C C   . ILE A 1 23  ? 186.652 -22.856  40.177  1.00 205.77 ? 23  ILE A C   1 
ATOM   190   O O   . ILE A 1 23  ? 187.777 -23.091  40.623  1.00 203.96 ? 23  ILE A O   1 
ATOM   191   C CB  . ILE A 1 23  ? 186.356 -20.383  40.799  1.00 202.55 ? 23  ILE A CB  1 
ATOM   192   C CG1 . ILE A 1 23  ? 186.036 -18.983  40.244  1.00 203.77 ? 23  ILE A CG1 1 
ATOM   193   C CG2 . ILE A 1 23  ? 187.709 -20.391  41.503  1.00 203.31 ? 23  ILE A CG2 1 
ATOM   194   C CD1 . ILE A 1 23  ? 186.874 -18.533  39.058  1.00 203.97 ? 23  ILE A CD1 1 
ATOM   195   N N   . THR A 1 24  ? 185.708 -23.791  40.085  1.00 213.32 ? 24  THR A N   1 
ATOM   196   C CA  . THR A 1 24  ? 186.011 -25.201  40.325  1.00 224.76 ? 24  THR A CA  1 
ATOM   197   C C   . THR A 1 24  ? 186.833 -25.747  39.156  1.00 235.86 ? 24  THR A C   1 
ATOM   198   O O   . THR A 1 24  ? 186.597 -25.376  38.003  1.00 242.61 ? 24  THR A O   1 
ATOM   199   C CB  . THR A 1 24  ? 184.738 -26.055  40.510  1.00 222.89 ? 24  THR A CB  1 
ATOM   200   O OG1 . THR A 1 24  ? 183.848 -25.848  39.407  1.00 221.88 ? 24  THR A OG1 1 
ATOM   201   C CG2 . THR A 1 24  ? 184.024 -25.695  41.809  1.00 221.26 ? 24  THR A CG2 1 
ATOM   202   N N   . ARG A 1 25  ? 187.795 -26.616  39.468  1.00 245.00 ? 25  ARG A N   1 
ATOM   203   C CA  . ARG A 1 25  ? 188.705 -27.225  38.479  1.00 249.90 ? 25  ARG A CA  1 
ATOM   204   C C   . ARG A 1 25  ? 189.665 -26.237  37.796  1.00 244.96 ? 25  ARG A C   1 
ATOM   205   O O   . ARG A 1 25  ? 189.926 -26.332  36.591  1.00 246.80 ? 25  ARG A O   1 
ATOM   206   C CB  . ARG A 1 25  ? 187.937 -28.068  37.444  1.00 258.44 ? 25  ARG A CB  1 
ATOM   207   C CG  . ARG A 1 25  ? 187.673 -29.508  37.868  1.00 263.02 ? 25  ARG A CG  1 
ATOM   208   C CD  . ARG A 1 25  ? 188.797 -30.456  37.457  1.00 265.84 ? 25  ARG A CD  1 
ATOM   209   N NE  . ARG A 1 25  ? 190.029 -30.235  38.215  1.00 269.04 ? 25  ARG A NE  1 
ATOM   210   C CZ  . ARG A 1 25  ? 191.111 -29.618  37.745  1.00 271.80 ? 25  ARG A CZ  1 
ATOM   211   N NH1 . ARG A 1 25  ? 191.139 -29.149  36.502  1.00 272.84 ? 25  ARG A NH1 1 
ATOM   212   N NH2 . ARG A 1 25  ? 192.171 -29.467  38.527  1.00 273.13 ? 25  ARG A NH2 1 
ATOM   213   N N   . VAL A 1 26  ? 190.196 -25.303  38.582  1.00 235.05 ? 26  VAL A N   1 
ATOM   214   C CA  . VAL A 1 26  ? 191.198 -24.354  38.098  1.00 224.20 ? 26  VAL A CA  1 
ATOM   215   C C   . VAL A 1 26  ? 192.610 -24.840  38.466  1.00 219.47 ? 26  VAL A C   1 
ATOM   216   O O   . VAL A 1 26  ? 192.842 -25.276  39.598  1.00 218.78 ? 26  VAL A O   1 
ATOM   217   C CB  . VAL A 1 26  ? 190.919 -22.912  38.608  1.00 221.90 ? 26  VAL A CB  1 
ATOM   218   C CG1 . VAL A 1 26  ? 191.076 -22.812  40.122  1.00 221.90 ? 26  VAL A CG1 1 
ATOM   219   C CG2 . VAL A 1 26  ? 191.801 -21.893  37.897  1.00 218.56 ? 26  VAL A CG2 1 
ATOM   220   N N   . PRO A 1 27  ? 193.546 -24.798  37.495  1.00 215.51 ? 27  PRO A N   1 
ATOM   221   C CA  . PRO A 1 27  ? 194.961 -25.145  37.700  1.00 212.45 ? 27  PRO A CA  1 
ATOM   222   C C   . PRO A 1 27  ? 195.674 -24.300  38.768  1.00 205.14 ? 27  PRO A C   1 
ATOM   223   O O   . PRO A 1 27  ? 195.162 -23.255  39.171  1.00 204.54 ? 27  PRO A O   1 
ATOM   224   C CB  . PRO A 1 27  ? 195.591 -24.897  36.318  1.00 216.95 ? 27  PRO A CB  1 
ATOM   225   C CG  . PRO A 1 27  ? 194.567 -24.151  35.523  1.00 216.12 ? 27  PRO A CG  1 
ATOM   226   C CD  . PRO A 1 27  ? 193.248 -24.596  36.066  1.00 214.57 ? 27  PRO A CD  1 
ATOM   227   N N   . VAL A 1 28  ? 196.851 -24.756  39.201  1.00 195.48 ? 28  VAL A N   1 
ATOM   228   C CA  . VAL A 1 28  ? 197.607 -24.114  40.287  1.00 188.20 ? 28  VAL A CA  1 
ATOM   229   C C   . VAL A 1 28  ? 198.518 -22.958  39.843  1.00 191.81 ? 28  VAL A C   1 
ATOM   230   O O   . VAL A 1 28  ? 198.643 -21.965  40.564  1.00 191.02 ? 28  VAL A O   1 
ATOM   231   C CB  . VAL A 1 28  ? 198.378 -25.165  41.133  1.00 180.64 ? 28  VAL A CB  1 
ATOM   232   C CG1 . VAL A 1 28  ? 199.685 -24.617  41.689  1.00 178.32 ? 28  VAL A CG1 1 
ATOM   233   C CG2 . VAL A 1 28  ? 197.499 -25.682  42.262  1.00 177.39 ? 28  VAL A CG2 1 
ATOM   234   N N   . ILE A 1 29  ? 199.134 -23.074  38.665  1.00 197.72 ? 29  ILE A N   1 
ATOM   235   C CA  . ILE A 1 29  ? 200.051 -22.034  38.155  1.00 202.94 ? 29  ILE A CA  1 
ATOM   236   C C   . ILE A 1 29  ? 199.320 -20.742  37.723  1.00 207.59 ? 29  ILE A C   1 
ATOM   237   O O   . ILE A 1 29  ? 199.956 -19.722  37.437  1.00 206.61 ? 29  ILE A O   1 
ATOM   238   C CB  . ILE A 1 29  ? 200.990 -22.585  37.038  1.00 200.68 ? 29  ILE A CB  1 
ATOM   239   C CG1 . ILE A 1 29  ? 202.330 -21.826  37.003  1.00 195.48 ? 29  ILE A CG1 1 
ATOM   240   C CG2 . ILE A 1 29  ? 200.294 -22.591  35.680  1.00 205.13 ? 29  ILE A CG2 1 
ATOM   241   C CD1 . ILE A 1 29  ? 203.450 -22.542  36.267  1.00 186.71 ? 29  ILE A CD1 1 
ATOM   242   N N   . LEU A 1 30  ? 197.987 -20.798  37.694  1.00 214.41 ? 30  LEU A N   1 
ATOM   243   C CA  . LEU A 1 30  ? 197.149 -19.638  37.377  1.00 221.33 ? 30  LEU A CA  1 
ATOM   244   C C   . LEU A 1 30  ? 196.313 -19.176  38.584  1.00 230.34 ? 30  LEU A C   1 
ATOM   245   O O   . LEU A 1 30  ? 195.218 -18.633  38.410  1.00 238.94 ? 30  LEU A O   1 
ATOM   246   C CB  . LEU A 1 30  ? 196.225 -19.944  36.183  1.00 216.80 ? 30  LEU A CB  1 
ATOM   247   C CG  . LEU A 1 30  ? 196.767 -20.145  34.759  1.00 213.69 ? 30  LEU A CG  1 
ATOM   248   C CD1 . LEU A 1 30  ? 195.705 -20.791  33.879  1.00 211.69 ? 30  LEU A CD1 1 
ATOM   249   C CD2 . LEU A 1 30  ? 197.247 -18.841  34.134  1.00 212.25 ? 30  LEU A CD2 1 
ATOM   250   N N   . HIS A 1 31  ? 196.829 -19.381  39.798  1.00 235.49 ? 31  HIS A N   1 
ATOM   251   C CA  . HIS A 1 31  ? 196.087 -19.061  41.033  1.00 238.13 ? 31  HIS A CA  1 
ATOM   252   C C   . HIS A 1 31  ? 196.049 -17.574  41.403  1.00 232.68 ? 31  HIS A C   1 
ATOM   253   O O   . HIS A 1 31  ? 195.083 -17.106  42.014  1.00 230.21 ? 31  HIS A O   1 
ATOM   254   C CB  . HIS A 1 31  ? 196.625 -19.863  42.228  1.00 244.44 ? 31  HIS A CB  1 
ATOM   255   C CG  . HIS A 1 31  ? 195.999 -21.217  42.397  1.00 250.89 ? 31  HIS A CG  1 
ATOM   256   N ND1 . HIS A 1 31  ? 194.808 -21.577  41.802  1.00 255.03 ? 31  HIS A ND1 1 
ATOM   257   C CD2 . HIS A 1 31  ? 196.388 -22.287  43.131  1.00 252.04 ? 31  HIS A CD2 1 
ATOM   258   C CE1 . HIS A 1 31  ? 194.503 -22.817  42.144  1.00 254.81 ? 31  HIS A CE1 1 
ATOM   259   N NE2 . HIS A 1 31  ? 195.444 -23.269  42.952  1.00 252.74 ? 31  HIS A NE2 1 
ATOM   260   N N   . THR A 1 32  ? 197.100 -16.842  41.048  1.00 228.18 ? 32  THR A N   1 
ATOM   261   C CA  . THR A 1 32  ? 197.232 -15.435  41.442  1.00 226.76 ? 32  THR A CA  1 
ATOM   262   C C   . THR A 1 32  ? 196.734 -14.406  40.413  1.00 226.47 ? 32  THR A C   1 
ATOM   263   O O   . THR A 1 32  ? 196.169 -13.383  40.808  1.00 217.93 ? 32  THR A O   1 
ATOM   264   C CB  . THR A 1 32  ? 198.674 -15.090  41.879  1.00 229.82 ? 32  THR A CB  1 
ATOM   265   O OG1 . THR A 1 32  ? 199.606 -15.579  40.906  1.00 232.17 ? 32  THR A OG1 1 
ATOM   266   C CG2 . THR A 1 32  ? 198.986 -15.721  43.228  1.00 232.40 ? 32  THR A CG2 1 
ATOM   267   N N   . PRO A 1 33  ? 196.942 -14.660  39.099  1.00 233.44 ? 33  PRO A N   1 
ATOM   268   C CA  . PRO A 1 33  ? 196.466 -13.683  38.112  1.00 237.96 ? 33  PRO A CA  1 
ATOM   269   C C   . PRO A 1 33  ? 194.940 -13.617  37.993  1.00 237.79 ? 33  PRO A C   1 
ATOM   270   O O   . PRO A 1 33  ? 194.400 -12.560  37.662  1.00 236.36 ? 33  PRO A O   1 
ATOM   271   C CB  . PRO A 1 33  ? 197.087 -14.176  36.795  1.00 243.23 ? 33  PRO A CB  1 
ATOM   272   C CG  . PRO A 1 33  ? 198.198 -15.087  37.199  1.00 242.22 ? 33  PRO A CG  1 
ATOM   273   C CD  . PRO A 1 33  ? 197.698 -15.744  38.447  1.00 238.19 ? 33  PRO A CD  1 
ATOM   274   N N   . LEU A 1 34  ? 194.263 -14.735  38.256  1.00 237.85 ? 34  LEU A N   1 
ATOM   275   C CA  . LEU A 1 34  ? 192.798 -14.778  38.258  1.00 232.52 ? 34  LEU A CA  1 
ATOM   276   C C   . LEU A 1 34  ? 192.283 -14.057  39.502  1.00 219.81 ? 34  LEU A C   1 
ATOM   277   O O   . LEU A 1 34  ? 191.211 -13.446  39.482  1.00 220.37 ? 34  LEU A O   1 
ATOM   278   C CB  . LEU A 1 34  ? 192.290 -16.227  38.230  1.00 240.73 ? 34  LEU A CB  1 
ATOM   279   C CG  . LEU A 1 34  ? 191.187 -16.669  37.251  1.00 240.95 ? 34  LEU A CG  1 
ATOM   280   C CD1 . LEU A 1 34  ? 190.631 -18.023  37.667  1.00 241.54 ? 34  LEU A CD1 1 
ATOM   281   C CD2 . LEU A 1 34  ? 190.056 -15.657  37.116  1.00 239.04 ? 34  LEU A CD2 1 
ATOM   282   N N   . MET A 1 35  ? 193.062 -14.139  40.580  1.00 202.93 ? 35  MET A N   1 
ATOM   283   C CA  . MET A 1 35  ? 192.796 -13.395  41.803  1.00 190.04 ? 35  MET A CA  1 
ATOM   284   C C   . MET A 1 35  ? 193.037 -11.909  41.561  1.00 191.76 ? 35  MET A C   1 
ATOM   285   O O   . MET A 1 35  ? 192.372 -11.060  42.155  1.00 192.90 ? 35  MET A O   1 
ATOM   286   C CB  . MET A 1 35  ? 193.692 -13.893  42.931  1.00 179.09 ? 35  MET A CB  1 
ATOM   287   C CG  . MET A 1 35  ? 193.237 -13.469  44.314  1.00 172.44 ? 35  MET A CG  1 
ATOM   288   S SD  . MET A 1 35  ? 194.517 -13.780  45.535  1.00 168.13 ? 35  MET A SD  1 
ATOM   289   C CE  . MET A 1 35  ? 195.544 -12.329  45.325  1.00 172.80 ? 35  MET A CE  1 
ATOM   290   N N   . SER A 1 36  ? 193.998 -11.613  40.688  1.00 194.60 ? 36  SER A N   1 
ATOM   291   C CA  . SER A 1 36  ? 194.252 -10.251  40.233  1.00 200.83 ? 36  SER A CA  1 
ATOM   292   C C   . SER A 1 36  ? 193.188 -9.808   39.229  1.00 203.68 ? 36  SER A C   1 
ATOM   293   O O   . SER A 1 36  ? 192.904 -8.616   39.102  1.00 207.86 ? 36  SER A O   1 
ATOM   294   C CB  . SER A 1 36  ? 195.645 -10.144  39.611  1.00 201.45 ? 36  SER A CB  1 
ATOM   295   O OG  . SER A 1 36  ? 195.889 -8.835   39.127  1.00 204.07 ? 36  SER A OG  1 
ATOM   296   N N   . GLY A 1 37  ? 192.611 -10.778  38.521  1.00 204.45 ? 37  GLY A N   1 
ATOM   297   C CA  . GLY A 1 37  ? 191.522 -10.524  37.580  1.00 206.20 ? 37  GLY A CA  1 
ATOM   298   C C   . GLY A 1 37  ? 190.215 -10.212  38.287  1.00 207.08 ? 37  GLY A C   1 
ATOM   299   O O   . GLY A 1 37  ? 189.486 -9.306   37.881  1.00 208.24 ? 37  GLY A O   1 
ATOM   300   N N   . SER A 1 38  ? 189.927 -10.966  39.347  1.00 205.94 ? 38  SER A N   1 
ATOM   301   C CA  . SER A 1 38  ? 188.730 -10.754  40.164  1.00 203.32 ? 38  SER A CA  1 
ATOM   302   C C   . SER A 1 38  ? 188.809 -9.452   40.964  1.00 201.20 ? 38  SER A C   1 
ATOM   303   O O   . SER A 1 38  ? 187.796 -8.775   41.154  1.00 200.11 ? 38  SER A O   1 
ATOM   304   C CB  . SER A 1 38  ? 188.489 -11.945  41.096  1.00 203.32 ? 38  SER A CB  1 
ATOM   305   O OG  . SER A 1 38  ? 189.574 -12.129  41.990  1.00 202.81 ? 38  SER A OG  1 
ATOM   306   N N   . ASN A 1 39  ? 190.016 -9.112   41.424  1.00 198.35 ? 39  ASN A N   1 
ATOM   307   C CA  . ASN A 1 39  ? 190.282 -7.837   42.101  1.00 192.97 ? 39  ASN A CA  1 
ATOM   308   C C   . ASN A 1 39  ? 189.900 -6.643   41.228  1.00 194.86 ? 39  ASN A C   1 
ATOM   309   O O   . ASN A 1 39  ? 189.380 -5.639   41.723  1.00 192.01 ? 39  ASN A O   1 
ATOM   310   C CB  . ASN A 1 39  ? 191.755 -7.742   42.531  1.00 186.55 ? 39  ASN A CB  1 
ATOM   311   C CG  . ASN A 1 39  ? 192.092 -6.427   43.224  1.00 179.11 ? 39  ASN A CG  1 
ATOM   312   O OD1 . ASN A 1 39  ? 193.175 -5.872   43.033  1.00 174.77 ? 39  ASN A OD1 1 
ATOM   313   N ND2 . ASN A 1 39  ? 191.166 -5.924   44.030  1.00 175.29 ? 39  ASN A ND2 1 
ATOM   314   N N   . PHE A 1 40  ? 190.162 -6.776   39.931  1.00 199.46 ? 40  PHE A N   1 
ATOM   315   C CA  . PHE A 1 40  ? 189.789 -5.778   38.937  1.00 202.80 ? 40  PHE A CA  1 
ATOM   316   C C   . PHE A 1 40  ? 188.277 -5.735   38.723  1.00 193.24 ? 40  PHE A C   1 
ATOM   317   O O   . PHE A 1 40  ? 187.685 -4.655   38.695  1.00 191.42 ? 40  PHE A O   1 
ATOM   318   C CB  . PHE A 1 40  ? 190.511 -6.060   37.612  1.00 217.01 ? 40  PHE A CB  1 
ATOM   319   C CG  . PHE A 1 40  ? 189.890 -5.385   36.420  1.00 228.93 ? 40  PHE A CG  1 
ATOM   320   C CD1 . PHE A 1 40  ? 190.135 -4.042   36.158  1.00 232.52 ? 40  PHE A CD1 1 
ATOM   321   C CD2 . PHE A 1 40  ? 189.064 -6.095   35.553  1.00 233.57 ? 40  PHE A CD2 1 
ATOM   322   C CE1 . PHE A 1 40  ? 189.565 -3.416   35.060  1.00 237.11 ? 40  PHE A CE1 1 
ATOM   323   C CE2 . PHE A 1 40  ? 188.489 -5.476   34.454  1.00 237.92 ? 40  PHE A CE2 1 
ATOM   324   C CZ  . PHE A 1 40  ? 188.741 -4.135   34.206  1.00 238.92 ? 40  PHE A CZ  1 
ATOM   325   N N   . ILE A 1 41  ? 187.666 -6.911   38.570  1.00 183.19 ? 41  ILE A N   1 
ATOM   326   C CA  . ILE A 1 41  ? 186.235 -7.020   38.272  1.00 175.79 ? 41  ILE A CA  1 
ATOM   327   C C   . ILE A 1 41  ? 185.370 -6.356   39.348  1.00 175.35 ? 41  ILE A C   1 
ATOM   328   O O   . ILE A 1 41  ? 184.429 -5.633   39.021  1.00 177.65 ? 41  ILE A O   1 
ATOM   329   C CB  . ILE A 1 41  ? 185.799 -8.486   38.022  1.00 172.52 ? 41  ILE A CB  1 
ATOM   330   C CG1 . ILE A 1 41  ? 186.474 -9.040   36.764  1.00 171.60 ? 41  ILE A CG1 1 
ATOM   331   C CG2 . ILE A 1 41  ? 184.285 -8.588   37.872  1.00 171.01 ? 41  ILE A CG2 1 
ATOM   332   C CD1 . ILE A 1 41  ? 186.436 -10.551  36.650  1.00 172.69 ? 41  ILE A CD1 1 
ATOM   333   N N   . HIS A 1 42  ? 185.700 -6.576   40.621  1.00 173.58 ? 42  HIS A N   1 
ATOM   334   C CA  . HIS A 1 42  ? 184.959 -5.935   41.716  1.00 171.87 ? 42  HIS A CA  1 
ATOM   335   C C   . HIS A 1 42  ? 185.337 -4.462   41.915  1.00 169.84 ? 42  HIS A C   1 
ATOM   336   O O   . HIS A 1 42  ? 184.887 -3.817   42.868  1.00 167.18 ? 42  HIS A O   1 
ATOM   337   C CB  . HIS A 1 42  ? 185.069 -6.730   43.028  1.00 172.25 ? 42  HIS A CB  1 
ATOM   338   C CG  . HIS A 1 42  ? 186.396 -6.612   43.713  1.00 171.79 ? 42  HIS A CG  1 
ATOM   339   N ND1 . HIS A 1 42  ? 186.869 -5.425   44.231  1.00 170.51 ? 42  HIS A ND1 1 
ATOM   340   C CD2 . HIS A 1 42  ? 187.335 -7.544   43.997  1.00 171.97 ? 42  HIS A CD2 1 
ATOM   341   C CE1 . HIS A 1 42  ? 188.053 -5.626   44.780  1.00 169.60 ? 42  HIS A CE1 1 
ATOM   342   N NE2 . HIS A 1 42  ? 188.356 -6.905   44.656  1.00 170.61 ? 42  HIS A NE2 1 
ATOM   343   N N   . GLY A 1 43  ? 186.162 -3.939   41.009  1.00 168.90 ? 43  GLY A N   1 
ATOM   344   C CA  . GLY A 1 43  ? 186.472 -2.513   40.965  1.00 168.47 ? 43  GLY A CA  1 
ATOM   345   C C   . GLY A 1 43  ? 185.329 -1.704   40.381  1.00 167.80 ? 43  GLY A C   1 
ATOM   346   O O   . GLY A 1 43  ? 185.467 -0.502   40.145  1.00 168.91 ? 43  GLY A O   1 
ATOM   347   N N   . VAL A 1 44  ? 184.199 -2.376   40.155  1.00 166.94 ? 44  VAL A N   1 
ATOM   348   C CA  . VAL A 1 44  ? 182.970 -1.764   39.634  1.00 165.37 ? 44  VAL A CA  1 
ATOM   349   C C   . VAL A 1 44  ? 182.431 -0.650   40.524  1.00 157.61 ? 44  VAL A C   1 
ATOM   350   O O   . VAL A 1 44  ? 181.641 0.187    40.075  1.00 156.14 ? 44  VAL A O   1 
ATOM   351   C CB  . VAL A 1 44  ? 181.847 -2.808   39.440  1.00 171.47 ? 44  VAL A CB  1 
ATOM   352   C CG1 . VAL A 1 44  ? 181.994 -3.509   38.100  1.00 177.95 ? 44  VAL A CG1 1 
ATOM   353   C CG2 . VAL A 1 44  ? 181.820 -3.812   40.589  1.00 172.98 ? 44  VAL A CG2 1 
ATOM   354   N N   . VAL A 1 45  ? 182.860 -0.664   41.785  1.00 149.96 ? 45  VAL A N   1 
ATOM   355   C CA  . VAL A 1 45  ? 182.502 0.352    42.778  1.00 145.71 ? 45  VAL A CA  1 
ATOM   356   C C   . VAL A 1 45  ? 182.468 1.790    42.250  1.00 148.92 ? 45  VAL A C   1 
ATOM   357   O O   . VAL A 1 45  ? 181.776 2.636    42.818  1.00 150.94 ? 45  VAL A O   1 
ATOM   358   C CB  . VAL A 1 45  ? 183.410 0.276    44.024  1.00 140.82 ? 45  VAL A CB  1 
ATOM   359   C CG1 . VAL A 1 45  ? 182.730 -0.523   45.116  1.00 137.68 ? 45  VAL A CG1 1 
ATOM   360   C CG2 . VAL A 1 45  ? 184.770 -0.320   43.683  1.00 138.98 ? 45  VAL A CG2 1 
ATOM   361   N N   . VAL A 1 46  ? 183.205 2.056    41.168  1.00 150.52 ? 46  VAL A N   1 
ATOM   362   C CA  . VAL A 1 46  ? 183.206 3.371    40.506  1.00 149.53 ? 46  VAL A CA  1 
ATOM   363   C C   . VAL A 1 46  ? 181.827 3.796    40.007  1.00 145.03 ? 46  VAL A C   1 
ATOM   364   O O   . VAL A 1 46  ? 181.311 4.832    40.418  1.00 145.80 ? 46  VAL A O   1 
ATOM   365   C CB  . VAL A 1 46  ? 184.203 3.451    39.323  1.00 151.11 ? 46  VAL A CB  1 
ATOM   366   C CG1 . VAL A 1 46  ? 185.584 3.860    39.809  1.00 153.04 ? 46  VAL A CG1 1 
ATOM   367   C CG2 . VAL A 1 46  ? 184.249 2.145    38.541  1.00 150.87 ? 46  VAL A CG2 1 
ATOM   368   N N   . VAL A 1 47  ? 181.244 2.986    39.125  1.00 138.18 ? 47  VAL A N   1 
ATOM   369   C CA  . VAL A 1 47  ? 179.924 3.239    38.551  1.00 133.31 ? 47  VAL A CA  1 
ATOM   370   C C   . VAL A 1 47  ? 178.911 3.672    39.618  1.00 135.41 ? 47  VAL A C   1 
ATOM   371   O O   . VAL A 1 47  ? 178.197 4.661    39.435  1.00 134.72 ? 47  VAL A O   1 
ATOM   372   C CB  . VAL A 1 47  ? 179.422 1.998    37.779  1.00 130.14 ? 47  VAL A CB  1 
ATOM   373   C CG1 . VAL A 1 47  ? 177.939 2.100    37.463  1.00 129.07 ? 47  VAL A CG1 1 
ATOM   374   C CG2 . VAL A 1 47  ? 180.231 1.801    36.506  1.00 127.40 ? 47  VAL A CG2 1 
ATOM   375   N N   . GLY A 1 48  ? 178.879 2.937    40.731  1.00 137.85 ? 48  GLY A N   1 
ATOM   376   C CA  . GLY A 1 48  ? 177.981 3.224    41.853  1.00 138.42 ? 48  GLY A CA  1 
ATOM   377   C C   . GLY A 1 48  ? 178.363 4.441    42.678  1.00 136.48 ? 48  GLY A C   1 
ATOM   378   O O   . GLY A 1 48  ? 177.496 5.091    43.270  1.00 136.90 ? 48  GLY A O   1 
ATOM   379   N N   . ALA A 1 49  ? 179.660 4.740    42.730  1.00 133.00 ? 49  ALA A N   1 
ATOM   380   C CA  . ALA A 1 49  ? 180.152 5.942    43.401  1.00 127.22 ? 49  ALA A CA  1 
ATOM   381   C C   . ALA A 1 49  ? 179.991 7.173    42.511  1.00 122.68 ? 49  ALA A C   1 
ATOM   382   O O   . ALA A 1 49  ? 179.794 8.273    43.016  1.00 121.68 ? 49  ALA A O   1 
ATOM   383   C CB  . ALA A 1 49  ? 181.602 5.770    43.825  1.00 128.26 ? 49  ALA A CB  1 
ATOM   384   N N   . MET A 1 50  ? 180.079 6.975    41.193  1.00 116.92 ? 50  MET A N   1 
ATOM   385   C CA  . MET A 1 50  ? 179.841 8.031    40.200  1.00 111.84 ? 50  MET A CA  1 
ATOM   386   C C   . MET A 1 50  ? 178.428 8.565    40.343  1.00 112.47 ? 50  MET A C   1 
ATOM   387   O O   . MET A 1 50  ? 178.197 9.774    40.289  1.00 111.08 ? 50  MET A O   1 
ATOM   388   C CB  . MET A 1 50  ? 179.991 7.486    38.782  1.00 106.34 ? 50  MET A CB  1 
ATOM   389   C CG  . MET A 1 50  ? 181.380 7.017    38.398  1.00 101.93 ? 50  MET A CG  1 
ATOM   390   S SD  . MET A 1 50  ? 181.314 6.101    36.851  1.00 95.71  ? 50  MET A SD  1 
ATOM   391   C CE  . MET A 1 50  ? 180.888 7.427    35.721  1.00 98.01  ? 50  MET A CE  1 
ATOM   392   N N   . VAL A 1 51  ? 177.490 7.633    40.497  1.00 114.75 ? 51  VAL A N   1 
ATOM   393   C CA  . VAL A 1 51  ? 176.091 7.936    40.766  1.00 116.95 ? 51  VAL A CA  1 
ATOM   394   C C   . VAL A 1 51  ? 175.980 8.616    42.126  1.00 116.48 ? 51  VAL A C   1 
ATOM   395   O O   . VAL A 1 51  ? 175.423 9.707    42.237  1.00 117.00 ? 51  VAL A O   1 
ATOM   396   C CB  . VAL A 1 51  ? 175.222 6.657    40.705  1.00 118.56 ? 51  VAL A CB  1 
ATOM   397   C CG1 . VAL A 1 51  ? 173.813 6.916    41.223  1.00 120.14 ? 51  VAL A CG1 1 
ATOM   398   C CG2 . VAL A 1 51  ? 175.177 6.115    39.283  1.00 118.96 ? 51  VAL A CG2 1 
ATOM   399   N N   . VAL A 1 52  ? 176.541 7.972    43.146  1.00 115.60 ? 52  VAL A N   1 
ATOM   400   C CA  . VAL A 1 52  ? 176.586 8.523    44.497  1.00 114.94 ? 52  VAL A CA  1 
ATOM   401   C C   . VAL A 1 52  ? 177.241 9.913    44.523  1.00 117.20 ? 52  VAL A C   1 
ATOM   402   O O   . VAL A 1 52  ? 176.757 10.808   45.219  1.00 118.90 ? 52  VAL A O   1 
ATOM   403   C CB  . VAL A 1 52  ? 177.229 7.510    45.480  1.00 112.47 ? 52  VAL A CB  1 
ATOM   404   C CG1 . VAL A 1 52  ? 178.011 8.197    46.588  1.00 111.64 ? 52  VAL A CG1 1 
ATOM   405   C CG2 . VAL A 1 52  ? 176.158 6.593    46.057  1.00 110.63 ? 52  VAL A CG2 1 
ATOM   406   N N   . LEU A 1 53  ? 178.305 10.103   43.738  1.00 118.77 ? 53  LEU A N   1 
ATOM   407   C CA  . LEU A 1 53  ? 178.954 11.416   43.603  1.00 120.45 ? 53  LEU A CA  1 
ATOM   408   C C   . LEU A 1 53  ? 178.136 12.365   42.729  1.00 120.58 ? 53  LEU A C   1 
ATOM   409   O O   . LEU A 1 53  ? 178.114 13.574   42.962  1.00 119.06 ? 53  LEU A O   1 
ATOM   410   C CB  . LEU A 1 53  ? 180.381 11.280   43.049  1.00 121.92 ? 53  LEU A CB  1 
ATOM   411   C CG  . LEU A 1 53  ? 181.268 12.533   42.970  1.00 123.27 ? 53  LEU A CG  1 
ATOM   412   C CD1 . LEU A 1 53  ? 181.548 13.124   44.346  1.00 124.15 ? 53  LEU A CD1 1 
ATOM   413   C CD2 . LEU A 1 53  ? 182.574 12.233   42.250  1.00 123.89 ? 53  LEU A CD2 1 
ATOM   414   N N   . GLY A 1 54  ? 177.468 11.810   41.722  1.00 122.53 ? 54  GLY A N   1 
ATOM   415   C CA  . GLY A 1 54  ? 176.565 12.584   40.880  1.00 128.70 ? 54  GLY A CA  1 
ATOM   416   C C   . GLY A 1 54  ? 175.300 12.974   41.622  1.00 136.06 ? 54  GLY A C   1 
ATOM   417   O O   . GLY A 1 54  ? 174.539 13.823   41.157  1.00 134.63 ? 54  GLY A O   1 
ATOM   418   N N   . HIS A 1 55  ? 175.081 12.349   42.778  1.00 147.71 ? 55  HIS A N   1 
ATOM   419   C CA  . HIS A 1 55  ? 173.920 12.626   43.622  1.00 162.14 ? 55  HIS A CA  1 
ATOM   420   C C   . HIS A 1 55  ? 174.344 13.142   44.995  1.00 171.15 ? 55  HIS A C   1 
ATOM   421   O O   . HIS A 1 55  ? 173.618 12.996   45.984  1.00 171.23 ? 55  HIS A O   1 
ATOM   422   C CB  . HIS A 1 55  ? 173.047 11.377   43.749  1.00 166.15 ? 55  HIS A CB  1 
ATOM   423   C CG  . HIS A 1 55  ? 172.418 10.958   42.459  1.00 171.14 ? 55  HIS A CG  1 
ATOM   424   N ND1 . HIS A 1 55  ? 173.116 10.299   41.470  1.00 173.79 ? 55  HIS A ND1 1 
ATOM   425   C CD2 . HIS A 1 55  ? 171.160 11.122   41.986  1.00 174.11 ? 55  HIS A CD2 1 
ATOM   426   C CE1 . HIS A 1 55  ? 172.314 10.068   40.447  1.00 176.25 ? 55  HIS A CE1 1 
ATOM   427   N NE2 . HIS A 1 55  ? 171.121 10.555   40.735  1.00 176.74 ? 55  HIS A NE2 1 
ATOM   428   N N   . ALA A 1 56  ? 175.525 13.756   45.031  1.00 183.98 ? 56  ALA A N   1 
ATOM   429   C CA  . ALA A 1 56  ? 176.078 14.340   46.246  1.00 198.21 ? 56  ALA A CA  1 
ATOM   430   C C   . ALA A 1 56  ? 175.353 15.631   46.601  1.00 206.28 ? 56  ALA A C   1 
ATOM   431   O O   . ALA A 1 56  ? 175.219 16.534   45.767  1.00 202.38 ? 56  ALA A O   1 
ATOM   432   C CB  . ALA A 1 56  ? 177.571 14.592   46.084  1.00 200.09 ? 56  ALA A CB  1 
ATOM   433   N N   . GLU A 1 57  ? 174.889 15.708   47.845  1.00 220.56 ? 57  GLU A N   1 
ATOM   434   C CA  . GLU A 1 57  ? 174.108 16.847   48.313  1.00 235.36 ? 57  GLU A CA  1 
ATOM   435   C C   . GLU A 1 57  ? 174.857 17.695   49.343  1.00 259.64 ? 57  GLU A C   1 
ATOM   436   O O   . GLU A 1 57  ? 175.254 18.826   49.049  1.00 268.98 ? 57  GLU A O   1 
ATOM   437   C CB  . GLU A 1 57  ? 172.768 16.376   48.895  1.00 221.03 ? 57  GLU A CB  1 
ATOM   438   C CG  . GLU A 1 57  ? 171.799 15.781   47.884  1.00 208.19 ? 57  GLU A CG  1 
ATOM   439   C CD  . GLU A 1 57  ? 170.482 15.369   48.515  1.00 201.42 ? 57  GLU A CD  1 
ATOM   440   O OE1 . GLU A 1 57  ? 170.500 14.576   49.486  1.00 194.88 ? 57  GLU A OE1 1 
ATOM   441   O OE2 . GLU A 1 57  ? 169.424 15.833   48.035  1.00 200.56 ? 57  GLU A OE2 1 
ATOM   442   N N   . THR A 1 58  ? 175.070 17.125   50.531  1.00 283.99 ? 58  THR A N   1 
ATOM   443   C CA  . THR A 1 58  ? 175.426 17.885   51.744  1.00 296.76 ? 58  THR A CA  1 
ATOM   444   C C   . THR A 1 58  ? 176.901 18.322   51.898  1.00 295.80 ? 58  THR A C   1 
ATOM   445   O O   . THR A 1 58  ? 177.337 18.653   53.011  1.00 314.97 ? 58  THR A O   1 
ATOM   446   C CB  . THR A 1 58  ? 174.966 17.141   53.027  1.00 299.21 ? 58  THR A CB  1 
ATOM   447   O OG1 . THR A 1 58  ? 175.675 15.903   53.153  1.00 300.80 ? 58  THR A OG1 1 
ATOM   448   C CG2 . THR A 1 58  ? 173.462 16.859   53.001  1.00 300.16 ? 58  THR A CG2 1 
ATOM   449   N N   . GLY A 1 59  ? 177.660 18.332   50.798  1.00 274.75 ? 59  GLY A N   1 
ATOM   450   C CA  . GLY A 1 59  ? 179.046 18.821   50.814  1.00 282.94 ? 59  GLY A CA  1 
ATOM   451   C C   . GLY A 1 59  ? 180.032 17.871   51.472  1.00 287.56 ? 59  GLY A C   1 
ATOM   452   O O   . GLY A 1 59  ? 181.144 17.677   50.975  1.00 286.73 ? 59  GLY A O   1 
ATOM   453   N N   . LEU A 1 60  ? 179.625 17.299   52.604  1.00 281.11 ? 60  LEU A N   1 
ATOM   454   C CA  . LEU A 1 60  ? 180.361 16.219   53.252  1.00 274.43 ? 60  LEU A CA  1 
ATOM   455   C C   . LEU A 1 60  ? 180.190 14.944   52.420  1.00 272.33 ? 60  LEU A C   1 
ATOM   456   O O   . LEU A 1 60  ? 181.035 14.049   52.461  1.00 271.99 ? 60  LEU A O   1 
ATOM   457   C CB  . LEU A 1 60  ? 179.860 16.023   54.688  1.00 270.89 ? 60  LEU A CB  1 
ATOM   458   C CG  . LEU A 1 60  ? 180.836 15.525   55.763  1.00 267.66 ? 60  LEU A CG  1 
ATOM   459   C CD1 . LEU A 1 60  ? 180.548 16.193   57.102  1.00 261.63 ? 60  LEU A CD1 1 
ATOM   460   C CD2 . LEU A 1 60  ? 180.803 14.008   55.892  1.00 270.35 ? 60  LEU A CD2 1 
ATOM   461   N N   . GLU A 1 61  ? 179.091 14.884   51.665  1.00 270.45 ? 61  GLU A N   1 
ATOM   462   C CA  . GLU A 1 61  ? 178.856 13.838   50.665  1.00 266.33 ? 61  GLU A CA  1 
ATOM   463   C C   . GLU A 1 61  ? 179.680 14.091   49.390  1.00 260.23 ? 61  GLU A C   1 
ATOM   464   O O   . GLU A 1 61  ? 179.851 13.190   48.565  1.00 264.62 ? 61  GLU A O   1 
ATOM   465   C CB  . GLU A 1 61  ? 177.356 13.738   50.319  1.00 268.96 ? 61  GLU A CB  1 
ATOM   466   C CG  . GLU A 1 61  ? 176.474 13.105   51.396  1.00 261.32 ? 61  GLU A CG  1 
ATOM   467   C CD  . GLU A 1 61  ? 174.987 13.100   51.047  1.00 253.08 ? 61  GLU A CD  1 
ATOM   468   O OE1 . GLU A 1 61  ? 174.628 12.753   49.899  1.00 249.09 ? 61  GLU A OE1 1 
ATOM   469   O OE2 . GLU A 1 61  ? 174.166 13.433   51.932  1.00 245.40 ? 61  GLU A OE2 1 
ATOM   470   N N   . LYS A 1 62  ? 180.190 15.315   49.243  1.00 248.21 ? 62  LYS A N   1 
ATOM   471   C CA  . LYS A 1 62  ? 180.953 15.732   48.058  1.00 237.51 ? 62  LYS A CA  1 
ATOM   472   C C   . LYS A 1 62  ? 182.424 15.270   48.089  1.00 240.54 ? 62  LYS A C   1 
ATOM   473   O O   . LYS A 1 62  ? 183.038 15.094   47.032  1.00 237.16 ? 62  LYS A O   1 
ATOM   474   C CB  . LYS A 1 62  ? 180.812 17.256   47.855  1.00 227.38 ? 62  LYS A CB  1 
ATOM   475   C CG  . LYS A 1 62  ? 181.705 17.910   46.807  1.00 220.01 ? 62  LYS A CG  1 
ATOM   476   C CD  . LYS A 1 62  ? 182.812 18.715   47.470  1.00 218.89 ? 62  LYS A CD  1 
ATOM   477   C CE  . LYS A 1 62  ? 183.495 19.650   46.483  1.00 218.23 ? 62  LYS A CE  1 
ATOM   478   N NZ  . LYS A 1 62  ? 184.408 20.608   47.169  1.00 218.68 ? 62  LYS A NZ  1 
ATOM   479   N N   . LEU A 1 63  ? 182.972 15.062   49.289  1.00 248.55 ? 63  LEU A N   1 
ATOM   480   C CA  . LEU A 1 63  ? 184.380 14.662   49.454  1.00 257.03 ? 63  LEU A CA  1 
ATOM   481   C C   . LEU A 1 63  ? 184.573 13.148   49.609  1.00 255.06 ? 63  LEU A C   1 
ATOM   482   O O   . LEU A 1 63  ? 185.455 12.567   48.975  1.00 253.88 ? 63  LEU A O   1 
ATOM   483   C CB  . LEU A 1 63  ? 185.027 15.406   50.637  1.00 265.86 ? 63  LEU A CB  1 
ATOM   484   C CG  . LEU A 1 63  ? 186.561 15.496   50.744  1.00 269.11 ? 63  LEU A CG  1 
ATOM   485   C CD1 . LEU A 1 63  ? 186.970 16.727   51.545  1.00 267.37 ? 63  LEU A CD1 1 
ATOM   486   C CD2 . LEU A 1 63  ? 187.195 14.241   51.340  1.00 267.23 ? 63  LEU A CD2 1 
ATOM   487   N N   . ILE A 1 64  ? 183.759 12.524   50.462  1.00 252.34 ? 64  ILE A N   1 
ATOM   488   C CA  . ILE A 1 64  ? 183.844 11.079   50.728  1.00 248.21 ? 64  ILE A CA  1 
ATOM   489   C C   . ILE A 1 64  ? 183.395 10.256   49.509  1.00 243.53 ? 64  ILE A C   1 
ATOM   490   O O   . ILE A 1 64  ? 183.797 9.102    49.346  1.00 246.88 ? 64  ILE A O   1 
ATOM   491   C CB  . ILE A 1 64  ? 183.094 10.698   52.041  1.00 248.30 ? 64  ILE A CB  1 
ATOM   492   C CG1 . ILE A 1 64  ? 183.415 9.259    52.496  1.00 246.86 ? 64  ILE A CG1 1 
ATOM   493   C CG2 . ILE A 1 64  ? 181.597 11.002   51.928  1.00 248.59 ? 64  ILE A CG2 1 
ATOM   494   C CD1 . ILE A 1 64  ? 182.257 8.287    52.413  1.00 244.44 ? 64  ILE A CD1 1 
ATOM   495   N N   . GLY A 1 65  ? 182.578 10.871   48.654  1.00 233.61 ? 65  GLY A N   1 
ATOM   496   C CA  . GLY A 1 65  ? 182.218 10.300   47.355  1.00 218.22 ? 65  GLY A CA  1 
ATOM   497   C C   . GLY A 1 65  ? 183.293 10.559   46.312  1.00 204.48 ? 65  GLY A C   1 
ATOM   498   O O   . GLY A 1 65  ? 183.463 9.775    45.376  1.00 206.16 ? 65  GLY A O   1 
ATOM   499   N N   . PHE A 1 66  ? 184.011 11.671   46.477  1.00 188.23 ? 66  PHE A N   1 
ATOM   500   C CA  . PHE A 1 66  ? 185.169 12.014   45.649  1.00 171.44 ? 66  PHE A CA  1 
ATOM   501   C C   . PHE A 1 66  ? 186.316 11.044   45.930  1.00 169.52 ? 66  PHE A C   1 
ATOM   502   O O   . PHE A 1 66  ? 187.064 10.682   45.019  1.00 166.47 ? 66  PHE A O   1 
ATOM   503   C CB  . PHE A 1 66  ? 185.603 13.457   45.934  1.00 161.09 ? 66  PHE A CB  1 
ATOM   504   C CG  . PHE A 1 66  ? 186.654 13.985   44.998  1.00 151.22 ? 66  PHE A CG  1 
ATOM   505   C CD1 . PHE A 1 66  ? 186.299 14.529   43.769  1.00 148.18 ? 66  PHE A CD1 1 
ATOM   506   C CD2 . PHE A 1 66  ? 187.997 13.971   45.359  1.00 148.08 ? 66  PHE A CD2 1 
ATOM   507   C CE1 . PHE A 1 66  ? 187.265 15.031   42.910  1.00 145.23 ? 66  PHE A CE1 1 
ATOM   508   C CE2 . PHE A 1 66  ? 188.967 14.471   44.504  1.00 145.46 ? 66  PHE A CE2 1 
ATOM   509   C CZ  . PHE A 1 66  ? 188.601 15.000   43.277  1.00 144.56 ? 66  PHE A CZ  1 
ATOM   510   N N   . LEU A 1 67  ? 186.438 10.634   47.196  1.00 168.38 ? 67  LEU A N   1 
ATOM   511   C CA  . LEU A 1 67  ? 187.400 9.612    47.620  1.00 165.57 ? 67  LEU A CA  1 
ATOM   512   C C   . LEU A 1 67  ? 187.094 8.262    46.965  1.00 162.71 ? 67  LEU A C   1 
ATOM   513   O O   . LEU A 1 67  ? 187.970 7.655    46.347  1.00 164.45 ? 67  LEU A O   1 
ATOM   514   C CB  . LEU A 1 67  ? 187.406 9.456    49.153  1.00 163.84 ? 67  LEU A CB  1 
ATOM   515   C CG  . LEU A 1 67  ? 187.953 10.545   50.089  1.00 161.08 ? 67  LEU A CG  1 
ATOM   516   C CD1 . LEU A 1 67  ? 187.579 10.233   51.532  1.00 158.15 ? 67  LEU A CD1 1 
ATOM   517   C CD2 . LEU A 1 67  ? 189.461 10.713   49.960  1.00 160.16 ? 67  LEU A CD2 1 
ATOM   518   N N   . GLY A 1 68  ? 185.845 7.815    47.096  1.00 156.83 ? 68  GLY A N   1 
ATOM   519   C CA  . GLY A 1 68  ? 185.399 6.523    46.570  1.00 146.40 ? 68  GLY A CA  1 
ATOM   520   C C   . GLY A 1 68  ? 185.600 6.332    45.080  1.00 139.06 ? 68  GLY A C   1 
ATOM   521   O O   . GLY A 1 68  ? 185.909 5.225    44.632  1.00 138.19 ? 68  GLY A O   1 
ATOM   522   N N   . VAL A 1 69  ? 185.422 7.408    44.314  1.00 132.10 ? 69  VAL A N   1 
ATOM   523   C CA  . VAL A 1 69  ? 185.639 7.385    42.865  1.00 125.97 ? 69  VAL A CA  1 
ATOM   524   C C   . VAL A 1 69  ? 187.116 7.155    42.543  1.00 122.22 ? 69  VAL A C   1 
ATOM   525   O O   . VAL A 1 69  ? 187.446 6.418    41.615  1.00 119.62 ? 69  VAL A O   1 
ATOM   526   C CB  . VAL A 1 69  ? 185.103 8.661    42.175  1.00 125.84 ? 69  VAL A CB  1 
ATOM   527   C CG1 . VAL A 1 69  ? 185.511 8.705    40.708  1.00 125.64 ? 69  VAL A CG1 1 
ATOM   528   C CG2 . VAL A 1 69  ? 183.587 8.723    42.287  1.00 126.84 ? 69  VAL A CG2 1 
ATOM   529   N N   . ILE A 1 70  ? 187.995 7.779    43.322  1.00 120.49 ? 70  ILE A N   1 
ATOM   530   C CA  . ILE A 1 70  ? 189.434 7.549    43.205  1.00 121.16 ? 70  ILE A CA  1 
ATOM   531   C C   . ILE A 1 70  ? 189.797 6.154    43.731  1.00 120.88 ? 70  ILE A C   1 
ATOM   532   O O   . ILE A 1 70  ? 190.527 5.412    43.070  1.00 120.30 ? 70  ILE A O   1 
ATOM   533   C CB  . ILE A 1 70  ? 190.253 8.640    43.934  1.00 122.52 ? 70  ILE A CB  1 
ATOM   534   C CG1 . ILE A 1 70  ? 189.895 10.029   43.391  1.00 122.25 ? 70  ILE A CG1 1 
ATOM   535   C CG2 . ILE A 1 70  ? 191.750 8.384    43.789  1.00 123.97 ? 70  ILE A CG2 1 
ATOM   536   C CD1 . ILE A 1 70  ? 190.326 11.179   44.278  1.00 123.08 ? 70  ILE A CD1 1 
ATOM   537   N N   . LEU A 1 71  ? 189.271 5.806    44.909  1.00 121.23 ? 71  LEU A N   1 
ATOM   538   C CA  . LEU A 1 71  ? 189.486 4.492    45.530  1.00 121.21 ? 71  LEU A CA  1 
ATOM   539   C C   . LEU A 1 71  ? 189.088 3.358    44.595  1.00 121.50 ? 71  LEU A C   1 
ATOM   540   O O   . LEU A 1 71  ? 189.770 2.335    44.519  1.00 121.14 ? 71  LEU A O   1 
ATOM   541   C CB  . LEU A 1 71  ? 188.697 4.370    46.838  1.00 121.16 ? 71  LEU A CB  1 
ATOM   542   C CG  . LEU A 1 71  ? 189.183 5.075    48.108  1.00 121.96 ? 71  LEU A CG  1 
ATOM   543   C CD1 . LEU A 1 71  ? 188.047 5.185    49.112  1.00 121.86 ? 71  LEU A CD1 1 
ATOM   544   C CD2 . LEU A 1 71  ? 190.380 4.373    48.732  1.00 121.99 ? 71  LEU A CD2 1 
ATOM   545   N N   . GLY A 1 72  ? 187.976 3.555    43.891  1.00 122.57 ? 72  GLY A N   1 
ATOM   546   C CA  . GLY A 1 72  ? 187.495 2.600    42.901  1.00 124.18 ? 72  GLY A CA  1 
ATOM   547   C C   . GLY A 1 72  ? 188.295 2.645    41.613  1.00 123.55 ? 72  GLY A C   1 
ATOM   548   O O   . GLY A 1 72  ? 188.573 1.602    41.016  1.00 125.30 ? 72  GLY A O   1 
ATOM   549   N N   . ALA A 1 73  ? 188.661 3.852    41.184  1.00 120.82 ? 73  ALA A N   1 
ATOM   550   C CA  . ALA A 1 73  ? 189.447 4.034    39.963  1.00 118.15 ? 73  ALA A CA  1 
ATOM   551   C C   . ALA A 1 73  ? 190.830 3.406    40.108  1.00 117.43 ? 73  ALA A C   1 
ATOM   552   O O   . ALA A 1 73  ? 191.415 2.946    39.127  1.00 115.86 ? 73  ALA A O   1 
ATOM   553   C CB  . ALA A 1 73  ? 189.559 5.508    39.610  1.00 117.52 ? 73  ALA A CB  1 
ATOM   554   N N   . ALA A 1 74  ? 191.335 3.386    41.339  1.00 117.92 ? 74  ALA A N   1 
ATOM   555   C CA  . ALA A 1 74  ? 192.612 2.752    41.652  1.00 119.22 ? 74  ALA A CA  1 
ATOM   556   C C   . ALA A 1 74  ? 192.510 1.226    41.668  1.00 119.88 ? 74  ALA A C   1 
ATOM   557   O O   . ALA A 1 74  ? 193.444 0.538    41.262  1.00 121.70 ? 74  ALA A O   1 
ATOM   558   C CB  . ALA A 1 74  ? 193.153 3.268    42.976  1.00 118.56 ? 74  ALA A CB  1 
ATOM   559   N N   . ASN A 1 75  ? 191.377 0.707    42.139  1.00 119.78 ? 75  ASN A N   1 
ATOM   560   C CA  . ASN A 1 75  ? 191.118 -0.735   42.137  1.00 118.80 ? 75  ASN A CA  1 
ATOM   561   C C   . ASN A 1 75  ? 190.956 -1.279   40.717  1.00 117.67 ? 75  ASN A C   1 
ATOM   562   O O   . ASN A 1 75  ? 191.361 -2.407   40.426  1.00 117.64 ? 75  ASN A O   1 
ATOM   563   C CB  . ASN A 1 75  ? 189.874 -1.054   42.977  1.00 119.08 ? 75  ASN A CB  1 
ATOM   564   C CG  . ASN A 1 75  ? 189.661 -2.548   43.187  1.00 118.19 ? 75  ASN A CG  1 
ATOM   565   O OD1 . ASN A 1 75  ? 190.589 -3.354   43.083  1.00 116.85 ? 75  ASN A OD1 1 
ATOM   566   N ND2 . ASN A 1 75  ? 188.428 -2.918   43.504  1.00 118.34 ? 75  ASN A ND2 1 
ATOM   567   N N   . ALA A 1 76  ? 190.369 -0.462   39.843  1.00 115.84 ? 76  ALA A N   1 
ATOM   568   C CA  . ALA A 1 76  ? 190.111 -0.840   38.458  1.00 114.34 ? 76  ALA A CA  1 
ATOM   569   C C   . ALA A 1 76  ? 191.350 -0.688   37.580  1.00 114.51 ? 76  ALA A C   1 
ATOM   570   O O   . ALA A 1 76  ? 191.874 -1.677   37.067  1.00 113.77 ? 76  ALA A O   1 
ATOM   571   C CB  . ALA A 1 76  ? 188.951 -0.032   37.897  1.00 113.06 ? 76  ALA A CB  1 
ATOM   572   N N   . ALA A 1 77  ? 191.818 0.549    37.416  1.00 116.40 ? 77  ALA A N   1 
ATOM   573   C CA  . ALA A 1 77  ? 192.999 0.829    36.599  1.00 121.03 ? 77  ALA A CA  1 
ATOM   574   C C   . ALA A 1 77  ? 194.240 0.117    37.133  1.00 127.04 ? 77  ALA A C   1 
ATOM   575   O O   . ALA A 1 77  ? 195.155 -0.199   36.371  1.00 127.79 ? 77  ALA A O   1 
ATOM   576   C CB  . ALA A 1 77  ? 193.242 2.325    36.502  1.00 119.32 ? 77  ALA A CB  1 
ATOM   577   N N   . GLY A 1 78  ? 194.257 -0.134   38.440  1.00 135.23 ? 78  GLY A N   1 
ATOM   578   C CA  . GLY A 1 78  ? 195.341 -0.871   39.085  1.00 144.97 ? 78  GLY A CA  1 
ATOM   579   C C   . GLY A 1 78  ? 195.166 -2.375   39.004  1.00 151.23 ? 78  GLY A C   1 
ATOM   580   O O   . GLY A 1 78  ? 196.143 -3.121   39.046  1.00 151.10 ? 78  GLY A O   1 
ATOM   581   N N   . GLY A 1 79  ? 193.915 -2.817   38.895  1.00 157.72 ? 79  GLY A N   1 
ATOM   582   C CA  . GLY A 1 79  ? 193.608 -4.232   38.717  1.00 166.66 ? 79  GLY A CA  1 
ATOM   583   C C   . GLY A 1 79  ? 193.982 -4.726   37.331  1.00 173.64 ? 79  GLY A C   1 
ATOM   584   O O   . GLY A 1 79  ? 194.577 -5.796   37.190  1.00 174.65 ? 79  GLY A O   1 
ATOM   585   N N   . TYR A 1 80  ? 193.633 -3.938   36.313  1.00 180.10 ? 80  TYR A N   1 
ATOM   586   C CA  . TYR A 1 80  ? 193.926 -4.264   34.913  1.00 186.99 ? 80  TYR A CA  1 
ATOM   587   C C   . TYR A 1 80  ? 195.427 -4.395   34.664  1.00 191.58 ? 80  TYR A C   1 
ATOM   588   O O   . TYR A 1 80  ? 195.873 -5.342   34.014  1.00 189.35 ? 80  TYR A O   1 
ATOM   589   C CB  . TYR A 1 80  ? 193.322 -3.206   33.974  1.00 188.70 ? 80  TYR A CB  1 
ATOM   590   C CG  . TYR A 1 80  ? 193.642 -3.398   32.499  1.00 191.94 ? 80  TYR A CG  1 
ATOM   591   C CD1 . TYR A 1 80  ? 192.826 -4.180   31.681  1.00 193.64 ? 80  TYR A CD1 1 
ATOM   592   C CD2 . TYR A 1 80  ? 194.756 -2.786   31.921  1.00 194.09 ? 80  TYR A CD2 1 
ATOM   593   C CE1 . TYR A 1 80  ? 193.115 -4.354   30.333  1.00 195.76 ? 80  TYR A CE1 1 
ATOM   594   C CE2 . TYR A 1 80  ? 195.054 -2.954   30.575  1.00 195.96 ? 80  TYR A CE2 1 
ATOM   595   C CZ  . TYR A 1 80  ? 194.232 -3.737   29.784  1.00 196.06 ? 80  TYR A CZ  1 
ATOM   596   O OH  . TYR A 1 80  ? 194.531 -3.901   28.448  1.00 195.99 ? 80  TYR A OH  1 
ATOM   597   N N   . ALA A 1 81  ? 196.191 -3.440   35.190  1.00 201.20 ? 81  ALA A N   1 
ATOM   598   C CA  . ALA A 1 81  ? 197.638 -3.377   34.981  1.00 211.49 ? 81  ALA A CA  1 
ATOM   599   C C   . ALA A 1 81  ? 198.397 -4.509   35.675  1.00 214.97 ? 81  ALA A C   1 
ATOM   600   O O   . ALA A 1 81  ? 199.428 -4.963   35.173  1.00 220.30 ? 81  ALA A O   1 
ATOM   601   C CB  . ALA A 1 81  ? 198.178 -2.024   35.420  1.00 216.52 ? 81  ALA A CB  1 
ATOM   602   N N   . VAL A 1 82  ? 197.890 -4.954   36.824  1.00 214.29 ? 82  VAL A N   1 
ATOM   603   C CA  . VAL A 1 82  ? 198.493 -6.073   37.554  1.00 213.11 ? 82  VAL A CA  1 
ATOM   604   C C   . VAL A 1 82  ? 198.179 -7.409   36.862  1.00 216.04 ? 82  VAL A C   1 
ATOM   605   O O   . VAL A 1 82  ? 198.971 -8.351   36.939  1.00 221.01 ? 82  VAL A O   1 
ATOM   606   C CB  . VAL A 1 82  ? 198.084 -6.084   39.053  1.00 208.64 ? 82  VAL A CB  1 
ATOM   607   C CG1 . VAL A 1 82  ? 198.678 -7.281   39.780  1.00 206.14 ? 82  VAL A CG1 1 
ATOM   608   C CG2 . VAL A 1 82  ? 198.544 -4.807   39.742  1.00 205.69 ? 82  VAL A CG2 1 
ATOM   609   N N   . THR A 1 83  ? 197.044 -7.474   36.164  1.00 214.06 ? 83  THR A N   1 
ATOM   610   C CA  . THR A 1 83  ? 196.629 -8.691   35.450  1.00 210.41 ? 83  THR A CA  1 
ATOM   611   C C   . THR A 1 83  ? 197.322 -8.855   34.088  1.00 211.76 ? 83  THR A C   1 
ATOM   612   O O   . THR A 1 83  ? 197.587 -9.981   33.654  1.00 212.48 ? 83  THR A O   1 
ATOM   613   C CB  . THR A 1 83  ? 195.095 -8.759   35.270  1.00 206.03 ? 83  THR A CB  1 
ATOM   614   O OG1 . THR A 1 83  ? 194.446 -8.353   36.482  1.00 204.43 ? 83  THR A OG1 1 
ATOM   615   C CG2 . THR A 1 83  ? 194.649 -10.177  34.920  1.00 202.89 ? 83  THR A CG2 1 
ATOM   616   N N   . VAL A 1 84  ? 197.610 -7.736   33.423  1.00 212.15 ? 84  VAL A N   1 
ATOM   617   C CA  . VAL A 1 84  ? 198.298 -7.752   32.124  1.00 212.45 ? 84  VAL A CA  1 
ATOM   618   C C   . VAL A 1 84  ? 199.769 -8.183   32.262  1.00 212.92 ? 84  VAL A C   1 
ATOM   619   O O   . VAL A 1 84  ? 200.243 -9.028   31.494  1.00 213.61 ? 84  VAL A O   1 
ATOM   620   C CB  . VAL A 1 84  ? 198.162 -6.396   31.379  1.00 211.96 ? 84  VAL A CB  1 
ATOM   621   C CG1 . VAL A 1 84  ? 199.083 -6.325   30.167  1.00 212.75 ? 84  VAL A CG1 1 
ATOM   622   C CG2 . VAL A 1 84  ? 196.720 -6.171   30.946  1.00 210.24 ? 84  VAL A CG2 1 
ATOM   623   N N   . ARG A 1 85  ? 200.471 -7.616   33.247  1.00 210.75 ? 85  ARG A N   1 
ATOM   624   C CA  . ARG A 1 85  ? 201.893 -7.925   33.487  1.00 205.87 ? 85  ARG A CA  1 
ATOM   625   C C   . ARG A 1 85  ? 202.135 -9.345   34.027  1.00 205.90 ? 85  ARG A C   1 
ATOM   626   O O   . ARG A 1 85  ? 203.240 -9.878   33.901  1.00 209.11 ? 85  ARG A O   1 
ATOM   627   C CB  . ARG A 1 85  ? 202.552 -6.878   34.405  1.00 196.83 ? 85  ARG A CB  1 
ATOM   628   C CG  . ARG A 1 85  ? 202.806 -5.521   33.755  1.00 186.52 ? 85  ARG A CG  1 
ATOM   629   C CD  . ARG A 1 85  ? 203.764 -4.665   34.576  1.00 173.69 ? 85  ARG A CD  1 
ATOM   630   N NE  . ARG A 1 85  ? 205.156 -4.820   34.150  1.00 163.58 ? 85  ARG A NE  1 
ATOM   631   C CZ  . ARG A 1 85  ? 206.213 -4.387   34.835  1.00 157.22 ? 85  ARG A CZ  1 
ATOM   632   N NH1 . ARG A 1 85  ? 206.058 -3.774   36.001  1.00 155.05 ? 85  ARG A NH1 1 
ATOM   633   N NH2 . ARG A 1 85  ? 207.435 -4.578   34.353  1.00 153.43 ? 85  ARG A NH2 1 
ATOM   634   N N   . MET A 1 86  ? 201.107 -9.945   34.626  1.00 203.27 ? 86  MET A N   1 
ATOM   635   C CA  . MET A 1 86  ? 201.173 -11.335  35.082  1.00 198.47 ? 86  MET A CA  1 
ATOM   636   C C   . MET A 1 86  ? 200.999 -12.317  33.921  1.00 193.75 ? 86  MET A C   1 
ATOM   637   O O   . MET A 1 86  ? 201.454 -13.460  33.994  1.00 190.29 ? 86  MET A O   1 
ATOM   638   C CB  . MET A 1 86  ? 200.117 -11.602  36.159  1.00 202.31 ? 86  MET A CB  1 
ATOM   639   C CG  . MET A 1 86  ? 200.545 -11.243  37.576  1.00 205.43 ? 86  MET A CG  1 
ATOM   640   S SD  . MET A 1 86  ? 199.136 -11.148  38.703  1.00 209.50 ? 86  MET A SD  1 
ATOM   641   C CE  . MET A 1 86  ? 199.921 -11.442  40.287  1.00 208.84 ? 86  MET A CE  1 
ATOM   642   N N   . LEU A 1 87  ? 200.347 -11.855  32.854  1.00 191.17 ? 87  LEU A N   1 
ATOM   643   C CA  . LEU A 1 87  ? 200.060 -12.673  31.672  1.00 191.44 ? 87  LEU A CA  1 
ATOM   644   C C   . LEU A 1 87  ? 201.168 -12.649  30.616  1.00 195.50 ? 87  LEU A C   1 
ATOM   645   O O   . LEU A 1 87  ? 201.137 -13.432  29.663  1.00 195.06 ? 87  LEU A O   1 
ATOM   646   C CB  . LEU A 1 87  ? 198.728 -12.244  31.042  1.00 188.11 ? 87  LEU A CB  1 
ATOM   647   C CG  . LEU A 1 87  ? 197.443 -13.032  31.330  1.00 186.96 ? 87  LEU A CG  1 
ATOM   648   C CD1 . LEU A 1 87  ? 197.449 -13.736  32.680  1.00 188.77 ? 87  LEU A CD1 1 
ATOM   649   C CD2 . LEU A 1 87  ? 196.237 -12.113  31.213  1.00 184.89 ? 87  LEU A CD2 1 
ATOM   650   N N   . GLU A 1 88  ? 202.137 -11.751  30.788  1.00 203.51 ? 88  GLU A N   1 
ATOM   651   C CA  . GLU A 1 88  ? 203.256 -11.616  29.847  1.00 211.57 ? 88  GLU A CA  1 
ATOM   652   C C   . GLU A 1 88  ? 204.460 -12.501  30.200  1.00 211.69 ? 88  GLU A C   1 
ATOM   653   O O   . GLU A 1 88  ? 205.410 -12.610  29.415  1.00 210.74 ? 88  GLU A O   1 
ATOM   654   C CB  . GLU A 1 88  ? 203.676 -10.149  29.699  1.00 220.90 ? 88  GLU A CB  1 
ATOM   655   C CG  . GLU A 1 88  ? 202.723 -9.313   28.853  1.00 232.32 ? 88  GLU A CG  1 
ATOM   656   C CD  . GLU A 1 88  ? 203.203 -7.887   28.630  1.00 242.94 ? 88  GLU A CD  1 
ATOM   657   O OE1 . GLU A 1 88  ? 204.410 -7.609   28.826  1.00 248.24 ? 88  GLU A OE1 1 
ATOM   658   O OE2 . GLU A 1 88  ? 202.369 -7.038   28.246  1.00 250.07 ? 88  GLU A OE2 1 
ATOM   659   N N   . MET A 1 89  ? 204.419 -13.118  31.380  1.00 210.49 ? 89  MET A N   1 
ATOM   660   C CA  . MET A 1 89  ? 205.368 -14.175  31.734  1.00 208.26 ? 89  MET A CA  1 
ATOM   661   C C   . MET A 1 89  ? 204.906 -15.507  31.138  1.00 214.84 ? 89  MET A C   1 
ATOM   662   O O   . MET A 1 89  ? 205.683 -16.463  31.062  1.00 217.78 ? 89  MET A O   1 
ATOM   663   C CB  . MET A 1 89  ? 205.537 -14.284  33.255  1.00 196.35 ? 89  MET A CB  1 
ATOM   664   C CG  . MET A 1 89  ? 206.506 -13.275  33.866  1.00 184.57 ? 89  MET A CG  1 
ATOM   665   S SD  . MET A 1 89  ? 208.208 -13.872  34.032  1.00 169.31 ? 89  MET A SD  1 
ATOM   666   C CE  . MET A 1 89  ? 208.894 -13.542  32.407  1.00 165.63 ? 89  MET A CE  1 
ATOM   667   N N   . PHE A 1 90  ? 203.638 -15.550  30.716  1.00 218.42 ? 90  PHE A N   1 
ATOM   668   C CA  . PHE A 1 90  ? 203.060 -16.694  29.998  1.00 216.71 ? 90  PHE A CA  1 
ATOM   669   C C   . PHE A 1 90  ? 203.266 -16.582  28.479  1.00 218.76 ? 90  PHE A C   1 
ATOM   670   O O   . PHE A 1 90  ? 202.721 -17.376  27.703  1.00 214.76 ? 90  PHE A O   1 
ATOM   671   C CB  . PHE A 1 90  ? 201.566 -16.846  30.328  1.00 209.33 ? 90  PHE A CB  1 
ATOM   672   C CG  . PHE A 1 90  ? 201.290 -17.285  31.740  1.00 203.27 ? 90  PHE A CG  1 
ATOM   673   C CD1 . PHE A 1 90  ? 201.313 -18.634  32.084  1.00 200.27 ? 90  PHE A CD1 1 
ATOM   674   C CD2 . PHE A 1 90  ? 200.999 -16.351  32.727  1.00 199.98 ? 90  PHE A CD2 1 
ATOM   675   C CE1 . PHE A 1 90  ? 201.060 -19.040  33.386  1.00 196.87 ? 90  PHE A CE1 1 
ATOM   676   C CE2 . PHE A 1 90  ? 200.744 -16.751  34.031  1.00 196.11 ? 90  PHE A CE2 1 
ATOM   677   C CZ  . PHE A 1 90  ? 200.776 -18.096  34.361  1.00 195.04 ? 90  PHE A CZ  1 
ATOM   678   N N   . GLU A 1 91  ? 204.057 -15.591  28.068  1.00 222.02 ? 91  GLU A N   1 
ATOM   679   C CA  . GLU A 1 91  ? 204.415 -15.396  26.665  1.00 223.16 ? 91  GLU A CA  1 
ATOM   680   C C   . GLU A 1 91  ? 205.926 -15.378  26.459  1.00 228.69 ? 91  GLU A C   1 
ATOM   681   O O   . GLU A 1 91  ? 206.680 -14.891  27.309  1.00 229.96 ? 91  GLU A O   1 
ATOM   682   C CB  . GLU A 1 91  ? 203.805 -14.104  26.121  1.00 217.89 ? 91  GLU A CB  1 
ATOM   683   C CG  . GLU A 1 91  ? 202.387 -14.257  25.597  1.00 211.51 ? 91  GLU A CG  1 
ATOM   684   C CD  . GLU A 1 91  ? 201.757 -12.925  25.229  1.00 207.96 ? 91  GLU A CD  1 
ATOM   685   O OE1 . GLU A 1 91  ? 202.364 -12.163  24.442  1.00 204.42 ? 91  GLU A OE1 1 
ATOM   686   O OE2 . GLU A 1 91  ? 200.645 -12.642  25.724  1.00 207.32 ? 91  GLU A OE2 1 
ATOM   687   N N   . ARG A 1 92  ? 206.349 -15.910  25.315  1.00 232.69 ? 92  ARG A N   1 
ATOM   688   C CA  . ARG A 1 92  ? 207.756 -15.949  24.920  1.00 235.59 ? 92  ARG A CA  1 
ATOM   689   C C   . ARG A 1 92  ? 208.238 -14.542  24.533  1.00 241.82 ? 92  ARG A C   1 
ATOM   690   O O   . ARG A 1 92  ? 207.473 -13.754  23.969  1.00 250.84 ? 92  ARG A O   1 
ATOM   691   C CB  . ARG A 1 92  ? 207.952 -16.921  23.743  1.00 227.85 ? 92  ARG A CB  1 
ATOM   692   C CG  . ARG A 1 92  ? 207.026 -18.139  23.726  1.00 215.80 ? 92  ARG A CG  1 
ATOM   693   C CD  . ARG A 1 92  ? 207.619 -19.344  24.440  1.00 207.15 ? 92  ARG A CD  1 
ATOM   694   N NE  . ARG A 1 92  ? 206.661 -20.451  24.525  1.00 199.28 ? 92  ARG A NE  1 
ATOM   695   C CZ  . ARG A 1 92  ? 206.972 -21.708  24.852  1.00 196.90 ? 92  ARG A CZ  1 
ATOM   696   N NH1 . ARG A 1 92  ? 206.024 -22.636  24.897  1.00 196.84 ? 92  ARG A NH1 1 
ATOM   697   N NH2 . ARG A 1 92  ? 208.228 -22.047  25.119  1.00 194.82 ? 92  ARG A NH2 1 
ATOM   698   N N   . LYS A 1 93  ? 209.497 -14.233  24.844  1.00 239.27 ? 93  LYS A N   1 
ATOM   699   C CA  . LYS A 1 93  ? 210.106 -12.934  24.518  1.00 230.86 ? 93  LYS A CA  1 
ATOM   700   C C   . LYS A 1 93  ? 210.585 -12.918  23.049  1.00 234.86 ? 93  LYS A C   1 
ATOM   701   O O   . LYS A 1 93  ? 211.520 -13.643  22.699  1.00 245.56 ? 93  LYS A O   1 
ATOM   702   C CB  . LYS A 1 93  ? 211.241 -12.630  25.514  1.00 217.57 ? 93  LYS A CB  1 
ATOM   703   C CG  . LYS A 1 93  ? 211.861 -11.239  25.440  1.00 204.31 ? 93  LYS A CG  1 
ATOM   704   C CD  . LYS A 1 93  ? 213.243 -11.284  24.803  1.00 197.41 ? 93  LYS A CD  1 
ATOM   705   C CE  . LYS A 1 93  ? 214.017 -9.999   25.059  1.00 190.29 ? 93  LYS A CE  1 
ATOM   706   N NZ  . LYS A 1 93  ? 215.361 -10.017  24.414  1.00 186.66 ? 93  LYS A NZ  1 
ATOM   707   N N   . PRO A 1 94  ? 209.942 -12.089  22.189  1.00 229.74 ? 94  PRO A N   1 
ATOM   708   C CA  . PRO A 1 94  ? 210.116 -12.142  20.723  1.00 223.90 ? 94  PRO A CA  1 
ATOM   709   C C   . PRO A 1 94  ? 211.495 -11.679  20.239  1.00 221.58 ? 94  PRO A C   1 
ATOM   710   O O   . PRO A 1 94  ? 211.655 -11.343  19.060  1.00 215.83 ? 94  PRO A O   1 
ATOM   711   C CB  . PRO A 1 94  ? 209.025 -11.193  20.209  1.00 219.56 ? 94  PRO A CB  1 
ATOM   712   C CG  . PRO A 1 94  ? 208.845 -10.209  21.311  1.00 219.70 ? 94  PRO A CG  1 
ATOM   713   C CD  . PRO A 1 94  ? 209.055 -10.977  22.589  1.00 225.68 ? 94  PRO A CD  1 
ATOM   714   N N   . MET B 2 1   ? 165.299 4.284    32.058  1.00 182.38 ? 1   MET B N   1 
ATOM   715   C CA  . MET B 2 1   ? 166.729 3.849    32.029  1.00 184.45 ? 1   MET B CA  1 
ATOM   716   C C   . MET B 2 1   ? 166.925 2.519    31.281  1.00 190.99 ? 1   MET B C   1 
ATOM   717   O O   . MET B 2 1   ? 167.690 1.654    31.721  1.00 198.87 ? 1   MET B O   1 
ATOM   718   C CB  . MET B 2 1   ? 167.317 3.798    33.456  1.00 176.50 ? 1   MET B CB  1 
ATOM   719   C CG  . MET B 2 1   ? 166.455 3.085    34.496  1.00 169.86 ? 1   MET B CG  1 
ATOM   720   S SD  . MET B 2 1   ? 167.076 3.213    36.189  1.00 161.34 ? 1   MET B SD  1 
ATOM   721   C CE  . MET B 2 1   ? 168.298 1.904    36.231  1.00 162.17 ? 1   MET B CE  1 
ATOM   722   N N   . ASP B 2 2   ? 166.237 2.374    30.144  1.00 192.14 ? 2   ASP B N   1 
ATOM   723   C CA  . ASP B 2 2   ? 166.309 1.164    29.304  1.00 187.22 ? 2   ASP B CA  1 
ATOM   724   C C   . ASP B 2 2   ? 167.662 0.983    28.624  1.00 176.86 ? 2   ASP B C   1 
ATOM   725   O O   . ASP B 2 2   ? 168.100 -0.144   28.385  1.00 174.99 ? 2   ASP B O   1 
ATOM   726   C CB  . ASP B 2 2   ? 165.211 1.175    28.230  1.00 192.89 ? 2   ASP B CB  1 
ATOM   727   C CG  . ASP B 2 2   ? 163.928 0.494    28.690  1.00 198.28 ? 2   ASP B CG  1 
ATOM   728   O OD1 . ASP B 2 2   ? 163.357 0.907    29.727  1.00 205.11 ? 2   ASP B OD1 1 
ATOM   729   O OD2 . ASP B 2 2   ? 163.480 -0.450   27.997  1.00 197.09 ? 2   ASP B OD2 1 
ATOM   730   N N   . LEU B 2 3   ? 168.305 2.103    28.305  1.00 163.90 ? 3   LEU B N   1 
ATOM   731   C CA  . LEU B 2 3   ? 169.592 2.104    27.620  1.00 153.17 ? 3   LEU B CA  1 
ATOM   732   C C   . LEU B 2 3   ? 170.730 1.771    28.584  1.00 150.47 ? 3   LEU B C   1 
ATOM   733   O O   . LEU B 2 3   ? 171.712 1.132    28.199  1.00 152.42 ? 3   LEU B O   1 
ATOM   734   C CB  . LEU B 2 3   ? 169.842 3.461    26.940  1.00 146.50 ? 3   LEU B CB  1 
ATOM   735   C CG  . LEU B 2 3   ? 168.792 4.116    26.022  1.00 141.18 ? 3   LEU B CG  1 
ATOM   736   C CD1 . LEU B 2 3   ? 168.101 3.116    25.099  1.00 138.07 ? 3   LEU B CD1 1 
ATOM   737   C CD2 . LEU B 2 3   ? 167.761 4.910    26.816  1.00 138.26 ? 3   LEU B CD2 1 
ATOM   738   N N   . ILE B 2 4   ? 170.582 2.203    29.834  1.00 144.28 ? 4   ILE B N   1 
ATOM   739   C CA  . ILE B 2 4   ? 171.574 1.959    30.882  1.00 136.44 ? 4   ILE B CA  1 
ATOM   740   C C   . ILE B 2 4   ? 171.504 0.510    31.387  1.00 127.79 ? 4   ILE B C   1 
ATOM   741   O O   . ILE B 2 4   ? 172.533 -0.147   31.533  1.00 125.41 ? 4   ILE B O   1 
ATOM   742   C CB  . ILE B 2 4   ? 171.415 2.959    32.053  1.00 138.91 ? 4   ILE B CB  1 
ATOM   743   C CG1 . ILE B 2 4   ? 171.295 4.394    31.520  1.00 138.41 ? 4   ILE B CG1 1 
ATOM   744   C CG2 . ILE B 2 4   ? 172.588 2.853    33.019  1.00 141.10 ? 4   ILE B CG2 1 
ATOM   745   C CD1 . ILE B 2 4   ? 170.585 5.349    32.455  1.00 136.79 ? 4   ILE B CD1 1 
ATOM   746   N N   . GLN B 2 5   ? 170.290 0.021    31.641  1.00 118.62 ? 5   GLN B N   1 
ATOM   747   C CA  . GLN B 2 5   ? 170.068 -1.359   32.084  1.00 110.58 ? 5   GLN B CA  1 
ATOM   748   C C   . GLN B 2 5   ? 170.449 -2.375   31.009  1.00 108.24 ? 5   GLN B C   1 
ATOM   749   O O   . GLN B 2 5   ? 170.973 -3.440   31.328  1.00 105.96 ? 5   GLN B O   1 
ATOM   750   C CB  . GLN B 2 5   ? 168.611 -1.566   32.503  1.00 108.47 ? 5   GLN B CB  1 
ATOM   751   C CG  . GLN B 2 5   ? 168.260 -1.039   33.888  1.00 105.14 ? 5   GLN B CG  1 
ATOM   752   C CD  . GLN B 2 5   ? 168.277 -2.111   34.964  1.00 102.52 ? 5   GLN B CD  1 
ATOM   753   O OE1 . GLN B 2 5   ? 168.794 -3.211   34.760  1.00 100.64 ? 5   GLN B OE1 1 
ATOM   754   N NE2 . GLN B 2 5   ? 167.705 -1.794   36.122  1.00 100.85 ? 5   GLN B NE2 1 
ATOM   755   N N   . ALA B 2 6   ? 170.173 -2.041   29.746  1.00 107.54 ? 6   ALA B N   1 
ATOM   756   C CA  . ALA B 2 6   ? 170.589 -2.862   28.605  1.00 108.46 ? 6   ALA B CA  1 
ATOM   757   C C   . ALA B 2 6   ? 172.104 -2.876   28.480  1.00 110.65 ? 6   ALA B C   1 
ATOM   758   O O   . ALA B 2 6   ? 172.688 -3.886   28.087  1.00 110.44 ? 6   ALA B O   1 
ATOM   759   C CB  . ALA B 2 6   ? 169.955 -2.362   27.315  1.00 106.93 ? 6   ALA B CB  1 
ATOM   760   N N   . ALA B 2 7   ? 172.729 -1.746   28.809  1.00 114.52 ? 7   ALA B N   1 
ATOM   761   C CA  . ALA B 2 7   ? 174.182 -1.656   28.887  1.00 118.63 ? 7   ALA B CA  1 
ATOM   762   C C   . ALA B 2 7   ? 174.687 -2.457   30.082  1.00 121.10 ? 7   ALA B C   1 
ATOM   763   O O   . ALA B 2 7   ? 175.633 -3.229   29.951  1.00 123.19 ? 7   ALA B O   1 
ATOM   764   C CB  . ALA B 2 7   ? 174.633 -0.204   28.979  1.00 118.75 ? 7   ALA B CB  1 
ATOM   765   N N   . TYR B 2 8   ? 174.030 -2.290   31.230  1.00 122.58 ? 8   TYR B N   1 
ATOM   766   C CA  . TYR B 2 8   ? 174.386 -3.000   32.463  1.00 124.56 ? 8   TYR B CA  1 
ATOM   767   C C   . TYR B 2 8   ? 174.097 -4.491   32.361  1.00 126.20 ? 8   TYR B C   1 
ATOM   768   O O   . TYR B 2 8   ? 174.584 -5.286   33.169  1.00 125.11 ? 8   TYR B O   1 
ATOM   769   C CB  . TYR B 2 8   ? 173.658 -2.388   33.661  1.00 125.07 ? 8   TYR B CB  1 
ATOM   770   C CG  . TYR B 2 8   ? 174.228 -1.057   34.105  1.00 127.89 ? 8   TYR B CG  1 
ATOM   771   C CD1 . TYR B 2 8   ? 175.080 -0.324   33.275  1.00 129.46 ? 8   TYR B CD1 1 
ATOM   772   C CD2 . TYR B 2 8   ? 173.902 -0.520   35.347  1.00 130.16 ? 8   TYR B CD2 1 
ATOM   773   C CE1 . TYR B 2 8   ? 175.600 0.894    33.673  1.00 132.41 ? 8   TYR B CE1 1 
ATOM   774   C CE2 . TYR B 2 8   ? 174.418 0.702    35.754  1.00 133.21 ? 8   TYR B CE2 1 
ATOM   775   C CZ  . TYR B 2 8   ? 175.266 1.403    34.913  1.00 133.75 ? 8   TYR B CZ  1 
ATOM   776   O OH  . TYR B 2 8   ? 175.780 2.616    35.302  1.00 135.08 ? 8   TYR B OH  1 
ATOM   777   N N   . PHE B 2 9   ? 173.296 -4.853   31.362  1.00 129.78 ? 9   PHE B N   1 
ATOM   778   C CA  . PHE B 2 9   ? 173.052 -6.244   31.006  1.00 133.29 ? 9   PHE B CA  1 
ATOM   779   C C   . PHE B 2 9   ? 174.163 -6.766   30.092  1.00 132.50 ? 9   PHE B C   1 
ATOM   780   O O   . PHE B 2 9   ? 174.638 -7.891   30.270  1.00 132.81 ? 9   PHE B O   1 
ATOM   781   C CB  . PHE B 2 9   ? 171.684 -6.391   30.335  1.00 136.85 ? 9   PHE B CB  1 
ATOM   782   C CG  . PHE B 2 9   ? 171.363 -7.794   29.909  1.00 139.89 ? 9   PHE B CG  1 
ATOM   783   C CD1 . PHE B 2 9   ? 171.032 -8.763   30.850  1.00 140.12 ? 9   PHE B CD1 1 
ATOM   784   C CD2 . PHE B 2 9   ? 171.386 -8.146   28.563  1.00 141.29 ? 9   PHE B CD2 1 
ATOM   785   C CE1 . PHE B 2 9   ? 170.737 -10.057  30.457  1.00 140.29 ? 9   PHE B CE1 1 
ATOM   786   C CE2 . PHE B 2 9   ? 171.090 -9.439   28.163  1.00 141.47 ? 9   PHE B CE2 1 
ATOM   787   C CZ  . PHE B 2 9   ? 170.766 -10.394  29.111  1.00 140.69 ? 9   PHE B CZ  1 
ATOM   788   N N   . VAL B 2 10  ? 174.560 -5.948   29.114  1.00 130.03 ? 10  VAL B N   1 
ATOM   789   C CA  . VAL B 2 10  ? 175.714 -6.243   28.255  1.00 126.47 ? 10  VAL B CA  1 
ATOM   790   C C   . VAL B 2 10  ? 176.976 -6.305   29.122  1.00 126.31 ? 10  VAL B C   1 
ATOM   791   O O   . VAL B 2 10  ? 177.814 -7.191   28.949  1.00 126.34 ? 10  VAL B O   1 
ATOM   792   C CB  . VAL B 2 10  ? 175.862 -5.209   27.105  1.00 124.06 ? 10  VAL B CB  1 
ATOM   793   C CG1 . VAL B 2 10  ? 177.193 -5.368   26.380  1.00 122.35 ? 10  VAL B CG1 1 
ATOM   794   C CG2 . VAL B 2 10  ? 174.717 -5.342   26.109  1.00 122.08 ? 10  VAL B CG2 1 
ATOM   795   N N   . VAL B 2 11  ? 177.075 -5.373   30.071  1.00 125.66 ? 11  VAL B N   1 
ATOM   796   C CA  . VAL B 2 11  ? 178.159 -5.322   31.055  1.00 124.12 ? 11  VAL B CA  1 
ATOM   797   C C   . VAL B 2 11  ? 178.191 -6.578   31.931  1.00 122.72 ? 11  VAL B C   1 
ATOM   798   O O   . VAL B 2 11  ? 179.262 -7.124   32.202  1.00 122.38 ? 11  VAL B O   1 
ATOM   799   C CB  . VAL B 2 11  ? 178.053 -4.042   31.921  1.00 124.51 ? 11  VAL B CB  1 
ATOM   800   C CG1 . VAL B 2 11  ? 178.798 -4.181   33.240  1.00 124.59 ? 11  VAL B CG1 1 
ATOM   801   C CG2 . VAL B 2 11  ? 178.560 -2.839   31.140  1.00 125.17 ? 11  VAL B CG2 1 
ATOM   802   N N   . ALA B 2 12  ? 177.011 -7.031   32.351  1.00 121.56 ? 12  ALA B N   1 
ATOM   803   C CA  . ALA B 2 12  ? 176.873 -8.233   33.170  1.00 121.26 ? 12  ALA B CA  1 
ATOM   804   C C   . ALA B 2 12  ? 177.502 -9.459   32.515  1.00 122.48 ? 12  ALA B C   1 
ATOM   805   O O   . ALA B 2 12  ? 178.271 -10.181  33.151  1.00 122.92 ? 12  ALA B O   1 
ATOM   806   C CB  . ALA B 2 12  ? 175.408 -8.494   33.469  1.00 119.88 ? 12  ALA B CB  1 
ATOM   807   N N   . ILE B 2 13  ? 177.171 -9.678   31.243  1.00 124.14 ? 13  ILE B N   1 
ATOM   808   C CA  . ILE B 2 13  ? 177.636 -10.845  30.489  1.00 126.62 ? 13  ILE B CA  1 
ATOM   809   C C   . ILE B 2 13  ? 179.156 -10.844  30.305  1.00 131.46 ? 13  ILE B C   1 
ATOM   810   O O   . ILE B 2 13  ? 179.818 -11.846  30.583  1.00 130.95 ? 13  ILE B O   1 
ATOM   811   C CB  . ILE B 2 13  ? 176.922 -10.956  29.121  1.00 124.36 ? 13  ILE B CB  1 
ATOM   812   C CG1 . ILE B 2 13  ? 175.404 -11.059  29.323  1.00 123.10 ? 13  ILE B CG1 1 
ATOM   813   C CG2 . ILE B 2 13  ? 177.432 -12.161  28.338  1.00 123.71 ? 13  ILE B CG2 1 
ATOM   814   C CD1 . ILE B 2 13  ? 174.581 -10.712  28.100  1.00 122.96 ? 13  ILE B CD1 1 
ATOM   815   N N   . LEU B 2 14  ? 179.696 -9.709   29.860  1.00 139.12 ? 14  LEU B N   1 
ATOM   816   C CA  . LEU B 2 14  ? 181.127 -9.560   29.571  1.00 146.21 ? 14  LEU B CA  1 
ATOM   817   C C   . LEU B 2 14  ? 182.040 -9.969   30.733  1.00 145.27 ? 14  LEU B C   1 
ATOM   818   O O   . LEU B 2 14  ? 183.127 -10.511  30.513  1.00 144.61 ? 14  LEU B O   1 
ATOM   819   C CB  . LEU B 2 14  ? 181.436 -8.121   29.129  1.00 153.48 ? 14  LEU B CB  1 
ATOM   820   C CG  . LEU B 2 14  ? 180.769 -7.598   27.848  1.00 158.12 ? 14  LEU B CG  1 
ATOM   821   C CD1 . LEU B 2 14  ? 180.812 -6.076   27.779  1.00 159.91 ? 14  LEU B CD1 1 
ATOM   822   C CD2 . LEU B 2 14  ? 181.370 -8.220   26.593  1.00 161.90 ? 14  LEU B CD2 1 
ATOM   823   N N   . PHE B 2 15  ? 181.585 -9.711   31.960  1.00 144.19 ? 15  PHE B N   1 
ATOM   824   C CA  . PHE B 2 15  ? 182.324 -10.076  33.171  1.00 141.62 ? 15  PHE B CA  1 
ATOM   825   C C   . PHE B 2 15  ? 182.447 -11.581  33.341  1.00 134.56 ? 15  PHE B C   1 
ATOM   826   O O   . PHE B 2 15  ? 183.547 -12.104  33.525  1.00 131.86 ? 15  PHE B O   1 
ATOM   827   C CB  . PHE B 2 15  ? 181.662 -9.482   34.417  1.00 147.73 ? 15  PHE B CB  1 
ATOM   828   C CG  . PHE B 2 15  ? 181.986 -8.037   34.646  1.00 153.58 ? 15  PHE B CG  1 
ATOM   829   C CD1 . PHE B 2 15  ? 183.302 -7.587   34.587  1.00 155.85 ? 15  PHE B CD1 1 
ATOM   830   C CD2 . PHE B 2 15  ? 180.978 -7.127   34.941  1.00 156.41 ? 15  PHE B CD2 1 
ATOM   831   C CE1 . PHE B 2 15  ? 183.606 -6.254   34.802  1.00 158.89 ? 15  PHE B CE1 1 
ATOM   832   C CE2 . PHE B 2 15  ? 181.276 -5.792   35.161  1.00 159.81 ? 15  PHE B CE2 1 
ATOM   833   C CZ  . PHE B 2 15  ? 182.591 -5.355   35.089  1.00 160.94 ? 15  PHE B CZ  1 
ATOM   834   N N   . ILE B 2 16  ? 181.305 -12.263  33.286  1.00 128.26 ? 16  ILE B N   1 
ATOM   835   C CA  . ILE B 2 16  ? 181.244 -13.717  33.390  1.00 123.24 ? 16  ILE B CA  1 
ATOM   836   C C   . ILE B 2 16  ? 182.132 -14.340  32.315  1.00 117.89 ? 16  ILE B C   1 
ATOM   837   O O   . ILE B 2 16  ? 182.925 -15.240  32.603  1.00 116.27 ? 16  ILE B O   1 
ATOM   838   C CB  . ILE B 2 16  ? 179.795 -14.236  33.245  1.00 125.82 ? 16  ILE B CB  1 
ATOM   839   C CG1 . ILE B 2 16  ? 178.832 -13.399  34.096  1.00 127.84 ? 16  ILE B CG1 1 
ATOM   840   C CG2 . ILE B 2 16  ? 179.707 -15.708  33.626  1.00 126.45 ? 16  ILE B CG2 1 
ATOM   841   C CD1 . ILE B 2 16  ? 177.389 -13.446  33.633  1.00 130.45 ? 16  ILE B CD1 1 
ATOM   842   N N   . VAL B 2 17  ? 181.999 -13.837  31.088  1.00 112.74 ? 17  VAL B N   1 
ATOM   843   C CA  . VAL B 2 17  ? 182.824 -14.266  29.958  1.00 108.65 ? 17  VAL B CA  1 
ATOM   844   C C   . VAL B 2 17  ? 184.304 -14.049  30.276  1.00 103.99 ? 17  VAL B C   1 
ATOM   845   O O   . VAL B 2 17  ? 185.116 -14.967  30.137  1.00 103.43 ? 17  VAL B O   1 
ATOM   846   C CB  . VAL B 2 17  ? 182.439 -13.528  28.652  1.00 109.87 ? 17  VAL B CB  1 
ATOM   847   C CG1 . VAL B 2 17  ? 183.330 -13.970  27.499  1.00 111.36 ? 17  VAL B CG1 1 
ATOM   848   C CG2 . VAL B 2 17  ? 180.978 -13.777  28.301  1.00 110.64 ? 17  VAL B CG2 1 
ATOM   849   N N   . GLY B 2 18  ? 184.638 -12.838  30.716  1.00 99.41  ? 18  GLY B N   1 
ATOM   850   C CA  . GLY B 2 18  ? 185.994 -12.513  31.144  1.00 95.17  ? 18  GLY B CA  1 
ATOM   851   C C   . GLY B 2 18  ? 186.481 -13.452  32.230  1.00 92.35  ? 18  GLY B C   1 
ATOM   852   O O   . GLY B 2 18  ? 187.607 -13.948  32.169  1.00 92.13  ? 18  GLY B O   1 
ATOM   853   N N   . LEU B 2 19  ? 185.618 -13.708  33.212  1.00 89.95  ? 19  LEU B N   1 
ATOM   854   C CA  . LEU B 2 19  ? 185.939 -14.580  34.338  1.00 88.10  ? 19  LEU B CA  1 
ATOM   855   C C   . LEU B 2 19  ? 186.193 -16.011  33.879  1.00 88.26  ? 19  LEU B C   1 
ATOM   856   O O   . LEU B 2 19  ? 187.106 -16.675  34.376  1.00 85.66  ? 19  LEU B O   1 
ATOM   857   C CB  . LEU B 2 19  ? 184.808 -14.571  35.368  1.00 87.33  ? 19  LEU B CB  1 
ATOM   858   C CG  . LEU B 2 19  ? 185.122 -14.686  36.866  1.00 86.89  ? 19  LEU B CG  1 
ATOM   859   C CD1 . LEU B 2 19  ? 184.221 -15.738  37.490  1.00 87.09  ? 19  LEU B CD1 1 
ATOM   860   C CD2 . LEU B 2 19  ? 186.576 -15.015  37.173  1.00 86.88  ? 19  LEU B CD2 1 
ATOM   861   N N   . LYS B 2 20  ? 185.377 -16.478  32.936  1.00 91.40  ? 20  LYS B N   1 
ATOM   862   C CA  . LYS B 2 20  ? 185.522 -17.819  32.381  1.00 96.33  ? 20  LYS B CA  1 
ATOM   863   C C   . LYS B 2 20  ? 186.853 -17.947  31.652  1.00 101.75 ? 20  LYS B C   1 
ATOM   864   O O   . LYS B 2 20  ? 187.653 -18.820  31.976  1.00 102.98 ? 20  LYS B O   1 
ATOM   865   C CB  . LYS B 2 20  ? 184.364 -18.158  31.433  1.00 94.86  ? 20  LYS B CB  1 
ATOM   866   C CG  . LYS B 2 20  ? 184.209 -19.646  31.129  1.00 92.88  ? 20  LYS B CG  1 
ATOM   867   C CD  . LYS B 2 20  ? 183.335 -19.885  29.905  1.00 91.24  ? 20  LYS B CD  1 
ATOM   868   C CE  . LYS B 2 20  ? 182.665 -21.254  29.926  1.00 89.57  ? 20  LYS B CE  1 
ATOM   869   N NZ  . LYS B 2 20  ? 183.616 -22.401  29.918  1.00 88.30  ? 20  LYS B NZ  1 
ATOM   870   N N   . ARG B 2 21  ? 187.093 -17.058  30.689  1.00 109.55 ? 21  ARG B N   1 
ATOM   871   C CA  . ARG B 2 21  ? 188.282 -17.138  29.835  1.00 117.62 ? 21  ARG B CA  1 
ATOM   872   C C   . ARG B 2 21  ? 189.597 -16.901  30.579  1.00 121.95 ? 21  ARG B C   1 
ATOM   873   O O   . ARG B 2 21  ? 190.643 -17.391  30.154  1.00 122.71 ? 21  ARG B O   1 
ATOM   874   C CB  . ARG B 2 21  ? 188.160 -16.206  28.623  1.00 120.71 ? 21  ARG B CB  1 
ATOM   875   C CG  . ARG B 2 21  ? 187.224 -16.729  27.542  1.00 123.69 ? 21  ARG B CG  1 
ATOM   876   C CD  . ARG B 2 21  ? 187.177 -15.813  26.327  1.00 126.31 ? 21  ARG B CD  1 
ATOM   877   N NE  . ARG B 2 21  ? 188.229 -16.104  25.351  1.00 126.19 ? 21  ARG B NE  1 
ATOM   878   C CZ  . ARG B 2 21  ? 188.084 -16.899  24.291  1.00 125.34 ? 21  ARG B CZ  1 
ATOM   879   N NH1 . ARG B 2 21  ? 186.929 -17.508  24.048  1.00 125.03 ? 21  ARG B NH1 1 
ATOM   880   N NH2 . ARG B 2 21  ? 189.105 -17.091  23.465  1.00 124.19 ? 21  ARG B NH2 1 
ATOM   881   N N   . MET B 2 22  ? 189.543 -16.167  31.688  1.00 127.13 ? 22  MET B N   1 
ATOM   882   C CA  . MET B 2 22  ? 190.731 -15.945  32.514  1.00 132.70 ? 22  MET B CA  1 
ATOM   883   C C   . MET B 2 22  ? 191.109 -17.147  33.380  1.00 135.67 ? 22  MET B C   1 
ATOM   884   O O   . MET B 2 22  ? 192.175 -17.158  33.998  1.00 137.83 ? 22  MET B O   1 
ATOM   885   C CB  . MET B 2 22  ? 190.579 -14.689  33.375  1.00 134.26 ? 22  MET B CB  1 
ATOM   886   C CG  . MET B 2 22  ? 191.253 -13.464  32.781  1.00 136.09 ? 22  MET B CG  1 
ATOM   887   S SD  . MET B 2 22  ? 191.183 -12.002  33.833  1.00 138.37 ? 22  MET B SD  1 
ATOM   888   C CE  . MET B 2 22  ? 189.453 -11.555  33.698  1.00 140.00 ? 22  MET B CE  1 
ATOM   889   N N   . ALA B 2 23  ? 190.247 -18.160  33.413  1.00 138.46 ? 23  ALA B N   1 
ATOM   890   C CA  . ALA B 2 23  ? 190.502 -19.369  34.197  1.00 141.21 ? 23  ALA B CA  1 
ATOM   891   C C   . ALA B 2 23  ? 191.245 -20.464  33.417  1.00 143.58 ? 23  ALA B C   1 
ATOM   892   O O   . ALA B 2 23  ? 191.863 -21.349  34.021  1.00 143.80 ? 23  ALA B O   1 
ATOM   893   C CB  . ALA B 2 23  ? 189.198 -19.909  34.772  1.00 141.18 ? 23  ALA B CB  1 
ATOM   894   N N   . HIS B 2 24  ? 191.193 -20.390  32.086  1.00 145.00 ? 24  HIS B N   1 
ATOM   895   C CA  . HIS B 2 24  ? 191.723 -21.449  31.215  1.00 141.98 ? 24  HIS B CA  1 
ATOM   896   C C   . HIS B 2 24  ? 193.120 -21.154  30.653  1.00 132.63 ? 24  HIS B C   1 
ATOM   897   O O   . HIS B 2 24  ? 193.428 -20.009  30.325  1.00 132.13 ? 24  HIS B O   1 
ATOM   898   C CB  . HIS B 2 24  ? 190.744 -21.750  30.071  1.00 148.60 ? 24  HIS B CB  1 
ATOM   899   C CG  . HIS B 2 24  ? 189.394 -22.207  30.533  1.00 154.17 ? 24  HIS B CG  1 
ATOM   900   N ND1 . HIS B 2 24  ? 189.123 -23.517  30.865  1.00 155.40 ? 24  HIS B ND1 1 
ATOM   901   C CD2 . HIS B 2 24  ? 188.237 -21.526  30.713  1.00 156.43 ? 24  HIS B CD2 1 
ATOM   902   C CE1 . HIS B 2 24  ? 187.858 -23.623  31.233  1.00 156.47 ? 24  HIS B CE1 1 
ATOM   903   N NE2 . HIS B 2 24  ? 187.298 -22.429  31.151  1.00 157.09 ? 24  HIS B NE2 1 
ATOM   904   N N   . PRO B 2 25  ? 193.961 -22.202  30.536  1.00 123.79 ? 25  PRO B N   1 
ATOM   905   C CA  . PRO B 2 25  ? 195.344 -22.149  30.057  1.00 118.39 ? 25  PRO B CA  1 
ATOM   906   C C   . PRO B 2 25  ? 195.561 -21.260  28.833  1.00 115.47 ? 25  PRO B C   1 
ATOM   907   O O   . PRO B 2 25  ? 196.411 -20.364  28.858  1.00 111.48 ? 25  PRO B O   1 
ATOM   908   C CB  . PRO B 2 25  ? 195.618 -23.599  29.673  1.00 117.80 ? 25  PRO B CB  1 
ATOM   909   C CG  . PRO B 2 25  ? 194.799 -24.394  30.620  1.00 118.62 ? 25  PRO B CG  1 
ATOM   910   C CD  . PRO B 2 25  ? 193.579 -23.574  30.931  1.00 121.08 ? 25  PRO B CD  1 
ATOM   911   N N   . THR B 2 26  ? 194.788 -21.516  27.782  1.00 116.06 ? 26  THR B N   1 
ATOM   912   C CA  . THR B 2 26  ? 194.986 -20.879  26.484  1.00 117.96 ? 26  THR B CA  1 
ATOM   913   C C   . THR B 2 26  ? 194.270 -19.533  26.348  1.00 116.88 ? 26  THR B C   1 
ATOM   914   O O   . THR B 2 26  ? 194.787 -18.619  25.701  1.00 121.04 ? 26  THR B O   1 
ATOM   915   C CB  . THR B 2 26  ? 194.565 -21.812  25.327  1.00 119.61 ? 26  THR B CB  1 
ATOM   916   O OG1 . THR B 2 26  ? 193.269 -22.364  25.600  1.00 120.33 ? 26  THR B OG1 1 
ATOM   917   C CG2 . THR B 2 26  ? 195.573 -22.950  25.159  1.00 119.75 ? 26  THR B CG2 1 
ATOM   918   N N   . THR B 2 27  ? 193.092 -19.413  26.958  1.00 111.86 ? 27  THR B N   1 
ATOM   919   C CA  . THR B 2 27  ? 192.303 -18.181  26.868  1.00 106.99 ? 27  THR B CA  1 
ATOM   920   C C   . THR B 2 27  ? 192.662 -17.175  27.972  1.00 105.21 ? 27  THR B C   1 
ATOM   921   O O   . THR B 2 27  ? 192.115 -16.069  28.015  1.00 104.61 ? 27  THR B O   1 
ATOM   922   C CB  . THR B 2 27  ? 190.784 -18.472  26.871  1.00 105.17 ? 27  THR B CB  1 
ATOM   923   O OG1 . THR B 2 27  ? 190.427 -19.163  28.072  1.00 104.00 ? 27  THR B OG1 1 
ATOM   924   C CG2 . THR B 2 27  ? 190.392 -19.329  25.669  1.00 103.96 ? 27  THR B CG2 1 
ATOM   925   N N   . ALA B 2 28  ? 193.591 -17.571  28.846  1.00 103.26 ? 28  ALA B N   1 
ATOM   926   C CA  . ALA B 2 28  ? 194.039 -16.763  29.989  1.00 102.10 ? 28  ALA B CA  1 
ATOM   927   C C   . ALA B 2 28  ? 194.367 -15.324  29.615  1.00 101.96 ? 28  ALA B C   1 
ATOM   928   O O   . ALA B 2 28  ? 193.896 -14.382  30.257  1.00 100.52 ? 28  ALA B O   1 
ATOM   929   C CB  . ALA B 2 28  ? 195.244 -17.417  30.654  1.00 101.13 ? 28  ALA B CB  1 
ATOM   930   N N   . LYS B 2 29  ? 195.177 -15.172  28.571  1.00 103.85 ? 29  LYS B N   1 
ATOM   931   C CA  . LYS B 2 29  ? 195.598 -13.866  28.082  1.00 107.26 ? 29  LYS B CA  1 
ATOM   932   C C   . LYS B 2 29  ? 194.392 -13.020  27.678  1.00 111.73 ? 29  LYS B C   1 
ATOM   933   O O   . LYS B 2 29  ? 194.251 -11.882  28.125  1.00 112.62 ? 29  LYS B O   1 
ATOM   934   C CB  . LYS B 2 29  ? 196.551 -14.016  26.889  1.00 106.11 ? 29  LYS B CB  1 
ATOM   935   C CG  . LYS B 2 29  ? 197.422 -15.266  26.895  1.00 104.28 ? 29  LYS B CG  1 
ATOM   936   C CD  . LYS B 2 29  ? 198.666 -15.111  27.754  1.00 102.60 ? 29  LYS B CD  1 
ATOM   937   C CE  . LYS B 2 29  ? 199.705 -16.158  27.384  1.00 101.46 ? 29  LYS B CE  1 
ATOM   938   N NZ  . LYS B 2 29  ? 199.297 -17.541  27.767  1.00 99.41  ? 29  LYS B NZ  1 
ATOM   939   N N   . SER B 2 30  ? 193.520 -13.599  26.853  1.00 117.57 ? 30  SER B N   1 
ATOM   940   C CA  . SER B 2 30  ? 192.382 -12.883  26.267  1.00 123.62 ? 30  SER B CA  1 
ATOM   941   C C   . SER B 2 30  ? 191.240 -12.603  27.248  1.00 128.50 ? 30  SER B C   1 
ATOM   942   O O   . SER B 2 30  ? 190.396 -11.742  26.989  1.00 129.83 ? 30  SER B O   1 
ATOM   943   C CB  . SER B 2 30  ? 191.855 -13.630  25.033  1.00 123.14 ? 30  SER B CB  1 
ATOM   944   O OG  . SER B 2 30  ? 191.467 -14.955  25.354  1.00 122.90 ? 30  SER B OG  1 
ATOM   945   N N   . GLY B 2 31  ? 191.221 -13.323  28.369  1.00 133.65 ? 31  GLY B N   1 
ATOM   946   C CA  . GLY B 2 31  ? 190.167 -13.178  29.373  1.00 141.35 ? 31  GLY B CA  1 
ATOM   947   C C   . GLY B 2 31  ? 190.052 -11.788  29.974  1.00 148.41 ? 31  GLY B C   1 
ATOM   948   O O   . GLY B 2 31  ? 188.945 -11.300  30.212  1.00 146.10 ? 31  GLY B O   1 
ATOM   949   N N   . ILE B 2 32  ? 191.199 -11.155  30.216  1.00 159.04 ? 32  ILE B N   1 
ATOM   950   C CA  . ILE B 2 32  ? 191.248 -9.825   30.831  1.00 172.37 ? 32  ILE B CA  1 
ATOM   951   C C   . ILE B 2 32  ? 190.780 -8.704   29.886  1.00 184.43 ? 32  ILE B C   1 
ATOM   952   O O   . ILE B 2 32  ? 190.218 -7.705   30.342  1.00 189.44 ? 32  ILE B O   1 
ATOM   953   C CB  . ILE B 2 32  ? 192.641 -9.529   31.467  1.00 170.75 ? 32  ILE B CB  1 
ATOM   954   C CG1 . ILE B 2 32  ? 192.621 -8.249   32.317  1.00 170.88 ? 32  ILE B CG1 1 
ATOM   955   C CG2 . ILE B 2 32  ? 193.741 -9.470   30.414  1.00 170.89 ? 32  ILE B CG2 1 
ATOM   956   C CD1 . ILE B 2 32  ? 191.754 -8.324   33.558  1.00 171.08 ? 32  ILE B CD1 1 
ATOM   957   N N   . VAL B 2 33  ? 190.995 -8.883   28.582  1.00 197.21 ? 33  VAL B N   1 
ATOM   958   C CA  . VAL B 2 33  ? 190.562 -7.904   27.571  1.00 205.70 ? 33  VAL B CA  1 
ATOM   959   C C   . VAL B 2 33  ? 189.032 -7.865   27.465  1.00 206.36 ? 33  VAL B C   1 
ATOM   960   O O   . VAL B 2 33  ? 188.445 -6.794   27.293  1.00 207.95 ? 33  VAL B O   1 
ATOM   961   C CB  . VAL B 2 33  ? 191.217 -8.159   26.186  1.00 209.37 ? 33  VAL B CB  1 
ATOM   962   C CG1 . VAL B 2 33  ? 190.675 -7.207   25.127  1.00 209.03 ? 33  VAL B CG1 1 
ATOM   963   C CG2 . VAL B 2 33  ? 192.731 -8.020   26.274  1.00 212.47 ? 33  VAL B CG2 1 
ATOM   964   N N   . TRP B 2 34  ? 188.400 -9.035   27.584  1.00 205.77 ? 34  TRP B N   1 
ATOM   965   C CA  . TRP B 2 34  ? 186.938 -9.147   27.611  1.00 206.29 ? 34  TRP B CA  1 
ATOM   966   C C   . TRP B 2 34  ? 186.332 -8.353   28.768  1.00 208.67 ? 34  TRP B C   1 
ATOM   967   O O   . TRP B 2 34  ? 185.304 -7.694   28.604  1.00 211.81 ? 34  TRP B O   1 
ATOM   968   C CB  . TRP B 2 34  ? 186.499 -10.613  27.703  1.00 204.23 ? 34  TRP B CB  1 
ATOM   969   C CG  . TRP B 2 34  ? 186.488 -11.346  26.386  1.00 204.84 ? 34  TRP B CG  1 
ATOM   970   C CD1 . TRP B 2 34  ? 187.545 -11.967  25.787  1.00 206.08 ? 34  TRP B CD1 1 
ATOM   971   C CD2 . TRP B 2 34  ? 185.361 -11.546  25.517  1.00 204.03 ? 34  TRP B CD2 1 
ATOM   972   N NE1 . TRP B 2 34  ? 187.152 -12.535  24.597  1.00 206.63 ? 34  TRP B NE1 1 
ATOM   973   C CE2 . TRP B 2 34  ? 185.817 -12.292  24.407  1.00 204.16 ? 34  TRP B CE2 1 
ATOM   974   C CE3 . TRP B 2 34  ? 184.012 -11.162  25.565  1.00 201.90 ? 34  TRP B CE3 1 
ATOM   975   C CZ2 . TRP B 2 34  ? 184.972 -12.667  23.352  1.00 200.90 ? 34  TRP B CZ2 1 
ATOM   976   C CZ3 . TRP B 2 34  ? 183.170 -11.538  24.515  1.00 199.05 ? 34  TRP B CZ3 1 
ATOM   977   C CH2 . TRP B 2 34  ? 183.657 -12.281  23.424  1.00 197.57 ? 34  TRP B CH2 1 
ATOM   978   N N   . ALA B 2 35  ? 186.977 -8.419   29.931  1.00 210.63 ? 35  ALA B N   1 
ATOM   979   C CA  . ALA B 2 35  ? 186.543 -7.671   31.110  1.00 213.76 ? 35  ALA B CA  1 
ATOM   980   C C   . ALA B 2 35  ? 186.908 -6.185   31.024  1.00 214.46 ? 35  ALA B C   1 
ATOM   981   O O   . ALA B 2 35  ? 186.303 -5.352   31.705  1.00 216.57 ? 35  ALA B O   1 
ATOM   982   C CB  . ALA B 2 35  ? 187.120 -8.294   32.373  1.00 215.06 ? 35  ALA B CB  1 
ATOM   983   N N   . GLY B 2 36  ? 187.891 -5.863   30.184  1.00 212.98 ? 36  GLY B N   1 
ATOM   984   C CA  . GLY B 2 36  ? 188.370 -4.489   30.015  1.00 208.84 ? 36  GLY B CA  1 
ATOM   985   C C   . GLY B 2 36  ? 187.402 -3.571   29.291  1.00 205.87 ? 36  GLY B C   1 
ATOM   986   O O   . GLY B 2 36  ? 187.306 -2.385   29.611  1.00 200.96 ? 36  GLY B O   1 
ATOM   987   N N   . TRP B 2 37  ? 186.686 -4.123   28.315  1.00 208.08 ? 37  TRP B N   1 
ATOM   988   C CA  . TRP B 2 37  ? 185.708 -3.362   27.538  1.00 210.74 ? 37  TRP B CA  1 
ATOM   989   C C   . TRP B 2 37  ? 184.414 -3.116   28.310  1.00 205.38 ? 37  TRP B C   1 
ATOM   990   O O   . TRP B 2 37  ? 183.712 -2.134   28.057  1.00 203.59 ? 37  TRP B O   1 
ATOM   991   C CB  . TRP B 2 37  ? 185.408 -4.068   26.214  1.00 221.11 ? 37  TRP B CB  1 
ATOM   992   C CG  . TRP B 2 37  ? 186.550 -4.021   25.245  1.00 231.83 ? 37  TRP B CG  1 
ATOM   993   C CD1 . TRP B 2 37  ? 187.391 -5.046   24.914  1.00 233.59 ? 37  TRP B CD1 1 
ATOM   994   C CD2 . TRP B 2 37  ? 186.983 -2.887   24.487  1.00 240.01 ? 37  TRP B CD2 1 
ATOM   995   N NE1 . TRP B 2 37  ? 188.319 -4.621   23.993  1.00 237.27 ? 37  TRP B NE1 1 
ATOM   996   C CE2 . TRP B 2 37  ? 188.092 -3.299   23.713  1.00 241.99 ? 37  TRP B CE2 1 
ATOM   997   C CE3 . TRP B 2 37  ? 186.540 -1.561   24.384  1.00 247.02 ? 37  TRP B CE3 1 
ATOM   998   C CZ2 . TRP B 2 37  ? 188.766 -2.434   22.846  1.00 247.77 ? 37  TRP B CZ2 1 
ATOM   999   C CZ3 . TRP B 2 37  ? 187.211 -0.699   23.522  1.00 253.35 ? 37  TRP B CZ3 1 
ATOM   1000  C CH2 . TRP B 2 37  ? 188.313 -1.141   22.765  1.00 253.71 ? 37  TRP B CH2 1 
ATOM   1001  N N   . GLY B 2 38  ? 184.108 -4.014   29.245  1.00 201.73 ? 38  GLY B N   1 
ATOM   1002  C CA  . GLY B 2 38  ? 182.911 -3.909   30.077  1.00 198.28 ? 38  GLY B CA  1 
ATOM   1003  C C   . GLY B 2 38  ? 182.927 -2.686   30.972  1.00 196.14 ? 38  GLY B C   1 
ATOM   1004  O O   . GLY B 2 38  ? 181.915 -1.995   31.105  1.00 195.32 ? 38  GLY B O   1 
ATOM   1005  N N   . MET B 2 39  ? 184.083 -2.424   31.580  1.00 195.61 ? 39  MET B N   1 
ATOM   1006  C CA  . MET B 2 39  ? 184.271 -1.262   32.448  1.00 195.58 ? 39  MET B CA  1 
ATOM   1007  C C   . MET B 2 39  ? 184.114 0.055    31.692  1.00 190.18 ? 39  MET B C   1 
ATOM   1008  O O   . MET B 2 39  ? 183.530 1.007    32.216  1.00 189.79 ? 39  MET B O   1 
ATOM   1009  C CB  . MET B 2 39  ? 185.638 -1.319   33.136  1.00 201.95 ? 39  MET B CB  1 
ATOM   1010  C CG  . MET B 2 39  ? 185.652 -2.083   34.454  1.00 207.38 ? 39  MET B CG  1 
ATOM   1011  S SD  . MET B 2 39  ? 184.820 -1.229   35.812  1.00 212.83 ? 39  MET B SD  1 
ATOM   1012  C CE  . MET B 2 39  ? 185.799 0.267    35.942  1.00 212.19 ? 39  MET B CE  1 
ATOM   1013  N N   . VAL B 2 40  ? 184.630 0.098    30.463  1.00 183.63 ? 40  VAL B N   1 
ATOM   1014  C CA  . VAL B 2 40  ? 184.534 1.292    29.620  1.00 179.35 ? 40  VAL B CA  1 
ATOM   1015  C C   . VAL B 2 40  ? 183.069 1.638    29.341  1.00 181.92 ? 40  VAL B C   1 
ATOM   1016  O O   . VAL B 2 40  ? 182.672 2.791    29.488  1.00 181.77 ? 40  VAL B O   1 
ATOM   1017  C CB  . VAL B 2 40  ? 185.324 1.144    28.297  1.00 175.21 ? 40  VAL B CB  1 
ATOM   1018  C CG1 . VAL B 2 40  ? 185.245 2.421    27.471  1.00 171.95 ? 40  VAL B CG1 1 
ATOM   1019  C CG2 . VAL B 2 40  ? 186.778 0.800    28.574  1.00 173.25 ? 40  VAL B CG2 1 
ATOM   1020  N N   . LEU B 2 41  ? 182.275 0.630    28.973  1.00 184.67 ? 41  LEU B N   1 
ATOM   1021  C CA  . LEU B 2 41  ? 180.857 0.817    28.641  1.00 185.40 ? 41  LEU B CA  1 
ATOM   1022  C C   . LEU B 2 41  ? 180.010 1.190    29.863  1.00 183.48 ? 41  LEU B C   1 
ATOM   1023  O O   . LEU B 2 41  ? 179.162 2.082    29.782  1.00 182.33 ? 41  LEU B O   1 
ATOM   1024  C CB  . LEU B 2 41  ? 180.287 -0.443   27.970  1.00 186.42 ? 41  LEU B CB  1 
ATOM   1025  C CG  . LEU B 2 41  ? 179.295 -0.320   26.800  1.00 186.17 ? 41  LEU B CG  1 
ATOM   1026  C CD1 . LEU B 2 41  ? 178.998 -1.698   26.220  1.00 185.40 ? 41  LEU B CD1 1 
ATOM   1027  C CD2 . LEU B 2 41  ? 177.996 0.390    27.177  1.00 184.72 ? 41  LEU B CD2 1 
ATOM   1028  N N   . ALA B 2 42  ? 180.246 0.500    30.981  1.00 180.80 ? 42  ALA B N   1 
ATOM   1029  C CA  . ALA B 2 42  ? 179.499 0.715    32.226  1.00 176.94 ? 42  ALA B CA  1 
ATOM   1030  C C   . ALA B 2 42  ? 179.668 2.130    32.758  1.00 172.97 ? 42  ALA B C   1 
ATOM   1031  O O   . ALA B 2 42  ? 178.684 2.805    33.066  1.00 170.75 ? 42  ALA B O   1 
ATOM   1032  C CB  . ALA B 2 42  ? 179.918 -0.298   33.281  1.00 178.63 ? 42  ALA B CB  1 
ATOM   1033  N N   . VAL B 2 43  ? 180.922 2.564    32.861  1.00 169.56 ? 43  VAL B N   1 
ATOM   1034  C CA  . VAL B 2 43  ? 181.255 3.922    33.276  1.00 167.98 ? 43  VAL B CA  1 
ATOM   1035  C C   . VAL B 2 43  ? 180.733 4.943    32.256  1.00 167.98 ? 43  VAL B C   1 
ATOM   1036  O O   . VAL B 2 43  ? 180.248 6.011    32.639  1.00 170.83 ? 43  VAL B O   1 
ATOM   1037  C CB  . VAL B 2 43  ? 182.772 4.073    33.535  1.00 168.37 ? 43  VAL B CB  1 
ATOM   1038  C CG1 . VAL B 2 43  ? 183.184 5.535    33.632  1.00 170.85 ? 43  VAL B CG1 1 
ATOM   1039  C CG2 . VAL B 2 43  ? 183.162 3.328    34.805  1.00 166.36 ? 43  VAL B CG2 1 
ATOM   1040  N N   . LEU B 2 44  ? 180.808 4.599    30.967  1.00 164.55 ? 44  LEU B N   1 
ATOM   1041  C CA  . LEU B 2 44  ? 180.239 5.438    29.901  1.00 158.89 ? 44  LEU B CA  1 
ATOM   1042  C C   . LEU B 2 44  ? 178.713 5.501    29.954  1.00 153.34 ? 44  LEU B C   1 
ATOM   1043  O O   . LEU B 2 44  ? 178.118 6.464    29.475  1.00 152.77 ? 44  LEU B O   1 
ATOM   1044  C CB  . LEU B 2 44  ? 180.689 4.976    28.507  1.00 158.82 ? 44  LEU B CB  1 
ATOM   1045  C CG  . LEU B 2 44  ? 182.066 5.397    27.975  1.00 158.36 ? 44  LEU B CG  1 
ATOM   1046  C CD1 . LEU B 2 44  ? 182.342 4.713    26.646  1.00 158.37 ? 44  LEU B CD1 1 
ATOM   1047  C CD2 . LEU B 2 44  ? 182.194 6.907    27.830  1.00 158.02 ? 44  LEU B CD2 1 
ATOM   1048  N N   . ALA B 2 45  ? 178.090 4.474    30.530  1.00 146.24 ? 45  ALA B N   1 
ATOM   1049  C CA  . ALA B 2 45  ? 176.638 4.445    30.691  1.00 139.79 ? 45  ALA B CA  1 
ATOM   1050  C C   . ALA B 2 45  ? 176.159 5.205    31.936  1.00 136.87 ? 45  ALA B C   1 
ATOM   1051  O O   . ALA B 2 45  ? 175.072 5.784    31.920  1.00 136.98 ? 45  ALA B O   1 
ATOM   1052  C CB  . ALA B 2 45  ? 176.125 3.013    30.700  1.00 138.53 ? 45  ALA B CB  1 
ATOM   1053  N N   . THR B 2 46  ? 176.963 5.203    33.003  1.00 132.36 ? 46  THR B N   1 
ATOM   1054  C CA  . THR B 2 46  ? 176.625 5.951    34.232  1.00 128.31 ? 46  THR B CA  1 
ATOM   1055  C C   . THR B 2 46  ? 176.919 7.452    34.133  1.00 132.37 ? 46  THR B C   1 
ATOM   1056  O O   . THR B 2 46  ? 176.490 8.225    34.991  1.00 131.17 ? 46  THR B O   1 
ATOM   1057  C CB  . THR B 2 46  ? 177.239 5.334    35.518  1.00 122.47 ? 46  THR B CB  1 
ATOM   1058  O OG1 . THR B 2 46  ? 177.232 6.298    36.580  1.00 118.13 ? 46  THR B OG1 1 
ATOM   1059  C CG2 . THR B 2 46  ? 178.649 4.875    35.289  1.00 119.40 ? 46  THR B CG2 1 
ATOM   1060  N N   . PHE B 2 47  ? 177.645 7.855    33.087  1.00 139.11 ? 47  PHE B N   1 
ATOM   1061  C CA  . PHE B 2 47  ? 177.734 9.266    32.685  1.00 144.03 ? 47  PHE B CA  1 
ATOM   1062  C C   . PHE B 2 47  ? 176.357 9.747    32.242  1.00 143.15 ? 47  PHE B C   1 
ATOM   1063  O O   . PHE B 2 47  ? 176.081 10.950   32.202  1.00 141.42 ? 47  PHE B O   1 
ATOM   1064  C CB  . PHE B 2 47  ? 178.723 9.447    31.526  1.00 148.55 ? 47  PHE B CB  1 
ATOM   1065  C CG  . PHE B 2 47  ? 180.031 10.079   31.922  1.00 152.20 ? 47  PHE B CG  1 
ATOM   1066  C CD1 . PHE B 2 47  ? 181.108 9.294    32.322  1.00 154.63 ? 47  PHE B CD1 1 
ATOM   1067  C CD2 . PHE B 2 47  ? 180.196 11.462   31.872  1.00 152.76 ? 47  PHE B CD2 1 
ATOM   1068  C CE1 . PHE B 2 47  ? 182.318 9.874    32.679  1.00 154.92 ? 47  PHE B CE1 1 
ATOM   1069  C CE2 . PHE B 2 47  ? 181.404 12.047   32.230  1.00 153.14 ? 47  PHE B CE2 1 
ATOM   1070  C CZ  . PHE B 2 47  ? 182.465 11.251   32.634  1.00 153.38 ? 47  PHE B CZ  1 
ATOM   1071  N N   . PHE B 2 48  ? 175.507 8.783    31.902  1.00 143.76 ? 48  PHE B N   1 
ATOM   1072  C CA  . PHE B 2 48  ? 174.150 9.048    31.458  1.00 144.02 ? 48  PHE B CA  1 
ATOM   1073  C C   . PHE B 2 48  ? 173.123 8.534    32.468  1.00 141.48 ? 48  PHE B C   1 
ATOM   1074  O O   . PHE B 2 48  ? 171.951 8.345    32.133  1.00 140.77 ? 48  PHE B O   1 
ATOM   1075  C CB  . PHE B 2 48  ? 173.921 8.438    30.069  1.00 147.25 ? 48  PHE B CB  1 
ATOM   1076  C CG  . PHE B 2 48  ? 174.963 8.829    29.051  1.00 148.58 ? 48  PHE B CG  1 
ATOM   1077  C CD1 . PHE B 2 48  ? 175.169 10.171   28.717  1.00 148.63 ? 48  PHE B CD1 1 
ATOM   1078  C CD2 . PHE B 2 48  ? 175.744 7.856    28.430  1.00 148.19 ? 48  PHE B CD2 1 
ATOM   1079  C CE1 . PHE B 2 48  ? 176.130 10.531   27.784  1.00 147.75 ? 48  PHE B CE1 1 
ATOM   1080  C CE2 . PHE B 2 48  ? 176.706 8.212    27.493  1.00 147.67 ? 48  PHE B CE2 1 
ATOM   1081  C CZ  . PHE B 2 48  ? 176.900 9.550    27.172  1.00 147.95 ? 48  PHE B CZ  1 
ATOM   1082  N N   . TRP B 2 49  ? 173.568 8.306    33.703  1.00 139.10 ? 49  TRP B N   1 
ATOM   1083  C CA  . TRP B 2 49  ? 172.649 8.029    34.795  1.00 138.93 ? 49  TRP B CA  1 
ATOM   1084  C C   . TRP B 2 49  ? 171.874 9.312    35.072  1.00 139.41 ? 49  TRP B C   1 
ATOM   1085  O O   . TRP B 2 49  ? 172.480 10.352   35.338  1.00 138.69 ? 49  TRP B O   1 
ATOM   1086  C CB  . TRP B 2 49  ? 173.392 7.570    36.049  1.00 140.22 ? 49  TRP B CB  1 
ATOM   1087  C CG  . TRP B 2 49  ? 172.472 7.106    37.140  1.00 143.62 ? 49  TRP B CG  1 
ATOM   1088  C CD1 . TRP B 2 49  ? 171.821 7.886    38.050  1.00 144.68 ? 49  TRP B CD1 1 
ATOM   1089  C CD2 . TRP B 2 49  ? 172.099 5.754    37.433  1.00 146.48 ? 49  TRP B CD2 1 
ATOM   1090  N NE1 . TRP B 2 49  ? 171.066 7.106    38.892  1.00 146.81 ? 49  TRP B NE1 1 
ATOM   1091  C CE2 . TRP B 2 49  ? 171.218 5.793    38.536  1.00 147.54 ? 49  TRP B CE2 1 
ATOM   1092  C CE3 . TRP B 2 49  ? 172.424 4.513    36.870  1.00 149.22 ? 49  TRP B CE3 1 
ATOM   1093  C CZ2 . TRP B 2 49  ? 170.656 4.636    39.091  1.00 149.13 ? 49  TRP B CZ2 1 
ATOM   1094  C CZ3 . TRP B 2 49  ? 171.864 3.362    37.422  1.00 151.34 ? 49  TRP B CZ3 1 
ATOM   1095  C CH2 . TRP B 2 49  ? 170.989 3.434    38.521  1.00 150.52 ? 49  TRP B CH2 1 
ATOM   1096  N N   . PRO B 2 50  ? 170.532 9.244    34.990  1.00 141.47 ? 50  PRO B N   1 
ATOM   1097  C CA  . PRO B 2 50  ? 169.668 10.417   35.145  1.00 145.79 ? 50  PRO B CA  1 
ATOM   1098  C C   . PRO B 2 50  ? 169.900 11.146   36.466  1.00 151.04 ? 50  PRO B C   1 
ATOM   1099  O O   . PRO B 2 50  ? 169.915 10.518   37.527  1.00 152.89 ? 50  PRO B O   1 
ATOM   1100  C CB  . PRO B 2 50  ? 168.248 9.830    35.086  1.00 144.09 ? 50  PRO B CB  1 
ATOM   1101  C CG  . PRO B 2 50  ? 168.408 8.361    35.293  1.00 141.95 ? 50  PRO B CG  1 
ATOM   1102  C CD  . PRO B 2 50  ? 169.753 8.020    34.739  1.00 140.50 ? 50  PRO B CD  1 
ATOM   1103  N N   . GLY B 2 51  ? 170.098 12.459   36.384  1.00 156.12 ? 51  GLY B N   1 
ATOM   1104  C CA  . GLY B 2 51  ? 170.353 13.289   37.558  1.00 161.15 ? 51  GLY B CA  1 
ATOM   1105  C C   . GLY B 2 51  ? 171.803 13.284   38.008  1.00 163.67 ? 51  GLY B C   1 
ATOM   1106  O O   . GLY B 2 51  ? 172.088 13.411   39.201  1.00 167.34 ? 51  GLY B O   1 
ATOM   1107  N N   . MET B 2 52  ? 172.721 13.135   37.053  1.00 162.20 ? 52  MET B N   1 
ATOM   1108  C CA  . MET B 2 52  ? 174.148 13.169   37.355  1.00 159.26 ? 52  MET B CA  1 
ATOM   1109  C C   . MET B 2 52  ? 174.624 14.610   37.482  1.00 158.05 ? 52  MET B C   1 
ATOM   1110  O O   . MET B 2 52  ? 174.394 15.433   36.594  1.00 154.85 ? 52  MET B O   1 
ATOM   1111  C CB  . MET B 2 52  ? 174.960 12.423   36.290  1.00 158.23 ? 52  MET B CB  1 
ATOM   1112  C CG  . MET B 2 52  ? 176.383 12.085   36.721  1.00 157.14 ? 52  MET B CG  1 
ATOM   1113  S SD  . MET B 2 52  ? 176.662 10.394   37.299  1.00 155.39 ? 52  MET B SD  1 
ATOM   1114  C CE  . MET B 2 52  ? 175.302 10.142   38.437  1.00 155.51 ? 52  MET B CE  1 
ATOM   1115  N N   . GLY B 2 53  ? 175.278 14.904   38.601  1.00 159.17 ? 53  GLY B N   1 
ATOM   1116  C CA  . GLY B 2 53  ? 175.789 16.241   38.875  1.00 163.47 ? 53  GLY B CA  1 
ATOM   1117  C C   . GLY B 2 53  ? 177.262 16.224   39.224  1.00 167.62 ? 53  GLY B C   1 
ATOM   1118  O O   . GLY B 2 53  ? 177.880 15.157   39.279  1.00 165.94 ? 53  GLY B O   1 
ATOM   1119  N N   . ASN B 2 54  ? 177.813 17.415   39.464  1.00 173.17 ? 54  ASN B N   1 
ATOM   1120  C CA  . ASN B 2 54  ? 179.235 17.596   39.774  1.00 177.49 ? 54  ASN B CA  1 
ATOM   1121  C C   . ASN B 2 54  ? 180.146 16.887   38.750  1.00 179.04 ? 54  ASN B C   1 
ATOM   1122  O O   . ASN B 2 54  ? 180.946 16.017   39.107  1.00 183.84 ? 54  ASN B O   1 
ATOM   1123  C CB  . ASN B 2 54  ? 179.543 17.160   41.223  1.00 176.18 ? 54  ASN B CB  1 
ATOM   1124  C CG  . ASN B 2 54  ? 178.845 18.026   42.271  1.00 172.64 ? 54  ASN B CG  1 
ATOM   1125  O OD1 . ASN B 2 54  ? 178.937 19.257   42.248  1.00 169.83 ? 54  ASN B OD1 1 
ATOM   1126  N ND2 . ASN B 2 54  ? 178.161 17.379   43.209  1.00 169.69 ? 54  ASN B ND2 1 
ATOM   1127  N N   . PHE B 2 55  ? 180.004 17.269   37.478  1.00 175.48 ? 55  PHE B N   1 
ATOM   1128  C CA  . PHE B 2 55  ? 180.721 16.630   36.362  1.00 170.25 ? 55  PHE B CA  1 
ATOM   1129  C C   . PHE B 2 55  ? 182.215 16.949   36.317  1.00 165.91 ? 55  PHE B C   1 
ATOM   1130  O O   . PHE B 2 55  ? 183.036 16.061   36.075  1.00 161.33 ? 55  PHE B O   1 
ATOM   1131  C CB  . PHE B 2 55  ? 180.080 16.996   35.019  1.00 171.09 ? 55  PHE B CB  1 
ATOM   1132  C CG  . PHE B 2 55  ? 178.886 16.155   34.658  1.00 172.56 ? 55  PHE B CG  1 
ATOM   1133  C CD1 . PHE B 2 55  ? 179.047 14.863   34.160  1.00 174.64 ? 55  PHE B CD1 1 
ATOM   1134  C CD2 . PHE B 2 55  ? 177.598 16.660   34.794  1.00 170.86 ? 55  PHE B CD2 1 
ATOM   1135  C CE1 . PHE B 2 55  ? 177.945 14.090   33.819  1.00 174.76 ? 55  PHE B CE1 1 
ATOM   1136  C CE2 . PHE B 2 55  ? 176.494 15.893   34.452  1.00 170.45 ? 55  PHE B CE2 1 
ATOM   1137  C CZ  . PHE B 2 55  ? 176.667 14.607   33.965  1.00 172.27 ? 55  PHE B CZ  1 
ATOM   1138  N N   . ALA B 2 56  ? 182.555 18.219   36.536  1.00 164.09 ? 56  ALA B N   1 
ATOM   1139  C CA  . ALA B 2 56  ? 183.949 18.656   36.617  1.00 166.12 ? 56  ALA B CA  1 
ATOM   1140  C C   . ALA B 2 56  ? 184.664 18.014   37.809  1.00 172.67 ? 56  ALA B C   1 
ATOM   1141  O O   . ALA B 2 56  ? 185.892 17.916   37.822  1.00 172.17 ? 56  ALA B O   1 
ATOM   1142  C CB  . ALA B 2 56  ? 184.027 20.173   36.695  1.00 161.37 ? 56  ALA B CB  1 
ATOM   1143  N N   . LEU B 2 57  ? 183.880 17.585   38.800  1.00 184.10 ? 57  LEU B N   1 
ATOM   1144  C CA  . LEU B 2 57  ? 184.382 16.830   39.953  1.00 191.90 ? 57  LEU B CA  1 
ATOM   1145  C C   . LEU B 2 57  ? 184.473 15.327   39.667  1.00 186.58 ? 57  LEU B C   1 
ATOM   1146  O O   . LEU B 2 57  ? 185.339 14.641   40.216  1.00 188.97 ? 57  LEU B O   1 
ATOM   1147  C CB  . LEU B 2 57  ? 183.507 17.075   41.193  1.00 203.70 ? 57  LEU B CB  1 
ATOM   1148  C CG  . LEU B 2 57  ? 183.771 18.306   42.073  1.00 210.38 ? 57  LEU B CG  1 
ATOM   1149  C CD1 . LEU B 2 57  ? 182.546 18.664   42.906  1.00 213.87 ? 57  LEU B CD1 1 
ATOM   1150  C CD2 . LEU B 2 57  ? 184.988 18.106   42.968  1.00 211.94 ? 57  LEU B CD2 1 
ATOM   1151  N N   . ILE B 2 58  ? 183.573 14.823   38.821  1.00 176.49 ? 58  ILE B N   1 
ATOM   1152  C CA  . ILE B 2 58  ? 183.580 13.413   38.418  1.00 165.79 ? 58  ILE B CA  1 
ATOM   1153  C C   . ILE B 2 58  ? 184.777 13.112   37.513  1.00 163.79 ? 58  ILE B C   1 
ATOM   1154  O O   . ILE B 2 58  ? 185.478 12.124   37.722  1.00 164.32 ? 58  ILE B O   1 
ATOM   1155  C CB  . ILE B 2 58  ? 182.241 12.986   37.761  1.00 160.61 ? 58  ILE B CB  1 
ATOM   1156  C CG1 . ILE B 2 58  ? 181.188 12.715   38.843  1.00 157.32 ? 58  ILE B CG1 1 
ATOM   1157  C CG2 . ILE B 2 58  ? 182.419 11.748   36.888  1.00 158.63 ? 58  ILE B CG2 1 
ATOM   1158  C CD1 . ILE B 2 58  ? 179.776 12.525   38.328  1.00 154.51 ? 58  ILE B CD1 1 
ATOM   1159  N N   . LEU B 2 59  ? 185.017 13.986   36.538  1.00 160.23 ? 59  LEU B N   1 
ATOM   1160  C CA  . LEU B 2 59  ? 186.100 13.815   35.565  1.00 159.94 ? 59  LEU B CA  1 
ATOM   1161  C C   . LEU B 2 59  ? 187.507 13.815   36.181  1.00 168.24 ? 59  LEU B C   1 
ATOM   1162  O O   . LEU B 2 59  ? 188.393 13.103   35.700  1.00 169.91 ? 59  LEU B O   1 
ATOM   1163  C CB  . LEU B 2 59  ? 185.999 14.881   34.469  1.00 151.38 ? 59  LEU B CB  1 
ATOM   1164  C CG  . LEU B 2 59  ? 184.776 14.821   33.548  1.00 145.53 ? 59  LEU B CG  1 
ATOM   1165  C CD1 . LEU B 2 59  ? 184.459 16.200   32.991  1.00 142.88 ? 59  LEU B CD1 1 
ATOM   1166  C CD2 . LEU B 2 59  ? 184.978 13.811   32.425  1.00 142.99 ? 59  LEU B CD2 1 
ATOM   1167  N N   . LEU B 2 60  ? 187.700 14.609   37.236  1.00 177.15 ? 60  LEU B N   1 
ATOM   1168  C CA  . LEU B 2 60  ? 189.004 14.745   37.906  1.00 182.70 ? 60  LEU B CA  1 
ATOM   1169  C C   . LEU B 2 60  ? 189.336 13.558   38.821  1.00 183.29 ? 60  LEU B C   1 
ATOM   1170  O O   . LEU B 2 60  ? 190.486 13.110   38.870  1.00 187.05 ? 60  LEU B O   1 
ATOM   1171  C CB  . LEU B 2 60  ? 189.079 16.071   38.685  1.00 183.47 ? 60  LEU B CB  1 
ATOM   1172  C CG  . LEU B 2 60  ? 190.409 16.545   39.295  1.00 182.74 ? 60  LEU B CG  1 
ATOM   1173  C CD1 . LEU B 2 60  ? 191.406 16.988   38.231  1.00 181.99 ? 60  LEU B CD1 1 
ATOM   1174  C CD2 . LEU B 2 60  ? 190.164 17.672   40.288  1.00 180.91 ? 60  LEU B CD2 1 
ATOM   1175  N N   . ALA B 2 61  ? 188.328 13.058   39.539  1.00 178.87 ? 61  ALA B N   1 
ATOM   1176  C CA  . ALA B 2 61  ? 188.474 11.872   40.389  1.00 170.66 ? 61  ALA B CA  1 
ATOM   1177  C C   . ALA B 2 61  ? 188.635 10.599   39.551  1.00 165.35 ? 61  ALA B C   1 
ATOM   1178  O O   . ALA B 2 61  ? 189.075 9.561    40.055  1.00 162.73 ? 61  ALA B O   1 
ATOM   1179  C CB  . ALA B 2 61  ? 187.293 11.751   41.341  1.00 169.43 ? 61  ALA B CB  1 
ATOM   1180  N N   . LEU B 2 62  ? 188.262 10.696   38.275  1.00 160.00 ? 62  LEU B N   1 
ATOM   1181  C CA  . LEU B 2 62  ? 188.548 9.668    37.275  1.00 154.07 ? 62  LEU B CA  1 
ATOM   1182  C C   . LEU B 2 62  ? 189.983 9.814    36.780  1.00 149.71 ? 62  LEU B C   1 
ATOM   1183  O O   . LEU B 2 62  ? 190.671 8.820    36.552  1.00 146.43 ? 62  LEU B O   1 
ATOM   1184  C CB  . LEU B 2 62  ? 187.597 9.788    36.077  1.00 154.63 ? 62  LEU B CB  1 
ATOM   1185  C CG  . LEU B 2 62  ? 186.079 9.647    36.240  1.00 155.79 ? 62  LEU B CG  1 
ATOM   1186  C CD1 . LEU B 2 62  ? 185.370 10.122   34.979  1.00 154.86 ? 62  LEU B CD1 1 
ATOM   1187  C CD2 . LEU B 2 62  ? 185.668 8.223    36.589  1.00 157.54 ? 62  LEU B CD2 1 
ATOM   1188  N N   . LEU B 2 63  ? 190.419 11.061   36.610  1.00 147.68 ? 63  LEU B N   1 
ATOM   1189  C CA  . LEU B 2 63  ? 191.758 11.371   36.113  1.00 147.05 ? 63  LEU B CA  1 
ATOM   1190  C C   . LEU B 2 63  ? 192.829 10.948   37.118  1.00 151.22 ? 63  LEU B C   1 
ATOM   1191  O O   . LEU B 2 63  ? 193.661 10.093   36.813  1.00 148.99 ? 63  LEU B O   1 
ATOM   1192  C CB  . LEU B 2 63  ? 191.881 12.870   35.803  1.00 143.87 ? 63  LEU B CB  1 
ATOM   1193  C CG  . LEU B 2 63  ? 192.737 13.367   34.627  1.00 141.16 ? 63  LEU B CG  1 
ATOM   1194  C CD1 . LEU B 2 63  ? 192.794 14.891   34.640  1.00 140.00 ? 63  LEU B CD1 1 
ATOM   1195  C CD2 . LEU B 2 63  ? 194.150 12.791   34.641  1.00 140.30 ? 63  LEU B CD2 1 
ATOM   1196  N N   . LEU B 2 64  ? 192.795 11.542   38.312  1.00 159.81 ? 64  LEU B N   1 
ATOM   1197  C CA  . LEU B 2 64  ? 193.783 11.266   39.363  1.00 168.30 ? 64  LEU B CA  1 
ATOM   1198  C C   . LEU B 2 64  ? 193.610 9.903    40.043  1.00 173.28 ? 64  LEU B C   1 
ATOM   1199  O O   . LEU B 2 64  ? 194.394 9.542    40.926  1.00 176.16 ? 64  LEU B O   1 
ATOM   1200  C CB  . LEU B 2 64  ? 193.796 12.388   40.415  1.00 169.79 ? 64  LEU B CB  1 
ATOM   1201  C CG  . LEU B 2 64  ? 194.809 13.533   40.263  1.00 169.93 ? 64  LEU B CG  1 
ATOM   1202  C CD1 . LEU B 2 64  ? 194.324 14.592   39.281  1.00 170.14 ? 64  LEU B CD1 1 
ATOM   1203  C CD2 . LEU B 2 64  ? 195.108 14.164   41.617  1.00 170.26 ? 64  LEU B CD2 1 
ATOM   1204  N N   . GLY B 2 65  ? 192.586 9.154    39.636  1.00 176.40 ? 65  GLY B N   1 
ATOM   1205  C CA  . GLY B 2 65  ? 192.356 7.811    40.162  1.00 177.84 ? 65  GLY B CA  1 
ATOM   1206  C C   . GLY B 2 65  ? 192.802 6.718    39.207  1.00 176.93 ? 65  GLY B C   1 
ATOM   1207  O O   . GLY B 2 65  ? 193.188 5.627    39.636  1.00 180.14 ? 65  GLY B O   1 
ATOM   1208  N N   . SER B 2 66  ? 192.745 7.018    37.910  1.00 172.34 ? 66  SER B N   1 
ATOM   1209  C CA  . SER B 2 66  ? 193.093 6.064    36.855  1.00 167.68 ? 66  SER B CA  1 
ATOM   1210  C C   . SER B 2 66  ? 194.588 6.015    36.560  1.00 169.27 ? 66  SER B C   1 
ATOM   1211  O O   . SER B 2 66  ? 195.091 5.019    36.036  1.00 164.61 ? 66  SER B O   1 
ATOM   1212  C CB  . SER B 2 66  ? 192.338 6.398    35.567  1.00 162.79 ? 66  SER B CB  1 
ATOM   1213  O OG  . SER B 2 66  ? 192.669 7.698    35.104  1.00 156.39 ? 66  SER B OG  1 
ATOM   1214  N N   . VAL B 2 67  ? 195.287 7.099    36.885  1.00 176.10 ? 67  VAL B N   1 
ATOM   1215  C CA  . VAL B 2 67  ? 196.719 7.202    36.613  1.00 184.28 ? 67  VAL B CA  1 
ATOM   1216  C C   . VAL B 2 67  ? 197.557 6.810    37.838  1.00 189.87 ? 67  VAL B C   1 
ATOM   1217  O O   . VAL B 2 67  ? 198.557 6.103    37.697  1.00 193.23 ? 67  VAL B O   1 
ATOM   1218  C CB  . VAL B 2 67  ? 197.104 8.605    36.086  1.00 185.61 ? 67  VAL B CB  1 
ATOM   1219  C CG1 . VAL B 2 67  ? 198.546 8.622    35.596  1.00 187.16 ? 67  VAL B CG1 1 
ATOM   1220  C CG2 . VAL B 2 67  ? 196.170 9.025    34.958  1.00 184.98 ? 67  VAL B CG2 1 
ATOM   1221  N N   . VAL B 2 68  ? 197.134 7.253    39.029  1.00 193.10 ? 68  VAL B N   1 
ATOM   1222  C CA  . VAL B 2 68  ? 197.799 6.924    40.311  1.00 191.86 ? 68  VAL B CA  1 
ATOM   1223  C C   . VAL B 2 68  ? 198.008 5.416    40.485  1.00 193.49 ? 68  VAL B C   1 
ATOM   1224  O O   . VAL B 2 68  ? 198.998 4.972    41.078  1.00 190.70 ? 68  VAL B O   1 
ATOM   1225  C CB  . VAL B 2 68  ? 197.030 7.524    41.525  1.00 187.91 ? 68  VAL B CB  1 
ATOM   1226  C CG1 . VAL B 2 68  ? 197.235 6.710    42.799  1.00 181.96 ? 68  VAL B CG1 1 
ATOM   1227  C CG2 . VAL B 2 68  ? 197.439 8.972    41.753  1.00 188.20 ? 68  VAL B CG2 1 
ATOM   1228  N N   . ALA B 2 69  ? 197.069 4.642    39.952  1.00 197.49 ? 69  ALA B N   1 
ATOM   1229  C CA  . ALA B 2 69  ? 197.155 3.191    39.957  1.00 200.56 ? 69  ALA B CA  1 
ATOM   1230  C C   . ALA B 2 69  ? 197.998 2.668    38.791  1.00 201.33 ? 69  ALA B C   1 
ATOM   1231  O O   . ALA B 2 69  ? 198.902 1.853    38.996  1.00 199.72 ? 69  ALA B O   1 
ATOM   1232  C CB  . ALA B 2 69  ? 195.763 2.589    39.922  1.00 202.76 ? 69  ALA B CB  1 
ATOM   1233  N N   . TRP B 2 70  ? 197.700 3.146    37.579  1.00 201.80 ? 70  TRP B N   1 
ATOM   1234  C CA  . TRP B 2 70  ? 198.398 2.718    36.357  1.00 202.34 ? 70  TRP B CA  1 
ATOM   1235  C C   . TRP B 2 70  ? 199.906 2.951    36.441  1.00 205.35 ? 70  TRP B C   1 
ATOM   1236  O O   . TRP B 2 70  ? 200.694 2.140    35.950  1.00 203.30 ? 70  TRP B O   1 
ATOM   1237  C CB  . TRP B 2 70  ? 197.820 3.419    35.118  1.00 199.59 ? 70  TRP B CB  1 
ATOM   1238  C CG  . TRP B 2 70  ? 198.447 2.972    33.819  1.00 200.64 ? 70  TRP B CG  1 
ATOM   1239  C CD1 . TRP B 2 70  ? 199.574 3.481    33.235  1.00 199.66 ? 70  TRP B CD1 1 
ATOM   1240  C CD2 . TRP B 2 70  ? 197.985 1.928    32.951  1.00 203.55 ? 70  TRP B CD2 1 
ATOM   1241  N NE1 . TRP B 2 70  ? 199.843 2.819    32.061  1.00 200.60 ? 70  TRP B NE1 1 
ATOM   1242  C CE2 . TRP B 2 70  ? 198.884 1.862    31.860  1.00 202.99 ? 70  TRP B CE2 1 
ATOM   1243  C CE3 . TRP B 2 70  ? 196.900 1.042    32.987  1.00 207.61 ? 70  TRP B CE3 1 
ATOM   1244  C CZ2 . TRP B 2 70  ? 198.733 0.944    30.813  1.00 204.07 ? 70  TRP B CZ2 1 
ATOM   1245  C CZ3 . TRP B 2 70  ? 196.750 0.128    31.943  1.00 210.45 ? 70  TRP B CZ3 1 
ATOM   1246  C CH2 . TRP B 2 70  ? 197.664 0.089    30.872  1.00 208.24 ? 70  TRP B CH2 1 
ATOM   1247  N N   . TRP B 2 71  ? 200.289 4.066    37.058  1.00 213.14 ? 71  TRP B N   1 
ATOM   1248  C CA  . TRP B 2 71  ? 201.690 4.392    37.307  1.00 223.02 ? 71  TRP B CA  1 
ATOM   1249  C C   . TRP B 2 71  ? 202.312 3.381    38.271  1.00 208.01 ? 71  TRP B C   1 
ATOM   1250  O O   . TRP B 2 71  ? 203.305 2.734    37.938  1.00 209.80 ? 71  TRP B O   1 
ATOM   1251  C CB  . TRP B 2 71  ? 201.804 5.817    37.865  1.00 250.53 ? 71  TRP B CB  1 
ATOM   1252  C CG  . TRP B 2 71  ? 203.212 6.321    38.072  1.00 278.75 ? 71  TRP B CG  1 
ATOM   1253  C CD1 . TRP B 2 71  ? 204.001 6.950    37.150  1.00 284.05 ? 71  TRP B CD1 1 
ATOM   1254  C CD2 . TRP B 2 71  ? 203.981 6.263    39.285  1.00 292.44 ? 71  TRP B CD2 1 
ATOM   1255  N NE1 . TRP B 2 71  ? 205.216 7.276    37.708  1.00 294.90 ? 71  TRP B NE1 1 
ATOM   1256  C CE2 . TRP B 2 71  ? 205.231 6.867    39.016  1.00 296.75 ? 71  TRP B CE2 1 
ATOM   1257  C CE3 . TRP B 2 71  ? 203.737 5.754    40.570  1.00 298.58 ? 71  TRP B CE3 1 
ATOM   1258  C CZ2 . TRP B 2 71  ? 206.238 6.976    39.985  1.00 299.39 ? 71  TRP B CZ2 1 
ATOM   1259  C CZ3 . TRP B 2 71  ? 204.740 5.863    41.534  1.00 301.22 ? 71  TRP B CZ3 1 
ATOM   1260  C CH2 . TRP B 2 71  ? 205.974 6.470    41.234  1.00 300.71 ? 71  TRP B CH2 1 
ATOM   1261  N N   . ALA B 2 72  ? 201.700 3.230    39.446  1.00 189.08 ? 72  ALA B N   1 
ATOM   1262  C CA  . ALA B 2 72  ? 202.233 2.388    40.521  1.00 173.30 ? 72  ALA B CA  1 
ATOM   1263  C C   . ALA B 2 72  ? 202.516 0.942    40.111  1.00 166.89 ? 72  ALA B C   1 
ATOM   1264  O O   . ALA B 2 72  ? 203.337 0.271    40.737  1.00 162.85 ? 72  ALA B O   1 
ATOM   1265  C CB  . ALA B 2 72  ? 201.309 2.428    41.731  1.00 168.44 ? 72  ALA B CB  1 
ATOM   1266  N N   . ALA B 2 73  ? 201.854 0.477    39.053  1.00 164.57 ? 73  ALA B N   1 
ATOM   1267  C CA  . ALA B 2 73  ? 201.914 -0.931   38.655  1.00 166.59 ? 73  ALA B CA  1 
ATOM   1268  C C   . ALA B 2 73  ? 202.918 -1.274   37.543  1.00 170.11 ? 73  ALA B C   1 
ATOM   1269  O O   . ALA B 2 73  ? 203.585 -2.308   37.617  1.00 168.92 ? 73  ALA B O   1 
ATOM   1270  C CB  . ALA B 2 73  ? 200.524 -1.432   38.293  1.00 166.10 ? 73  ALA B CB  1 
ATOM   1271  N N   . VAL B 2 74  ? 203.021 -0.423   36.522  1.00 176.67 ? 74  VAL B N   1 
ATOM   1272  C CA  . VAL B 2 74  ? 203.864 -0.713   35.345  1.00 184.30 ? 74  VAL B CA  1 
ATOM   1273  C C   . VAL B 2 74  ? 205.373 -0.602   35.633  1.00 193.69 ? 74  VAL B C   1 
ATOM   1274  O O   . VAL B 2 74  ? 206.186 -1.237   34.953  1.00 194.10 ? 74  VAL B O   1 
ATOM   1275  C CB  . VAL B 2 74  ? 203.462 0.148    34.111  1.00 181.44 ? 74  VAL B CB  1 
ATOM   1276  C CG1 . VAL B 2 74  ? 204.317 -0.183   32.892  1.00 178.78 ? 74  VAL B CG1 1 
ATOM   1277  C CG2 . VAL B 2 74  ? 201.995 -0.058   33.766  1.00 180.21 ? 74  VAL B CG2 1 
ATOM   1278  N N   . ARG B 2 75  ? 205.738 0.177    36.653  1.00 206.53 ? 75  ARG B N   1 
ATOM   1279  C CA  . ARG B 2 75  ? 207.149 0.496    36.931  1.00 215.14 ? 75  ARG B CA  1 
ATOM   1280  C C   . ARG B 2 75  ? 207.822 -0.434   37.944  1.00 209.39 ? 75  ARG B C   1 
ATOM   1281  O O   . ARG B 2 75  ? 209.022 -0.705   37.835  1.00 206.28 ? 75  ARG B O   1 
ATOM   1282  C CB  . ARG B 2 75  ? 207.306 1.950    37.401  1.00 228.05 ? 75  ARG B CB  1 
ATOM   1283  C CG  . ARG B 2 75  ? 206.344 2.957    36.779  1.00 243.08 ? 75  ARG B CG  1 
ATOM   1284  C CD  . ARG B 2 75  ? 206.718 3.358    35.359  1.00 251.19 ? 75  ARG B CD  1 
ATOM   1285  N NE  . ARG B 2 75  ? 205.736 4.287    34.795  1.00 256.59 ? 75  ARG B NE  1 
ATOM   1286  C CZ  . ARG B 2 75  ? 205.854 4.901    33.620  1.00 254.74 ? 75  ARG B CZ  1 
ATOM   1287  N NH1 . ARG B 2 75  ? 206.920 4.698    32.853  1.00 253.00 ? 75  ARG B NH1 1 
ATOM   1288  N NH2 . ARG B 2 75  ? 204.899 5.725    33.206  1.00 252.72 ? 75  ARG B NH2 1 
ATOM   1289  N N   . VAL B 2 76  ? 207.055 -0.903   38.928  1.00 204.99 ? 76  VAL B N   1 
ATOM   1290  C CA  . VAL B 2 76  ? 207.583 -1.765   39.997  1.00 200.89 ? 76  VAL B CA  1 
ATOM   1291  C C   . VAL B 2 76  ? 208.090 -3.115   39.480  1.00 198.21 ? 76  VAL B C   1 
ATOM   1292  O O   . VAL B 2 76  ? 207.809 -3.505   38.342  1.00 198.28 ? 76  VAL B O   1 
ATOM   1293  C CB  . VAL B 2 76  ? 206.559 -1.983   41.141  1.00 200.99 ? 76  VAL B CB  1 
ATOM   1294  C CG1 . VAL B 2 76  ? 206.417 -0.721   41.981  1.00 200.55 ? 76  VAL B CG1 1 
ATOM   1295  C CG2 . VAL B 2 76  ? 205.209 -2.436   40.597  1.00 201.29 ? 76  VAL B CG2 1 
ATOM   1296  N N   . ALA B 2 77  ? 208.838 -3.818   40.329  1.00 194.07 ? 77  ALA B N   1 
ATOM   1297  C CA  . ALA B 2 77  ? 209.449 -5.101   39.974  1.00 189.28 ? 77  ALA B CA  1 
ATOM   1298  C C   . ALA B 2 77  ? 208.433 -6.246   39.862  1.00 184.17 ? 77  ALA B C   1 
ATOM   1299  O O   . ALA B 2 77  ? 207.230 -6.047   40.065  1.00 185.15 ? 77  ALA B O   1 
ATOM   1300  C CB  . ALA B 2 77  ? 210.549 -5.449   40.970  1.00 191.35 ? 77  ALA B CB  1 
ATOM   1301  N N   . MET B 2 78  ? 208.935 -7.440   39.542  1.00 176.43 ? 78  MET B N   1 
ATOM   1302  C CA  . MET B 2 78  ? 208.092 -8.617   39.304  1.00 170.52 ? 78  MET B CA  1 
ATOM   1303  C C   . MET B 2 78  ? 207.790 -9.473   40.541  1.00 171.73 ? 78  MET B C   1 
ATOM   1304  O O   . MET B 2 78  ? 206.988 -10.409  40.463  1.00 171.04 ? 78  MET B O   1 
ATOM   1305  C CB  . MET B 2 78  ? 208.701 -9.489   38.197  1.00 164.81 ? 78  MET B CB  1 
ATOM   1306  C CG  . MET B 2 78  ? 208.489 -8.965   36.784  1.00 161.02 ? 78  MET B CG  1 
ATOM   1307  S SD  . MET B 2 78  ? 206.769 -9.050   36.244  1.00 158.61 ? 78  MET B SD  1 
ATOM   1308  C CE  . MET B 2 78  ? 206.178 -7.412   36.666  1.00 157.40 ? 78  MET B CE  1 
ATOM   1309  N N   . THR B 2 79  ? 208.424 -9.157   41.672  1.00 173.38 ? 79  THR B N   1 
ATOM   1310  C CA  . THR B 2 79  ? 208.233 -9.929   42.913  1.00 173.28 ? 79  THR B CA  1 
ATOM   1311  C C   . THR B 2 79  ? 207.459 -9.180   44.004  1.00 171.42 ? 79  THR B C   1 
ATOM   1312  O O   . THR B 2 79  ? 207.074 -9.773   45.018  1.00 169.88 ? 79  THR B O   1 
ATOM   1313  C CB  . THR B 2 79  ? 209.569 -10.434  43.502  1.00 174.72 ? 79  THR B CB  1 
ATOM   1314  O OG1 . THR B 2 79  ? 210.469 -9.333   43.679  1.00 177.61 ? 79  THR B OG1 1 
ATOM   1315  C CG2 . THR B 2 79  ? 210.205 -11.483  42.592  1.00 175.09 ? 79  THR B CG2 1 
ATOM   1316  N N   . ASP B 2 80  ? 207.241 -7.883   43.792  1.00 169.33 ? 80  ASP B N   1 
ATOM   1317  C CA  . ASP B 2 80  ? 206.447 -7.055   44.705  1.00 167.56 ? 80  ASP B CA  1 
ATOM   1318  C C   . ASP B 2 80  ? 204.964 -7.035   44.319  1.00 171.19 ? 80  ASP B C   1 
ATOM   1319  O O   . ASP B 2 80  ? 204.238 -6.100   44.662  1.00 173.18 ? 80  ASP B O   1 
ATOM   1320  C CB  . ASP B 2 80  ? 206.996 -5.623   44.748  1.00 160.72 ? 80  ASP B CB  1 
ATOM   1321  C CG  . ASP B 2 80  ? 208.299 -5.510   45.522  1.00 156.72 ? 80  ASP B CG  1 
ATOM   1322  O OD1 . ASP B 2 80  ? 208.687 -6.477   46.213  1.00 154.76 ? 80  ASP B OD1 1 
ATOM   1323  O OD2 . ASP B 2 80  ? 208.936 -4.439   45.439  1.00 154.20 ? 80  ASP B OD2 1 
ATOM   1324  N N   . MET B 2 81  ? 204.523 -8.077   43.616  1.00 173.30 ? 81  MET B N   1 
ATOM   1325  C CA  . MET B 2 81  ? 203.159 -8.156   43.085  1.00 171.36 ? 81  MET B CA  1 
ATOM   1326  C C   . MET B 2 81  ? 202.091 -8.633   44.088  1.00 166.02 ? 81  MET B C   1 
ATOM   1327  O O   . MET B 2 81  ? 200.940 -8.195   43.994  1.00 164.11 ? 81  MET B O   1 
ATOM   1328  C CB  . MET B 2 81  ? 203.128 -9.015   41.813  1.00 175.01 ? 81  MET B CB  1 
ATOM   1329  C CG  . MET B 2 81  ? 202.049 -8.635   40.808  1.00 177.02 ? 81  MET B CG  1 
ATOM   1330  S SD  . MET B 2 81  ? 202.571 -7.435   39.563  1.00 180.58 ? 81  MET B SD  1 
ATOM   1331  C CE  . MET B 2 81  ? 202.211 -5.881   40.380  1.00 181.43 ? 81  MET B CE  1 
ATOM   1332  N N   . PRO B 2 82  ? 202.454 -9.530   45.040  1.00 161.38 ? 82  PRO B N   1 
ATOM   1333  C CA  . PRO B 2 82  ? 201.470 -9.976   46.040  1.00 158.95 ? 82  PRO B CA  1 
ATOM   1334  C C   . PRO B 2 82  ? 200.847 -8.833   46.844  1.00 158.43 ? 82  PRO B C   1 
ATOM   1335  O O   . PRO B 2 82  ? 199.647 -8.855   47.123  1.00 156.51 ? 82  PRO B O   1 
ATOM   1336  C CB  . PRO B 2 82  ? 202.295 -10.876  46.966  1.00 157.11 ? 82  PRO B CB  1 
ATOM   1337  C CG  . PRO B 2 82  ? 203.391 -11.391  46.106  1.00 156.57 ? 82  PRO B CG  1 
ATOM   1338  C CD  . PRO B 2 82  ? 203.731 -10.260  45.180  1.00 159.26 ? 82  PRO B CD  1 
ATOM   1339  N N   . GLN B 2 83  ? 201.665 -7.847   47.200  1.00 159.79 ? 83  GLN B N   1 
ATOM   1340  C CA  . GLN B 2 83  ? 201.213 -6.700   47.985  1.00 160.72 ? 83  GLN B CA  1 
ATOM   1341  C C   . GLN B 2 83  ? 200.423 -5.676   47.162  1.00 159.39 ? 83  GLN B C   1 
ATOM   1342  O O   . GLN B 2 83  ? 199.522 -5.021   47.691  1.00 160.67 ? 83  GLN B O   1 
ATOM   1343  C CB  . GLN B 2 83  ? 202.391 -6.031   48.715  1.00 162.58 ? 83  GLN B CB  1 
ATOM   1344  C CG  . GLN B 2 83  ? 203.659 -5.834   47.889  1.00 163.35 ? 83  GLN B CG  1 
ATOM   1345  C CD  . GLN B 2 83  ? 204.638 -6.998   47.987  1.00 163.60 ? 83  GLN B CD  1 
ATOM   1346  O OE1 . GLN B 2 83  ? 204.249 -8.168   47.946  1.00 163.29 ? 83  GLN B OE1 1 
ATOM   1347  N NE2 . GLN B 2 83  ? 205.921 -6.677   48.108  1.00 164.08 ? 83  GLN B NE2 1 
ATOM   1348  N N   . MET B 2 84  ? 200.758 -5.550   45.877  1.00 156.13 ? 84  MET B N   1 
ATOM   1349  C CA  . MET B 2 84  ? 200.095 -4.593   44.979  1.00 151.68 ? 84  MET B CA  1 
ATOM   1350  C C   . MET B 2 84  ? 198.622 -4.927   44.744  1.00 145.51 ? 84  MET B C   1 
ATOM   1351  O O   . MET B 2 84  ? 197.791 -4.029   44.603  1.00 144.76 ? 84  MET B O   1 
ATOM   1352  C CB  . MET B 2 84  ? 200.835 -4.490   43.640  1.00 153.94 ? 84  MET B CB  1 
ATOM   1353  C CG  . MET B 2 84  ? 202.162 -3.739   43.695  1.00 155.70 ? 84  MET B CG  1 
ATOM   1354  S SD  . MET B 2 84  ? 202.033 -1.956   43.955  1.00 156.24 ? 84  MET B SD  1 
ATOM   1355  C CE  . MET B 2 84  ? 201.257 -1.436   42.429  1.00 154.75 ? 84  MET B CE  1 
ATOM   1356  N N   . VAL B 2 85  ? 198.309 -6.218   44.705  1.00 138.39 ? 85  VAL B N   1 
ATOM   1357  C CA  . VAL B 2 85  ? 196.928 -6.675   44.585  1.00 132.79 ? 85  VAL B CA  1 
ATOM   1358  C C   . VAL B 2 85  ? 196.154 -6.325   45.855  1.00 127.26 ? 85  VAL B C   1 
ATOM   1359  O O   . VAL B 2 85  ? 195.022 -5.847   45.783  1.00 124.57 ? 85  VAL B O   1 
ATOM   1360  C CB  . VAL B 2 85  ? 196.850 -8.194   44.323  1.00 134.95 ? 85  VAL B CB  1 
ATOM   1361  C CG1 . VAL B 2 85  ? 195.405 -8.637   44.138  1.00 137.10 ? 85  VAL B CG1 1 
ATOM   1362  C CG2 . VAL B 2 85  ? 197.677 -8.568   43.101  1.00 135.40 ? 85  VAL B CG2 1 
ATOM   1363  N N   . ALA B 2 86  ? 196.787 -6.552   47.005  1.00 122.67 ? 86  ALA B N   1 
ATOM   1364  C CA  . ALA B 2 86  ? 196.190 -6.280   48.311  1.00 119.88 ? 86  ALA B CA  1 
ATOM   1365  C C   . ALA B 2 86  ? 195.736 -4.833   48.466  1.00 119.64 ? 86  ALA B C   1 
ATOM   1366  O O   . ALA B 2 86  ? 194.619 -4.580   48.901  1.00 118.41 ? 86  ALA B O   1 
ATOM   1367  C CB  . ALA B 2 86  ? 197.156 -6.655   49.426  1.00 118.63 ? 86  ALA B CB  1 
ATOM   1368  N N   . ILE B 2 87  ? 196.598 -3.889   48.097  1.00 121.16 ? 87  ILE B N   1 
ATOM   1369  C CA  . ILE B 2 87  ? 196.296 -2.465   48.263  1.00 122.97 ? 87  ILE B CA  1 
ATOM   1370  C C   . ILE B 2 87  ? 195.216 -1.970   47.292  1.00 122.43 ? 87  ILE B C   1 
ATOM   1371  O O   . ILE B 2 87  ? 194.357 -1.170   47.677  1.00 121.14 ? 87  ILE B O   1 
ATOM   1372  C CB  . ILE B 2 87  ? 197.573 -1.588   48.196  1.00 125.18 ? 87  ILE B CB  1 
ATOM   1373  C CG1 . ILE B 2 87  ? 197.329 -0.210   48.825  1.00 125.77 ? 87  ILE B CG1 1 
ATOM   1374  C CG2 . ILE B 2 87  ? 198.110 -1.471   46.773  1.00 127.41 ? 87  ILE B CG2 1 
ATOM   1375  C CD1 . ILE B 2 87  ? 197.658 -0.142   50.301  1.00 125.00 ? 87  ILE B CD1 1 
ATOM   1376  N N   . TYR B 2 88  ? 195.262 -2.450   46.048  1.00 123.06 ? 88  TYR B N   1 
ATOM   1377  C CA  . TYR B 2 88  ? 194.217 -2.157   45.070  1.00 124.04 ? 88  TYR B CA  1 
ATOM   1378  C C   . TYR B 2 88  ? 192.924 -2.809   45.524  1.00 123.36 ? 88  TYR B C   1 
ATOM   1379  O O   . TYR B 2 88  ? 191.844 -2.249   45.353  1.00 124.33 ? 88  TYR B O   1 
ATOM   1380  C CB  . TYR B 2 88  ? 194.604 -2.636   43.667  1.00 125.90 ? 88  TYR B CB  1 
ATOM   1381  C CG  . TYR B 2 88  ? 195.723 -1.840   43.025  1.00 129.44 ? 88  TYR B CG  1 
ATOM   1382  C CD1 . TYR B 2 88  ? 195.793 -0.452   43.168  1.00 131.62 ? 88  TYR B CD1 1 
ATOM   1383  C CD2 . TYR B 2 88  ? 196.701 -2.470   42.258  1.00 130.75 ? 88  TYR B CD2 1 
ATOM   1384  C CE1 . TYR B 2 88  ? 196.815 0.280    42.580  1.00 133.81 ? 88  TYR B CE1 1 
ATOM   1385  C CE2 . TYR B 2 88  ? 197.727 -1.747   41.666  1.00 132.97 ? 88  TYR B CE2 1 
ATOM   1386  C CZ  . TYR B 2 88  ? 197.779 -0.372   41.828  1.00 133.94 ? 88  TYR B CZ  1 
ATOM   1387  O OH  . TYR B 2 88  ? 198.791 0.354    41.241  1.00 133.99 ? 88  TYR B OH  1 
ATOM   1388  N N   . ASN B 2 89  ? 193.055 -3.991   46.121  1.00 122.26 ? 89  ASN B N   1 
ATOM   1389  C CA  . ASN B 2 89  ? 191.946 -4.656   46.786  1.00 122.05 ? 89  ASN B CA  1 
ATOM   1390  C C   . ASN B 2 89  ? 191.437 -3.850   47.978  1.00 123.39 ? 89  ASN B C   1 
ATOM   1391  O O   . ASN B 2 89  ? 190.229 -3.744   48.188  1.00 125.51 ? 89  ASN B O   1 
ATOM   1392  C CB  . ASN B 2 89  ? 192.357 -6.058   47.232  1.00 119.79 ? 89  ASN B CB  1 
ATOM   1393  C CG  . ASN B 2 89  ? 191.200 -6.851   47.790  1.00 118.44 ? 89  ASN B CG  1 
ATOM   1394  O OD1 . ASN B 2 89  ? 191.242 -7.310   48.928  1.00 118.10 ? 89  ASN B OD1 1 
ATOM   1395  N ND2 . ASN B 2 89  ? 190.155 -7.008   46.992  1.00 117.78 ? 89  ASN B ND2 1 
ATOM   1396  N N   . GLY B 2 90  ? 192.368 -3.286   48.747  1.00 122.73 ? 90  GLY B N   1 
ATOM   1397  C CA  . GLY B 2 90  ? 192.039 -2.444   49.895  1.00 120.44 ? 90  GLY B CA  1 
ATOM   1398  C C   . GLY B 2 90  ? 191.177 -1.264   49.502  1.00 118.86 ? 90  GLY B C   1 
ATOM   1399  O O   . GLY B 2 90  ? 190.070 -1.098   50.015  1.00 119.04 ? 90  GLY B O   1 
ATOM   1400  N N   . MET B 2 91  ? 191.685 -0.463   48.569  1.00 116.43 ? 91  MET B N   1 
ATOM   1401  C CA  . MET B 2 91  ? 190.984 0.718    48.064  1.00 114.49 ? 91  MET B CA  1 
ATOM   1402  C C   . MET B 2 91  ? 189.594 0.409    47.500  1.00 115.66 ? 91  MET B C   1 
ATOM   1403  O O   . MET B 2 91  ? 188.690 1.242    47.582  1.00 114.62 ? 91  MET B O   1 
ATOM   1404  C CB  . MET B 2 91  ? 191.839 1.430    47.015  1.00 111.64 ? 91  MET B CB  1 
ATOM   1405  C CG  . MET B 2 91  ? 193.112 2.040    47.578  1.00 109.24 ? 91  MET B CG  1 
ATOM   1406  S SD  . MET B 2 91  ? 193.989 3.035    46.363  1.00 107.54 ? 91  MET B SD  1 
ATOM   1407  C CE  . MET B 2 91  ? 195.236 3.804    47.391  1.00 108.00 ? 91  MET B CE  1 
ATOM   1408  N N   . GLY B 2 92  ? 189.434 -0.787   46.934  1.00 117.67 ? 92  GLY B N   1 
ATOM   1409  C CA  . GLY B 2 92  ? 188.138 -1.262   46.443  1.00 118.39 ? 92  GLY B CA  1 
ATOM   1410  C C   . GLY B 2 92  ? 187.140 -1.491   47.563  1.00 118.39 ? 92  GLY B C   1 
ATOM   1411  O O   . GLY B 2 92  ? 185.940 -1.258   47.393  1.00 118.15 ? 92  GLY B O   1 
ATOM   1412  N N   . GLY B 2 93  ? 187.644 -1.955   48.706  1.00 118.39 ? 93  GLY B N   1 
ATOM   1413  C CA  . GLY B 2 93  ? 186.848 -2.081   49.925  1.00 117.53 ? 93  GLY B CA  1 
ATOM   1414  C C   . GLY B 2 93  ? 186.514 -0.720   50.503  1.00 117.03 ? 93  GLY B C   1 
ATOM   1415  O O   . GLY B 2 93  ? 185.434 -0.521   51.060  1.00 118.12 ? 93  GLY B O   1 
ATOM   1416  N N   . GLY B 2 94  ? 187.448 0.219    50.368  1.00 115.63 ? 94  GLY B N   1 
ATOM   1417  C CA  . GLY B 2 94  ? 187.218 1.607    50.755  1.00 113.44 ? 94  GLY B CA  1 
ATOM   1418  C C   . GLY B 2 94  ? 186.172 2.268    49.876  1.00 111.49 ? 94  GLY B C   1 
ATOM   1419  O O   . GLY B 2 94  ? 185.321 3.010    50.367  1.00 111.17 ? 94  GLY B O   1 
ATOM   1420  N N   . ALA B 2 95  ? 186.237 1.982    48.576  1.00 109.54 ? 95  ALA B N   1 
ATOM   1421  C CA  . ALA B 2 95  ? 185.304 2.531    47.592  1.00 108.34 ? 95  ALA B CA  1 
ATOM   1422  C C   . ALA B 2 95  ? 183.861 2.085    47.826  1.00 108.78 ? 95  ALA B C   1 
ATOM   1423  O O   . ALA B 2 95  ? 182.927 2.844    47.574  1.00 107.65 ? 95  ALA B O   1 
ATOM   1424  C CB  . ALA B 2 95  ? 185.749 2.168    46.187  1.00 107.37 ? 95  ALA B CB  1 
ATOM   1425  N N   . ALA B 2 96  ? 183.691 0.853    48.304  1.00 110.74 ? 96  ALA B N   1 
ATOM   1426  C CA  . ALA B 2 96  ? 182.375 0.324    48.663  1.00 112.56 ? 96  ALA B CA  1 
ATOM   1427  C C   . ALA B 2 96  ? 181.873 0.929    49.969  1.00 112.72 ? 96  ALA B C   1 
ATOM   1428  O O   . ALA B 2 96  ? 180.688 1.246    50.102  1.00 112.51 ? 96  ALA B O   1 
ATOM   1429  C CB  . ALA B 2 96  ? 182.427 -1.191   48.771  1.00 114.28 ? 96  ALA B CB  1 
ATOM   1430  N N   . ALA B 2 97  ? 182.788 1.076    50.927  1.00 112.65 ? 97  ALA B N   1 
ATOM   1431  C CA  . ALA B 2 97  ? 182.495 1.692    52.216  1.00 111.90 ? 97  ALA B CA  1 
ATOM   1432  C C   . ALA B 2 97  ? 182.081 3.152    52.046  1.00 111.38 ? 97  ALA B C   1 
ATOM   1433  O O   . ALA B 2 97  ? 181.273 3.667    52.818  1.00 112.52 ? 97  ALA B O   1 
ATOM   1434  C CB  . ALA B 2 97  ? 183.700 1.583    53.136  1.00 111.96 ? 97  ALA B CB  1 
ATOM   1435  N N   . THR B 2 98  ? 182.634 3.806    51.027  1.00 109.86 ? 98  THR B N   1 
ATOM   1436  C CA  . THR B 2 98  ? 182.313 5.202    50.732  1.00 108.51 ? 98  THR B CA  1 
ATOM   1437  C C   . THR B 2 98  ? 180.917 5.381    50.130  1.00 107.20 ? 98  THR B C   1 
ATOM   1438  O O   . THR B 2 98  ? 180.240 6.369    50.420  1.00 107.50 ? 98  THR B O   1 
ATOM   1439  C CB  . THR B 2 98  ? 183.359 5.856    49.811  1.00 108.56 ? 98  THR B CB  1 
ATOM   1440  O OG1 . THR B 2 98  ? 183.571 5.030    48.662  1.00 108.02 ? 98  THR B OG1 1 
ATOM   1441  C CG2 . THR B 2 98  ? 184.679 6.060    50.551  1.00 108.39 ? 98  THR B CG2 1 
ATOM   1442  N N   . ILE B 2 99  ? 180.496 4.434    49.293  1.00 105.48 ? 99  ILE B N   1 
ATOM   1443  C CA  . ILE B 2 99  ? 179.138 4.433    48.741  1.00 104.41 ? 99  ILE B CA  1 
ATOM   1444  C C   . ILE B 2 99  ? 178.121 4.207    49.865  1.00 106.20 ? 99  ILE B C   1 
ATOM   1445  O O   . ILE B 2 99  ? 177.023 4.771    49.844  1.00 106.76 ? 99  ILE B O   1 
ATOM   1446  C CB  . ILE B 2 99  ? 178.962 3.359    47.641  1.00 102.52 ? 99  ILE B CB  1 
ATOM   1447  C CG1 . ILE B 2 99  ? 179.984 3.564    46.519  1.00 101.25 ? 99  ILE B CG1 1 
ATOM   1448  C CG2 . ILE B 2 99  ? 177.551 3.391    47.064  1.00 101.84 ? 99  ILE B CG2 1 
ATOM   1449  C CD1 . ILE B 2 99  ? 180.246 2.323    45.693  1.00 101.01 ? 99  ILE B CD1 1 
ATOM   1450  N N   . ALA B 2 100 ? 178.513 3.395    50.848  1.00 107.97 ? 100 ALA B N   1 
ATOM   1451  C CA  . ALA B 2 100 ? 177.672 3.042    51.995  1.00 109.62 ? 100 ALA B CA  1 
ATOM   1452  C C   . ALA B 2 100 ? 177.332 4.227    52.898  1.00 110.57 ? 100 ALA B C   1 
ATOM   1453  O O   . ALA B 2 100 ? 176.173 4.413    53.277  1.00 110.14 ? 100 ALA B O   1 
ATOM   1454  C CB  . ALA B 2 100 ? 178.337 1.941    52.809  1.00 109.44 ? 100 ALA B CB  1 
ATOM   1455  N N   . ALA B 2 101 ? 178.348 5.019    53.238  1.00 112.13 ? 101 ALA B N   1 
ATOM   1456  C CA  . ALA B 2 101 ? 178.200 6.132    54.177  1.00 112.89 ? 101 ALA B CA  1 
ATOM   1457  C C   . ALA B 2 101 ? 177.325 7.262    53.638  1.00 112.87 ? 101 ALA B C   1 
ATOM   1458  O O   . ALA B 2 101 ? 176.570 7.878    54.393  1.00 111.28 ? 101 ALA B O   1 
ATOM   1459  C CB  . ALA B 2 101 ? 179.567 6.667    54.582  1.00 114.06 ? 101 ALA B CB  1 
ATOM   1460  N N   . VAL B 2 102 ? 177.427 7.517    52.335  1.00 114.50 ? 102 VAL B N   1 
ATOM   1461  C CA  . VAL B 2 102 ? 176.736 8.636    51.688  1.00 116.83 ? 102 VAL B CA  1 
ATOM   1462  C C   . VAL B 2 102 ? 175.211 8.553    51.815  1.00 118.25 ? 102 VAL B C   1 
ATOM   1463  O O   . VAL B 2 102 ? 174.580 9.487    52.316  1.00 119.23 ? 102 VAL B O   1 
ATOM   1464  C CB  . VAL B 2 102 ? 177.163 8.787    50.209  1.00 117.33 ? 102 VAL B CB  1 
ATOM   1465  C CG1 . VAL B 2 102 ? 176.247 9.751    49.466  1.00 118.82 ? 102 VAL B CG1 1 
ATOM   1466  C CG2 . VAL B 2 102 ? 178.609 9.256    50.123  1.00 117.23 ? 102 VAL B CG2 1 
ATOM   1467  N N   . GLU B 2 103 ? 174.627 7.440    51.370  1.00 119.55 ? 103 GLU B N   1 
ATOM   1468  C CA  . GLU B 2 103 ? 173.180 7.228    51.484  1.00 120.28 ? 103 GLU B CA  1 
ATOM   1469  C C   . GLU B 2 103 ? 172.736 6.971    52.937  1.00 121.98 ? 103 GLU B C   1 
ATOM   1470  O O   . GLU B 2 103 ? 171.538 6.995    53.238  1.00 125.13 ? 103 GLU B O   1 
ATOM   1471  C CB  . GLU B 2 103 ? 172.748 6.059    50.596  1.00 20.00  ? 103 GLU B CB  1 
ATOM   1472  C CG  . GLU B 2 103 ? 172.903 6.321    49.106  1.00 20.00  ? 103 GLU B CG  1 
ATOM   1473  C CD  . GLU B 2 103 ? 172.533 5.115    48.263  1.00 20.00  ? 103 GLU B CD  1 
ATOM   1474  O OE1 . GLU B 2 103 ? 172.340 4.023    48.837  1.00 20.00  ? 103 GLU B OE1 1 
ATOM   1475  O OE2 . GLU B 2 103 ? 172.438 5.259    47.026  1.00 20.00  ? 103 GLU B OE2 1 
ATOM   1476  N N   . LEU B 2 104 ? 173.703 6.732    53.826  1.00 120.60 ? 104 LEU B N   1 
ATOM   1477  C CA  . LEU B 2 104 ? 173.443 6.614    55.266  1.00 119.67 ? 104 LEU B CA  1 
ATOM   1478  C C   . LEU B 2 104 ? 173.355 7.984    55.943  1.00 122.33 ? 104 LEU B C   1 
ATOM   1479  O O   . LEU B 2 104 ? 172.642 8.152    56.936  1.00 122.43 ? 104 LEU B O   1 
ATOM   1480  C CB  . LEU B 2 104 ? 174.521 5.759    55.940  1.00 115.75 ? 104 LEU B CB  1 
ATOM   1481  C CG  . LEU B 2 104 ? 174.278 4.273    56.239  1.00 113.56 ? 104 LEU B CG  1 
ATOM   1482  C CD1 . LEU B 2 104 ? 173.572 3.529    55.113  1.00 112.03 ? 104 LEU B CD1 1 
ATOM   1483  C CD2 . LEU B 2 104 ? 175.598 3.595    56.575  1.00 112.88 ? 104 LEU B CD2 1 
ATOM   1484  N N   . LEU B 2 105 ? 174.090 8.951    55.396  1.00 126.04 ? 105 LEU B N   1 
ATOM   1485  C CA  . LEU B 2 105 ? 174.086 10.332   55.881  1.00 129.47 ? 105 LEU B CA  1 
ATOM   1486  C C   . LEU B 2 105 ? 172.886 11.109   55.335  1.00 131.02 ? 105 LEU B C   1 
ATOM   1487  O O   . LEU B 2 105 ? 172.337 11.983   56.014  1.00 129.91 ? 105 LEU B O   1 
ATOM   1488  C CB  . LEU B 2 105 ? 175.394 11.027   55.486  1.00 131.38 ? 105 LEU B CB  1 
ATOM   1489  C CG  . LEU B 2 105 ? 176.685 10.850   56.305  1.00 132.64 ? 105 LEU B CG  1 
ATOM   1490  C CD1 . LEU B 2 105 ? 176.689 9.630    57.220  1.00 132.32 ? 105 LEU B CD1 1 
ATOM   1491  C CD2 . LEU B 2 105 ? 177.889 10.817   55.372  1.00 133.51 ? 105 LEU B CD2 1 
ATOM   1492  N N   . LYS B 2 106 ? 172.504 10.783   54.099  1.00 132.82 ? 106 LYS B N   1 
ATOM   1493  C CA  . LYS B 2 106 ? 171.290 11.295   53.460  1.00 133.95 ? 106 LYS B CA  1 
ATOM   1494  C C   . LYS B 2 106 ? 170.036 10.920   54.247  1.00 139.44 ? 106 LYS B C   1 
ATOM   1495  O O   . LYS B 2 106 ? 169.142 11.747   54.435  1.00 140.78 ? 106 LYS B O   1 
ATOM   1496  C CB  . LYS B 2 106 ? 171.151 10.707   52.051  1.00 127.94 ? 106 LYS B CB  1 
ATOM   1497  C CG  . LYS B 2 106 ? 171.614 11.575   50.892  1.00 121.41 ? 106 LYS B CG  1 
ATOM   1498  C CD  . LYS B 2 106 ? 171.546 10.754   49.608  1.00 115.65 ? 106 LYS B CD  1 
ATOM   1499  C CE  . LYS B 2 106 ? 171.551 11.616   48.359  1.00 112.64 ? 106 LYS B CE  1 
ATOM   1500  N NZ  . LYS B 2 106 ? 171.356 10.774   47.144  1.00 109.84 ? 106 LYS B NZ  1 
ATOM   1501  N N   . GLY B 2 107 ? 169.985 9.669    54.705  1.00 144.67 ? 107 GLY B N   1 
ATOM   1502  C CA  . GLY B 2 107 ? 168.743 9.063    55.178  1.00 147.96 ? 107 GLY B CA  1 
ATOM   1503  C C   . GLY B 2 107 ? 167.905 8.720    53.960  1.00 151.43 ? 107 GLY B C   1 
ATOM   1504  O O   . GLY B 2 107 ? 166.672 8.730    54.019  1.00 147.88 ? 107 GLY B O   1 
ATOM   1505  N N   . ALA B 2 108 ? 168.601 8.410    52.862  1.00 158.13 ? 108 ALA B N   1 
ATOM   1506  C CA  . ALA B 2 108 ? 168.012 8.215    51.530  1.00 164.85 ? 108 ALA B CA  1 
ATOM   1507  C C   . ALA B 2 108 ? 167.052 7.036    51.447  1.00 170.94 ? 108 ALA B C   1 
ATOM   1508  O O   . ALA B 2 108 ? 166.210 6.979    50.549  1.00 173.66 ? 108 ALA B O   1 
ATOM   1509  C CB  . ALA B 2 108 ? 169.107 8.073    50.480  1.00 163.06 ? 108 ALA B CB  1 
ATOM   1510  N N   . PHE B 2 109 ? 167.197 6.090    52.369  1.00 177.50 ? 109 PHE B N   1 
ATOM   1511  C CA  . PHE B 2 109 ? 166.236 5.001    52.500  1.00 182.86 ? 109 PHE B CA  1 
ATOM   1512  C C   . PHE B 2 109 ? 165.702 4.867    53.921  1.00 189.81 ? 109 PHE B C   1 
ATOM   1513  O O   . PHE B 2 109 ? 166.422 5.066    54.906  1.00 184.68 ? 109 PHE B O   1 
ATOM   1514  C CB  . PHE B 2 109 ? 166.796 3.660    51.991  1.00 179.20 ? 109 PHE B CB  1 
ATOM   1515  C CG  . PHE B 2 109 ? 168.282 3.500    52.163  1.00 177.30 ? 109 PHE B CG  1 
ATOM   1516  C CD1 . PHE B 2 109 ? 168.869 3.543    53.425  1.00 177.57 ? 109 PHE B CD1 1 
ATOM   1517  C CD2 . PHE B 2 109 ? 169.096 3.282    51.055  1.00 175.42 ? 109 PHE B CD2 1 
ATOM   1518  C CE1 . PHE B 2 109 ? 170.238 3.394    53.575  1.00 176.63 ? 109 PHE B CE1 1 
ATOM   1519  C CE2 . PHE B 2 109 ? 170.466 3.126    51.201  1.00 175.29 ? 109 PHE B CE2 1 
ATOM   1520  C CZ  . PHE B 2 109 ? 171.036 3.181    52.463  1.00 175.90 ? 109 PHE B CZ  1 
ATOM   1521  N N   . GLU B 2 110 ? 164.415 4.555    54.002  1.00 204.59 ? 110 GLU B N   1 
ATOM   1522  C CA  . GLU B 2 110 ? 163.776 4.193    55.254  1.00 219.28 ? 110 GLU B CA  1 
ATOM   1523  C C   . GLU B 2 110 ? 163.497 2.689    55.230  1.00 228.27 ? 110 GLU B C   1 
ATOM   1524  O O   . GLU B 2 110 ? 162.969 2.129    56.194  1.00 228.44 ? 110 GLU B O   1 
ATOM   1525  C CB  . GLU B 2 110 ? 162.503 5.020    55.463  1.00 227.60 ? 110 GLU B CB  1 
ATOM   1526  C CG  . GLU B 2 110 ? 162.783 6.478    55.825  1.00 234.73 ? 110 GLU B CG  1 
ATOM   1527  C CD  . GLU B 2 110 ? 161.731 7.452    55.313  1.00 243.75 ? 110 GLU B CD  1 
ATOM   1528  O OE1 . GLU B 2 110 ? 162.088 8.631    55.091  1.00 242.75 ? 110 GLU B OE1 1 
ATOM   1529  O OE2 . GLU B 2 110 ? 160.558 7.055    55.138  1.00 252.66 ? 110 GLU B OE2 1 
ATOM   1530  N N   . ASN B 2 111 ? 163.875 2.051    54.119  1.00 240.91 ? 111 ASN B N   1 
ATOM   1531  C CA  . ASN B 2 111 ? 163.851 0.594    53.966  1.00 254.87 ? 111 ASN B CA  1 
ATOM   1532  C C   . ASN B 2 111 ? 164.810 -0.044   54.974  1.00 250.69 ? 111 ASN B C   1 
ATOM   1533  O O   . ASN B 2 111 ? 165.978 0.347    55.054  1.00 257.42 ? 111 ASN B O   1 
ATOM   1534  C CB  . ASN B 2 111 ? 164.251 0.213    52.529  1.00 269.30 ? 111 ASN B CB  1 
ATOM   1535  C CG  . ASN B 2 111 ? 163.705 -1.142   52.093  1.00 283.74 ? 111 ASN B CG  1 
ATOM   1536  O OD1 . ASN B 2 111 ? 163.034 -1.244   51.066  1.00 291.34 ? 111 ASN B OD1 1 
ATOM   1537  N ND2 . ASN B 2 111 ? 164.003 -2.188   52.859  1.00 286.62 ? 111 ASN B ND2 1 
ATOM   1538  N N   . THR B 2 112 ? 164.312 -1.013   55.744  1.00 237.69 ? 112 THR B N   1 
ATOM   1539  C CA  . THR B 2 112 ? 165.097 -1.647   56.817  1.00 220.99 ? 112 THR B CA  1 
ATOM   1540  C C   . THR B 2 112 ? 166.021 -2.778   56.340  1.00 209.29 ? 112 THR B C   1 
ATOM   1541  O O   . THR B 2 112 ? 166.925 -3.195   57.069  1.00 207.52 ? 112 THR B O   1 
ATOM   1542  C CB  . THR B 2 112 ? 164.205 -2.155   57.977  1.00 219.28 ? 112 THR B CB  1 
ATOM   1543  O OG1 . THR B 2 112 ? 163.136 -2.958   57.457  1.00 214.54 ? 112 THR B OG1 1 
ATOM   1544  C CG2 . THR B 2 112 ? 163.626 -0.988   58.774  1.00 219.43 ? 112 THR B CG2 1 
ATOM   1545  N N   . GLY B 2 113 ? 165.786 -3.270   55.125  1.00 196.36 ? 113 GLY B N   1 
ATOM   1546  C CA  . GLY B 2 113 ? 166.649 -4.281   54.511  1.00 179.71 ? 113 GLY B CA  1 
ATOM   1547  C C   . GLY B 2 113 ? 167.799 -3.666   53.730  1.00 168.72 ? 113 GLY B C   1 
ATOM   1548  O O   . GLY B 2 113 ? 168.952 -4.084   53.878  1.00 166.53 ? 113 GLY B O   1 
ATOM   1549  N N   . LEU B 2 114 ? 167.475 -2.672   52.898  1.00 158.27 ? 114 LEU B N   1 
ATOM   1550  C CA  . LEU B 2 114 ? 168.453 -1.927   52.091  1.00 147.49 ? 114 LEU B CA  1 
ATOM   1551  C C   . LEU B 2 114 ? 169.528 -1.267   52.949  1.00 143.09 ? 114 LEU B C   1 
ATOM   1552  O O   . LEU B 2 114 ? 170.716 -1.334   52.626  1.00 139.58 ? 114 LEU B O   1 
ATOM   1553  C CB  . LEU B 2 114 ? 167.751 -0.854   51.245  1.00 143.20 ? 114 LEU B CB  1 
ATOM   1554  C CG  . LEU B 2 114 ? 167.291 -1.134   49.809  1.00 140.03 ? 114 LEU B CG  1 
ATOM   1555  C CD1 . LEU B 2 114 ? 166.243 -2.235   49.728  1.00 139.30 ? 114 LEU B CD1 1 
ATOM   1556  C CD2 . LEU B 2 114 ? 166.754 0.148    49.189  1.00 136.91 ? 114 LEU B CD2 1 
ATOM   1557  N N   . MET B 2 115 ? 169.090 -0.624   54.032  1.00 140.65 ? 115 MET B N   1 
ATOM   1558  C CA  . MET B 2 115 ? 169.981 -0.017   55.019  1.00 137.41 ? 115 MET B CA  1 
ATOM   1559  C C   . MET B 2 115 ? 170.901 -1.100   55.592  1.00 132.88 ? 115 MET B C   1 
ATOM   1560  O O   . MET B 2 115 ? 172.118 -0.927   55.618  1.00 132.69 ? 115 MET B O   1 
ATOM   1561  C CB  . MET B 2 115 ? 169.161 0.667    56.129  1.00 140.08 ? 115 MET B CB  1 
ATOM   1562  C CG  . MET B 2 115 ? 169.731 1.979    56.669  1.00 139.32 ? 115 MET B CG  1 
ATOM   1563  S SD  . MET B 2 115 ? 168.506 3.015    57.513  1.00 137.14 ? 115 MET B SD  1 
ATOM   1564  C CE  . MET B 2 115 ? 169.353 4.591    57.576  1.00 134.92 ? 115 MET B CE  1 
ATOM   1565  N N   . ALA B 2 116 ? 170.312 -2.227   56.000  1.00 126.69 ? 116 ALA B N   1 
ATOM   1566  C CA  . ALA B 2 116 ? 171.045 -3.353   56.597  1.00 120.28 ? 116 ALA B CA  1 
ATOM   1567  C C   . ALA B 2 116 ? 172.095 -3.966   55.671  1.00 116.30 ? 116 ALA B C   1 
ATOM   1568  O O   . ALA B 2 116 ? 173.081 -4.536   56.142  1.00 114.40 ? 116 ALA B O   1 
ATOM   1569  C CB  . ALA B 2 116 ? 170.076 -4.425   57.076  1.00 119.50 ? 116 ALA B CB  1 
ATOM   1570  N N   . LEU B 2 117 ? 171.873 -3.856   54.364  1.00 113.20 ? 117 LEU B N   1 
ATOM   1571  C CA  . LEU B 2 117 ? 172.826 -4.350   53.372  1.00 111.67 ? 117 LEU B CA  1 
ATOM   1572  C C   . LEU B 2 117 ? 173.800 -3.263   52.940  1.00 109.97 ? 117 LEU B C   1 
ATOM   1573  O O   . LEU B 2 117 ? 174.902 -3.557   52.468  1.00 108.10 ? 117 LEU B O   1 
ATOM   1574  C CB  . LEU B 2 117 ? 172.096 -4.922   52.159  1.00 113.53 ? 117 LEU B CB  1 
ATOM   1575  C CG  . LEU B 2 117 ? 171.266 -6.182   52.415  1.00 115.80 ? 117 LEU B CG  1 
ATOM   1576  C CD1 . LEU B 2 117 ? 170.443 -6.524   51.183  1.00 118.04 ? 117 LEU B CD1 1 
ATOM   1577  C CD2 . LEU B 2 117 ? 172.141 -7.360   52.825  1.00 116.39 ? 117 LEU B CD2 1 
ATOM   1578  N N   . ALA B 2 118 ? 173.378 -2.010   53.094  1.00 109.89 ? 118 ALA B N   1 
ATOM   1579  C CA  . ALA B 2 118 ? 174.259 -0.867   52.899  1.00 111.31 ? 118 ALA B CA  1 
ATOM   1580  C C   . ALA B 2 118 ? 175.280 -0.807   54.029  1.00 112.81 ? 118 ALA B C   1 
ATOM   1581  O O   . ALA B 2 118 ? 176.470 -0.587   53.797  1.00 112.88 ? 118 ALA B O   1 
ATOM   1582  C CB  . ALA B 2 118 ? 173.457 0.424    52.835  1.00 110.73 ? 118 ALA B CB  1 
ATOM   1583  N N   . ILE B 2 119 ? 174.796 -1.019   55.251  1.00 114.88 ? 119 ILE B N   1 
ATOM   1584  C CA  . ILE B 2 119 ? 175.626 -1.011   56.454  1.00 115.85 ? 119 ILE B CA  1 
ATOM   1585  C C   . ILE B 2 119 ? 176.550 -2.231   56.495  1.00 113.92 ? 119 ILE B C   1 
ATOM   1586  O O   . ILE B 2 119 ? 177.757 -2.091   56.710  1.00 114.15 ? 119 ILE B O   1 
ATOM   1587  C CB  . ILE B 2 119 ? 174.756 -0.945   57.733  1.00 117.91 ? 119 ILE B CB  1 
ATOM   1588  C CG1 . ILE B 2 119 ? 173.988 0.380    57.790  1.00 118.87 ? 119 ILE B CG1 1 
ATOM   1589  C CG2 . ILE B 2 119 ? 175.608 -1.101   58.984  1.00 118.03 ? 119 ILE B CG2 1 
ATOM   1590  C CD1 . ILE B 2 119 ? 172.707 0.317    58.595  1.00 120.17 ? 119 ILE B CD1 1 
ATOM   1591  N N   . LEU B 2 120 ? 175.979 -3.416   56.273  1.00 110.54 ? 120 LEU B N   1 
ATOM   1592  C CA  . LEU B 2 120 ? 176.731 -4.672   56.314  1.00 106.33 ? 120 LEU B CA  1 
ATOM   1593  C C   . LEU B 2 120 ? 177.778 -4.723   55.197  1.00 105.61 ? 120 LEU B C   1 
ATOM   1594  O O   . LEU B 2 120 ? 178.843 -5.321   55.363  1.00 106.00 ? 120 LEU B O   1 
ATOM   1595  C CB  . LEU B 2 120 ? 175.783 -5.874   56.233  1.00 103.19 ? 120 LEU B CB  1 
ATOM   1596  C CG  . LEU B 2 120 ? 175.807 -6.881   57.391  1.00 100.53 ? 120 LEU B CG  1 
ATOM   1597  C CD1 . LEU B 2 120 ? 174.478 -7.620   57.494  1.00 98.74  ? 120 LEU B CD1 1 
ATOM   1598  C CD2 . LEU B 2 120 ? 176.968 -7.861   57.270  1.00 100.34 ? 120 LEU B CD2 1 
ATOM   1599  N N   . GLY B 2 121 ? 177.467 -4.088   54.068  1.00 104.21 ? 121 GLY B N   1 
ATOM   1600  C CA  . GLY B 2 121 ? 178.425 -3.925   52.976  1.00 102.75 ? 121 GLY B CA  1 
ATOM   1601  C C   . GLY B 2 121 ? 179.493 -2.897   53.307  1.00 102.65 ? 121 GLY B C   1 
ATOM   1602  O O   . GLY B 2 121 ? 180.639 -3.021   52.875  1.00 101.25 ? 121 GLY B O   1 
ATOM   1603  N N   . GLY B 2 122 ? 179.108 -1.878   54.074  1.00 104.05 ? 122 GLY B N   1 
ATOM   1604  C CA  . GLY B 2 122 ? 180.033 -0.838   54.520  1.00 108.02 ? 122 GLY B CA  1 
ATOM   1605  C C   . GLY B 2 122 ? 181.004 -1.317   55.582  1.00 112.52 ? 122 GLY B C   1 
ATOM   1606  O O   . GLY B 2 122 ? 182.144 -0.847   55.643  1.00 111.70 ? 122 GLY B O   1 
ATOM   1607  N N   . LEU B 2 123 ? 180.546 -2.246   56.421  1.00 118.98 ? 123 LEU B N   1 
ATOM   1608  C CA  . LEU B 2 123 ? 181.380 -2.861   57.456  1.00 126.80 ? 123 LEU B CA  1 
ATOM   1609  C C   . LEU B 2 123 ? 182.519 -3.652   56.819  1.00 130.03 ? 123 LEU B C   1 
ATOM   1610  O O   . LEU B 2 123 ? 183.693 -3.347   57.037  1.00 131.64 ? 123 LEU B O   1 
ATOM   1611  C CB  . LEU B 2 123 ? 180.536 -3.777   58.359  1.00 129.78 ? 123 LEU B CB  1 
ATOM   1612  C CG  . LEU B 2 123 ? 181.125 -4.354   59.658  1.00 132.00 ? 123 LEU B CG  1 
ATOM   1613  C CD1 . LEU B 2 123 ? 180.009 -4.702   60.633  1.00 133.75 ? 123 LEU B CD1 1 
ATOM   1614  C CD2 . LEU B 2 123 ? 182.017 -5.569   59.423  1.00 131.59 ? 123 LEU B CD2 1 
ATOM   1615  N N   . ILE B 2 124 ? 182.150 -4.658   56.026  1.00 132.95 ? 124 ILE B N   1 
ATOM   1616  C CA  . ILE B 2 124 ? 183.101 -5.561   55.373  1.00 134.74 ? 124 ILE B CA  1 
ATOM   1617  C C   . ILE B 2 124 ? 184.034 -4.814   54.409  1.00 133.72 ? 124 ILE B C   1 
ATOM   1618  O O   . ILE B 2 124 ? 185.184 -5.214   54.218  1.00 134.84 ? 124 ILE B O   1 
ATOM   1619  C CB  . ILE B 2 124 ? 182.362 -6.731   54.672  1.00 136.36 ? 124 ILE B CB  1 
ATOM   1620  C CG1 . ILE B 2 124 ? 181.647 -7.604   55.714  1.00 137.02 ? 124 ILE B CG1 1 
ATOM   1621  C CG2 . ILE B 2 124 ? 183.321 -7.582   53.853  1.00 137.20 ? 124 ILE B CG2 1 
ATOM   1622  C CD1 . ILE B 2 124 ? 180.647 -8.588   55.141  1.00 137.95 ? 124 ILE B CD1 1 
ATOM   1623  N N   . GLY B 2 125 ? 183.540 -3.721   53.830  1.00 131.21 ? 125 GLY B N   1 
ATOM   1624  C CA  . GLY B 2 125 ? 184.344 -2.863   52.961  1.00 127.42 ? 125 GLY B CA  1 
ATOM   1625  C C   . GLY B 2 125 ? 185.513 -2.207   53.676  1.00 124.93 ? 125 GLY B C   1 
ATOM   1626  O O   . GLY B 2 125 ? 186.660 -2.331   53.242  1.00 122.56 ? 125 GLY B O   1 
ATOM   1627  N N   . SER B 2 126 ? 185.216 -1.511   54.774  1.00 124.15 ? 126 SER B N   1 
ATOM   1628  C CA  . SER B 2 126 ? 186.236 -0.852   55.597  1.00 124.40 ? 126 SER B CA  1 
ATOM   1629  C C   . SER B 2 126 ? 187.211 -1.844   56.227  1.00 126.89 ? 126 SER B C   1 
ATOM   1630  O O   . SER B 2 126 ? 188.383 -1.521   56.433  1.00 125.42 ? 126 SER B O   1 
ATOM   1631  C CB  . SER B 2 126 ? 185.582 -0.006   56.689  1.00 122.92 ? 126 SER B CB  1 
ATOM   1632  O OG  . SER B 2 126 ? 185.034 1.185    56.154  1.00 121.99 ? 126 SER B OG  1 
ATOM   1633  N N   . VAL B 2 127 ? 186.712 -3.041   56.538  1.00 132.07 ? 127 VAL B N   1 
ATOM   1634  C CA  . VAL B 2 127 ? 187.540 -4.151   57.021  1.00 136.66 ? 127 VAL B CA  1 
ATOM   1635  C C   . VAL B 2 127 ? 188.459 -4.639   55.896  1.00 138.86 ? 127 VAL B C   1 
ATOM   1636  O O   . VAL B 2 127 ? 189.659 -4.832   56.108  1.00 143.61 ? 127 VAL B O   1 
ATOM   1637  C CB  . VAL B 2 127 ? 186.678 -5.318   57.577  1.00 136.56 ? 127 VAL B CB  1 
ATOM   1638  C CG1 . VAL B 2 127 ? 187.528 -6.550   57.866  1.00 136.10 ? 127 VAL B CG1 1 
ATOM   1639  C CG2 . VAL B 2 127 ? 185.938 -4.892   58.838  1.00 135.53 ? 127 VAL B CG2 1 
ATOM   1640  N N   . ALA B 2 128 ? 187.890 -4.816   54.703  1.00 136.80 ? 128 ALA B N   1 
ATOM   1641  C CA  . ALA B 2 128 ? 188.646 -5.240   53.521  1.00 132.80 ? 128 ALA B CA  1 
ATOM   1642  C C   . ALA B 2 128 ? 189.557 -4.133   52.995  1.00 130.13 ? 128 ALA B C   1 
ATOM   1643  O O   . ALA B 2 128 ? 190.454 -4.386   52.187  1.00 129.96 ? 128 ALA B O   1 
ATOM   1644  C CB  . ALA B 2 128 ? 187.703 -5.717   52.430  1.00 131.34 ? 128 ALA B CB  1 
ATOM   1645  N N   . PHE B 2 129 ? 189.316 -2.906   53.454  1.00 126.96 ? 129 PHE B N   1 
ATOM   1646  C CA  . PHE B 2 129 ? 190.184 -1.783   53.136  1.00 124.91 ? 129 PHE B CA  1 
ATOM   1647  C C   . PHE B 2 129 ? 191.436 -1.804   54.009  1.00 122.32 ? 129 PHE B C   1 
ATOM   1648  O O   . PHE B 2 129 ? 192.520 -2.127   53.523  1.00 121.02 ? 129 PHE B O   1 
ATOM   1649  C CB  . PHE B 2 129 ? 189.440 -0.451   53.274  1.00 127.36 ? 129 PHE B CB  1 
ATOM   1650  C CG  . PHE B 2 129 ? 190.324 0.755    53.116  1.00 131.13 ? 129 PHE B CG  1 
ATOM   1651  C CD1 . PHE B 2 129 ? 190.885 1.071    51.883  1.00 131.95 ? 129 PHE B CD1 1 
ATOM   1652  C CD2 . PHE B 2 129 ? 190.600 1.575    54.203  1.00 133.45 ? 129 PHE B CD2 1 
ATOM   1653  C CE1 . PHE B 2 129 ? 191.703 2.179    51.734  1.00 133.94 ? 129 PHE B CE1 1 
ATOM   1654  C CE2 . PHE B 2 129 ? 191.414 2.688    54.062  1.00 135.66 ? 129 PHE B CE2 1 
ATOM   1655  C CZ  . PHE B 2 129 ? 191.966 2.991    52.826  1.00 135.46 ? 129 PHE B CZ  1 
ATOM   1656  N N   . THR B 2 130 ? 191.272 -1.479   55.292  1.00 120.11 ? 130 THR B N   1 
ATOM   1657  C CA  . THR B 2 130 ? 192.389 -1.398   56.244  1.00 118.57 ? 130 THR B CA  1 
ATOM   1658  C C   . THR B 2 130 ? 193.114 -2.728   56.466  1.00 118.89 ? 130 THR B C   1 
ATOM   1659  O O   . THR B 2 130 ? 194.267 -2.743   56.897  1.00 119.98 ? 130 THR B O   1 
ATOM   1660  C CB  . THR B 2 130 ? 191.952 -0.812   57.606  1.00 116.77 ? 130 THR B CB  1 
ATOM   1661  O OG1 . THR B 2 130 ? 190.613 -1.225   57.906  1.00 115.69 ? 130 THR B OG1 1 
ATOM   1662  C CG2 . THR B 2 130 ? 192.012 0.707    57.579  1.00 115.31 ? 130 THR B CG2 1 
ATOM   1663  N N   . GLY B 2 131 ? 192.435 -3.835   56.170  1.00 117.99 ? 131 GLY B N   1 
ATOM   1664  C CA  . GLY B 2 131 ? 193.037 -5.165   56.249  1.00 114.99 ? 131 GLY B CA  1 
ATOM   1665  C C   . GLY B 2 131 ? 194.076 -5.400   55.169  1.00 112.56 ? 131 GLY B C   1 
ATOM   1666  O O   . GLY B 2 131 ? 195.139 -5.968   55.431  1.00 111.18 ? 131 GLY B O   1 
ATOM   1667  N N   . SER B 2 132 ? 193.758 -4.946   53.959  1.00 111.00 ? 132 SER B N   1 
ATOM   1668  C CA  . SER B 2 132 ? 194.618 -5.115   52.790  1.00 109.05 ? 132 SER B CA  1 
ATOM   1669  C C   . SER B 2 132 ? 195.807 -4.157   52.768  1.00 107.37 ? 132 SER B C   1 
ATOM   1670  O O   . SER B 2 132 ? 196.778 -4.393   52.047  1.00 106.73 ? 132 SER B O   1 
ATOM   1671  C CB  . SER B 2 132 ? 193.799 -4.955   51.512  1.00 109.44 ? 132 SER B CB  1 
ATOM   1672  O OG  . SER B 2 132 ? 193.151 -6.162   51.153  1.00 110.02 ? 132 SER B OG  1 
ATOM   1673  N N   . LEU B 2 133 ? 195.722 -3.078   53.545  1.00 105.88 ? 133 LEU B N   1 
ATOM   1674  C CA  . LEU B 2 133 ? 196.814 -2.110   53.657  1.00 104.66 ? 133 LEU B CA  1 
ATOM   1675  C C   . LEU B 2 133 ? 197.818 -2.545   54.725  1.00 105.06 ? 133 LEU B C   1 
ATOM   1676  O O   . LEU B 2 133 ? 199.014 -2.259   54.617  1.00 103.84 ? 133 LEU B O   1 
ATOM   1677  C CB  . LEU B 2 133 ? 196.287 -0.704   53.971  1.00 103.23 ? 133 LEU B CB  1 
ATOM   1678  C CG  . LEU B 2 133 ? 194.891 -0.244   53.531  1.00 101.84 ? 133 LEU B CG  1 
ATOM   1679  C CD1 . LEU B 2 133 ? 194.565 1.068    54.222  1.00 101.63 ? 133 LEU B CD1 1 
ATOM   1680  C CD2 . LEU B 2 133 ? 194.726 -0.113   52.022  1.00 100.50 ? 133 LEU B CD2 1 
ATOM   1681  N N   . ILE B 2 134 ? 197.320 -3.221   55.762  1.00 106.06 ? 134 ILE B N   1 
ATOM   1682  C CA  . ILE B 2 134 ? 198.174 -3.866   56.761  1.00 106.43 ? 134 ILE B CA  1 
ATOM   1683  C C   . ILE B 2 134 ? 198.837 -5.081   56.114  1.00 106.77 ? 134 ILE B C   1 
ATOM   1684  O O   . ILE B 2 134 ? 200.021 -5.346   56.336  1.00 106.53 ? 134 ILE B O   1 
ATOM   1685  C CB  . ILE B 2 134 ? 197.384 -4.292   58.026  1.00 106.12 ? 134 ILE B CB  1 
ATOM   1686  C CG1 . ILE B 2 134 ? 196.722 -3.088   58.722  1.00 106.21 ? 134 ILE B CG1 1 
ATOM   1687  C CG2 . ILE B 2 134 ? 198.267 -5.075   58.994  1.00 105.73 ? 134 ILE B CG2 1 
ATOM   1688  C CD1 . ILE B 2 134 ? 197.662 -1.986   59.175  1.00 106.41 ? 134 ILE B CD1 1 
ATOM   1689  N N   . ALA B 2 135 ? 198.063 -5.806   55.305  1.00 107.55 ? 135 ALA B N   1 
ATOM   1690  C CA  . ALA B 2 135 ? 198.583 -6.895   54.481  1.00 108.74 ? 135 ALA B CA  1 
ATOM   1691  C C   . ALA B 2 135 ? 199.603 -6.372   53.475  1.00 109.28 ? 135 ALA B C   1 
ATOM   1692  O O   . ALA B 2 135 ? 200.592 -7.044   53.170  1.00 109.91 ? 135 ALA B O   1 
ATOM   1693  C CB  . ALA B 2 135 ? 197.447 -7.605   53.761  1.00 109.18 ? 135 ALA B CB  1 
ATOM   1694  N N   . PHE B 2 136 ? 199.346 -5.169   52.966  1.00 109.32 ? 136 PHE B N   1 
ATOM   1695  C CA  . PHE B 2 136 ? 200.255 -4.480   52.058  1.00 109.11 ? 136 PHE B CA  1 
ATOM   1696  C C   . PHE B 2 136 ? 201.569 -4.119   52.748  1.00 107.64 ? 136 PHE B C   1 
ATOM   1697  O O   . PHE B 2 136 ? 202.642 -4.242   52.157  1.00 107.83 ? 136 PHE B O   1 
ATOM   1698  C CB  . PHE B 2 136 ? 199.581 -3.222   51.497  1.00 110.36 ? 136 PHE B CB  1 
ATOM   1699  C CG  . PHE B 2 136 ? 200.537 -2.219   50.921  1.00 111.82 ? 136 PHE B CG  1 
ATOM   1700  C CD1 . PHE B 2 136 ? 200.984 -2.341   49.610  1.00 113.08 ? 136 PHE B CD1 1 
ATOM   1701  C CD2 . PHE B 2 136 ? 200.990 -1.150   51.688  1.00 111.70 ? 136 PHE B CD2 1 
ATOM   1702  C CE1 . PHE B 2 136 ? 201.868 -1.418   49.074  1.00 113.76 ? 136 PHE B CE1 1 
ATOM   1703  C CE2 . PHE B 2 136 ? 201.875 -0.225   51.159  1.00 112.89 ? 136 PHE B CE2 1 
ATOM   1704  C CZ  . PHE B 2 136 ? 202.314 -0.359   49.849  1.00 113.72 ? 136 PHE B CZ  1 
ATOM   1705  N N   . ALA B 2 137 ? 201.472 -3.678   53.998  1.00 105.85 ? 137 ALA B N   1 
ATOM   1706  C CA  . ALA B 2 137 ? 202.629 -3.186   54.737  1.00 105.49 ? 137 ALA B CA  1 
ATOM   1707  C C   . ALA B 2 137 ? 203.588 -4.285   55.211  1.00 106.73 ? 137 ALA B C   1 
ATOM   1708  O O   . ALA B 2 137 ? 204.768 -4.016   55.442  1.00 107.76 ? 137 ALA B O   1 
ATOM   1709  C CB  . ALA B 2 137 ? 202.175 -2.325   55.904  1.00 104.13 ? 137 ALA B CB  1 
ATOM   1710  N N   . LYS B 2 138 ? 203.087 -5.514   55.341  1.00 107.72 ? 138 LYS B N   1 
ATOM   1711  C CA  . LYS B 2 138 ? 203.887 -6.633   55.864  1.00 108.92 ? 138 LYS B CA  1 
ATOM   1712  C C   . LYS B 2 138 ? 204.877 -7.226   54.857  1.00 111.38 ? 138 LYS B C   1 
ATOM   1713  O O   . LYS B 2 138 ? 205.994 -7.600   55.225  1.00 110.56 ? 138 LYS B O   1 
ATOM   1714  C CB  . LYS B 2 138 ? 202.988 -7.734   56.438  1.00 107.03 ? 138 LYS B CB  1 
ATOM   1715  C CG  . LYS B 2 138 ? 202.355 -7.382   57.776  1.00 104.89 ? 138 LYS B CG  1 
ATOM   1716  C CD  . LYS B 2 138 ? 201.817 -8.616   58.483  1.00 102.73 ? 138 LYS B CD  1 
ATOM   1717  C CE  . LYS B 2 138 ? 201.206 -8.253   59.826  1.00 100.95 ? 138 LYS B CE  1 
ATOM   1718  N NZ  . LYS B 2 138 ? 200.900 -9.462   60.636  1.00 100.16 ? 138 LYS B NZ  1 
ATOM   1719  N N   . LEU B 2 139 ? 204.462 -7.318   53.595  1.00 115.42 ? 139 LEU B N   1 
ATOM   1720  C CA  . LEU B 2 139 ? 205.327 -7.830   52.531  1.00 120.26 ? 139 LEU B CA  1 
ATOM   1721  C C   . LEU B 2 139 ? 206.379 -6.805   52.092  1.00 127.38 ? 139 LEU B C   1 
ATOM   1722  O O   . LEU B 2 139 ? 207.452 -7.181   51.614  1.00 127.96 ? 139 LEU B O   1 
ATOM   1723  C CB  . LEU B 2 139 ? 204.493 -8.298   51.332  1.00 117.31 ? 139 LEU B CB  1 
ATOM   1724  C CG  . LEU B 2 139 ? 203.776 -9.650   51.435  1.00 114.77 ? 139 LEU B CG  1 
ATOM   1725  C CD1 . LEU B 2 139 ? 202.548 -9.686   50.537  1.00 113.91 ? 139 LEU B CD1 1 
ATOM   1726  C CD2 . LEU B 2 139 ? 204.714 -10.804  51.110  1.00 113.56 ? 139 LEU B CD2 1 
ATOM   1727  N N   . GLN B 2 140 ? 206.065 -5.520   52.266  1.00 136.86 ? 140 GLN B N   1 
ATOM   1728  C CA  . GLN B 2 140 ? 206.968 -4.419   51.897  1.00 145.25 ? 140 GLN B CA  1 
ATOM   1729  C C   . GLN B 2 140 ? 208.113 -4.198   52.887  1.00 151.21 ? 140 GLN B C   1 
ATOM   1730  O O   . GLN B 2 140 ? 209.132 -3.594   52.540  1.00 150.73 ? 140 GLN B O   1 
ATOM   1731  C CB  . GLN B 2 140 ? 206.184 -3.114   51.715  1.00 145.13 ? 140 GLN B CB  1 
ATOM   1732  C CG  . GLN B 2 140 ? 205.906 -2.734   50.265  1.00 144.41 ? 140 GLN B CG  1 
ATOM   1733  C CD  . GLN B 2 140 ? 207.110 -2.126   49.558  1.00 143.65 ? 140 GLN B CD  1 
ATOM   1734  O OE1 . GLN B 2 140 ? 207.371 -2.426   48.392  1.00 143.73 ? 140 GLN B OE1 1 
ATOM   1735  N NE2 . GLN B 2 140 ? 207.846 -1.265   50.259  1.00 141.77 ? 140 GLN B NE2 1 
ATOM   1736  N N   . GLY B 2 141 ? 207.939 -4.678   54.116  1.00 158.71 ? 141 GLY B N   1 
ATOM   1737  C CA  . GLY B 2 141 ? 208.954 -4.527   55.155  1.00 168.49 ? 141 GLY B CA  1 
ATOM   1738  C C   . GLY B 2 141 ? 208.794 -3.274   55.998  1.00 176.36 ? 141 GLY B C   1 
ATOM   1739  O O   . GLY B 2 141 ? 209.602 -3.018   56.893  1.00 178.22 ? 141 GLY B O   1 
ATOM   1740  N N   . ILE B 2 142 ? 207.752 -2.494   55.711  1.00 182.93 ? 142 ILE B N   1 
ATOM   1741  C CA  . ILE B 2 142 ? 207.425 -1.299   56.492  1.00 189.77 ? 142 ILE B CA  1 
ATOM   1742  C C   . ILE B 2 142 ? 206.877 -1.706   57.864  1.00 199.81 ? 142 ILE B C   1 
ATOM   1743  O O   . ILE B 2 142 ? 206.913 -0.925   58.820  1.00 202.03 ? 142 ILE B O   1 
ATOM   1744  C CB  . ILE B 2 142 ? 206.404 -0.400   55.754  1.00 185.18 ? 142 ILE B CB  1 
ATOM   1745  C CG1 . ILE B 2 142 ? 206.760 -0.288   54.266  1.00 181.75 ? 142 ILE B CG1 1 
ATOM   1746  C CG2 . ILE B 2 142 ? 206.343 0.984    56.392  1.00 184.24 ? 142 ILE B CG2 1 
ATOM   1747  C CD1 . ILE B 2 142 ? 205.612 0.154    53.383  1.00 181.12 ? 142 ILE B CD1 1 
ATOM   1748  N N   . MET B 2 143 ? 206.395 -2.945   57.949  1.00 211.37 ? 143 MET B N   1 
ATOM   1749  C CA  . MET B 2 143 ? 205.761 -3.470   59.152  1.00 217.74 ? 143 MET B CA  1 
ATOM   1750  C C   . MET B 2 143 ? 206.251 -4.904   59.406  1.00 209.42 ? 143 MET B C   1 
ATOM   1751  O O   . MET B 2 143 ? 206.663 -5.596   58.470  1.00 207.97 ? 143 MET B O   1 
ATOM   1752  C CB  . MET B 2 143 ? 204.239 -3.424   58.974  1.00 233.22 ? 143 MET B CB  1 
ATOM   1753  C CG  . MET B 2 143 ? 203.499 -2.609   60.028  1.00 245.58 ? 143 MET B CG  1 
ATOM   1754  S SD  . MET B 2 143 ? 202.097 -1.667   59.377  1.00 251.83 ? 143 MET B SD  1 
ATOM   1755  C CE  . MET B 2 143 ? 202.906 -0.169   58.816  1.00 244.93 ? 143 MET B CE  1 
ATOM   1756  N N   . LYS B 2 144 ? 206.219 -5.338   60.667  1.00 199.56 ? 144 LYS B N   1 
ATOM   1757  C CA  . LYS B 2 144 ? 206.700 -6.670   61.048  1.00 191.17 ? 144 LYS B CA  1 
ATOM   1758  C C   . LYS B 2 144 ? 205.920 -7.782   60.344  1.00 185.71 ? 144 LYS B C   1 
ATOM   1759  O O   . LYS B 2 144 ? 204.710 -7.930   60.539  1.00 181.87 ? 144 LYS B O   1 
ATOM   1760  C CB  . LYS B 2 144 ? 206.653 -6.857   62.568  1.00 193.20 ? 144 LYS B CB  1 
ATOM   1761  C CG  . LYS B 2 144 ? 207.342 -8.122   63.056  1.00 197.59 ? 144 LYS B CG  1 
ATOM   1762  C CD  . LYS B 2 144 ? 207.184 -8.302   64.556  1.00 202.50 ? 144 LYS B CD  1 
ATOM   1763  C CE  . LYS B 2 144 ? 207.860 -9.581   65.026  1.00 206.52 ? 144 LYS B CE  1 
ATOM   1764  N NZ  . LYS B 2 144 ? 207.790 -9.733   66.506  1.00 209.38 ? 144 LYS B NZ  1 
ATOM   1765  N N   . SER B 2 145 ? 206.632 -8.554   59.525  1.00 182.34 ? 145 SER B N   1 
ATOM   1766  C CA  . SER B 2 145 ? 206.034 -9.615   58.715  1.00 182.22 ? 145 SER B CA  1 
ATOM   1767  C C   . SER B 2 145 ? 205.512 -10.772  59.564  1.00 185.03 ? 145 SER B C   1 
ATOM   1768  O O   . SER B 2 145 ? 204.403 -11.259  59.339  1.00 185.30 ? 145 SER B O   1 
ATOM   1769  C CB  . SER B 2 145 ? 207.039 -10.129  57.681  1.00 179.72 ? 145 SER B CB  1 
ATOM   1770  O OG  . SER B 2 145 ? 207.497 -9.077   56.848  1.00 176.60 ? 145 SER B OG  1 
ATOM   1771  N N   . ARG B 2 146 ? 206.317 -11.197  60.537  1.00 188.97 ? 146 ARG B N   1 
ATOM   1772  C CA  . ARG B 2 146 ? 205.951 -12.271  61.464  1.00 194.27 ? 146 ARG B CA  1 
ATOM   1773  C C   . ARG B 2 146 ? 204.671 -11.915  62.240  1.00 205.14 ? 146 ARG B C   1 
ATOM   1774  O O   . ARG B 2 146 ? 204.401 -10.731  62.464  1.00 204.99 ? 146 ARG B O   1 
ATOM   1775  C CB  . ARG B 2 146 ? 207.112 -12.553  62.432  1.00 187.53 ? 146 ARG B CB  1 
ATOM   1776  C CG  . ARG B 2 146 ? 208.402 -13.039  61.773  1.00 179.97 ? 146 ARG B CG  1 
ATOM   1777  C CD  . ARG B 2 146 ? 208.542 -14.558  61.783  1.00 175.96 ? 146 ARG B CD  1 
ATOM   1778  N NE  . ARG B 2 146 ? 207.483 -15.234  61.032  1.00 174.95 ? 146 ARG B NE  1 
ATOM   1779  C CZ  . ARG B 2 146 ? 207.529 -15.507  59.729  1.00 174.20 ? 146 ARG B CZ  1 
ATOM   1780  N NH1 . ARG B 2 146 ? 208.590 -15.172  59.004  1.00 172.70 ? 146 ARG B NH1 1 
ATOM   1781  N NH2 . ARG B 2 146 ? 206.509 -16.126  59.150  1.00 174.79 ? 146 ARG B NH2 1 
ATOM   1782  N N   . PRO B 2 147 ? 203.874 -12.935  62.633  1.00 216.15 ? 147 PRO B N   1 
ATOM   1783  C CA  . PRO B 2 147 ? 202.629 -12.719  63.387  1.00 222.78 ? 147 PRO B CA  1 
ATOM   1784  C C   . PRO B 2 147 ? 202.823 -11.834  64.623  1.00 227.76 ? 147 PRO B C   1 
ATOM   1785  O O   . PRO B 2 147 ? 203.744 -12.068  65.409  1.00 234.10 ? 147 PRO B O   1 
ATOM   1786  C CB  . PRO B 2 147 ? 202.233 -14.135  63.811  1.00 223.53 ? 147 PRO B CB  1 
ATOM   1787  C CG  . PRO B 2 147 ? 202.789 -15.008  62.742  1.00 222.58 ? 147 PRO B CG  1 
ATOM   1788  C CD  . PRO B 2 147 ? 204.087 -14.366  62.337  1.00 220.06 ? 147 PRO B CD  1 
ATOM   1789  N N   . ILE B 2 148 ? 201.963 -10.827  64.779  1.00 228.16 ? 148 ILE B N   1 
ATOM   1790  C CA  . ILE B 2 148 ? 202.072 -9.869   65.886  1.00 227.14 ? 148 ILE B CA  1 
ATOM   1791  C C   . ILE B 2 148 ? 201.009 -10.133  66.959  1.00 237.91 ? 148 ILE B C   1 
ATOM   1792  O O   . ILE B 2 148 ? 199.826 -9.840   66.761  1.00 242.85 ? 148 ILE B O   1 
ATOM   1793  C CB  . ILE B 2 148 ? 201.983 -8.405   65.390  1.00 215.54 ? 148 ILE B CB  1 
ATOM   1794  C CG1 . ILE B 2 148 ? 202.835 -8.208   64.131  1.00 209.23 ? 148 ILE B CG1 1 
ATOM   1795  C CG2 . ILE B 2 148 ? 202.414 -7.441   66.490  1.00 210.27 ? 148 ILE B CG2 1 
ATOM   1796  C CD1 . ILE B 2 148 ? 202.354 -7.098   63.222  1.00 204.92 ? 148 ILE B CD1 1 
ATOM   1797  N N   . LEU B 2 149 ? 201.446 -10.688  68.091  1.00 246.31 ? 149 LEU B N   1 
ATOM   1798  C CA  . LEU B 2 149 ? 200.552 -11.047  69.200  1.00 250.22 ? 149 LEU B CA  1 
ATOM   1799  C C   . LEU B 2 149 ? 200.677 -10.107  70.405  1.00 254.15 ? 149 LEU B C   1 
ATOM   1800  O O   . LEU B 2 149 ? 201.744 -9.538   70.657  1.00 256.53 ? 149 LEU B O   1 
ATOM   1801  C CB  . LEU B 2 149 ? 200.803 -12.495  69.661  1.00 243.91 ? 149 LEU B CB  1 
ATOM   1802  C CG  . LEU B 2 149 ? 200.210 -13.685  68.896  1.00 237.84 ? 149 LEU B CG  1 
ATOM   1803  C CD1 . LEU B 2 149 ? 201.105 -14.094  67.731  1.00 236.66 ? 149 LEU B CD1 1 
ATOM   1804  C CD2 . LEU B 2 149 ? 200.002 -14.864  69.838  1.00 231.24 ? 149 LEU B CD2 1 
ATOM   1805  N N   . PHE B 2 150 ? 199.570 -9.949   71.130  1.00 254.16 ? 150 PHE B N   1 
ATOM   1806  C CA  . PHE B 2 150 ? 199.551 -9.287   72.439  1.00 250.23 ? 150 PHE B CA  1 
ATOM   1807  C C   . PHE B 2 150 ? 198.571 -10.019  73.368  1.00 256.94 ? 150 PHE B C   1 
ATOM   1808  O O   . PHE B 2 150 ? 197.527 -10.488  72.906  1.00 262.44 ? 150 PHE B O   1 
ATOM   1809  C CB  . PHE B 2 150 ? 199.232 -7.784   72.316  1.00 238.12 ? 150 PHE B CB  1 
ATOM   1810  C CG  . PHE B 2 150 ? 197.832 -7.480   71.846  1.00 227.78 ? 150 PHE B CG  1 
ATOM   1811  C CD1 . PHE B 2 150 ? 197.526 -7.454   70.488  1.00 223.69 ? 150 PHE B CD1 1 
ATOM   1812  C CD2 . PHE B 2 150 ? 196.824 -7.188   72.761  1.00 221.36 ? 150 PHE B CD2 1 
ATOM   1813  C CE1 . PHE B 2 150 ? 196.240 -7.164   70.053  1.00 217.00 ? 150 PHE B CE1 1 
ATOM   1814  C CE2 . PHE B 2 150 ? 195.536 -6.898   72.332  1.00 215.60 ? 150 PHE B CE2 1 
ATOM   1815  C CZ  . PHE B 2 150 ? 195.244 -6.885   70.977  1.00 214.02 ? 150 PHE B CZ  1 
ATOM   1816  N N   . PRO B 2 151 ? 198.902 -10.121  74.676  1.00 259.63 ? 151 PRO B N   1 
ATOM   1817  C CA  . PRO B 2 151 ? 198.186 -11.001  75.617  1.00 264.86 ? 151 PRO B CA  1 
ATOM   1818  C C   . PRO B 2 151 ? 196.660 -10.860  75.606  1.00 273.88 ? 151 PRO B C   1 
ATOM   1819  O O   . PRO B 2 151 ? 196.130 -9.796   75.938  1.00 278.02 ? 151 PRO B O   1 
ATOM   1820  C CB  . PRO B 2 151 ? 198.757 -10.599  76.988  1.00 259.22 ? 151 PRO B CB  1 
ATOM   1821  C CG  . PRO B 2 151 ? 199.412 -9.275   76.773  1.00 255.11 ? 151 PRO B CG  1 
ATOM   1822  C CD  . PRO B 2 151 ? 199.930 -9.325   75.369  1.00 255.45 ? 151 PRO B CD  1 
ATOM   1823  N N   . GLY B 2 152 ? 195.976 -11.936  75.219  1.00 280.90 ? 152 GLY B N   1 
ATOM   1824  C CA  . GLY B 2 152 ? 194.514 -11.980  75.182  1.00 287.88 ? 152 GLY B CA  1 
ATOM   1825  C C   . GLY B 2 152 ? 193.893 -11.154  74.069  1.00 294.08 ? 152 GLY B C   1 
ATOM   1826  O O   . GLY B 2 152 ? 193.081 -10.263  74.331  1.00 283.61 ? 152 GLY B O   1 
ATOM   1827  N N   . GLN B 2 153 ? 194.268 -11.456  72.825  1.00 298.54 ? 153 GLN B N   1 
ATOM   1828  C CA  . GLN B 2 153 ? 193.758 -10.727  71.657  1.00 298.37 ? 153 GLN B CA  1 
ATOM   1829  C C   . GLN B 2 153 ? 192.522 -11.371  71.012  1.00 293.60 ? 153 GLN B C   1 
ATOM   1830  O O   . GLN B 2 153 ? 191.869 -10.751  70.165  1.00 302.61 ? 153 GLN B O   1 
ATOM   1831  C CB  . GLN B 2 153 ? 194.862 -10.511  70.610  1.00 290.27 ? 153 GLN B CB  1 
ATOM   1832  C CG  . GLN B 2 153 ? 195.293 -11.763  69.858  1.00 282.33 ? 153 GLN B CG  1 
ATOM   1833  C CD  . GLN B 2 153 ? 195.853 -11.458  68.480  1.00 275.47 ? 153 GLN B CD  1 
ATOM   1834  O OE1 . GLN B 2 153 ? 195.282 -10.673  67.720  1.00 269.67 ? 153 GLN B OE1 1 
ATOM   1835  N NE2 . GLN B 2 153 ? 196.970 -12.094  68.145  1.00 273.50 ? 153 GLN B NE2 1 
ATOM   1836  N N   . LYS B 2 154 ? 192.212 -12.608  71.410  1.00 279.38 ? 154 LYS B N   1 
ATOM   1837  C CA  . LYS B 2 154 ? 191.017 -13.322  70.930  1.00 277.35 ? 154 LYS B CA  1 
ATOM   1838  C C   . LYS B 2 154 ? 189.732 -12.758  71.561  1.00 280.17 ? 154 LYS B C   1 
ATOM   1839  O O   . LYS B 2 154 ? 188.623 -13.059  71.108  1.00 289.86 ? 154 LYS B O   1 
ATOM   1840  C CB  . LYS B 2 154 ? 191.134 -14.838  71.180  1.00 259.29 ? 154 LYS B CB  1 
ATOM   1841  C CG  . LYS B 2 154 ? 190.202 -15.699  70.326  1.00 232.49 ? 154 LYS B CG  1 
ATOM   1842  C CD  . LYS B 2 154 ? 190.115 -17.141  70.813  1.00 207.68 ? 154 LYS B CD  1 
ATOM   1843  C CE  . LYS B 2 154 ? 191.162 -18.030  70.155  1.00 194.52 ? 154 LYS B CE  1 
ATOM   1844  N NZ  . LYS B 2 154 ? 190.945 -19.468  70.476  1.00 180.79 ? 154 LYS B NZ  1 
ATOM   1845  N N   . ALA B 2 155 ? 189.897 -11.943  72.606  1.00 262.06 ? 155 ALA B N   1 
ATOM   1846  C CA  . ALA B 2 155 ? 188.786 -11.238  73.254  1.00 236.66 ? 155 ALA B CA  1 
ATOM   1847  C C   . ALA B 2 155 ? 188.811 -9.725   72.974  1.00 219.68 ? 155 ALA B C   1 
ATOM   1848  O O   . ALA B 2 155 ? 187.912 -8.994   73.398  1.00 217.14 ? 155 ALA B O   1 
ATOM   1849  C CB  . ALA B 2 155 ? 188.782 -11.512  74.753  1.00 233.26 ? 155 ALA B CB  1 
ATOM   1850  N N   . VAL B 2 156 ? 189.846 -9.270   72.265  1.00 199.63 ? 156 VAL B N   1 
ATOM   1851  C CA  . VAL B 2 156 ? 189.953 -7.878   71.809  1.00 181.34 ? 156 VAL B CA  1 
ATOM   1852  C C   . VAL B 2 156 ? 189.381 -7.739   70.394  1.00 179.31 ? 156 VAL B C   1 
ATOM   1853  O O   . VAL B 2 156 ? 188.572 -6.845   70.137  1.00 172.09 ? 156 VAL B O   1 
ATOM   1854  C CB  . VAL B 2 156 ? 191.411 -7.362   71.862  1.00 173.54 ? 156 VAL B CB  1 
ATOM   1855  C CG1 . VAL B 2 156 ? 191.547 -6.018   71.158  1.00 167.93 ? 156 VAL B CG1 1 
ATOM   1856  C CG2 . VAL B 2 156 ? 191.884 -7.250   73.303  1.00 170.51 ? 156 VAL B CG2 1 
ATOM   1857  N N   . ASN B 2 157 ? 189.810 -8.625   69.492  1.00 181.22 ? 157 ASN B N   1 
ATOM   1858  C CA  . ASN B 2 157 ? 189.252 -8.729   68.138  1.00 182.36 ? 157 ASN B CA  1 
ATOM   1859  C C   . ASN B 2 157 ? 187.741 -8.965   68.156  1.00 185.76 ? 157 ASN B C   1 
ATOM   1860  O O   . ASN B 2 157 ? 186.989 -8.266   67.474  1.00 190.41 ? 157 ASN B O   1 
ATOM   1861  C CB  . ASN B 2 157 ? 189.919 -9.872   67.352  1.00 175.84 ? 157 ASN B CB  1 
ATOM   1862  C CG  . ASN B 2 157 ? 191.352 -9.567   66.942  1.00 170.70 ? 157 ASN B CG  1 
ATOM   1863  O OD1 . ASN B 2 157 ? 191.981 -8.637   67.449  1.00 169.56 ? 157 ASN B OD1 1 
ATOM   1864  N ND2 . ASN B 2 157 ? 191.878 -10.368  66.018  1.00 164.25 ? 157 ASN B ND2 1 
ATOM   1865  N N   . ALA B 2 158 ? 187.313 -9.944   68.955  1.00 185.40 ? 158 ALA B N   1 
ATOM   1866  C CA  . ALA B 2 158 ? 185.918 -10.397  68.997  1.00 178.54 ? 158 ALA B CA  1 
ATOM   1867  C C   . ALA B 2 158 ? 184.947 -9.438   69.697  1.00 171.19 ? 158 ALA B C   1 
ATOM   1868  O O   . ALA B 2 158 ? 183.733 -9.545   69.507  1.00 172.02 ? 158 ALA B O   1 
ATOM   1869  C CB  . ALA B 2 158 ? 185.830 -11.789  69.612  1.00 180.26 ? 158 ALA B CB  1 
ATOM   1870  N N   . LEU B 2 159 ? 185.471 -8.519   70.509  1.00 158.92 ? 159 LEU B N   1 
ATOM   1871  C CA  . LEU B 2 159 ? 184.634 -7.500   71.151  1.00 145.82 ? 159 LEU B CA  1 
ATOM   1872  C C   . LEU B 2 159 ? 184.704 -6.141   70.441  1.00 138.12 ? 159 LEU B C   1 
ATOM   1873  O O   . LEU B 2 159 ? 183.788 -5.327   70.572  1.00 137.45 ? 159 LEU B O   1 
ATOM   1874  C CB  . LEU B 2 159 ? 184.933 -7.380   72.655  1.00 143.84 ? 159 LEU B CB  1 
ATOM   1875  C CG  . LEU B 2 159 ? 184.321 -8.447   73.582  1.00 141.64 ? 159 LEU B CG  1 
ATOM   1876  C CD1 . LEU B 2 159 ? 184.954 -8.412   74.966  1.00 141.03 ? 159 LEU B CD1 1 
ATOM   1877  C CD2 . LEU B 2 159 ? 182.805 -8.323   73.690  1.00 138.52 ? 159 LEU B CD2 1 
ATOM   1878  N N   . VAL B 2 160 ? 185.784 -5.903   69.692  1.00 129.08 ? 160 VAL B N   1 
ATOM   1879  C CA  . VAL B 2 160 ? 185.861 -4.754   68.783  1.00 124.04 ? 160 VAL B CA  1 
ATOM   1880  C C   . VAL B 2 160 ? 184.871 -4.952   67.638  1.00 131.33 ? 160 VAL B C   1 
ATOM   1881  O O   . VAL B 2 160 ? 184.168 -4.021   67.244  1.00 127.66 ? 160 VAL B O   1 
ATOM   1882  C CB  . VAL B 2 160 ? 187.289 -4.548   68.230  1.00 116.53 ? 160 VAL B CB  1 
ATOM   1883  C CG1 . VAL B 2 160 ? 187.268 -3.786   66.912  1.00 112.69 ? 160 VAL B CG1 1 
ATOM   1884  C CG2 . VAL B 2 160 ? 188.151 -3.823   69.249  1.00 112.81 ? 160 VAL B CG2 1 
ATOM   1885  N N   . LEU B 2 161 ? 184.821 -6.179   67.124  1.00 146.02 ? 161 LEU B N   1 
ATOM   1886  C CA  . LEU B 2 161 ? 183.895 -6.556   66.060  1.00 164.07 ? 161 LEU B CA  1 
ATOM   1887  C C   . LEU B 2 161 ? 182.450 -6.623   66.560  1.00 170.97 ? 161 LEU B C   1 
ATOM   1888  O O   . LEU B 2 161 ? 181.539 -6.144   65.882  1.00 173.21 ? 161 LEU B O   1 
ATOM   1889  C CB  . LEU B 2 161 ? 184.310 -7.901   65.447  1.00 174.28 ? 161 LEU B CB  1 
ATOM   1890  C CG  . LEU B 2 161 ? 183.453 -8.529   64.341  1.00 181.80 ? 161 LEU B CG  1 
ATOM   1891  C CD1 . LEU B 2 161 ? 183.526 -7.730   63.045  1.00 183.32 ? 161 LEU B CD1 1 
ATOM   1892  C CD2 . LEU B 2 161 ? 183.873 -9.973   64.107  1.00 187.06 ? 161 LEU B CD2 1 
ATOM   1893  N N   . ALA B 2 162 ? 182.253 -7.216   67.740  1.00 178.21 ? 162 ALA B N   1 
ATOM   1894  C CA  . ALA B 2 162 ? 180.920 -7.365   68.344  1.00 182.92 ? 162 ALA B CA  1 
ATOM   1895  C C   . ALA B 2 162 ? 180.217 -6.025   68.542  1.00 184.98 ? 162 ALA B C   1 
ATOM   1896  O O   . ALA B 2 162 ? 178.987 -5.951   68.493  1.00 188.71 ? 162 ALA B O   1 
ATOM   1897  C CB  . ALA B 2 162 ? 181.006 -8.118   69.665  1.00 182.67 ? 162 ALA B CB  1 
ATOM   1898  N N   . LEU B 2 163 ? 181.004 -4.974   68.769  1.00 182.96 ? 163 LEU B N   1 
ATOM   1899  C CA  . LEU B 2 163 ? 180.473 -3.617   68.839  1.00 177.75 ? 163 LEU B CA  1 
ATOM   1900  C C   . LEU B 2 163 ? 180.280 -3.054   67.435  1.00 173.60 ? 163 LEU B C   1 
ATOM   1901  O O   . LEU B 2 163 ? 179.246 -2.454   67.153  1.00 173.60 ? 163 LEU B O   1 
ATOM   1902  C CB  . LEU B 2 163 ? 181.389 -2.699   69.651  1.00 177.71 ? 163 LEU B CB  1 
ATOM   1903  C CG  . LEU B 2 163 ? 180.782 -1.609   70.552  1.00 176.59 ? 163 LEU B CG  1 
ATOM   1904  C CD1 . LEU B 2 163 ? 181.745 -0.436   70.634  1.00 178.54 ? 163 LEU B CD1 1 
ATOM   1905  C CD2 . LEU B 2 163 ? 179.407 -1.111   70.117  1.00 174.00 ? 163 LEU B CD2 1 
ATOM   1906  N N   . THR B 2 164 ? 181.270 -3.258   66.561  1.00 168.01 ? 164 THR B N   1 
ATOM   1907  C CA  . THR B 2 164 ? 181.180 -2.847   65.154  1.00 163.92 ? 164 THR B CA  1 
ATOM   1908  C C   . THR B 2 164 ? 179.876 -3.351   64.514  1.00 169.84 ? 164 THR B C   1 
ATOM   1909  O O   . THR B 2 164 ? 179.328 -2.705   63.621  1.00 169.10 ? 164 THR B O   1 
ATOM   1910  C CB  . THR B 2 164 ? 182.397 -3.334   64.330  1.00 157.57 ? 164 THR B CB  1 
ATOM   1911  O OG1 . THR B 2 164 ? 183.605 -3.115   65.067  1.00 150.90 ? 164 THR B OG1 1 
ATOM   1912  C CG2 . THR B 2 164 ? 182.489 -2.595   62.998  1.00 155.10 ? 164 THR B CG2 1 
ATOM   1913  N N   . VAL B 2 165 ? 179.386 -4.495   64.994  1.00 177.33 ? 165 VAL B N   1 
ATOM   1914  C CA  . VAL B 2 165 ? 178.119 -5.080   64.534  1.00 182.69 ? 165 VAL B CA  1 
ATOM   1915  C C   . VAL B 2 165 ? 176.905 -4.424   65.207  1.00 184.24 ? 165 VAL B C   1 
ATOM   1916  O O   . VAL B 2 165 ? 175.999 -3.947   64.519  1.00 186.28 ? 165 VAL B O   1 
ATOM   1917  C CB  . VAL B 2 165 ? 178.088 -6.619   64.730  1.00 183.48 ? 165 VAL B CB  1 
ATOM   1918  C CG1 . VAL B 2 165 ? 176.706 -7.188   64.430  1.00 183.52 ? 165 VAL B CG1 1 
ATOM   1919  C CG2 . VAL B 2 165 ? 179.133 -7.293   63.852  1.00 183.63 ? 165 VAL B CG2 1 
ATOM   1920  N N   . VAL B 2 166 ? 176.894 -4.399   66.542  1.00 183.48 ? 166 VAL B N   1 
ATOM   1921  C CA  . VAL B 2 166 ? 175.789 -3.809   67.314  1.00 181.47 ? 166 VAL B CA  1 
ATOM   1922  C C   . VAL B 2 166 ? 175.600 -2.318   66.993  1.00 186.89 ? 166 VAL B C   1 
ATOM   1923  O O   . VAL B 2 166 ? 174.470 -1.821   66.994  1.00 189.70 ? 166 VAL B O   1 
ATOM   1924  C CB  . VAL B 2 166 ? 175.945 -4.064   68.839  1.00 175.73 ? 166 VAL B CB  1 
ATOM   1925  C CG1 . VAL B 2 166 ? 174.951 -3.244   69.651  1.00 171.84 ? 166 VAL B CG1 1 
ATOM   1926  C CG2 . VAL B 2 166 ? 175.764 -5.544   69.150  1.00 172.04 ? 166 VAL B CG2 1 
ATOM   1927  N N   . ILE B 2 167 ? 176.699 -1.622   66.698  1.00 190.46 ? 167 ILE B N   1 
ATOM   1928  C CA  . ILE B 2 167 ? 176.643 -0.219   66.262  1.00 191.37 ? 167 ILE B CA  1 
ATOM   1929  C C   . ILE B 2 167 ? 176.164 -0.085   64.807  1.00 189.26 ? 167 ILE B C   1 
ATOM   1930  O O   . ILE B 2 167 ? 175.523 0.904    64.450  1.00 190.24 ? 167 ILE B O   1 
ATOM   1931  C CB  . ILE B 2 167 ? 177.984 0.533    66.496  1.00 191.84 ? 167 ILE B CB  1 
ATOM   1932  C CG1 . ILE B 2 167 ? 177.773 2.054    66.451  1.00 193.25 ? 167 ILE B CG1 1 
ATOM   1933  C CG2 . ILE B 2 167 ? 179.057 0.086    65.506  1.00 189.67 ? 167 ILE B CG2 1 
ATOM   1934  C CD1 . ILE B 2 167 ? 178.925 2.865    67.010  1.00 192.73 ? 167 ILE B CD1 1 
ATOM   1935  N N   . GLY B 2 168 ? 176.473 -1.082   63.979  1.00 185.21 ? 168 GLY B N   1 
ATOM   1936  C CA  . GLY B 2 168 ? 176.000 -1.116   62.596  1.00 179.36 ? 168 GLY B CA  1 
ATOM   1937  C C   . GLY B 2 168 ? 174.499 -1.318   62.518  1.00 177.45 ? 168 GLY B C   1 
ATOM   1938  O O   . GLY B 2 168 ? 173.818 -0.689   61.705  1.00 174.42 ? 168 GLY B O   1 
ATOM   1939  N N   . LEU B 2 169 ? 173.990 -2.196   63.381  1.00 177.60 ? 169 LEU B N   1 
ATOM   1940  C CA  . LEU B 2 169 ? 172.559 -2.481   63.476  1.00 177.96 ? 169 LEU B CA  1 
ATOM   1941  C C   . LEU B 2 169 ? 171.749 -1.313   64.049  1.00 179.26 ? 169 LEU B C   1 
ATOM   1942  O O   . LEU B 2 169 ? 170.546 -1.207   63.797  1.00 180.41 ? 169 LEU B O   1 
ATOM   1943  C CB  . LEU B 2 169 ? 172.317 -3.751   64.307  1.00 176.60 ? 169 LEU B CB  1 
ATOM   1944  C CG  . LEU B 2 169 ? 172.262 -5.143   63.650  1.00 175.17 ? 169 LEU B CG  1 
ATOM   1945  C CD1 . LEU B 2 169 ? 171.098 -5.256   62.673  1.00 174.64 ? 169 LEU B CD1 1 
ATOM   1946  C CD2 . LEU B 2 169 ? 173.567 -5.543   62.969  1.00 173.81 ? 169 LEU B CD2 1 
ATOM   1947  N N   . SER B 2 170 ? 172.411 -0.442   64.812  1.00 179.91 ? 170 SER B N   1 
ATOM   1948  C CA  . SER B 2 170 ? 171.755 0.711    65.440  1.00 178.38 ? 170 SER B CA  1 
ATOM   1949  C C   . SER B 2 170 ? 171.341 1.780    64.427  1.00 173.41 ? 170 SER B C   1 
ATOM   1950  O O   . SER B 2 170 ? 170.444 2.581    64.694  1.00 173.81 ? 170 SER B O   1 
ATOM   1951  C CB  . SER B 2 170 ? 172.656 1.328    66.516  1.00 181.87 ? 170 SER B CB  1 
ATOM   1952  O OG  . SER B 2 170 ? 173.712 2.078    65.939  1.00 184.64 ? 170 SER B OG  1 
ATOM   1953  N N   . LEU B 2 171 ? 171.995 1.777    63.268  1.00 167.27 ? 171 LEU B N   1 
ATOM   1954  C CA  . LEU B 2 171 ? 171.730 2.742    62.199  1.00 164.55 ? 171 LEU B CA  1 
ATOM   1955  C C   . LEU B 2 171 ? 170.337 2.585    61.579  1.00 167.34 ? 171 LEU B C   1 
ATOM   1956  O O   . LEU B 2 171 ? 169.887 3.446    60.818  1.00 163.68 ? 171 LEU B O   1 
ATOM   1957  C CB  . LEU B 2 171 ? 172.810 2.631    61.117  1.00 160.86 ? 171 LEU B CB  1 
ATOM   1958  C CG  . LEU B 2 171 ? 174.144 3.383    61.236  1.00 159.86 ? 171 LEU B CG  1 
ATOM   1959  C CD1 . LEU B 2 171 ? 174.740 3.364    62.637  1.00 159.47 ? 171 LEU B CD1 1 
ATOM   1960  C CD2 . LEU B 2 171 ? 175.147 2.830    60.235  1.00 158.58 ? 171 LEU B CD2 1 
ATOM   1961  N N   . LEU B 2 172 ? 169.665 1.485    61.909  1.00 176.22 ? 172 LEU B N   1 
ATOM   1962  C CA  . LEU B 2 172 ? 168.305 1.224    61.441  1.00 188.03 ? 172 LEU B CA  1 
ATOM   1963  C C   . LEU B 2 172 ? 167.295 2.101    62.174  1.00 196.37 ? 172 LEU B C   1 
ATOM   1964  O O   . LEU B 2 172 ? 166.578 2.887    61.547  1.00 193.12 ? 172 LEU B O   1 
ATOM   1965  C CB  . LEU B 2 172 ? 167.943 -0.256   61.616  1.00 190.31 ? 172 LEU B CB  1 
ATOM   1966  C CG  . LEU B 2 172 ? 168.796 -1.317   60.911  1.00 192.99 ? 172 LEU B CG  1 
ATOM   1967  C CD1 . LEU B 2 172 ? 168.494 -2.695   61.478  1.00 194.04 ? 172 LEU B CD1 1 
ATOM   1968  C CD2 . LEU B 2 172 ? 168.585 -1.299   59.403  1.00 196.13 ? 172 LEU B CD2 1 
ATOM   1969  N N   . TRP B 2 173 ? 167.244 1.960    63.498  1.00 213.19 ? 173 TRP B N   1 
ATOM   1970  C CA  . TRP B 2 173 ? 166.364 2.783    64.328  1.00 230.40 ? 173 TRP B CA  1 
ATOM   1971  C C   . TRP B 2 173 ? 166.923 4.186    64.578  1.00 236.57 ? 173 TRP B C   1 
ATOM   1972  O O   . TRP B 2 173 ? 166.166 5.160    64.586  1.00 242.71 ? 173 TRP B O   1 
ATOM   1973  C CB  . TRP B 2 173 ? 165.970 2.084    65.648  1.00 238.97 ? 173 TRP B CB  1 
ATOM   1974  C CG  . TRP B 2 173 ? 167.061 1.310    66.378  1.00 246.45 ? 173 TRP B CG  1 
ATOM   1975  C CD1 . TRP B 2 173 ? 167.565 0.085    66.036  1.00 248.23 ? 173 TRP B CD1 1 
ATOM   1976  C CD2 . TRP B 2 173 ? 167.732 1.691    67.594  1.00 249.23 ? 173 TRP B CD2 1 
ATOM   1977  N NE1 . TRP B 2 173 ? 168.520 -0.308   66.945  1.00 250.36 ? 173 TRP B NE1 1 
ATOM   1978  C CE2 . TRP B 2 173 ? 168.642 0.656    67.911  1.00 249.61 ? 173 TRP B CE2 1 
ATOM   1979  C CE3 . TRP B 2 173 ? 167.660 2.810    68.438  1.00 248.24 ? 173 TRP B CE3 1 
ATOM   1980  C CZ2 . TRP B 2 173 ? 169.477 0.707    69.036  1.00 247.52 ? 173 TRP B CZ2 1 
ATOM   1981  C CZ3 . TRP B 2 173 ? 168.492 2.860    69.559  1.00 244.36 ? 173 TRP B CZ3 1 
ATOM   1982  C CH2 . TRP B 2 173 ? 169.387 1.813    69.845  1.00 244.68 ? 173 TRP B CH2 1 
ATOM   1983  N N   . ASN B 2 174 ? 168.239 4.284    64.764  1.00 238.13 ? 174 ASN B N   1 
ATOM   1984  C CA  . ASN B 2 174 ? 168.894 5.566    65.038  1.00 234.97 ? 174 ASN B CA  1 
ATOM   1985  C C   . ASN B 2 174 ? 170.113 5.807    64.139  1.00 229.64 ? 174 ASN B C   1 
ATOM   1986  O O   . ASN B 2 174 ? 171.240 5.443    64.492  1.00 229.63 ? 174 ASN B O   1 
ATOM   1987  C CB  . ASN B 2 174 ? 169.272 5.666    66.528  1.00 235.82 ? 174 ASN B CB  1 
ATOM   1988  C CG  . ASN B 2 174 ? 169.701 7.068    66.944  1.00 234.30 ? 174 ASN B CG  1 
ATOM   1989  O OD1 . ASN B 2 174 ? 169.377 8.060    66.288  1.00 234.71 ? 174 ASN B OD1 1 
ATOM   1990  N ND2 . ASN B 2 174 ? 170.428 7.152    68.053  1.00 231.61 ? 174 ASN B ND2 1 
ATOM   1991  N N   . ASP B 2 175 ? 169.875 6.410    62.973  1.00 221.33 ? 175 ASP B N   1 
ATOM   1992  C CA  . ASP B 2 175 ? 170.963 6.810    62.075  1.00 213.76 ? 175 ASP B CA  1 
ATOM   1993  C C   . ASP B 2 175 ? 171.386 8.265    62.295  1.00 214.92 ? 175 ASP B C   1 
ATOM   1994  O O   . ASP B 2 175 ? 171.325 9.098    61.383  1.00 210.86 ? 175 ASP B O   1 
ATOM   1995  C CB  . ASP B 2 175 ? 170.641 6.524    60.596  1.00 205.44 ? 175 ASP B CB  1 
ATOM   1996  C CG  . ASP B 2 175 ? 169.269 7.028    60.173  1.00 198.93 ? 175 ASP B CG  1 
ATOM   1997  O OD1 . ASP B 2 175 ? 168.261 6.360    60.486  1.00 193.82 ? 175 ASP B OD1 1 
ATOM   1998  O OD2 . ASP B 2 175 ? 169.200 8.076    59.496  1.00 195.71 ? 175 ASP B OD2 1 
ATOM   1999  N N   . ALA B 2 176 ? 171.804 8.555    63.525  1.00 218.82 ? 176 ALA B N   1 
ATOM   2000  C CA  . ALA B 2 176 ? 172.431 9.826    63.859  1.00 222.36 ? 176 ALA B CA  1 
ATOM   2001  C C   . ALA B 2 176 ? 173.848 9.825    63.298  1.00 223.92 ? 176 ALA B C   1 
ATOM   2002  O O   . ALA B 2 176 ? 174.566 8.827    63.411  1.00 228.15 ? 176 ALA B O   1 
ATOM   2003  C CB  . ALA B 2 176 ? 172.447 10.029   65.366  1.00 223.83 ? 176 ALA B CB  1 
ATOM   2004  N N   . THR B 2 177 ? 174.244 10.943   62.693  1.00 221.29 ? 177 THR B N   1 
ATOM   2005  C CA  . THR B 2 177 ? 175.544 11.052   62.022  1.00 217.08 ? 177 THR B CA  1 
ATOM   2006  C C   . THR B 2 177 ? 176.733 11.158   63.002  1.00 213.79 ? 177 THR B C   1 
ATOM   2007  O O   . THR B 2 177 ? 177.748 11.798   62.704  1.00 214.24 ? 177 THR B O   1 
ATOM   2008  C CB  . THR B 2 177 ? 175.550 12.208   60.991  1.00 216.20 ? 177 THR B CB  1 
ATOM   2009  O OG1 . THR B 2 177 ? 175.106 13.418   61.618  1.00 217.10 ? 177 THR B OG1 1 
ATOM   2010  C CG2 . THR B 2 177 ? 174.622 11.888   59.816  1.00 212.45 ? 177 THR B CG2 1 
ATOM   2011  N N   . ALA B 2 178 ? 176.591 10.512   64.161  1.00 207.30 ? 178 ALA B N   1 
ATOM   2012  C CA  . ALA B 2 178 ? 177.632 10.457   65.190  1.00 199.38 ? 178 ALA B CA  1 
ATOM   2013  C C   . ALA B 2 178 ? 177.919 9.017    65.624  1.00 195.09 ? 178 ALA B C   1 
ATOM   2014  O O   . ALA B 2 178 ? 178.869 8.757    66.368  1.00 190.30 ? 178 ALA B O   1 
ATOM   2015  C CB  . ALA B 2 178 ? 177.236 11.306   66.388  1.00 198.85 ? 178 ALA B CB  1 
ATOM   2016  N N   . SER B 2 179 ? 177.085 8.089    65.162  1.00 195.23 ? 179 SER B N   1 
ATOM   2017  C CA  . SER B 2 179 ? 177.290 6.664    65.407  1.00 198.56 ? 179 SER B CA  1 
ATOM   2018  C C   . SER B 2 179 ? 177.565 5.904    64.102  1.00 204.76 ? 179 SER B C   1 
ATOM   2019  O O   . SER B 2 179 ? 177.567 4.670    64.081  1.00 208.17 ? 179 SER B O   1 
ATOM   2020  C CB  . SER B 2 179 ? 176.090 6.067    66.154  1.00 195.73 ? 179 SER B CB  1 
ATOM   2021  O OG  . SER B 2 179 ? 174.876 6.314    65.467  1.00 195.23 ? 179 SER B OG  1 
ATOM   2022  N N   . ILE B 2 180 ? 177.810 6.654    63.025  1.00 209.28 ? 180 ILE B N   1 
ATOM   2023  C CA  . ILE B 2 180 ? 178.087 6.078    61.702  1.00 210.10 ? 180 ILE B CA  1 
ATOM   2024  C C   . ILE B 2 180 ? 179.594 5.950    61.432  1.00 198.25 ? 180 ILE B C   1 
ATOM   2025  O O   . ILE B 2 180 ? 180.070 4.873    61.066  1.00 199.15 ? 180 ILE B O   1 
ATOM   2026  C CB  . ILE B 2 180 ? 177.367 6.854    60.566  1.00 220.16 ? 180 ILE B CB  1 
ATOM   2027  C CG1 . ILE B 2 180 ? 175.843 6.743    60.731  1.00 226.90 ? 180 ILE B CG1 1 
ATOM   2028  C CG2 . ILE B 2 180 ? 177.787 6.328    59.195  1.00 223.93 ? 180 ILE B CG2 1 
ATOM   2029  C CD1 . ILE B 2 180 ? 175.033 7.749    59.937  1.00 229.44 ? 180 ILE B CD1 1 
ATOM   2030  N N   . VAL B 2 181 ? 180.336 7.042    61.618  1.00 181.87 ? 181 VAL B N   1 
ATOM   2031  C CA  . VAL B 2 181 ? 181.796 7.024    61.448  1.00 166.24 ? 181 VAL B CA  1 
ATOM   2032  C C   . VAL B 2 181 ? 182.512 6.215    62.538  1.00 158.70 ? 181 VAL B C   1 
ATOM   2033  O O   . VAL B 2 181 ? 183.584 5.662    62.290  1.00 156.77 ? 181 VAL B O   1 
ATOM   2034  C CB  . VAL B 2 181 ? 182.408 8.442    61.335  1.00 163.61 ? 181 VAL B CB  1 
ATOM   2035  C CG1 . VAL B 2 181 ? 182.276 8.967    59.912  1.00 159.11 ? 181 VAL B CG1 1 
ATOM   2036  C CG2 . VAL B 2 181 ? 181.774 9.399    62.337  1.00 164.86 ? 181 VAL B CG2 1 
ATOM   2037  N N   . LEU B 2 182 ? 181.913 6.150    63.731  1.00 148.97 ? 182 LEU B N   1 
ATOM   2038  C CA  . LEU B 2 182 ? 182.402 5.287    64.816  1.00 137.36 ? 182 LEU B CA  1 
ATOM   2039  C C   . LEU B 2 182 ? 182.201 3.817    64.449  1.00 132.77 ? 182 LEU B C   1 
ATOM   2040  O O   . LEU B 2 182 ? 183.002 2.963    64.827  1.00 132.06 ? 182 LEU B O   1 
ATOM   2041  C CB  . LEU B 2 182 ? 181.708 5.618    66.149  1.00 131.52 ? 182 LEU B CB  1 
ATOM   2042  C CG  . LEU B 2 182 ? 182.124 4.890    67.439  1.00 125.82 ? 182 LEU B CG  1 
ATOM   2043  C CD1 . LEU B 2 182 ? 183.584 5.137    67.802  1.00 122.78 ? 182 LEU B CD1 1 
ATOM   2044  C CD2 . LEU B 2 182 ? 181.218 5.290    68.595  1.00 123.09 ? 182 LEU B CD2 1 
ATOM   2045  N N   . PHE B 2 183 ? 181.125 3.541    63.715  1.00 126.53 ? 183 PHE B N   1 
ATOM   2046  C CA  . PHE B 2 183 ? 180.901 2.235    63.102  1.00 119.46 ? 183 PHE B CA  1 
ATOM   2047  C C   . PHE B 2 183 ? 181.911 1.991    61.978  1.00 122.36 ? 183 PHE B C   1 
ATOM   2048  O O   . PHE B 2 183 ? 182.374 0.863    61.787  1.00 121.85 ? 183 PHE B O   1 
ATOM   2049  C CB  . PHE B 2 183 ? 179.458 2.126    62.585  1.00 110.78 ? 183 PHE B CB  1 
ATOM   2050  C CG  . PHE B 2 183 ? 179.276 1.119    61.487  1.00 103.08 ? 183 PHE B CG  1 
ATOM   2051  C CD1 . PHE B 2 183 ? 179.334 -0.240   61.755  1.00 101.19 ? 183 PHE B CD1 1 
ATOM   2052  C CD2 . PHE B 2 183 ? 179.048 1.534    60.180  1.00 100.35 ? 183 PHE B CD2 1 
ATOM   2053  C CE1 . PHE B 2 183 ? 179.171 -1.168   60.742  1.00 99.09  ? 183 PHE B CE1 1 
ATOM   2054  C CE2 . PHE B 2 183 ? 178.884 0.611    59.162  1.00 98.36  ? 183 PHE B CE2 1 
ATOM   2055  C CZ  . PHE B 2 183 ? 178.948 -0.741   59.445  1.00 98.31  ? 183 PHE B CZ  1 
ATOM   2056  N N   . PHE B 2 184 ? 182.250 3.054    61.248  1.00 127.12 ? 184 PHE B N   1 
ATOM   2057  C CA  . PHE B 2 184 ? 183.201 2.969    60.138  1.00 130.45 ? 184 PHE B CA  1 
ATOM   2058  C C   . PHE B 2 184 ? 184.651 2.826    60.577  1.00 126.62 ? 184 PHE B C   1 
ATOM   2059  O O   . PHE B 2 184 ? 185.417 2.082    59.964  1.00 125.96 ? 184 PHE B O   1 
ATOM   2060  C CB  . PHE B 2 184 ? 183.037 4.149    59.176  1.00 137.49 ? 184 PHE B CB  1 
ATOM   2061  C CG  . PHE B 2 184 ? 182.112 3.856    58.036  1.00 145.48 ? 184 PHE B CG  1 
ATOM   2062  C CD1 . PHE B 2 184 ? 182.578 3.204    56.901  1.00 148.53 ? 184 PHE B CD1 1 
ATOM   2063  C CD2 . PHE B 2 184 ? 180.768 4.204    58.103  1.00 150.16 ? 184 PHE B CD2 1 
ATOM   2064  C CE1 . PHE B 2 184 ? 181.724 2.914    55.850  1.00 152.31 ? 184 PHE B CE1 1 
ATOM   2065  C CE2 . PHE B 2 184 ? 179.908 3.919    57.055  1.00 153.78 ? 184 PHE B CE2 1 
ATOM   2066  C CZ  . PHE B 2 184 ? 180.387 3.274    55.926  1.00 154.10 ? 184 PHE B CZ  1 
ATOM   2067  N N   . LEU B 2 185 ? 185.020 3.539    61.637  1.00 122.34 ? 185 LEU B N   1 
ATOM   2068  C CA  . LEU B 2 185 ? 186.367 3.455    62.186  1.00 118.48 ? 185 LEU B CA  1 
ATOM   2069  C C   . LEU B 2 185 ? 186.573 2.174    62.991  1.00 117.21 ? 185 LEU B C   1 
ATOM   2070  O O   . LEU B 2 185 ? 187.695 1.687    63.087  1.00 117.08 ? 185 LEU B O   1 
ATOM   2071  C CB  . LEU B 2 185 ? 186.696 4.693    63.025  1.00 117.00 ? 185 LEU B CB  1 
ATOM   2072  C CG  . LEU B 2 185 ? 186.832 6.015    62.258  1.00 115.89 ? 185 LEU B CG  1 
ATOM   2073  C CD1 . LEU B 2 185 ? 186.702 7.196    63.205  1.00 115.47 ? 185 LEU B CD1 1 
ATOM   2074  C CD2 . LEU B 2 185 ? 188.141 6.087    61.483  1.00 115.25 ? 185 LEU B CD2 1 
ATOM   2075  N N   . LEU B 2 186 ? 185.490 1.636    63.557  1.00 115.27 ? 186 LEU B N   1 
ATOM   2076  C CA  . LEU B 2 186 ? 185.512 0.328    64.227  1.00 112.82 ? 186 LEU B CA  1 
ATOM   2077  C C   . LEU B 2 186 ? 185.802 -0.803   63.247  1.00 111.43 ? 186 LEU B C   1 
ATOM   2078  O O   . LEU B 2 186 ? 186.415 -1.808   63.611  1.00 110.84 ? 186 LEU B O   1 
ATOM   2079  C CB  . LEU B 2 186 ? 184.183 0.053    64.937  1.00 111.89 ? 186 LEU B CB  1 
ATOM   2080  C CG  . LEU B 2 186 ? 184.083 0.266    66.448  1.00 111.31 ? 186 LEU B CG  1 
ATOM   2081  C CD1 . LEU B 2 186 ? 182.624 0.270    66.878  1.00 110.39 ? 186 LEU B CD1 1 
ATOM   2082  C CD2 . LEU B 2 186 ? 184.864 -0.800   67.203  1.00 111.03 ? 186 LEU B CD2 1 
ATOM   2083  N N   . ALA B 2 187 ? 185.337 -0.631   62.012  1.00 109.97 ? 187 ALA B N   1 
ATOM   2084  C CA  . ALA B 2 187 ? 185.615 -1.564   60.926  1.00 107.98 ? 187 ALA B CA  1 
ATOM   2085  C C   . ALA B 2 187 ? 186.977 -1.271   60.299  1.00 106.41 ? 187 ALA B C   1 
ATOM   2086  O O   . ALA B 2 187 ? 187.663 -2.184   59.840  1.00 106.02 ? 187 ALA B O   1 
ATOM   2087  C CB  . ALA B 2 187 ? 184.515 -1.499   59.879  1.00 108.43 ? 187 ALA B CB  1 
ATOM   2088  N N   . LEU B 2 188 ? 187.360 0.006    60.283  1.00 104.89 ? 188 LEU B N   1 
ATOM   2089  C CA  . LEU B 2 188 ? 188.707 0.407    59.877  1.00 104.49 ? 188 LEU B CA  1 
ATOM   2090  C C   . LEU B 2 188 ? 189.723 -0.002   60.939  1.00 107.67 ? 188 LEU B C   1 
ATOM   2091  O O   . LEU B 2 188 ? 190.914 -0.134   60.655  1.00 105.97 ? 188 LEU B O   1 
ATOM   2092  C CB  . LEU B 2 188 ? 188.785 1.918    59.632  1.00 101.57 ? 188 LEU B CB  1 
ATOM   2093  C CG  . LEU B 2 188 ? 188.032 2.498    58.430  1.00 100.07 ? 188 LEU B CG  1 
ATOM   2094  C CD1 . LEU B 2 188 ? 188.012 4.017    58.485  1.00 99.11  ? 188 LEU B CD1 1 
ATOM   2095  C CD2 . LEU B 2 188 ? 188.618 2.018    57.113  1.00 99.70  ? 188 LEU B CD2 1 
ATOM   2096  N N   . LEU B 2 189 ? 189.234 -0.197   62.162  1.00 114.23 ? 189 LEU B N   1 
ATOM   2097  C CA  . LEU B 2 189 ? 190.058 -0.661   63.272  1.00 122.30 ? 189 LEU B CA  1 
ATOM   2098  C C   . LEU B 2 189 ? 190.140 -2.181   63.286  1.00 130.53 ? 189 LEU B C   1 
ATOM   2099  O O   . LEU B 2 189 ? 191.237 -2.737   63.371  1.00 130.86 ? 189 LEU B O   1 
ATOM   2100  C CB  . LEU B 2 189 ? 189.524 -0.128   64.609  1.00 121.00 ? 189 LEU B CB  1 
ATOM   2101  C CG  . LEU B 2 189 ? 190.322 -0.298   65.912  1.00 120.39 ? 189 LEU B CG  1 
ATOM   2102  C CD1 . LEU B 2 189 ? 189.930 -1.571   66.647  1.00 119.47 ? 189 LEU B CD1 1 
ATOM   2103  C CD2 . LEU B 2 189 ? 191.830 -0.238   65.694  1.00 120.26 ? 189 LEU B CD2 1 
ATOM   2104  N N   . PHE B 2 190 ? 188.986 -2.849   63.208  1.00 142.04 ? 190 PHE B N   1 
ATOM   2105  C CA  . PHE B 2 190 ? 188.952 -4.312   63.113  1.00 154.80 ? 190 PHE B CA  1 
ATOM   2106  C C   . PHE B 2 190 ? 189.638 -4.784   61.830  1.00 155.99 ? 190 PHE B C   1 
ATOM   2107  O O   . PHE B 2 190 ? 190.118 -5.918   61.752  1.00 161.03 ? 190 PHE B O   1 
ATOM   2108  C CB  . PHE B 2 190 ? 187.522 -4.867   63.206  1.00 162.65 ? 190 PHE B CB  1 
ATOM   2109  C CG  . PHE B 2 190 ? 187.456 -6.373   63.169  1.00 171.82 ? 190 PHE B CG  1 
ATOM   2110  C CD1 . PHE B 2 190 ? 187.806 -7.128   64.288  1.00 175.86 ? 190 PHE B CD1 1 
ATOM   2111  C CD2 . PHE B 2 190 ? 187.063 -7.040   62.011  1.00 174.01 ? 190 PHE B CD2 1 
ATOM   2112  C CE1 . PHE B 2 190 ? 187.760 -8.516   64.254  1.00 178.73 ? 190 PHE B CE1 1 
ATOM   2113  C CE2 . PHE B 2 190 ? 187.015 -8.427   61.972  1.00 176.89 ? 190 PHE B CE2 1 
ATOM   2114  C CZ  . PHE B 2 190 ? 187.362 -9.166   63.095  1.00 178.42 ? 190 PHE B CZ  1 
ATOM   2115  N N   . GLY B 2 191 ? 189.680 -3.903   60.832  1.00 153.48 ? 191 GLY B N   1 
ATOM   2116  C CA  . GLY B 2 191 ? 190.456 -4.135   59.619  1.00 148.30 ? 191 GLY B CA  1 
ATOM   2117  C C   . GLY B 2 191 ? 191.928 -4.325   59.936  1.00 143.67 ? 191 GLY B C   1 
ATOM   2118  O O   . GLY B 2 191 ? 192.565 -5.233   59.410  1.00 142.67 ? 191 GLY B O   1 
ATOM   2119  N N   . VAL B 2 192 ? 192.455 -3.474   60.814  1.00 138.64 ? 192 VAL B N   1 
ATOM   2120  C CA  . VAL B 2 192 ? 193.853 -3.543   61.242  1.00 134.93 ? 192 VAL B CA  1 
ATOM   2121  C C   . VAL B 2 192 ? 194.106 -4.730   62.179  1.00 139.08 ? 192 VAL B C   1 
ATOM   2122  O O   . VAL B 2 192 ? 195.059 -5.483   61.979  1.00 136.61 ? 192 VAL B O   1 
ATOM   2123  C CB  . VAL B 2 192 ? 194.302 -2.222   61.911  1.00 130.13 ? 192 VAL B CB  1 
ATOM   2124  C CG1 . VAL B 2 192 ? 195.735 -2.322   62.414  1.00 127.09 ? 192 VAL B CG1 1 
ATOM   2125  C CG2 . VAL B 2 192 ? 194.167 -1.058   60.940  1.00 128.21 ? 192 VAL B CG2 1 
ATOM   2126  N N   . LEU B 2 193 ? 193.243 -4.893   63.184  1.00 147.61 ? 193 LEU B N   1 
ATOM   2127  C CA  . LEU B 2 193 ? 193.396 -5.928   64.222  1.00 156.25 ? 193 LEU B CA  1 
ATOM   2128  C C   . LEU B 2 193 ? 193.455 -7.373   63.717  1.00 160.47 ? 193 LEU B C   1 
ATOM   2129  O O   . LEU B 2 193 ? 194.279 -8.161   64.188  1.00 164.34 ? 193 LEU B O   1 
ATOM   2130  C CB  . LEU B 2 193 ? 192.284 -5.813   65.278  1.00 158.12 ? 193 LEU B CB  1 
ATOM   2131  C CG  . LEU B 2 193 ? 192.504 -5.035   66.581  1.00 157.63 ? 193 LEU B CG  1 
ATOM   2132  C CD1 . LEU B 2 193 ? 191.212 -5.008   67.385  1.00 156.97 ? 193 LEU B CD1 1 
ATOM   2133  C CD2 . LEU B 2 193 ? 193.625 -5.643   67.415  1.00 157.03 ? 193 LEU B CD2 1 
ATOM   2134  N N   . MET B 2 194 ? 192.580 -7.718   62.774  1.00 161.62 ? 194 MET B N   1 
ATOM   2135  C CA  . MET B 2 194 ? 192.451 -9.102   62.310  1.00 158.67 ? 194 MET B CA  1 
ATOM   2136  C C   . MET B 2 194 ? 193.503 -9.486   61.259  1.00 158.69 ? 194 MET B C   1 
ATOM   2137  O O   . MET B 2 194 ? 193.658 -10.666  60.932  1.00 160.75 ? 194 MET B O   1 
ATOM   2138  C CB  . MET B 2 194 ? 191.035 -9.365   61.790  1.00 155.53 ? 194 MET B CB  1 
ATOM   2139  C CG  . MET B 2 194 ? 190.594 -10.817  61.898  1.00 151.73 ? 194 MET B CG  1 
ATOM   2140  S SD  . MET B 2 194 ? 189.239 -11.204  60.775  1.00 151.74 ? 194 MET B SD  1 
ATOM   2141  C CE  . MET B 2 194 ? 190.013 -10.939  59.173  1.00 152.22 ? 194 MET B CE  1 
ATOM   2142  N N   . THR B 2 195 ? 194.219 -8.488   60.740  1.00 155.58 ? 195 THR B N   1 
ATOM   2143  C CA  . THR B 2 195 ? 195.337 -8.710   59.811  1.00 151.82 ? 195 THR B CA  1 
ATOM   2144  C C   . THR B 2 195 ? 196.696 -8.467   60.492  1.00 156.89 ? 195 THR B C   1 
ATOM   2145  O O   . THR B 2 195 ? 197.709 -8.223   59.829  1.00 154.20 ? 195 THR B O   1 
ATOM   2146  C CB  . THR B 2 195 ? 195.187 -7.871   58.519  1.00 144.91 ? 195 THR B CB  1 
ATOM   2147  O OG1 . THR B 2 195 ? 196.378 -7.968   57.727  1.00 140.29 ? 195 THR B OG1 1 
ATOM   2148  C CG2 . THR B 2 195 ? 194.940 -6.426   58.852  1.00 141.32 ? 195 THR B CG2 1 
ATOM   2149  N N   . LEU B 2 196 ? 196.696 -8.542   61.821  1.00 165.16 ? 196 LEU B N   1 
ATOM   2150  C CA  . LEU B 2 196 ? 197.913 -8.457   62.632  1.00 172.26 ? 196 LEU B CA  1 
ATOM   2151  C C   . LEU B 2 196 ? 198.536 -9.822   62.980  1.00 185.42 ? 196 LEU B C   1 
ATOM   2152  O O   . LEU B 2 196 ? 199.765 -9.936   63.005  1.00 183.85 ? 196 LEU B O   1 
ATOM   2153  C CB  . LEU B 2 196 ? 197.649 -7.653   63.913  1.00 164.21 ? 196 LEU B CB  1 
ATOM   2154  C CG  . LEU B 2 196 ? 198.046 -6.174   64.026  1.00 157.83 ? 196 LEU B CG  1 
ATOM   2155  C CD1 . LEU B 2 196 ? 198.038 -5.432   62.696  1.00 154.95 ? 196 LEU B CD1 1 
ATOM   2156  C CD2 . LEU B 2 196 ? 197.149 -5.477   65.038  1.00 155.27 ? 196 LEU B CD2 1 
ATOM   2157  N N   . PRO B 2 197 ? 197.702 -10.857  63.256  1.00 199.94 ? 197 PRO B N   1 
ATOM   2158  C CA  . PRO B 2 197 ? 198.260 -12.162  63.640  1.00 206.51 ? 197 PRO B CA  1 
ATOM   2159  C C   . PRO B 2 197 ? 198.662 -13.064  62.465  1.00 209.52 ? 197 PRO B C   1 
ATOM   2160  O O   . PRO B 2 197 ? 199.242 -14.130  62.680  1.00 209.35 ? 197 PRO B O   1 
ATOM   2161  C CB  . PRO B 2 197 ? 197.118 -12.821  64.440  1.00 207.81 ? 197 PRO B CB  1 
ATOM   2162  C CG  . PRO B 2 197 ? 195.961 -11.869  64.409  1.00 207.10 ? 197 PRO B CG  1 
ATOM   2163  C CD  . PRO B 2 197 ? 196.230 -10.882  63.315  1.00 205.33 ? 197 PRO B CD  1 
ATOM   2164  N N   . ILE B 2 198 ? 198.354 -12.642  61.242  1.00 212.47 ? 198 ILE B N   1 
ATOM   2165  C CA  . ILE B 2 198 ? 198.674 -13.427  60.050  1.00 213.30 ? 198 ILE B CA  1 
ATOM   2166  C C   . ILE B 2 198 ? 200.157 -13.274  59.702  1.00 211.11 ? 198 ILE B C   1 
ATOM   2167  O O   . ILE B 2 198 ? 200.681 -12.157  59.665  1.00 211.22 ? 198 ILE B O   1 
ATOM   2168  C CB  . ILE B 2 198 ? 197.781 -13.024  58.851  1.00 217.07 ? 198 ILE B CB  1 
ATOM   2169  C CG1 . ILE B 2 198 ? 196.298 -13.070  59.248  1.00 219.78 ? 198 ILE B CG1 1 
ATOM   2170  C CG2 . ILE B 2 198 ? 198.032 -13.937  57.659  1.00 217.48 ? 198 ILE B CG2 1 
ATOM   2171  C CD1 . ILE B 2 198 ? 195.377 -12.269  58.348  1.00 222.57 ? 198 ILE B CD1 1 
ATOM   2172  N N   . GLY B 2 199 ? 200.825 -14.402  59.466  1.00 208.43 ? 199 GLY B N   1 
ATOM   2173  C CA  . GLY B 2 199 ? 202.248 -14.413  59.123  1.00 207.94 ? 199 GLY B CA  1 
ATOM   2174  C C   . GLY B 2 199 ? 202.553 -13.794  57.771  1.00 208.52 ? 199 GLY B C   1 
ATOM   2175  O O   . GLY B 2 199 ? 201.682 -13.727  56.901  1.00 209.26 ? 199 GLY B O   1 
ATOM   2176  N N   . GLY B 2 200 ? 203.795 -13.339  57.605  1.00 208.35 ? 200 GLY B N   1 
ATOM   2177  C CA  . GLY B 2 200 ? 204.261 -12.739  56.350  1.00 207.41 ? 200 GLY B CA  1 
ATOM   2178  C C   . GLY B 2 200 ? 204.200 -13.705  55.182  1.00 206.37 ? 200 GLY B C   1 
ATOM   2179  O O   . GLY B 2 200 ? 203.957 -13.301  54.041  1.00 205.30 ? 200 GLY B O   1 
ATOM   2180  N N   . GLY B 2 201 ? 204.429 -14.983  55.476  1.00 205.97 ? 201 GLY B N   1 
ATOM   2181  C CA  . GLY B 2 201 ? 204.258 -16.052  54.500  1.00 205.03 ? 201 GLY B CA  1 
ATOM   2182  C C   . GLY B 2 201 ? 202.801 -16.453  54.349  1.00 202.52 ? 201 GLY B C   1 
ATOM   2183  O O   . GLY B 2 201 ? 202.400 -16.968  53.304  1.00 205.94 ? 201 GLY B O   1 
ATOM   2184  N N   . ASP B 2 202 ? 202.010 -16.207  55.393  1.00 196.17 ? 202 ASP B N   1 
ATOM   2185  C CA  . ASP B 2 202 ? 200.586 -16.547  55.399  1.00 190.15 ? 202 ASP B CA  1 
ATOM   2186  C C   . ASP B 2 202 ? 199.728 -15.446  54.753  1.00 189.25 ? 202 ASP B C   1 
ATOM   2187  O O   . ASP B 2 202 ? 198.495 -15.496  54.810  1.00 188.97 ? 202 ASP B O   1 
ATOM   2188  C CB  . ASP B 2 202 ? 200.105 -16.821  56.837  1.00 184.53 ? 202 ASP B CB  1 
ATOM   2189  C CG  . ASP B 2 202 ? 201.055 -17.724  57.628  1.00 180.45 ? 202 ASP B CG  1 
ATOM   2190  O OD1 . ASP B 2 202 ? 201.676 -18.632  57.036  1.00 179.74 ? 202 ASP B OD1 1 
ATOM   2191  O OD2 . ASP B 2 202 ? 201.170 -17.529  58.856  1.00 175.20 ? 202 ASP B OD2 1 
ATOM   2192  N N   . MET B 2 203 ? 200.385 -14.473  54.120  1.00 188.91 ? 203 MET B N   1 
ATOM   2193  C CA  . MET B 2 203 ? 199.716 -13.260  53.633  1.00 189.43 ? 203 MET B CA  1 
ATOM   2194  C C   . MET B 2 203 ? 198.943 -13.387  52.312  1.00 182.69 ? 203 MET B C   1 
ATOM   2195  O O   . MET B 2 203 ? 197.879 -12.781  52.177  1.00 179.34 ? 203 MET B O   1 
ATOM   2196  C CB  . MET B 2 203 ? 200.698 -12.083  53.565  1.00 197.39 ? 203 MET B CB  1 
ATOM   2197  C CG  . MET B 2 203 ? 200.126 -10.800  54.142  1.00 207.62 ? 203 MET B CG  1 
ATOM   2198  S SD  . MET B 2 203 ? 200.102 -10.864  55.948  1.00 217.17 ? 203 MET B SD  1 
ATOM   2199  C CE  . MET B 2 203 ? 198.526 -10.097  56.316  1.00 216.94 ? 203 MET B CE  1 
ATOM   2200  N N   . PRO B 2 204 ? 199.476 -14.146  51.330  1.00 179.54 ? 204 PRO B N   1 
ATOM   2201  C CA  . PRO B 2 204 ? 198.725 -14.356  50.088  1.00 178.91 ? 204 PRO B CA  1 
ATOM   2202  C C   . PRO B 2 204 ? 197.274 -14.817  50.294  1.00 176.90 ? 204 PRO B C   1 
ATOM   2203  O O   . PRO B 2 204 ? 196.358 -14.214  49.728  1.00 177.31 ? 204 PRO B O   1 
ATOM   2204  C CB  . PRO B 2 204 ? 199.543 -15.430  49.374  1.00 180.76 ? 204 PRO B CB  1 
ATOM   2205  C CG  . PRO B 2 204 ? 200.942 -15.136  49.790  1.00 179.86 ? 204 PRO B CG  1 
ATOM   2206  C CD  . PRO B 2 204 ? 200.851 -14.675  51.220  1.00 179.17 ? 204 PRO B CD  1 
ATOM   2207  N N   . VAL B 2 205 ? 197.074 -15.858  51.105  1.00 173.83 ? 205 VAL B N   1 
ATOM   2208  C CA  . VAL B 2 205 ? 195.738 -16.418  51.368  1.00 170.62 ? 205 VAL B CA  1 
ATOM   2209  C C   . VAL B 2 205 ? 194.821 -15.387  52.033  1.00 164.43 ? 205 VAL B C   1 
ATOM   2210  O O   . VAL B 2 205 ? 193.606 -15.386  51.811  1.00 162.71 ? 205 VAL B O   1 
ATOM   2211  C CB  . VAL B 2 205 ? 195.808 -17.706  52.230  1.00 173.75 ? 205 VAL B CB  1 
ATOM   2212  C CG1 . VAL B 2 205 ? 194.431 -18.343  52.379  1.00 175.70 ? 205 VAL B CG1 1 
ATOM   2213  C CG2 . VAL B 2 205 ? 196.778 -18.710  51.623  1.00 175.84 ? 205 VAL B CG2 1 
ATOM   2214  N N   . ALA B 2 206 ? 195.415 -14.509  52.838  1.00 158.69 ? 206 ALA B N   1 
ATOM   2215  C CA  . ALA B 2 206 ? 194.685 -13.413  53.466  1.00 154.47 ? 206 ALA B CA  1 
ATOM   2216  C C   . ALA B 2 206 ? 194.223 -12.380  52.437  1.00 151.15 ? 206 ALA B C   1 
ATOM   2217  O O   . ALA B 2 206 ? 193.132 -11.823  52.566  1.00 151.78 ? 206 ALA B O   1 
ATOM   2218  C CB  . ALA B 2 206 ? 195.535 -12.755  54.543  1.00 155.74 ? 206 ALA B CB  1 
ATOM   2219  N N   . ILE B 2 207 ? 195.052 -12.140  51.420  1.00 146.13 ? 207 ILE B N   1 
ATOM   2220  C CA  . ILE B 2 207 ? 194.739 -11.180  50.353  1.00 141.72 ? 207 ILE B CA  1 
ATOM   2221  C C   . ILE B 2 207 ? 193.582 -11.669  49.474  1.00 144.34 ? 207 ILE B C   1 
ATOM   2222  O O   . ILE B 2 207 ? 192.754 -10.870  49.033  1.00 144.17 ? 207 ILE B O   1 
ATOM   2223  C CB  . ILE B 2 207 ? 195.988 -10.840  49.502  1.00 136.51 ? 207 ILE B CB  1 
ATOM   2224  C CG1 . ILE B 2 207 ? 197.059 -10.180  50.378  1.00 133.43 ? 207 ILE B CG1 1 
ATOM   2225  C CG2 . ILE B 2 207 ? 195.628 -9.924   48.339  1.00 134.12 ? 207 ILE B CG2 1 
ATOM   2226  C CD1 . ILE B 2 207 ? 198.471 -10.298  49.845  1.00 131.10 ? 207 ILE B CD1 1 
ATOM   2227  N N   . SER B 2 208 ? 193.528 -12.981  49.240  1.00 147.75 ? 208 SER B N   1 
ATOM   2228  C CA  . SER B 2 208 ? 192.422 -13.607  48.510  1.00 151.24 ? 208 SER B CA  1 
ATOM   2229  C C   . SER B 2 208 ? 191.146 -13.614  49.345  1.00 153.01 ? 208 SER B C   1 
ATOM   2230  O O   . SER B 2 208 ? 190.038 -13.552  48.806  1.00 155.48 ? 208 SER B O   1 
ATOM   2231  C CB  . SER B 2 208 ? 192.778 -15.040  48.116  1.00 151.69 ? 208 SER B CB  1 
ATOM   2232  O OG  . SER B 2 208 ? 191.804 -15.582  47.241  1.00 151.24 ? 208 SER B OG  1 
ATOM   2233  N N   . PHE B 2 209 ? 191.321 -13.702  50.661  1.00 152.33 ? 209 PHE B N   1 
ATOM   2234  C CA  . PHE B 2 209 ? 190.214 -13.681  51.608  1.00 150.79 ? 209 PHE B CA  1 
ATOM   2235  C C   . PHE B 2 209 ? 189.605 -12.284  51.713  1.00 154.07 ? 209 PHE B C   1 
ATOM   2236  O O   . PHE B 2 209 ? 188.395 -12.145  51.902  1.00 154.89 ? 209 PHE B O   1 
ATOM   2237  C CB  . PHE B 2 209 ? 190.684 -14.169  52.979  1.00 146.27 ? 209 PHE B CB  1 
ATOM   2238  C CG  . PHE B 2 209 ? 189.567 -14.512  53.916  1.00 143.61 ? 209 PHE B CG  1 
ATOM   2239  C CD1 . PHE B 2 209 ? 188.884 -15.717  53.794  1.00 142.48 ? 209 PHE B CD1 1 
ATOM   2240  C CD2 . PHE B 2 209 ? 189.199 -13.635  54.925  1.00 143.94 ? 209 PHE B CD2 1 
ATOM   2241  C CE1 . PHE B 2 209 ? 187.852 -16.040  54.658  1.00 142.91 ? 209 PHE B CE1 1 
ATOM   2242  C CE2 . PHE B 2 209 ? 188.169 -13.952  55.795  1.00 145.04 ? 209 PHE B CE2 1 
ATOM   2243  C CZ  . PHE B 2 209 ? 187.493 -15.155  55.660  1.00 144.39 ? 209 PHE B CZ  1 
ATOM   2244  N N   . TYR B 2 210 ? 190.450 -11.259  51.593  1.00 157.58 ? 210 TYR B N   1 
ATOM   2245  C CA  . TYR B 2 210 ? 189.995 -9.868   51.536  1.00 159.79 ? 210 TYR B CA  1 
ATOM   2246  C C   . TYR B 2 210 ? 189.498 -9.493   50.139  1.00 161.69 ? 210 TYR B C   1 
ATOM   2247  O O   . TYR B 2 210 ? 188.690 -8.571   49.987  1.00 160.63 ? 210 TYR B O   1 
ATOM   2248  C CB  . TYR B 2 210 ? 191.101 -8.900   51.975  1.00 159.02 ? 210 TYR B CB  1 
ATOM   2249  C CG  . TYR B 2 210 ? 191.338 -8.836   53.473  1.00 157.06 ? 210 TYR B CG  1 
ATOM   2250  C CD1 . TYR B 2 210 ? 190.293 -8.561   54.359  1.00 155.23 ? 210 TYR B CD1 1 
ATOM   2251  C CD2 . TYR B 2 210 ? 192.615 -9.021   54.003  1.00 155.99 ? 210 TYR B CD2 1 
ATOM   2252  C CE1 . TYR B 2 210 ? 190.511 -8.496   55.728  1.00 152.02 ? 210 TYR B CE1 1 
ATOM   2253  C CE2 . TYR B 2 210 ? 192.844 -8.955   55.370  1.00 152.44 ? 210 TYR B CE2 1 
ATOM   2254  C CZ  . TYR B 2 210 ? 191.790 -8.691   56.227  1.00 150.66 ? 210 TYR B CZ  1 
ATOM   2255  O OH  . TYR B 2 210 ? 192.012 -8.624   57.583  1.00 147.07 ? 210 TYR B OH  1 
ATOM   2256  N N   . ASN B 2 211 ? 190.000 -10.201  49.126  1.00 164.17 ? 211 ASN B N   1 
ATOM   2257  C CA  . ASN B 2 211 ? 189.535 -10.045  47.748  1.00 165.21 ? 211 ASN B CA  1 
ATOM   2258  C C   . ASN B 2 211 ? 188.091 -10.516  47.599  1.00 164.97 ? 211 ASN B C   1 
ATOM   2259  O O   . ASN B 2 211 ? 187.313 -9.936   46.837  1.00 166.50 ? 211 ASN B O   1 
ATOM   2260  C CB  . ASN B 2 211 ? 190.450 -10.801  46.780  1.00 167.04 ? 211 ASN B CB  1 
ATOM   2261  C CG  . ASN B 2 211 ? 190.220 -10.414  45.332  1.00 168.43 ? 211 ASN B CG  1 
ATOM   2262  O OD1 . ASN B 2 211 ? 189.851 -9.279   45.026  1.00 169.50 ? 211 ASN B OD1 1 
ATOM   2263  N ND2 . ASN B 2 211 ? 190.447 -11.360  44.428  1.00 168.74 ? 211 ASN B ND2 1 
ATOM   2264  N N   . ALA B 2 212 ? 187.752 -11.574  48.334  1.00 162.46 ? 212 ALA B N   1 
ATOM   2265  C CA  . ALA B 2 212 ? 186.376 -12.039  48.469  1.00 157.90 ? 212 ALA B CA  1 
ATOM   2266  C C   . ALA B 2 212 ? 185.562 -11.031  49.273  1.00 154.20 ? 212 ALA B C   1 
ATOM   2267  O O   . ALA B 2 212 ? 184.416 -10.736  48.931  1.00 154.97 ? 212 ALA B O   1 
ATOM   2268  C CB  . ALA B 2 212 ? 186.343 -13.398  49.151  1.00 157.63 ? 212 ALA B CB  1 
ATOM   2269  N N   . PHE B 2 213 ? 186.172 -10.510  50.339  1.00 147.54 ? 213 PHE B N   1 
ATOM   2270  C CA  . PHE B 2 213 ? 185.540 -9.541   51.237  1.00 139.58 ? 213 PHE B CA  1 
ATOM   2271  C C   . PHE B 2 213 ? 185.143 -8.244   50.534  1.00 134.15 ? 213 PHE B C   1 
ATOM   2272  O O   . PHE B 2 213 ? 184.068 -7.700   50.789  1.00 133.26 ? 213 PHE B O   1 
ATOM   2273  C CB  . PHE B 2 213 ? 186.448 -9.255   52.441  1.00 138.35 ? 213 PHE B CB  1 
ATOM   2274  C CG  . PHE B 2 213 ? 186.096 -10.044  53.675  1.00 136.61 ? 213 PHE B CG  1 
ATOM   2275  C CD1 . PHE B 2 213 ? 185.840 -11.411  53.604  1.00 135.92 ? 213 PHE B CD1 1 
ATOM   2276  C CD2 . PHE B 2 213 ? 186.036 -9.420   54.916  1.00 135.03 ? 213 PHE B CD2 1 
ATOM   2277  C CE1 . PHE B 2 213 ? 185.512 -12.133  54.740  1.00 134.69 ? 213 PHE B CE1 1 
ATOM   2278  C CE2 . PHE B 2 213 ? 185.711 -10.136  56.058  1.00 133.81 ? 213 PHE B CE2 1 
ATOM   2279  C CZ  . PHE B 2 213 ? 185.451 -11.495  55.969  1.00 134.19 ? 213 PHE B CZ  1 
ATOM   2280  N N   . THR B 2 214 ? 186.009 -7.757   49.650  1.00 127.76 ? 214 THR B N   1 
ATOM   2281  C CA  . THR B 2 214 ? 185.684 -6.605   48.816  1.00 122.97 ? 214 THR B CA  1 
ATOM   2282  C C   . THR B 2 214 ? 184.575 -6.961   47.828  1.00 122.71 ? 214 THR B C   1 
ATOM   2283  O O   . THR B 2 214 ? 183.610 -6.212   47.684  1.00 122.87 ? 214 THR B O   1 
ATOM   2284  C CB  . THR B 2 214 ? 186.912 -6.088   48.049  1.00 120.76 ? 214 THR B CB  1 
ATOM   2285  O OG1 . THR B 2 214 ? 187.556 -7.182   47.387  1.00 119.66 ? 214 THR B OG1 1 
ATOM   2286  C CG2 . THR B 2 214 ? 187.893 -5.442   48.999  1.00 119.22 ? 214 THR B CG2 1 
ATOM   2287  N N   . GLY B 2 215 ? 184.715 -8.112   47.169  1.00 122.34 ? 215 GLY B N   1 
ATOM   2288  C CA  . GLY B 2 215 ? 183.717 -8.614   46.221  1.00 121.83 ? 215 GLY B CA  1 
ATOM   2289  C C   . GLY B 2 215 ? 182.335 -8.756   46.831  1.00 122.08 ? 215 GLY B C   1 
ATOM   2290  O O   . GLY B 2 215 ? 181.354 -8.256   46.280  1.00 120.63 ? 215 GLY B O   1 
ATOM   2291  N N   . MET B 2 216 ? 182.265 -9.436   47.975  1.00 124.32 ? 216 MET B N   1 
ATOM   2292  C CA  . MET B 2 216 ? 181.024 -9.566   48.743  1.00 127.33 ? 216 MET B CA  1 
ATOM   2293  C C   . MET B 2 216 ? 180.398 -8.201   49.008  1.00 129.98 ? 216 MET B C   1 
ATOM   2294  O O   . MET B 2 216 ? 179.229 -7.974   48.689  1.00 128.15 ? 216 MET B O   1 
ATOM   2295  C CB  . MET B 2 216 ? 181.277 -10.276  50.081  1.00 127.89 ? 216 MET B CB  1 
ATOM   2296  C CG  . MET B 2 216 ? 181.347 -11.795  50.006  1.00 128.28 ? 216 MET B CG  1 
ATOM   2297  S SD  . MET B 2 216 ? 181.137 -12.605  51.610  1.00 127.31 ? 216 MET B SD  1 
ATOM   2298  C CE  . MET B 2 216 ? 182.780 -12.472  52.306  1.00 126.87 ? 216 MET B CE  1 
ATOM   2299  N N   . ALA B 2 217 ? 181.198 -7.299   49.576  1.00 135.51 ? 217 ALA B N   1 
ATOM   2300  C CA  . ALA B 2 217 ? 180.752 -5.961   49.962  1.00 142.44 ? 217 ALA B CA  1 
ATOM   2301  C C   . ALA B 2 217 ? 180.099 -5.200   48.811  1.00 148.34 ? 217 ALA B C   1 
ATOM   2302  O O   . ALA B 2 217 ? 179.007 -4.651   48.976  1.00 149.10 ? 217 ALA B O   1 
ATOM   2303  C CB  . ALA B 2 217 ? 181.910 -5.162   50.544  1.00 141.92 ? 217 ALA B CB  1 
ATOM   2304  N N   . VAL B 2 218 ? 180.758 -5.189   47.650  1.00 155.56 ? 218 VAL B N   1 
ATOM   2305  C CA  . VAL B 2 218 ? 180.255 -4.467   46.471  1.00 160.32 ? 218 VAL B CA  1 
ATOM   2306  C C   . VAL B 2 218 ? 179.021 -5.149   45.862  1.00 158.42 ? 218 VAL B C   1 
ATOM   2307  O O   . VAL B 2 218 ? 178.296 -4.546   45.065  1.00 162.56 ? 218 VAL B O   1 
ATOM   2308  C CB  . VAL B 2 218 ? 181.358 -4.198   45.402  1.00 162.75 ? 218 VAL B CB  1 
ATOM   2309  C CG1 . VAL B 2 218 ? 182.653 -3.731   46.059  1.00 163.54 ? 218 VAL B CG1 1 
ATOM   2310  C CG2 . VAL B 2 218 ? 181.629 -5.429   44.545  1.00 163.23 ? 218 VAL B CG2 1 
ATOM   2311  N N   . GLY B 2 219 ? 178.796 -6.405   46.247  1.00 152.08 ? 219 GLY B N   1 
ATOM   2312  C CA  . GLY B 2 219 ? 177.565 -7.110   45.914  1.00 143.34 ? 219 GLY B CA  1 
ATOM   2313  C C   . GLY B 2 219 ? 176.419 -6.548   46.731  1.00 138.03 ? 219 GLY B C   1 
ATOM   2314  O O   . GLY B 2 219 ? 175.450 -6.032   46.175  1.00 135.94 ? 219 GLY B O   1 
ATOM   2315  N N   . PHE B 2 220 ? 176.553 -6.625   48.055  1.00 134.70 ? 220 PHE B N   1 
ATOM   2316  C CA  . PHE B 2 220 ? 175.527 -6.155   48.994  1.00 133.64 ? 220 PHE B CA  1 
ATOM   2317  C C   . PHE B 2 220 ? 175.266 -4.659   48.908  1.00 132.75 ? 220 PHE B C   1 
ATOM   2318  O O   . PHE B 2 220 ? 174.139 -4.207   49.117  1.00 130.52 ? 220 PHE B O   1 
ATOM   2319  C CB  . PHE B 2 220 ? 175.910 -6.511   50.431  1.00 135.47 ? 220 PHE B CB  1 
ATOM   2320  C CG  . PHE B 2 220 ? 176.258 -7.955   50.625  1.00 138.76 ? 220 PHE B CG  1 
ATOM   2321  C CD1 . PHE B 2 220 ? 175.355 -8.955   50.278  1.00 140.31 ? 220 PHE B CD1 1 
ATOM   2322  C CD2 . PHE B 2 220 ? 177.485 -8.319   51.166  1.00 140.67 ? 220 PHE B CD2 1 
ATOM   2323  C CE1 . PHE B 2 220 ? 175.674 -10.291  50.458  1.00 142.56 ? 220 PHE B CE1 1 
ATOM   2324  C CE2 . PHE B 2 220 ? 177.811 -9.654   51.348  1.00 142.74 ? 220 PHE B CE2 1 
ATOM   2325  C CZ  . PHE B 2 220 ? 176.904 -10.641  50.995  1.00 143.33 ? 220 PHE B CZ  1 
ATOM   2326  N N   . GLU B 2 221 ? 176.318 -3.897   48.623  1.00 134.68 ? 221 GLU B N   1 
ATOM   2327  C CA  . GLU B 2 221 ? 176.202 -2.459   48.424  1.00 138.11 ? 221 GLU B CA  1 
ATOM   2328  C C   . GLU B 2 221 ? 175.529 -2.172   47.086  1.00 141.00 ? 221 GLU B C   1 
ATOM   2329  O O   . GLU B 2 221 ? 174.756 -1.218   46.961  1.00 142.19 ? 221 GLU B O   1 
ATOM   2330  C CB  . GLU B 2 221 ? 177.584 -1.806   48.468  1.00 137.97 ? 221 GLU B CB  1 
ATOM   2331  C CG  . GLU B 2 221 ? 177.594 -0.418   49.082  1.00 136.57 ? 221 GLU B CG  1 
ATOM   2332  C CD  . GLU B 2 221 ? 177.212 -0.434   50.547  1.00 134.88 ? 221 GLU B CD  1 
ATOM   2333  O OE1 . GLU B 2 221 ? 177.900 -1.109   51.341  1.00 131.90 ? 221 GLU B OE1 1 
ATOM   2334  O OE2 . GLU B 2 221 ? 176.223 0.236    50.901  1.00 135.24 ? 221 GLU B OE2 1 
ATOM   2335  N N   . GLY B 2 222 ? 175.831 -3.010   46.096  1.00 143.36 ? 222 GLY B N   1 
ATOM   2336  C CA  . GLY B 2 222 ? 175.220 -2.926   44.774  1.00 144.83 ? 222 GLY B CA  1 
ATOM   2337  C C   . GLY B 2 222 ? 173.745 -3.267   44.805  1.00 146.11 ? 222 GLY B C   1 
ATOM   2338  O O   . GLY B 2 222 ? 172.983 -2.811   43.954  1.00 145.92 ? 222 GLY B O   1 
ATOM   2339  N N   . PHE B 2 223 ? 173.355 -4.076   45.788  1.00 147.87 ? 223 PHE B N   1 
ATOM   2340  C CA  . PHE B 2 223 ? 171.952 -4.397   46.033  1.00 150.36 ? 223 PHE B CA  1 
ATOM   2341  C C   . PHE B 2 223 ? 171.241 -3.271   46.800  1.00 152.61 ? 223 PHE B C   1 
ATOM   2342  O O   . PHE B 2 223 ? 170.059 -3.008   46.562  1.00 154.90 ? 223 PHE B O   1 
ATOM   2343  C CB  . PHE B 2 223 ? 171.821 -5.726   46.796  1.00 149.20 ? 223 PHE B CB  1 
ATOM   2344  C CG  . PHE B 2 223 ? 172.113 -6.954   45.963  1.00 147.22 ? 223 PHE B CG  1 
ATOM   2345  C CD1 . PHE B 2 223 ? 171.246 -7.353   44.948  1.00 147.24 ? 223 PHE B CD1 1 
ATOM   2346  C CD2 . PHE B 2 223 ? 173.234 -7.735   46.221  1.00 145.26 ? 223 PHE B CD2 1 
ATOM   2347  C CE1 . PHE B 2 223 ? 171.511 -8.488   44.191  1.00 145.91 ? 223 PHE B CE1 1 
ATOM   2348  C CE2 . PHE B 2 223 ? 173.506 -8.868   45.468  1.00 144.28 ? 223 PHE B CE2 1 
ATOM   2349  C CZ  . PHE B 2 223 ? 172.641 -9.247   44.453  1.00 144.71 ? 223 PHE B CZ  1 
ATOM   2350  N N   . ALA B 2 224 ? 171.967 -2.612   47.707  1.00 152.90 ? 224 ALA B N   1 
ATOM   2351  C CA  . ALA B 2 224 ? 171.413 -1.557   48.575  1.00 152.29 ? 224 ALA B CA  1 
ATOM   2352  C C   . ALA B 2 224 ? 170.866 -0.341   47.816  1.00 152.24 ? 224 ALA B C   1 
ATOM   2353  O O   . ALA B 2 224 ? 169.908 0.296    48.261  1.00 151.47 ? 224 ALA B O   1 
ATOM   2354  C CB  . ALA B 2 224 ? 172.444 -1.123   49.604  1.00 151.51 ? 224 ALA B CB  1 
ATOM   2355  N N   . VAL B 2 225 ? 171.501 -0.010   46.693  1.00 151.92 ? 225 VAL B N   1 
ATOM   2356  C CA  . VAL B 2 225 ? 170.951 0.942    45.721  1.00 150.95 ? 225 VAL B CA  1 
ATOM   2357  C C   . VAL B 2 225 ? 170.621 0.192    44.425  1.00 152.92 ? 225 VAL B C   1 
ATOM   2358  O O   . VAL B 2 225 ? 171.139 -0.900   44.196  1.00 153.84 ? 225 VAL B O   1 
ATOM   2359  C CB  . VAL B 2 225 ? 171.898 2.141    45.447  1.00 147.68 ? 225 VAL B CB  1 
ATOM   2360  C CG1 . VAL B 2 225 ? 171.830 3.155    46.582  1.00 145.12 ? 225 VAL B CG1 1 
ATOM   2361  C CG2 . VAL B 2 225 ? 173.331 1.678    45.211  1.00 145.82 ? 225 VAL B CG2 1 
ATOM   2362  N N   . GLY B 2 226 ? 169.760 0.769    43.587  1.00 153.92 ? 226 GLY B N   1 
ATOM   2363  C CA  . GLY B 2 226 ? 169.296 0.100    42.364  1.00 153.82 ? 226 GLY B CA  1 
ATOM   2364  C C   . GLY B 2 226 ? 170.331 0.031    41.254  1.00 155.42 ? 226 GLY B C   1 
ATOM   2365  O O   . GLY B 2 226 ? 170.168 0.666    40.210  1.00 153.15 ? 226 GLY B O   1 
ATOM   2366  N N   . ASN B 2 227 ? 171.380 -0.763   41.477  1.00 159.43 ? 227 ASN B N   1 
ATOM   2367  C CA  . ASN B 2 227 ? 172.530 -0.837   40.570  1.00 164.03 ? 227 ASN B CA  1 
ATOM   2368  C C   . ASN B 2 227 ? 172.865 -2.267   40.108  1.00 164.51 ? 227 ASN B C   1 
ATOM   2369  O O   . ASN B 2 227 ? 173.564 -2.997   40.814  1.00 165.15 ? 227 ASN B O   1 
ATOM   2370  C CB  . ASN B 2 227 ? 173.755 -0.186   41.229  1.00 166.31 ? 227 ASN B CB  1 
ATOM   2371  C CG  . ASN B 2 227 ? 174.894 0.059    40.252  1.00 168.79 ? 227 ASN B CG  1 
ATOM   2372  O OD1 . ASN B 2 227 ? 175.326 -0.842   39.530  1.00 169.36 ? 227 ASN B OD1 1 
ATOM   2373  N ND2 . ASN B 2 227 ? 175.404 1.285    40.245  1.00 170.99 ? 227 ASN B ND2 1 
ATOM   2374  N N   . PRO B 2 228 ? 172.382 -2.654   38.907  1.00 163.64 ? 228 PRO B N   1 
ATOM   2375  C CA  . PRO B 2 228 ? 172.540 -3.996   38.318  1.00 159.77 ? 228 PRO B CA  1 
ATOM   2376  C C   . PRO B 2 228 ? 173.984 -4.453   38.070  1.00 152.77 ? 228 PRO B C   1 
ATOM   2377  O O   . PRO B 2 228 ? 174.313 -5.605   38.355  1.00 152.42 ? 228 PRO B O   1 
ATOM   2378  C CB  . PRO B 2 228 ? 171.783 -3.886   36.988  1.00 161.37 ? 228 PRO B CB  1 
ATOM   2379  C CG  . PRO B 2 228 ? 170.801 -2.791   37.210  1.00 162.02 ? 228 PRO B CG  1 
ATOM   2380  C CD  . PRO B 2 228 ? 171.528 -1.798   38.063  1.00 163.99 ? 228 PRO B CD  1 
ATOM   2381  N N   . ALA B 2 229 ? 174.826 -3.570   37.536  1.00 144.10 ? 229 ALA B N   1 
ATOM   2382  C CA  . ALA B 2 229 ? 176.219 -3.910   37.243  1.00 136.28 ? 229 ALA B CA  1 
ATOM   2383  C C   . ALA B 2 229 ? 176.976 -4.331   38.503  1.00 132.48 ? 229 ALA B C   1 
ATOM   2384  O O   . ALA B 2 229 ? 177.677 -5.345   38.499  1.00 128.69 ? 229 ALA B O   1 
ATOM   2385  C CB  . ALA B 2 229 ? 176.918 -2.748   36.555  1.00 136.38 ? 229 ALA B CB  1 
ATOM   2386  N N   . LEU B 2 230 ? 176.816 -3.552   39.573  1.00 131.37 ? 230 LEU B N   1 
ATOM   2387  C CA  . LEU B 2 230 ? 177.407 -3.860   40.875  1.00 133.20 ? 230 LEU B CA  1 
ATOM   2388  C C   . LEU B 2 230 ? 176.855 -5.166   41.434  1.00 137.21 ? 230 LEU B C   1 
ATOM   2389  O O   . LEU B 2 230 ? 177.603 -5.980   41.979  1.00 136.71 ? 230 LEU B O   1 
ATOM   2390  C CB  . LEU B 2 230 ? 177.138 -2.732   41.874  1.00 131.57 ? 230 LEU B CB  1 
ATOM   2391  C CG  . LEU B 2 230 ? 177.836 -1.374   41.756  1.00 131.21 ? 230 LEU B CG  1 
ATOM   2392  C CD1 . LEU B 2 230 ? 177.233 -0.401   42.758  1.00 131.87 ? 230 LEU B CD1 1 
ATOM   2393  C CD2 . LEU B 2 230 ? 179.335 -1.494   41.982  1.00 130.68 ? 230 LEU B CD2 1 
ATOM   2394  N N   . MET B 2 231 ? 175.540 -5.347   41.299  1.00 144.69 ? 231 MET B N   1 
ATOM   2395  C CA  . MET B 2 231 ? 174.855 -6.570   41.719  1.00 152.61 ? 231 MET B CA  1 
ATOM   2396  C C   . MET B 2 231 ? 175.465 -7.792   41.045  1.00 152.98 ? 231 MET B C   1 
ATOM   2397  O O   . MET B 2 231 ? 175.686 -8.820   41.690  1.00 154.99 ? 231 MET B O   1 
ATOM   2398  C CB  . MET B 2 231 ? 173.363 -6.507   41.371  1.00 160.15 ? 231 MET B CB  1 
ATOM   2399  C CG  . MET B 2 231 ? 172.538 -5.509   42.167  1.00 167.06 ? 231 MET B CG  1 
ATOM   2400  S SD  . MET B 2 231 ? 170.912 -5.253   41.422  1.00 175.98 ? 231 MET B SD  1 
ATOM   2401  C CE  . MET B 2 231 ? 170.250 -3.936   42.441  1.00 175.01 ? 231 MET B CE  1 
ATOM   2402  N N   . VAL B 2 232 ? 175.734 -7.664   39.746  1.00 151.55 ? 232 VAL B N   1 
ATOM   2403  C CA  . VAL B 2 232 ? 176.273 -8.758   38.943  1.00 150.83 ? 232 VAL B CA  1 
ATOM   2404  C C   . VAL B 2 232 ? 177.724 -9.067   39.312  1.00 152.31 ? 232 VAL B C   1 
ATOM   2405  O O   . VAL B 2 232 ? 178.034 -10.186  39.715  1.00 154.86 ? 232 VAL B O   1 
ATOM   2406  C CB  . VAL B 2 232 ? 176.146 -8.479   37.425  1.00 148.42 ? 232 VAL B CB  1 
ATOM   2407  C CG1 . VAL B 2 232 ? 176.874 -9.546   36.619  1.00 148.02 ? 232 VAL B CG1 1 
ATOM   2408  C CG2 . VAL B 2 232 ? 174.681 -8.429   37.016  1.00 147.53 ? 232 VAL B CG2 1 
ATOM   2409  N N   . ALA B 2 233 ? 178.595 -8.067   39.191  1.00 152.44 ? 233 ALA B N   1 
ATOM   2410  C CA  . ALA B 2 233 ? 180.037 -8.259   39.365  1.00 153.34 ? 233 ALA B CA  1 
ATOM   2411  C C   . ALA B 2 233 ? 180.472 -8.527   40.808  1.00 152.80 ? 233 ALA B C   1 
ATOM   2412  O O   . ALA B 2 233 ? 181.473 -9.209   41.039  1.00 153.07 ? 233 ALA B O   1 
ATOM   2413  C CB  . ALA B 2 233 ? 180.795 -7.071   38.795  1.00 155.09 ? 233 ALA B CB  1 
ATOM   2414  N N   . GLY B 2 234 ? 179.720 -7.991   41.767  1.00 151.42 ? 234 GLY B N   1 
ATOM   2415  C CA  . GLY B 2 234 ? 180.057 -8.101   43.187  1.00 149.54 ? 234 GLY B CA  1 
ATOM   2416  C C   . GLY B 2 234 ? 180.124 -9.521   43.714  1.00 148.91 ? 234 GLY B C   1 
ATOM   2417  O O   . GLY B 2 234 ? 181.203 -10.019  44.049  1.00 146.32 ? 234 GLY B O   1 
ATOM   2418  N N   . THR B 2 235 ? 178.961 -10.165  43.781  1.00 150.83 ? 235 THR B N   1 
ATOM   2419  C CA  . THR B 2 235 ? 178.842 -11.546  44.256  1.00 152.94 ? 235 THR B CA  1 
ATOM   2420  C C   . THR B 2 235 ? 179.500 -12.547  43.300  1.00 153.61 ? 235 THR B C   1 
ATOM   2421  O O   . THR B 2 235 ? 179.750 -13.697  43.670  1.00 153.55 ? 235 THR B O   1 
ATOM   2422  C CB  . THR B 2 235 ? 177.367 -11.944  44.487  1.00 153.51 ? 235 THR B CB  1 
ATOM   2423  O OG1 . THR B 2 235 ? 176.630 -11.806  43.266  1.00 154.31 ? 235 THR B OG1 1 
ATOM   2424  C CG2 . THR B 2 235 ? 176.729 -11.067  45.562  1.00 153.41 ? 235 THR B CG2 1 
ATOM   2425  N N   . LEU B 2 236 ? 179.770 -12.100  42.074  1.00 154.31 ? 236 LEU B N   1 
ATOM   2426  C CA  . LEU B 2 236 ? 180.484 -12.897  41.078  1.00 153.75 ? 236 LEU B CA  1 
ATOM   2427  C C   . LEU B 2 236 ? 181.966 -13.008  41.441  1.00 153.10 ? 236 LEU B C   1 
ATOM   2428  O O   . LEU B 2 236 ? 182.591 -14.040  41.199  1.00 154.63 ? 236 LEU B O   1 
ATOM   2429  C CB  . LEU B 2 236 ? 180.306 -12.283  39.682  1.00 153.62 ? 236 LEU B CB  1 
ATOM   2430  C CG  . LEU B 2 236 ? 180.566 -13.047  38.371  1.00 152.58 ? 236 LEU B CG  1 
ATOM   2431  C CD1 . LEU B 2 236 ? 182.011 -12.899  37.916  1.00 152.17 ? 236 LEU B CD1 1 
ATOM   2432  C CD2 . LEU B 2 236 ? 180.147 -14.511  38.436  1.00 151.71 ? 236 LEU B CD2 1 
ATOM   2433  N N   . VAL B 2 237 ? 182.514 -11.939  42.020  1.00 150.49 ? 237 VAL B N   1 
ATOM   2434  C CA  . VAL B 2 237 ? 183.885 -11.935  42.534  1.00 148.01 ? 237 VAL B CA  1 
ATOM   2435  C C   . VAL B 2 237 ? 183.920 -12.511  43.946  1.00 148.70 ? 237 VAL B C   1 
ATOM   2436  O O   . VAL B 2 237 ? 184.855 -13.229  44.310  1.00 146.40 ? 237 VAL B O   1 
ATOM   2437  C CB  . VAL B 2 237 ? 184.491 -10.515  42.537  1.00 146.41 ? 237 VAL B CB  1 
ATOM   2438  C CG1 . VAL B 2 237 ? 185.808 -10.484  43.299  1.00 145.89 ? 237 VAL B CG1 1 
ATOM   2439  C CG2 . VAL B 2 237 ? 184.697 -10.026  41.116  1.00 146.03 ? 237 VAL B CG2 1 
ATOM   2440  N N   . GLY B 2 238 ? 182.896 -12.185  44.733  1.00 151.69 ? 238 GLY B N   1 
ATOM   2441  C CA  . GLY B 2 238 ? 182.768 -12.672  46.104  1.00 157.61 ? 238 GLY B CA  1 
ATOM   2442  C C   . GLY B 2 238 ? 182.747 -14.187  46.198  1.00 162.18 ? 238 GLY B C   1 
ATOM   2443  O O   . GLY B 2 238 ? 183.557 -14.778  46.918  1.00 163.37 ? 238 GLY B O   1 
ATOM   2444  N N   . ALA B 2 239 ? 181.825 -14.810  45.461  1.00 165.37 ? 239 ALA B N   1 
ATOM   2445  C CA  . ALA B 2 239 ? 181.692 -16.271  45.422  1.00 167.22 ? 239 ALA B CA  1 
ATOM   2446  C C   . ALA B 2 239 ? 182.927 -16.937  44.820  1.00 168.66 ? 239 ALA B C   1 
ATOM   2447  O O   . ALA B 2 239 ? 183.265 -18.069  45.174  1.00 171.74 ? 239 ALA B O   1 
ATOM   2448  C CB  . ALA B 2 239 ? 180.440 -16.678  44.656  1.00 164.78 ? 239 ALA B CB  1 
ATOM   2449  N N   . ALA B 2 240 ? 183.589 -16.225  43.909  1.00 168.13 ? 240 ALA B N   1 
ATOM   2450  C CA  . ALA B 2 240 ? 184.855 -16.669  43.336  1.00 165.67 ? 240 ALA B CA  1 
ATOM   2451  C C   . ALA B 2 240 ? 185.984 -16.568  44.360  1.00 161.46 ? 240 ALA B C   1 
ATOM   2452  O O   . ALA B 2 240 ? 186.838 -17.450  44.436  1.00 162.66 ? 240 ALA B O   1 
ATOM   2453  C CB  . ALA B 2 240 ? 185.189 -15.853  42.096  1.00 167.75 ? 240 ALA B CB  1 
ATOM   2454  N N   . GLY B 2 241 ? 185.964 -15.495  45.150  1.00 154.81 ? 241 GLY B N   1 
ATOM   2455  C CA  . GLY B 2 241 ? 187.021 -15.195  46.113  1.00 147.53 ? 241 GLY B CA  1 
ATOM   2456  C C   . GLY B 2 241 ? 187.163 -16.162  47.277  1.00 143.32 ? 241 GLY B C   1 
ATOM   2457  O O   . GLY B 2 241 ? 188.279 -16.442  47.713  1.00 142.66 ? 241 GLY B O   1 
ATOM   2458  N N   . THR B 2 242 ? 186.039 -16.657  47.794  1.00 139.44 ? 242 THR B N   1 
ATOM   2459  C CA  . THR B 2 242 ? 186.059 -17.604  48.917  1.00 136.45 ? 242 THR B CA  1 
ATOM   2460  C C   . THR B 2 242 ? 186.502 -19.003  48.491  1.00 135.84 ? 242 THR B C   1 
ATOM   2461  O O   . THR B 2 242 ? 187.151 -19.708  49.264  1.00 134.69 ? 242 THR B O   1 
ATOM   2462  C CB  . THR B 2 242 ? 184.703 -17.690  49.650  1.00 135.54 ? 242 THR B CB  1 
ATOM   2463  O OG1 . THR B 2 242 ? 183.647 -17.865  48.697  1.00 136.44 ? 242 THR B OG1 1 
ATOM   2464  C CG2 . THR B 2 242 ? 184.450 -16.431  50.473  1.00 134.20 ? 242 THR B CG2 1 
ATOM   2465  N N   . LEU B 2 243 ? 186.139 -19.401  47.271  1.00 136.09 ? 243 LEU B N   1 
ATOM   2466  C CA  . LEU B 2 243 ? 186.648 -20.635  46.669  1.00 135.90 ? 243 LEU B CA  1 
ATOM   2467  C C   . LEU B 2 243 ? 188.135 -20.445  46.392  1.00 133.95 ? 243 LEU B C   1 
ATOM   2468  O O   . LEU B 2 243 ? 188.943 -21.350  46.615  1.00 133.42 ? 243 LEU B O   1 
ATOM   2469  C CB  . LEU B 2 243 ? 185.905 -20.948  45.363  1.00 137.92 ? 243 LEU B CB  1 
ATOM   2470  C CG  . LEU B 2 243 ? 185.739 -22.395  44.869  1.00 139.12 ? 243 LEU B CG  1 
ATOM   2471  C CD1 . LEU B 2 243 ? 184.849 -22.412  43.637  1.00 139.24 ? 243 LEU B CD1 1 
ATOM   2472  C CD2 . LEU B 2 243 ? 187.058 -23.093  44.556  1.00 139.51 ? 243 LEU B CD2 1 
ATOM   2473  N N   . LEU B 2 244 ? 188.475 -19.249  45.913  1.00 132.09 ? 244 LEU B N   1 
ATOM   2474  C CA  . LEU B 2 244 ? 189.851 -18.837  45.663  1.00 130.44 ? 244 LEU B CA  1 
ATOM   2475  C C   . LEU B 2 244 ? 190.671 -18.926  46.944  1.00 130.24 ? 244 LEU B C   1 
ATOM   2476  O O   . LEU B 2 244 ? 191.850 -19.270  46.907  1.00 128.90 ? 244 LEU B O   1 
ATOM   2477  C CB  . LEU B 2 244 ? 189.869 -17.396  45.151  1.00 129.87 ? 244 LEU B CB  1 
ATOM   2478  C CG  . LEU B 2 244 ? 190.715 -16.970  43.951  1.00 129.39 ? 244 LEU B CG  1 
ATOM   2479  C CD1 . LEU B 2 244 ? 190.317 -15.559  43.548  1.00 128.81 ? 244 LEU B CD1 1 
ATOM   2480  C CD2 . LEU B 2 244 ? 192.206 -17.051  44.235  1.00 128.52 ? 244 LEU B CD2 1 
ATOM   2481  N N   . THR B 2 245 ? 190.032 -18.618  48.073  1.00 131.42 ? 245 THR B N   1 
ATOM   2482  C CA  . THR B 2 245 ? 190.683 -18.658  49.382  1.00 132.78 ? 245 THR B CA  1 
ATOM   2483  C C   . THR B 2 245 ? 191.045 -20.088  49.801  1.00 133.91 ? 245 THR B C   1 
ATOM   2484  O O   . THR B 2 245 ? 192.184 -20.350  50.197  1.00 134.12 ? 245 THR B O   1 
ATOM   2485  C CB  . THR B 2 245 ? 189.813 -17.998  50.480  1.00 132.29 ? 245 THR B CB  1 
ATOM   2486  O OG1 . THR B 2 245 ? 189.314 -16.735  50.020  1.00 131.70 ? 245 THR B OG1 1 
ATOM   2487  C CG2 . THR B 2 245 ? 190.626 -17.779  51.749  1.00 131.93 ? 245 THR B CG2 1 
ATOM   2488  N N   . VAL B 2 246 ? 190.081 -21.004  49.701  1.00 134.99 ? 246 VAL B N   1 
ATOM   2489  C CA  . VAL B 2 246 ? 190.264 -22.388  50.164  1.00 135.99 ? 246 VAL B CA  1 
ATOM   2490  C C   . VAL B 2 246 ? 191.268 -23.169  49.303  1.00 138.47 ? 246 VAL B C   1 
ATOM   2491  O O   . VAL B 2 246 ? 192.118 -23.881  49.844  1.00 138.57 ? 246 VAL B O   1 
ATOM   2492  C CB  . VAL B 2 246 ? 188.921 -23.159  50.284  1.00 134.28 ? 246 VAL B CB  1 
ATOM   2493  C CG1 . VAL B 2 246 ? 189.116 -24.483  51.013  1.00 132.67 ? 246 VAL B CG1 1 
ATOM   2494  C CG2 . VAL B 2 246 ? 187.878 -22.328  51.017  1.00 133.41 ? 246 VAL B CG2 1 
ATOM   2495  N N   . LEU B 2 247 ? 191.176 -23.027  47.979  1.00 141.61 ? 247 LEU B N   1 
ATOM   2496  C CA  . LEU B 2 247 ? 192.107 -23.700  47.058  1.00 143.97 ? 247 LEU B CA  1 
ATOM   2497  C C   . LEU B 2 247 ? 193.549 -23.218  47.206  1.00 143.35 ? 247 LEU B C   1 
ATOM   2498  O O   . LEU B 2 247 ? 194.488 -23.996  47.021  1.00 143.08 ? 247 LEU B O   1 
ATOM   2499  C CB  . LEU B 2 247 ? 191.655 -23.582  45.594  1.00 146.10 ? 247 LEU B CB  1 
ATOM   2500  C CG  . LEU B 2 247 ? 191.083 -24.828  44.897  1.00 147.56 ? 247 LEU B CG  1 
ATOM   2501  C CD1 . LEU B 2 247 ? 190.452 -24.459  43.562  1.00 147.95 ? 247 LEU B CD1 1 
ATOM   2502  C CD2 . LEU B 2 247 ? 192.137 -25.913  44.697  1.00 147.17 ? 247 LEU B CD2 1 
ATOM   2503  N N   . MET B 2 248 ? 193.718 -21.941  47.539  1.00 143.65 ? 248 MET B N   1 
ATOM   2504  C CA  . MET B 2 248 ? 195.045 -21.383  47.794  1.00 145.66 ? 248 MET B CA  1 
ATOM   2505  C C   . MET B 2 248 ? 195.582 -21.831  49.154  1.00 147.30 ? 248 MET B C   1 
ATOM   2506  O O   . MET B 2 248 ? 196.791 -21.809  49.389  1.00 145.83 ? 248 MET B O   1 
ATOM   2507  C CB  . MET B 2 248 ? 195.033 -19.856  47.683  1.00 146.67 ? 248 MET B CB  1 
ATOM   2508  C CG  . MET B 2 248 ? 194.829 -19.342  46.265  1.00 147.57 ? 248 MET B CG  1 
ATOM   2509  S SD  . MET B 2 248 ? 194.797 -17.542  46.150  1.00 148.22 ? 248 MET B SD  1 
ATOM   2510  C CE  . MET B 2 248 ? 196.538 -17.186  45.928  1.00 150.85 ? 248 MET B CE  1 
ATOM   2511  N N   . ALA B 2 249 ? 194.677 -22.238  50.042  1.00 152.01 ? 249 ALA B N   1 
ATOM   2512  C CA  . ALA B 2 249 ? 195.058 -22.835  51.318  1.00 160.59 ? 249 ALA B CA  1 
ATOM   2513  C C   . ALA B 2 249 ? 195.318 -24.330  51.153  1.00 171.11 ? 249 ALA B C   1 
ATOM   2514  O O   . ALA B 2 249 ? 196.128 -24.908  51.882  1.00 169.45 ? 249 ALA B O   1 
ATOM   2515  C CB  . ALA B 2 249 ? 193.982 -22.596  52.363  1.00 158.38 ? 249 ALA B CB  1 
ATOM   2516  N N   . ARG B 2 250 ? 194.619 -24.940  50.195  1.00 188.95 ? 250 ARG B N   1 
ATOM   2517  C CA  . ARG B 2 250 ? 194.790 -26.354  49.844  1.00 210.89 ? 250 ARG B CA  1 
ATOM   2518  C C   . ARG B 2 250 ? 196.175 -26.613  49.248  1.00 218.55 ? 250 ARG B C   1 
ATOM   2519  O O   . ARG B 2 250 ? 196.775 -27.667  49.482  1.00 225.19 ? 250 ARG B O   1 
ATOM   2520  C CB  . ARG B 2 250 ? 193.689 -26.795  48.862  1.00 219.58 ? 250 ARG B CB  1 
ATOM   2521  C CG  . ARG B 2 250 ? 193.789 -28.227  48.336  1.00 227.57 ? 250 ARG B CG  1 
ATOM   2522  C CD  . ARG B 2 250 ? 193.239 -29.263  49.311  1.00 233.39 ? 250 ARG B CD  1 
ATOM   2523  N NE  . ARG B 2 250 ? 191.775 -29.272  49.364  1.00 238.95 ? 250 ARG B NE  1 
ATOM   2524  C CZ  . ARG B 2 250 ? 191.043 -28.731  50.339  1.00 241.40 ? 250 ARG B CZ  1 
ATOM   2525  N NH1 . ARG B 2 250 ? 189.719 -28.799  50.289  1.00 242.26 ? 250 ARG B NH1 1 
ATOM   2526  N NH2 . ARG B 2 250 ? 191.626 -28.126  51.368  1.00 241.71 ? 250 ARG B NH2 1 
ATOM   2527  N N   . ALA B 2 251 ? 196.672 -25.641  48.484  1.00 222.94 ? 251 ALA B N   1 
ATOM   2528  C CA  . ALA B 2 251 ? 197.980 -25.737  47.837  1.00 223.92 ? 251 ALA B CA  1 
ATOM   2529  C C   . ALA B 2 251 ? 199.142 -25.577  48.824  1.00 219.55 ? 251 ALA B C   1 
ATOM   2530  O O   . ALA B 2 251 ? 200.158 -26.268  48.710  1.00 224.77 ? 251 ALA B O   1 
ATOM   2531  C CB  . ALA B 2 251 ? 198.088 -24.720  46.709  1.00 227.16 ? 251 ALA B CB  1 
ATOM   2532  N N   . MET B 2 252 ? 198.980 -24.677  49.795  1.00 206.83 ? 252 MET B N   1 
ATOM   2533  C CA  . MET B 2 252 ? 200.025 -24.389  50.786  1.00 191.88 ? 252 MET B CA  1 
ATOM   2534  C C   . MET B 2 252 ? 200.135 -25.456  51.879  1.00 178.67 ? 252 MET B C   1 
ATOM   2535  O O   . MET B 2 252 ? 200.876 -25.288  52.856  1.00 172.37 ? 252 MET B O   1 
ATOM   2536  C CB  . MET B 2 252 ? 199.802 -23.010  51.413  1.00 195.70 ? 252 MET B CB  1 
ATOM   2537  C CG  . MET B 2 252 ? 200.063 -21.849  50.466  1.00 199.96 ? 252 MET B CG  1 
ATOM   2538  S SD  . MET B 2 252 ? 200.191 -20.266  51.318  1.00 204.03 ? 252 MET B SD  1 
ATOM   2539  C CE  . MET B 2 252 ? 201.770 -20.446  52.149  1.00 205.59 ? 252 MET B CE  1 
ATOM   2540  N N   . ASN B 2 253 ? 199.400 -26.553  51.694  1.00 168.84 ? 253 ASN B N   1 
ATOM   2541  C CA  . ASN B 2 253 ? 199.374 -27.686  52.624  1.00 160.90 ? 253 ASN B CA  1 
ATOM   2542  C C   . ASN B 2 253 ? 199.050 -27.253  54.053  1.00 156.70 ? 253 ASN B C   1 
ATOM   2543  O O   . ASN B 2 253 ? 199.819 -27.465  54.997  1.00 149.12 ? 253 ASN B O   1 
ATOM   2544  C CB  . ASN B 2 253 ? 200.665 -28.505  52.523  1.00 159.69 ? 253 ASN B CB  1 
ATOM   2545  C CG  . ASN B 2 253 ? 200.908 -29.033  51.118  1.00 159.87 ? 253 ASN B CG  1 
ATOM   2546  O OD1 . ASN B 2 253 ? 201.860 -28.629  50.450  1.00 158.91 ? 253 ASN B OD1 1 
ATOM   2547  N ND2 . ASN B 2 253 ? 200.036 -29.928  50.658  1.00 159.98 ? 253 ASN B ND2 1 
ATOM   2548  N N   . ARG B 2 254 ? 197.900 -26.612  54.166  1.00 158.72 ? 254 ARG B N   1 
ATOM   2549  C CA  . ARG B 2 254 ? 197.428 -25.976  55.380  1.00 164.10 ? 254 ARG B CA  1 
ATOM   2550  C C   . ARG B 2 254 ? 195.910 -25.863  55.243  1.00 169.82 ? 254 ARG B C   1 
ATOM   2551  O O   . ARG B 2 254 ? 195.323 -26.429  54.318  1.00 169.00 ? 254 ARG B O   1 
ATOM   2552  C CB  . ARG B 2 254 ? 198.055 -24.585  55.490  1.00 164.58 ? 254 ARG B CB  1 
ATOM   2553  C CG  . ARG B 2 254 ? 198.406 -24.138  56.898  1.00 168.60 ? 254 ARG B CG  1 
ATOM   2554  C CD  . ARG B 2 254 ? 199.887 -23.822  57.042  1.00 172.33 ? 254 ARG B CD  1 
ATOM   2555  N NE  . ARG B 2 254 ? 200.119 -22.759  58.021  1.00 178.40 ? 254 ARG B NE  1 
ATOM   2556  C CZ  . ARG B 2 254 ? 200.583 -21.544  57.731  1.00 180.67 ? 254 ARG B CZ  1 
ATOM   2557  N NH1 . ARG B 2 254 ? 200.647 -20.615  58.679  1.00 180.62 ? 254 ARG B NH1 1 
ATOM   2558  N NH2 . ARG B 2 254 ? 200.990 -21.253  56.502  1.00 183.10 ? 254 ARG B NH2 1 
ATOM   2559  N N   . SER B 2 255 ? 195.256 -25.162  56.164  1.00 180.18 ? 255 SER B N   1 
ATOM   2560  C CA  . SER B 2 255 ? 193.838 -24.821  56.038  1.00 192.66 ? 255 SER B CA  1 
ATOM   2561  C C   . SER B 2 255 ? 193.608 -23.356  56.413  1.00 203.82 ? 255 SER B C   1 
ATOM   2562  O O   . SER B 2 255 ? 194.412 -22.767  57.140  1.00 207.35 ? 255 SER B O   1 
ATOM   2563  C CB  . SER B 2 255 ? 192.964 -25.759  56.877  1.00 191.37 ? 255 SER B CB  1 
ATOM   2564  O OG  . SER B 2 255 ? 193.422 -25.839  58.215  1.00 191.35 ? 255 SER B OG  1 
ATOM   2565  N N   . VAL B 2 256 ? 192.511 -22.781  55.915  1.00 216.01 ? 256 VAL B N   1 
ATOM   2566  C CA  . VAL B 2 256 ? 192.214 -21.343  56.069  1.00 224.26 ? 256 VAL B CA  1 
ATOM   2567  C C   . VAL B 2 256 ? 192.192 -20.847  57.519  1.00 221.63 ? 256 VAL B C   1 
ATOM   2568  O O   . VAL B 2 256 ? 192.472 -19.676  57.783  1.00 218.40 ? 256 VAL B O   1 
ATOM   2569  C CB  . VAL B 2 256 ? 190.888 -20.934  55.371  1.00 231.57 ? 256 VAL B CB  1 
ATOM   2570  C CG1 . VAL B 2 256 ? 190.993 -21.118  53.859  1.00 236.78 ? 256 VAL B CG1 1 
ATOM   2571  C CG2 . VAL B 2 256 ? 189.698 -21.717  55.934  1.00 235.79 ? 256 VAL B CG2 1 
ATOM   2572  N N   . TRP B 2 257 ? 191.862 -21.743  58.445  1.00 221.08 ? 257 TRP B N   1 
ATOM   2573  C CA  . TRP B 2 257 ? 191.778 -21.401  59.858  1.00 220.93 ? 257 TRP B CA  1 
ATOM   2574  C C   . TRP B 2 257 ? 193.152 -21.247  60.508  1.00 221.31 ? 257 TRP B C   1 
ATOM   2575  O O   . TRP B 2 257 ? 193.302 -20.484  61.461  1.00 222.94 ? 257 TRP B O   1 
ATOM   2576  C CB  . TRP B 2 257 ? 190.942 -22.435  60.616  1.00 222.15 ? 257 TRP B CB  1 
ATOM   2577  C CG  . TRP B 2 257 ? 190.532 -21.965  61.973  1.00 225.08 ? 257 TRP B CG  1 
ATOM   2578  C CD1 . TRP B 2 257 ? 190.970 -22.444  63.174  1.00 225.53 ? 257 TRP B CD1 1 
ATOM   2579  C CD2 . TRP B 2 257 ? 189.615 -20.905  62.271  1.00 227.76 ? 257 TRP B CD2 1 
ATOM   2580  N NE1 . TRP B 2 257 ? 190.375 -21.754  64.204  1.00 228.89 ? 257 TRP B NE1 1 
ATOM   2581  C CE2 . TRP B 2 257 ? 189.540 -20.803  63.678  1.00 230.79 ? 257 TRP B CE2 1 
ATOM   2582  C CE3 . TRP B 2 257 ? 188.845 -20.032  61.487  1.00 227.00 ? 257 TRP B CE3 1 
ATOM   2583  C CZ2 . TRP B 2 257 ? 188.725 -19.863  64.320  1.00 233.83 ? 257 TRP B CZ2 1 
ATOM   2584  C CZ3 . TRP B 2 257 ? 188.036 -19.098  62.125  1.00 229.13 ? 257 TRP B CZ3 1 
ATOM   2585  C CH2 . TRP B 2 257 ? 187.983 -19.022  63.529  1.00 233.05 ? 257 TRP B CH2 1 
ATOM   2586  N N   . SER B 2 258 ? 194.143 -21.970  59.989  1.00 221.65 ? 258 SER B N   1 
ATOM   2587  C CA  . SER B 2 258 ? 195.516 -21.889  60.499  1.00 221.53 ? 258 SER B CA  1 
ATOM   2588  C C   . SER B 2 258 ? 196.150 -20.528  60.175  1.00 221.85 ? 258 SER B C   1 
ATOM   2589  O O   . SER B 2 258 ? 196.877 -19.970  60.995  1.00 222.32 ? 258 SER B O   1 
ATOM   2590  C CB  . SER B 2 258 ? 196.373 -23.016  59.919  1.00 20.00  ? 258 SER B CB  1 
ATOM   2591  O OG  . SER B 2 258 ? 196.498 -22.890  58.513  1.00 20.00  ? 258 SER B OG  1 
ATOM   2592  N N   . VAL B 2 259 ? 195.853 -19.992  58.993  1.00 221.26 ? 259 VAL B N   1 
ATOM   2593  C CA  . VAL B 2 259 ? 196.405 -18.704  58.562  1.00 218.79 ? 259 VAL B CA  1 
ATOM   2594  C C   . VAL B 2 259 ? 195.719 -17.499  59.207  1.00 212.51 ? 259 VAL B C   1 
ATOM   2595  O O   . VAL B 2 259 ? 196.356 -16.466  59.425  1.00 208.66 ? 259 VAL B O   1 
ATOM   2596  C CB  . VAL B 2 259 ? 196.317 -18.553  57.032  1.00 20.00  ? 259 VAL B CB  1 
ATOM   2597  C CG1 . VAL B 2 259 ? 196.802 -17.177  56.603  1.00 20.00  ? 259 VAL B CG1 1 
ATOM   2598  C CG2 . VAL B 2 259 ? 197.117 -19.647  56.342  1.00 20.00  ? 259 VAL B CG2 1 
ATOM   2599  N N   . LEU B 2 260 ? 194.426 -17.640  59.508  1.00 208.16 ? 260 LEU B N   1 
ATOM   2600  C CA  . LEU B 2 260 ? 193.643 -16.588  60.171  1.00 206.44 ? 260 LEU B CA  1 
ATOM   2601  C C   . LEU B 2 260 ? 194.243 -16.214  61.537  1.00 208.28 ? 260 LEU B C   1 
ATOM   2602  O O   . LEU B 2 260 ? 194.016 -15.109  62.043  1.00 205.69 ? 260 LEU B O   1 
ATOM   2603  C CB  . LEU B 2 260 ? 192.188 -17.033  60.342  1.00 20.00  ? 260 LEU B CB  1 
ATOM   2604  C CG  . LEU B 2 260 ? 191.390 -17.247  59.053  1.00 20.00  ? 260 LEU B CG  1 
ATOM   2605  C CD1 . LEU B 2 260 ? 190.018 -17.826  59.363  1.00 20.00  ? 260 LEU B CD1 1 
ATOM   2606  C CD2 . LEU B 2 260 ? 191.265 -15.947  58.275  1.00 20.00  ? 260 LEU B CD2 1 
ATOM   2607  N N   . VAL B 2 261 ? 195.024 -17.129  62.115  1.00 213.42 ? 261 VAL B N   1 
ATOM   2608  C CA  . VAL B 2 261 ? 195.731 -16.853  63.371  1.00 216.27 ? 261 VAL B CA  1 
ATOM   2609  C C   . VAL B 2 261 ? 197.203 -17.310  63.458  1.00 206.40 ? 261 VAL B C   1 
ATOM   2610  O O   . VAL B 2 261 ? 198.080 -16.482  63.705  1.00 205.37 ? 261 VAL B O   1 
ATOM   2611  C CB  . VAL B 2 261 ? 194.977 -17.493  64.551  1.00 20.00  ? 261 VAL B CB  1 
ATOM   2612  C CG1 . VAL B 2 261 ? 195.731 -17.265  65.852  1.00 20.00  ? 261 VAL B CG1 1 
ATOM   2613  C CG2 . VAL B 2 261 ? 193.563 -16.939  64.643  1.00 20.00  ? 261 VAL B CG2 1 
ATOM   2614  N N   . GLY B 2 262 ? 197.464 -18.605  63.250  1.00 194.96 ? 262 GLY B N   1 
ATOM   2615  C CA  . GLY B 2 262 ? 198.770 -19.249  63.553  1.00 182.38 ? 262 GLY B CA  1 
ATOM   2616  C C   . GLY B 2 262 ? 199.407 -18.706  64.851  1.00 179.77 ? 262 GLY B C   1 
ATOM   2617  O O   . GLY B 2 262 ? 200.628 -18.532  64.959  1.00 177.37 ? 262 GLY B O   1 
ATOM   2618  N N   . GLY B 2 263 ? 198.543 -18.469  65.838  1.00 178.35 ? 263 GLY B N   1 
ATOM   2619  C CA  . GLY B 2 263 ? 198.900 -17.760  67.063  1.00 176.62 ? 263 GLY B CA  1 
ATOM   2620  C C   . GLY B 2 263 ? 198.071 -16.492  67.195  1.00 175.46 ? 263 GLY B C   1 
ATOM   2621  O O   . GLY B 2 263 ? 198.385 -15.474  66.574  1.00 176.21 ? 263 GLY B O   1 
ATOM   2622  N N   . LYS B 2 274 ? 216.602 -31.984  54.704  1.00 193.60 ? 274 LYS B N   1 
ATOM   2623  C CA  . LYS B 2 274 ? 216.884 -30.519  54.824  1.00 196.31 ? 274 LYS B CA  1 
ATOM   2624  C C   . LYS B 2 274 ? 215.639 -29.653  54.590  1.00 198.73 ? 274 LYS B C   1 
ATOM   2625  O O   . LYS B 2 274 ? 215.537 -28.543  55.123  1.00 198.03 ? 274 LYS B O   1 
ATOM   2626  C CB  . LYS B 2 274 ? 218.003 -30.119  53.869  1.00 194.74 ? 274 LYS B CB  1 
ATOM   2627  N N   . GLY B 2 275 ? 214.702 -30.168  53.793  1.00 201.54 ? 275 GLY B N   1 
ATOM   2628  C CA  . GLY B 2 275 ? 213.458 -29.462  53.468  1.00 202.66 ? 275 GLY B CA  1 
ATOM   2629  C C   . GLY B 2 275 ? 212.219 -30.193  53.957  1.00 203.18 ? 275 GLY B C   1 
ATOM   2630  O O   . GLY B 2 275 ? 212.074 -30.435  55.157  1.00 206.86 ? 275 GLY B O   1 
ATOM   2631  N N   . SER B 2 276 ? 211.325 -30.537  53.026  1.00 200.77 ? 276 SER B N   1 
ATOM   2632  C CA  . SER B 2 276 ? 210.097 -31.285  53.340  1.00 197.53 ? 276 SER B CA  1 
ATOM   2633  C C   . SER B 2 276 ? 209.461 -31.941  52.108  1.00 192.45 ? 276 SER B C   1 
ATOM   2634  O O   . SER B 2 276 ? 209.830 -31.642  50.971  1.00 191.46 ? 276 SER B O   1 
ATOM   2635  C CB  . SER B 2 276 ? 209.070 -30.386  54.041  1.00 201.51 ? 276 SER B CB  1 
ATOM   2636  O OG  . SER B 2 276 ? 207.982 -31.149  54.537  1.00 204.12 ? 276 SER B OG  1 
ATOM   2637  N N   . LEU B 2 277 ? 208.503 -32.834  52.356  1.00 187.41 ? 277 LEU B N   1 
ATOM   2638  C CA  . LEU B 2 277 ? 207.750 -33.517  51.301  1.00 186.69 ? 277 LEU B CA  1 
ATOM   2639  C C   . LEU B 2 277 ? 206.638 -32.632  50.736  1.00 190.15 ? 277 LEU B C   1 
ATOM   2640  O O   . LEU B 2 277 ? 206.061 -31.820  51.462  1.00 193.52 ? 277 LEU B O   1 
ATOM   2641  C CB  . LEU B 2 277 ? 207.163 -34.821  51.845  1.00 183.47 ? 277 LEU B CB  1 
ATOM   2642  C CG  . LEU B 2 277 ? 207.970 -36.128  51.802  1.00 183.02 ? 277 LEU B CG  1 
ATOM   2643  C CD1 . LEU B 2 277 ? 209.444 -35.944  51.463  1.00 182.17 ? 277 LEU B CD1 1 
ATOM   2644  C CD2 . LEU B 2 277 ? 207.805 -36.879  53.115  1.00 183.46 ? 277 LEU B CD2 1 
ATOM   2645  N N   . LYS B 2 278 ? 206.340 -32.795  49.445  1.00 192.76 ? 278 LYS B N   1 
ATOM   2646  C CA  . LYS B 2 278 ? 205.380 -31.928  48.741  1.00 195.00 ? 278 LYS B CA  1 
ATOM   2647  C C   . LYS B 2 278 ? 204.345 -32.710  47.911  1.00 197.64 ? 278 LYS B C   1 
ATOM   2648  O O   . LYS B 2 278 ? 204.670 -33.201  46.825  1.00 199.08 ? 278 LYS B O   1 
ATOM   2649  C CB  . LYS B 2 278 ? 206.120 -30.929  47.838  1.00 192.89 ? 278 LYS B CB  1 
ATOM   2650  C CG  . LYS B 2 278 ? 207.187 -30.096  48.534  1.00 192.30 ? 278 LYS B CG  1 
ATOM   2651  C CD  . LYS B 2 278 ? 208.120 -29.438  47.529  1.00 192.32 ? 278 LYS B CD  1 
ATOM   2652  C CE  . LYS B 2 278 ? 209.328 -28.807  48.207  1.00 191.92 ? 278 LYS B CE  1 
ATOM   2653  N NZ  . LYS B 2 278 ? 210.299 -29.817  48.715  1.00 190.46 ? 278 LYS B NZ  1 
ATOM   2654  N N   . PRO B 2 279 ? 203.094 -32.822  48.414  1.00 198.72 ? 279 PRO B N   1 
ATOM   2655  C CA  . PRO B 2 279 ? 202.031 -33.524  47.684  1.00 195.20 ? 279 PRO B CA  1 
ATOM   2656  C C   . PRO B 2 279 ? 201.396 -32.669  46.589  1.00 189.38 ? 279 PRO B C   1 
ATOM   2657  O O   . PRO B 2 279 ? 200.983 -31.533  46.843  1.00 188.09 ? 279 PRO B O   1 
ATOM   2658  C CB  . PRO B 2 279 ? 200.987 -33.843  48.771  1.00 196.46 ? 279 PRO B CB  1 
ATOM   2659  C CG  . PRO B 2 279 ? 201.582 -33.402  50.071  1.00 200.10 ? 279 PRO B CG  1 
ATOM   2660  C CD  . PRO B 2 279 ? 202.623 -32.377  49.736  1.00 201.35 ? 279 PRO B CD  1 
ATOM   2661  N N   . ILE B 2 280 ? 201.326 -33.228  45.383  1.00 182.71 ? 280 ILE B N   1 
ATOM   2662  C CA  . ILE B 2 280 ? 200.697 -32.568  44.241  1.00 174.46 ? 280 ILE B CA  1 
ATOM   2663  C C   . ILE B 2 280 ? 199.559 -33.441  43.691  1.00 166.33 ? 280 ILE B C   1 
ATOM   2664  O O   . ILE B 2 280 ? 199.673 -34.670  43.653  1.00 168.76 ? 280 ILE B O   1 
ATOM   2665  C CB  . ILE B 2 280 ? 201.743 -32.195  43.150  1.00 174.97 ? 280 ILE B CB  1 
ATOM   2666  C CG1 . ILE B 2 280 ? 201.252 -31.019  42.297  1.00 174.32 ? 280 ILE B CG1 1 
ATOM   2667  C CG2 . ILE B 2 280 ? 202.139 -33.399  42.297  1.00 175.96 ? 280 ILE B CG2 1 
ATOM   2668  C CD1 . ILE B 2 280 ? 202.342 -30.315  41.513  1.00 172.71 ? 280 ILE B CD1 1 
ATOM   2669  N N   . ASP B 2 281 ? 198.456 -32.807  43.297  1.00 153.72 ? 281 ASP B N   1 
ATOM   2670  C CA  . ASP B 2 281 ? 197.317 -33.526  42.724  1.00 140.21 ? 281 ASP B CA  1 
ATOM   2671  C C   . ASP B 2 281 ? 197.635 -33.949  41.288  1.00 135.13 ? 281 ASP B C   1 
ATOM   2672  O O   . ASP B 2 281 ? 198.522 -33.378  40.647  1.00 134.42 ? 281 ASP B O   1 
ATOM   2673  C CB  . ASP B 2 281 ? 196.051 -32.664  42.771  1.00 135.18 ? 281 ASP B CB  1 
ATOM   2674  C CG  . ASP B 2 281 ? 194.783 -33.491  42.903  1.00 130.72 ? 281 ASP B CG  1 
ATOM   2675  O OD1 . ASP B 2 281 ? 194.489 -33.960  44.024  1.00 128.46 ? 281 ASP B OD1 1 
ATOM   2676  O OD2 . ASP B 2 281 ? 194.072 -33.660  41.893  1.00 129.00 ? 281 ASP B OD2 1 
ATOM   2677  N N   . VAL B 2 282 ? 196.910 -34.950  40.794  1.00 128.99 ? 282 VAL B N   1 
ATOM   2678  C CA  . VAL B 2 282 ? 197.142 -35.508  39.455  1.00 124.79 ? 282 VAL B CA  1 
ATOM   2679  C C   . VAL B 2 282 ? 197.018 -34.486  38.320  1.00 123.48 ? 282 VAL B C   1 
ATOM   2680  O O   . VAL B 2 282 ? 197.634 -34.645  37.264  1.00 123.21 ? 282 VAL B O   1 
ATOM   2681  C CB  . VAL B 2 282 ? 196.224 -36.719  39.169  1.00 123.56 ? 282 VAL B CB  1 
ATOM   2682  C CG1 . VAL B 2 282 ? 196.754 -37.958  39.874  1.00 122.52 ? 282 VAL B CG1 1 
ATOM   2683  C CG2 . VAL B 2 282 ? 194.785 -36.430  39.581  1.00 122.72 ? 282 VAL B CG2 1 
ATOM   2684  N N   . GLU B 2 283 ? 196.231 -33.439  38.551  1.00 122.01 ? 283 GLU B N   1 
ATOM   2685  C CA  . GLU B 2 283 ? 195.989 -32.408  37.544  1.00 119.99 ? 283 GLU B CA  1 
ATOM   2686  C C   . GLU B 2 283 ? 197.137 -31.400  37.403  1.00 115.67 ? 283 GLU B C   1 
ATOM   2687  O O   . GLU B 2 283 ? 197.545 -31.079  36.284  1.00 114.11 ? 283 GLU B O   1 
ATOM   2688  C CB  . GLU B 2 283 ? 194.657 -31.696  37.813  1.00 122.97 ? 283 GLU B CB  1 
ATOM   2689  C CG  . GLU B 2 283 ? 193.434 -32.386  37.209  1.00 123.83 ? 283 GLU B CG  1 
ATOM   2690  C CD  . GLU B 2 283 ? 192.904 -33.551  38.035  1.00 122.94 ? 283 GLU B CD  1 
ATOM   2691  O OE1 . GLU B 2 283 ? 193.033 -33.526  39.279  1.00 122.75 ? 283 GLU B OE1 1 
ATOM   2692  O OE2 . GLU B 2 283 ? 192.339 -34.494  37.436  1.00 121.92 ? 283 GLU B OE2 1 
ATOM   2693  N N   . ASP B 2 284 ? 197.658 -30.917  38.532  1.00 111.17 ? 284 ASP B N   1 
ATOM   2694  C CA  . ASP B 2 284 ? 198.723 -29.904  38.540  1.00 107.05 ? 284 ASP B CA  1 
ATOM   2695  C C   . ASP B 2 284 ? 200.027 -30.397  37.922  1.00 104.82 ? 284 ASP B C   1 
ATOM   2696  O O   . ASP B 2 284 ? 200.860 -29.596  37.493  1.00 103.66 ? 284 ASP B O   1 
ATOM   2697  C CB  . ASP B 2 284 ? 198.979 -29.393  39.959  1.00 106.93 ? 284 ASP B CB  1 
ATOM   2698  C CG  . ASP B 2 284 ? 197.785 -28.671  40.543  1.00 107.40 ? 284 ASP B CG  1 
ATOM   2699  O OD1 . ASP B 2 284 ? 197.144 -27.884  39.814  1.00 107.07 ? 284 ASP B OD1 1 
ATOM   2700  O OD2 . ASP B 2 284 ? 197.489 -28.884  41.737  1.00 107.98 ? 284 ASP B OD2 1 
ATOM   2701  N N   . ALA B 2 285 ? 200.200 -31.715  37.895  1.00 103.31 ? 285 ALA B N   1 
ATOM   2702  C CA  . ALA B 2 285 ? 201.335 -32.330  37.221  1.00 102.43 ? 285 ALA B CA  1 
ATOM   2703  C C   . ALA B 2 285 ? 201.156 -32.241  35.709  1.00 101.61 ? 285 ALA B C   1 
ATOM   2704  O O   . ALA B 2 285 ? 202.095 -31.899  34.993  1.00 101.59 ? 285 ALA B O   1 
ATOM   2705  C CB  . ALA B 2 285 ? 201.507 -33.772  37.669  1.00 102.32 ? 285 ALA B CB  1 
ATOM   2706  N N   . ALA B 2 286 ? 199.942 -32.527  35.237  1.00 100.92 ? 286 ALA B N   1 
ATOM   2707  C CA  . ALA B 2 286 ? 199.597 -32.380  33.823  1.00 101.36 ? 286 ALA B CA  1 
ATOM   2708  C C   . ALA B 2 286 ? 199.696 -30.921  33.383  1.00 102.75 ? 286 ALA B C   1 
ATOM   2709  O O   . ALA B 2 286 ? 199.872 -30.631  32.199  1.00 101.89 ? 286 ALA B O   1 
ATOM   2710  C CB  . ALA B 2 286 ? 198.203 -32.924  33.556  1.00 100.66 ? 286 ALA B CB  1 
ATOM   2711  N N   . VAL B 2 287 ? 199.582 -30.016  34.353  1.00 106.31 ? 287 VAL B N   1 
ATOM   2712  C CA  . VAL B 2 287 ? 199.750 -28.581  34.137  1.00 111.83 ? 287 VAL B CA  1 
ATOM   2713  C C   . VAL B 2 287 ? 201.180 -28.262  33.706  1.00 117.08 ? 287 VAL B C   1 
ATOM   2714  O O   . VAL B 2 287 ? 201.400 -27.672  32.647  1.00 116.17 ? 287 VAL B O   1 
ATOM   2715  C CB  . VAL B 2 287 ? 199.385 -27.785  35.411  1.00 111.40 ? 287 VAL B CB  1 
ATOM   2716  C CG1 . VAL B 2 287 ? 199.915 -26.358  35.351  1.00 112.26 ? 287 VAL B CG1 1 
ATOM   2717  C CG2 . VAL B 2 287 ? 197.880 -27.794  35.628  1.00 111.93 ? 287 VAL B CG2 1 
ATOM   2718  N N   . MET B 2 288 ? 202.146 -28.666  34.528  1.00 126.87 ? 288 MET B N   1 
ATOM   2719  C CA  . MET B 2 288 ? 203.557 -28.441  34.232  1.00 136.84 ? 288 MET B CA  1 
ATOM   2720  C C   . MET B 2 288 ? 203.990 -29.227  32.997  1.00 137.95 ? 288 MET B C   1 
ATOM   2721  O O   . MET B 2 288 ? 204.961 -28.858  32.333  1.00 138.83 ? 288 MET B O   1 
ATOM   2722  C CB  . MET B 2 288 ? 204.429 -28.823  35.431  1.00 147.11 ? 288 MET B CB  1 
ATOM   2723  C CG  . MET B 2 288 ? 204.098 -28.082  36.719  1.00 155.69 ? 288 MET B CG  1 
ATOM   2724  S SD  . MET B 2 288 ? 205.369 -28.293  37.982  1.00 167.10 ? 288 MET B SD  1 
ATOM   2725  C CE  . MET B 2 288 ? 206.588 -27.099  37.433  1.00 164.04 ? 288 MET B CE  1 
ATOM   2726  N N   . LEU B 2 289 ? 203.251 -30.294  32.690  1.00 138.36 ? 289 LEU B N   1 
ATOM   2727  C CA  . LEU B 2 289 ? 203.568 -31.188  31.573  1.00 139.53 ? 289 LEU B CA  1 
ATOM   2728  C C   . LEU B 2 289 ? 202.967 -30.758  30.227  1.00 143.78 ? 289 LEU B C   1 
ATOM   2729  O O   . LEU B 2 289 ? 203.461 -31.162  29.173  1.00 147.00 ? 289 LEU B O   1 
ATOM   2730  C CB  . LEU B 2 289 ? 203.164 -32.633  31.902  1.00 134.67 ? 289 LEU B CB  1 
ATOM   2731  C CG  . LEU B 2 289 ? 203.971 -33.392  32.966  1.00 130.98 ? 289 LEU B CG  1 
ATOM   2732  C CD1 . LEU B 2 289 ? 203.219 -34.631  33.427  1.00 129.52 ? 289 LEU B CD1 1 
ATOM   2733  C CD2 . LEU B 2 289 ? 205.363 -33.765  32.474  1.00 129.19 ? 289 LEU B CD2 1 
ATOM   2734  N N   . ALA B 2 290 ? 201.912 -29.947  30.257  1.00 146.49 ? 290 ALA B N   1 
ATOM   2735  C CA  . ALA B 2 290 ? 201.286 -29.471  29.019  1.00 149.52 ? 290 ALA B CA  1 
ATOM   2736  C C   . ALA B 2 290 ? 202.063 -28.315  28.387  1.00 153.10 ? 290 ALA B C   1 
ATOM   2737  O O   . ALA B 2 290 ? 201.789 -27.921  27.249  1.00 149.30 ? 290 ALA B O   1 
ATOM   2738  C CB  . ALA B 2 290 ? 199.840 -29.069  29.273  1.00 148.57 ? 290 ALA B CB  1 
ATOM   2739  N N   . TYR B 2 291 ? 203.044 -27.794  29.124  1.00 162.02 ? 291 TYR B N   1 
ATOM   2740  C CA  . TYR B 2 291 ? 203.706 -26.539  28.767  1.00 172.51 ? 291 TYR B CA  1 
ATOM   2741  C C   . TYR B 2 291 ? 205.232 -26.562  28.835  1.00 175.48 ? 291 TYR B C   1 
ATOM   2742  O O   . TYR B 2 291 ? 205.886 -25.537  28.629  1.00 175.79 ? 291 TYR B O   1 
ATOM   2743  C CB  . TYR B 2 291 ? 203.139 -25.404  29.624  1.00 179.33 ? 291 TYR B CB  1 
ATOM   2744  C CG  . TYR B 2 291 ? 201.669 -25.194  29.363  1.00 184.73 ? 291 TYR B CG  1 
ATOM   2745  C CD1 . TYR B 2 291 ? 201.239 -24.582  28.187  1.00 187.64 ? 291 TYR B CD1 1 
ATOM   2746  C CD2 . TYR B 2 291 ? 200.705 -25.642  30.265  1.00 185.75 ? 291 TYR B CD2 1 
ATOM   2747  C CE1 . TYR B 2 291 ? 199.893 -24.401  27.924  1.00 185.80 ? 291 TYR B CE1 1 
ATOM   2748  C CE2 . TYR B 2 291 ? 199.353 -25.465  30.008  1.00 185.48 ? 291 TYR B CE2 1 
ATOM   2749  C CZ  . TYR B 2 291 ? 198.958 -24.841  28.835  1.00 183.83 ? 291 TYR B CZ  1 
ATOM   2750  O OH  . TYR B 2 291 ? 197.631 -24.654  28.550  1.00 178.71 ? 291 TYR B OH  1 
ATOM   2751  N N   . ALA B 2 292 ? 205.795 -27.733  29.110  1.00 180.92 ? 292 ALA B N   1 
ATOM   2752  C CA  . ALA B 2 292 ? 207.244 -27.889  29.132  1.00 186.16 ? 292 ALA B CA  1 
ATOM   2753  C C   . ALA B 2 292 ? 207.815 -28.025  27.714  1.00 186.90 ? 292 ALA B C   1 
ATOM   2754  O O   . ALA B 2 292 ? 207.083 -27.920  26.721  1.00 182.72 ? 292 ALA B O   1 
ATOM   2755  C CB  . ALA B 2 292 ? 207.633 -29.078  29.999  1.00 191.17 ? 292 ALA B CB  1 
ATOM   2756  N N   . GLY B 2 293 ? 209.127 -28.247  27.635  1.00 189.00 ? 293 GLY B N   1 
ATOM   2757  C CA  . GLY B 2 293 ? 209.829 -28.415  26.361  1.00 186.33 ? 293 GLY B CA  1 
ATOM   2758  C C   . GLY B 2 293 ? 210.812 -29.576  26.349  1.00 182.11 ? 293 GLY B C   1 
ATOM   2759  O O   . GLY B 2 293 ? 210.990 -30.233  25.320  1.00 183.77 ? 293 GLY B O   1 
ATOM   2760  N N   . LYS B 2 294 ? 211.456 -29.825  27.489  1.00 174.22 ? 294 LYS B N   1 
ATOM   2761  C CA  . LYS B 2 294 ? 212.402 -30.931  27.624  1.00 164.48 ? 294 LYS B CA  1 
ATOM   2762  C C   . LYS B 2 294 ? 212.059 -31.799  28.830  1.00 166.65 ? 294 LYS B C   1 
ATOM   2763  O O   . LYS B 2 294 ? 212.373 -31.452  29.972  1.00 161.76 ? 294 LYS B O   1 
ATOM   2764  C CB  . LYS B 2 294 ? 213.834 -30.410  27.724  1.00 155.77 ? 294 LYS B CB  1 
ATOM   2765  C CG  . LYS B 2 294 ? 214.890 -31.478  27.526  1.00 147.64 ? 294 LYS B CG  1 
ATOM   2766  C CD  . LYS B 2 294 ? 216.231 -30.839  27.233  1.00 144.20 ? 294 LYS B CD  1 
ATOM   2767  C CE  . LYS B 2 294 ? 217.247 -31.864  26.776  1.00 142.87 ? 294 LYS B CE  1 
ATOM   2768  N NZ  . LYS B 2 294 ? 218.463 -31.168  26.276  1.00 143.26 ? 294 LYS B NZ  1 
ATOM   2769  N N   . VAL B 2 295 ? 211.409 -32.925  28.554  1.00 175.06 ? 295 VAL B N   1 
ATOM   2770  C CA  . VAL B 2 295 ? 210.949 -33.848  29.590  1.00 186.75 ? 295 VAL B CA  1 
ATOM   2771  C C   . VAL B 2 295 ? 211.686 -35.179  29.455  1.00 195.02 ? 295 VAL B C   1 
ATOM   2772  O O   . VAL B 2 295 ? 211.952 -35.638  28.340  1.00 194.79 ? 295 VAL B O   1 
ATOM   2773  C CB  . VAL B 2 295 ? 209.419 -34.079  29.509  1.00 188.15 ? 295 VAL B CB  1 
ATOM   2774  C CG1 . VAL B 2 295 ? 208.929 -34.948  30.660  1.00 188.97 ? 295 VAL B CG1 1 
ATOM   2775  C CG2 . VAL B 2 295 ? 208.673 -32.753  29.513  1.00 190.52 ? 295 VAL B CG2 1 
ATOM   2776  N N   . VAL B 2 296 ? 212.021 -35.779  30.598  1.00 207.14 ? 296 VAL B N   1 
ATOM   2777  C CA  . VAL B 2 296 ? 212.708 -37.073  30.649  1.00 214.93 ? 296 VAL B CA  1 
ATOM   2778  C C   . VAL B 2 296 ? 212.057 -38.009  31.682  1.00 210.15 ? 296 VAL B C   1 
ATOM   2779  O O   . VAL B 2 296 ? 212.018 -37.698  32.877  1.00 213.80 ? 296 VAL B O   1 
ATOM   2780  C CB  . VAL B 2 296 ? 214.221 -36.911  30.954  1.00 223.39 ? 296 VAL B CB  1 
ATOM   2781  C CG1 . VAL B 2 296 ? 214.903 -38.268  31.067  1.00 227.71 ? 296 VAL B CG1 1 
ATOM   2782  C CG2 . VAL B 2 296 ? 214.911 -36.065  29.889  1.00 226.48 ? 296 VAL B CG2 1 
ATOM   2783  N N   . PHE B 2 297 ? 211.548 -39.148  31.212  1.00 200.68 ? 297 PHE B N   1 
ATOM   2784  C CA  . PHE B 2 297 ? 210.930 -40.147  32.087  1.00 189.14 ? 297 PHE B CA  1 
ATOM   2785  C C   . PHE B 2 297 ? 211.981 -41.052  32.722  1.00 172.89 ? 297 PHE B C   1 
ATOM   2786  O O   . PHE B 2 297 ? 212.831 -41.613  32.026  1.00 168.87 ? 297 PHE B O   1 
ATOM   2787  C CB  . PHE B 2 297 ? 209.905 -40.995  31.322  1.00 201.34 ? 297 PHE B CB  1 
ATOM   2788  C CG  . PHE B 2 297 ? 208.643 -40.257  30.955  1.00 211.68 ? 297 PHE B CG  1 
ATOM   2789  C CD1 . PHE B 2 297 ? 207.721 -39.889  31.934  1.00 214.96 ? 297 PHE B CD1 1 
ATOM   2790  C CD2 . PHE B 2 297 ? 208.363 -39.948  29.626  1.00 216.35 ? 297 PHE B CD2 1 
ATOM   2791  C CE1 . PHE B 2 297 ? 206.555 -39.216  31.595  1.00 218.07 ? 297 PHE B CE1 1 
ATOM   2792  C CE2 . PHE B 2 297 ? 207.197 -39.276  29.282  1.00 218.53 ? 297 PHE B CE2 1 
ATOM   2793  C CZ  . PHE B 2 297 ? 206.293 -38.910  30.268  1.00 218.94 ? 297 PHE B CZ  1 
ATOM   2794  N N   . VAL B 2 298 ? 211.921 -41.183  34.045  1.00 157.40 ? 298 VAL B N   1 
ATOM   2795  C CA  . VAL B 2 298 ? 212.838 -42.058  34.769  1.00 147.39 ? 298 VAL B CA  1 
ATOM   2796  C C   . VAL B 2 298 ? 212.067 -43.226  35.387  1.00 141.06 ? 298 VAL B C   1 
ATOM   2797  O O   . VAL B 2 298 ? 211.502 -43.096  36.477  1.00 137.07 ? 298 VAL B O   1 
ATOM   2798  C CB  . VAL B 2 298 ? 213.644 -41.309  35.853  1.00 147.14 ? 298 VAL B CB  1 
ATOM   2799  C CG1 . VAL B 2 298 ? 214.801 -42.171  36.332  1.00 147.80 ? 298 VAL B CG1 1 
ATOM   2800  C CG2 . VAL B 2 298 ? 214.170 -39.982  35.323  1.00 146.86 ? 298 VAL B CG2 1 
ATOM   2801  N N   . PRO B 2 299 ? 212.040 -44.372  34.683  1.00 137.58 ? 299 PRO B N   1 
ATOM   2802  C CA  . PRO B 2 299 ? 211.298 -45.530  35.163  1.00 137.09 ? 299 PRO B CA  1 
ATOM   2803  C C   . PRO B 2 299 ? 212.088 -46.385  36.149  1.00 138.49 ? 299 PRO B C   1 
ATOM   2804  O O   . PRO B 2 299 ? 213.308 -46.523  36.025  1.00 138.02 ? 299 PRO B O   1 
ATOM   2805  C CB  . PRO B 2 299 ? 211.001 -46.308  33.881  1.00 135.73 ? 299 PRO B CB  1 
ATOM   2806  C CG  . PRO B 2 299 ? 212.100 -45.942  32.941  1.00 134.86 ? 299 PRO B CG  1 
ATOM   2807  C CD  . PRO B 2 299 ? 212.689 -44.630  33.383  1.00 136.04 ? 299 PRO B CD  1 
ATOM   2808  N N   . GLY B 2 300 ? 211.378 -46.942  37.125  1.00 141.05 ? 300 GLY B N   1 
ATOM   2809  C CA  . GLY B 2 300 ? 211.968 -47.838  38.110  1.00 145.08 ? 300 GLY B CA  1 
ATOM   2810  C C   . GLY B 2 300 ? 211.164 -49.112  38.270  1.00 147.58 ? 300 GLY B C   1 
ATOM   2811  O O   . GLY B 2 300 ? 210.327 -49.443  37.424  1.00 147.42 ? 300 GLY B O   1 
ATOM   2812  N N   . TYR B 2 301 ? 211.415 -49.820  39.368  1.00 150.01 ? 301 TYR B N   1 
ATOM   2813  C CA  . TYR B 2 301 ? 210.768 -51.104  39.638  1.00 150.46 ? 301 TYR B CA  1 
ATOM   2814  C C   . TYR B 2 301 ? 209.268 -50.973  39.916  1.00 139.14 ? 301 TYR B C   1 
ATOM   2815  O O   . TYR B 2 301 ? 208.506 -51.916  39.696  1.00 136.35 ? 301 TYR B O   1 
ATOM   2816  C CB  . TYR B 2 301 ? 211.475 -51.827  40.790  1.00 164.90 ? 301 TYR B CB  1 
ATOM   2817  C CG  . TYR B 2 301 ? 210.924 -53.206  41.082  1.00 178.91 ? 301 TYR B CG  1 
ATOM   2818  C CD1 . TYR B 2 301 ? 211.038 -54.237  40.146  1.00 183.32 ? 301 TYR B CD1 1 
ATOM   2819  C CD2 . TYR B 2 301 ? 210.286 -53.481  42.291  1.00 186.65 ? 301 TYR B CD2 1 
ATOM   2820  C CE1 . TYR B 2 301 ? 210.530 -55.502  40.407  1.00 189.94 ? 301 TYR B CE1 1 
ATOM   2821  C CE2 . TYR B 2 301 ? 209.777 -54.743  42.563  1.00 193.00 ? 301 TYR B CE2 1 
ATOM   2822  C CZ  . TYR B 2 301 ? 209.902 -55.750  41.619  1.00 193.17 ? 301 TYR B CZ  1 
ATOM   2823  O OH  . TYR B 2 301 ? 209.399 -57.006  41.880  1.00 195.07 ? 301 TYR B OH  1 
ATOM   2824  N N   . GLY B 2 302 ? 208.853 -49.801  40.390  1.00 128.87 ? 302 GLY B N   1 
ATOM   2825  C CA  . GLY B 2 302 ? 207.443 -49.521  40.648  1.00 117.78 ? 302 GLY B CA  1 
ATOM   2826  C C   . GLY B 2 302 ? 206.567 -49.615  39.415  1.00 111.24 ? 302 GLY B C   1 
ATOM   2827  O O   . GLY B 2 302 ? 205.421 -50.064  39.492  1.00 110.08 ? 302 GLY B O   1 
ATOM   2828  N N   . MET B 2 303 ? 207.116 -49.186  38.280  1.00 105.46 ? 303 MET B N   1 
ATOM   2829  C CA  . MET B 2 303 ? 206.445 -49.271  36.985  1.00 99.79  ? 303 MET B CA  1 
ATOM   2830  C C   . MET B 2 303 ? 206.143 -50.721  36.633  1.00 97.81  ? 303 MET B C   1 
ATOM   2831  O O   . MET B 2 303 ? 205.089 -51.028  36.072  1.00 96.36  ? 303 MET B O   1 
ATOM   2832  C CB  . MET B 2 303 ? 207.327 -48.657  35.897  1.00 97.56  ? 303 MET B CB  1 
ATOM   2833  C CG  . MET B 2 303 ? 206.719 -48.690  34.504  1.00 95.03  ? 303 MET B CG  1 
ATOM   2834  S SD  . MET B 2 303 ? 207.925 -49.137  33.244  1.00 92.97  ? 303 MET B SD  1 
ATOM   2835  C CE  . MET B 2 303 ? 208.142 -50.878  33.591  1.00 92.54  ? 303 MET B CE  1 
ATOM   2836  N N   . ALA B 2 304 ? 207.085 -51.600  36.966  1.00 97.10  ? 304 ALA B N   1 
ATOM   2837  C CA  . ALA B 2 304 ? 206.952 -53.026  36.706  1.00 98.27  ? 304 ALA B CA  1 
ATOM   2838  C C   . ALA B 2 304 ? 205.820 -53.662  37.519  1.00 99.35  ? 304 ALA B C   1 
ATOM   2839  O O   . ALA B 2 304 ? 204.958 -54.331  36.950  1.00 101.26 ? 304 ALA B O   1 
ATOM   2840  C CB  . ALA B 2 304 ? 208.274 -53.737  36.960  1.00 98.11  ? 304 ALA B CB  1 
ATOM   2841  N N   . LEU B 2 305 ? 205.813 -53.437  38.836  1.00 99.15  ? 305 LEU B N   1 
ATOM   2842  C CA  . LEU B 2 305 ? 204.789 -54.013  39.725  1.00 98.82  ? 305 LEU B CA  1 
ATOM   2843  C C   . LEU B 2 305 ? 203.385 -53.545  39.337  1.00 100.50 ? 305 LEU B C   1 
ATOM   2844  O O   . LEU B 2 305 ? 202.396 -54.254  39.555  1.00 99.57  ? 305 LEU B O   1 
ATOM   2845  C CB  . LEU B 2 305 ? 205.075 -53.658  41.192  1.00 96.41  ? 305 LEU B CB  1 
ATOM   2846  C CG  . LEU B 2 305 ? 204.864 -54.708  42.301  1.00 94.34  ? 305 LEU B CG  1 
ATOM   2847  C CD1 . LEU B 2 305 ? 205.409 -54.182  43.621  1.00 93.53  ? 305 LEU B CD1 1 
ATOM   2848  C CD2 . LEU B 2 305 ? 203.411 -55.147  42.476  1.00 93.04  ? 305 LEU B CD2 1 
ATOM   2849  N N   . SER B 2 306 ? 203.317 -52.351  38.754  1.00 102.96 ? 306 SER B N   1 
ATOM   2850  C CA  . SER B 2 306 ? 202.064 -51.759  38.301  1.00 105.05 ? 306 SER B CA  1 
ATOM   2851  C C   . SER B 2 306 ? 201.718 -52.137  36.859  1.00 106.24 ? 306 SER B C   1 
ATOM   2852  O O   . SER B 2 306 ? 200.580 -51.942  36.424  1.00 107.49 ? 306 SER B O   1 
ATOM   2853  C CB  . SER B 2 306 ? 202.131 -50.238  38.434  1.00 104.66 ? 306 SER B CB  1 
ATOM   2854  O OG  . SER B 2 306 ? 200.921 -49.623  38.024  1.00 104.51 ? 306 SER B OG  1 
ATOM   2855  N N   . GLN B 2 307 ? 202.698 -52.674  36.129  1.00 106.85 ? 307 GLN B N   1 
ATOM   2856  C CA  . GLN B 2 307 ? 202.552 -52.977  34.698  1.00 106.28 ? 307 GLN B CA  1 
ATOM   2857  C C   . GLN B 2 307 ? 202.154 -51.710  33.933  1.00 102.49 ? 307 GLN B C   1 
ATOM   2858  O O   . GLN B 2 307 ? 201.277 -51.729  33.063  1.00 100.75 ? 307 GLN B O   1 
ATOM   2859  C CB  . GLN B 2 307 ? 201.550 -54.123  34.469  1.00 109.71 ? 307 GLN B CB  1 
ATOM   2860  C CG  . GLN B 2 307 ? 201.931 -55.439  35.138  1.00 113.46 ? 307 GLN B CG  1 
ATOM   2861  C CD  . GLN B 2 307 ? 203.120 -56.114  34.474  1.00 117.26 ? 307 GLN B CD  1 
ATOM   2862  O OE1 . GLN B 2 307 ? 203.008 -56.641  33.366  1.00 120.43 ? 307 GLN B OE1 1 
ATOM   2863  N NE2 . GLN B 2 307 ? 204.261 -56.110  35.155  1.00 119.41 ? 307 GLN B NE2 1 
ATOM   2864  N N   . ALA B 2 308 ? 202.832 -50.615  34.269  1.00 99.16  ? 308 ALA B N   1 
ATOM   2865  C CA  . ALA B 2 308 ? 202.454 -49.280  33.825  1.00 97.34  ? 308 ALA B CA  1 
ATOM   2866  C C   . ALA B 2 308 ? 202.840 -48.969  32.386  1.00 97.16  ? 308 ALA B C   1 
ATOM   2867  O O   . ALA B 2 308 ? 202.183 -48.160  31.734  1.00 96.81  ? 308 ALA B O   1 
ATOM   2868  C CB  . ALA B 2 308 ? 203.040 -48.236  34.764  1.00 96.65  ? 308 ALA B CB  1 
ATOM   2869  N N   . GLN B 2 309 ? 203.895 -49.624  31.904  1.00 98.10  ? 309 GLN B N   1 
ATOM   2870  C CA  . GLN B 2 309 ? 204.518 -49.346  30.596  1.00 100.22 ? 309 GLN B CA  1 
ATOM   2871  C C   . GLN B 2 309 ? 203.597 -48.854  29.468  1.00 101.34 ? 309 GLN B C   1 
ATOM   2872  O O   . GLN B 2 309 ? 204.003 -48.028  28.649  1.00 101.58 ? 309 GLN B O   1 
ATOM   2873  C CB  . GLN B 2 309 ? 205.341 -50.551  30.116  1.00 100.90 ? 309 GLN B CB  1 
ATOM   2874  C CG  . GLN B 2 309 ? 204.554 -51.838  29.902  1.00 101.92 ? 309 GLN B CG  1 
ATOM   2875  C CD  . GLN B 2 309 ? 204.108 -52.482  31.200  1.00 102.85 ? 309 GLN B CD  1 
ATOM   2876  O OE1 . GLN B 2 309 ? 204.795 -52.398  32.221  1.00 103.30 ? 309 GLN B OE1 1 
ATOM   2877  N NE2 . GLN B 2 309 ? 202.947 -53.126  31.169  1.00 103.85 ? 309 GLN B NE2 1 
ATOM   2878  N N   . HIS B 2 310 ? 202.372 -49.373  29.427  1.00 102.96 ? 310 HIS B N   1 
ATOM   2879  C CA  . HIS B 2 310 ? 201.423 -49.047  28.363  1.00 105.87 ? 310 HIS B CA  1 
ATOM   2880  C C   . HIS B 2 310 ? 200.718 -47.705  28.553  1.00 109.67 ? 310 HIS B C   1 
ATOM   2881  O O   . HIS B 2 310 ? 200.319 -47.066  27.577  1.00 110.30 ? 310 HIS B O   1 
ATOM   2882  C CB  . HIS B 2 310 ? 200.398 -50.167  28.205  1.00 104.30 ? 310 HIS B CB  1 
ATOM   2883  C CG  . HIS B 2 310 ? 201.003 -51.485  27.840  1.00 103.42 ? 310 HIS B CG  1 
ATOM   2884  N ND1 . HIS B 2 310 ? 201.647 -51.702  26.640  1.00 103.48 ? 310 HIS B ND1 1 
ATOM   2885  C CD2 . HIS B 2 310 ? 201.066 -52.655  28.517  1.00 102.99 ? 310 HIS B CD2 1 
ATOM   2886  C CE1 . HIS B 2 310 ? 202.080 -52.949  26.595  1.00 103.27 ? 310 HIS B CE1 1 
ATOM   2887  N NE2 . HIS B 2 310 ? 201.740 -53.549  27.721  1.00 103.09 ? 310 HIS B NE2 1 
ATOM   2888  N N   . LYS B 2 311 ? 200.561 -47.292  29.808  1.00 114.14 ? 311 LYS B N   1 
ATOM   2889  C CA  . LYS B 2 311 ? 199.975 -45.990  30.128  1.00 118.33 ? 311 LYS B CA  1 
ATOM   2890  C C   . LYS B 2 311 ? 201.035 -44.886  30.102  1.00 122.04 ? 311 LYS B C   1 
ATOM   2891  O O   . LYS B 2 311 ? 200.712 -43.700  30.010  1.00 121.04 ? 311 LYS B O   1 
ATOM   2892  C CB  . LYS B 2 311 ? 199.273 -46.033  31.491  1.00 117.87 ? 311 LYS B CB  1 
ATOM   2893  C CG  . LYS B 2 311 ? 198.188 -47.097  31.614  1.00 116.79 ? 311 LYS B CG  1 
ATOM   2894  C CD  . LYS B 2 311 ? 197.003 -46.810  30.703  1.00 115.98 ? 311 LYS B CD  1 
ATOM   2895  C CE  . LYS B 2 311 ? 195.977 -47.928  30.763  1.00 115.27 ? 311 LYS B CE  1 
ATOM   2896  N NZ  . LYS B 2 311 ? 194.765 -47.600  29.963  1.00 114.76 ? 311 LYS B NZ  1 
ATOM   2897  N N   . LEU B 2 312 ? 202.301 -45.292  30.181  1.00 127.44 ? 312 LEU B N   1 
ATOM   2898  C CA  . LEU B 2 312 ? 203.429 -44.370  30.107  1.00 131.80 ? 312 LEU B CA  1 
ATOM   2899  C C   . LEU B 2 312 ? 203.718 -43.970  28.661  1.00 131.57 ? 312 LEU B C   1 
ATOM   2900  O O   . LEU B 2 312 ? 203.815 -42.781  28.347  1.00 131.12 ? 312 LEU B O   1 
ATOM   2901  C CB  . LEU B 2 312 ? 204.673 -45.001  30.744  1.00 136.82 ? 312 LEU B CB  1 
ATOM   2902  C CG  . LEU B 2 312 ? 205.963 -44.177  30.810  1.00 140.59 ? 312 LEU B CG  1 
ATOM   2903  C CD1 . LEU B 2 312 ? 205.859 -43.074  31.854  1.00 142.11 ? 312 LEU B CD1 1 
ATOM   2904  C CD2 . LEU B 2 312 ? 207.153 -45.080  31.101  1.00 143.01 ? 312 LEU B CD2 1 
ATOM   2905  N N   . LYS B 2 313 ? 203.852 -44.974  27.793  1.00 131.33 ? 313 LYS B N   1 
ATOM   2906  C CA  . LYS B 2 313 ? 204.117 -44.770  26.368  1.00 130.43 ? 313 LYS B CA  1 
ATOM   2907  C C   . LYS B 2 313 ? 202.974 -44.000  25.702  1.00 127.22 ? 313 LYS B C   1 
ATOM   2908  O O   . LYS B 2 313 ? 203.195 -43.224  24.770  1.00 129.13 ? 313 LYS B O   1 
ATOM   2909  C CB  . LYS B 2 313 ? 204.333 -46.123  25.678  1.00 132.86 ? 313 LYS B CB  1 
ATOM   2910  C CG  . LYS B 2 313 ? 205.136 -46.064  24.387  1.00 136.39 ? 313 LYS B CG  1 
ATOM   2911  C CD  . LYS B 2 313 ? 204.250 -45.986  23.154  1.00 140.59 ? 313 LYS B CD  1 
ATOM   2912  C CE  . LYS B 2 313 ? 205.088 -45.859  21.890  1.00 144.10 ? 313 LYS B CE  1 
ATOM   2913  N NZ  . LYS B 2 313 ? 204.248 -45.634  20.681  1.00 147.18 ? 313 LYS B NZ  1 
ATOM   2914  N N   . GLU B 2 314 ? 201.759 -44.224  26.201  1.00 121.25 ? 314 GLU B N   1 
ATOM   2915  C CA  . GLU B 2 314 ? 200.554 -43.527  25.755  1.00 114.67 ? 314 GLU B CA  1 
ATOM   2916  C C   . GLU B 2 314 ? 200.627 -42.033  26.066  1.00 113.77 ? 314 GLU B C   1 
ATOM   2917  O O   . GLU B 2 314 ? 200.164 -41.198  25.282  1.00 111.61 ? 314 GLU B O   1 
ATOM   2918  C CB  . GLU B 2 314 ? 199.340 -44.146  26.444  1.00 110.50 ? 314 GLU B CB  1 
ATOM   2919  C CG  . GLU B 2 314 ? 197.999 -43.551  26.059  1.00 106.83 ? 314 GLU B CG  1 
ATOM   2920  C CD  . GLU B 2 314 ? 196.877 -44.048  26.948  1.00 105.66 ? 314 GLU B CD  1 
ATOM   2921  O OE1 . GLU B 2 314 ? 196.891 -45.237  27.332  1.00 104.13 ? 314 GLU B OE1 1 
ATOM   2922  O OE2 . GLU B 2 314 ? 195.977 -43.245  27.263  1.00 105.83 ? 314 GLU B OE2 1 
ATOM   2923  N N   . LEU B 2 315 ? 201.207 -41.713  27.219  1.00 114.54 ? 315 LEU B N   1 
ATOM   2924  C CA  . LEU B 2 315 ? 201.406 -40.335  27.645  1.00 116.16 ? 315 LEU B CA  1 
ATOM   2925  C C   . LEU B 2 315 ? 202.536 -39.663  26.860  1.00 115.96 ? 315 LEU B C   1 
ATOM   2926  O O   . LEU B 2 315 ? 202.431 -38.489  26.501  1.00 115.31 ? 315 LEU B O   1 
ATOM   2927  C CB  . LEU B 2 315 ? 201.682 -40.290  29.152  1.00 118.44 ? 315 LEU B CB  1 
ATOM   2928  C CG  . LEU B 2 315 ? 201.726 -38.950  29.895  1.00 120.97 ? 315 LEU B CG  1 
ATOM   2929  C CD1 . LEU B 2 315 ? 200.590 -38.020  29.490  1.00 122.42 ? 315 LEU B CD1 1 
ATOM   2930  C CD2 . LEU B 2 315 ? 201.715 -39.189  31.398  1.00 121.53 ? 315 LEU B CD2 1 
ATOM   2931  N N   . ALA B 2 316 ? 203.602 -40.419  26.594  1.00 115.94 ? 316 ALA B N   1 
ATOM   2932  C CA  . ALA B 2 316 ? 204.765 -39.924  25.849  1.00 115.55 ? 316 ALA B CA  1 
ATOM   2933  C C   . ALA B 2 316 ? 204.418 -39.532  24.412  1.00 115.52 ? 316 ALA B C   1 
ATOM   2934  O O   . ALA B 2 316 ? 204.947 -38.548  23.887  1.00 115.19 ? 316 ALA B O   1 
ATOM   2935  C CB  . ALA B 2 316 ? 205.886 -40.954  25.865  1.00 115.05 ? 316 ALA B CB  1 
ATOM   2936  N N   . ASP B 2 317 ? 203.533 -40.309  23.788  1.00 115.82 ? 317 ASP B N   1 
ATOM   2937  C CA  . ASP B 2 317 ? 203.035 -40.015  22.443  1.00 114.41 ? 317 ASP B CA  1 
ATOM   2938  C C   . ASP B 2 317 ? 202.157 -38.771  22.440  1.00 110.15 ? 317 ASP B C   1 
ATOM   2939  O O   . ASP B 2 317 ? 202.179 -37.992  21.486  1.00 109.70 ? 317 ASP B O   1 
ATOM   2940  C CB  . ASP B 2 317 ? 202.245 -41.201  21.882  1.00 118.31 ? 317 ASP B CB  1 
ATOM   2941  C CG  . ASP B 2 317 ? 203.135 -42.355  21.451  1.00 121.27 ? 317 ASP B CG  1 
ATOM   2942  O OD1 . ASP B 2 317 ? 204.272 -42.111  20.984  1.00 122.49 ? 317 ASP B OD1 1 
ATOM   2943  O OD2 . ASP B 2 317 ? 202.682 -43.513  21.567  1.00 123.52 ? 317 ASP B OD2 1 
ATOM   2944  N N   . LEU B 2 318 ? 201.385 -38.597  23.512  1.00 105.09 ? 318 LEU B N   1 
ATOM   2945  C CA  . LEU B 2 318 ? 200.564 -37.406  23.700  1.00 101.42 ? 318 LEU B CA  1 
ATOM   2946  C C   . LEU B 2 318 ? 201.434 -36.157  23.848  1.00 102.37 ? 318 LEU B C   1 
ATOM   2947  O O   . LEU B 2 318 ? 200.982 -35.041  23.583  1.00 102.03 ? 318 LEU B O   1 
ATOM   2948  C CB  . LEU B 2 318 ? 199.651 -37.573  24.919  1.00 97.76  ? 318 LEU B CB  1 
ATOM   2949  C CG  . LEU B 2 318 ? 198.709 -36.421  25.283  1.00 95.64  ? 318 LEU B CG  1 
ATOM   2950  C CD1 . LEU B 2 318 ? 197.644 -36.208  24.215  1.00 95.15  ? 318 LEU B CD1 1 
ATOM   2951  C CD2 . LEU B 2 318 ? 198.071 -36.676  26.637  1.00 94.89  ? 318 LEU B CD2 1 
ATOM   2952  N N   . LEU B 2 319 ? 202.682 -36.359  24.266  1.00 104.62 ? 319 LEU B N   1 
ATOM   2953  C CA  . LEU B 2 319 ? 203.646 -35.270  24.405  1.00 107.75 ? 319 LEU B CA  1 
ATOM   2954  C C   . LEU B 2 319 ? 204.407 -34.990  23.105  1.00 110.32 ? 319 LEU B C   1 
ATOM   2955  O O   . LEU B 2 319 ? 204.621 -33.829  22.752  1.00 111.22 ? 319 LEU B O   1 
ATOM   2956  C CB  . LEU B 2 319 ? 204.618 -35.554  25.553  1.00 107.79 ? 319 LEU B CB  1 
ATOM   2957  C CG  . LEU B 2 319 ? 204.041 -35.618  26.970  1.00 108.43 ? 319 LEU B CG  1 
ATOM   2958  C CD1 . LEU B 2 319 ? 205.021 -36.302  27.911  1.00 108.83 ? 319 LEU B CD1 1 
ATOM   2959  C CD2 . LEU B 2 319 ? 203.661 -34.238  27.489  1.00 109.26 ? 319 LEU B CD2 1 
ATOM   2960  N N   . GLU B 2 320 ? 204.807 -36.053  22.401  1.00 113.23 ? 320 GLU B N   1 
ATOM   2961  C CA  . GLU B 2 320 ? 205.471 -35.942  21.089  1.00 116.01 ? 320 GLU B CA  1 
ATOM   2962  C C   . GLU B 2 320 ? 204.631 -35.186  20.061  1.00 118.38 ? 320 GLU B C   1 
ATOM   2963  O O   . GLU B 2 320 ? 205.170 -34.512  19.175  1.00 115.74 ? 320 GLU B O   1 
ATOM   2964  C CB  . GLU B 2 320 ? 205.809 -37.328  20.528  1.00 115.92 ? 320 GLU B CB  1 
ATOM   2965  C CG  . GLU B 2 320 ? 207.239 -37.790  20.766  1.00 115.86 ? 320 GLU B CG  1 
ATOM   2966  C CD  . GLU B 2 320 ? 207.667 -38.893  19.809  1.00 115.39 ? 320 GLU B CD  1 
ATOM   2967  O OE1 . GLU B 2 320 ? 206.935 -39.898  19.671  1.00 113.91 ? 320 GLU B OE1 1 
ATOM   2968  O OE2 . GLU B 2 320 ? 208.745 -38.759  19.192  1.00 116.12 ? 320 GLU B OE2 1 
ATOM   2969  N N   . ALA B 2 321 ? 203.312 -35.324  20.183  1.00 123.90 ? 321 ALA B N   1 
ATOM   2970  C CA  . ALA B 2 321 ? 202.355 -34.647  19.313  1.00 129.46 ? 321 ALA B CA  1 
ATOM   2971  C C   . ALA B 2 321 ? 202.322 -33.144  19.582  1.00 132.36 ? 321 ALA B C   1 
ATOM   2972  O O   . ALA B 2 321 ? 202.355 -32.341  18.645  1.00 132.01 ? 321 ALA B O   1 
ATOM   2973  C CB  . ALA B 2 321 ? 200.969 -35.251  19.484  1.00 131.50 ? 321 ALA B CB  1 
ATOM   2974  N N   . ARG B 2 322 ? 202.265 -32.773  20.862  1.00 135.66 ? 322 ARG B N   1 
ATOM   2975  C CA  . ARG B 2 322 ? 202.345 -31.372  21.281  1.00 138.01 ? 322 ARG B CA  1 
ATOM   2976  C C   . ARG B 2 322 ? 203.730 -30.789  20.993  1.00 143.74 ? 322 ARG B C   1 
ATOM   2977  O O   . ARG B 2 322 ? 204.033 -29.656  21.380  1.00 144.98 ? 322 ARG B O   1 
ATOM   2978  C CB  . ARG B 2 322 ? 202.008 -31.232  22.768  1.00 132.53 ? 322 ARG B CB  1 
ATOM   2979  C CG  . ARG B 2 322 ? 200.524 -31.313  23.076  1.00 125.68 ? 322 ARG B CG  1 
ATOM   2980  C CD  . ARG B 2 322 ? 200.257 -31.030  24.543  1.00 119.92 ? 322 ARG B CD  1 
ATOM   2981  N NE  . ARG B 2 322 ? 198.930 -30.455  24.737  1.00 114.46 ? 322 ARG B NE  1 
ATOM   2982  C CZ  . ARG B 2 322 ? 198.650 -29.160  24.617  1.00 111.48 ? 322 ARG B CZ  1 
ATOM   2983  N NH1 . ARG B 2 322 ? 199.601 -28.287  24.303  1.00 108.52 ? 322 ARG B NH1 1 
ATOM   2984  N NH2 . ARG B 2 322 ? 197.412 -28.731  24.808  1.00 110.64 ? 322 ARG B NH2 1 
ATOM   2985  N N   . GLY B 2 323 ? 204.560 -31.582  20.315  1.00 149.43 ? 323 GLY B N   1 
ATOM   2986  C CA  . GLY B 2 323 ? 205.898 -31.172  19.905  1.00 156.59 ? 323 GLY B CA  1 
ATOM   2987  C C   . GLY B 2 323 ? 206.944 -31.262  21.000  1.00 162.27 ? 323 GLY B C   1 
ATOM   2988  O O   . GLY B 2 323 ? 208.107 -30.928  20.775  1.00 165.45 ? 323 GLY B O   1 
ATOM   2989  N N   . VAL B 2 324 ? 206.533 -31.723  22.180  1.00 165.87 ? 324 VAL B N   1 
ATOM   2990  C CA  . VAL B 2 324 ? 207.405 -31.777  23.357  1.00 169.58 ? 324 VAL B CA  1 
ATOM   2991  C C   . VAL B 2 324 ? 208.505 -32.835  23.193  1.00 172.09 ? 324 VAL B C   1 
ATOM   2992  O O   . VAL B 2 324 ? 208.227 -33.973  22.805  1.00 172.89 ? 324 VAL B O   1 
ATOM   2993  C CB  . VAL B 2 324 ? 206.589 -32.028  24.649  1.00 169.82 ? 324 VAL B CB  1 
ATOM   2994  C CG1 . VAL B 2 324 ? 207.473 -31.913  25.882  1.00 172.43 ? 324 VAL B CG1 1 
ATOM   2995  C CG2 . VAL B 2 324 ? 205.424 -31.048  24.746  1.00 168.55 ? 324 VAL B CG2 1 
ATOM   2996  N N   . GLU B 2 325 ? 209.748 -32.441  23.480  1.00 174.64 ? 325 GLU B N   1 
ATOM   2997  C CA  . GLU B 2 325 ? 210.907 -33.331  23.358  1.00 176.24 ? 325 GLU B CA  1 
ATOM   2998  C C   . GLU B 2 325 ? 210.957 -34.341  24.503  1.00 178.58 ? 325 GLU B C   1 
ATOM   2999  O O   . GLU B 2 325 ? 211.283 -33.996  25.645  1.00 175.47 ? 325 GLU B O   1 
ATOM   3000  C CB  . GLU B 2 325 ? 212.216 -32.535  23.295  1.00 174.38 ? 325 GLU B CB  1 
ATOM   3001  C CG  . GLU B 2 325 ? 213.397 -33.334  22.758  1.00 173.03 ? 325 GLU B CG  1 
ATOM   3002  C CD  . GLU B 2 325 ? 214.683 -33.084  23.527  1.00 171.65 ? 325 GLU B CD  1 
ATOM   3003  O OE1 . GLU B 2 325 ? 215.738 -32.889  22.880  1.00 173.59 ? 325 GLU B OE1 1 
ATOM   3004  O OE2 . GLU B 2 325 ? 214.646 -33.089  24.777  1.00 168.29 ? 325 GLU B OE2 1 
ATOM   3005  N N   . VAL B 2 326 ? 210.636 -35.590  24.175  1.00 184.78 ? 326 VAL B N   1 
ATOM   3006  C CA  . VAL B 2 326 ? 210.578 -36.676  25.149  1.00 190.73 ? 326 VAL B CA  1 
ATOM   3007  C C   . VAL B 2 326 ? 211.783 -37.607  24.983  1.00 196.93 ? 326 VAL B C   1 
ATOM   3008  O O   . VAL B 2 326 ? 212.065 -38.079  23.878  1.00 202.62 ? 326 VAL B O   1 
ATOM   3009  C CB  . VAL B 2 326 ? 209.264 -37.486  25.010  1.00 189.01 ? 326 VAL B CB  1 
ATOM   3010  C CG1 . VAL B 2 326 ? 209.098 -38.461  26.167  1.00 189.22 ? 326 VAL B CG1 1 
ATOM   3011  C CG2 . VAL B 2 326 ? 208.060 -36.559  24.936  1.00 186.80 ? 326 VAL B CG2 1 
ATOM   3012  N N   . LYS B 2 327 ? 212.495 -37.849  26.085  1.00 198.98 ? 327 LYS B N   1 
ATOM   3013  C CA  . LYS B 2 327 ? 213.601 -38.816  26.131  1.00 199.03 ? 327 LYS B CA  1 
ATOM   3014  C C   . LYS B 2 327 ? 213.469 -39.736  27.356  1.00 203.67 ? 327 LYS B C   1 
ATOM   3015  O O   . LYS B 2 327 ? 212.926 -39.327  28.384  1.00 207.92 ? 327 LYS B O   1 
ATOM   3016  C CB  . LYS B 2 327 ? 214.961 -38.100  26.138  1.00 189.92 ? 327 LYS B CB  1 
ATOM   3017  C CG  . LYS B 2 327 ? 215.413 -37.569  24.782  1.00 179.51 ? 327 LYS B CG  1 
ATOM   3018  C CD  . LYS B 2 327 ? 216.879 -37.155  24.800  1.00 168.92 ? 327 LYS B CD  1 
ATOM   3019  C CE  . LYS B 2 327 ? 217.381 -36.824  23.403  1.00 162.58 ? 327 LYS B CE  1 
ATOM   3020  N NZ  . LYS B 2 327 ? 218.841 -36.527  23.387  1.00 156.46 ? 327 LYS B NZ  1 
ATOM   3021  N N   . PHE B 2 328 ? 213.958 -40.972  27.240  1.00 204.97 ? 328 PHE B N   1 
ATOM   3022  C CA  . PHE B 2 328 ? 213.894 -41.944  28.340  1.00 202.35 ? 328 PHE B CA  1 
ATOM   3023  C C   . PHE B 2 328 ? 215.279 -42.219  28.931  1.00 196.36 ? 328 PHE B C   1 
ATOM   3024  O O   . PHE B 2 328 ? 216.225 -42.522  28.198  1.00 197.14 ? 328 PHE B O   1 
ATOM   3025  C CB  . PHE B 2 328 ? 213.252 -43.262  27.874  1.00 207.22 ? 328 PHE B CB  1 
ATOM   3026  C CG  . PHE B 2 328 ? 211.773 -43.167  27.593  1.00 211.52 ? 328 PHE B CG  1 
ATOM   3027  C CD1 . PHE B 2 328 ? 211.309 -42.815  26.327  1.00 213.47 ? 328 PHE B CD1 1 
ATOM   3028  C CD2 . PHE B 2 328 ? 210.840 -43.452  28.588  1.00 212.90 ? 328 PHE B CD2 1 
ATOM   3029  C CE1 . PHE B 2 328 ? 209.948 -42.734  26.063  1.00 213.93 ? 328 PHE B CE1 1 
ATOM   3030  C CE2 . PHE B 2 328 ? 209.477 -43.373  28.328  1.00 214.24 ? 328 PHE B CE2 1 
ATOM   3031  C CZ  . PHE B 2 328 ? 209.031 -43.014  27.065  1.00 213.78 ? 328 PHE B CZ  1 
ATOM   3032  N N   . ALA B 2 329 ? 215.391 -42.108  30.254  1.00 188.24 ? 329 ALA B N   1 
ATOM   3033  C CA  . ALA B 2 329 ? 216.649 -42.381  30.950  1.00 180.77 ? 329 ALA B CA  1 
ATOM   3034  C C   . ALA B 2 329 ? 216.576 -43.691  31.726  1.00 174.25 ? 329 ALA B C   1 
ATOM   3035  O O   . ALA B 2 329 ? 215.983 -43.757  32.808  1.00 175.28 ? 329 ALA B O   1 
ATOM   3036  C CB  . ALA B 2 329 ? 217.019 -41.227  31.871  1.00 181.75 ? 329 ALA B CB  1 
ATOM   3037  N N   . ILE B 2 330 ? 217.176 -44.733  31.159  1.00 164.65 ? 330 ILE B N   1 
ATOM   3038  C CA  . ILE B 2 330 ? 217.204 -46.039  31.803  1.00 154.70 ? 330 ILE B CA  1 
ATOM   3039  C C   . ILE B 2 330 ? 218.462 -46.155  32.639  1.00 147.78 ? 330 ILE B C   1 
ATOM   3040  O O   . ILE B 2 330 ? 219.579 -46.112  32.114  1.00 145.50 ? 330 ILE B O   1 
ATOM   3041  C CB  . ILE B 2 330 ? 217.155 -47.206  30.790  1.00 154.88 ? 330 ILE B CB  1 
ATOM   3042  C CG1 . ILE B 2 330 ? 216.033 -47.003  29.758  1.00 156.27 ? 330 ILE B CG1 1 
ATOM   3043  C CG2 . ILE B 2 330 ? 217.028 -48.542  31.516  1.00 153.45 ? 330 ILE B CG2 1 
ATOM   3044  C CD1 . ILE B 2 330 ? 214.645 -46.809  30.340  1.00 157.00 ? 330 ILE B CD1 1 
ATOM   3045  N N   . HIS B 2 331 ? 218.272 -46.289  33.945  1.00 141.62 ? 331 HIS B N   1 
ATOM   3046  C CA  . HIS B 2 331 ? 219.389 -46.540  34.825  1.00 138.17 ? 331 HIS B CA  1 
ATOM   3047  C C   . HIS B 2 331 ? 219.847 -47.978  34.635  1.00 137.77 ? 331 HIS B C   1 
ATOM   3048  O O   . HIS B 2 331 ? 219.018 -48.881  34.504  1.00 133.83 ? 331 HIS B O   1 
ATOM   3049  C CB  . HIS B 2 331 ? 219.022 -46.290  36.283  1.00 137.52 ? 331 HIS B CB  1 
ATOM   3050  C CG  . HIS B 2 331 ? 220.211 -46.186  37.184  1.00 138.33 ? 331 HIS B CG  1 
ATOM   3051  N ND1 . HIS B 2 331 ? 220.912 -47.287  37.625  1.00 138.69 ? 331 HIS B ND1 1 
ATOM   3052  C CD2 . HIS B 2 331 ? 220.834 -45.107  37.715  1.00 139.68 ? 331 HIS B CD2 1 
ATOM   3053  C CE1 . HIS B 2 331 ? 221.912 -46.893  38.393  1.00 139.72 ? 331 HIS B CE1 1 
ATOM   3054  N NE2 . HIS B 2 331 ? 221.885 -45.575  38.466  1.00 140.50 ? 331 HIS B NE2 1 
ATOM   3055  N N   . PRO B 2 332 ? 221.174 -48.184  34.586  1.00 140.83 ? 332 PRO B N   1 
ATOM   3056  C CA  . PRO B 2 332 ? 221.800 -49.496  34.546  1.00 143.68 ? 332 PRO B CA  1 
ATOM   3057  C C   . PRO B 2 332 ? 221.107 -50.539  35.429  1.00 145.13 ? 332 PRO B C   1 
ATOM   3058  O O   . PRO B 2 332 ? 220.806 -51.637  34.954  1.00 145.79 ? 332 PRO B O   1 
ATOM   3059  C CB  . PRO B 2 332 ? 223.208 -49.205  35.065  1.00 144.65 ? 332 PRO B CB  1 
ATOM   3060  C CG  . PRO B 2 332 ? 223.491 -47.814  34.597  1.00 144.18 ? 332 PRO B CG  1 
ATOM   3061  C CD  . PRO B 2 332 ? 222.171 -47.114  34.392  1.00 142.47 ? 332 PRO B CD  1 
ATOM   3062  N N   . VAL B 2 333 ? 220.844 -50.191  36.689  1.00 146.31 ? 333 VAL B N   1 
ATOM   3063  C CA  . VAL B 2 333 ? 220.248 -51.135  37.647  1.00 146.00 ? 333 VAL B CA  1 
ATOM   3064  C C   . VAL B 2 333 ? 218.767 -50.872  37.955  1.00 139.30 ? 333 VAL B C   1 
ATOM   3065  O O   . VAL B 2 333 ? 218.214 -51.444  38.901  1.00 138.35 ? 333 VAL B O   1 
ATOM   3066  C CB  . VAL B 2 333 ? 221.067 -51.251  38.964  1.00 151.41 ? 333 VAL B CB  1 
ATOM   3067  C CG1 . VAL B 2 333 ? 222.484 -51.735  38.682  1.00 155.10 ? 333 VAL B CG1 1 
ATOM   3068  C CG2 . VAL B 2 333 ? 221.085 -49.939  39.736  1.00 153.00 ? 333 VAL B CG2 1 
ATOM   3069  N N   . ALA B 2 334 ? 218.132 -50.019  37.152  1.00 131.57 ? 334 ALA B N   1 
ATOM   3070  C CA  . ALA B 2 334 ? 216.702 -49.747  37.289  1.00 125.04 ? 334 ALA B CA  1 
ATOM   3071  C C   . ALA B 2 334 ? 215.908 -51.049  37.212  1.00 120.31 ? 334 ALA B C   1 
ATOM   3072  O O   . ALA B 2 334 ? 216.030 -51.806  36.246  1.00 120.55 ? 334 ALA B O   1 
ATOM   3073  C CB  . ALA B 2 334 ? 216.235 -48.765  36.224  1.00 124.95 ? 334 ALA B CB  1 
ATOM   3074  N N   . GLY B 2 335 ? 215.117 -51.309  38.249  1.00 114.10 ? 335 GLY B N   1 
ATOM   3075  C CA  . GLY B 2 335 ? 214.348 -52.545  38.349  1.00 106.45 ? 335 GLY B CA  1 
ATOM   3076  C C   . GLY B 2 335 ? 215.019 -53.546  39.265  1.00 101.40 ? 335 GLY B C   1 
ATOM   3077  O O   . GLY B 2 335 ? 215.679 -53.169  40.234  1.00 98.73  ? 335 GLY B O   1 
ATOM   3078  N N   . ARG B 2 336 ? 214.854 -54.828  38.959  1.00 99.24  ? 336 ARG B N   1 
ATOM   3079  C CA  . ARG B 2 336 ? 215.443 -55.880  39.780  1.00 99.40  ? 336 ARG B CA  1 
ATOM   3080  C C   . ARG B 2 336 ? 216.362 -56.809  39.007  1.00 101.59 ? 336 ARG B C   1 
ATOM   3081  O O   . ARG B 2 336 ? 217.232 -57.454  39.593  1.00 101.30 ? 336 ARG B O   1 
ATOM   3082  C CB  . ARG B 2 336 ? 214.362 -56.673  40.517  1.00 98.20  ? 336 ARG B CB  1 
ATOM   3083  C CG  . ARG B 2 336 ? 213.854 -55.984  41.774  1.00 97.30  ? 336 ARG B CG  1 
ATOM   3084  C CD  . ARG B 2 336 ? 215.003 -55.500  42.648  1.00 96.02  ? 336 ARG B CD  1 
ATOM   3085  N NE  . ARG B 2 336 ? 214.544 -54.867  43.883  1.00 94.28  ? 336 ARG B NE  1 
ATOM   3086  C CZ  . ARG B 2 336 ? 214.212 -53.584  44.002  1.00 92.65  ? 336 ARG B CZ  1 
ATOM   3087  N NH1 . ARG B 2 336 ? 214.273 -52.768  42.956  1.00 91.57  ? 336 ARG B NH1 1 
ATOM   3088  N NH2 . ARG B 2 336 ? 213.811 -53.114  45.176  1.00 91.50  ? 336 ARG B NH2 1 
ATOM   3089  N N   . MET B 2 337 ? 216.164 -56.877  37.696  1.00 105.81 ? 337 MET B N   1 
ATOM   3090  C CA  . MET B 2 337 ? 217.075 -57.610  36.831  1.00 111.75 ? 337 MET B CA  1 
ATOM   3091  C C   . MET B 2 337 ? 217.726 -56.648  35.835  1.00 118.91 ? 337 MET B C   1 
ATOM   3092  O O   . MET B 2 337 ? 217.215 -55.544  35.625  1.00 118.45 ? 337 MET B O   1 
ATOM   3093  C CB  . MET B 2 337 ? 216.359 -58.771  36.128  1.00 109.72 ? 337 MET B CB  1 
ATOM   3094  C CG  . MET B 2 337 ? 215.534 -58.397  34.909  1.00 107.82 ? 337 MET B CG  1 
ATOM   3095  S SD  . MET B 2 337 ? 215.294 -59.829  33.841  1.00 105.75 ? 337 MET B SD  1 
ATOM   3096  C CE  . MET B 2 337 ? 214.403 -59.082  32.481  1.00 107.06 ? 337 MET B CE  1 
ATOM   3097  N N   . PRO B 2 338 ? 218.870 -57.049  35.243  1.00 127.40 ? 338 PRO B N   1 
ATOM   3098  C CA  . PRO B 2 338 ? 219.522 -56.208  34.237  1.00 133.08 ? 338 PRO B CA  1 
ATOM   3099  C C   . PRO B 2 338 ? 218.656 -56.037  32.986  1.00 136.99 ? 338 PRO B C   1 
ATOM   3100  O O   . PRO B 2 338 ? 218.138 -57.022  32.453  1.00 139.60 ? 338 PRO B O   1 
ATOM   3101  C CB  . PRO B 2 338 ? 220.804 -56.986  33.909  1.00 133.70 ? 338 PRO B CB  1 
ATOM   3102  C CG  . PRO B 2 338 ? 221.047 -57.849  35.100  1.00 132.56 ? 338 PRO B CG  1 
ATOM   3103  C CD  . PRO B 2 338 ? 219.676 -58.244  35.554  1.00 129.97 ? 338 PRO B CD  1 
ATOM   3104  N N   . GLY B 2 339 ? 218.493 -54.791  32.541  1.00 139.14 ? 339 GLY B N   1 
ATOM   3105  C CA  . GLY B 2 339 ? 217.669 -54.474  31.372  1.00 141.20 ? 339 GLY B CA  1 
ATOM   3106  C C   . GLY B 2 339 ? 216.182 -54.699  31.592  1.00 143.80 ? 339 GLY B C   1 
ATOM   3107  O O   . GLY B 2 339 ? 215.438 -54.949  30.640  1.00 141.15 ? 339 GLY B O   1 
ATOM   3108  N N   . HIS B 2 340 ? 215.760 -54.603  32.854  1.00 149.06 ? 340 HIS B N   1 
ATOM   3109  C CA  . HIS B 2 340 ? 214.371 -54.826  33.263  1.00 155.75 ? 340 HIS B CA  1 
ATOM   3110  C C   . HIS B 2 340 ? 213.403 -53.907  32.522  1.00 159.22 ? 340 HIS B C   1 
ATOM   3111  O O   . HIS B 2 340 ? 212.336 -54.339  32.082  1.00 157.13 ? 340 HIS B O   1 
ATOM   3112  C CB  . HIS B 2 340 ? 214.230 -54.608  34.775  1.00 158.81 ? 340 HIS B CB  1 
ATOM   3113  C CG  . HIS B 2 340 ? 212.974 -55.176  35.362  1.00 162.74 ? 340 HIS B CG  1 
ATOM   3114  N ND1 . HIS B 2 340 ? 212.961 -55.875  36.550  1.00 164.17 ? 340 HIS B ND1 1 
ATOM   3115  C CD2 . HIS B 2 340 ? 211.691 -55.149  34.928  1.00 164.54 ? 340 HIS B CD2 1 
ATOM   3116  C CE1 . HIS B 2 340 ? 211.725 -56.252  36.823  1.00 166.41 ? 340 HIS B CE1 1 
ATOM   3117  N NE2 . HIS B 2 340 ? 210.935 -55.826  35.854  1.00 166.90 ? 340 HIS B NE2 1 
ATOM   3118  N N   . MET B 2 341 ? 213.785 -52.640  32.395  1.00 166.18 ? 341 MET B N   1 
ATOM   3119  C CA  . MET B 2 341 ? 212.950 -51.641  31.735  1.00 171.28 ? 341 MET B CA  1 
ATOM   3120  C C   . MET B 2 341 ? 212.948 -51.831  30.215  1.00 168.34 ? 341 MET B C   1 
ATOM   3121  O O   . MET B 2 341 ? 211.896 -51.740  29.578  1.00 170.07 ? 341 MET B O   1 
ATOM   3122  C CB  . MET B 2 341 ? 213.403 -50.220  32.104  1.00 177.25 ? 341 MET B CB  1 
ATOM   3123  C CG  . MET B 2 341 ? 213.490 -49.921  33.600  1.00 181.04 ? 341 MET B CG  1 
ATOM   3124  S SD  . MET B 2 341 ? 211.906 -49.740  34.451  1.00 183.06 ? 341 MET B SD  1 
ATOM   3125  C CE  . MET B 2 341 ? 211.618 -51.406  35.045  1.00 183.97 ? 341 MET B CE  1 
ATOM   3126  N N   . ASN B 2 342 ? 214.126 -52.117  29.654  1.00 162.49 ? 342 ASN B N   1 
ATOM   3127  C CA  . ASN B 2 342 ? 214.327 -52.244  28.203  1.00 155.12 ? 342 ASN B CA  1 
ATOM   3128  C C   . ASN B 2 342 ? 213.360 -53.191  27.519  1.00 147.44 ? 342 ASN B C   1 
ATOM   3129  O O   . ASN B 2 342 ? 212.920 -52.948  26.394  1.00 141.92 ? 342 ASN B O   1 
ATOM   3130  C CB  . ASN B 2 342 ? 215.755 -52.697  27.902  1.00 157.58 ? 342 ASN B CB  1 
ATOM   3131  C CG  . ASN B 2 342 ? 216.791 -51.724  28.413  1.00 159.81 ? 342 ASN B CG  1 
ATOM   3132  O OD1 . ASN B 2 342 ? 217.106 -51.701  29.604  1.00 159.07 ? 342 ASN B OD1 1 
ATOM   3133  N ND2 . ASN B 2 342 ? 217.336 -50.915  27.511  1.00 161.72 ? 342 ASN B ND2 1 
ATOM   3134  N N   . VAL B 2 343 ? 213.051 -54.280  28.210  1.00 143.32 ? 343 VAL B N   1 
ATOM   3135  C CA  . VAL B 2 343 ? 212.125 -55.274  27.707  1.00 143.19 ? 343 VAL B CA  1 
ATOM   3136  C C   . VAL B 2 343 ? 210.681 -54.793  27.846  1.00 141.78 ? 343 VAL B C   1 
ATOM   3137  O O   . VAL B 2 343 ? 209.886 -54.946  26.920  1.00 143.34 ? 343 VAL B O   1 
ATOM   3138  C CB  . VAL B 2 343 ? 212.344 -56.646  28.382  1.00 145.82 ? 343 VAL B CB  1 
ATOM   3139  C CG1 . VAL B 2 343 ? 213.691 -57.222  27.965  1.00 147.08 ? 343 VAL B CG1 1 
ATOM   3140  C CG2 . VAL B 2 343 ? 212.257 -56.543  29.901  1.00 146.16 ? 343 VAL B CG2 1 
ATOM   3141  N N   . LEU B 2 344 ? 210.359 -54.189  28.990  1.00 139.41 ? 344 LEU B N   1 
ATOM   3142  C CA  . LEU B 2 344 ? 209.009 -53.688  29.247  1.00 139.88 ? 344 LEU B CA  1 
ATOM   3143  C C   . LEU B 2 344 ? 208.685 -52.434  28.426  1.00 146.23 ? 344 LEU B C   1 
ATOM   3144  O O   . LEU B 2 344 ? 207.515 -52.082  28.262  1.00 147.13 ? 344 LEU B O   1 
ATOM   3145  C CB  . LEU B 2 344 ? 208.786 -53.452  30.749  1.00 133.60 ? 344 LEU B CB  1 
ATOM   3146  C CG  . LEU B 2 344 ? 208.773 -54.693  31.655  1.00 129.56 ? 344 LEU B CG  1 
ATOM   3147  C CD1 . LEU B 2 344 ? 208.773 -54.301  33.124  1.00 127.98 ? 344 LEU B CD1 1 
ATOM   3148  C CD2 . LEU B 2 344 ? 207.595 -55.612  31.354  1.00 127.92 ? 344 LEU B CD2 1 
ATOM   3149  N N   . LEU B 2 345 ? 209.722 -51.777  27.906  1.00 154.37 ? 345 LEU B N   1 
ATOM   3150  C CA  . LEU B 2 345 ? 209.547 -50.637  27.001  1.00 161.41 ? 345 LEU B CA  1 
ATOM   3151  C C   . LEU B 2 345 ? 209.610 -51.054  25.533  1.00 162.10 ? 345 LEU B C   1 
ATOM   3152  O O   . LEU B 2 345 ? 209.039 -50.387  24.669  1.00 160.61 ? 345 LEU B O   1 
ATOM   3153  C CB  . LEU B 2 345 ? 210.566 -49.531  27.293  1.00 167.30 ? 345 LEU B CB  1 
ATOM   3154  C CG  . LEU B 2 345 ? 210.352 -48.669  28.545  1.00 171.44 ? 345 LEU B CG  1 
ATOM   3155  C CD1 . LEU B 2 345 ? 211.485 -47.666  28.689  1.00 173.98 ? 345 LEU B CD1 1 
ATOM   3156  C CD2 . LEU B 2 345 ? 209.010 -47.948  28.529  1.00 172.48 ? 345 LEU B CD2 1 
ATOM   3157  N N   . ALA B 2 346 ? 210.305 -52.155  25.256  1.00 164.38 ? 346 ALA B N   1 
ATOM   3158  C CA  . ALA B 2 346 ? 210.269 -52.773  23.933  1.00 170.44 ? 346 ALA B CA  1 
ATOM   3159  C C   . ALA B 2 346 ? 208.883 -53.371  23.662  1.00 179.33 ? 346 ALA B C   1 
ATOM   3160  O O   . ALA B 2 346 ? 208.466 -53.486  22.506  1.00 183.17 ? 346 ALA B O   1 
ATOM   3161  C CB  . ALA B 2 346 ? 211.344 -53.841  23.816  1.00 165.57 ? 346 ALA B CB  1 
ATOM   3162  N N   . GLU B 2 347 ? 208.182 -53.739  24.738  1.00 188.69 ? 347 GLU B N   1 
ATOM   3163  C CA  . GLU B 2 347 ? 206.831 -54.318  24.670  1.00 194.38 ? 347 GLU B CA  1 
ATOM   3164  C C   . GLU B 2 347 ? 205.784 -53.286  24.247  1.00 191.58 ? 347 GLU B C   1 
ATOM   3165  O O   . GLU B 2 347 ? 205.049 -53.500  23.276  1.00 190.75 ? 347 GLU B O   1 
ATOM   3166  C CB  . GLU B 2 347 ? 206.441 -54.944  26.021  1.00 200.64 ? 347 GLU B CB  1 
ATOM   3167  C CG  . GLU B 2 347 ? 205.117 -55.709  26.015  1.00 203.84 ? 347 GLU B CG  1 
ATOM   3168  C CD  . GLU B 2 347 ? 204.633 -56.115  27.403  1.00 204.47 ? 347 GLU B CD  1 
ATOM   3169  O OE1 . GLU B 2 347 ? 205.435 -56.098  28.364  1.00 205.35 ? 347 GLU B OE1 1 
ATOM   3170  O OE2 . GLU B 2 347 ? 203.437 -56.462  27.532  1.00 203.65 ? 347 GLU B OE2 1 
ATOM   3171  N N   . ALA B 2 348 ? 205.723 -52.176  24.985  1.00 187.28 ? 348 ALA B N   1 
ATOM   3172  C CA  . ALA B 2 348 ? 204.794 -51.081  24.702  1.00 182.99 ? 348 ALA B CA  1 
ATOM   3173  C C   . ALA B 2 348 ? 204.985 -50.542  23.286  1.00 181.94 ? 348 ALA B C   1 
ATOM   3174  O O   . ALA B 2 348 ? 204.041 -50.045  22.670  1.00 182.12 ? 348 ALA B O   1 
ATOM   3175  C CB  . ALA B 2 348 ? 204.960 -49.966  25.725  1.00 180.53 ? 348 ALA B CB  1 
ATOM   3176  N N   . GLY B 2 349 ? 206.210 -50.656  22.780  1.00 181.66 ? 349 GLY B N   1 
ATOM   3177  C CA  . GLY B 2 349 ? 206.535 -50.256  21.417  1.00 182.26 ? 349 GLY B CA  1 
ATOM   3178  C C   . GLY B 2 349 ? 207.355 -48.983  21.351  1.00 182.75 ? 349 GLY B C   1 
ATOM   3179  O O   . GLY B 2 349 ? 207.299 -48.258  20.355  1.00 185.24 ? 349 GLY B O   1 
ATOM   3180  N N   . VAL B 2 350 ? 208.118 -48.712  22.410  1.00 180.71 ? 350 VAL B N   1 
ATOM   3181  C CA  . VAL B 2 350 ? 208.956 -47.516  22.468  1.00 178.84 ? 350 VAL B CA  1 
ATOM   3182  C C   . VAL B 2 350 ? 210.169 -47.672  21.550  1.00 178.47 ? 350 VAL B C   1 
ATOM   3183  O O   . VAL B 2 350 ? 210.903 -48.665  21.632  1.00 177.53 ? 350 VAL B O   1 
ATOM   3184  C CB  . VAL B 2 350 ? 209.419 -47.181  23.907  1.00 177.30 ? 350 VAL B CB  1 
ATOM   3185  C CG1 . VAL B 2 350 ? 209.969 -45.765  23.969  1.00 177.56 ? 350 VAL B CG1 1 
ATOM   3186  C CG2 . VAL B 2 350 ? 208.274 -47.327  24.897  1.00 174.99 ? 350 VAL B CG2 1 
ATOM   3187  N N   . ASP B 2 351 ? 210.354 -46.687  20.672  1.00 177.06 ? 351 ASP B N   1 
ATOM   3188  C CA  . ASP B 2 351 ? 211.475 -46.642  19.734  1.00 173.55 ? 351 ASP B CA  1 
ATOM   3189  C C   . ASP B 2 351 ? 212.792 -46.584  20.511  1.00 174.94 ? 351 ASP B C   1 
ATOM   3190  O O   . ASP B 2 351 ? 212.867 -45.957  21.571  1.00 175.83 ? 351 ASP B O   1 
ATOM   3191  C CB  . ASP B 2 351 ? 211.338 -45.418  18.821  1.00 166.95 ? 351 ASP B CB  1 
ATOM   3192  C CG  . ASP B 2 351 ? 211.591 -45.736  17.354  1.00 161.37 ? 351 ASP B CG  1 
ATOM   3193  O OD1 . ASP B 2 351 ? 212.454 -46.588  17.049  1.00 159.67 ? 351 ASP B OD1 1 
ATOM   3194  O OD2 . ASP B 2 351 ? 210.922 -45.118  16.498  1.00 156.40 ? 351 ASP B OD2 1 
ATOM   3195  N N   . TYR B 2 352 ? 213.821 -47.242  19.983  1.00 175.48 ? 352 TYR B N   1 
ATOM   3196  C CA  . TYR B 2 352 ? 215.088 -47.395  20.702  1.00 176.41 ? 352 TYR B CA  1 
ATOM   3197  C C   . TYR B 2 352 ? 215.993 -46.159  20.689  1.00 181.47 ? 352 TYR B C   1 
ATOM   3198  O O   . TYR B 2 352 ? 216.909 -46.053  21.509  1.00 180.83 ? 352 TYR B O   1 
ATOM   3199  C CB  . TYR B 2 352 ? 215.846 -48.629  20.200  1.00 172.85 ? 352 TYR B CB  1 
ATOM   3200  C CG  . TYR B 2 352 ? 215.151 -49.945  20.492  1.00 168.83 ? 352 TYR B CG  1 
ATOM   3201  C CD1 . TYR B 2 352 ? 214.892 -50.347  21.805  1.00 166.10 ? 352 TYR B CD1 1 
ATOM   3202  C CD2 . TYR B 2 352 ? 214.767 -50.796  19.457  1.00 167.42 ? 352 TYR B CD2 1 
ATOM   3203  C CE1 . TYR B 2 352 ? 214.260 -51.550  22.077  1.00 162.88 ? 352 TYR B CE1 1 
ATOM   3204  C CE2 . TYR B 2 352 ? 214.137 -52.004  19.719  1.00 164.90 ? 352 TYR B CE2 1 
ATOM   3205  C CZ  . TYR B 2 352 ? 213.887 -52.374  21.030  1.00 162.84 ? 352 TYR B CZ  1 
ATOM   3206  O OH  . TYR B 2 352 ? 213.264 -53.571  21.295  1.00 160.56 ? 352 TYR B OH  1 
ATOM   3207  N N   . ASP B 2 353 ? 215.736 -45.235  19.762  1.00 188.90 ? 353 ASP B N   1 
ATOM   3208  C CA  . ASP B 2 353 ? 216.459 -43.957  19.706  1.00 193.90 ? 353 ASP B CA  1 
ATOM   3209  C C   . ASP B 2 353 ? 216.053 -43.014  20.841  1.00 190.89 ? 353 ASP B C   1 
ATOM   3210  O O   . ASP B 2 353 ? 216.822 -42.128  21.226  1.00 196.64 ? 353 ASP B O   1 
ATOM   3211  C CB  . ASP B 2 353 ? 216.263 -43.267  18.348  1.00 199.71 ? 353 ASP B CB  1 
ATOM   3212  C CG  . ASP B 2 353 ? 217.391 -43.561  17.361  1.00 202.37 ? 353 ASP B CG  1 
ATOM   3213  O OD1 . ASP B 2 353 ? 218.426 -44.146  17.758  1.00 203.61 ? 353 ASP B OD1 1 
ATOM   3214  O OD2 . ASP B 2 353 ? 217.244 -43.189  16.177  1.00 204.27 ? 353 ASP B OD2 1 
ATOM   3215  N N   . LYS B 2 354 ? 214.843 -43.210  21.363  1.00 180.90 ? 354 LYS B N   1 
ATOM   3216  C CA  . LYS B 2 354 ? 214.356 -42.462  22.522  1.00 169.74 ? 354 LYS B CA  1 
ATOM   3217  C C   . LYS B 2 354 ? 214.956 -42.997  23.835  1.00 163.44 ? 354 LYS B C   1 
ATOM   3218  O O   . LYS B 2 354 ? 214.727 -42.431  24.907  1.00 166.03 ? 354 LYS B O   1 
ATOM   3219  C CB  . LYS B 2 354 ? 212.817 -42.485  22.575  1.00 166.48 ? 354 LYS B CB  1 
ATOM   3220  C CG  . LYS B 2 354 ? 212.108 -41.546  21.599  1.00 160.14 ? 354 LYS B CG  1 
ATOM   3221  C CD  . LYS B 2 354 ? 211.735 -42.232  20.292  1.00 152.73 ? 354 LYS B CD  1 
ATOM   3222  C CE  . LYS B 2 354 ? 210.721 -41.423  19.495  1.00 145.80 ? 354 LYS B CE  1 
ATOM   3223  N NZ  . LYS B 2 354 ? 210.229 -42.154  18.293  1.00 139.93 ? 354 LYS B NZ  1 
ATOM   3224  N N   . LEU B 2 355 ? 215.734 -44.076  23.734  1.00 152.53 ? 355 LEU B N   1 
ATOM   3225  C CA  . LEU B 2 355 ? 216.314 -44.756  24.895  1.00 142.58 ? 355 LEU B CA  1 
ATOM   3226  C C   . LEU B 2 355 ? 217.822 -44.508  25.023  1.00 136.14 ? 355 LEU B C   1 
ATOM   3227  O O   . LEU B 2 355 ? 218.625 -45.132  24.320  1.00 134.86 ? 355 LEU B O   1 
ATOM   3228  C CB  . LEU B 2 355 ? 216.024 -46.262  24.814  1.00 142.05 ? 355 LEU B CB  1 
ATOM   3229  C CG  . LEU B 2 355 ? 214.689 -46.875  25.275  1.00 142.45 ? 355 LEU B CG  1 
ATOM   3230  C CD1 . LEU B 2 355 ? 213.485 -45.956  25.096  1.00 142.67 ? 355 LEU B CD1 1 
ATOM   3231  C CD2 . LEU B 2 355 ? 214.453 -48.194  24.550  1.00 141.79 ? 355 LEU B CD2 1 
ATOM   3232  N N   . LYS B 2 356 ? 218.197 -43.599  25.925  1.00 129.06 ? 356 LYS B N   1 
ATOM   3233  C CA  . LYS B 2 356 ? 219.605 -43.225  26.134  1.00 123.00 ? 356 LYS B CA  1 
ATOM   3234  C C   . LYS B 2 356 ? 220.081 -43.579  27.548  1.00 120.55 ? 356 LYS B C   1 
ATOM   3235  O O   . LYS B 2 356 ? 219.296 -43.558  28.498  1.00 120.22 ? 356 LYS B O   1 
ATOM   3236  C CB  . LYS B 2 356 ? 219.831 -41.725  25.865  1.00 119.83 ? 356 LYS B CB  1 
ATOM   3237  C CG  . LYS B 2 356 ? 219.104 -41.155  24.649  1.00 116.67 ? 356 LYS B CG  1 
ATOM   3238  C CD  . LYS B 2 356 ? 219.630 -39.781  24.241  1.00 112.06 ? 356 LYS B CD  1 
ATOM   3239  C CE  . LYS B 2 356 ? 220.535 -39.865  23.017  1.00 109.52 ? 356 LYS B CE  1 
ATOM   3240  N NZ  . LYS B 2 356 ? 221.078 -38.542  22.599  1.00 105.37 ? 356 LYS B NZ  1 
ATOM   3241  N N   . ASP B 2 357 ? 221.368 -43.898  27.679  1.00 118.13 ? 357 ASP B N   1 
ATOM   3242  C CA  . ASP B 2 357 ? 221.959 -44.218  28.983  1.00 116.33 ? 357 ASP B CA  1 
ATOM   3243  C C   . ASP B 2 357 ? 222.547 -42.985  29.671  1.00 114.34 ? 357 ASP B C   1 
ATOM   3244  O O   . ASP B 2 357 ? 222.529 -41.888  29.108  1.00 113.50 ? 357 ASP B O   1 
ATOM   3245  C CB  . ASP B 2 357 ? 223.000 -45.342  28.860  1.00 117.80 ? 357 ASP B CB  1 
ATOM   3246  C CG  . ASP B 2 357 ? 224.225 -44.931  28.059  1.00 119.05 ? 357 ASP B CG  1 
ATOM   3247  O OD1 . ASP B 2 357 ? 225.086 -44.207  28.605  1.00 119.33 ? 357 ASP B OD1 1 
ATOM   3248  O OD2 . ASP B 2 357 ? 224.336 -45.355  26.888  1.00 120.26 ? 357 ASP B OD2 1 
ATOM   3249  N N   . LEU B 2 358 ? 223.074 -43.180  30.880  1.00 112.85 ? 358 LEU B N   1 
ATOM   3250  C CA  . LEU B 2 358 ? 223.526 -42.085  31.746  1.00 112.85 ? 358 LEU B CA  1 
ATOM   3251  C C   . LEU B 2 358 ? 224.579 -41.154  31.132  1.00 115.64 ? 358 LEU B C   1 
ATOM   3252  O O   . LEU B 2 358 ? 224.472 -39.934  31.254  1.00 115.37 ? 358 LEU B O   1 
ATOM   3253  C CB  . LEU B 2 358 ? 224.029 -42.633  33.093  1.00 110.22 ? 358 LEU B CB  1 
ATOM   3254  C CG  . LEU B 2 358 ? 225.440 -43.235  33.194  1.00 108.18 ? 358 LEU B CG  1 
ATOM   3255  C CD1 . LEU B 2 358 ? 226.003 -43.064  34.597  1.00 107.34 ? 358 LEU B CD1 1 
ATOM   3256  C CD2 . LEU B 2 358 ? 225.485 -44.695  32.759  1.00 106.91 ? 358 LEU B CD2 1 
ATOM   3257  N N   . GLU B 2 359 ? 225.579 -41.730  30.466  1.00 119.77 ? 359 GLU B N   1 
ATOM   3258  C CA  . GLU B 2 359 ? 226.764 -40.980  30.026  1.00 124.17 ? 359 GLU B CA  1 
ATOM   3259  C C   . GLU B 2 359 ? 226.524 -39.914  28.949  1.00 127.81 ? 359 GLU B C   1 
ATOM   3260  O O   . GLU B 2 359 ? 227.301 -38.960  28.836  1.00 127.26 ? 359 GLU B O   1 
ATOM   3261  C CB  . GLU B 2 359 ? 227.877 -41.932  29.581  1.00 123.84 ? 359 GLU B CB  1 
ATOM   3262  C CG  . GLU B 2 359 ? 228.779 -42.398  30.711  1.00 123.11 ? 359 GLU B CG  1 
ATOM   3263  C CD  . GLU B 2 359 ? 230.156 -42.806  30.222  1.00 123.09 ? 359 GLU B CD  1 
ATOM   3264  O OE1 . GLU B 2 359 ? 231.145 -42.168  30.639  1.00 122.60 ? 359 GLU B OE1 1 
ATOM   3265  O OE2 . GLU B 2 359 ? 230.251 -43.755  29.414  1.00 123.23 ? 359 GLU B OE2 1 
ATOM   3266  N N   . GLU B 2 360 ? 225.462 -40.080  28.163  1.00 133.12 ? 360 GLU B N   1 
ATOM   3267  C CA  . GLU B 2 360 ? 225.141 -39.137  27.088  1.00 136.95 ? 360 GLU B CA  1 
ATOM   3268  C C   . GLU B 2 360 ? 223.906 -38.278  27.392  1.00 137.02 ? 360 GLU B C   1 
ATOM   3269  O O   . GLU B 2 360 ? 223.420 -37.548  26.522  1.00 138.88 ? 360 GLU B O   1 
ATOM   3270  C CB  . GLU B 2 360 ? 224.975 -39.871  25.747  1.00 139.96 ? 360 GLU B CB  1 
ATOM   3271  C CG  . GLU B 2 360 ? 223.774 -40.808  25.665  1.00 143.11 ? 360 GLU B CG  1 
ATOM   3272  C CD  . GLU B 2 360 ? 223.521 -41.324  24.259  1.00 144.98 ? 360 GLU B CD  1 
ATOM   3273  O OE1 . GLU B 2 360 ? 223.771 -40.579  23.284  1.00 144.14 ? 360 GLU B OE1 1 
ATOM   3274  O OE2 . GLU B 2 360 ? 223.059 -42.478  24.127  1.00 147.97 ? 360 GLU B OE2 1 
ATOM   3275  N N   . ILE B 2 361 ? 223.418 -38.360  28.629  1.00 134.73 ? 361 ILE B N   1 
ATOM   3276  C CA  . ILE B 2 361 ? 222.185 -37.675  29.021  1.00 131.42 ? 361 ILE B CA  1 
ATOM   3277  C C   . ILE B 2 361 ? 222.338 -36.816  30.284  1.00 127.25 ? 361 ILE B C   1 
ATOM   3278  O O   . ILE B 2 361 ? 221.517 -35.934  30.546  1.00 125.26 ? 361 ILE B O   1 
ATOM   3279  C CB  . ILE B 2 361 ? 221.008 -38.676  29.157  1.00 132.96 ? 361 ILE B CB  1 
ATOM   3280  C CG1 . ILE B 2 361 ? 219.674 -37.986  28.840  1.00 134.38 ? 361 ILE B CG1 1 
ATOM   3281  C CG2 . ILE B 2 361 ? 221.007 -39.354  30.527  1.00 132.49 ? 361 ILE B CG2 1 
ATOM   3282  C CD1 . ILE B 2 361 ? 218.621 -38.908  28.261  1.00 135.45 ? 361 ILE B CD1 1 
ATOM   3283  N N   . ASN B 2 362 ? 223.393 -37.072  31.055  1.00 123.75 ? 362 ASN B N   1 
ATOM   3284  C CA  . ASN B 2 362 ? 223.646 -36.329  32.290  1.00 121.79 ? 362 ASN B CA  1 
ATOM   3285  C C   . ASN B 2 362 ? 224.027 -34.853  32.100  1.00 121.76 ? 362 ASN B C   1 
ATOM   3286  O O   . ASN B 2 362 ? 223.551 -34.006  32.858  1.00 121.99 ? 362 ASN B O   1 
ATOM   3287  C CB  . ASN B 2 362 ? 224.663 -37.062  33.175  1.00 120.62 ? 362 ASN B CB  1 
ATOM   3288  C CG  . ASN B 2 362 ? 224.116 -38.361  33.743  1.00 119.98 ? 362 ASN B CG  1 
ATOM   3289  O OD1 . ASN B 2 362 ? 222.921 -38.481  34.027  1.00 119.52 ? 362 ASN B OD1 1 
ATOM   3290  N ND2 . ASN B 2 362 ? 224.993 -39.345  33.909  1.00 119.46 ? 362 ASN B ND2 1 
ATOM   3291  N N   . PRO B 2 363 ? 224.872 -34.530  31.092  1.00 121.98 ? 363 PRO B N   1 
ATOM   3292  C CA  . PRO B 2 363 ? 225.148 -33.107  30.836  1.00 121.94 ? 363 PRO B CA  1 
ATOM   3293  C C   . PRO B 2 363 ? 223.999 -32.405  30.105  1.00 121.16 ? 363 PRO B C   1 
ATOM   3294  O O   . PRO B 2 363 ? 224.143 -31.257  29.667  1.00 120.89 ? 363 PRO B O   1 
ATOM   3295  C CB  . PRO B 2 363 ? 226.393 -33.148  29.945  1.00 122.41 ? 363 PRO B CB  1 
ATOM   3296  C CG  . PRO B 2 363 ? 226.291 -34.450  29.230  1.00 122.35 ? 363 PRO B CG  1 
ATOM   3297  C CD  . PRO B 2 363 ? 225.683 -35.404  30.219  1.00 122.20 ? 363 PRO B CD  1 
ATOM   3298  N N   . GLU B 2 364 ? 222.873 -33.104  29.990  1.00 120.35 ? 364 GLU B N   1 
ATOM   3299  C CA  . GLU B 2 364 ? 221.705 -32.624  29.266  1.00 120.37 ? 364 GLU B CA  1 
ATOM   3300  C C   . GLU B 2 364 ? 220.574 -32.260  30.233  1.00 119.78 ? 364 GLU B C   1 
ATOM   3301  O O   . GLU B 2 364 ? 219.576 -31.657  29.832  1.00 119.84 ? 364 GLU B O   1 
ATOM   3302  C CB  . GLU B 2 364 ? 221.245 -33.705  28.284  1.00 121.25 ? 364 GLU B CB  1 
ATOM   3303  C CG  . GLU B 2 364 ? 220.775 -33.190  26.935  1.00 122.62 ? 364 GLU B CG  1 
ATOM   3304  C CD  . GLU B 2 364 ? 220.449 -34.309  25.961  1.00 123.11 ? 364 GLU B CD  1 
ATOM   3305  O OE1 . GLU B 2 364 ? 221.390 -34.971  25.469  1.00 123.51 ? 364 GLU B OE1 1 
ATOM   3306  O OE2 . GLU B 2 364 ? 219.251 -34.522  25.676  1.00 122.95 ? 364 GLU B OE2 1 
ATOM   3307  N N   . PHE B 2 365 ? 220.751 -32.617  31.506  1.00 119.23 ? 365 PHE B N   1 
ATOM   3308  C CA  . PHE B 2 365 ? 219.744 -32.399  32.556  1.00 119.42 ? 365 PHE B CA  1 
ATOM   3309  C C   . PHE B 2 365 ? 219.507 -30.950  33.010  1.00 120.13 ? 365 PHE B C   1 
ATOM   3310  O O   . PHE B 2 365 ? 218.367 -30.604  33.333  1.00 119.89 ? 365 PHE B O   1 
ATOM   3311  C CB  . PHE B 2 365 ? 220.039 -33.270  33.780  1.00 119.38 ? 365 PHE B CB  1 
ATOM   3312  C CG  . PHE B 2 365 ? 219.305 -34.579  33.790  1.00 119.71 ? 365 PHE B CG  1 
ATOM   3313  C CD1 . PHE B 2 365 ? 217.998 -34.656  34.264  1.00 119.76 ? 365 PHE B CD1 1 
ATOM   3314  C CD2 . PHE B 2 365 ? 219.927 -35.741  33.351  1.00 120.20 ? 365 PHE B CD2 1 
ATOM   3315  C CE1 . PHE B 2 365 ? 217.322 -35.866  34.284  1.00 120.91 ? 365 PHE B CE1 1 
ATOM   3316  C CE2 . PHE B 2 365 ? 219.257 -36.953  33.367  1.00 121.22 ? 365 PHE B CE2 1 
ATOM   3317  C CZ  . PHE B 2 365 ? 217.954 -37.017  33.837  1.00 121.59 ? 365 PHE B CZ  1 
ATOM   3318  N N   . PRO B 2 366 ? 220.567 -30.103  33.065  1.00 120.68 ? 366 PRO B N   1 
ATOM   3319  C CA  . PRO B 2 366 ? 220.341 -28.700  33.454  1.00 120.46 ? 366 PRO B CA  1 
ATOM   3320  C C   . PRO B 2 366 ? 219.409 -27.943  32.505  1.00 120.14 ? 366 PRO B C   1 
ATOM   3321  O O   . PRO B 2 366 ? 218.871 -26.897  32.877  1.00 121.90 ? 366 PRO B O   1 
ATOM   3322  C CB  . PRO B 2 366 ? 221.746 -28.086  33.404  1.00 119.57 ? 366 PRO B CB  1 
ATOM   3323  C CG  . PRO B 2 366 ? 222.669 -29.234  33.599  1.00 119.52 ? 366 PRO B CG  1 
ATOM   3324  C CD  . PRO B 2 366 ? 222.007 -30.389  32.905  1.00 120.54 ? 366 PRO B CD  1 
ATOM   3325  N N   . THR B 2 367 ? 219.234 -28.470  31.294  1.00 117.39 ? 367 THR B N   1 
ATOM   3326  C CA  . THR B 2 367 ? 218.311 -27.900  30.311  1.00 113.15 ? 367 THR B CA  1 
ATOM   3327  C C   . THR B 2 367 ? 216.986 -28.681  30.227  1.00 110.92 ? 367 THR B C   1 
ATOM   3328  O O   . THR B 2 367 ? 216.134 -28.385  29.386  1.00 110.69 ? 367 THR B O   1 
ATOM   3329  C CB  . THR B 2 367 ? 218.965 -27.770  28.913  1.00 111.90 ? 367 THR B CB  1 
ATOM   3330  O OG1 . THR B 2 367 ? 219.639 -28.988  28.573  1.00 111.72 ? 367 THR B OG1 1 
ATOM   3331  C CG2 . THR B 2 367 ? 219.970 -26.619  28.891  1.00 110.38 ? 367 THR B CG2 1 
ATOM   3332  N N   . VAL B 2 368 ? 216.821 -29.667  31.110  1.00 107.75 ? 368 VAL B N   1 
ATOM   3333  C CA  . VAL B 2 368 ? 215.577 -30.434  31.222  1.00 104.49 ? 368 VAL B CA  1 
ATOM   3334  C C   . VAL B 2 368 ? 214.642 -29.750  32.218  1.00 103.62 ? 368 VAL B C   1 
ATOM   3335  O O   . VAL B 2 368 ? 215.008 -29.530  33.375  1.00 102.54 ? 368 VAL B O   1 
ATOM   3336  C CB  . VAL B 2 368 ? 215.845 -31.895  31.658  1.00 103.70 ? 368 VAL B CB  1 
ATOM   3337  C CG1 . VAL B 2 368 ? 214.558 -32.597  32.069  1.00 103.41 ? 368 VAL B CG1 1 
ATOM   3338  C CG2 . VAL B 2 368 ? 216.539 -32.666  30.547  1.00 103.48 ? 368 VAL B CG2 1 
ATOM   3339  N N   . ASP B 2 369 ? 213.440 -29.415  31.757  1.00 103.89 ? 369 ASP B N   1 
ATOM   3340  C CA  . ASP B 2 369 ? 212.464 -28.711  32.583  1.00 105.91 ? 369 ASP B CA  1 
ATOM   3341  C C   . ASP B 2 369 ? 211.867 -29.601  33.662  1.00 108.14 ? 369 ASP B C   1 
ATOM   3342  O O   . ASP B 2 369 ? 212.146 -29.413  34.843  1.00 108.70 ? 369 ASP B O   1 
ATOM   3343  C CB  . ASP B 2 369 ? 211.360 -28.105  31.717  1.00 105.75 ? 369 ASP B CB  1 
ATOM   3344  C CG  . ASP B 2 369 ? 211.804 -26.842  31.022  1.00 106.21 ? 369 ASP B CG  1 
ATOM   3345  O OD1 . ASP B 2 369 ? 211.806 -25.775  31.674  1.00 105.63 ? 369 ASP B OD1 1 
ATOM   3346  O OD2 . ASP B 2 369 ? 212.150 -26.916  29.824  1.00 107.89 ? 369 ASP B OD2 1 
ATOM   3347  N N   . VAL B 2 370 ? 211.056 -30.572  33.248  1.00 111.59 ? 370 VAL B N   1 
ATOM   3348  C CA  . VAL B 2 370 ? 210.385 -31.473  34.182  1.00 115.46 ? 370 VAL B CA  1 
ATOM   3349  C C   . VAL B 2 370 ? 211.016 -32.862  34.115  1.00 118.33 ? 370 VAL B C   1 
ATOM   3350  O O   . VAL B 2 370 ? 211.273 -33.383  33.028  1.00 120.34 ? 370 VAL B O   1 
ATOM   3351  C CB  . VAL B 2 370 ? 208.863 -31.555  33.905  1.00 115.39 ? 370 VAL B CB  1 
ATOM   3352  C CG1 . VAL B 2 370 ? 208.173 -32.487  34.892  1.00 114.62 ? 370 VAL B CG1 1 
ATOM   3353  C CG2 . VAL B 2 370 ? 208.234 -30.170  33.967  1.00 116.16 ? 370 VAL B CG2 1 
ATOM   3354  N N   . ALA B 2 371 ? 211.276 -33.441  35.286  1.00 120.24 ? 371 ALA B N   1 
ATOM   3355  C CA  . ALA B 2 371 ? 211.813 -34.794  35.392  1.00 121.09 ? 371 ALA B CA  1 
ATOM   3356  C C   . ALA B 2 371 ? 210.807 -35.712  36.086  1.00 120.63 ? 371 ALA B C   1 
ATOM   3357  O O   . ALA B 2 371 ? 210.635 -35.650  37.304  1.00 121.40 ? 371 ALA B O   1 
ATOM   3358  C CB  . ALA B 2 371 ? 213.141 -34.780  36.139  1.00 120.59 ? 371 ALA B CB  1 
ATOM   3359  N N   . VAL B 2 372 ? 210.137 -36.556  35.302  1.00 118.44 ? 372 VAL B N   1 
ATOM   3360  C CA  . VAL B 2 372 ? 209.111 -37.454  35.839  1.00 114.51 ? 372 VAL B CA  1 
ATOM   3361  C C   . VAL B 2 372 ? 209.690 -38.824  36.198  1.00 109.91 ? 372 VAL B C   1 
ATOM   3362  O O   . VAL B 2 372 ? 209.940 -39.666  35.330  1.00 108.44 ? 372 VAL B O   1 
ATOM   3363  C CB  . VAL B 2 372 ? 207.885 -37.586  34.900  1.00 115.75 ? 372 VAL B CB  1 
ATOM   3364  C CG1 . VAL B 2 372 ? 206.833 -38.502  35.511  1.00 116.38 ? 372 VAL B CG1 1 
ATOM   3365  C CG2 . VAL B 2 372 ? 207.280 -36.219  34.611  1.00 115.73 ? 372 VAL B CG2 1 
ATOM   3366  N N   . VAL B 2 373 ? 209.911 -39.023  37.492  1.00 105.62 ? 373 VAL B N   1 
ATOM   3367  C CA  . VAL B 2 373 ? 210.355 -40.305  38.008  1.00 102.01 ? 373 VAL B CA  1 
ATOM   3368  C C   . VAL B 2 373 ? 209.134 -41.159  38.296  1.00 98.04  ? 373 VAL B C   1 
ATOM   3369  O O   . VAL B 2 373 ? 208.167 -40.708  38.912  1.00 95.17  ? 373 VAL B O   1 
ATOM   3370  C CB  . VAL B 2 373 ? 211.213 -40.150  39.279  1.00 104.31 ? 373 VAL B CB  1 
ATOM   3371  C CG1 . VAL B 2 373 ? 211.456 -41.500  39.941  1.00 104.80 ? 373 VAL B CG1 1 
ATOM   3372  C CG2 . VAL B 2 373 ? 212.535 -39.474  38.944  1.00 106.25 ? 373 VAL B CG2 1 
ATOM   3373  N N   . ILE B 2 374 ? 209.189 -42.395  37.832  1.00 96.52  ? 374 ILE B N   1 
ATOM   3374  C CA  . ILE B 2 374 ? 208.093 -43.318  38.017  1.00 97.23  ? 374 ILE B CA  1 
ATOM   3375  C C   . ILE B 2 374 ? 208.617 -44.589  38.683  1.00 94.52  ? 374 ILE B C   1 
ATOM   3376  O O   . ILE B 2 374 ? 209.417 -45.327  38.105  1.00 95.01  ? 374 ILE B O   1 
ATOM   3377  C CB  . ILE B 2 374 ? 207.345 -43.577  36.680  1.00 100.61 ? 374 ILE B CB  1 
ATOM   3378  C CG1 . ILE B 2 374 ? 206.427 -44.800  36.770  1.00 103.83 ? 374 ILE B CG1 1 
ATOM   3379  C CG2 . ILE B 2 374 ? 208.314 -43.697  35.511  1.00 101.61 ? 374 ILE B CG2 1 
ATOM   3380  C CD1 . ILE B 2 374 ? 204.988 -44.465  37.090  1.00 105.30 ? 374 ILE B CD1 1 
ATOM   3381  N N   . GLY B 2 375 ? 208.191 -44.796  39.928  1.00 91.29  ? 375 GLY B N   1 
ATOM   3382  C CA  . GLY B 2 375 ? 208.520 -45.998  40.696  1.00 87.78  ? 375 GLY B CA  1 
ATOM   3383  C C   . GLY B 2 375 ? 209.996 -46.273  40.910  1.00 85.31  ? 375 GLY B C   1 
ATOM   3384  O O   . GLY B 2 375 ? 210.374 -47.383  41.281  1.00 84.58  ? 375 GLY B O   1 
ATOM   3385  N N   . ALA B 2 376 ? 210.832 -45.270  40.662  1.00 83.82  ? 376 ALA B N   1 
ATOM   3386  C CA  . ALA B 2 376 ? 212.265 -45.382  40.902  1.00 83.89  ? 376 ALA B CA  1 
ATOM   3387  C C   . ALA B 2 376 ? 212.599 -44.754  42.246  1.00 85.12  ? 376 ALA B C   1 
ATOM   3388  O O   . ALA B 2 376 ? 211.856 -43.899  42.732  1.00 84.61  ? 376 ALA B O   1 
ATOM   3389  C CB  . ALA B 2 376 ? 213.044 -44.713  39.783  1.00 83.03  ? 376 ALA B CB  1 
ATOM   3390  N N   . ASN B 2 377 ? 213.708 -45.182  42.847  1.00 87.99  ? 377 ASN B N   1 
ATOM   3391  C CA  . ASN B 2 377 ? 214.123 -44.679  44.159  1.00 91.43  ? 377 ASN B CA  1 
ATOM   3392  C C   . ASN B 2 377 ? 215.640 -44.675  44.366  1.00 91.42  ? 377 ASN B C   1 
ATOM   3393  O O   . ASN B 2 377 ? 216.260 -43.610  44.428  1.00 90.58  ? 377 ASN B O   1 
ATOM   3394  C CB  . ASN B 2 377 ? 213.423 -45.461  45.285  1.00 95.25  ? 377 ASN B CB  1 
ATOM   3395  C CG  . ASN B 2 377 ? 213.741 -44.921  46.675  1.00 98.24  ? 377 ASN B CG  1 
ATOM   3396  O OD1 . ASN B 2 377 ? 214.301 -43.832  46.828  1.00 99.68  ? 377 ASN B OD1 1 
ATOM   3397  N ND2 . ASN B 2 377 ? 213.377 -45.689  47.699  1.00 99.88  ? 377 ASN B ND2 1 
ATOM   3398  N N   . ASP B 2 378 ? 216.225 -45.866  44.483  1.00 92.07  ? 378 ASP B N   1 
ATOM   3399  C CA  . ASP B 2 378 ? 217.653 -46.011  44.768  1.00 92.89  ? 378 ASP B CA  1 
ATOM   3400  C C   . ASP B 2 378 ? 218.513 -45.539  43.601  1.00 94.33  ? 378 ASP B C   1 
ATOM   3401  O O   . ASP B 2 378 ? 219.619 -45.033  43.800  1.00 93.99  ? 378 ASP B O   1 
ATOM   3402  C CB  . ASP B 2 378 ? 217.994 -47.466  45.114  1.00 92.05  ? 378 ASP B CB  1 
ATOM   3403  C CG  . ASP B 2 378 ? 217.241 -47.980  46.340  1.00 91.66  ? 378 ASP B CG  1 
ATOM   3404  O OD1 . ASP B 2 378 ? 216.457 -47.219  46.945  1.00 92.04  ? 378 ASP B OD1 1 
ATOM   3405  O OD2 . ASP B 2 378 ? 217.430 -49.162  46.697  1.00 91.07  ? 378 ASP B OD2 1 
ATOM   3406  N N   . VAL B 2 379 ? 217.989 -45.706  42.389  1.00 96.93  ? 379 VAL B N   1 
ATOM   3407  C CA  . VAL B 2 379 ? 218.703 -45.336  41.165  1.00 100.08 ? 379 VAL B CA  1 
ATOM   3408  C C   . VAL B 2 379 ? 218.786 -43.820  40.952  1.00 102.28 ? 379 VAL B C   1 
ATOM   3409  O O   . VAL B 2 379 ? 219.710 -43.330  40.299  1.00 104.00 ? 379 VAL B O   1 
ATOM   3410  C CB  . VAL B 2 379 ? 218.099 -46.021  39.913  1.00 99.98  ? 379 VAL B CB  1 
ATOM   3411  C CG1 . VAL B 2 379 ? 218.246 -47.533  40.003  1.00 99.53  ? 379 VAL B CG1 1 
ATOM   3412  C CG2 . VAL B 2 379 ? 216.641 -45.629  39.707  1.00 99.82  ? 379 VAL B CG2 1 
ATOM   3413  N N   . VAL B 2 380 ? 217.824 -43.089  41.508  1.00 103.72 ? 380 VAL B N   1 
ATOM   3414  C CA  . VAL B 2 380 ? 217.762 -41.635  41.352  1.00 105.32 ? 380 VAL B CA  1 
ATOM   3415  C C   . VAL B 2 380 ? 218.322 -40.912  42.571  1.00 106.34 ? 380 VAL B C   1 
ATOM   3416  O O   . VAL B 2 380 ? 218.600 -39.712  42.523  1.00 104.66 ? 380 VAL B O   1 
ATOM   3417  C CB  . VAL B 2 380 ? 216.322 -41.150  41.081  1.00 106.14 ? 380 VAL B CB  1 
ATOM   3418  C CG1 . VAL B 2 380 ? 215.856 -41.615  39.712  1.00 107.36 ? 380 VAL B CG1 1 
ATOM   3419  C CG2 . VAL B 2 380 ? 215.364 -41.619  42.169  1.00 106.32 ? 380 VAL B CG2 1 
ATOM   3420  N N   . ASN B 2 381 ? 218.486 -41.667  43.654  1.00 110.20 ? 381 ASN B N   1 
ATOM   3421  C CA  . ASN B 2 381 ? 218.942 -41.149  44.934  1.00 116.47 ? 381 ASN B CA  1 
ATOM   3422  C C   . ASN B 2 381 ? 220.297 -40.446  44.850  1.00 120.33 ? 381 ASN B C   1 
ATOM   3423  O O   . ASN B 2 381 ? 221.284 -41.059  44.438  1.00 120.26 ? 381 ASN B O   1 
ATOM   3424  C CB  . ASN B 2 381 ? 219.000 -42.290  45.954  1.00 119.15 ? 381 ASN B CB  1 
ATOM   3425  C CG  . ASN B 2 381 ? 218.920 -41.805  47.391  1.00 122.37 ? 381 ASN B CG  1 
ATOM   3426  O OD1 . ASN B 2 381 ? 219.280 -40.671  47.708  1.00 123.90 ? 381 ASN B OD1 1 
ATOM   3427  N ND2 . ASN B 2 381 ? 218.441 -42.675  48.274  1.00 124.49 ? 381 ASN B ND2 1 
ATOM   3428  N N   . PRO B 2 382 ? 220.343 -39.153  45.230  1.00 125.12 ? 382 PRO B N   1 
ATOM   3429  C CA  . PRO B 2 382 ? 221.591 -38.391  45.320  1.00 130.29 ? 382 PRO B CA  1 
ATOM   3430  C C   . PRO B 2 382 ? 222.445 -38.749  46.545  1.00 136.36 ? 382 PRO B C   1 
ATOM   3431  O O   . PRO B 2 382 ? 223.341 -37.983  46.916  1.00 138.37 ? 382 PRO B O   1 
ATOM   3432  C CB  . PRO B 2 382 ? 221.111 -36.931  45.407  1.00 128.26 ? 382 PRO B CB  1 
ATOM   3433  C CG  . PRO B 2 382 ? 219.696 -36.951  44.938  1.00 126.36 ? 382 PRO B CG  1 
ATOM   3434  C CD  . PRO B 2 382 ? 219.175 -38.275  45.401  1.00 125.35 ? 382 PRO B CD  1 
ATOM   3435  N N   . ALA B 2 383 ? 222.167 -39.896  47.164  1.00 141.80 ? 383 ALA B N   1 
ATOM   3436  C CA  . ALA B 2 383 ? 223.007 -40.421  48.242  1.00 146.94 ? 383 ALA B CA  1 
ATOM   3437  C C   . ALA B 2 383 ? 224.184 -41.214  47.675  1.00 152.40 ? 383 ALA B C   1 
ATOM   3438  O O   . ALA B 2 383 ? 225.147 -41.503  48.386  1.00 151.43 ? 383 ALA B O   1 
ATOM   3439  C CB  . ALA B 2 383 ? 222.186 -41.287  49.186  1.00 145.54 ? 383 ALA B CB  1 
ATOM   3440  N N   . ALA B 2 384 ? 224.098 -41.543  46.386  1.00 161.33 ? 384 ALA B N   1 
ATOM   3441  C CA  . ALA B 2 384 ? 225.086 -42.380  45.698  1.00 170.84 ? 384 ALA B CA  1 
ATOM   3442  C C   . ALA B 2 384 ? 226.429 -41.690  45.405  1.00 178.17 ? 384 ALA B C   1 
ATOM   3443  O O   . ALA B 2 384 ? 227.429 -42.369  45.149  1.00 182.17 ? 384 ALA B O   1 
ATOM   3444  C CB  . ALA B 2 384 ? 224.489 -42.947  44.416  1.00 169.83 ? 384 ALA B CB  1 
ATOM   3445  N N   . ARG B 2 385 ? 226.448 -40.357  45.434  1.00 184.70 ? 385 ARG B N   1 
ATOM   3446  C CA  . ARG B 2 385 ? 227.678 -39.582  45.214  1.00 186.83 ? 385 ARG B CA  1 
ATOM   3447  C C   . ARG B 2 385 ? 228.665 -39.743  46.378  1.00 185.97 ? 385 ARG B C   1 
ATOM   3448  O O   . ARG B 2 385 ? 229.876 -39.866  46.165  1.00 185.48 ? 385 ARG B O   1 
ATOM   3449  C CB  . ARG B 2 385 ? 227.368 -38.089  45.001  1.00 188.75 ? 385 ARG B CB  1 
ATOM   3450  C CG  . ARG B 2 385 ? 226.686 -37.722  43.683  1.00 186.80 ? 385 ARG B CG  1 
ATOM   3451  C CD  . ARG B 2 385 ? 226.802 -36.223  43.408  1.00 179.76 ? 385 ARG B CD  1 
ATOM   3452  N NE  . ARG B 2 385 ? 226.108 -35.789  42.190  1.00 170.33 ? 385 ARG B NE  1 
ATOM   3453  C CZ  . ARG B 2 385 ? 225.209 -34.807  42.134  1.00 163.20 ? 385 ARG B CZ  1 
ATOM   3454  N NH1 . ARG B 2 385 ? 224.879 -34.127  43.226  1.00 159.26 ? 385 ARG B NH1 1 
ATOM   3455  N NH2 . ARG B 2 385 ? 224.643 -34.495  40.976  1.00 159.43 ? 385 ARG B NH2 1 
ATOM   3456  N N   . ARG B 2 386 ? 228.128 -39.745  47.600  1.00 183.31 ? 386 ARG B N   1 
ATOM   3457  C CA  . ARG B 2 386 ? 228.925 -39.803  48.829  1.00 179.23 ? 386 ARG B CA  1 
ATOM   3458  C C   . ARG B 2 386 ? 229.426 -41.215  49.139  1.00 177.13 ? 386 ARG B C   1 
ATOM   3459  O O   . ARG B 2 386 ? 228.681 -42.184  48.983  1.00 178.46 ? 386 ARG B O   1 
ATOM   3460  C CB  . ARG B 2 386 ? 228.118 -39.274  50.019  1.00 176.52 ? 386 ARG B CB  1 
ATOM   3461  C CG  . ARG B 2 386 ? 227.708 -37.813  49.909  1.00 174.04 ? 386 ARG B CG  1 
ATOM   3462  C CD  . ARG B 2 386 ? 226.947 -37.346  51.142  1.00 171.93 ? 386 ARG B CD  1 
ATOM   3463  N NE  . ARG B 2 386 ? 225.801 -38.200  51.458  1.00 170.83 ? 386 ARG B NE  1 
ATOM   3464  C CZ  . ARG B 2 386 ? 224.598 -38.099  50.898  1.00 170.27 ? 386 ARG B CZ  1 
ATOM   3465  N NH1 . ARG B 2 386 ? 224.355 -37.178  49.973  1.00 169.50 ? 386 ARG B NH1 1 
ATOM   3466  N NH2 . ARG B 2 386 ? 223.631 -38.929  51.264  1.00 170.54 ? 386 ARG B NH2 1 
ATOM   3467  N N   . PRO B 2 387 ? 230.691 -41.331  49.595  1.00 173.93 ? 387 PRO B N   1 
ATOM   3468  C CA  . PRO B 2 387 ? 231.290 -42.624  49.937  1.00 170.81 ? 387 PRO B CA  1 
ATOM   3469  C C   . PRO B 2 387 ? 230.715 -43.239  51.212  1.00 168.69 ? 387 PRO B C   1 
ATOM   3470  O O   . PRO B 2 387 ? 230.863 -44.441  51.434  1.00 166.40 ? 387 PRO B O   1 
ATOM   3471  C CB  . PRO B 2 387 ? 232.774 -42.284  50.151  1.00 171.03 ? 387 PRO B CB  1 
ATOM   3472  C CG  . PRO B 2 387 ? 232.968 -40.924  49.568  1.00 172.88 ? 387 PRO B CG  1 
ATOM   3473  C CD  . PRO B 2 387 ? 231.657 -40.232  49.758  1.00 173.91 ? 387 PRO B CD  1 
ATOM   3474  N N   . GLY B 2 388 ? 230.065 -42.419  52.034  1.00 169.21 ? 388 GLY B N   1 
ATOM   3475  C CA  . GLY B 2 388 ? 229.523 -42.867  53.314  1.00 173.46 ? 388 GLY B CA  1 
ATOM   3476  C C   . GLY B 2 388 ? 228.242 -43.680  53.249  1.00 178.56 ? 388 GLY B C   1 
ATOM   3477  O O   . GLY B 2 388 ? 227.834 -44.271  54.251  1.00 180.89 ? 388 GLY B O   1 
ATOM   3478  N N   . SER B 2 389 ? 227.612 -43.713  52.075  1.00 181.85 ? 389 SER B N   1 
ATOM   3479  C CA  . SER B 2 389 ? 226.326 -44.395  51.885  1.00 184.44 ? 389 SER B CA  1 
ATOM   3480  C C   . SER B 2 389 ? 226.485 -45.815  51.314  1.00 185.87 ? 389 SER B C   1 
ATOM   3481  O O   . SER B 2 389 ? 227.512 -46.121  50.700  1.00 186.10 ? 389 SER B O   1 
ATOM   3482  C CB  . SER B 2 389 ? 225.422 -43.560  50.973  1.00 182.89 ? 389 SER B CB  1 
ATOM   3483  O OG  . SER B 2 389 ? 225.919 -43.534  49.647  1.00 181.41 ? 389 SER B OG  1 
ATOM   3484  N N   . PRO B 2 390 ? 225.464 -46.685  51.503  1.00 186.00 ? 390 PRO B N   1 
ATOM   3485  C CA  . PRO B 2 390 ? 225.542 -48.023  50.914  1.00 182.58 ? 390 PRO B CA  1 
ATOM   3486  C C   . PRO B 2 390 ? 225.140 -47.994  49.445  1.00 180.42 ? 390 PRO B C   1 
ATOM   3487  O O   . PRO B 2 390 ? 224.937 -49.048  48.839  1.00 174.67 ? 390 PRO B O   1 
ATOM   3488  C CB  . PRO B 2 390 ? 224.520 -48.819  51.726  1.00 183.29 ? 390 PRO B CB  1 
ATOM   3489  C CG  . PRO B 2 390 ? 223.487 -47.811  52.096  1.00 187.00 ? 390 PRO B CG  1 
ATOM   3490  C CD  . PRO B 2 390 ? 224.188 -46.481  52.222  1.00 187.99 ? 390 PRO B CD  1 
ATOM   3491  N N   . LEU B 2 391 ? 225.027 -46.784  48.898  1.00 184.24 ? 391 LEU B N   1 
ATOM   3492  C CA  . LEU B 2 391 ? 224.644 -46.560  47.509  1.00 189.66 ? 391 LEU B CA  1 
ATOM   3493  C C   . LEU B 2 391 ? 225.811 -46.149  46.607  1.00 193.73 ? 391 LEU B C   1 
ATOM   3494  O O   . LEU B 2 391 ? 225.642 -46.063  45.387  1.00 198.03 ? 391 LEU B O   1 
ATOM   3495  C CB  . LEU B 2 391 ? 223.519 -45.522  47.414  1.00 189.81 ? 391 LEU B CB  1 
ATOM   3496  C CG  . LEU B 2 391 ? 222.073 -45.941  47.697  1.00 190.40 ? 391 LEU B CG  1 
ATOM   3497  C CD1 . LEU B 2 391 ? 221.202 -44.702  47.804  1.00 190.51 ? 391 LEU B CD1 1 
ATOM   3498  C CD2 . LEU B 2 391 ? 221.530 -46.875  46.624  1.00 190.88 ? 391 LEU B CD2 1 
ATOM   3499  N N   . TYR B 2 392 ? 226.984 -45.901  47.197  1.00 194.85 ? 392 TYR B N   1 
ATOM   3500  C CA  . TYR B 2 392 ? 228.175 -45.494  46.429  1.00 193.91 ? 392 TYR B CA  1 
ATOM   3501  C C   . TYR B 2 392 ? 228.636 -46.593  45.459  1.00 196.23 ? 392 TYR B C   1 
ATOM   3502  O O   . TYR B 2 392 ? 228.197 -47.731  45.568  1.00 198.19 ? 392 TYR B O   1 
ATOM   3503  C CB  . TYR B 2 392 ? 229.326 -45.058  47.355  1.00 187.07 ? 392 TYR B CB  1 
ATOM   3504  C CG  . TYR B 2 392 ? 230.552 -44.574  46.599  1.00 178.99 ? 392 TYR B CG  1 
ATOM   3505  C CD1 . TYR B 2 392 ? 230.547 -43.348  45.929  1.00 176.08 ? 392 TYR B CD1 1 
ATOM   3506  C CD2 . TYR B 2 392 ? 231.707 -45.354  46.530  1.00 173.90 ? 392 TYR B CD2 1 
ATOM   3507  C CE1 . TYR B 2 392 ? 231.657 -42.912  45.222  1.00 169.62 ? 392 TYR B CE1 1 
ATOM   3508  C CE2 . TYR B 2 392 ? 232.821 -44.926  45.824  1.00 168.42 ? 392 TYR B CE2 1 
ATOM   3509  C CZ  . TYR B 2 392 ? 232.790 -43.706  45.175  1.00 167.19 ? 392 TYR B CZ  1 
ATOM   3510  O OH  . TYR B 2 392 ? 233.894 -43.279  44.477  1.00 163.64 ? 392 TYR B OH  1 
ATOM   3511  N N   . GLY B 2 393 ? 229.492 -46.239  44.497  1.00 195.43 ? 393 GLY B N   1 
ATOM   3512  C CA  . GLY B 2 393 ? 230.024 -47.200  43.525  1.00 189.78 ? 393 GLY B CA  1 
ATOM   3513  C C   . GLY B 2 393 ? 229.131 -47.366  42.309  1.00 186.54 ? 393 GLY B C   1 
ATOM   3514  O O   . GLY B 2 393 ? 229.618 -47.563  41.190  1.00 183.58 ? 393 GLY B O   1 
ATOM   3515  N N   . MET B 2 394 ? 227.821 -47.297  42.543  1.00 184.50 ? 394 MET B N   1 
ATOM   3516  C CA  . MET B 2 394 ? 226.810 -47.321  41.492  1.00 180.54 ? 394 MET B CA  1 
ATOM   3517  C C   . MET B 2 394 ? 226.849 -46.015  40.693  1.00 181.93 ? 394 MET B C   1 
ATOM   3518  O O   . MET B 2 394 ? 226.815 -44.929  41.279  1.00 182.78 ? 394 MET B O   1 
ATOM   3519  C CB  . MET B 2 394 ? 225.420 -47.525  42.113  1.00 175.27 ? 394 MET B CB  1 
ATOM   3520  C CG  . MET B 2 394 ? 224.260 -47.535  41.125  1.00 170.15 ? 394 MET B CG  1 
ATOM   3521  S SD  . MET B 2 394 ? 222.655 -47.279  41.915  1.00 165.29 ? 394 MET B SD  1 
ATOM   3522  C CE  . MET B 2 394 ? 222.692 -45.517  42.242  1.00 166.03 ? 394 MET B CE  1 
ATOM   3523  N N   . PRO B 2 395 ? 226.940 -46.119  39.351  1.00 182.41 ? 395 PRO B N   1 
ATOM   3524  C CA  . PRO B 2 395 ? 226.830 -44.962  38.457  1.00 183.07 ? 395 PRO B CA  1 
ATOM   3525  C C   . PRO B 2 395 ? 225.527 -44.188  38.693  1.00 183.86 ? 395 PRO B C   1 
ATOM   3526  O O   . PRO B 2 395 ? 224.469 -44.798  38.863  1.00 185.01 ? 395 PRO B O   1 
ATOM   3527  C CB  . PRO B 2 395 ? 226.844 -45.601  37.067  1.00 182.40 ? 395 PRO B CB  1 
ATOM   3528  C CG  . PRO B 2 395 ? 227.650 -46.842  37.245  1.00 181.81 ? 395 PRO B CG  1 
ATOM   3529  C CD  . PRO B 2 395 ? 227.291 -47.349  38.613  1.00 181.79 ? 395 PRO B CD  1 
ATOM   3530  N N   . ILE B 2 396 ? 225.617 -42.859  38.703  1.00 183.96 ? 396 ILE B N   1 
ATOM   3531  C CA  . ILE B 2 396 ? 224.514 -41.990  39.141  1.00 183.46 ? 396 ILE B CA  1 
ATOM   3532  C C   . ILE B 2 396 ? 223.800 -41.259  37.992  1.00 180.85 ? 396 ILE B C   1 
ATOM   3533  O O   . ILE B 2 396 ? 224.432 -40.842  37.017  1.00 183.50 ? 396 ILE B O   1 
ATOM   3534  C CB  . ILE B 2 396 ? 224.993 -40.989  40.235  1.00 184.78 ? 396 ILE B CB  1 
ATOM   3535  C CG1 . ILE B 2 396 ? 223.891 -39.990  40.629  1.00 185.97 ? 396 ILE B CG1 1 
ATOM   3536  C CG2 . ILE B 2 396 ? 226.255 -40.257  39.793  1.00 186.35 ? 396 ILE B CG2 1 
ATOM   3537  C CD1 . ILE B 2 396 ? 222.796 -40.571  41.502  1.00 185.38 ? 396 ILE B CD1 1 
ATOM   3538  N N   . LEU B 2 397 ? 222.478 -41.123  38.123  1.00 174.36 ? 397 LEU B N   1 
ATOM   3539  C CA  . LEU B 2 397 ? 221.656 -40.383  37.169  1.00 166.17 ? 397 LEU B CA  1 
ATOM   3540  C C   . LEU B 2 397 ? 221.359 -38.988  37.721  1.00 164.39 ? 397 LEU B C   1 
ATOM   3541  O O   . LEU B 2 397 ? 220.727 -38.849  38.773  1.00 161.56 ? 397 LEU B O   1 
ATOM   3542  C CB  . LEU B 2 397 ? 220.349 -41.135  36.895  1.00 161.65 ? 397 LEU B CB  1 
ATOM   3543  C CG  . LEU B 2 397 ? 219.922 -41.406  35.446  1.00 158.08 ? 397 LEU B CG  1 
ATOM   3544  C CD1 . LEU B 2 397 ? 218.574 -42.114  35.424  1.00 157.10 ? 397 LEU B CD1 1 
ATOM   3545  C CD2 . LEU B 2 397 ? 219.870 -40.140  34.602  1.00 156.39 ? 397 LEU B CD2 1 
ATOM   3546  N N   . ASP B 2 398 ? 221.816 -37.964  37.001  1.00 164.76 ? 398 ASP B N   1 
ATOM   3547  C CA  . ASP B 2 398 ? 221.713 -36.569  37.444  1.00 164.52 ? 398 ASP B CA  1 
ATOM   3548  C C   . ASP B 2 398 ? 220.302 -35.990  37.277  1.00 159.45 ? 398 ASP B C   1 
ATOM   3549  O O   . ASP B 2 398 ? 220.110 -34.983  36.596  1.00 160.24 ? 398 ASP B O   1 
ATOM   3550  C CB  . ASP B 2 398 ? 222.741 -35.693  36.705  1.00 169.80 ? 398 ASP B CB  1 
ATOM   3551  C CG  . ASP B 2 398 ? 224.181 -35.975  37.126  1.00 171.89 ? 398 ASP B CG  1 
ATOM   3552  O OD1 . ASP B 2 398 ? 224.447 -37.044  37.717  1.00 173.98 ? 398 ASP B OD1 1 
ATOM   3553  O OD2 . ASP B 2 398 ? 225.056 -35.120  36.858  1.00 171.96 ? 398 ASP B OD2 1 
ATOM   3554  N N   . VAL B 2 399 ? 219.326 -36.619  37.923  1.00 151.65 ? 399 VAL B N   1 
ATOM   3555  C CA  . VAL B 2 399 ? 217.922 -36.224  37.797  1.00 144.72 ? 399 VAL B CA  1 
ATOM   3556  C C   . VAL B 2 399 ? 217.571 -34.956  38.603  1.00 142.10 ? 399 VAL B C   1 
ATOM   3557  O O   . VAL B 2 399 ? 216.635 -34.232  38.248  1.00 139.21 ? 399 VAL B O   1 
ATOM   3558  C CB  . VAL B 2 399 ? 216.984 -37.416  38.120  1.00 143.52 ? 399 VAL B CB  1 
ATOM   3559  C CG1 . VAL B 2 399 ? 217.277 -37.984  39.502  1.00 143.40 ? 399 VAL B CG1 1 
ATOM   3560  C CG2 . VAL B 2 399 ? 215.516 -37.039  37.966  1.00 142.74 ? 399 VAL B CG2 1 
ATOM   3561  N N   . ASP B 2 400 ? 218.339 -34.682  39.660  1.00 140.40 ? 400 ASP B N   1 
ATOM   3562  C CA  . ASP B 2 400 ? 218.100 -33.510  40.522  1.00 137.74 ? 400 ASP B CA  1 
ATOM   3563  C C   . ASP B 2 400 ? 218.494 -32.155  39.909  1.00 135.94 ? 400 ASP B C   1 
ATOM   3564  O O   . ASP B 2 400 ? 217.999 -31.112  40.351  1.00 136.92 ? 400 ASP B O   1 
ATOM   3565  C CB  . ASP B 2 400 ? 218.718 -33.689  41.927  1.00 136.39 ? 400 ASP B CB  1 
ATOM   3566  C CG  . ASP B 2 400 ? 220.164 -34.172  41.895  1.00 134.67 ? 400 ASP B CG  1 
ATOM   3567  O OD1 . ASP B 2 400 ? 220.450 -35.202  41.247  1.00 134.34 ? 400 ASP B OD1 1 
ATOM   3568  O OD2 . ASP B 2 400 ? 221.015 -33.532  42.549  1.00 132.34 ? 400 ASP B OD2 1 
ATOM   3569  N N   . LYS B 2 401 ? 219.367 -32.171  38.898  1.00 132.11 ? 401 LYS B N   1 
ATOM   3570  C CA  . LYS B 2 401 ? 219.766 -30.945  38.183  1.00 126.47 ? 401 LYS B CA  1 
ATOM   3571  C C   . LYS B 2 401 ? 218.649 -30.383  37.298  1.00 121.64 ? 401 LYS B C   1 
ATOM   3572  O O   . LYS B 2 401 ? 218.663 -29.196  36.956  1.00 121.18 ? 401 LYS B O   1 
ATOM   3573  C CB  . LYS B 2 401 ? 221.038 -31.160  37.343  1.00 126.47 ? 401 LYS B CB  1 
ATOM   3574  C CG  . LYS B 2 401 ? 222.356 -30.801  38.029  1.00 124.29 ? 401 LYS B CG  1 
ATOM   3575  C CD  . LYS B 2 401 ? 223.466 -30.597  36.999  1.00 120.71 ? 401 LYS B CD  1 
ATOM   3576  C CE  . LYS B 2 401 ? 224.854 -30.886  37.562  1.00 117.63 ? 401 LYS B CE  1 
ATOM   3577  N NZ  . LYS B 2 401 ? 225.415 -29.755  38.359  1.00 115.39 ? 401 LYS B NZ  1 
ATOM   3578  N N   . ALA B 2 402 ? 217.697 -31.240  36.924  1.00 115.63 ? 402 ALA B N   1 
ATOM   3579  C CA  . ALA B 2 402 ? 216.521 -30.820  36.164  1.00 111.45 ? 402 ALA B CA  1 
ATOM   3580  C C   . ALA B 2 402 ? 215.749 -29.753  36.935  1.00 110.70 ? 402 ALA B C   1 
ATOM   3581  O O   . ALA B 2 402 ? 215.577 -29.862  38.152  1.00 111.40 ? 402 ALA B O   1 
ATOM   3582  C CB  . ALA B 2 402 ? 215.631 -32.013  35.854  1.00 108.99 ? 402 ALA B CB  1 
ATOM   3583  N N   . LYS B 2 403 ? 215.298 -28.723  36.219  1.00 109.45 ? 403 LYS B N   1 
ATOM   3584  C CA  . LYS B 2 403 ? 214.660 -27.542  36.823  1.00 108.52 ? 403 LYS B CA  1 
ATOM   3585  C C   . LYS B 2 403 ? 213.424 -27.851  37.673  1.00 110.03 ? 403 LYS B C   1 
ATOM   3586  O O   . LYS B 2 403 ? 213.104 -27.100  38.597  1.00 111.36 ? 403 LYS B O   1 
ATOM   3587  C CB  . LYS B 2 403 ? 214.315 -26.505  35.748  1.00 105.45 ? 403 LYS B CB  1 
ATOM   3588  C CG  . LYS B 2 403 ? 215.519 -25.767  35.186  1.00 102.50 ? 403 LYS B CG  1 
ATOM   3589  C CD  . LYS B 2 403 ? 215.140 -24.948  33.964  1.00 100.20 ? 403 LYS B CD  1 
ATOM   3590  C CE  . LYS B 2 403 ? 216.374 -24.365  33.296  1.00 99.21  ? 403 LYS B CE  1 
ATOM   3591  N NZ  . LYS B 2 403 ? 216.047 -23.689  32.011  1.00 98.39  ? 403 LYS B NZ  1 
ATOM   3592  N N   . ASN B 2 404 ? 212.735 -28.944  37.341  1.00 110.34 ? 404 ASN B N   1 
ATOM   3593  C CA  . ASN B 2 404 ? 211.597 -29.457  38.114  1.00 108.68 ? 404 ASN B CA  1 
ATOM   3594  C C   . ASN B 2 404 ? 211.551 -30.990  38.072  1.00 105.28 ? 404 ASN B C   1 
ATOM   3595  O O   . ASN B 2 404 ? 212.007 -31.602  37.104  1.00 105.13 ? 404 ASN B O   1 
ATOM   3596  C CB  . ASN B 2 404 ? 210.271 -28.867  37.610  1.00 110.07 ? 404 ASN B CB  1 
ATOM   3597  C CG  . ASN B 2 404 ? 210.113 -27.391  37.950  1.00 110.82 ? 404 ASN B CG  1 
ATOM   3598  O OD1 . ASN B 2 404 ? 210.127 -27.000  39.120  1.00 110.44 ? 404 ASN B OD1 1 
ATOM   3599  N ND2 . ASN B 2 404 ? 209.946 -26.563  36.922  1.00 111.22 ? 404 ASN B ND2 1 
ATOM   3600  N N   . VAL B 2 405 ? 211.012 -31.602  39.127  1.00 100.70 ? 405 VAL B N   1 
ATOM   3601  C CA  . VAL B 2 405 ? 210.959 -33.063  39.248  1.00 96.95  ? 405 VAL B CA  1 
ATOM   3602  C C   . VAL B 2 405 ? 209.597 -33.503  39.795  1.00 95.65  ? 405 VAL B C   1 
ATOM   3603  O O   . VAL B 2 405 ? 209.064 -32.885  40.715  1.00 94.10  ? 405 VAL B O   1 
ATOM   3604  C CB  . VAL B 2 405 ? 212.097 -33.611  40.150  1.00 96.06  ? 405 VAL B CB  1 
ATOM   3605  C CG1 . VAL B 2 405 ? 212.122 -35.132  40.142  1.00 95.76  ? 405 VAL B CG1 1 
ATOM   3606  C CG2 . VAL B 2 405 ? 213.458 -33.074  39.725  1.00 95.72  ? 405 VAL B CG2 1 
ATOM   3607  N N   . ILE B 2 406 ? 209.036 -34.562  39.209  1.00 96.14  ? 406 ILE B N   1 
ATOM   3608  C CA  . ILE B 2 406 ? 207.762 -35.138  39.658  1.00 97.34  ? 406 ILE B CA  1 
ATOM   3609  C C   . ILE B 2 406 ? 207.878 -36.663  39.825  1.00 99.44  ? 406 ILE B C   1 
ATOM   3610  O O   . ILE B 2 406 ? 208.136 -37.383  38.860  1.00 100.91 ? 406 ILE B O   1 
ATOM   3611  C CB  . ILE B 2 406 ? 206.594 -34.779  38.705  1.00 95.86  ? 406 ILE B CB  1 
ATOM   3612  C CG1 . ILE B 2 406 ? 206.428 -33.258  38.595  1.00 94.13  ? 406 ILE B CG1 1 
ATOM   3613  C CG2 . ILE B 2 406 ? 205.295 -35.423  39.177  1.00 96.17  ? 406 ILE B CG2 1 
ATOM   3614  C CD1 . ILE B 2 406 ? 205.528 -32.803  37.465  1.00 93.30  ? 406 ILE B CD1 1 
ATOM   3615  N N   . VAL B 2 407 ? 207.674 -37.143  41.052  1.00 100.58 ? 407 VAL B N   1 
ATOM   3616  C CA  . VAL B 2 407 ? 207.897 -38.555  41.398  1.00 100.73 ? 407 VAL B CA  1 
ATOM   3617  C C   . VAL B 2 407 ? 206.587 -39.330  41.543  1.00 98.37  ? 407 VAL B C   1 
ATOM   3618  O O   . VAL B 2 407 ? 205.602 -38.794  42.045  1.00 98.01  ? 407 VAL B O   1 
ATOM   3619  C CB  . VAL B 2 407 ? 208.709 -38.690  42.706  1.00 103.00 ? 407 VAL B CB  1 
ATOM   3620  C CG1 . VAL B 2 407 ? 209.093 -40.142  42.964  1.00 104.52 ? 407 VAL B CG1 1 
ATOM   3621  C CG2 . VAL B 2 407 ? 209.955 -37.816  42.659  1.00 104.56 ? 407 VAL B CG2 1 
ATOM   3622  N N   . ILE B 2 408 ? 206.586 -40.591  41.115  1.00 96.54  ? 408 ILE B N   1 
ATOM   3623  C CA  . ILE B 2 408 ? 205.386 -41.426  41.190  1.00 96.76  ? 408 ILE B CA  1 
ATOM   3624  C C   . ILE B 2 408 ? 205.603 -42.693  42.028  1.00 100.20 ? 408 ILE B C   1 
ATOM   3625  O O   . ILE B 2 408 ? 206.458 -43.522  41.702  1.00 99.06  ? 408 ILE B O   1 
ATOM   3626  C CB  . ILE B 2 408 ? 204.860 -41.795  39.784  1.00 94.42  ? 408 ILE B CB  1 
ATOM   3627  C CG1 . ILE B 2 408 ? 204.703 -40.538  38.919  1.00 93.04  ? 408 ILE B CG1 1 
ATOM   3628  C CG2 . ILE B 2 408 ? 203.537 -42.545  39.889  1.00 94.28  ? 408 ILE B CG2 1 
ATOM   3629  C CD1 . ILE B 2 408 ? 204.564 -40.805  37.435  1.00 92.35  ? 408 ILE B CD1 1 
ATOM   3630  N N   . LYS B 2 409 ? 204.824 -42.815  43.110  1.00 106.39 ? 409 LYS B N   1 
ATOM   3631  C CA  . LYS B 2 409 ? 204.783 -44.009  43.985  1.00 111.66 ? 409 LYS B CA  1 
ATOM   3632  C C   . LYS B 2 409 ? 203.689 -43.931  45.074  1.00 112.26 ? 409 LYS B C   1 
ATOM   3633  O O   . LYS B 2 409 ? 203.335 -42.838  45.519  1.00 114.14 ? 409 LYS B O   1 
ATOM   3634  C CB  . LYS B 2 409 ? 206.157 -44.311  44.603  1.00 115.67 ? 409 LYS B CB  1 
ATOM   3635  C CG  . LYS B 2 409 ? 206.759 -43.183  45.429  1.00 120.02 ? 409 LYS B CG  1 
ATOM   3636  C CD  . LYS B 2 409 ? 208.256 -43.375  45.640  1.00 123.83 ? 409 LYS B CD  1 
ATOM   3637  C CE  . LYS B 2 409 ? 208.581 -44.607  46.478  1.00 125.73 ? 409 LYS B CE  1 
ATOM   3638  N NZ  . LYS B 2 409 ? 208.067 -44.523  47.874  1.00 127.75 ? 409 LYS B NZ  1 
ATOM   3639  N N   . ARG B 2 410 ? 203.184 -45.092  45.506  1.00 110.59 ? 410 ARG B N   1 
ATOM   3640  C CA  . ARG B 2 410 ? 202.000 -45.190  46.389  1.00 108.40 ? 410 ARG B CA  1 
ATOM   3641  C C   . ARG B 2 410 ? 202.111 -44.502  47.749  1.00 107.57 ? 410 ARG B C   1 
ATOM   3642  O O   . ARG B 2 410 ? 201.223 -43.740  48.135  1.00 105.50 ? 410 ARG B O   1 
ATOM   3643  C CB  . ARG B 2 410 ? 201.612 -46.654  46.620  1.00 107.66 ? 410 ARG B CB  1 
ATOM   3644  C CG  . ARG B 2 410 ? 201.080 -47.379  45.397  1.00 108.51 ? 410 ARG B CG  1 
ATOM   3645  C CD  . ARG B 2 410 ? 201.171 -48.880  45.598  1.00 110.11 ? 410 ARG B CD  1 
ATOM   3646  N NE  . ARG B 2 410 ? 202.548 -49.302  45.854  1.00 112.41 ? 410 ARG B NE  1 
ATOM   3647  C CZ  . ARG B 2 410 ? 202.916 -50.542  46.166  1.00 114.31 ? 410 ARG B CZ  1 
ATOM   3648  N NH1 . ARG B 2 410 ? 202.012 -51.511  46.268  1.00 115.44 ? 410 ARG B NH1 1 
ATOM   3649  N NH2 . ARG B 2 410 ? 204.196 -50.815  46.379  1.00 115.27 ? 410 ARG B NH2 1 
ATOM   3650  N N   . GLY B 2 411 ? 203.186 -44.793  48.478  1.00 108.82 ? 411 GLY B N   1 
ATOM   3651  C CA  . GLY B 2 411 ? 203.362 -44.267  49.828  1.00 112.48 ? 411 GLY B CA  1 
ATOM   3652  C C   . GLY B 2 411 ? 204.804 -43.967  50.192  1.00 115.84 ? 411 GLY B C   1 
ATOM   3653  O O   . GLY B 2 411 ? 205.451 -43.135  49.553  1.00 116.26 ? 411 GLY B O   1 
ATOM   3654  N N   . GLN B 2 412 ? 205.300 -44.652  51.223  1.00 119.41 ? 412 GLN B N   1 
ATOM   3655  C CA  . GLN B 2 412 ? 206.654 -44.434  51.750  1.00 121.80 ? 412 GLN B CA  1 
ATOM   3656  C C   . GLN B 2 412 ? 207.627 -45.573  51.443  1.00 122.08 ? 412 GLN B C   1 
ATOM   3657  O O   . GLN B 2 412 ? 208.818 -45.474  51.755  1.00 121.55 ? 412 GLN B O   1 
ATOM   3658  C CB  . GLN B 2 412 ? 206.612 -44.198  53.266  1.00 123.51 ? 412 GLN B CB  1 
ATOM   3659  C CG  . GLN B 2 412 ? 206.188 -42.799  53.685  1.00 126.03 ? 412 GLN B CG  1 
ATOM   3660  C CD  . GLN B 2 412 ? 207.121 -41.720  53.168  1.00 127.80 ? 412 GLN B CD  1 
ATOM   3661  O OE1 . GLN B 2 412 ? 206.699 -40.823  52.439  1.00 131.82 ? 412 GLN B OE1 1 
ATOM   3662  N NE2 . GLN B 2 412 ? 208.397 -41.809  53.531  1.00 126.68 ? 412 GLN B NE2 1 
ATOM   3663  N N   . GLY B 2 413 ? 207.114 -46.643  50.833  1.00 122.92 ? 413 GLY B N   1 
ATOM   3664  C CA  . GLY B 2 413 ? 207.893 -47.849  50.531  1.00 123.29 ? 413 GLY B CA  1 
ATOM   3665  C C   . GLY B 2 413 ? 209.272 -47.580  49.958  1.00 123.11 ? 413 GLY B C   1 
ATOM   3666  O O   . GLY B 2 413 ? 209.429 -46.751  49.060  1.00 124.22 ? 413 GLY B O   1 
ATOM   3667  N N   . LYS B 2 414 ? 210.271 -48.285  50.484  1.00 122.00 ? 414 LYS B N   1 
ATOM   3668  C CA  . LYS B 2 414 ? 211.667 -48.058  50.110  1.00 120.09 ? 414 LYS B CA  1 
ATOM   3669  C C   . LYS B 2 414 ? 212.112 -48.919  48.937  1.00 115.62 ? 414 LYS B C   1 
ATOM   3670  O O   . LYS B 2 414 ? 211.362 -49.763  48.442  1.00 112.64 ? 414 LYS B O   1 
ATOM   3671  C CB  . LYS B 2 414 ? 212.595 -48.316  51.298  1.00 124.94 ? 414 LYS B CB  1 
ATOM   3672  C CG  . LYS B 2 414 ? 212.290 -47.483  52.526  1.00 132.33 ? 414 LYS B CG  1 
ATOM   3673  C CD  . LYS B 2 414 ? 213.257 -47.814  53.646  1.00 139.00 ? 414 LYS B CD  1 
ATOM   3674  C CE  . LYS B 2 414 ? 212.583 -47.676  55.002  1.00 144.64 ? 414 LYS B CE  1 
ATOM   3675  N NZ  . LYS B 2 414 ? 211.794 -48.887  55.371  1.00 146.89 ? 414 LYS B NZ  1 
ATOM   3676  N N   . GLY B 2 415 ? 213.351 -48.699  48.511  1.00 113.23 ? 415 GLY B N   1 
ATOM   3677  C CA  . GLY B 2 415 ? 213.950 -49.473  47.441  1.00 112.71 ? 415 GLY B CA  1 
ATOM   3678  C C   . GLY B 2 415 ? 214.465 -50.810  47.920  1.00 114.62 ? 415 GLY B C   1 
ATOM   3679  O O   . GLY B 2 415 ? 213.882 -51.423  48.817  1.00 110.84 ? 415 GLY B O   1 
ATOM   3680  N N   . PHE B 2 416 ? 215.561 -51.265  47.318  1.00 121.72 ? 416 PHE B N   1 
ATOM   3681  C CA  . PHE B 2 416 ? 216.185 -52.524  47.720  1.00 132.51 ? 416 PHE B CA  1 
ATOM   3682  C C   . PHE B 2 416 ? 217.104 -52.364  48.929  1.00 136.53 ? 416 PHE B C   1 
ATOM   3683  O O   . PHE B 2 416 ? 216.844 -52.943  49.986  1.00 138.31 ? 416 PHE B O   1 
ATOM   3684  C CB  . PHE B 2 416 ? 216.955 -53.178  46.560  1.00 138.14 ? 416 PHE B CB  1 
ATOM   3685  C CG  . PHE B 2 416 ? 217.912 -54.263  47.001  1.00 143.12 ? 416 PHE B CG  1 
ATOM   3686  C CD1 . PHE B 2 416 ? 217.445 -55.527  47.359  1.00 143.56 ? 416 PHE B CD1 1 
ATOM   3687  C CD2 . PHE B 2 416 ? 219.284 -54.019  47.072  1.00 144.18 ? 416 PHE B CD2 1 
ATOM   3688  C CE1 . PHE B 2 416 ? 218.324 -56.521  47.772  1.00 142.59 ? 416 PHE B CE1 1 
ATOM   3689  C CE2 . PHE B 2 416 ? 220.167 -55.008  47.485  1.00 142.80 ? 416 PHE B CE2 1 
ATOM   3690  C CZ  . PHE B 2 416 ? 219.686 -56.261  47.834  1.00 141.94 ? 416 PHE B CZ  1 
ATOM   3691  N N   . ALA B 2 417 ? 218.180 -51.591  48.761  1.00 139.96 ? 417 ALA B N   1 
ATOM   3692  C CA  . ALA B 2 417 ? 219.228 -51.465  49.779  1.00 142.34 ? 417 ALA B CA  1 
ATOM   3693  C C   . ALA B 2 417 ? 218.645 -51.032  51.117  1.00 146.45 ? 417 ALA B C   1 
ATOM   3694  O O   . ALA B 2 417 ? 219.061 -51.525  52.170  1.00 144.80 ? 417 ALA B O   1 
ATOM   3695  C CB  . ALA B 2 417 ? 220.314 -50.500  49.323  1.00 140.59 ? 417 ALA B CB  1 
ATOM   3696  N N   . GLY B 2 418 ? 217.681 -50.114  51.058  1.00 153.19 ? 418 GLY B N   1 
ATOM   3697  C CA  . GLY B 2 418 ? 216.871 -49.744  52.215  1.00 162.29 ? 418 GLY B CA  1 
ATOM   3698  C C   . GLY B 2 418 ? 217.186 -48.400  52.842  1.00 167.93 ? 418 GLY B C   1 
ATOM   3699  O O   . GLY B 2 418 ? 217.288 -48.298  54.066  1.00 175.28 ? 418 GLY B O   1 
ATOM   3700  N N   . VAL B 2 419 ? 217.333 -47.368  52.012  1.00 167.33 ? 419 VAL B N   1 
ATOM   3701  C CA  . VAL B 2 419 ? 217.602 -46.012  52.505  1.00 165.51 ? 419 VAL B CA  1 
ATOM   3702  C C   . VAL B 2 419 ? 216.577 -44.998  52.010  1.00 161.74 ? 419 VAL B C   1 
ATOM   3703  O O   . VAL B 2 419 ? 215.952 -45.189  50.964  1.00 159.10 ? 419 VAL B O   1 
ATOM   3704  C CB  . VAL B 2 419 ? 219.024 -45.515  52.146  1.00 167.55 ? 419 VAL B CB  1 
ATOM   3705  C CG1 . VAL B 2 419 ? 220.046 -46.041  53.142  1.00 170.71 ? 419 VAL B CG1 1 
ATOM   3706  C CG2 . VAL B 2 419 ? 219.396 -45.899  50.720  1.00 169.01 ? 419 VAL B CG2 1 
ATOM   3707  N N   . GLU B 2 420 ? 216.409 -43.925  52.780  1.00 160.91 ? 420 GLU B N   1 
ATOM   3708  C CA  . GLU B 2 420 ? 215.559 -42.812  52.382  1.00 162.36 ? 420 GLU B CA  1 
ATOM   3709  C C   . GLU B 2 420 ? 216.223 -42.009  51.272  1.00 161.18 ? 420 GLU B C   1 
ATOM   3710  O O   . GLU B 2 420 ? 217.452 -41.981  51.163  1.00 161.96 ? 420 GLU B O   1 
ATOM   3711  C CB  . GLU B 2 420 ? 215.260 -41.906  53.576  1.00 167.27 ? 420 GLU B CB  1 
ATOM   3712  C CG  . GLU B 2 420 ? 214.137 -42.406  54.469  1.00 172.39 ? 420 GLU B CG  1 
ATOM   3713  C CD  . GLU B 2 420 ? 213.736 -41.396  55.528  1.00 176.63 ? 420 GLU B CD  1 
ATOM   3714  O OE1 . GLU B 2 420 ? 214.580 -41.056  56.385  1.00 179.62 ? 420 GLU B OE1 1 
ATOM   3715  O OE2 . GLU B 2 420 ? 212.570 -40.947  55.509  1.00 178.05 ? 420 GLU B OE2 1 
ATOM   3716  N N   . ASN B 2 421 ? 215.400 -41.362  50.452  1.00 158.63 ? 421 ASN B N   1 
ATOM   3717  C CA  . ASN B 2 421 ? 215.884 -40.565  49.332  1.00 156.30 ? 421 ASN B CA  1 
ATOM   3718  C C   . ASN B 2 421 ? 215.662 -39.076  49.579  1.00 159.02 ? 421 ASN B C   1 
ATOM   3719  O O   . ASN B 2 421 ? 214.523 -38.620  49.709  1.00 158.98 ? 421 ASN B O   1 
ATOM   3720  C CB  . ASN B 2 421 ? 215.198 -41.013  48.039  1.00 149.71 ? 421 ASN B CB  1 
ATOM   3721  C CG  . ASN B 2 421 ? 215.898 -40.517  46.786  1.00 144.54 ? 421 ASN B CG  1 
ATOM   3722  O OD1 . ASN B 2 421 ? 216.662 -39.555  46.818  1.00 142.14 ? 421 ASN B OD1 1 
ATOM   3723  N ND2 . ASN B 2 421 ? 215.631 -41.178  45.666  1.00 141.19 ? 421 ASN B ND2 1 
ATOM   3724  N N   . GLU B 2 422 ? 216.762 -38.329  49.641  1.00 162.76 ? 422 GLU B N   1 
ATOM   3725  C CA  . GLU B 2 422 ? 216.721 -36.891  49.906  1.00 165.93 ? 422 GLU B CA  1 
ATOM   3726  C C   . GLU B 2 422 ? 216.341 -36.072  48.670  1.00 170.85 ? 422 GLU B C   1 
ATOM   3727  O O   . GLU B 2 422 ? 216.188 -34.852  48.754  1.00 174.01 ? 422 GLU B O   1 
ATOM   3728  C CB  . GLU B 2 422 ? 218.055 -36.409  50.489  1.00 163.29 ? 422 GLU B CB  1 
ATOM   3729  C CG  . GLU B 2 422 ? 219.252 -36.579  49.563  1.00 162.36 ? 422 GLU B CG  1 
ATOM   3730  C CD  . GLU B 2 422 ? 220.578 -36.360  50.267  1.00 162.00 ? 422 GLU B CD  1 
ATOM   3731  O OE1 . GLU B 2 422 ? 220.615 -35.612  51.270  1.00 160.69 ? 422 GLU B OE1 1 
ATOM   3732  O OE2 . GLU B 2 422 ? 221.587 -36.939  49.812  1.00 162.61 ? 422 GLU B OE2 1 
ATOM   3733  N N   . LEU B 2 423 ? 216.196 -36.747  47.530  1.00 175.03 ? 423 LEU B N   1 
ATOM   3734  C CA  . LEU B 2 423 ? 215.725 -36.112  46.300  1.00 179.58 ? 423 LEU B CA  1 
ATOM   3735  C C   . LEU B 2 423 ? 214.247 -35.754  46.397  1.00 183.29 ? 423 LEU B C   1 
ATOM   3736  O O   . LEU B 2 423 ? 213.809 -34.760  45.821  1.00 181.71 ? 423 LEU B O   1 
ATOM   3737  C CB  . LEU B 2 423 ? 215.971 -37.020  45.093  1.00 179.41 ? 423 LEU B CB  1 
ATOM   3738  C CG  . LEU B 2 423 ? 215.383 -36.682  43.719  1.00 181.16 ? 423 LEU B CG  1 
ATOM   3739  C CD1 . LEU B 2 423 ? 215.834 -35.324  43.199  1.00 181.23 ? 423 LEU B CD1 1 
ATOM   3740  C CD2 . LEU B 2 423 ? 215.748 -37.782  42.738  1.00 182.50 ? 423 LEU B CD2 1 
ATOM   3741  N N   . PHE B 2 424 ? 213.490 -36.569  47.130  1.00 189.50 ? 424 PHE B N   1 
ATOM   3742  C CA  . PHE B 2 424 ? 212.060 -36.337  47.338  1.00 196.46 ? 424 PHE B CA  1 
ATOM   3743  C C   . PHE B 2 424 ? 211.802 -35.013  48.060  1.00 201.15 ? 424 PHE B C   1 
ATOM   3744  O O   . PHE B 2 424 ? 210.796 -34.345  47.808  1.00 204.54 ? 424 PHE B O   1 
ATOM   3745  C CB  . PHE B 2 424 ? 211.426 -37.485  48.137  1.00 197.34 ? 424 PHE B CB  1 
ATOM   3746  C CG  . PHE B 2 424 ? 211.673 -38.859  47.564  1.00 197.56 ? 424 PHE B CG  1 
ATOM   3747  C CD1 . PHE B 2 424 ? 211.832 -39.056  46.193  1.00 198.49 ? 424 PHE B CD1 1 
ATOM   3748  C CD2 . PHE B 2 424 ? 211.709 -39.968  48.404  1.00 197.62 ? 424 PHE B CD2 1 
ATOM   3749  C CE1 . PHE B 2 424 ? 212.050 -40.326  45.679  1.00 200.03 ? 424 PHE B CE1 1 
ATOM   3750  C CE2 . PHE B 2 424 ? 211.918 -41.241  47.895  1.00 198.01 ? 424 PHE B CE2 1 
ATOM   3751  C CZ  . PHE B 2 424 ? 212.090 -41.420  46.530  1.00 199.11 ? 424 PHE B CZ  1 
ATOM   3752  N N   . TYR B 2 425 ? 212.724 -34.649  48.951  1.00 203.05 ? 425 TYR B N   1 
ATOM   3753  C CA  . TYR B 2 425 ? 212.623 -33.437  49.769  1.00 200.57 ? 425 TYR B CA  1 
ATOM   3754  C C   . TYR B 2 425 ? 213.007 -32.145  49.022  1.00 200.27 ? 425 TYR B C   1 
ATOM   3755  O O   . TYR B 2 425 ? 212.758 -31.044  49.524  1.00 203.12 ? 425 TYR B O   1 
ATOM   3756  C CB  . TYR B 2 425 ? 213.488 -33.581  51.035  1.00 195.63 ? 425 TYR B CB  1 
ATOM   3757  C CG  . TYR B 2 425 ? 212.991 -34.595  52.053  1.00 188.40 ? 425 TYR B CG  1 
ATOM   3758  C CD1 . TYR B 2 425 ? 213.352 -35.941  51.965  1.00 186.28 ? 425 TYR B CD1 1 
ATOM   3759  C CD2 . TYR B 2 425 ? 212.181 -34.202  53.118  1.00 184.32 ? 425 TYR B CD2 1 
ATOM   3760  C CE1 . TYR B 2 425 ? 212.904 -36.865  52.898  1.00 182.86 ? 425 TYR B CE1 1 
ATOM   3761  C CE2 . TYR B 2 425 ? 211.730 -35.118  54.056  1.00 181.03 ? 425 TYR B CE2 1 
ATOM   3762  C CZ  . TYR B 2 425 ? 212.093 -36.447  53.942  1.00 181.09 ? 425 TYR B CZ  1 
ATOM   3763  O OH  . TYR B 2 425 ? 211.645 -37.356  54.872  1.00 180.04 ? 425 TYR B OH  1 
ATOM   3764  N N   . ALA B 2 426 ? 213.596 -32.285  47.830  1.00 194.27 ? 426 ALA B N   1 
ATOM   3765  C CA  . ALA B 2 426 ? 214.188 -31.157  47.085  1.00 184.57 ? 426 ALA B CA  1 
ATOM   3766  C C   . ALA B 2 426 ? 213.212 -30.034  46.723  1.00 178.44 ? 426 ALA B C   1 
ATOM   3767  O O   . ALA B 2 426 ? 212.018 -30.272  46.533  1.00 177.14 ? 426 ALA B O   1 
ATOM   3768  C CB  . ALA B 2 426 ? 214.906 -31.657  45.837  1.00 182.28 ? 426 ALA B CB  1 
ATOM   3769  N N   . GLU B 2 427 ? 213.745 -28.815  46.626  1.00 173.26 ? 427 GLU B N   1 
ATOM   3770  C CA  . GLU B 2 427 ? 212.960 -27.621  46.301  1.00 171.01 ? 427 GLU B CA  1 
ATOM   3771  C C   . GLU B 2 427 ? 212.377 -27.705  44.892  1.00 167.93 ? 427 GLU B C   1 
ATOM   3772  O O   . GLU B 2 427 ? 211.296 -27.175  44.628  1.00 169.77 ? 427 GLU B O   1 
ATOM   3773  C CB  . GLU B 2 427 ? 213.822 -26.359  46.443  1.00 173.50 ? 427 GLU B CB  1 
ATOM   3774  C CG  . GLU B 2 427 ? 213.057 -25.090  46.814  1.00 176.22 ? 427 GLU B CG  1 
ATOM   3775  C CD  . GLU B 2 427 ? 212.356 -24.426  45.637  1.00 177.48 ? 427 GLU B CD  1 
ATOM   3776  O OE1 . GLU B 2 427 ? 211.310 -23.772  45.860  1.00 176.44 ? 427 GLU B OE1 1 
ATOM   3777  O OE2 . GLU B 2 427 ? 212.843 -24.550  44.489  1.00 179.86 ? 427 GLU B OE2 1 
ATOM   3778  N N   . ASN B 2 428 ? 213.098 -28.375  43.996  1.00 162.29 ? 428 ASN B N   1 
ATOM   3779  C CA  . ASN B 2 428 ? 212.646 -28.566  42.622  1.00 158.34 ? 428 ASN B CA  1 
ATOM   3780  C C   . ASN B 2 428 ? 211.976 -29.926  42.377  1.00 156.69 ? 428 ASN B C   1 
ATOM   3781  O O   . ASN B 2 428 ? 211.719 -30.297  41.232  1.00 157.23 ? 428 ASN B O   1 
ATOM   3782  C CB  . ASN B 2 428 ? 213.807 -28.340  41.641  1.00 155.12 ? 428 ASN B CB  1 
ATOM   3783  C CG  . ASN B 2 428 ? 214.162 -26.869  41.472  1.00 152.09 ? 428 ASN B CG  1 
ATOM   3784  O OD1 . ASN B 2 428 ? 213.285 -26.006  41.391  1.00 150.78 ? 428 ASN B OD1 1 
ATOM   3785  N ND2 . ASN B 2 428 ? 215.458 -26.581  41.398  1.00 148.83 ? 428 ASN B ND2 1 
ATOM   3786  N N   . THR B 2 429 ? 211.683 -30.658  43.453  1.00 153.33 ? 429 THR B N   1 
ATOM   3787  C CA  . THR B 2 429 ? 211.053 -31.977  43.342  1.00 149.69 ? 429 THR B CA  1 
ATOM   3788  C C   . THR B 2 429 ? 209.675 -32.026  44.010  1.00 153.70 ? 429 THR B C   1 
ATOM   3789  O O   . THR B 2 429 ? 209.520 -31.620  45.164  1.00 156.35 ? 429 THR B O   1 
ATOM   3790  C CB  . THR B 2 429 ? 211.960 -33.084  43.920  1.00 144.46 ? 429 THR B CB  1 
ATOM   3791  O OG1 . THR B 2 429 ? 213.237 -33.046  43.272  1.00 140.03 ? 429 THR B OG1 1 
ATOM   3792  C CG2 . THR B 2 429 ? 211.340 -34.463  43.724  1.00 141.61 ? 429 THR B CG2 1 
ATOM   3793  N N   . ARG B 2 430 ? 208.687 -32.529  43.271  1.00 155.69 ? 430 ARG B N   1 
ATOM   3794  C CA  . ARG B 2 430 ? 207.319 -32.686  43.772  1.00 158.07 ? 430 ARG B CA  1 
ATOM   3795  C C   . ARG B 2 430 ? 206.877 -34.150  43.725  1.00 160.01 ? 430 ARG B C   1 
ATOM   3796  O O   . ARG B 2 430 ? 207.371 -34.926  42.904  1.00 159.60 ? 430 ARG B O   1 
ATOM   3797  C CB  . ARG B 2 430 ? 206.355 -31.786  42.992  1.00 156.95 ? 430 ARG B CB  1 
ATOM   3798  C CG  . ARG B 2 430 ? 206.506 -30.311  43.332  1.00 157.19 ? 430 ARG B CG  1 
ATOM   3799  C CD  . ARG B 2 430 ? 205.964 -29.408  42.237  1.00 157.74 ? 430 ARG B CD  1 
ATOM   3800  N NE  . ARG B 2 430 ? 206.353 -28.011  42.443  1.00 159.88 ? 430 ARG B NE  1 
ATOM   3801  C CZ  . ARG B 2 430 ? 207.430 -27.435  41.909  1.00 160.35 ? 430 ARG B CZ  1 
ATOM   3802  N NH1 . ARG B 2 430 ? 208.245 -28.126  41.121  1.00 160.40 ? 430 ARG B NH1 1 
ATOM   3803  N NH2 . ARG B 2 430 ? 207.693 -26.158  42.159  1.00 160.15 ? 430 ARG B NH2 1 
ATOM   3804  N N   . MET B 2 431 ? 205.948 -34.518  44.606  1.00 162.68 ? 431 MET B N   1 
ATOM   3805  C CA  . MET B 2 431 ? 205.566 -35.921  44.803  1.00 164.67 ? 431 MET B CA  1 
ATOM   3806  C C   . MET B 2 431 ? 204.136 -36.227  44.367  1.00 169.34 ? 431 MET B C   1 
ATOM   3807  O O   . MET B 2 431 ? 203.214 -35.462  44.657  1.00 172.89 ? 431 MET B O   1 
ATOM   3808  C CB  . MET B 2 431 ? 205.748 -36.324  46.271  1.00 161.24 ? 431 MET B CB  1 
ATOM   3809  C CG  . MET B 2 431 ? 207.117 -36.003  46.854  1.00 158.67 ? 431 MET B CG  1 
ATOM   3810  S SD  . MET B 2 431 ? 208.476 -36.796  45.974  1.00 155.77 ? 431 MET B SD  1 
ATOM   3811  C CE  . MET B 2 431 ? 208.190 -38.515  46.392  1.00 157.46 ? 431 MET B CE  1 
ATOM   3812  N N   . LEU B 2 432 ? 203.963 -37.356  43.682  1.00 172.61 ? 432 LEU B N   1 
ATOM   3813  C CA  . LEU B 2 432 ? 202.647 -37.814  43.237  1.00 176.09 ? 432 LEU B CA  1 
ATOM   3814  C C   . LEU B 2 432 ? 202.383 -39.218  43.793  1.00 176.28 ? 432 LEU B C   1 
ATOM   3815  O O   . LEU B 2 432 ? 203.163 -40.144  43.547  1.00 179.19 ? 432 LEU B O   1 
ATOM   3816  C CB  . LEU B 2 432 ? 202.573 -37.811  41.703  1.00 177.53 ? 432 LEU B CB  1 
ATOM   3817  C CG  . LEU B 2 432 ? 201.374 -37.159  41.001  1.00 178.83 ? 432 LEU B CG  1 
ATOM   3818  C CD1 . LEU B 2 432 ? 201.596 -37.123  39.495  1.00 178.96 ? 432 LEU B CD1 1 
ATOM   3819  C CD2 . LEU B 2 432 ? 200.063 -37.857  41.334  1.00 179.57 ? 432 LEU B CD2 1 
ATOM   3820  N N   . TYR B 2 433 ? 201.289 -39.365  44.546  1.00 172.52 ? 433 TYR B N   1 
ATOM   3821  C CA  . TYR B 2 433 ? 200.962 -40.623  45.239  1.00 164.99 ? 433 TYR B CA  1 
ATOM   3822  C C   . TYR B 2 433 ? 199.890 -41.477  44.545  1.00 161.76 ? 433 TYR B C   1 
ATOM   3823  O O   . TYR B 2 433 ? 199.022 -40.958  43.836  1.00 165.25 ? 433 TYR B O   1 
ATOM   3824  C CB  . TYR B 2 433 ? 200.547 -40.359  46.695  1.00 159.21 ? 433 TYR B CB  1 
ATOM   3825  C CG  . TYR B 2 433 ? 201.622 -39.738  47.561  1.00 151.76 ? 433 TYR B CG  1 
ATOM   3826  C CD1 . TYR B 2 433 ? 202.745 -40.469  47.948  1.00 148.82 ? 433 TYR B CD1 1 
ATOM   3827  C CD2 . TYR B 2 433 ? 201.505 -38.423  48.008  1.00 148.15 ? 433 TYR B CD2 1 
ATOM   3828  C CE1 . TYR B 2 433 ? 203.727 -39.902  48.742  1.00 146.57 ? 433 TYR B CE1 1 
ATOM   3829  C CE2 . TYR B 2 433 ? 202.480 -37.849  48.804  1.00 145.83 ? 433 TYR B CE2 1 
ATOM   3830  C CZ  . TYR B 2 433 ? 203.587 -38.591  49.167  1.00 146.06 ? 433 TYR B CZ  1 
ATOM   3831  O OH  . TYR B 2 433 ? 204.553 -38.019  49.957  1.00 147.63 ? 433 TYR B OH  1 
ATOM   3832  N N   . GLY B 2 434 ? 199.960 -42.788  44.775  1.00 152.52 ? 434 GLY B N   1 
ATOM   3833  C CA  . GLY B 2 434 ? 199.020 -43.746  44.194  1.00 137.77 ? 434 GLY B CA  1 
ATOM   3834  C C   . GLY B 2 434 ? 199.706 -44.805  43.350  1.00 127.19 ? 434 GLY B C   1 
ATOM   3835  O O   . GLY B 2 434 ? 200.930 -44.802  43.202  1.00 127.81 ? 434 GLY B O   1 
ATOM   3836  N N   . ASP B 2 435 ? 198.909 -45.717  42.801  1.00 116.46 ? 435 ASP B N   1 
ATOM   3837  C CA  . ASP B 2 435 ? 199.417 -46.763  41.919  1.00 107.25 ? 435 ASP B CA  1 
ATOM   3838  C C   . ASP B 2 435 ? 199.923 -46.166  40.608  1.00 103.77 ? 435 ASP B C   1 
ATOM   3839  O O   . ASP B 2 435 ? 199.338 -45.216  40.089  1.00 102.23 ? 435 ASP B O   1 
ATOM   3840  C CB  . ASP B 2 435 ? 198.329 -47.800  41.648  1.00 104.93 ? 435 ASP B CB  1 
ATOM   3841  C CG  . ASP B 2 435 ? 198.717 -48.780  40.564  1.00 103.31 ? 435 ASP B CG  1 
ATOM   3842  O OD1 . ASP B 2 435 ? 199.794 -49.403  40.678  1.00 102.61 ? 435 ASP B OD1 1 
ATOM   3843  O OD2 . ASP B 2 435 ? 197.945 -48.921  39.594  1.00 103.03 ? 435 ASP B OD2 1 
ATOM   3844  N N   . ALA B 2 436 ? 201.001 -46.744  40.079  1.00 101.11 ? 436 ALA B N   1 
ATOM   3845  C CA  . ALA B 2 436 ? 201.713 -46.190  38.923  1.00 100.59 ? 436 ALA B CA  1 
ATOM   3846  C C   . ALA B 2 436 ? 200.851 -45.925  37.682  1.00 100.46 ? 436 ALA B C   1 
ATOM   3847  O O   . ALA B 2 436 ? 200.648 -44.766  37.314  1.00 100.95 ? 436 ALA B O   1 
ATOM   3848  C CB  . ALA B 2 436 ? 202.923 -47.045  38.576  1.00 100.49 ? 436 ALA B CB  1 
ATOM   3849  N N   . GLN B 2 437 ? 200.346 -46.986  37.048  1.00 100.03 ? 437 GLN B N   1 
ATOM   3850  C CA  . GLN B 2 437 ? 199.556 -46.838  35.815  1.00 100.00 ? 437 GLN B CA  1 
ATOM   3851  C C   . GLN B 2 437 ? 198.185 -46.208  36.077  1.00 100.19 ? 437 GLN B C   1 
ATOM   3852  O O   . GLN B 2 437 ? 197.547 -45.687  35.161  1.00 101.04 ? 437 GLN B O   1 
ATOM   3853  C CB  . GLN B 2 437 ? 199.438 -48.164  35.039  1.00 99.09  ? 437 GLN B CB  1 
ATOM   3854  C CG  . GLN B 2 437 ? 198.148 -48.954  35.220  1.00 98.08  ? 437 GLN B CG  1 
ATOM   3855  C CD  . GLN B 2 437 ? 197.826 -49.830  34.018  1.00 97.09  ? 437 GLN B CD  1 
ATOM   3856  O OE1 . GLN B 2 437 ? 198.699 -50.504  33.466  1.00 96.08  ? 437 GLN B OE1 1 
ATOM   3857  N NE2 . GLN B 2 437 ? 196.562 -49.825  33.608  1.00 96.84  ? 437 GLN B NE2 1 
ATOM   3858  N N   . LYS B 2 438 ? 197.754 -46.260  37.335  1.00 99.40  ? 438 LYS B N   1 
ATOM   3859  C CA  . LYS B 2 438 ? 196.519 -45.624  37.779  1.00 98.57  ? 438 LYS B CA  1 
ATOM   3860  C C   . LYS B 2 438 ? 196.658 -44.099  37.761  1.00 99.54  ? 438 LYS B C   1 
ATOM   3861  O O   . LYS B 2 438 ? 195.677 -43.382  37.551  1.00 100.77 ? 438 LYS B O   1 
ATOM   3862  C CB  . LYS B 2 438 ? 196.170 -46.108  39.187  1.00 96.24  ? 438 LYS B CB  1 
ATOM   3863  C CG  . LYS B 2 438 ? 194.705 -45.987  39.565  1.00 93.70  ? 438 LYS B CG  1 
ATOM   3864  C CD  . LYS B 2 438 ? 194.456 -46.608  40.930  1.00 91.64  ? 438 LYS B CD  1 
ATOM   3865  C CE  . LYS B 2 438 ? 192.995 -46.497  41.341  1.00 90.19  ? 438 LYS B CE  1 
ATOM   3866  N NZ  . LYS B 2 438 ? 192.102 -47.348  40.502  1.00 88.73  ? 438 LYS B NZ  1 
ATOM   3867  N N   . VAL B 2 439 ? 197.882 -43.619  37.978  1.00 99.40  ? 439 VAL B N   1 
ATOM   3868  C CA  . VAL B 2 439 ? 198.183 -42.185  37.976  1.00 98.47  ? 439 VAL B CA  1 
ATOM   3869  C C   . VAL B 2 439 ? 198.444 -41.659  36.560  1.00 97.16  ? 439 VAL B C   1 
ATOM   3870  O O   . VAL B 2 439 ? 197.933 -40.600  36.188  1.00 96.98  ? 439 VAL B O   1 
ATOM   3871  C CB  . VAL B 2 439 ? 199.360 -41.854  38.926  1.00 98.80  ? 439 VAL B CB  1 
ATOM   3872  C CG1 . VAL B 2 439 ? 199.914 -40.461  38.663  1.00 98.86  ? 439 VAL B CG1 1 
ATOM   3873  C CG2 . VAL B 2 439 ? 198.918 -41.979  40.377  1.00 98.91  ? 439 VAL B CG2 1 
ATOM   3874  N N   . LEU B 2 440 ? 199.231 -42.401  35.781  1.00 95.68  ? 440 LEU B N   1 
ATOM   3875  C CA  . LEU B 2 440 ? 199.508 -42.045  34.387  1.00 94.63  ? 440 LEU B CA  1 
ATOM   3876  C C   . LEU B 2 440 ? 198.220 -41.924  33.584  1.00 95.84  ? 440 LEU B C   1 
ATOM   3877  O O   . LEU B 2 440 ? 198.079 -41.011  32.778  1.00 95.48  ? 440 LEU B O   1 
ATOM   3878  C CB  . LEU B 2 440 ? 200.443 -43.064  33.734  1.00 93.15  ? 440 LEU B CB  1 
ATOM   3879  C CG  . LEU B 2 440 ? 201.888 -43.122  34.235  1.00 92.31  ? 440 LEU B CG  1 
ATOM   3880  C CD1 . LEU B 2 440 ? 202.520 -44.450  33.855  1.00 92.54  ? 440 LEU B CD1 1 
ATOM   3881  C CD2 . LEU B 2 440 ? 202.712 -41.958  33.704  1.00 91.37  ? 440 LEU B CD2 1 
ATOM   3882  N N   . THR B 2 441 ? 197.285 -42.844  33.822  1.00 98.61  ? 441 THR B N   1 
ATOM   3883  C CA  . THR B 2 441 ? 195.952 -42.794  33.218  1.00 102.20 ? 441 THR B CA  1 
ATOM   3884  C C   . THR B 2 441 ? 195.248 -41.480  33.574  1.00 105.63 ? 441 THR B C   1 
ATOM   3885  O O   . THR B 2 441 ? 194.680 -40.824  32.702  1.00 106.41 ? 441 THR B O   1 
ATOM   3886  C CB  . THR B 2 441 ? 195.081 -43.997  33.648  1.00 101.76 ? 441 THR B CB  1 
ATOM   3887  O OG1 . THR B 2 441 ? 195.788 -45.218  33.399  1.00 101.84 ? 441 THR B OG1 1 
ATOM   3888  C CG2 . THR B 2 441 ? 193.763 -44.027  32.880  1.00 101.63 ? 441 THR B CG2 1 
ATOM   3889  N N   . GLU B 2 442 ? 195.303 -41.101  34.851  1.00 110.63 ? 442 GLU B N   1 
ATOM   3890  C CA  . GLU B 2 442 ? 194.751 -39.825  35.315  1.00 116.55 ? 442 GLU B CA  1 
ATOM   3891  C C   . GLU B 2 442 ? 195.537 -38.638  34.766  1.00 121.48 ? 442 GLU B C   1 
ATOM   3892  O O   . GLU B 2 442 ? 194.984 -37.550  34.587  1.00 120.31 ? 442 GLU B O   1 
ATOM   3893  C CB  . GLU B 2 442 ? 194.730 -39.762  36.844  1.00 117.74 ? 442 GLU B CB  1 
ATOM   3894  C CG  . GLU B 2 442 ? 193.625 -40.583  37.494  1.00 120.14 ? 442 GLU B CG  1 
ATOM   3895  C CD  . GLU B 2 442 ? 193.608 -40.479  39.013  1.00 122.11 ? 442 GLU B CD  1 
ATOM   3896  O OE1 . GLU B 2 442 ? 194.417 -39.724  39.590  1.00 121.88 ? 442 GLU B OE1 1 
ATOM   3897  O OE2 . GLU B 2 442 ? 192.776 -41.162  39.643  1.00 124.39 ? 442 GLU B OE2 1 
ATOM   3898  N N   . LEU B 2 443 ? 196.825 -38.858  34.508  1.00 130.17 ? 443 LEU B N   1 
ATOM   3899  C CA  . LEU B 2 443 ? 197.698 -37.837  33.933  1.00 140.55 ? 443 LEU B CA  1 
ATOM   3900  C C   . LEU B 2 443 ? 197.422 -37.607  32.448  1.00 147.85 ? 443 LEU B C   1 
ATOM   3901  O O   . LEU B 2 443 ? 197.421 -36.463  31.987  1.00 149.97 ? 443 LEU B O   1 
ATOM   3902  C CB  . LEU B 2 443 ? 199.173 -38.192  34.152  1.00 141.78 ? 443 LEU B CB  1 
ATOM   3903  C CG  . LEU B 2 443 ? 199.812 -37.767  35.477  1.00 143.23 ? 443 LEU B CG  1 
ATOM   3904  C CD1 . LEU B 2 443 ? 201.126 -38.503  35.692  1.00 144.25 ? 443 LEU B CD1 1 
ATOM   3905  C CD2 . LEU B 2 443 ? 200.026 -36.259  35.521  1.00 144.07 ? 443 LEU B CD2 1 
ATOM   3906  N N   . ILE B 2 444 ? 197.193 -38.694  31.710  1.00 155.86 ? 444 ILE B N   1 
ATOM   3907  C CA  . ILE B 2 444 ? 196.838 -38.617  30.288  1.00 163.68 ? 444 ILE B CA  1 
ATOM   3908  C C   . ILE B 2 444 ? 195.460 -37.967  30.126  1.00 169.51 ? 444 ILE B C   1 
ATOM   3909  O O   . ILE B 2 444 ? 195.251 -37.159  29.216  1.00 173.42 ? 444 ILE B O   1 
ATOM   3910  C CB  . ILE B 2 444 ? 196.856 -40.006  29.596  1.00 162.11 ? 444 ILE B CB  1 
ATOM   3911  C CG1 . ILE B 2 444 ? 198.162 -40.754  29.879  1.00 158.79 ? 444 ILE B CG1 1 
ATOM   3912  C CG2 . ILE B 2 444 ? 196.672 -39.865  28.089  1.00 163.32 ? 444 ILE B CG2 1 
ATOM   3913  C CD1 . ILE B 2 444 ? 198.056 -42.256  29.730  1.00 154.83 ? 444 ILE B CD1 1 
ATOM   3914  N N   . GLN B 2 445 ? 194.536 -38.314  31.025  1.00 172.72 ? 445 GLN B N   1 
ATOM   3915  C CA  . GLN B 2 445 ? 193.164 -37.792  31.004  1.00 173.28 ? 445 GLN B CA  1 
ATOM   3916  C C   . GLN B 2 445 ? 193.084 -36.286  31.241  1.00 173.18 ? 445 GLN B C   1 
ATOM   3917  O O   . GLN B 2 445 ? 192.208 -35.616  30.693  1.00 172.43 ? 445 GLN B O   1 
ATOM   3918  C CB  . GLN B 2 445 ? 192.294 -38.521  32.030  1.00 173.06 ? 445 GLN B CB  1 
ATOM   3919  C CG  . GLN B 2 445 ? 191.771 -39.869  31.559  1.00 173.91 ? 445 GLN B CG  1 
ATOM   3920  C CD  . GLN B 2 445 ? 191.173 -40.700  32.680  1.00 174.33 ? 445 GLN B CD  1 
ATOM   3921  O OE1 . GLN B 2 445 ? 191.160 -40.289  33.842  1.00 173.58 ? 445 GLN B OE1 1 
ATOM   3922  N NE2 . GLN B 2 445 ? 190.678 -41.883  32.334  1.00 175.21 ? 445 GLN B NE2 1 
ATOM   3923  N N   . ALA B 2 446 ? 193.997 -35.766  32.058  1.00 173.76 ? 446 ALA B N   1 
ATOM   3924  C CA  . ALA B 2 446 ? 194.025 -34.344  32.392  1.00 174.98 ? 446 ALA B CA  1 
ATOM   3925  C C   . ALA B 2 446 ? 194.733 -33.490  31.335  1.00 175.76 ? 446 ALA B C   1 
ATOM   3926  O O   . ALA B 2 446 ? 194.439 -32.300  31.198  1.00 177.43 ? 446 ALA B O   1 
ATOM   3927  C CB  . ALA B 2 446 ? 194.656 -34.136  33.761  1.00 175.01 ? 446 ALA B CB  1 
ATOM   3928  N N   . LEU B 2 447 ? 195.657 -34.100  30.592  1.00 175.47 ? 447 LEU B N   1 
ATOM   3929  C CA  . LEU B 2 447 ? 196.443 -33.390  29.579  1.00 175.22 ? 447 LEU B CA  1 
ATOM   3930  C C   . LEU B 2 447 ? 195.660 -33.184  28.280  1.00 175.51 ? 447 LEU B C   1 
ATOM   3931  O O   . LEU B 2 447 ? 195.858 -32.189  27.580  1.00 175.66 ? 447 LEU B O   1 
ATOM   3932  C CB  . LEU B 2 447 ? 197.755 -34.130  29.299  1.00 174.43 ? 447 LEU B CB  1 
ATOM   3933  C CG  . LEU B 2 447 ? 199.048 -33.325  29.102  1.00 174.24 ? 447 LEU B CG  1 
ATOM   3934  C CD1 . LEU B 2 447 ? 200.251 -34.257  29.193  1.00 174.48 ? 447 LEU B CD1 1 
ATOM   3935  C CD2 . LEU B 2 447 ? 199.077 -32.551  27.785  1.00 174.15 ? 447 LEU B CD2 1 
ATOM   3936  N N   . LYS B 2 448 ? 194.779 -34.129  27.962  1.00 176.74 ? 448 LYS B N   1 
ATOM   3937  C CA  . LYS B 2 448 ? 193.890 -34.009  26.806  1.00 178.13 ? 448 LYS B CA  1 
ATOM   3938  C C   . LYS B 2 448 ? 192.775 -33.004  27.089  1.00 176.47 ? 448 LYS B C   1 
ATOM   3939  O O   . LYS B 2 448 ? 192.222 -32.397  26.168  1.00 169.98 ? 448 LYS B O   1 
ATOM   3940  C CB  . LYS B 2 448 ? 193.302 -35.372  26.433  1.00 184.88 ? 448 LYS B CB  1 
ATOM   3941  C CG  . LYS B 2 448 ? 194.326 -36.366  25.904  1.00 193.03 ? 448 LYS B CG  1 
ATOM   3942  C CD  . LYS B 2 448 ? 193.695 -37.713  25.587  1.00 200.74 ? 448 LYS B CD  1 
ATOM   3943  C CE  . LYS B 2 448 ? 194.716 -38.683  25.011  1.00 204.79 ? 448 LYS B CE  1 
ATOM   3944  N NZ  . LYS B 2 448 ? 194.112 -40.004  24.681  1.00 207.29 ? 448 LYS B NZ  1 
ATOM   3945  N N   . ARG B 2 449 ? 192.461 -32.838  28.374  1.00 180.72 ? 449 ARG B N   1 
ATOM   3946  C CA  . ARG B 2 449 ? 191.510 -31.831  28.844  1.00 187.47 ? 449 ARG B CA  1 
ATOM   3947  C C   . ARG B 2 449 ? 192.058 -30.407  28.694  1.00 194.46 ? 449 ARG B C   1 
ATOM   3948  O O   . ARG B 2 449 ? 191.316 -29.431  28.848  1.00 195.44 ? 449 ARG B O   1 
ATOM   3949  C CB  . ARG B 2 449 ? 191.127 -32.100  30.307  1.00 186.04 ? 449 ARG B CB  1 
ATOM   3950  C CG  . ARG B 2 449 ? 190.082 -33.192  30.501  1.00 184.16 ? 449 ARG B CG  1 
ATOM   3951  C CD  . ARG B 2 449 ? 189.739 -33.407  31.972  1.00 182.58 ? 449 ARG B CD  1 
ATOM   3952  N NE  . ARG B 2 449 ? 190.631 -34.362  32.634  1.00 178.72 ? 449 ARG B NE  1 
ATOM   3953  C CZ  . ARG B 2 449 ? 190.544 -34.726  33.915  1.00 175.77 ? 449 ARG B CZ  1 
ATOM   3954  N NH1 . ARG B 2 449 ? 189.602 -34.221  34.703  1.00 175.14 ? 449 ARG B NH1 1 
ATOM   3955  N NH2 . ARG B 2 449 ? 191.406 -35.603  34.412  1.00 172.61 ? 449 ARG B NH2 1 
ATOM   3956  N N   . LEU B 2 450 ? 193.354 -30.297  28.398  1.00 203.09 ? 450 LEU B N   1 
ATOM   3957  C CA  . LEU B 2 450 ? 194.014 -29.001  28.214  1.00 209.80 ? 450 LEU B CA  1 
ATOM   3958  C C   . LEU B 2 450 ? 194.799 -28.940  26.896  1.00 214.79 ? 450 LEU B C   1 
ATOM   3959  O O   . LEU B 2 450 ? 194.797 -29.883  26.101  1.00 216.97 ? 450 LEU B O   1 
ATOM   3960  C CB  . LEU B 2 450 ? 194.936 -28.683  29.404  1.00 207.03 ? 450 LEU B CB  1 
ATOM   3961  C CG  . LEU B 2 450 ? 194.413 -28.789  30.845  1.00 202.84 ? 450 LEU B CG  1 
ATOM   3962  C CD1 . LEU B 2 450 ? 195.558 -28.653  31.839  1.00 202.20 ? 450 LEU B CD1 1 
ATOM   3963  C CD2 . LEU B 2 450 ? 193.313 -27.779  31.149  1.00 197.93 ? 450 LEU B CD2 1 
ATOM   3964  N N   . MET C 1 1   ? 152.088 -12.524  40.481  1.00 188.49 ? 1   MET C N   1 
ATOM   3965  C CA  . MET C 1 1   ? 153.312 -12.176  41.264  1.00 192.78 ? 1   MET C CA  1 
ATOM   3966  C C   . MET C 1 1   ? 154.229 -11.236  40.484  1.00 195.31 ? 1   MET C C   1 
ATOM   3967  O O   . MET C 1 1   ? 154.389 -11.375  39.269  1.00 193.81 ? 1   MET C O   1 
ATOM   3968  C CB  . MET C 1 1   ? 154.056 -13.442  41.698  1.00 193.77 ? 1   MET C CB  1 
ATOM   3969  C CG  . MET C 1 1   ? 153.373 -14.186  42.837  1.00 193.74 ? 1   MET C CG  1 
ATOM   3970  S SD  . MET C 1 1   ? 154.161 -15.754  43.249  1.00 194.45 ? 1   MET C SD  1 
ATOM   3971  C CE  . MET C 1 1   ? 153.178 -16.261  44.657  1.00 193.04 ? 1   MET C CE  1 
ATOM   3972  N N   . GLU C 1 2   ? 154.833 -10.291  41.204  1.00 200.18 ? 2   GLU C N   1 
ATOM   3973  C CA  . GLU C 1 2   ? 155.538 -9.150   40.605  1.00 203.23 ? 2   GLU C CA  1 
ATOM   3974  C C   . GLU C 1 2   ? 157.017 -9.427   40.286  1.00 203.89 ? 2   GLU C C   1 
ATOM   3975  O O   . GLU C 1 2   ? 157.869 -9.417   41.181  1.00 205.33 ? 2   GLU C O   1 
ATOM   3976  C CB  . GLU C 1 2   ? 155.416 -7.913   41.513  1.00 203.65 ? 2   GLU C CB  1 
ATOM   3977  C CG  . GLU C 1 2   ? 154.051 -7.713   42.172  1.00 200.84 ? 2   GLU C CG  1 
ATOM   3978  C CD  . GLU C 1 2   ? 153.080 -6.906   41.327  1.00 199.18 ? 2   GLU C CD  1 
ATOM   3979  O OE1 . GLU C 1 2   ? 152.004 -7.444   40.988  1.00 196.46 ? 2   GLU C OE1 1 
ATOM   3980  O OE2 . GLU C 1 2   ? 153.383 -5.733   41.012  1.00 199.32 ? 2   GLU C OE2 1 
ATOM   3981  N N   . PHE C 1 3   ? 157.307 -9.662   39.007  1.00 202.73 ? 3   PHE C N   1 
ATOM   3982  C CA  . PHE C 1 3   ? 158.675 -9.878   38.523  1.00 201.97 ? 3   PHE C CA  1 
ATOM   3983  C C   . PHE C 1 3   ? 158.986 -8.957   37.340  1.00 198.77 ? 3   PHE C C   1 
ATOM   3984  O O   . PHE C 1 3   ? 158.367 -9.068   36.277  1.00 195.96 ? 3   PHE C O   1 
ATOM   3985  C CB  . PHE C 1 3   ? 158.882 -11.349  38.136  1.00 207.64 ? 3   PHE C CB  1 
ATOM   3986  C CG  . PHE C 1 3   ? 159.436 -12.209  39.245  1.00 215.20 ? 3   PHE C CG  1 
ATOM   3987  C CD1 . PHE C 1 3   ? 158.728 -12.398  40.430  1.00 219.59 ? 3   PHE C CD1 1 
ATOM   3988  C CD2 . PHE C 1 3   ? 160.661 -12.850  39.094  1.00 218.34 ? 3   PHE C CD2 1 
ATOM   3989  C CE1 . PHE C 1 3   ? 159.241 -13.192  41.446  1.00 224.08 ? 3   PHE C CE1 1 
ATOM   3990  C CE2 . PHE C 1 3   ? 161.178 -13.649  40.105  1.00 221.61 ? 3   PHE C CE2 1 
ATOM   3991  C CZ  . PHE C 1 3   ? 160.468 -13.818  41.283  1.00 223.55 ? 3   PHE C CZ  1 
ATOM   3992  N N   . GLY C 1 4   ? 159.947 -8.052   37.533  1.00 197.84 ? 4   GLY C N   1 
ATOM   3993  C CA  . GLY C 1 4   ? 160.305 -7.038   36.529  1.00 198.56 ? 4   GLY C CA  1 
ATOM   3994  C C   . GLY C 1 4   ? 160.988 -7.581   35.285  1.00 198.49 ? 4   GLY C C   1 
ATOM   3995  O O   . GLY C 1 4   ? 161.256 -8.779   35.191  1.00 201.85 ? 4   GLY C O   1 
ATOM   3996  N N   . PHE C 1 5   ? 161.273 -6.696   34.329  1.00 194.76 ? 5   PHE C N   1 
ATOM   3997  C CA  . PHE C 1 5   ? 161.872 -7.098   33.048  1.00 188.52 ? 5   PHE C CA  1 
ATOM   3998  C C   . PHE C 1 5   ? 163.380 -7.357   33.126  1.00 185.11 ? 5   PHE C C   1 
ATOM   3999  O O   . PHE C 1 5   ? 163.870 -8.340   32.565  1.00 185.24 ? 5   PHE C O   1 
ATOM   4000  C CB  . PHE C 1 5   ? 161.549 -6.081   31.940  1.00 185.55 ? 5   PHE C CB  1 
ATOM   4001  C CG  . PHE C 1 5   ? 162.233 -6.366   30.625  1.00 180.66 ? 5   PHE C CG  1 
ATOM   4002  C CD1 . PHE C 1 5   ? 161.846 -7.449   29.838  1.00 178.22 ? 5   PHE C CD1 1 
ATOM   4003  C CD2 . PHE C 1 5   ? 163.263 -5.546   30.170  1.00 178.12 ? 5   PHE C CD2 1 
ATOM   4004  C CE1 . PHE C 1 5   ? 162.477 -7.710   28.629  1.00 175.00 ? 5   PHE C CE1 1 
ATOM   4005  C CE2 . PHE C 1 5   ? 163.896 -5.802   28.962  1.00 174.38 ? 5   PHE C CE2 1 
ATOM   4006  C CZ  . PHE C 1 5   ? 163.501 -6.883   28.190  1.00 173.25 ? 5   PHE C CZ  1 
ATOM   4007  N N   . TRP C 1 6   ? 164.107 -6.472   33.808  1.00 178.50 ? 6   TRP C N   1 
ATOM   4008  C CA  . TRP C 1 6   ? 165.565 -6.586   33.923  1.00 171.35 ? 6   TRP C CA  1 
ATOM   4009  C C   . TRP C 1 6   ? 165.992 -7.560   35.002  1.00 166.05 ? 6   TRP C C   1 
ATOM   4010  O O   . TRP C 1 6   ? 167.062 -8.160   34.921  1.00 165.11 ? 6   TRP C O   1 
ATOM   4011  C CB  . TRP C 1 6   ? 166.205 -5.219   34.155  1.00 171.10 ? 6   TRP C CB  1 
ATOM   4012  C CG  . TRP C 1 6   ? 166.051 -4.345   32.970  1.00 172.97 ? 6   TRP C CG  1 
ATOM   4013  C CD1 . TRP C 1 6   ? 165.273 -3.232   32.872  1.00 174.50 ? 6   TRP C CD1 1 
ATOM   4014  C CD2 . TRP C 1 6   ? 166.655 -4.532   31.683  1.00 172.31 ? 6   TRP C CD2 1 
ATOM   4015  N NE1 . TRP C 1 6   ? 165.367 -2.700   31.608  1.00 175.57 ? 6   TRP C NE1 1 
ATOM   4016  C CE2 . TRP C 1 6   ? 166.207 -3.479   30.857  1.00 172.70 ? 6   TRP C CE2 1 
ATOM   4017  C CE3 . TRP C 1 6   ? 167.537 -5.482   31.149  1.00 170.55 ? 6   TRP C CE3 1 
ATOM   4018  C CZ2 . TRP C 1 6   ? 166.614 -3.345   29.525  1.00 170.24 ? 6   TRP C CZ2 1 
ATOM   4019  C CZ3 . TRP C 1 6   ? 167.939 -5.350   29.824  1.00 168.69 ? 6   TRP C CZ3 1 
ATOM   4020  C CH2 . TRP C 1 6   ? 167.473 -4.290   29.028  1.00 167.82 ? 6   TRP C CH2 1 
ATOM   4021  N N   . SER C 1 7   ? 165.141 -7.708   36.010  1.00 160.53 ? 7   SER C N   1 
ATOM   4022  C CA  . SER C 1 7   ? 165.346 -8.680   37.069  1.00 156.95 ? 7   SER C CA  1 
ATOM   4023  C C   . SER C 1 7   ? 165.194 -10.103  36.526  1.00 156.40 ? 7   SER C C   1 
ATOM   4024  O O   . SER C 1 7   ? 165.967 -10.995  36.883  1.00 159.30 ? 7   SER C O   1 
ATOM   4025  C CB  . SER C 1 7   ? 164.338 -8.432   38.184  1.00 154.94 ? 7   SER C CB  1 
ATOM   4026  O OG  . SER C 1 7   ? 164.100 -7.043   38.335  1.00 152.19 ? 7   SER C OG  1 
ATOM   4027  N N   . ALA C 1 8   ? 164.201 -10.294  35.656  1.00 152.34 ? 8   ALA C N   1 
ATOM   4028  C CA  . ALA C 1 8   ? 163.917 -11.594  35.041  1.00 145.18 ? 8   ALA C CA  1 
ATOM   4029  C C   . ALA C 1 8   ? 164.951 -11.987  33.987  1.00 137.91 ? 8   ALA C C   1 
ATOM   4030  O O   . ALA C 1 8   ? 165.349 -13.151  33.912  1.00 136.78 ? 8   ALA C O   1 
ATOM   4031  C CB  . ALA C 1 8   ? 162.519 -11.607  34.438  1.00 147.10 ? 8   ALA C CB  1 
ATOM   4032  N N   . LEU C 1 9   ? 165.377 -11.012  33.181  1.00 128.56 ? 9   LEU C N   1 
ATOM   4033  C CA  . LEU C 1 9   ? 166.347 -11.246  32.109  1.00 118.96 ? 9   LEU C CA  1 
ATOM   4034  C C   . LEU C 1 9   ? 167.728 -11.613  32.670  1.00 112.77 ? 9   LEU C C   1 
ATOM   4035  O O   . LEU C 1 9   ? 168.483 -12.350  32.030  1.00 112.34 ? 9   LEU C O   1 
ATOM   4036  C CB  . LEU C 1 9   ? 166.439 -10.030  31.174  1.00 117.73 ? 9   LEU C CB  1 
ATOM   4037  C CG  . LEU C 1 9   ? 166.242 -10.228  29.660  1.00 115.82 ? 9   LEU C CG  1 
ATOM   4038  C CD1 . LEU C 1 9   ? 166.282 -8.893   28.933  1.00 114.12 ? 9   LEU C CD1 1 
ATOM   4039  C CD2 . LEU C 1 9   ? 167.248 -11.192  29.044  1.00 116.16 ? 9   LEU C CD2 1 
ATOM   4040  N N   . TYR C 1 10  ? 168.052 -11.099  33.858  1.00 104.55 ? 10  TYR C N   1 
ATOM   4041  C CA  . TYR C 1 10  ? 169.262 -11.516  34.569  1.00 96.79  ? 10  TYR C CA  1 
ATOM   4042  C C   . TYR C 1 10  ? 169.137 -12.963  35.030  1.00 93.51  ? 10  TYR C C   1 
ATOM   4043  O O   . TYR C 1 10  ? 169.968 -13.791  34.668  1.00 90.86  ? 10  TYR C O   1 
ATOM   4044  C CB  . TYR C 1 10  ? 169.576 -10.593  35.752  1.00 94.78  ? 10  TYR C CB  1 
ATOM   4045  C CG  . TYR C 1 10  ? 170.299 -9.322   35.368  1.00 93.09  ? 10  TYR C CG  1 
ATOM   4046  C CD1 . TYR C 1 10  ? 171.515 -9.366   34.687  1.00 92.06  ? 10  TYR C CD1 1 
ATOM   4047  C CD2 . TYR C 1 10  ? 169.776 -8.073   35.702  1.00 92.50  ? 10  TYR C CD2 1 
ATOM   4048  C CE1 . TYR C 1 10  ? 172.176 -8.203   34.334  1.00 91.81  ? 10  TYR C CE1 1 
ATOM   4049  C CE2 . TYR C 1 10  ? 170.431 -6.905   35.354  1.00 92.09  ? 10  TYR C CE2 1 
ATOM   4050  C CZ  . TYR C 1 10  ? 171.631 -6.976   34.674  1.00 92.01  ? 10  TYR C CZ  1 
ATOM   4051  O OH  . TYR C 1 10  ? 172.283 -5.817   34.332  1.00 92.40  ? 10  TYR C OH  1 
ATOM   4052  N N   . ILE C 1 11  ? 168.095 -13.259  35.812  1.00 91.69  ? 11  ILE C N   1 
ATOM   4053  C CA  . ILE C 1 11  ? 167.764 -14.632  36.213  1.00 90.48  ? 11  ILE C CA  1 
ATOM   4054  C C   . ILE C 1 11  ? 167.922 -15.552  35.014  1.00 91.17  ? 11  ILE C C   1 
ATOM   4055  O O   . ILE C 1 11  ? 168.755 -16.457  35.024  1.00 88.95  ? 11  ILE C O   1 
ATOM   4056  C CB  . ILE C 1 11  ? 166.315 -14.751  36.746  1.00 89.89  ? 11  ILE C CB  1 
ATOM   4057  C CG1 . ILE C 1 11  ? 166.187 -14.119  38.133  1.00 90.44  ? 11  ILE C CG1 1 
ATOM   4058  C CG2 . ILE C 1 11  ? 165.868 -16.208  36.793  1.00 88.64  ? 11  ILE C CG2 1 
ATOM   4059  C CD1 . ILE C 1 11  ? 164.753 -13.931  38.589  1.00 90.83  ? 11  ILE C CD1 1 
ATOM   4060  N N   . PHE C 1 12  ? 167.118 -15.285  33.985  1.00 95.02  ? 12  PHE C N   1 
ATOM   4061  C CA  . PHE C 1 12  ? 167.169 -15.971  32.698  1.00 100.64 ? 12  PHE C CA  1 
ATOM   4062  C C   . PHE C 1 12  ? 168.607 -16.282  32.299  1.00 98.95  ? 12  PHE C C   1 
ATOM   4063  O O   . PHE C 1 12  ? 168.945 -17.437  32.046  1.00 98.87  ? 12  PHE C O   1 
ATOM   4064  C CB  . PHE C 1 12  ? 166.477 -15.099  31.637  1.00 108.67 ? 12  PHE C CB  1 
ATOM   4065  C CG  . PHE C 1 12  ? 166.589 -15.619  30.225  1.00 116.88 ? 12  PHE C CG  1 
ATOM   4066  C CD1 . PHE C 1 12  ? 165.812 -16.692  29.795  1.00 119.73 ? 12  PHE C CD1 1 
ATOM   4067  C CD2 . PHE C 1 12  ? 167.444 -15.004  29.310  1.00 120.21 ? 12  PHE C CD2 1 
ATOM   4068  C CE1 . PHE C 1 12  ? 165.907 -17.158  28.489  1.00 122.86 ? 12  PHE C CE1 1 
ATOM   4069  C CE2 . PHE C 1 12  ? 167.542 -15.466  28.004  1.00 122.42 ? 12  PHE C CE2 1 
ATOM   4070  C CZ  . PHE C 1 12  ? 166.772 -16.544  27.593  1.00 123.18 ? 12  PHE C CZ  1 
ATOM   4071  N N   . VAL C 1 13  ? 169.447 -15.249  32.278  1.00 97.23  ? 13  VAL C N   1 
ATOM   4072  C CA  . VAL C 1 13  ? 170.846 -15.366  31.863  1.00 96.18  ? 13  VAL C CA  1 
ATOM   4073  C C   . VAL C 1 13  ? 171.708 -16.105  32.893  1.00 95.28  ? 13  VAL C C   1 
ATOM   4074  O O   . VAL C 1 13  ? 172.628 -16.840  32.529  1.00 96.50  ? 13  VAL C O   1 
ATOM   4075  C CB  . VAL C 1 13  ? 171.432 -13.975  31.508  1.00 95.93  ? 13  VAL C CB  1 
ATOM   4076  C CG1 . VAL C 1 13  ? 172.955 -13.948  31.607  1.00 95.91  ? 13  VAL C CG1 1 
ATOM   4077  C CG2 . VAL C 1 13  ? 170.990 -13.575  30.108  1.00 96.18  ? 13  VAL C CG2 1 
ATOM   4078  N N   . LEU C 1 14  ? 171.392 -15.925  34.172  1.00 93.04  ? 14  LEU C N   1 
ATOM   4079  C CA  . LEU C 1 14  ? 172.194 -16.500  35.252  1.00 91.85  ? 14  LEU C CA  1 
ATOM   4080  C C   . LEU C 1 14  ? 172.056 -18.016  35.362  1.00 92.28  ? 14  LEU C C   1 
ATOM   4081  O O   . LEU C 1 14  ? 173.063 -18.730  35.407  1.00 90.74  ? 14  LEU C O   1 
ATOM   4082  C CB  . LEU C 1 14  ? 171.854 -15.828  36.580  1.00 90.80  ? 14  LEU C CB  1 
ATOM   4083  C CG  . LEU C 1 14  ? 172.165 -14.332  36.655  1.00 90.14  ? 14  LEU C CG  1 
ATOM   4084  C CD1 . LEU C 1 14  ? 171.293 -13.673  37.703  1.00 89.70  ? 14  LEU C CD1 1 
ATOM   4085  C CD2 . LEU C 1 14  ? 173.637 -14.066  36.929  1.00 90.72  ? 14  LEU C CD2 1 
ATOM   4086  N N   . THR C 1 15  ? 170.812 -18.496  35.401  1.00 94.06  ? 15  THR C N   1 
ATOM   4087  C CA  . THR C 1 15  ? 170.523 -19.936  35.430  1.00 96.36  ? 15  THR C CA  1 
ATOM   4088  C C   . THR C 1 15  ? 170.898 -20.626  34.116  1.00 98.08  ? 15  THR C C   1 
ATOM   4089  O O   . THR C 1 15  ? 171.127 -21.839  34.089  1.00 98.66  ? 15  THR C O   1 
ATOM   4090  C CB  . THR C 1 15  ? 169.048 -20.238  35.798  1.00 96.18  ? 15  THR C CB  1 
ATOM   4091  O OG1 . THR C 1 15  ? 168.757 -21.619  35.546  1.00 95.79  ? 15  THR C OG1 1 
ATOM   4092  C CG2 . THR C 1 15  ? 168.087 -19.372  34.997  1.00 95.76  ? 15  THR C CG2 1 
ATOM   4093  N N   . ALA C 1 16  ? 170.950 -19.844  33.037  1.00 99.92  ? 16  ALA C N   1 
ATOM   4094  C CA  . ALA C 1 16  ? 171.424 -20.324  31.741  1.00 101.08 ? 16  ALA C CA  1 
ATOM   4095  C C   . ALA C 1 16  ? 172.905 -20.691  31.817  1.00 98.13  ? 16  ALA C C   1 
ATOM   4096  O O   . ALA C 1 16  ? 173.282 -21.822  31.505  1.00 99.81  ? 16  ALA C O   1 
ATOM   4097  C CB  . ALA C 1 16  ? 171.185 -19.278  30.663  1.00 20.00  ? 16  ALA C CB  1 
ATOM   4098  N N   . PHE C 1 17  ? 173.736 -19.741  32.247  1.00 92.62  ? 17  PHE C N   1 
ATOM   4099  C CA  . PHE C 1 17  ? 175.176 -19.971  32.368  1.00 87.16  ? 17  PHE C CA  1 
ATOM   4100  C C   . PHE C 1 17  ? 175.512 -20.920  33.503  1.00 84.58  ? 17  PHE C C   1 
ATOM   4101  O O   . PHE C 1 17  ? 176.573 -21.546  33.507  1.00 82.30  ? 17  PHE C O   1 
ATOM   4102  C CB  . PHE C 1 17  ? 175.930 -18.655  32.543  1.00 86.25  ? 17  PHE C CB  1 
ATOM   4103  C CG  . PHE C 1 17  ? 176.199 -17.939  31.255  1.00 86.28  ? 17  PHE C CG  1 
ATOM   4104  C CD1 . PHE C 1 17  ? 177.138 -18.432  30.353  1.00 85.68  ? 17  PHE C CD1 1 
ATOM   4105  C CD2 . PHE C 1 17  ? 175.517 -16.770  30.940  1.00 86.68  ? 17  PHE C CD2 1 
ATOM   4106  C CE1 . PHE C 1 17  ? 177.388 -17.774  29.159  1.00 85.47  ? 17  PHE C CE1 1 
ATOM   4107  C CE2 . PHE C 1 17  ? 175.763 -16.106  29.748  1.00 86.55  ? 17  PHE C CE2 1 
ATOM   4108  C CZ  . PHE C 1 17  ? 176.700 -16.609  28.857  1.00 86.01  ? 17  PHE C CZ  1 
ATOM   4109  N N   . LEU C 1 18  ? 174.605 -21.017  34.467  1.00 83.97  ? 18  LEU C N   1 
ATOM   4110  C CA  . LEU C 1 18  ? 174.754 -21.944  35.570  1.00 85.49  ? 18  LEU C CA  1 
ATOM   4111  C C   . LEU C 1 18  ? 174.695 -23.390  35.080  1.00 87.39  ? 18  LEU C C   1 
ATOM   4112  O O   . LEU C 1 18  ? 175.688 -24.111  35.175  1.00 86.19  ? 18  LEU C O   1 
ATOM   4113  C CB  . LEU C 1 18  ? 173.690 -21.670  36.632  1.00 86.15  ? 18  LEU C CB  1 
ATOM   4114  C CG  . LEU C 1 18  ? 173.815 -22.328  38.008  1.00 87.04  ? 18  LEU C CG  1 
ATOM   4115  C CD1 . LEU C 1 18  ? 175.265 -22.498  38.445  1.00 87.10  ? 18  LEU C CD1 1 
ATOM   4116  C CD2 . LEU C 1 18  ? 173.029 -21.519  39.028  1.00 87.79  ? 18  LEU C CD2 1 
ATOM   4117  N N   . GLY C 1 19  ? 173.545 -23.794  34.541  1.00 91.09  ? 19  GLY C N   1 
ATOM   4118  C CA  . GLY C 1 19  ? 173.340 -25.153  34.027  1.00 96.39  ? 19  GLY C CA  1 
ATOM   4119  C C   . GLY C 1 19  ? 174.374 -25.583  33.002  1.00 100.93 ? 19  GLY C C   1 
ATOM   4120  O O   . GLY C 1 19  ? 174.945 -26.671  33.109  1.00 99.08  ? 19  GLY C O   1 
ATOM   4121  N N   . TYR C 1 20  ? 174.607 -24.715  32.016  1.00 107.96 ? 20  TYR C N   1 
ATOM   4122  C CA  . TYR C 1 20  ? 175.639 -24.892  30.985  1.00 115.34 ? 20  TYR C CA  1 
ATOM   4123  C C   . TYR C 1 20  ? 176.905 -25.501  31.579  1.00 115.75 ? 20  TYR C C   1 
ATOM   4124  O O   . TYR C 1 20  ? 177.365 -26.558  31.139  1.00 116.03 ? 20  TYR C O   1 
ATOM   4125  C CB  . TYR C 1 20  ? 175.950 -23.529  30.331  1.00 120.70 ? 20  TYR C CB  1 
ATOM   4126  C CG  . TYR C 1 20  ? 176.916 -23.525  29.146  1.00 124.19 ? 20  TYR C CG  1 
ATOM   4127  C CD1 . TYR C 1 20  ? 178.298 -23.457  29.341  1.00 124.22 ? 20  TYR C CD1 1 
ATOM   4128  C CD2 . TYR C 1 20  ? 176.443 -23.534  27.831  1.00 125.40 ? 20  TYR C CD2 1 
ATOM   4129  C CE1 . TYR C 1 20  ? 179.179 -23.435  28.268  1.00 123.57 ? 20  TYR C CE1 1 
ATOM   4130  C CE2 . TYR C 1 20  ? 177.318 -23.511  26.751  1.00 124.78 ? 20  TYR C CE2 1 
ATOM   4131  C CZ  . TYR C 1 20  ? 178.684 -23.462  26.976  1.00 123.69 ? 20  TYR C CZ  1 
ATOM   4132  O OH  . TYR C 1 20  ? 179.560 -23.438  25.914  1.00 122.58 ? 20  TYR C OH  1 
ATOM   4133  N N   . GLU C 1 21  ? 177.437 -24.842  32.606  1.00 115.88 ? 21  GLU C N   1 
ATOM   4134  C CA  . GLU C 1 21  ? 178.732 -25.203  33.167  1.00 115.33 ? 21  GLU C CA  1 
ATOM   4135  C C   . GLU C 1 21  ? 178.673 -26.370  34.155  1.00 113.18 ? 21  GLU C C   1 
ATOM   4136  O O   . GLU C 1 21  ? 179.703 -26.972  34.469  1.00 113.38 ? 21  GLU C O   1 
ATOM   4137  C CB  . GLU C 1 21  ? 179.403 -23.976  33.793  1.00 116.50 ? 21  GLU C CB  1 
ATOM   4138  C CG  . GLU C 1 21  ? 180.921 -23.949  33.635  1.00 116.37 ? 21  GLU C CG  1 
ATOM   4139  C CD  . GLU C 1 21  ? 181.383 -23.963  32.181  1.00 115.29 ? 21  GLU C CD  1 
ATOM   4140  O OE1 . GLU C 1 21  ? 180.736 -23.319  31.328  1.00 115.22 ? 21  GLU C OE1 1 
ATOM   4141  O OE2 . GLU C 1 21  ? 182.409 -24.617  31.890  1.00 113.55 ? 21  GLU C OE2 1 
ATOM   4142  N N   . LEU C 1 22  ? 177.477 -26.693  34.641  1.00 109.94 ? 22  LEU C N   1 
ATOM   4143  C CA  . LEU C 1 22  ? 177.300 -27.899  35.440  1.00 108.05 ? 22  LEU C CA  1 
ATOM   4144  C C   . LEU C 1 22  ? 177.497 -29.100  34.526  1.00 108.23 ? 22  LEU C C   1 
ATOM   4145  O O   . LEU C 1 22  ? 178.209 -30.045  34.865  1.00 105.87 ? 22  LEU C O   1 
ATOM   4146  C CB  . LEU C 1 22  ? 175.908 -27.946  36.081  1.00 107.23 ? 22  LEU C CB  1 
ATOM   4147  C CG  . LEU C 1 22  ? 175.351 -26.720  36.815  1.00 107.15 ? 22  LEU C CG  1 
ATOM   4148  C CD1 . LEU C 1 22  ? 173.966 -27.016  37.367  1.00 107.17 ? 22  LEU C CD1 1 
ATOM   4149  C CD2 . LEU C 1 22  ? 176.275 -26.235  37.926  1.00 107.58 ? 22  LEU C CD2 1 
ATOM   4150  N N   . ILE C 1 23  ? 176.894 -29.013  33.343  1.00 111.27 ? 23  ILE C N   1 
ATOM   4151  C CA  . ILE C 1 23  ? 176.826 -30.113  32.383  1.00 116.98 ? 23  ILE C CA  1 
ATOM   4152  C C   . ILE C 1 23  ? 178.109 -30.281  31.562  1.00 122.01 ? 23  ILE C C   1 
ATOM   4153  O O   . ILE C 1 23  ? 178.286 -31.293  30.881  1.00 122.85 ? 23  ILE C O   1 
ATOM   4154  C CB  . ILE C 1 23  ? 175.603 -29.940  31.442  1.00 116.72 ? 23  ILE C CB  1 
ATOM   4155  C CG1 . ILE C 1 23  ? 174.318 -29.703  32.250  1.00 117.31 ? 23  ILE C CG1 1 
ATOM   4156  C CG2 . ILE C 1 23  ? 175.438 -31.130  30.502  1.00 117.06 ? 23  ILE C CG2 1 
ATOM   4157  C CD1 . ILE C 1 23  ? 174.037 -30.734  33.326  1.00 118.95 ? 23  ILE C CD1 1 
ATOM   4158  N N   . THR C 1 24  ? 179.003 -29.298  31.630  1.00 128.72 ? 24  THR C N   1 
ATOM   4159  C CA  . THR C 1 24  ? 180.255 -29.348  30.868  1.00 136.29 ? 24  THR C CA  1 
ATOM   4160  C C   . THR C 1 24  ? 181.098 -30.583  31.192  1.00 143.27 ? 24  THR C C   1 
ATOM   4161  O O   . THR C 1 24  ? 181.631 -31.226  30.284  1.00 145.27 ? 24  THR C O   1 
ATOM   4162  C CB  . THR C 1 24  ? 181.112 -28.080  31.058  1.00 135.22 ? 24  THR C CB  1 
ATOM   4163  O OG1 . THR C 1 24  ? 181.106 -27.693  32.438  1.00 135.09 ? 24  THR C OG1 1 
ATOM   4164  C CG2 . THR C 1 24  ? 180.579 -26.937  30.205  1.00 134.13 ? 24  THR C CG2 1 
ATOM   4165  N N   . ARG C 1 25  ? 181.198 -30.915  32.479  1.00 151.21 ? 25  ARG C N   1 
ATOM   4166  C CA  . ARG C 1 25  ? 182.038 -32.025  32.933  1.00 158.10 ? 25  ARG C CA  1 
ATOM   4167  C C   . ARG C 1 25  ? 181.220 -33.294  33.208  1.00 153.31 ? 25  ARG C C   1 
ATOM   4168  O O   . ARG C 1 25  ? 181.173 -33.783  34.340  1.00 152.55 ? 25  ARG C O   1 
ATOM   4169  C CB  . ARG C 1 25  ? 182.863 -31.623  34.172  1.00 168.85 ? 25  ARG C CB  1 
ATOM   4170  C CG  . ARG C 1 25  ? 183.534 -30.251  34.103  1.00 182.12 ? 25  ARG C CG  1 
ATOM   4171  C CD  . ARG C 1 25  ? 184.736 -30.200  33.161  1.00 197.72 ? 25  ARG C CD  1 
ATOM   4172  N NE  . ARG C 1 25  ? 185.990 -30.610  33.802  1.00 212.79 ? 25  ARG C NE  1 
ATOM   4173  C CZ  . ARG C 1 25  ? 187.209 -30.327  33.339  1.00 222.07 ? 25  ARG C CZ  1 
ATOM   4174  N NH1 . ARG C 1 25  ? 187.364 -29.619  32.224  1.00 225.78 ? 25  ARG C NH1 1 
ATOM   4175  N NH2 . ARG C 1 25  ? 188.281 -30.747  33.998  1.00 226.69 ? 25  ARG C NH2 1 
ATOM   4176  N N   . VAL C 1 26  ? 180.578 -33.819  32.164  1.00 148.15 ? 26  VAL C N   1 
ATOM   4177  C CA  . VAL C 1 26  ? 179.807 -35.066  32.265  1.00 143.09 ? 26  VAL C CA  1 
ATOM   4178  C C   . VAL C 1 26  ? 180.551 -36.251  31.643  1.00 142.62 ? 26  VAL C C   1 
ATOM   4179  O O   . VAL C 1 26  ? 181.121 -36.122  30.557  1.00 143.18 ? 26  VAL C O   1 
ATOM   4180  C CB  . VAL C 1 26  ? 178.396 -34.954  31.627  1.00 140.17 ? 26  VAL C CB  1 
ATOM   4181  C CG1 . VAL C 1 26  ? 177.515 -34.000  32.418  1.00 139.18 ? 26  VAL C CG1 1 
ATOM   4182  C CG2 . VAL C 1 26  ? 178.472 -34.531  30.162  1.00 138.50 ? 26  VAL C CG2 1 
ATOM   4183  N N   . PRO C 1 27  ? 180.560 -37.406  32.336  1.00 142.05 ? 27  PRO C N   1 
ATOM   4184  C CA  . PRO C 1 27  ? 181.104 -38.613  31.717  1.00 143.68 ? 27  PRO C CA  1 
ATOM   4185  C C   . PRO C 1 27  ? 180.100 -39.236  30.749  1.00 147.12 ? 27  PRO C C   1 
ATOM   4186  O O   . PRO C 1 27  ? 178.888 -39.079  30.929  1.00 147.52 ? 27  PRO C O   1 
ATOM   4187  C CB  . PRO C 1 27  ? 181.346 -39.540  32.909  1.00 141.62 ? 27  PRO C CB  1 
ATOM   4188  C CG  . PRO C 1 27  ? 180.351 -39.109  33.927  1.00 140.62 ? 27  PRO C CG  1 
ATOM   4189  C CD  . PRO C 1 27  ? 180.185 -37.627  33.745  1.00 140.96 ? 27  PRO C CD  1 
ATOM   4190  N N   . VAL C 1 28  ? 180.617 -39.931  29.735  1.00 151.04 ? 28  VAL C N   1 
ATOM   4191  C CA  . VAL C 1 28  ? 179.807 -40.608  28.710  1.00 153.13 ? 28  VAL C CA  1 
ATOM   4192  C C   . VAL C 1 28  ? 178.849 -41.620  29.343  1.00 149.29 ? 28  VAL C C   1 
ATOM   4193  O O   . VAL C 1 28  ? 177.747 -41.865  28.839  1.00 152.74 ? 28  VAL C O   1 
ATOM   4194  C CB  . VAL C 1 28  ? 180.715 -41.300  27.661  1.00 155.56 ? 28  VAL C CB  1 
ATOM   4195  C CG1 . VAL C 1 28  ? 179.918 -42.195  26.718  1.00 158.02 ? 28  VAL C CG1 1 
ATOM   4196  C CG2 . VAL C 1 28  ? 181.497 -40.262  26.866  1.00 157.23 ? 28  VAL C CG2 1 
ATOM   4197  N N   . ILE C 1 29  ? 179.281 -42.178  30.467  1.00 141.61 ? 29  ILE C N   1 
ATOM   4198  C CA  . ILE C 1 29  ? 178.531 -43.178  31.211  1.00 134.60 ? 29  ILE C CA  1 
ATOM   4199  C C   . ILE C 1 29  ? 177.193 -42.638  31.746  1.00 130.36 ? 29  ILE C C   1 
ATOM   4200  O O   . ILE C 1 29  ? 176.242 -43.400  31.950  1.00 127.11 ? 29  ILE C O   1 
ATOM   4201  C CB  . ILE C 1 29  ? 179.398 -43.758  32.352  1.00 134.84 ? 29  ILE C CB  1 
ATOM   4202  C CG1 . ILE C 1 29  ? 180.731 -44.300  31.809  1.00 133.72 ? 29  ILE C CG1 1 
ATOM   4203  C CG2 . ILE C 1 29  ? 178.663 -44.868  33.084  1.00 137.07 ? 29  ILE C CG2 1 
ATOM   4204  C CD1 . ILE C 1 29  ? 181.863 -43.291  31.760  1.00 132.63 ? 29  ILE C CD1 1 
ATOM   4205  N N   . LEU C 1 30  ? 177.118 -41.322  31.936  1.00 127.74 ? 30  LEU C N   1 
ATOM   4206  C CA  . LEU C 1 30  ? 175.939 -40.685  32.524  1.00 127.05 ? 30  LEU C CA  1 
ATOM   4207  C C   . LEU C 1 30  ? 174.863 -40.198  31.547  1.00 130.84 ? 30  LEU C C   1 
ATOM   4208  O O   . LEU C 1 30  ? 173.727 -39.980  31.962  1.00 132.23 ? 30  LEU C O   1 
ATOM   4209  C CB  . LEU C 1 30  ? 176.357 -39.521  33.428  1.00 122.42 ? 30  LEU C CB  1 
ATOM   4210  C CG  . LEU C 1 30  ? 176.674 -39.827  34.890  1.00 119.89 ? 30  LEU C CG  1 
ATOM   4211  C CD1 . LEU C 1 30  ? 177.054 -38.538  35.593  1.00 119.40 ? 30  LEU C CD1 1 
ATOM   4212  C CD2 . LEU C 1 30  ? 175.495 -40.480  35.598  1.00 119.08 ? 30  LEU C CD2 1 
ATOM   4213  N N   . HIS C 1 31  ? 175.209 -40.039  30.269  1.00 134.40 ? 31  HIS C N   1 
ATOM   4214  C CA  . HIS C 1 31  ? 174.336 -39.364  29.284  1.00 134.82 ? 31  HIS C CA  1 
ATOM   4215  C C   . HIS C 1 31  ? 172.849 -39.743  29.286  1.00 129.97 ? 31  HIS C C   1 
ATOM   4216  O O   . HIS C 1 31  ? 171.989 -38.871  29.154  1.00 129.54 ? 31  HIS C O   1 
ATOM   4217  C CB  . HIS C 1 31  ? 174.894 -39.490  27.860  1.00 140.74 ? 31  HIS C CB  1 
ATOM   4218  C CG  . HIS C 1 31  ? 176.036 -38.564  27.569  1.00 146.66 ? 31  HIS C CG  1 
ATOM   4219  N ND1 . HIS C 1 31  ? 176.878 -38.744  26.493  1.00 150.41 ? 31  HIS C ND1 1 
ATOM   4220  C CD2 . HIS C 1 31  ? 176.485 -37.460  28.215  1.00 148.60 ? 31  HIS C CD2 1 
ATOM   4221  C CE1 . HIS C 1 31  ? 177.790 -37.788  26.483  1.00 151.78 ? 31  HIS C CE1 1 
ATOM   4222  N NE2 . HIS C 1 31  ? 177.575 -36.996  27.519  1.00 150.09 ? 31  HIS C NE2 1 
ATOM   4223  N N   . THR C 1 32  ? 172.554 -41.033  29.426  1.00 123.58 ? 32  THR C N   1 
ATOM   4224  C CA  . THR C 1 32  ? 171.171 -41.516  29.383  1.00 117.14 ? 32  THR C CA  1 
ATOM   4225  C C   . THR C 1 32  ? 170.409 -41.298  30.703  1.00 113.61 ? 32  THR C C   1 
ATOM   4226  O O   . THR C 1 32  ? 169.325 -40.708  30.684  1.00 112.10 ? 32  THR C O   1 
ATOM   4227  C CB  . THR C 1 32  ? 171.084 -42.995  28.954  1.00 116.26 ? 32  THR C CB  1 
ATOM   4228  O OG1 . THR C 1 32  ? 172.148 -43.297  28.045  1.00 114.46 ? 32  THR C OG1 1 
ATOM   4229  C CG2 . THR C 1 32  ? 169.743 -43.282  28.291  1.00 116.20 ? 32  THR C CG2 1 
ATOM   4230  N N   . PRO C 1 33  ? 170.956 -41.781  31.845  1.00 110.71 ? 33  PRO C N   1 
ATOM   4231  C CA  . PRO C 1 33  ? 170.300 -41.471  33.125  1.00 107.23 ? 33  PRO C CA  1 
ATOM   4232  C C   . PRO C 1 33  ? 170.245 -39.971  33.417  1.00 102.85 ? 33  PRO C C   1 
ATOM   4233  O O   . PRO C 1 33  ? 169.298 -39.501  34.050  1.00 101.24 ? 33  PRO C O   1 
ATOM   4234  C CB  . PRO C 1 33  ? 171.170 -42.196  34.166  1.00 108.67 ? 33  PRO C CB  1 
ATOM   4235  C CG  . PRO C 1 33  ? 172.426 -42.584  33.458  1.00 109.83 ? 33  PRO C CG  1 
ATOM   4236  C CD  . PRO C 1 33  ? 172.052 -42.754  32.020  1.00 110.61 ? 33  PRO C CD  1 
ATOM   4237  N N   . LEU C 1 34  ? 171.253 -39.242  32.941  1.00 99.03  ? 34  LEU C N   1 
ATOM   4238  C CA  . LEU C 1 34  ? 171.325 -37.787  33.059  1.00 95.22  ? 34  LEU C CA  1 
ATOM   4239  C C   . LEU C 1 34  ? 170.227 -37.121  32.227  1.00 92.28  ? 34  LEU C C   1 
ATOM   4240  O O   . LEU C 1 34  ? 169.698 -36.077  32.606  1.00 91.39  ? 34  LEU C O   1 
ATOM   4241  C CB  . LEU C 1 34  ? 172.718 -37.305  32.623  1.00 95.60  ? 34  LEU C CB  1 
ATOM   4242  C CG  . LEU C 1 34  ? 173.322 -35.930  32.948  1.00 95.78  ? 34  LEU C CG  1 
ATOM   4243  C CD1 . LEU C 1 34  ? 172.954 -34.896  31.891  1.00 96.32  ? 34  LEU C CD1 1 
ATOM   4244  C CD2 . LEU C 1 34  ? 172.967 -35.437  34.346  1.00 96.51  ? 34  LEU C CD2 1 
ATOM   4245  N N   . MET C 1 35  ? 169.890 -37.741  31.096  1.00 89.70  ? 35  MET C N   1 
ATOM   4246  C CA  . MET C 1 35  ? 168.808 -37.281  30.226  1.00 88.49  ? 35  MET C CA  1 
ATOM   4247  C C   . MET C 1 35  ? 167.451 -37.520  30.877  1.00 89.68  ? 35  MET C C   1 
ATOM   4248  O O   . MET C 1 35  ? 166.530 -36.714  30.728  1.00 89.97  ? 35  MET C O   1 
ATOM   4249  C CB  . MET C 1 35  ? 168.872 -38.021  28.891  1.00 86.45  ? 35  MET C CB  1 
ATOM   4250  C CG  . MET C 1 35  ? 167.799 -37.645  27.878  1.00 84.69  ? 35  MET C CG  1 
ATOM   4251  S SD  . MET C 1 35  ? 167.366 -39.028  26.804  1.00 83.06  ? 35  MET C SD  1 
ATOM   4252  C CE  . MET C 1 35  ? 168.952 -39.847  26.630  1.00 83.47  ? 35  MET C CE  1 
ATOM   4253  N N   . SER C 1 36  ? 167.344 -38.639  31.591  1.00 91.65  ? 36  SER C N   1 
ATOM   4254  C CA  . SER C 1 36  ? 166.115 -39.036  32.274  1.00 94.88  ? 36  SER C CA  1 
ATOM   4255  C C   . SER C 1 36  ? 165.711 -38.053  33.374  1.00 97.01  ? 36  SER C C   1 
ATOM   4256  O O   . SER C 1 36  ? 164.524 -37.899  33.674  1.00 98.00  ? 36  SER C O   1 
ATOM   4257  C CB  . SER C 1 36  ? 166.278 -40.438  32.861  1.00 95.12  ? 36  SER C CB  1 
ATOM   4258  O OG  . SER C 1 36  ? 165.119 -40.834  33.570  1.00 96.33  ? 36  SER C OG  1 
ATOM   4259  N N   . GLY C 1 37  ? 166.710 -37.400  33.966  1.00 99.04  ? 37  GLY C N   1 
ATOM   4260  C CA  . GLY C 1 37  ? 166.499 -36.436  35.043  1.00 101.85 ? 37  GLY C CA  1 
ATOM   4261  C C   . GLY C 1 37  ? 165.952 -35.098  34.579  1.00 103.43 ? 37  GLY C C   1 
ATOM   4262  O O   . GLY C 1 37  ? 164.971 -34.603  35.132  1.00 102.91 ? 37  GLY C O   1 
ATOM   4263  N N   . SER C 1 38  ? 166.594 -34.510  33.569  1.00 105.67 ? 38  SER C N   1 
ATOM   4264  C CA  . SER C 1 38  ? 166.130 -33.257  32.961  1.00 107.92 ? 38  SER C CA  1 
ATOM   4265  C C   . SER C 1 38  ? 164.700 -33.418  32.462  1.00 110.10 ? 38  SER C C   1 
ATOM   4266  O O   . SER C 1 38  ? 163.895 -32.484  32.525  1.00 109.00 ? 38  SER C O   1 
ATOM   4267  C CB  . SER C 1 38  ? 167.042 -32.853  31.801  1.00 108.07 ? 38  SER C CB  1 
ATOM   4268  O OG  . SER C 1 38  ? 166.975 -33.796  30.743  1.00 108.33 ? 38  SER C OG  1 
ATOM   4269  N N   . ASN C 1 39  ? 164.410 -34.619  31.965  1.00 114.25 ? 39  ASN C N   1 
ATOM   4270  C CA  . ASN C 1 39  ? 163.070 -35.035  31.578  1.00 118.09 ? 39  ASN C CA  1 
ATOM   4271  C C   . ASN C 1 39  ? 162.099 -35.011  32.760  1.00 120.16 ? 39  ASN C C   1 
ATOM   4272  O O   . ASN C 1 39  ? 160.936 -34.627  32.611  1.00 120.65 ? 39  ASN C O   1 
ATOM   4273  C CB  . ASN C 1 39  ? 163.122 -36.433  30.954  1.00 118.48 ? 39  ASN C CB  1 
ATOM   4274  C CG  . ASN C 1 39  ? 161.788 -36.874  30.389  1.00 118.57 ? 39  ASN C CG  1 
ATOM   4275  O OD1 . ASN C 1 39  ? 161.165 -36.161  29.603  1.00 119.42 ? 39  ASN C OD1 1 
ATOM   4276  N ND2 . ASN C 1 39  ? 161.347 -38.064  30.784  1.00 117.57 ? 39  ASN C ND2 1 
ATOM   4277  N N   . PHE C 1 40  ? 162.590 -35.426  33.926  1.00 122.52 ? 40  PHE C N   1 
ATOM   4278  C CA  . PHE C 1 40  ? 161.821 -35.372  35.164  1.00 124.94 ? 40  PHE C CA  1 
ATOM   4279  C C   . PHE C 1 40  ? 161.676 -33.941  35.671  1.00 123.82 ? 40  PHE C C   1 
ATOM   4280  O O   . PHE C 1 40  ? 160.580 -33.525  36.038  1.00 123.26 ? 40  PHE C O   1 
ATOM   4281  C CB  . PHE C 1 40  ? 162.474 -36.245  36.242  1.00 129.04 ? 40  PHE C CB  1 
ATOM   4282  C CG  . PHE C 1 40  ? 162.063 -35.893  37.647  1.00 133.76 ? 40  PHE C CG  1 
ATOM   4283  C CD1 . PHE C 1 40  ? 160.784 -36.186  38.108  1.00 136.14 ? 40  PHE C CD1 1 
ATOM   4284  C CD2 . PHE C 1 40  ? 162.957 -35.269  38.511  1.00 135.62 ? 40  PHE C CD2 1 
ATOM   4285  C CE1 . PHE C 1 40  ? 160.402 -35.859  39.400  1.00 138.94 ? 40  PHE C CE1 1 
ATOM   4286  C CE2 . PHE C 1 40  ? 162.582 -34.941  39.806  1.00 138.01 ? 40  PHE C CE2 1 
ATOM   4287  C CZ  . PHE C 1 40  ? 161.303 -35.239  40.251  1.00 139.46 ? 40  PHE C CZ  1 
ATOM   4288  N N   . ILE C 1 41  ? 162.788 -33.204  35.693  1.00 123.53 ? 41  ILE C N   1 
ATOM   4289  C CA  . ILE C 1 41  ? 162.832 -31.859  36.274  1.00 125.61 ? 41  ILE C CA  1 
ATOM   4290  C C   . ILE C 1 41  ? 161.764 -30.940  35.679  1.00 126.71 ? 41  ILE C C   1 
ATOM   4291  O O   . ILE C 1 41  ? 160.988 -30.335  36.424  1.00 127.42 ? 41  ILE C O   1 
ATOM   4292  C CB  . ILE C 1 41  ? 164.234 -31.215  36.156  1.00 126.62 ? 41  ILE C CB  1 
ATOM   4293  C CG1 . ILE C 1 41  ? 165.277 -32.054  36.902  1.00 126.65 ? 41  ILE C CG1 1 
ATOM   4294  C CG2 . ILE C 1 41  ? 164.226 -29.799  36.724  1.00 129.29 ? 41  ILE C CG2 1 
ATOM   4295  C CD1 . ILE C 1 41  ? 166.710 -31.771  36.500  1.00 127.12 ? 41  ILE C CD1 1 
ATOM   4296  N N   . HIS C 1 42  ? 161.712 -30.856  34.349  1.00 127.75 ? 42  HIS C N   1 
ATOM   4297  C CA  . HIS C 1 42  ? 160.716 -30.017  33.670  1.00 128.54 ? 42  HIS C CA  1 
ATOM   4298  C C   . HIS C 1 42  ? 159.288 -30.539  33.868  1.00 128.97 ? 42  HIS C C   1 
ATOM   4299  O O   . HIS C 1 42  ? 158.336 -30.040  33.260  1.00 127.92 ? 42  HIS C O   1 
ATOM   4300  C CB  . HIS C 1 42  ? 161.053 -29.828  32.182  1.00 128.04 ? 42  HIS C CB  1 
ATOM   4301  C CG  . HIS C 1 42  ? 160.940 -31.075  31.362  1.00 127.18 ? 42  HIS C CG  1 
ATOM   4302  N ND1 . HIS C 1 42  ? 162.019 -31.646  30.724  1.00 126.69 ? 42  HIS C ND1 1 
ATOM   4303  C CD2 . HIS C 1 42  ? 159.872 -31.851  31.060  1.00 126.82 ? 42  HIS C CD2 1 
ATOM   4304  C CE1 . HIS C 1 42  ? 161.622 -32.722  30.070  1.00 127.00 ? 42  HIS C CE1 1 
ATOM   4305  N NE2 . HIS C 1 42  ? 160.324 -32.873  30.263  1.00 127.07 ? 42  HIS C NE2 1 
ATOM   4306  N N   . GLY C 1 43  ? 159.161 -31.547  34.728  1.00 130.30 ? 43  GLY C N   1 
ATOM   4307  C CA  . GLY C 1 43  ? 157.870 -32.038  35.182  1.00 132.69 ? 43  GLY C CA  1 
ATOM   4308  C C   . GLY C 1 43  ? 157.232 -31.109  36.199  1.00 134.58 ? 43  GLY C C   1 
ATOM   4309  O O   . GLY C 1 43  ? 156.126 -31.375  36.667  1.00 136.25 ? 43  GLY C O   1 
ATOM   4310  N N   . VAL C 1 44  ? 157.928 -30.023  36.548  1.00 135.17 ? 44  VAL C N   1 
ATOM   4311  C CA  . VAL C 1 44  ? 157.348 -28.948  37.367  1.00 136.10 ? 44  VAL C CA  1 
ATOM   4312  C C   . VAL C 1 44  ? 156.241 -28.230  36.601  1.00 139.82 ? 44  VAL C C   1 
ATOM   4313  O O   . VAL C 1 44  ? 155.616 -27.296  37.109  1.00 140.58 ? 44  VAL C O   1 
ATOM   4314  C CB  . VAL C 1 44  ? 158.398 -27.913  37.833  1.00 133.54 ? 44  VAL C CB  1 
ATOM   4315  C CG1 . VAL C 1 44  ? 159.237 -28.485  38.963  1.00 132.59 ? 44  VAL C CG1 1 
ATOM   4316  C CG2 . VAL C 1 44  ? 159.271 -27.442  36.673  1.00 132.03 ? 44  VAL C CG2 1 
ATOM   4317  N N   . VAL C 1 45  ? 156.013 -28.693  35.375  1.00 144.25 ? 45  VAL C N   1 
ATOM   4318  C CA  . VAL C 1 45  ? 154.952 -28.198  34.507  1.00 148.62 ? 45  VAL C CA  1 
ATOM   4319  C C   . VAL C 1 45  ? 153.547 -28.560  35.040  1.00 150.49 ? 45  VAL C C   1 
ATOM   4320  O O   . VAL C 1 45  ? 152.534 -28.124  34.483  1.00 153.81 ? 45  VAL C O   1 
ATOM   4321  C CB  . VAL C 1 45  ? 155.182 -28.675  33.046  1.00 149.08 ? 45  VAL C CB  1 
ATOM   4322  C CG1 . VAL C 1 45  ? 154.846 -30.153  32.880  1.00 150.03 ? 45  VAL C CG1 1 
ATOM   4323  C CG2 . VAL C 1 45  ? 154.420 -27.806  32.051  1.00 149.99 ? 45  VAL C CG2 1 
ATOM   4324  N N   . VAL C 1 46  ? 153.492 -29.345  36.121  1.00 148.69 ? 46  VAL C N   1 
ATOM   4325  C CA  . VAL C 1 46  ? 152.224 -29.631  36.805  1.00 143.66 ? 46  VAL C CA  1 
ATOM   4326  C C   . VAL C 1 46  ? 151.764 -28.389  37.563  1.00 141.22 ? 46  VAL C C   1 
ATOM   4327  O O   . VAL C 1 46  ? 150.613 -27.976  37.437  1.00 139.66 ? 46  VAL C O   1 
ATOM   4328  C CB  . VAL C 1 46  ? 152.300 -30.808  37.809  1.00 142.17 ? 46  VAL C CB  1 
ATOM   4329  C CG1 . VAL C 1 46  ? 150.988 -31.577  37.807  1.00 139.73 ? 46  VAL C CG1 1 
ATOM   4330  C CG2 . VAL C 1 46  ? 153.443 -31.753  37.492  1.00 142.20 ? 46  VAL C CG2 1 
ATOM   4331  N N   . VAL C 1 47  ? 152.680 -27.804  38.338  1.00 138.79 ? 47  VAL C N   1 
ATOM   4332  C CA  . VAL C 1 47  ? 152.429 -26.603  39.147  1.00 136.89 ? 47  VAL C CA  1 
ATOM   4333  C C   . VAL C 1 47  ? 151.651 -25.527  38.385  1.00 139.16 ? 47  VAL C C   1 
ATOM   4334  O O   . VAL C 1 47  ? 150.657 -25.002  38.890  1.00 137.74 ? 47  VAL C O   1 
ATOM   4335  C CB  . VAL C 1 47  ? 153.753 -26.032  39.717  1.00 134.45 ? 47  VAL C CB  1 
ATOM   4336  C CG1 . VAL C 1 47  ? 153.602 -24.579  40.147  1.00 132.60 ? 47  VAL C CG1 1 
ATOM   4337  C CG2 . VAL C 1 47  ? 154.246 -26.889  40.874  1.00 133.31 ? 47  VAL C CG2 1 
ATOM   4338  N N   . GLY C 1 48  ? 152.101 -25.219  37.169  1.00 143.55 ? 48  GLY C N   1 
ATOM   4339  C CA  . GLY C 1 48  ? 151.441 -24.236  36.311  1.00 148.42 ? 48  GLY C CA  1 
ATOM   4340  C C   . GLY C 1 48  ? 150.091 -24.707  35.802  1.00 150.57 ? 48  GLY C C   1 
ATOM   4341  O O   . GLY C 1 48  ? 149.138 -23.928  35.744  1.00 151.74 ? 48  GLY C O   1 
ATOM   4342  N N   . ALA C 1 49  ? 150.017 -25.986  35.436  1.00 151.76 ? 49  ALA C N   1 
ATOM   4343  C CA  . ALA C 1 49  ? 148.771 -26.608  34.992  1.00 153.59 ? 49  ALA C CA  1 
ATOM   4344  C C   . ALA C 1 49  ? 147.770 -26.718  36.141  1.00 157.93 ? 49  ALA C C   1 
ATOM   4345  O O   . ALA C 1 49  ? 146.562 -26.758  35.916  1.00 158.10 ? 49  ALA C O   1 
ATOM   4346  C CB  . ALA C 1 49  ? 149.048 -27.977  34.391  1.00 150.07 ? 49  ALA C CB  1 
ATOM   4347  N N   . MET C 1 50  ? 148.290 -26.765  37.366  1.00 165.71 ? 50  MET C N   1 
ATOM   4348  C CA  . MET C 1 50  ? 147.476 -26.788  38.582  1.00 173.40 ? 50  MET C CA  1 
ATOM   4349  C C   . MET C 1 50  ? 146.953 -25.393  38.926  1.00 173.35 ? 50  MET C C   1 
ATOM   4350  O O   . MET C 1 50  ? 145.789 -25.235  39.307  1.00 174.51 ? 50  MET C O   1 
ATOM   4351  C CB  . MET C 1 50  ? 148.292 -27.337  39.757  1.00 180.25 ? 50  MET C CB  1 
ATOM   4352  C CG  . MET C 1 50  ? 148.646 -28.814  39.654  1.00 184.99 ? 50  MET C CG  1 
ATOM   4353  S SD  . MET C 1 50  ? 150.172 -29.238  40.523  1.00 189.65 ? 50  MET C SD  1 
ATOM   4354  C CE  . MET C 1 50  ? 149.686 -29.018  42.233  1.00 192.77 ? 50  MET C CE  1 
ATOM   4355  N N   . VAL C 1 51  ? 147.829 -24.394  38.799  1.00 170.53 ? 51  VAL C N   1 
ATOM   4356  C CA  . VAL C 1 51  ? 147.490 -22.992  39.052  1.00 166.86 ? 51  VAL C CA  1 
ATOM   4357  C C   . VAL C 1 51  ? 146.392 -22.520  38.104  1.00 168.76 ? 51  VAL C C   1 
ATOM   4358  O O   . VAL C 1 51  ? 145.426 -21.887  38.528  1.00 164.91 ? 51  VAL C O   1 
ATOM   4359  C CB  . VAL C 1 51  ? 148.732 -22.080  38.912  1.00 163.28 ? 51  VAL C CB  1 
ATOM   4360  C CG1 . VAL C 1 51  ? 148.334 -20.614  38.804  1.00 161.47 ? 51  VAL C CG1 1 
ATOM   4361  C CG2 . VAL C 1 51  ? 149.679 -22.291  40.080  1.00 161.71 ? 51  VAL C CG2 1 
ATOM   4362  N N   . VAL C 1 52  ? 146.546 -22.849  36.825  1.00 174.64 ? 52  VAL C N   1 
ATOM   4363  C CA  . VAL C 1 52  ? 145.598 -22.429  35.800  1.00 181.81 ? 52  VAL C CA  1 
ATOM   4364  C C   . VAL C 1 52  ? 144.267 -23.206  35.874  1.00 186.00 ? 52  VAL C C   1 
ATOM   4365  O O   . VAL C 1 52  ? 143.220 -22.672  35.501  1.00 191.24 ? 52  VAL C O   1 
ATOM   4366  C CB  . VAL C 1 52  ? 146.244 -22.451  34.387  1.00 182.82 ? 52  VAL C CB  1 
ATOM   4367  C CG1 . VAL C 1 52  ? 146.307 -23.863  33.814  1.00 184.94 ? 52  VAL C CG1 1 
ATOM   4368  C CG2 . VAL C 1 52  ? 145.522 -21.498  33.443  1.00 183.04 ? 52  VAL C CG2 1 
ATOM   4369  N N   . LEU C 1 53  ? 144.310 -24.445  36.373  1.00 186.57 ? 53  LEU C N   1 
ATOM   4370  C CA  . LEU C 1 53  ? 143.097 -25.265  36.550  1.00 184.22 ? 53  LEU C CA  1 
ATOM   4371  C C   . LEU C 1 53  ? 142.274 -24.804  37.750  1.00 187.25 ? 53  LEU C C   1 
ATOM   4372  O O   . LEU C 1 53  ? 141.043 -24.911  37.749  1.00 184.57 ? 53  LEU C O   1 
ATOM   4373  C CB  . LEU C 1 53  ? 143.440 -26.759  36.677  1.00 177.86 ? 53  LEU C CB  1 
ATOM   4374  C CG  . LEU C 1 53  ? 142.330 -27.792  36.939  1.00 172.47 ? 53  LEU C CG  1 
ATOM   4375  C CD1 . LEU C 1 53  ? 141.214 -27.737  35.904  1.00 170.57 ? 53  LEU C CD1 1 
ATOM   4376  C CD2 . LEU C 1 53  ? 142.914 -29.194  37.007  1.00 170.48 ? 53  LEU C CD2 1 
ATOM   4377  N N   . GLY C 1 54  ? 142.960 -24.295  38.771  1.00 193.07 ? 54  GLY C N   1 
ATOM   4378  C CA  . GLY C 1 54  ? 142.300 -23.703  39.930  1.00 202.12 ? 54  GLY C CA  1 
ATOM   4379  C C   . GLY C 1 54  ? 141.790 -22.297  39.655  1.00 207.92 ? 54  GLY C C   1 
ATOM   4380  O O   . GLY C 1 54  ? 141.426 -21.571  40.582  1.00 214.77 ? 54  GLY C O   1 
ATOM   4381  N N   . HIS C 1 55  ? 141.767 -21.918  38.377  1.00 207.28 ? 55  HIS C N   1 
ATOM   4382  C CA  . HIS C 1 55  ? 141.327 -20.591  37.944  1.00 203.89 ? 55  HIS C CA  1 
ATOM   4383  C C   . HIS C 1 55  ? 140.380 -20.656  36.733  1.00 203.62 ? 55  HIS C C   1 
ATOM   4384  O O   . HIS C 1 55  ? 140.192 -19.660  36.028  1.00 207.08 ? 55  HIS C O   1 
ATOM   4385  C CB  . HIS C 1 55  ? 142.545 -19.709  37.635  1.00 198.52 ? 55  HIS C CB  1 
ATOM   4386  C CG  . HIS C 1 55  ? 143.254 -19.205  38.854  1.00 194.68 ? 55  HIS C CG  1 
ATOM   4387  N ND1 . HIS C 1 55  ? 143.222 -17.881  39.237  1.00 194.41 ? 55  HIS C ND1 1 
ATOM   4388  C CD2 . HIS C 1 55  ? 144.010 -19.845  39.778  1.00 192.67 ? 55  HIS C CD2 1 
ATOM   4389  C CE1 . HIS C 1 55  ? 143.929 -17.728  40.342  1.00 195.00 ? 55  HIS C CE1 1 
ATOM   4390  N NE2 . HIS C 1 55  ? 144.418 -18.904  40.691  1.00 193.15 ? 55  HIS C NE2 1 
ATOM   4391  N N   . ALA C 1 56  ? 139.777 -21.827  36.513  1.00 197.98 ? 56  ALA C N   1 
ATOM   4392  C CA  . ALA C 1 56  ? 138.911 -22.071  35.353  1.00 189.56 ? 56  ALA C CA  1 
ATOM   4393  C C   . ALA C 1 56  ? 137.426 -21.927  35.685  1.00 184.54 ? 56  ALA C C   1 
ATOM   4394  O O   . ALA C 1 56  ? 136.986 -22.315  36.771  1.00 182.49 ? 56  ALA C O   1 
ATOM   4395  C CB  . ALA C 1 56  ? 139.193 -23.447  34.769  1.00 187.27 ? 56  ALA C CB  1 
ATOM   4396  N N   . GLU C 1 57  ? 136.660 -21.385  34.738  1.00 180.67 ? 57  GLU C N   1 
ATOM   4397  C CA  . GLU C 1 57  ? 135.242 -21.081  34.965  1.00 178.84 ? 57  GLU C CA  1 
ATOM   4398  C C   . GLU C 1 57  ? 134.287 -21.628  33.901  1.00 178.64 ? 57  GLU C C   1 
ATOM   4399  O O   . GLU C 1 57  ? 133.258 -22.219  34.237  1.00 179.73 ? 57  GLU C O   1 
ATOM   4400  C CB  . GLU C 1 57  ? 135.037 -19.573  35.143  1.00 176.55 ? 57  GLU C CB  1 
ATOM   4401  C CG  . GLU C 1 57  ? 135.450 -19.056  36.515  1.00 173.88 ? 57  GLU C CG  1 
ATOM   4402  C CD  . GLU C 1 57  ? 135.415 -17.541  36.615  1.00 171.06 ? 57  GLU C CD  1 
ATOM   4403  O OE1 . GLU C 1 57  ? 135.008 -17.031  37.683  1.00 168.21 ? 57  GLU C OE1 1 
ATOM   4404  O OE2 . GLU C 1 57  ? 135.794 -16.860  35.633  1.00 170.67 ? 57  GLU C OE2 1 
ATOM   4405  N N   . THR C 1 58  ? 134.619 -21.425  32.627  1.00 177.69 ? 58  THR C N   1 
ATOM   4406  C CA  . THR C 1 58  ? 133.773 -21.908  31.532  1.00 177.92 ? 58  THR C CA  1 
ATOM   4407  C C   . THR C 1 58  ? 133.937 -23.421  31.319  1.00 180.54 ? 58  THR C C   1 
ATOM   4408  O O   . THR C 1 58  ? 134.846 -24.039  31.881  1.00 183.88 ? 58  THR C O   1 
ATOM   4409  C CB  . THR C 1 58  ? 134.023 -21.133  30.219  1.00 175.59 ? 58  THR C CB  1 
ATOM   4410  O OG1 . THR C 1 58  ? 135.408 -21.212  29.866  1.00 174.71 ? 58  THR C OG1 1 
ATOM   4411  C CG2 . THR C 1 58  ? 133.622 -19.668  30.369  1.00 172.63 ? 58  THR C CG2 1 
ATOM   4412  N N   . GLY C 1 59  ? 133.048 -24.005  30.515  1.00 179.81 ? 59  GLY C N   1 
ATOM   4413  C CA  . GLY C 1 59  ? 132.993 -25.456  30.309  1.00 175.53 ? 59  GLY C CA  1 
ATOM   4414  C C   . GLY C 1 59  ? 134.129 -26.079  29.511  1.00 171.44 ? 59  GLY C C   1 
ATOM   4415  O O   . GLY C 1 59  ? 134.342 -27.297  29.578  1.00 171.55 ? 59  GLY C O   1 
ATOM   4416  N N   . LEU C 1 60  ? 134.851 -25.251  28.754  1.00 166.08 ? 60  LEU C N   1 
ATOM   4417  C CA  . LEU C 1 60  ? 135.944 -25.726  27.901  1.00 158.44 ? 60  LEU C CA  1 
ATOM   4418  C C   . LEU C 1 60  ? 137.324 -25.380  28.486  1.00 156.40 ? 60  LEU C C   1 
ATOM   4419  O O   . LEU C 1 60  ? 138.337 -25.976  28.104  1.00 154.88 ? 60  LEU C O   1 
ATOM   4420  C CB  . LEU C 1 60  ? 135.787 -25.158  26.484  1.00 154.30 ? 60  LEU C CB  1 
ATOM   4421  C CG  . LEU C 1 60  ? 135.761 -26.154  25.318  1.00 149.84 ? 60  LEU C CG  1 
ATOM   4422  C CD1 . LEU C 1 60  ? 135.043 -25.553  24.114  1.00 147.17 ? 60  LEU C CD1 1 
ATOM   4423  C CD2 . LEU C 1 60  ? 137.162 -26.625  24.941  1.00 149.26 ? 60  LEU C CD2 1 
ATOM   4424  N N   . GLU C 1 61  ? 137.347 -24.417  29.410  1.00 153.48 ? 61  GLU C N   1 
ATOM   4425  C CA  . GLU C 1 61  ? 138.562 -24.026  30.133  1.00 149.56 ? 61  GLU C CA  1 
ATOM   4426  C C   . GLU C 1 61  ? 138.944 -25.050  31.205  1.00 149.41 ? 61  GLU C C   1 
ATOM   4427  O O   . GLU C 1 61  ? 140.126 -25.332  31.406  1.00 149.77 ? 61  GLU C O   1 
ATOM   4428  C CB  . GLU C 1 61  ? 138.388 -22.643  30.776  1.00 146.20 ? 61  GLU C CB  1 
ATOM   4429  C CG  . GLU C 1 61  ? 138.604 -21.465  29.833  1.00 141.81 ? 61  GLU C CG  1 
ATOM   4430  C CD  . GLU C 1 61  ? 138.114 -20.139  30.403  1.00 138.61 ? 61  GLU C CD  1 
ATOM   4431  O OE1 . GLU C 1 61  ? 137.517 -20.125  31.502  1.00 136.67 ? 61  GLU C OE1 1 
ATOM   4432  O OE2 . GLU C 1 61  ? 138.315 -19.100  29.739  1.00 136.73 ? 61  GLU C OE2 1 
ATOM   4433  N N   . LYS C 1 62  ? 137.934 -25.593  31.886  1.00 148.72 ? 62  LYS C N   1 
ATOM   4434  C CA  . LYS C 1 62  ? 138.122 -26.587  32.951  1.00 148.65 ? 62  LYS C CA  1 
ATOM   4435  C C   . LYS C 1 62  ? 138.698 -27.919  32.445  1.00 153.17 ? 62  LYS C C   1 
ATOM   4436  O O   . LYS C 1 62  ? 139.284 -28.677  33.223  1.00 155.17 ? 62  LYS C O   1 
ATOM   4437  C CB  . LYS C 1 62  ? 136.797 -26.835  33.693  1.00 143.39 ? 62  LYS C CB  1 
ATOM   4438  C CG  . LYS C 1 62  ? 136.371 -25.730  34.656  1.00 137.38 ? 62  LYS C CG  1 
ATOM   4439  C CD  . LYS C 1 62  ? 134.872 -25.755  34.946  1.00 133.39 ? 62  LYS C CD  1 
ATOM   4440  C CE  . LYS C 1 62  ? 134.486 -26.791  35.997  1.00 130.76 ? 62  LYS C CE  1 
ATOM   4441  N NZ  . LYS C 1 62  ? 133.007 -26.897  36.184  1.00 126.52 ? 62  LYS C NZ  1 
ATOM   4442  N N   . LEU C 1 63  ? 138.538 -28.188  31.148  1.00 156.91 ? 63  LEU C N   1 
ATOM   4443  C CA  . LEU C 1 63  ? 138.933 -29.468  30.546  1.00 158.73 ? 63  LEU C CA  1 
ATOM   4444  C C   . LEU C 1 63  ? 140.421 -29.566  30.202  1.00 156.62 ? 63  LEU C C   1 
ATOM   4445  O O   . LEU C 1 63  ? 141.092 -30.521  30.601  1.00 156.28 ? 63  LEU C O   1 
ATOM   4446  C CB  . LEU C 1 63  ? 138.076 -29.763  29.300  1.00 162.05 ? 63  LEU C CB  1 
ATOM   4447  C CG  . LEU C 1 63  ? 138.280 -31.025  28.437  1.00 164.54 ? 63  LEU C CG  1 
ATOM   4448  C CD1 . LEU C 1 63  ? 139.397 -30.856  27.409  1.00 164.98 ? 63  LEU C CD1 1 
ATOM   4449  C CD2 . LEU C 1 63  ? 138.487 -32.286  29.272  1.00 164.93 ? 63  LEU C CD2 1 
ATOM   4450  N N   . ILE C 1 64  ? 140.921 -28.591  29.446  1.00 153.57 ? 64  ILE C N   1 
ATOM   4451  C CA  . ILE C 1 64  ? 142.301 -28.613  28.954  1.00 150.72 ? 64  ILE C CA  1 
ATOM   4452  C C   . ILE C 1 64  ? 143.304 -28.470  30.109  1.00 151.41 ? 64  ILE C C   1 
ATOM   4453  O O   . ILE C 1 64  ? 144.444 -28.934  30.016  1.00 152.27 ? 64  ILE C O   1 
ATOM   4454  C CB  . ILE C 1 64  ? 142.528 -27.552  27.847  1.00 147.79 ? 64  ILE C CB  1 
ATOM   4455  C CG1 . ILE C 1 64  ? 141.400 -27.620  26.805  1.00 144.35 ? 64  ILE C CG1 1 
ATOM   4456  C CG2 . ILE C 1 64  ? 143.870 -27.770  27.155  1.00 148.73 ? 64  ILE C CG2 1 
ATOM   4457  C CD1 . ILE C 1 64  ? 141.288 -26.401  25.912  1.00 141.50 ? 64  ILE C CD1 1 
ATOM   4458  N N   . GLY C 1 65  ? 142.861 -27.844  31.200  1.00 150.60 ? 65  GLY C N   1 
ATOM   4459  C CA  . GLY C 1 65  ? 143.644 -27.764  32.435  1.00 146.75 ? 65  GLY C CA  1 
ATOM   4460  C C   . GLY C 1 65  ? 143.752 -29.114  33.121  1.00 141.99 ? 65  GLY C C   1 
ATOM   4461  O O   . GLY C 1 65  ? 144.817 -29.481  33.621  1.00 142.13 ? 65  GLY C O   1 
ATOM   4462  N N   . PHE C 1 66  ? 142.639 -29.848  33.135  1.00 136.13 ? 66  PHE C N   1 
ATOM   4463  C CA  . PHE C 1 66  ? 142.588 -31.226  33.624  1.00 128.86 ? 66  PHE C CA  1 
ATOM   4464  C C   . PHE C 1 66  ? 143.453 -32.138  32.749  1.00 125.87 ? 66  PHE C C   1 
ATOM   4465  O O   . PHE C 1 66  ? 144.015 -33.125  33.232  1.00 127.44 ? 66  PHE C O   1 
ATOM   4466  C CB  . PHE C 1 66  ? 141.133 -31.714  33.644  1.00 125.37 ? 66  PHE C CB  1 
ATOM   4467  C CG  . PHE C 1 66  ? 140.948 -33.083  34.236  1.00 121.41 ? 66  PHE C CG  1 
ATOM   4468  C CD1 . PHE C 1 66  ? 140.796 -33.246  35.609  1.00 119.96 ? 66  PHE C CD1 1 
ATOM   4469  C CD2 . PHE C 1 66  ? 140.899 -34.208  33.420  1.00 119.98 ? 66  PHE C CD2 1 
ATOM   4470  C CE1 . PHE C 1 66  ? 140.618 -34.507  36.157  1.00 118.67 ? 66  PHE C CE1 1 
ATOM   4471  C CE2 . PHE C 1 66  ? 140.719 -35.470  33.962  1.00 118.67 ? 66  PHE C CE2 1 
ATOM   4472  C CZ  . PHE C 1 66  ? 140.580 -35.619  35.332  1.00 118.54 ? 66  PHE C CZ  1 
ATOM   4473  N N   . LEU C 1 67  ? 143.547 -31.792  31.465  1.00 119.89 ? 67  LEU C N   1 
ATOM   4474  C CA  . LEU C 1 67  ? 144.410 -32.484  30.511  1.00 113.43 ? 67  LEU C CA  1 
ATOM   4475  C C   . LEU C 1 67  ? 145.876 -32.175  30.811  1.00 111.25 ? 67  LEU C C   1 
ATOM   4476  O O   . LEU C 1 67  ? 146.724 -33.068  30.787  1.00 110.57 ? 67  LEU C O   1 
ATOM   4477  C CB  . LEU C 1 67  ? 144.076 -32.035  29.082  1.00 110.66 ? 67  LEU C CB  1 
ATOM   4478  C CG  . LEU C 1 67  ? 144.043 -33.013  27.899  1.00 108.41 ? 67  LEU C CG  1 
ATOM   4479  C CD1 . LEU C 1 67  ? 145.244 -33.951  27.859  1.00 107.69 ? 67  LEU C CD1 1 
ATOM   4480  C CD2 . LEU C 1 67  ? 142.737 -33.794  27.906  1.00 107.59 ? 67  LEU C CD2 1 
ATOM   4481  N N   . GLY C 1 68  ? 146.154 -30.904  31.097  1.00 109.01 ? 68  GLY C N   1 
ATOM   4482  C CA  . GLY C 1 68  ? 147.507 -30.425  31.371  1.00 106.90 ? 68  GLY C CA  1 
ATOM   4483  C C   . GLY C 1 68  ? 148.116 -30.950  32.658  1.00 106.36 ? 68  GLY C C   1 
ATOM   4484  O O   . GLY C 1 68  ? 149.336 -31.068  32.762  1.00 106.57 ? 68  GLY C O   1 
ATOM   4485  N N   . VAL C 1 69  ? 147.274 -31.259  33.641  1.00 105.94 ? 69  VAL C N   1 
ATOM   4486  C CA  . VAL C 1 69  ? 147.749 -31.806  34.916  1.00 106.04 ? 69  VAL C CA  1 
ATOM   4487  C C   . VAL C 1 69  ? 148.070 -33.305  34.807  1.00 107.14 ? 69  VAL C C   1 
ATOM   4488  O O   . VAL C 1 69  ? 149.023 -33.778  35.431  1.00 107.72 ? 69  VAL C O   1 
ATOM   4489  C CB  . VAL C 1 69  ? 146.766 -31.520  36.079  1.00 105.33 ? 69  VAL C CB  1 
ATOM   4490  C CG1 . VAL C 1 69  ? 147.294 -32.079  37.391  1.00 104.95 ? 69  VAL C CG1 1 
ATOM   4491  C CG2 . VAL C 1 69  ? 146.529 -30.027  36.228  1.00 104.83 ? 69  VAL C CG2 1 
ATOM   4492  N N   . ILE C 1 70  ? 147.285 -34.042  34.015  1.00 107.51 ? 70  ILE C N   1 
ATOM   4493  C CA  . ILE C 1 70  ? 147.539 -35.474  33.763  1.00 106.47 ? 70  ILE C CA  1 
ATOM   4494  C C   . ILE C 1 70  ? 148.828 -35.684  32.968  1.00 107.90 ? 70  ILE C C   1 
ATOM   4495  O O   . ILE C 1 70  ? 149.593 -36.606  33.249  1.00 107.42 ? 70  ILE C O   1 
ATOM   4496  C CB  . ILE C 1 70  ? 146.353 -36.174  33.051  1.00 104.28 ? 70  ILE C CB  1 
ATOM   4497  C CG1 . ILE C 1 70  ? 145.188 -36.363  34.028  1.00 103.45 ? 70  ILE C CG1 1 
ATOM   4498  C CG2 . ILE C 1 70  ? 146.776 -37.523  32.470  1.00 102.05 ? 70  ILE C CG2 1 
ATOM   4499  C CD1 . ILE C 1 70  ? 143.924 -36.911  33.401  1.00 102.82 ? 70  ILE C CD1 1 
ATOM   4500  N N   . LEU C 1 71  ? 149.052 -34.828  31.974  1.00 109.72 ? 71  LEU C N   1 
ATOM   4501  C CA  . LEU C 1 71  ? 150.302 -34.819  31.220  1.00 111.13 ? 71  LEU C CA  1 
ATOM   4502  C C   . LEU C 1 71  ? 151.465 -34.420  32.127  1.00 113.94 ? 71  LEU C C   1 
ATOM   4503  O O   . LEU C 1 71  ? 152.522 -35.052  32.112  1.00 114.02 ? 71  LEU C O   1 
ATOM   4504  C CB  . LEU C 1 71  ? 150.208 -33.848  30.039  1.00 108.88 ? 71  LEU C CB  1 
ATOM   4505  C CG  . LEU C 1 71  ? 149.191 -34.094  28.922  1.00 107.20 ? 71  LEU C CG  1 
ATOM   4506  C CD1 . LEU C 1 71  ? 148.907 -32.798  28.180  1.00 105.88 ? 71  LEU C CD1 1 
ATOM   4507  C CD2 . LEU C 1 71  ? 149.662 -35.173  27.961  1.00 107.07 ? 71  LEU C CD2 1 
ATOM   4508  N N   . GLY C 1 72  ? 151.246 -33.377  32.928  1.00 116.92 ? 72  GLY C N   1 
ATOM   4509  C CA  . GLY C 1 72  ? 152.262 -32.835  33.829  1.00 118.17 ? 72  GLY C CA  1 
ATOM   4510  C C   . GLY C 1 72  ? 152.710 -33.791  34.917  1.00 117.44 ? 72  GLY C C   1 
ATOM   4511  O O   . GLY C 1 72  ? 153.904 -34.055  35.061  1.00 117.61 ? 72  GLY C O   1 
ATOM   4512  N N   . ALA C 1 73  ? 151.752 -34.303  35.689  1.00 116.05 ? 73  ALA C N   1 
ATOM   4513  C CA  . ALA C 1 73  ? 152.038 -35.275  36.742  1.00 114.60 ? 73  ALA C CA  1 
ATOM   4514  C C   . ALA C 1 73  ? 152.601 -36.573  36.166  1.00 115.01 ? 73  ALA C C   1 
ATOM   4515  O O   . ALA C 1 73  ? 153.340 -37.288  36.846  1.00 114.44 ? 73  ALA C O   1 
ATOM   4516  C CB  . ALA C 1 73  ? 150.795 -35.548  37.572  1.00 114.00 ? 73  ALA C CB  1 
ATOM   4517  N N   . ALA C 1 74  ? 152.247 -36.864  34.913  1.00 116.01 ? 74  ALA C N   1 
ATOM   4518  C CA  . ALA C 1 74  ? 152.813 -37.996  34.180  1.00 117.24 ? 74  ALA C CA  1 
ATOM   4519  C C   . ALA C 1 74  ? 154.250 -37.723  33.748  1.00 117.35 ? 74  ALA C C   1 
ATOM   4520  O O   . ALA C 1 74  ? 155.074 -38.635  33.691  1.00 120.25 ? 74  ALA C O   1 
ATOM   4521  C CB  . ALA C 1 74  ? 151.953 -38.351  32.979  1.00 115.90 ? 74  ALA C CB  1 
ATOM   4522  N N   . ASN C 1 75  ? 154.542 -36.464  33.436  1.00 115.41 ? 75  ASN C N   1 
ATOM   4523  C CA  . ASN C 1 75  ? 155.911 -36.034  33.186  1.00 113.26 ? 75  ASN C CA  1 
ATOM   4524  C C   . ASN C 1 75  ? 156.691 -35.970  34.500  1.00 113.74 ? 75  ASN C C   1 
ATOM   4525  O O   . ASN C 1 75  ? 157.908 -36.177  34.520  1.00 113.36 ? 75  ASN C O   1 
ATOM   4526  C CB  . ASN C 1 75  ? 155.911 -34.673  32.486  1.00 110.98 ? 75  ASN C CB  1 
ATOM   4527  C CG  . ASN C 1 75  ? 157.299 -34.220  32.065  1.00 109.60 ? 75  ASN C CG  1 
ATOM   4528  O OD1 . ASN C 1 75  ? 157.524 -33.027  31.855  1.00 108.11 ? 75  ASN C OD1 1 
ATOM   4529  N ND2 . ASN C 1 75  ? 158.232 -35.162  31.935  1.00 109.72 ? 75  ASN C ND2 1 
ATOM   4530  N N   . ALA C 1 76  ? 155.973 -35.693  35.589  1.00 114.44 ? 76  ALA C N   1 
ATOM   4531  C CA  . ALA C 1 76  ? 156.555 -35.618  36.926  1.00 115.53 ? 76  ALA C CA  1 
ATOM   4532  C C   . ALA C 1 76  ? 156.909 -37.001  37.469  1.00 116.78 ? 76  ALA C C   1 
ATOM   4533  O O   . ALA C 1 76  ? 158.080 -37.380  37.479  1.00 117.49 ? 76  ALA C O   1 
ATOM   4534  C CB  . ALA C 1 76  ? 155.617 -34.886  37.878  1.00 114.58 ? 76  ALA C CB  1 
ATOM   4535  N N   . ALA C 1 77  ? 155.898 -37.756  37.900  1.00 118.06 ? 77  ALA C N   1 
ATOM   4536  C CA  . ALA C 1 77  ? 156.109 -39.078  38.498  1.00 120.20 ? 77  ALA C CA  1 
ATOM   4537  C C   . ALA C 1 77  ? 156.698 -40.108  37.524  1.00 122.47 ? 77  ALA C C   1 
ATOM   4538  O O   . ALA C 1 77  ? 157.234 -41.134  37.951  1.00 124.70 ? 77  ALA C O   1 
ATOM   4539  C CB  . ALA C 1 77  ? 154.817 -39.595  39.115  1.00 119.08 ? 77  ALA C CB  1 
ATOM   4540  N N   . GLY C 1 78  ? 156.600 -39.827  36.226  1.00 123.61 ? 78  GLY C N   1 
ATOM   4541  C CA  . GLY C 1 78  ? 157.154 -40.705  35.196  1.00 122.98 ? 78  GLY C CA  1 
ATOM   4542  C C   . GLY C 1 78  ? 158.652 -40.556  35.033  1.00 122.07 ? 78  GLY C C   1 
ATOM   4543  O O   . GLY C 1 78  ? 159.368 -41.546  34.880  1.00 118.78 ? 78  GLY C O   1 
ATOM   4544  N N   . GLY C 1 79  ? 159.119 -39.311  35.061  1.00 124.38 ? 79  GLY C N   1 
ATOM   4545  C CA  . GLY C 1 79  ? 160.543 -39.011  34.993  1.00 131.11 ? 79  GLY C CA  1 
ATOM   4546  C C   . GLY C 1 79  ? 161.320 -39.467  36.218  1.00 139.22 ? 79  GLY C C   1 
ATOM   4547  O O   . GLY C 1 79  ? 162.504 -39.786  36.114  1.00 139.10 ? 79  GLY C O   1 
ATOM   4548  N N   . TYR C 1 80  ? 160.653 -39.493  37.374  1.00 149.41 ? 80  TYR C N   1 
ATOM   4549  C CA  . TYR C 1 80  ? 161.275 -39.881  38.650  1.00 159.90 ? 80  TYR C CA  1 
ATOM   4550  C C   . TYR C 1 80  ? 161.566 -41.383  38.721  1.00 168.02 ? 80  TYR C C   1 
ATOM   4551  O O   . TYR C 1 80  ? 162.645 -41.788  39.156  1.00 173.24 ? 80  TYR C O   1 
ATOM   4552  C CB  . TYR C 1 80  ? 160.393 -39.449  39.835  1.00 157.76 ? 80  TYR C CB  1 
ATOM   4553  C CG  . TYR C 1 80  ? 161.059 -39.500  41.204  1.00 153.16 ? 80  TYR C CG  1 
ATOM   4554  C CD1 . TYR C 1 80  ? 161.810 -38.424  41.678  1.00 150.15 ? 80  TYR C CD1 1 
ATOM   4555  C CD2 . TYR C 1 80  ? 160.916 -40.615  42.033  1.00 151.72 ? 80  TYR C CD2 1 
ATOM   4556  C CE1 . TYR C 1 80  ? 162.411 -38.464  42.926  1.00 146.40 ? 80  TYR C CE1 1 
ATOM   4557  C CE2 . TYR C 1 80  ? 161.513 -40.661  43.284  1.00 147.65 ? 80  TYR C CE2 1 
ATOM   4558  C CZ  . TYR C 1 80  ? 162.258 -39.583  43.722  1.00 145.90 ? 80  TYR C CZ  1 
ATOM   4559  O OH  . TYR C 1 80  ? 162.852 -39.622  44.959  1.00 145.41 ? 80  TYR C OH  1 
ATOM   4560  N N   . ALA C 1 81  ? 160.604 -42.198  38.289  1.00 172.67 ? 81  ALA C N   1 
ATOM   4561  C CA  . ALA C 1 81  ? 160.710 -43.656  38.389  1.00 171.68 ? 81  ALA C CA  1 
ATOM   4562  C C   . ALA C 1 81  ? 161.621 -44.272  37.325  1.00 168.05 ? 81  ALA C C   1 
ATOM   4563  O O   . ALA C 1 81  ? 162.213 -45.333  37.553  1.00 168.49 ? 81  ALA C O   1 
ATOM   4564  C CB  . ALA C 1 81  ? 159.330 -44.296  38.356  1.00 173.44 ? 81  ALA C CB  1 
ATOM   4565  N N   . VAL C 1 82  ? 161.728 -43.611  36.171  1.00 161.74 ? 82  VAL C N   1 
ATOM   4566  C CA  . VAL C 1 82  ? 162.657 -44.048  35.121  1.00 155.54 ? 82  VAL C CA  1 
ATOM   4567  C C   . VAL C 1 82  ? 164.120 -43.750  35.477  1.00 152.68 ? 82  VAL C C   1 
ATOM   4568  O O   . VAL C 1 82  ? 165.025 -44.446  35.014  1.00 154.78 ? 82  VAL C O   1 
ATOM   4569  C CB  . VAL C 1 82  ? 162.314 -43.488  33.710  1.00 153.34 ? 82  VAL C CB  1 
ATOM   4570  C CG1 . VAL C 1 82  ? 161.074 -44.161  33.141  1.00 151.29 ? 82  VAL C CG1 1 
ATOM   4571  C CG2 . VAL C 1 82  ? 162.155 -41.976  33.717  1.00 150.58 ? 82  VAL C CG2 1 
ATOM   4572  N N   . THR C 1 83  ? 164.344 -42.727  36.303  1.00 145.97 ? 83  THR C N   1 
ATOM   4573  C CA  . THR C 1 83  ? 165.701 -42.343  36.709  1.00 138.86 ? 83  THR C CA  1 
ATOM   4574  C C   . THR C 1 83  ? 166.152 -42.978  38.029  1.00 138.31 ? 83  THR C C   1 
ATOM   4575  O O   . THR C 1 83  ? 167.345 -43.211  38.224  1.00 134.79 ? 83  THR C O   1 
ATOM   4576  C CB  . THR C 1 83  ? 165.896 -40.808  36.745  1.00 135.62 ? 83  THR C CB  1 
ATOM   4577  O OG1 . THR C 1 83  ? 167.295 -40.506  36.757  1.00 132.30 ? 83  THR C OG1 1 
ATOM   4578  C CG2 . THR C 1 83  ? 165.231 -40.176  37.966  1.00 135.10 ? 83  THR C CG2 1 
ATOM   4579  N N   . VAL C 1 84  ? 165.198 -43.251  38.923  1.00 141.47 ? 84  VAL C N   1 
ATOM   4580  C CA  . VAL C 1 84  ? 165.473 -43.956  40.180  1.00 145.51 ? 84  VAL C CA  1 
ATOM   4581  C C   . VAL C 1 84  ? 166.064 -45.330  39.885  1.00 149.21 ? 84  VAL C C   1 
ATOM   4582  O O   . VAL C 1 84  ? 167.077 -45.714  40.472  1.00 151.30 ? 84  VAL C O   1 
ATOM   4583  C CB  . VAL C 1 84  ? 164.209 -44.062  41.076  1.00 145.04 ? 84  VAL C CB  1 
ATOM   4584  C CG1 . VAL C 1 84  ? 164.220 -45.316  41.947  1.00 143.78 ? 84  VAL C CG1 1 
ATOM   4585  C CG2 . VAL C 1 84  ? 164.073 -42.818  41.940  1.00 144.92 ? 84  VAL C CG2 1 
ATOM   4586  N N   . ARG C 1 85  ? 165.440 -46.052  38.957  1.00 153.01 ? 85  ARG C N   1 
ATOM   4587  C CA  . ARG C 1 85  ? 165.937 -47.358  38.548  1.00 157.62 ? 85  ARG C CA  1 
ATOM   4588  C C   . ARG C 1 85  ? 167.172 -47.267  37.645  1.00 162.60 ? 85  ARG C C   1 
ATOM   4589  O O   . ARG C 1 85  ? 167.981 -48.190  37.626  1.00 166.48 ? 85  ARG C O   1 
ATOM   4590  C CB  . ARG C 1 85  ? 164.835 -48.194  37.894  1.00 155.76 ? 85  ARG C CB  1 
ATOM   4591  C CG  . ARG C 1 85  ? 163.852 -48.809  38.883  1.00 153.25 ? 85  ARG C CG  1 
ATOM   4592  C CD  . ARG C 1 85  ? 163.427 -50.200  38.438  1.00 153.27 ? 85  ARG C CD  1 
ATOM   4593  N NE  . ARG C 1 85  ? 162.825 -50.200  37.104  1.00 154.14 ? 85  ARG C NE  1 
ATOM   4594  C CZ  . ARG C 1 85  ? 162.823 -51.243  36.276  1.00 154.23 ? 85  ARG C CZ  1 
ATOM   4595  N NH1 . ARG C 1 85  ? 163.396 -52.388  36.630  1.00 152.86 ? 85  ARG C NH1 1 
ATOM   4596  N NH2 . ARG C 1 85  ? 162.248 -51.138  35.085  1.00 155.04 ? 85  ARG C NH2 1 
ATOM   4597  N N   . MET C 1 86  ? 167.320 -46.163  36.909  1.00 166.25 ? 86  MET C N   1 
ATOM   4598  C CA  . MET C 1 86  ? 168.526 -45.941  36.099  1.00 169.81 ? 86  MET C CA  1 
ATOM   4599  C C   . MET C 1 86  ? 169.740 -45.603  36.958  1.00 174.03 ? 86  MET C C   1 
ATOM   4600  O O   . MET C 1 86  ? 170.869 -45.965  36.618  1.00 171.65 ? 86  MET C O   1 
ATOM   4601  C CB  . MET C 1 86  ? 168.314 -44.850  35.050  1.00 169.16 ? 86  MET C CB  1 
ATOM   4602  C CG  . MET C 1 86  ? 167.952 -45.385  33.676  1.00 169.80 ? 86  MET C CG  1 
ATOM   4603  S SD  . MET C 1 86  ? 168.841 -44.513  32.375  1.00 170.65 ? 86  MET C SD  1 
ATOM   4604  C CE  . MET C 1 86  ? 167.936 -45.038  30.926  1.00 169.72 ? 86  MET C CE  1 
ATOM   4605  N N   . LEU C 1 87  ? 169.495 -44.902  38.062  1.00 182.48 ? 87  LEU C N   1 
ATOM   4606  C CA  . LEU C 1 87  ? 170.537 -44.574  39.031  1.00 193.82 ? 87  LEU C CA  1 
ATOM   4607  C C   . LEU C 1 87  ? 170.764 -45.709  40.028  1.00 203.22 ? 87  LEU C C   1 
ATOM   4608  O O   . LEU C 1 87  ? 171.798 -45.757  40.699  1.00 202.14 ? 87  LEU C O   1 
ATOM   4609  C CB  . LEU C 1 87  ? 170.205 -43.272  39.771  1.00 193.82 ? 87  LEU C CB  1 
ATOM   4610  C CG  . LEU C 1 87  ? 170.699 -41.924  39.220  1.00 195.32 ? 87  LEU C CG  1 
ATOM   4611  C CD1 . LEU C 1 87  ? 172.223 -41.845  39.232  1.00 198.95 ? 87  LEU C CD1 1 
ATOM   4612  C CD2 . LEU C 1 87  ? 170.157 -41.614  37.828  1.00 194.08 ? 87  LEU C CD2 1 
ATOM   4613  N N   . GLU C 1 88  ? 169.790 -46.614  40.119  1.00 217.47 ? 88  GLU C N   1 
ATOM   4614  C CA  . GLU C 1 88  ? 169.913 -47.819  40.936  1.00 232.89 ? 88  GLU C CA  1 
ATOM   4615  C C   . GLU C 1 88  ? 170.968 -48.746  40.337  1.00 242.95 ? 88  GLU C C   1 
ATOM   4616  O O   . GLU C 1 88  ? 171.648 -49.477  41.062  1.00 240.72 ? 88  GLU C O   1 
ATOM   4617  C CB  . GLU C 1 88  ? 168.565 -48.543  41.039  1.00 236.05 ? 88  GLU C CB  1 
ATOM   4618  C CG  . GLU C 1 88  ? 168.477 -49.578  42.154  1.00 238.35 ? 88  GLU C CG  1 
ATOM   4619  C CD  . GLU C 1 88  ? 168.475 -48.957  43.539  1.00 239.36 ? 88  GLU C CD  1 
ATOM   4620  O OE1 . GLU C 1 88  ? 169.449 -49.176  44.290  1.00 238.14 ? 88  GLU C OE1 1 
ATOM   4621  O OE2 . GLU C 1 88  ? 167.501 -48.246  43.877  1.00 242.29 ? 88  GLU C OE2 1 
ATOM   4622  N N   . MET C 1 89  ? 171.102 -48.689  39.011  1.00 259.26 ? 89  MET C N   1 
ATOM   4623  C CA  . MET C 1 89  ? 172.080 -49.486  38.270  1.00 273.96 ? 89  MET C CA  1 
ATOM   4624  C C   . MET C 1 89  ? 173.496 -48.926  38.457  1.00 272.73 ? 89  MET C C   1 
ATOM   4625  O O   . MET C 1 89  ? 174.224 -48.707  37.485  1.00 273.11 ? 89  MET C O   1 
ATOM   4626  C CB  . MET C 1 89  ? 171.717 -49.540  36.775  1.00 284.59 ? 89  MET C CB  1 
ATOM   4627  C CG  . MET C 1 89  ? 170.253 -49.832  36.449  1.00 299.13 ? 89  MET C CG  1 
ATOM   4628  S SD  . MET C 1 89  ? 169.690 -51.516  36.791  1.00 314.55 ? 89  MET C SD  1 
ATOM   4629  C CE  . MET C 1 89  ? 167.938 -51.391  36.427  1.00 305.12 ? 89  MET C CE  1 
ATOM   4630  N N   . PHE C 1 90  ? 173.870 -48.697  39.715  1.00 272.36 ? 90  PHE C N   1 
ATOM   4631  C CA  . PHE C 1 90  ? 175.184 -48.170  40.079  1.00 273.79 ? 90  PHE C CA  1 
ATOM   4632  C C   . PHE C 1 90  ? 175.856 -49.053  41.128  1.00 267.33 ? 90  PHE C C   1 
ATOM   4633  O O   . PHE C 1 90  ? 175.231 -49.449  42.115  1.00 257.92 ? 90  PHE C O   1 
ATOM   4634  C CB  . PHE C 1 90  ? 175.061 -46.735  40.602  1.00 281.82 ? 90  PHE C CB  1 
ATOM   4635  C CG  . PHE C 1 90  ? 175.281 -45.677  39.553  1.00 291.84 ? 90  PHE C CG  1 
ATOM   4636  C CD1 . PHE C 1 90  ? 174.309 -45.407  38.594  1.00 295.83 ? 90  PHE C CD1 1 
ATOM   4637  C CD2 . PHE C 1 90  ? 176.460 -44.937  39.535  1.00 295.63 ? 90  PHE C CD2 1 
ATOM   4638  C CE1 . PHE C 1 90  ? 174.515 -44.427  37.631  1.00 299.54 ? 90  PHE C CE1 1 
ATOM   4639  C CE2 . PHE C 1 90  ? 176.671 -43.955  38.578  1.00 300.56 ? 90  PHE C CE2 1 
ATOM   4640  C CZ  . PHE C 1 90  ? 175.697 -43.700  37.624  1.00 294.99 ? 90  PHE C CZ  1 
ATOM   4641  N N   . MET D 2 1   ? 157.792 -10.925  50.659  1.00 178.14 ? 1   MET D N   1 
ATOM   4642  C CA  . MET D 2 1   ? 156.483 -10.574  51.294  1.00 175.78 ? 1   MET D CA  1 
ATOM   4643  C C   . MET D 2 1   ? 155.432 -11.693  51.200  1.00 176.73 ? 1   MET D C   1 
ATOM   4644  O O   . MET D 2 1   ? 154.252 -11.476  51.501  1.00 173.98 ? 1   MET D O   1 
ATOM   4645  C CB  . MET D 2 1   ? 155.934 -9.244   50.736  1.00 172.81 ? 1   MET D CB  1 
ATOM   4646  C CG  . MET D 2 1   ? 156.009 -9.065   49.219  1.00 169.12 ? 1   MET D CG  1 
ATOM   4647  S SD  . MET D 2 1   ? 157.479 -8.171   48.649  1.00 163.96 ? 1   MET D SD  1 
ATOM   4648  C CE  . MET D 2 1   ? 157.047 -7.815   46.946  1.00 161.74 ? 1   MET D CE  1 
ATOM   4649  N N   . ASP D 2 2   ? 155.876 -12.888  50.800  1.00 179.28 ? 2   ASP D N   1 
ATOM   4650  C CA  . ASP D 2 2   ? 155.006 -14.062  50.622  1.00 178.64 ? 2   ASP D CA  1 
ATOM   4651  C C   . ASP D 2 2   ? 155.761 -15.348  51.004  1.00 179.72 ? 2   ASP D C   1 
ATOM   4652  O O   . ASP D 2 2   ? 156.995 -15.349  51.065  1.00 185.16 ? 2   ASP D O   1 
ATOM   4653  C CB  . ASP D 2 2   ? 154.507 -14.122  49.167  1.00 174.03 ? 2   ASP D CB  1 
ATOM   4654  C CG  . ASP D 2 2   ? 153.378 -15.129  48.958  1.00 168.78 ? 2   ASP D CG  1 
ATOM   4655  O OD1 . ASP D 2 2   ? 152.476 -15.238  49.818  1.00 165.87 ? 2   ASP D OD1 1 
ATOM   4656  O OD2 . ASP D 2 2   ? 153.392 -15.808  47.911  1.00 165.15 ? 2   ASP D OD2 1 
ATOM   4657  N N   . LEU D 2 3   ? 155.025 -16.430  51.270  1.00 173.41 ? 3   LEU D N   1 
ATOM   4658  C CA  . LEU D 2 3   ? 155.635 -17.719  51.640  1.00 163.77 ? 3   LEU D CA  1 
ATOM   4659  C C   . LEU D 2 3   ? 155.446 -18.824  50.591  1.00 158.45 ? 3   LEU D C   1 
ATOM   4660  O O   . LEU D 2 3   ? 155.950 -19.940  50.754  1.00 156.74 ? 3   LEU D O   1 
ATOM   4661  C CB  . LEU D 2 3   ? 155.141 -18.192  53.016  1.00 160.84 ? 3   LEU D CB  1 
ATOM   4662  C CG  . LEU D 2 3   ? 155.661 -17.471  54.268  1.00 158.49 ? 3   LEU D CG  1 
ATOM   4663  C CD1 . LEU D 2 3   ? 154.898 -17.933  55.500  1.00 157.49 ? 3   LEU D CD1 1 
ATOM   4664  C CD2 . LEU D 2 3   ? 157.159 -17.665  54.470  1.00 155.41 ? 3   LEU D CD2 1 
ATOM   4665  N N   . ILE D 2 4   ? 154.716 -18.507  49.524  1.00 152.59 ? 4   ILE D N   1 
ATOM   4666  C CA  . ILE D 2 4   ? 154.573 -19.408  48.384  1.00 147.11 ? 4   ILE D CA  1 
ATOM   4667  C C   . ILE D 2 4   ? 155.784 -19.235  47.459  1.00 147.40 ? 4   ILE D C   1 
ATOM   4668  O O   . ILE D 2 4   ? 156.209 -20.181  46.788  1.00 147.79 ? 4   ILE D O   1 
ATOM   4669  C CB  . ILE D 2 4   ? 153.255 -19.148  47.621  1.00 143.20 ? 4   ILE D CB  1 
ATOM   4670  C CG1 . ILE D 2 4   ? 152.112 -18.867  48.606  1.00 138.62 ? 4   ILE D CG1 1 
ATOM   4671  C CG2 . ILE D 2 4   ? 152.912 -20.333  46.728  1.00 144.03 ? 4   ILE D CG2 1 
ATOM   4672  C CD1 . ILE D 2 4   ? 151.042 -17.936  48.073  1.00 134.94 ? 4   ILE D CD1 1 
ATOM   4673  N N   . GLN D 2 5   ? 156.332 -18.019  47.447  1.00 145.83 ? 5   GLN D N   1 
ATOM   4674  C CA  . GLN D 2 5   ? 157.555 -17.684  46.711  1.00 142.58 ? 5   GLN D CA  1 
ATOM   4675  C C   . GLN D 2 5   ? 158.788 -18.346  47.326  1.00 141.85 ? 5   GLN D C   1 
ATOM   4676  O O   . GLN D 2 5   ? 159.676 -18.808  46.604  1.00 142.88 ? 5   GLN D O   1 
ATOM   4677  C CB  . GLN D 2 5   ? 157.759 -16.167  46.699  1.00 140.31 ? 5   GLN D CB  1 
ATOM   4678  C CG  . GLN D 2 5   ? 156.782 -15.389  45.832  1.00 138.05 ? 5   GLN D CG  1 
ATOM   4679  C CD  . GLN D 2 5   ? 157.376 -14.952  44.504  1.00 137.32 ? 5   GLN D CD  1 
ATOM   4680  O OE1 . GLN D 2 5   ? 156.933 -13.967  43.917  1.00 138.31 ? 5   GLN D OE1 1 
ATOM   4681  N NE2 . GLN D 2 5   ? 158.384 -15.678  44.028  1.00 136.13 ? 5   GLN D NE2 1 
ATOM   4682  N N   . ALA D 2 6   ? 158.828 -18.381  48.660  1.00 139.29 ? 6   ALA D N   1 
ATOM   4683  C CA  . ALA D 2 6   ? 159.952 -18.934  49.428  1.00 134.07 ? 6   ALA D CA  1 
ATOM   4684  C C   . ALA D 2 6   ? 160.196 -20.412  49.140  1.00 129.56 ? 6   ALA D C   1 
ATOM   4685  O O   . ALA D 2 6   ? 161.334 -20.886  49.210  1.00 128.00 ? 6   ALA D O   1 
ATOM   4686  C CB  . ALA D 2 6   ? 159.734 -18.714  50.920  1.00 134.12 ? 6   ALA D CB  1 
ATOM   4687  N N   . ALA D 2 7   ? 159.120 -21.130  48.825  1.00 124.32 ? 7   ALA D N   1 
ATOM   4688  C CA  . ALA D 2 7   ? 159.203 -22.529  48.430  1.00 119.06 ? 7   ALA D CA  1 
ATOM   4689  C C   . ALA D 2 7   ? 159.935 -22.658  47.104  1.00 116.63 ? 7   ALA D C   1 
ATOM   4690  O O   . ALA D 2 7   ? 160.861 -23.456  46.983  1.00 113.83 ? 7   ALA D O   1 
ATOM   4691  C CB  . ALA D 2 7   ? 157.814 -23.134  48.333  1.00 117.97 ? 7   ALA D CB  1 
ATOM   4692  N N   . TYR D 2 8   ? 159.527 -21.845  46.129  1.00 116.55 ? 8   TYR D N   1 
ATOM   4693  C CA  . TYR D 2 8   ? 160.103 -21.857  44.784  1.00 118.26 ? 8   TYR D CA  1 
ATOM   4694  C C   . TYR D 2 8   ? 161.603 -21.570  44.736  1.00 120.75 ? 8   TYR D C   1 
ATOM   4695  O O   . TYR D 2 8   ? 162.308 -22.100  43.874  1.00 122.10 ? 8   TYR D O   1 
ATOM   4696  C CB  . TYR D 2 8   ? 159.366 -20.879  43.869  1.00 117.55 ? 8   TYR D CB  1 
ATOM   4697  C CG  . TYR D 2 8   ? 157.932 -21.248  43.568  1.00 117.38 ? 8   TYR D CG  1 
ATOM   4698  C CD1 . TYR D 2 8   ? 157.563 -22.569  43.305  1.00 117.22 ? 8   TYR D CD1 1 
ATOM   4699  C CD2 . TYR D 2 8   ? 156.945 -20.268  43.518  1.00 117.89 ? 8   TYR D CD2 1 
ATOM   4700  C CE1 . TYR D 2 8   ? 156.248 -22.902  43.018  1.00 117.45 ? 8   TYR D CE1 1 
ATOM   4701  C CE2 . TYR D 2 8   ? 155.629 -20.590  43.231  1.00 118.31 ? 8   TYR D CE2 1 
ATOM   4702  C CZ  . TYR D 2 8   ? 155.286 -21.905  42.982  1.00 117.80 ? 8   TYR D CZ  1 
ATOM   4703  O OH  . TYR D 2 8   ? 153.979 -22.213  42.695  1.00 117.46 ? 8   TYR D OH  1 
ATOM   4704  N N   . PHE D 2 9   ? 162.079 -20.722  45.648  1.00 122.72 ? 9   PHE D N   1 
ATOM   4705  C CA  . PHE D 2 9   ? 163.505 -20.384  45.729  1.00 122.98 ? 9   PHE D CA  1 
ATOM   4706  C C   . PHE D 2 9   ? 164.328 -21.559  46.243  1.00 120.59 ? 9   PHE D C   1 
ATOM   4707  O O   . PHE D 2 9   ? 165.430 -21.812  45.755  1.00 122.45 ? 9   PHE D O   1 
ATOM   4708  C CB  . PHE D 2 9   ? 163.739 -19.147  46.603  1.00 124.10 ? 9   PHE D CB  1 
ATOM   4709  C CG  . PHE D 2 9   ? 165.194 -18.791  46.778  1.00 123.30 ? 9   PHE D CG  1 
ATOM   4710  C CD1 . PHE D 2 9   ? 165.892 -18.133  45.767  1.00 122.97 ? 9   PHE D CD1 1 
ATOM   4711  C CD2 . PHE D 2 9   ? 165.867 -19.115  47.953  1.00 121.96 ? 9   PHE D CD2 1 
ATOM   4712  C CE1 . PHE D 2 9   ? 167.230 -17.809  45.926  1.00 121.25 ? 9   PHE D CE1 1 
ATOM   4713  C CE2 . PHE D 2 9   ? 167.203 -18.789  48.117  1.00 120.46 ? 9   PHE D CE2 1 
ATOM   4714  C CZ  . PHE D 2 9   ? 167.882 -18.136  47.103  1.00 120.27 ? 9   PHE D CZ  1 
ATOM   4715  N N   . VAL D 2 10  ? 163.792 -22.262  47.237  1.00 115.34 ? 10  VAL D N   1 
ATOM   4716  C CA  . VAL D 2 10  ? 164.401 -23.495  47.721  1.00 110.64 ? 10  VAL D CA  1 
ATOM   4717  C C   . VAL D 2 10  ? 164.190 -24.593  46.669  1.00 108.64 ? 10  VAL D C   1 
ATOM   4718  O O   . VAL D 2 10  ? 165.037 -25.470  46.499  1.00 110.21 ? 10  VAL D O   1 
ATOM   4719  C CB  . VAL D 2 10  ? 163.843 -23.906  49.105  1.00 109.17 ? 10  VAL D CB  1 
ATOM   4720  C CG1 . VAL D 2 10  ? 164.603 -25.100  49.665  1.00 109.10 ? 10  VAL D CG1 1 
ATOM   4721  C CG2 . VAL D 2 10  ? 163.936 -22.741  50.083  1.00 107.53 ? 10  VAL D CG2 1 
ATOM   4722  N N   . VAL D 2 11  ? 163.069 -24.510  45.950  1.00 104.12 ? 11  VAL D N   1 
ATOM   4723  C CA  . VAL D 2 11  ? 162.737 -25.420  44.846  1.00 99.94  ? 11  VAL D CA  1 
ATOM   4724  C C   . VAL D 2 11  ? 163.767 -25.382  43.705  1.00 98.48  ? 11  VAL D C   1 
ATOM   4725  O O   . VAL D 2 11  ? 164.201 -26.432  43.221  1.00 96.06  ? 11  VAL D O   1 
ATOM   4726  C CB  . VAL D 2 11  ? 161.297 -25.149  44.335  1.00 98.95  ? 11  VAL D CB  1 
ATOM   4727  C CG1 . VAL D 2 11  ? 161.138 -25.439  42.851  1.00 98.04  ? 11  VAL D CG1 1 
ATOM   4728  C CG2 . VAL D 2 11  ? 160.284 -25.935  45.152  1.00 98.53  ? 11  VAL D CG2 1 
ATOM   4729  N N   . ALA D 2 12  ? 164.162 -24.175  43.300  1.00 98.57  ? 12  ALA D N   1 
ATOM   4730  C CA  . ALA D 2 12  ? 165.112 -23.983  42.200  1.00 99.01  ? 12  ALA D CA  1 
ATOM   4731  C C   . ALA D 2 12  ? 166.546 -24.387  42.560  1.00 100.07 ? 12  ALA D C   1 
ATOM   4732  O O   . ALA D 2 12  ? 167.238 -24.987  41.736  1.00 99.18  ? 12  ALA D O   1 
ATOM   4733  C CB  . ALA D 2 12  ? 165.067 -22.547  41.698  1.00 98.99  ? 12  ALA D CB  1 
ATOM   4734  N N   . ILE D 2 13  ? 166.983 -24.052  43.778  1.00 102.11 ? 13  ILE D N   1 
ATOM   4735  C CA  . ILE D 2 13  ? 168.316 -24.440  44.277  1.00 102.87 ? 13  ILE D CA  1 
ATOM   4736  C C   . ILE D 2 13  ? 168.473 -25.964  44.235  1.00 102.06 ? 13  ILE D C   1 
ATOM   4737  O O   . ILE D 2 13  ? 169.498 -26.475  43.783  1.00 103.48 ? 13  ILE D O   1 
ATOM   4738  C CB  . ILE D 2 13  ? 168.602 -23.906  45.710  1.00 103.09 ? 13  ILE D CB  1 
ATOM   4739  C CG1 . ILE D 2 13  ? 168.590 -22.371  45.740  1.00 102.16 ? 13  ILE D CG1 1 
ATOM   4740  C CG2 . ILE D 2 13  ? 169.945 -24.415  46.229  1.00 103.36 ? 13  ILE D CG2 1 
ATOM   4741  C CD1 . ILE D 2 13  ? 168.643 -21.772  47.132  1.00 100.35 ? 13  ILE D CD1 1 
ATOM   4742  N N   . LEU D 2 14  ? 167.439 -26.676  44.685  1.00 99.33  ? 14  LEU D N   1 
ATOM   4743  C CA  . LEU D 2 14  ? 167.417 -28.140  44.668  1.00 95.49  ? 14  LEU D CA  1 
ATOM   4744  C C   . LEU D 2 14  ? 167.484 -28.704  43.253  1.00 90.95  ? 14  LEU D C   1 
ATOM   4745  O O   . LEU D 2 14  ? 168.049 -29.778  43.033  1.00 89.34  ? 14  LEU D O   1 
ATOM   4746  C CB  . LEU D 2 14  ? 166.167 -28.668  45.376  1.00 98.22  ? 14  LEU D CB  1 
ATOM   4747  C CG  . LEU D 2 14  ? 166.064 -28.463  46.892  1.00 100.66 ? 14  LEU D CG  1 
ATOM   4748  C CD1 . LEU D 2 14  ? 164.651 -28.760  47.373  1.00 102.21 ? 14  LEU D CD1 1 
ATOM   4749  C CD2 . LEU D 2 14  ? 167.083 -29.300  47.653  1.00 101.27 ? 14  LEU D CD2 1 
ATOM   4750  N N   . PHE D 2 15  ? 166.898 -27.975  42.305  1.00 86.65  ? 15  PHE D N   1 
ATOM   4751  C CA  . PHE D 2 15  ? 166.971 -28.336  40.894  1.00 83.92  ? 15  PHE D CA  1 
ATOM   4752  C C   . PHE D 2 15  ? 168.387 -28.170  40.363  1.00 83.48  ? 15  PHE D C   1 
ATOM   4753  O O   . PHE D 2 15  ? 168.923 -29.066  39.710  1.00 82.57  ? 15  PHE D O   1 
ATOM   4754  C CB  . PHE D 2 15  ? 166.007 -27.486  40.065  1.00 82.36  ? 15  PHE D CB  1 
ATOM   4755  C CG  . PHE D 2 15  ? 164.560 -27.737  40.366  1.00 81.25  ? 15  PHE D CG  1 
ATOM   4756  C CD1 . PHE D 2 15  ? 164.137 -28.976  40.842  1.00 80.95  ? 15  PHE D CD1 1 
ATOM   4757  C CD2 . PHE D 2 15  ? 163.614 -26.746  40.145  1.00 80.56  ? 15  PHE D CD2 1 
ATOM   4758  C CE1 . PHE D 2 15  ? 162.803 -29.213  41.113  1.00 80.91  ? 15  PHE D CE1 1 
ATOM   4759  C CE2 . PHE D 2 15  ? 162.277 -26.980  40.407  1.00 80.42  ? 15  PHE D CE2 1 
ATOM   4760  C CZ  . PHE D 2 15  ? 161.873 -28.214  40.895  1.00 80.94  ? 15  PHE D CZ  1 
ATOM   4761  N N   . ILE D 2 16  ? 168.980 -27.017  40.662  1.00 83.73  ? 16  ILE D N   1 
ATOM   4762  C CA  . ILE D 2 16  ? 170.324 -26.671  40.206  1.00 84.13  ? 16  ILE D CA  1 
ATOM   4763  C C   . ILE D 2 16  ? 171.402 -27.559  40.845  1.00 83.68  ? 16  ILE D C   1 
ATOM   4764  O O   . ILE D 2 16  ? 172.222 -28.144  40.134  1.00 83.85  ? 16  ILE D O   1 
ATOM   4765  C CB  . ILE D 2 16  ? 170.622 -25.171  40.443  1.00 84.68  ? 16  ILE D CB  1 
ATOM   4766  C CG1 . ILE D 2 16  ? 169.697 -24.303  39.578  1.00 84.61  ? 16  ILE D CG1 1 
ATOM   4767  C CG2 . ILE D 2 16  ? 172.084 -24.855  40.155  1.00 85.11  ? 16  ILE D CG2 1 
ATOM   4768  C CD1 . ILE D 2 16  ? 169.409 -22.933  40.154  1.00 84.44  ? 16  ILE D CD1 1 
ATOM   4769  N N   . VAL D 2 17  ? 171.394 -27.657  42.177  1.00 82.74  ? 17  VAL D N   1 
ATOM   4770  C CA  . VAL D 2 17  ? 172.357 -28.495  42.912  1.00 80.88  ? 17  VAL D CA  1 
ATOM   4771  C C   . VAL D 2 17  ? 172.208 -29.963  42.501  1.00 78.77  ? 17  VAL D C   1 
ATOM   4772  O O   . VAL D 2 17  ? 173.205 -30.649  42.257  1.00 78.73  ? 17  VAL D O   1 
ATOM   4773  C CB  . VAL D 2 17  ? 172.233 -28.334  44.452  1.00 81.15  ? 17  VAL D CB  1 
ATOM   4774  C CG1 . VAL D 2 17  ? 173.204 -29.252  45.182  1.00 81.36  ? 17  VAL D CG1 1 
ATOM   4775  C CG2 . VAL D 2 17  ? 172.492 -26.895  44.868  1.00 80.98  ? 17  VAL D CG2 1 
ATOM   4776  N N   . GLY D 2 18  ? 170.964 -30.431  42.416  1.00 76.20  ? 18  GLY D N   1 
ATOM   4777  C CA  . GLY D 2 18  ? 170.677 -31.757  41.881  1.00 73.47  ? 18  GLY D CA  1 
ATOM   4778  C C   . GLY D 2 18  ? 171.368 -31.914  40.544  1.00 72.34  ? 18  GLY D C   1 
ATOM   4779  O O   . GLY D 2 18  ? 172.198 -32.805  40.371  1.00 70.86  ? 18  GLY D O   1 
ATOM   4780  N N   . LEU D 2 19  ? 171.043 -31.010  39.622  1.00 73.24  ? 19  LEU D N   1 
ATOM   4781  C CA  . LEU D 2 19  ? 171.644 -30.964  38.294  1.00 75.78  ? 19  LEU D CA  1 
ATOM   4782  C C   . LEU D 2 19  ? 173.165 -31.035  38.380  1.00 78.54  ? 19  LEU D C   1 
ATOM   4783  O O   . LEU D 2 19  ? 173.786 -31.900  37.762  1.00 78.16  ? 19  LEU D O   1 
ATOM   4784  C CB  . LEU D 2 19  ? 171.232 -29.674  37.576  1.00 75.70  ? 19  LEU D CB  1 
ATOM   4785  C CG  . LEU D 2 19  ? 170.691 -29.707  36.145  1.00 76.33  ? 19  LEU D CG  1 
ATOM   4786  C CD1 . LEU D 2 19  ? 171.134 -28.457  35.401  1.00 76.62  ? 19  LEU D CD1 1 
ATOM   4787  C CD2 . LEU D 2 19  ? 171.127 -30.953  35.390  1.00 77.17  ? 19  LEU D CD2 1 
ATOM   4788  N N   . LYS D 2 20  ? 173.750 -30.128  39.162  1.00 83.74  ? 20  LYS D N   1 
ATOM   4789  C CA  . LYS D 2 20  ? 175.195 -30.087  39.395  1.00 90.23  ? 20  LYS D CA  1 
ATOM   4790  C C   . LYS D 2 20  ? 175.703 -31.449  39.854  1.00 93.41  ? 20  LYS D C   1 
ATOM   4791  O O   . LYS D 2 20  ? 176.689 -31.962  39.323  1.00 93.75  ? 20  LYS D O   1 
ATOM   4792  C CB  . LYS D 2 20  ? 175.541 -29.002  40.430  1.00 92.22  ? 20  LYS D CB  1 
ATOM   4793  C CG  . LYS D 2 20  ? 177.031 -28.765  40.683  1.00 94.02  ? 20  LYS D CG  1 
ATOM   4794  C CD  . LYS D 2 20  ? 177.572 -29.613  41.832  1.00 94.59  ? 20  LYS D CD  1 
ATOM   4795  C CE  . LYS D 2 20  ? 178.990 -29.217  42.226  1.00 94.40  ? 20  LYS D CE  1 
ATOM   4796  N NZ  . LYS D 2 20  ? 179.016 -28.018  43.116  1.00 93.94  ? 20  LYS D NZ  1 
ATOM   4797  N N   . ARG D 2 21  ? 175.016 -32.029  40.834  1.00 98.03  ? 21  ARG D N   1 
ATOM   4798  C CA  . ARG D 2 21  ? 175.419 -33.307  41.403  1.00 104.17 ? 21  ARG D CA  1 
ATOM   4799  C C   . ARG D 2 21  ? 175.074 -34.471  40.495  1.00 109.50 ? 21  ARG D C   1 
ATOM   4800  O O   . ARG D 2 21  ? 175.619 -35.558  40.644  1.00 106.32 ? 21  ARG D O   1 
ATOM   4801  C CB  . ARG D 2 21  ? 174.808 -33.500  42.789  1.00 106.02 ? 21  ARG D CB  1 
ATOM   4802  C CG  . ARG D 2 21  ? 175.533 -32.702  43.858  1.00 111.21 ? 21  ARG D CG  1 
ATOM   4803  C CD  . ARG D 2 21  ? 175.064 -33.051  45.260  1.00 116.09 ? 21  ARG D CD  1 
ATOM   4804  N NE  . ARG D 2 21  ? 176.010 -32.574  46.271  1.00 119.41 ? 21  ARG D NE  1 
ATOM   4805  C CZ  . ARG D 2 21  ? 176.778 -33.357  47.028  1.00 120.47 ? 21  ARG D CZ  1 
ATOM   4806  N NH1 . ARG D 2 21  ? 176.717 -34.680  46.917  1.00 123.24 ? 21  ARG D NH1 1 
ATOM   4807  N NH2 . ARG D 2 21  ? 177.606 -32.810  47.911  1.00 119.29 ? 21  ARG D NH2 1 
ATOM   4808  N N   . MET D 2 22  ? 174.175 -34.235  39.550  1.00 123.30 ? 22  MET D N   1 
ATOM   4809  C CA  . MET D 2 22  ? 173.826 -35.245  38.567  1.00 142.03 ? 22  MET D CA  1 
ATOM   4810  C C   . MET D 2 22  ? 174.827 -35.292  37.424  1.00 148.99 ? 22  MET D C   1 
ATOM   4811  O O   . MET D 2 22  ? 175.038 -36.345  36.823  1.00 146.56 ? 22  MET D O   1 
ATOM   4812  C CB  . MET D 2 22  ? 172.436 -34.985  38.012  1.00 159.26 ? 22  MET D CB  1 
ATOM   4813  C CG  . MET D 2 22  ? 171.320 -35.497  38.899  1.00 180.16 ? 22  MET D CG  1 
ATOM   4814  S SD  . MET D 2 22  ? 169.777 -35.644  37.984  1.00 215.00 ? 22  MET D SD  1 
ATOM   4815  C CE  . MET D 2 22  ? 170.133 -37.036  36.909  1.00 213.60 ? 22  MET D CE  1 
ATOM   4816  N N   . ALA D 2 23  ? 175.434 -34.144  37.132  1.00 161.61 ? 23  ALA D N   1 
ATOM   4817  C CA  . ALA D 2 23  ? 176.382 -34.008  36.027  1.00 177.25 ? 23  ALA D CA  1 
ATOM   4818  C C   . ALA D 2 23  ? 177.621 -34.889  36.199  1.00 189.60 ? 23  ALA D C   1 
ATOM   4819  O O   . ALA D 2 23  ? 178.154 -35.418  35.222  1.00 189.90 ? 23  ALA D O   1 
ATOM   4820  C CB  . ALA D 2 23  ? 176.786 -32.553  35.864  1.00 176.76 ? 23  ALA D CB  1 
ATOM   4821  N N   . HIS D 2 24  ? 178.061 -35.041  37.446  1.00 206.12 ? 24  HIS D N   1 
ATOM   4822  C CA  . HIS D 2 24  ? 179.264 -35.808  37.779  1.00 218.29 ? 24  HIS D CA  1 
ATOM   4823  C C   . HIS D 2 24  ? 178.896 -37.183  38.378  1.00 221.58 ? 24  HIS D C   1 
ATOM   4824  O O   . HIS D 2 24  ? 177.897 -37.291  39.096  1.00 228.44 ? 24  HIS D O   1 
ATOM   4825  C CB  . HIS D 2 24  ? 180.159 -34.998  38.731  1.00 219.00 ? 24  HIS D CB  1 
ATOM   4826  C CG  . HIS D 2 24  ? 180.303 -33.553  38.350  1.00 213.15 ? 24  HIS D CG  1 
ATOM   4827  N ND1 . HIS D 2 24  ? 179.736 -32.532  39.082  1.00 210.78 ? 24  HIS D ND1 1 
ATOM   4828  C CD2 . HIS D 2 24  ? 180.943 -32.960  37.313  1.00 208.32 ? 24  HIS D CD2 1 
ATOM   4829  C CE1 . HIS D 2 24  ? 180.023 -31.373  38.516  1.00 205.75 ? 24  HIS D CE1 1 
ATOM   4830  N NE2 . HIS D 2 24  ? 180.753 -31.605  37.440  1.00 203.25 ? 24  HIS D NE2 1 
ATOM   4831  N N   . PRO D 2 25  ? 179.706 -38.232  38.088  1.00 216.51 ? 25  PRO D N   1 
ATOM   4832  C CA  . PRO D 2 25  ? 179.325 -39.633  38.356  1.00 204.32 ? 25  PRO D CA  1 
ATOM   4833  C C   . PRO D 2 25  ? 179.310 -40.083  39.826  1.00 188.23 ? 25  PRO D C   1 
ATOM   4834  O O   . PRO D 2 25  ? 178.430 -40.856  40.217  1.00 185.16 ? 25  PRO D O   1 
ATOM   4835  C CB  . PRO D 2 25  ? 180.368 -40.433  37.569  1.00 209.12 ? 25  PRO D CB  1 
ATOM   4836  C CG  . PRO D 2 25  ? 181.568 -39.551  37.532  1.00 212.35 ? 25  PRO D CG  1 
ATOM   4837  C CD  . PRO D 2 25  ? 181.050 -38.140  37.480  1.00 216.47 ? 25  PRO D CD  1 
ATOM   4838  N N   . THR D 2 26  ? 180.273 -39.616  40.618  1.00 170.56 ? 26  THR D N   1 
ATOM   4839  C CA  . THR D 2 26  ? 180.392 -40.020  42.022  1.00 155.67 ? 26  THR D CA  1 
ATOM   4840  C C   . THR D 2 26  ? 179.182 -39.592  42.866  1.00 150.94 ? 26  THR D C   1 
ATOM   4841  O O   . THR D 2 26  ? 178.757 -40.321  43.768  1.00 147.28 ? 26  THR D O   1 
ATOM   4842  C CB  . THR D 2 26  ? 181.700 -39.494  42.658  1.00 151.69 ? 26  THR D CB  1 
ATOM   4843  O OG1 . THR D 2 26  ? 181.845 -38.095  42.387  1.00 149.05 ? 26  THR D OG1 1 
ATOM   4844  C CG2 . THR D 2 26  ? 182.909 -40.233  42.098  1.00 148.55 ? 26  THR D CG2 1 
ATOM   4845  N N   . THR D 2 27  ? 178.626 -38.424  42.546  1.00 147.11 ? 27  THR D N   1 
ATOM   4846  C CA  . THR D 2 27  ? 177.522 -37.826  43.310  1.00 143.09 ? 27  THR D CA  1 
ATOM   4847  C C   . THR D 2 27  ? 176.163 -37.858  42.599  1.00 138.57 ? 27  THR D C   1 
ATOM   4848  O O   . THR D 2 27  ? 175.150 -37.433  43.167  1.00 135.91 ? 27  THR D O   1 
ATOM   4849  C CB  . THR D 2 27  ? 177.847 -36.374  43.746  1.00 144.59 ? 27  THR D CB  1 
ATOM   4850  O OG1 . THR D 2 27  ? 176.691 -35.782  44.352  1.00 144.73 ? 27  THR D OG1 1 
ATOM   4851  C CG2 . THR D 2 27  ? 178.284 -35.518  42.557  1.00 144.57 ? 27  THR D CG2 1 
ATOM   4852  N N   . ALA D 2 28  ? 176.144 -38.357  41.365  1.00 136.18 ? 28  ALA D N   1 
ATOM   4853  C CA  . ALA D 2 28  ? 174.903 -38.504  40.603  1.00 135.14 ? 28  ALA D CA  1 
ATOM   4854  C C   . ALA D 2 28  ? 173.867 -39.315  41.377  1.00 135.22 ? 28  ALA D C   1 
ATOM   4855  O O   . ALA D 2 28  ? 172.663 -39.105  41.222  1.00 136.31 ? 28  ALA D O   1 
ATOM   4856  C CB  . ALA D 2 28  ? 175.179 -39.142  39.250  1.00 135.75 ? 28  ALA D CB  1 
ATOM   4857  N N   . LYS D 2 29  ? 174.354 -40.226  42.220  1.00 134.46 ? 29  LYS D N   1 
ATOM   4858  C CA  . LYS D 2 29  ? 173.514 -41.098  43.044  1.00 134.03 ? 29  LYS D CA  1 
ATOM   4859  C C   . LYS D 2 29  ? 172.693 -40.311  44.057  1.00 133.68 ? 29  LYS D C   1 
ATOM   4860  O O   . LYS D 2 29  ? 171.523 -40.616  44.290  1.00 134.23 ? 29  LYS D O   1 
ATOM   4861  C CB  . LYS D 2 29  ? 174.372 -42.128  43.782  1.00 133.54 ? 29  LYS D CB  1 
ATOM   4862  C CG  . LYS D 2 29  ? 175.501 -42.712  42.952  1.00 133.35 ? 29  LYS D CG  1 
ATOM   4863  C CD  . LYS D 2 29  ? 176.056 -43.973  43.588  1.00 134.13 ? 29  LYS D CD  1 
ATOM   4864  C CE  . LYS D 2 29  ? 177.344 -44.391  42.898  1.00 134.47 ? 29  LYS D CE  1 
ATOM   4865  N NZ  . LYS D 2 29  ? 177.637 -45.838  43.093  1.00 136.11 ? 29  LYS D NZ  1 
ATOM   4866  N N   . SER D 2 30  ? 173.320 -39.309  44.669  1.00 132.86 ? 30  SER D N   1 
ATOM   4867  C CA  . SER D 2 30  ? 172.615 -38.421  45.581  1.00 132.73 ? 30  SER D CA  1 
ATOM   4868  C C   . SER D 2 30  ? 171.935 -37.294  44.797  1.00 136.33 ? 30  SER D C   1 
ATOM   4869  O O   . SER D 2 30  ? 171.244 -36.462  45.380  1.00 137.36 ? 30  SER D O   1 
ATOM   4870  C CB  . SER D 2 30  ? 173.566 -37.866  46.647  1.00 128.99 ? 30  SER D CB  1 
ATOM   4871  O OG  . SER D 2 30  ? 172.861 -37.514  47.830  1.00 123.55 ? 30  SER D OG  1 
ATOM   4872  N N   . GLY D 2 31  ? 172.128 -37.288  43.476  1.00 139.80 ? 31  GLY D N   1 
ATOM   4873  C CA  . GLY D 2 31  ? 171.521 -36.294  42.587  1.00 144.55 ? 31  GLY D CA  1 
ATOM   4874  C C   . GLY D 2 31  ? 170.000 -36.282  42.587  1.00 149.32 ? 31  GLY D C   1 
ATOM   4875  O O   . GLY D 2 31  ? 169.392 -35.240  42.848  1.00 150.24 ? 31  GLY D O   1 
ATOM   4876  N N   . ILE D 2 32  ? 169.386 -37.435  42.302  1.00 152.81 ? 32  ILE D N   1 
ATOM   4877  C CA  . ILE D 2 32  ? 167.914 -37.555  42.260  1.00 155.04 ? 32  ILE D CA  1 
ATOM   4878  C C   . ILE D 2 32  ? 167.282 -37.432  43.652  1.00 160.45 ? 32  ILE D C   1 
ATOM   4879  O O   . ILE D 2 32  ? 166.062 -37.287  43.781  1.00 159.11 ? 32  ILE D O   1 
ATOM   4880  C CB  . ILE D 2 32  ? 167.409 -38.843  41.534  1.00 151.55 ? 32  ILE D CB  1 
ATOM   4881  C CG1 . ILE D 2 32  ? 167.512 -40.095  42.427  1.00 149.42 ? 32  ILE D CG1 1 
ATOM   4882  C CG2 . ILE D 2 32  ? 168.082 -39.022  40.175  1.00 151.57 ? 32  ILE D CG2 1 
ATOM   4883  C CD1 . ILE D 2 32  ? 168.857 -40.794  42.432  1.00 148.78 ? 32  ILE D CD1 1 
ATOM   4884  N N   . VAL D 2 33  ? 168.130 -37.496  44.681  1.00 169.05 ? 33  VAL D N   1 
ATOM   4885  C CA  . VAL D 2 33  ? 167.749 -37.226  46.072  1.00 177.01 ? 33  VAL D CA  1 
ATOM   4886  C C   . VAL D 2 33  ? 167.392 -35.743  46.233  1.00 182.83 ? 33  VAL D C   1 
ATOM   4887  O O   . VAL D 2 33  ? 166.589 -35.377  47.093  1.00 184.71 ? 33  VAL D O   1 
ATOM   4888  C CB  . VAL D 2 33  ? 168.893 -37.606  47.058  1.00 175.39 ? 33  VAL D CB  1 
ATOM   4889  C CG1 . VAL D 2 33  ? 168.570 -37.206  48.496  1.00 172.69 ? 33  VAL D CG1 1 
ATOM   4890  C CG2 . VAL D 2 33  ? 169.205 -39.095  46.988  1.00 175.93 ? 33  VAL D CG2 1 
ATOM   4891  N N   . TRP D 2 34  ? 167.979 -34.902  45.384  1.00 190.03 ? 34  TRP D N   1 
ATOM   4892  C CA  . TRP D 2 34  ? 167.865 -33.451  45.517  1.00 196.23 ? 34  TRP D CA  1 
ATOM   4893  C C   . TRP D 2 34  ? 166.756 -32.814  44.681  1.00 194.14 ? 34  TRP D C   1 
ATOM   4894  O O   . TRP D 2 34  ? 166.092 -31.884  45.139  1.00 192.26 ? 34  TRP D O   1 
ATOM   4895  C CB  . TRP D 2 34  ? 169.215 -32.797  45.220  1.00 205.50 ? 34  TRP D CB  1 
ATOM   4896  C CG  . TRP D 2 34  ? 170.213 -33.048  46.303  1.00 216.76 ? 34  TRP D CG  1 
ATOM   4897  C CD1 . TRP D 2 34  ? 170.852 -34.222  46.577  1.00 218.98 ? 34  TRP D CD1 1 
ATOM   4898  C CD2 . TRP D 2 34  ? 170.677 -32.106  47.272  1.00 224.38 ? 34  TRP D CD2 1 
ATOM   4899  N NE1 . TRP D 2 34  ? 171.690 -34.072  47.653  1.00 224.18 ? 34  TRP D NE1 1 
ATOM   4900  C CE2 . TRP D 2 34  ? 171.604 -32.780  48.099  1.00 227.74 ? 34  TRP D CE2 1 
ATOM   4901  C CE3 . TRP D 2 34  ? 170.406 -30.753  47.520  1.00 227.76 ? 34  TRP D CE3 1 
ATOM   4902  C CZ2 . TRP D 2 34  ? 172.260 -32.147  49.159  1.00 232.97 ? 34  TRP D CZ2 1 
ATOM   4903  C CZ3 . TRP D 2 34  ? 171.058 -30.124  48.574  1.00 231.03 ? 34  TRP D CZ3 1 
ATOM   4904  C CH2 . TRP D 2 34  ? 171.976 -30.823  49.379  1.00 234.67 ? 34  TRP D CH2 1 
ATOM   4905  N N   . ALA D 2 35  ? 166.559 -33.310  43.463  1.00 194.07 ? 35  ALA D N   1 
ATOM   4906  C CA  . ALA D 2 35  ? 165.514 -32.790  42.580  1.00 195.02 ? 35  ALA D CA  1 
ATOM   4907  C C   . ALA D 2 35  ? 164.128 -33.326  42.943  1.00 195.01 ? 35  ALA D C   1 
ATOM   4908  O O   . ALA D 2 35  ? 163.118 -32.659  42.705  1.00 196.98 ? 35  ALA D O   1 
ATOM   4909  C CB  . ALA D 2 35  ? 165.844 -33.098  41.128  1.00 197.07 ? 35  ALA D CB  1 
ATOM   4910  N N   . GLY D 2 36  ? 164.093 -34.529  43.516  1.00 193.12 ? 36  GLY D N   1 
ATOM   4911  C CA  . GLY D 2 36  ? 162.848 -35.172  43.941  1.00 190.01 ? 36  GLY D CA  1 
ATOM   4912  C C   . GLY D 2 36  ? 162.154 -34.449  45.080  1.00 188.15 ? 36  GLY D C   1 
ATOM   4913  O O   . GLY D 2 36  ? 160.923 -34.423  45.148  1.00 186.34 ? 36  GLY D O   1 
ATOM   4914  N N   . TRP D 2 37  ? 162.952 -33.871  45.977  1.00 185.90 ? 37  TRP D N   1 
ATOM   4915  C CA  . TRP D 2 37  ? 162.435 -33.017  47.042  1.00 183.65 ? 37  TRP D CA  1 
ATOM   4916  C C   . TRP D 2 37  ? 161.972 -31.673  46.490  1.00 190.23 ? 37  TRP D C   1 
ATOM   4917  O O   . TRP D 2 37  ? 161.021 -31.088  47.002  1.00 191.49 ? 37  TRP D O   1 
ATOM   4918  C CB  . TRP D 2 37  ? 163.478 -32.806  48.145  1.00 172.62 ? 37  TRP D CB  1 
ATOM   4919  C CG  . TRP D 2 37  ? 163.640 -33.978  49.075  1.00 160.87 ? 37  TRP D CG  1 
ATOM   4920  C CD1 . TRP D 2 37  ? 164.805 -34.618  49.389  1.00 157.82 ? 37  TRP D CD1 1 
ATOM   4921  C CD2 . TRP D 2 37  ? 162.605 -34.647  49.809  1.00 153.55 ? 37  TRP D CD2 1 
ATOM   4922  N NE1 . TRP D 2 37  ? 164.562 -35.643  50.272  1.00 153.50 ? 37  TRP D NE1 1 
ATOM   4923  C CE2 . TRP D 2 37  ? 163.220 -35.684  50.546  1.00 151.16 ? 37  TRP D CE2 1 
ATOM   4924  C CE3 . TRP D 2 37  ? 161.218 -34.471  49.916  1.00 149.17 ? 37  TRP D CE3 1 
ATOM   4925  C CZ2 . TRP D 2 37  ? 162.497 -36.543  51.379  1.00 147.46 ? 37  TRP D CZ2 1 
ATOM   4926  C CZ3 . TRP D 2 37  ? 160.500 -35.326  50.743  1.00 146.37 ? 37  TRP D CZ3 1 
ATOM   4927  C CH2 . TRP D 2 37  ? 161.142 -36.349  51.464  1.00 145.52 ? 37  TRP D CH2 1 
ATOM   4928  N N   . GLY D 2 38  ? 162.650 -31.199  45.444  1.00 196.40 ? 38  GLY D N   1 
ATOM   4929  C CA  . GLY D 2 38  ? 162.268 -29.971  44.744  1.00 201.72 ? 38  GLY D CA  1 
ATOM   4930  C C   . GLY D 2 38  ? 160.969 -30.110  43.970  1.00 205.14 ? 38  GLY D C   1 
ATOM   4931  O O   . GLY D 2 38  ? 160.346 -29.110  43.608  1.00 208.90 ? 38  GLY D O   1 
ATOM   4932  N N   . MET D 2 39  ? 160.571 -31.357  43.716  1.00 206.05 ? 39  MET D N   1 
ATOM   4933  C CA  . MET D 2 39  ? 159.306 -31.678  43.052  1.00 203.46 ? 39  MET D CA  1 
ATOM   4934  C C   . MET D 2 39  ? 158.214 -31.977  44.078  1.00 196.03 ? 39  MET D C   1 
ATOM   4935  O O   . MET D 2 39  ? 157.044 -31.649  43.865  1.00 195.02 ? 39  MET D O   1 
ATOM   4936  C CB  . MET D 2 39  ? 159.489 -32.872  42.110  1.00 208.29 ? 39  MET D CB  1 
ATOM   4937  C CG  . MET D 2 39  ? 158.295 -33.182  41.214  1.00 211.68 ? 39  MET D CG  1 
ATOM   4938  S SD  . MET D 2 39  ? 158.013 -31.976  39.900  1.00 214.29 ? 39  MET D SD  1 
ATOM   4939  C CE  . MET D 2 39  ? 159.437 -32.263  38.851  1.00 211.57 ? 39  MET D CE  1 
ATOM   4940  N N   . VAL D 2 40  ? 158.602 -32.610  45.182  1.00 186.84 ? 40  VAL D N   1 
ATOM   4941  C CA  . VAL D 2 40  ? 157.694 -32.858  46.299  1.00 180.49 ? 40  VAL D CA  1 
ATOM   4942  C C   . VAL D 2 40  ? 157.349 -31.536  46.998  1.00 185.60 ? 40  VAL D C   1 
ATOM   4943  O O   . VAL D 2 40  ? 156.204 -31.322  47.399  1.00 183.12 ? 40  VAL D O   1 
ATOM   4944  C CB  . VAL D 2 40  ? 158.280 -33.901  47.281  1.00 173.89 ? 40  VAL D CB  1 
ATOM   4945  C CG1 . VAL D 2 40  ? 157.535 -33.900  48.607  1.00 171.71 ? 40  VAL D CG1 1 
ATOM   4946  C CG2 . VAL D 2 40  ? 158.244 -35.291  46.661  1.00 169.17 ? 40  VAL D CG2 1 
ATOM   4947  N N   . LEU D 2 41  ? 158.339 -30.649  47.108  1.00 194.74 ? 41  LEU D N   1 
ATOM   4948  C CA  . LEU D 2 41  ? 158.171 -29.331  47.734  1.00 205.61 ? 41  LEU D CA  1 
ATOM   4949  C C   . LEU D 2 41  ? 157.293 -28.373  46.918  1.00 214.80 ? 41  LEU D C   1 
ATOM   4950  O O   . LEU D 2 41  ? 156.461 -27.659  47.483  1.00 219.81 ? 41  LEU D O   1 
ATOM   4951  C CB  . LEU D 2 41  ? 159.542 -28.690  48.002  1.00 203.87 ? 41  LEU D CB  1 
ATOM   4952  C CG  . LEU D 2 41  ? 159.654 -27.351  48.742  1.00 203.18 ? 41  LEU D CG  1 
ATOM   4953  C CD1 . LEU D 2 41  ? 159.248 -27.497  50.201  1.00 203.65 ? 41  LEU D CD1 1 
ATOM   4954  C CD2 . LEU D 2 41  ? 161.070 -26.804  48.641  1.00 202.30 ? 41  LEU D CD2 1 
ATOM   4955  N N   . ALA D 2 42  ? 157.486 -28.364  45.598  1.00 222.28 ? 42  ALA D N   1 
ATOM   4956  C CA  . ALA D 2 42  ? 156.790 -27.432  44.702  1.00 223.30 ? 42  ALA D CA  1 
ATOM   4957  C C   . ALA D 2 42  ? 155.289 -27.699  44.584  1.00 218.32 ? 42  ALA D C   1 
ATOM   4958  O O   . ALA D 2 42  ? 154.489 -26.763  44.591  1.00 220.11 ? 42  ALA D O   1 
ATOM   4959  C CB  . ALA D 2 42  ? 157.437 -27.433  43.323  1.00 228.91 ? 42  ALA D CB  1 
ATOM   4960  N N   . VAL D 2 43  ? 154.923 -28.975  44.475  1.00 207.75 ? 43  VAL D N   1 
ATOM   4961  C CA  . VAL D 2 43  ? 153.524 -29.388  44.335  1.00 196.35 ? 43  VAL D CA  1 
ATOM   4962  C C   . VAL D 2 43  ? 152.710 -29.050  45.590  1.00 190.07 ? 43  VAL D C   1 
ATOM   4963  O O   . VAL D 2 43  ? 151.573 -28.580  45.493  1.00 187.73 ? 43  VAL D O   1 
ATOM   4964  C CB  . VAL D 2 43  ? 153.418 -30.893  43.984  1.00 195.13 ? 43  VAL D CB  1 
ATOM   4965  C CG1 . VAL D 2 43  ? 151.983 -31.387  44.085  1.00 195.10 ? 43  VAL D CG1 1 
ATOM   4966  C CG2 . VAL D 2 43  ? 153.969 -31.154  42.588  1.00 194.58 ? 43  VAL D CG2 1 
ATOM   4967  N N   . LEU D 2 44  ? 153.310 -29.274  46.757  1.00 183.90 ? 44  LEU D N   1 
ATOM   4968  C CA  . LEU D 2 44  ? 152.669 -28.988  48.042  1.00 179.68 ? 44  LEU D CA  1 
ATOM   4969  C C   . LEU D 2 44  ? 152.472 -27.497  48.299  1.00 181.33 ? 44  LEU D C   1 
ATOM   4970  O O   . LEU D 2 44  ? 151.512 -27.096  48.962  1.00 178.21 ? 44  LEU D O   1 
ATOM   4971  C CB  . LEU D 2 44  ? 153.474 -29.601  49.189  1.00 176.40 ? 44  LEU D CB  1 
ATOM   4972  C CG  . LEU D 2 44  ? 153.463 -31.123  49.326  1.00 174.68 ? 44  LEU D CG  1 
ATOM   4973  C CD1 . LEU D 2 44  ? 154.577 -31.572  50.258  1.00 175.04 ? 44  LEU D CD1 1 
ATOM   4974  C CD2 . LEU D 2 44  ? 152.112 -31.619  49.819  1.00 174.21 ? 44  LEU D CD2 1 
ATOM   4975  N N   . ALA D 2 45  ? 153.387 -26.688  47.770  1.00 186.15 ? 45  ALA D N   1 
ATOM   4976  C CA  . ALA D 2 45  ? 153.390 -25.243  47.990  1.00 190.56 ? 45  ALA D CA  1 
ATOM   4977  C C   . ALA D 2 45  ? 152.290 -24.512  47.225  1.00 194.70 ? 45  ALA D C   1 
ATOM   4978  O O   . ALA D 2 45  ? 151.844 -23.443  47.651  1.00 196.54 ? 45  ALA D O   1 
ATOM   4979  C CB  . ALA D 2 45  ? 154.749 -24.663  47.635  1.00 188.89 ? 45  ALA D CB  1 
ATOM   4980  N N   . THR D 2 46  ? 151.855 -25.088  46.105  1.00 198.57 ? 46  THR D N   1 
ATOM   4981  C CA  . THR D 2 46  ? 150.872 -24.438  45.230  1.00 200.35 ? 46  THR D CA  1 
ATOM   4982  C C   . THR D 2 46  ? 149.418 -24.743  45.608  1.00 200.17 ? 46  THR D C   1 
ATOM   4983  O O   . THR D 2 46  ? 148.489 -24.250  44.962  1.00 199.89 ? 46  THR D O   1 
ATOM   4984  C CB  . THR D 2 46  ? 151.113 -24.759  43.736  1.00 200.51 ? 46  THR D CB  1 
ATOM   4985  O OG1 . THR D 2 46  ? 150.693 -26.100  43.453  1.00 202.06 ? 46  THR D OG1 1 
ATOM   4986  C CG2 . THR D 2 46  ? 152.577 -24.617  43.395  1.00 198.35 ? 46  THR D CG2 1 
ATOM   4987  N N   . PHE D 2 47  ? 149.229 -25.552  46.649  1.00 198.25 ? 47  PHE D N   1 
ATOM   4988  C CA  . PHE D 2 47  ? 147.906 -25.754  47.241  1.00 198.61 ? 47  PHE D CA  1 
ATOM   4989  C C   . PHE D 2 47  ? 147.475 -24.505  48.001  1.00 213.67 ? 47  PHE D C   1 
ATOM   4990  O O   . PHE D 2 47  ? 146.285 -24.298  48.255  1.00 214.18 ? 47  PHE D O   1 
ATOM   4991  C CB  . PHE D 2 47  ? 147.903 -26.956  48.186  1.00 183.99 ? 47  PHE D CB  1 
ATOM   4992  C CG  . PHE D 2 47  ? 148.093 -28.273  47.496  1.00 173.29 ? 47  PHE D CG  1 
ATOM   4993  C CD1 . PHE D 2 47  ? 147.160 -28.732  46.573  1.00 170.19 ? 47  PHE D CD1 1 
ATOM   4994  C CD2 . PHE D 2 47  ? 149.196 -29.064  47.780  1.00 168.20 ? 47  PHE D CD2 1 
ATOM   4995  C CE1 . PHE D 2 47  ? 147.333 -29.949  45.936  1.00 167.05 ? 47  PHE D CE1 1 
ATOM   4996  C CE2 . PHE D 2 47  ? 149.375 -30.284  47.149  1.00 165.61 ? 47  PHE D CE2 1 
ATOM   4997  C CZ  . PHE D 2 47  ? 148.442 -30.727  46.225  1.00 165.78 ? 47  PHE D CZ  1 
ATOM   4998  N N   . PHE D 2 48  ? 148.459 -23.680  48.355  1.00 234.86 ? 48  PHE D N   1 
ATOM   4999  C CA  . PHE D 2 48  ? 148.239 -22.450  49.110  1.00 253.69 ? 48  PHE D CA  1 
ATOM   5000  C C   . PHE D 2 48  ? 148.245 -21.215  48.197  1.00 265.70 ? 48  PHE D C   1 
ATOM   5001  O O   . PHE D 2 48  ? 148.598 -20.111  48.624  1.00 271.18 ? 48  PHE D O   1 
ATOM   5002  C CB  . PHE D 2 48  ? 149.283 -22.325  50.231  1.00 253.35 ? 48  PHE D CB  1 
ATOM   5003  C CG  . PHE D 2 48  ? 149.324 -23.512  51.158  1.00 250.17 ? 48  PHE D CG  1 
ATOM   5004  C CD1 . PHE D 2 48  ? 148.498 -23.567  52.279  1.00 247.35 ? 48  PHE D CD1 1 
ATOM   5005  C CD2 . PHE D 2 48  ? 150.185 -24.579  50.910  1.00 249.26 ? 48  PHE D CD2 1 
ATOM   5006  C CE1 . PHE D 2 48  ? 148.531 -24.660  53.132  1.00 244.40 ? 48  PHE D CE1 1 
ATOM   5007  C CE2 . PHE D 2 48  ? 150.221 -25.675  51.759  1.00 246.70 ? 48  PHE D CE2 1 
ATOM   5008  C CZ  . PHE D 2 48  ? 149.394 -25.715  52.871  1.00 244.99 ? 48  PHE D CZ  1 
ATOM   5009  N N   . TRP D 2 49  ? 147.847 -21.422  46.941  1.00 273.17 ? 49  TRP D N   1 
ATOM   5010  C CA  . TRP D 2 49  ? 147.703 -20.354  45.951  1.00 276.29 ? 49  TRP D CA  1 
ATOM   5011  C C   . TRP D 2 49  ? 146.357 -19.656  46.197  1.00 268.75 ? 49  TRP D C   1 
ATOM   5012  O O   . TRP D 2 49  ? 145.302 -20.283  46.051  1.00 268.55 ? 49  TRP D O   1 
ATOM   5013  C CB  . TRP D 2 49  ? 147.778 -20.951  44.537  1.00 285.55 ? 49  TRP D CB  1 
ATOM   5014  C CG  . TRP D 2 49  ? 148.077 -19.975  43.422  1.00 294.85 ? 49  TRP D CG  1 
ATOM   5015  C CD1 . TRP D 2 49  ? 147.200 -19.109  42.838  1.00 297.94 ? 49  TRP D CD1 1 
ATOM   5016  C CD2 . TRP D 2 49  ? 149.330 -19.798  42.738  1.00 298.79 ? 49  TRP D CD2 1 
ATOM   5017  N NE1 . TRP D 2 49  ? 147.828 -18.392  41.846  1.00 302.29 ? 49  TRP D NE1 1 
ATOM   5018  C CE2 . TRP D 2 49  ? 149.135 -18.793  41.763  1.00 300.88 ? 49  TRP D CE2 1 
ATOM   5019  C CE3 . TRP D 2 49  ? 150.600 -20.382  42.862  1.00 299.55 ? 49  TRP D CE3 1 
ATOM   5020  C CZ2 . TRP D 2 49  ? 150.161 -18.359  40.913  1.00 297.81 ? 49  TRP D CZ2 1 
ATOM   5021  C CZ3 . TRP D 2 49  ? 151.621 -19.950  42.014  1.00 300.16 ? 49  TRP D CZ3 1 
ATOM   5022  C CH2 . TRP D 2 49  ? 151.392 -18.949  41.052  1.00 300.04 ? 49  TRP D CH2 1 
ATOM   5023  N N   . PRO D 2 50  ? 146.393 -18.363  46.589  1.00 259.66 ? 50  PRO D N   1 
ATOM   5024  C CA  . PRO D 2 50  ? 145.228 -17.601  47.079  1.00 249.88 ? 50  PRO D CA  1 
ATOM   5025  C C   . PRO D 2 50  ? 143.955 -17.689  46.226  1.00 237.79 ? 50  PRO D C   1 
ATOM   5026  O O   . PRO D 2 50  ? 143.908 -17.166  45.110  1.00 237.67 ? 50  PRO D O   1 
ATOM   5027  C CB  . PRO D 2 50  ? 145.743 -16.149  47.140  1.00 251.72 ? 50  PRO D CB  1 
ATOM   5028  C CG  . PRO D 2 50  ? 147.082 -16.150  46.473  1.00 253.83 ? 50  PRO D CG  1 
ATOM   5029  C CD  . PRO D 2 50  ? 147.616 -17.541  46.607  1.00 256.94 ? 50  PRO D CD  1 
ATOM   5030  N N   . GLY D 2 51  ? 142.936 -18.355  46.768  1.00 224.38 ? 51  GLY D N   1 
ATOM   5031  C CA  . GLY D 2 51  ? 141.623 -18.441  46.132  1.00 211.58 ? 51  GLY D CA  1 
ATOM   5032  C C   . GLY D 2 51  ? 141.482 -19.528  45.083  1.00 205.73 ? 51  GLY D C   1 
ATOM   5033  O O   . GLY D 2 51  ? 140.783 -19.341  44.085  1.00 204.20 ? 51  GLY D O   1 
ATOM   5034  N N   . MET D 2 52  ? 142.139 -20.666  45.310  1.00 201.03 ? 52  MET D N   1 
ATOM   5035  C CA  . MET D 2 52  ? 142.041 -21.808  44.400  1.00 200.34 ? 52  MET D CA  1 
ATOM   5036  C C   . MET D 2 52  ? 140.714 -22.548  44.549  1.00 207.72 ? 52  MET D C   1 
ATOM   5037  O O   . MET D 2 52  ? 140.289 -22.869  45.664  1.00 209.39 ? 52  MET D O   1 
ATOM   5038  C CB  . MET D 2 52  ? 143.207 -22.784  44.592  1.00 188.43 ? 52  MET D CB  1 
ATOM   5039  C CG  . MET D 2 52  ? 144.427 -22.491  43.730  1.00 178.54 ? 52  MET D CG  1 
ATOM   5040  S SD  . MET D 2 52  ? 145.144 -23.959  42.959  1.00 167.48 ? 52  MET D SD  1 
ATOM   5041  C CE  . MET D 2 52  ? 145.427 -25.026  44.369  1.00 167.10 ? 52  MET D CE  1 
ATOM   5042  N N   . GLY D 2 53  ? 140.066 -22.803  43.414  1.00 215.47 ? 53  GLY D N   1 
ATOM   5043  C CA  . GLY D 2 53  ? 138.845 -23.608  43.361  1.00 218.26 ? 53  GLY D CA  1 
ATOM   5044  C C   . GLY D 2 53  ? 139.091 -24.910  42.620  1.00 218.24 ? 53  GLY D C   1 
ATOM   5045  O O   . GLY D 2 53  ? 140.244 -25.303  42.418  1.00 221.92 ? 53  GLY D O   1 
ATOM   5046  N N   . ASN D 2 54  ? 138.007 -25.578  42.218  1.00 213.00 ? 54  ASN D N   1 
ATOM   5047  C CA  . ASN D 2 54  ? 138.075 -26.863  41.504  1.00 207.39 ? 54  ASN D CA  1 
ATOM   5048  C C   . ASN D 2 54  ? 139.008 -27.867  42.189  1.00 206.00 ? 54  ASN D C   1 
ATOM   5049  O O   . ASN D 2 54  ? 139.610 -28.719  41.530  1.00 203.53 ? 54  ASN D O   1 
ATOM   5050  C CB  . ASN D 2 54  ? 138.498 -26.661  40.037  1.00 204.28 ? 54  ASN D CB  1 
ATOM   5051  C CG  . ASN D 2 54  ? 137.554 -25.754  39.266  1.00 201.50 ? 54  ASN D CG  1 
ATOM   5052  O OD1 . ASN D 2 54  ? 136.685 -26.223  38.531  1.00 198.04 ? 54  ASN D OD1 1 
ATOM   5053  N ND2 . ASN D 2 54  ? 137.722 -24.447  39.428  1.00 201.56 ? 54  ASN D ND2 1 
ATOM   5054  N N   . PHE D 2 55  ? 139.108 -27.763  43.515  1.00 205.81 ? 55  PHE D N   1 
ATOM   5055  C CA  . PHE D 2 55  ? 140.127 -28.476  44.290  1.00 206.75 ? 55  PHE D CA  1 
ATOM   5056  C C   . PHE D 2 55  ? 139.999 -29.993  44.193  1.00 196.95 ? 55  PHE D C   1 
ATOM   5057  O O   . PHE D 2 55  ? 140.994 -30.712  44.289  1.00 196.60 ? 55  PHE D O   1 
ATOM   5058  C CB  . PHE D 2 55  ? 140.100 -28.033  45.756  1.00 218.70 ? 55  PHE D CB  1 
ATOM   5059  C CG  . PHE D 2 55  ? 141.466 -27.806  46.346  1.00 231.00 ? 55  PHE D CG  1 
ATOM   5060  C CD1 . PHE D 2 55  ? 142.215 -28.868  46.850  1.00 233.90 ? 55  PHE D CD1 1 
ATOM   5061  C CD2 . PHE D 2 55  ? 142.008 -26.525  46.399  1.00 236.15 ? 55  PHE D CD2 1 
ATOM   5062  C CE1 . PHE D 2 55  ? 143.475 -28.655  47.392  1.00 236.79 ? 55  PHE D CE1 1 
ATOM   5063  C CE2 . PHE D 2 55  ? 143.266 -26.306  46.941  1.00 238.18 ? 55  PHE D CE2 1 
ATOM   5064  C CZ  . PHE D 2 55  ? 144.001 -27.372  47.438  1.00 237.74 ? 55  PHE D CZ  1 
ATOM   5065  N N   . ALA D 2 56  ? 138.771 -30.466  44.000  1.00 185.76 ? 56  ALA D N   1 
ATOM   5066  C CA  . ALA D 2 56  ? 138.505 -31.887  43.802  1.00 176.68 ? 56  ALA D CA  1 
ATOM   5067  C C   . ALA D 2 56  ? 139.006 -32.374  42.440  1.00 171.25 ? 56  ALA D C   1 
ATOM   5068  O O   . ALA D 2 56  ? 139.389 -33.536  42.294  1.00 168.86 ? 56  ALA D O   1 
ATOM   5069  C CB  . ALA D 2 56  ? 137.019 -32.169  43.954  1.00 176.27 ? 56  ALA D CB  1 
ATOM   5070  N N   . LEU D 2 57  ? 139.007 -31.474  41.457  1.00 166.68 ? 57  LEU D N   1 
ATOM   5071  C CA  . LEU D 2 57  ? 139.357 -31.814  40.076  1.00 162.48 ? 57  LEU D CA  1 
ATOM   5072  C C   . LEU D 2 57  ? 140.865 -31.816  39.826  1.00 155.52 ? 57  LEU D C   1 
ATOM   5073  O O   . LEU D 2 57  ? 141.368 -32.612  39.028  1.00 151.97 ? 57  LEU D O   1 
ATOM   5074  C CB  . LEU D 2 57  ? 138.660 -30.859  39.096  1.00 167.82 ? 57  LEU D CB  1 
ATOM   5075  C CG  . LEU D 2 57  ? 137.155 -30.599  39.282  1.00 172.13 ? 57  LEU D CG  1 
ATOM   5076  C CD1 . LEU D 2 57  ? 136.681 -29.489  38.356  1.00 174.82 ? 57  LEU D CD1 1 
ATOM   5077  C CD2 . LEU D 2 57  ? 136.316 -31.858  39.077  1.00 174.06 ? 57  LEU D CD2 1 
ATOM   5078  N N   . ILE D 2 58  ? 141.573 -30.917  40.506  1.00 150.48 ? 58  ILE D N   1 
ATOM   5079  C CA  . ILE D 2 58  ? 143.024 -30.797  40.371  1.00 147.67 ? 58  ILE D CA  1 
ATOM   5080  C C   . ILE D 2 58  ? 143.726 -32.037  40.931  1.00 149.13 ? 58  ILE D C   1 
ATOM   5081  O O   . ILE D 2 58  ? 144.592 -32.616  40.270  1.00 150.08 ? 58  ILE D O   1 
ATOM   5082  C CB  . ILE D 2 58  ? 143.563 -29.520  41.059  1.00 144.45 ? 58  ILE D CB  1 
ATOM   5083  C CG1 . ILE D 2 58  ? 142.743 -28.293  40.644  1.00 141.04 ? 58  ILE D CG1 1 
ATOM   5084  C CG2 . ILE D 2 58  ? 145.034 -29.310  40.722  1.00 145.21 ? 58  ILE D CG2 1 
ATOM   5085  C CD1 . ILE D 2 58  ? 142.936 -27.083  41.534  1.00 138.61 ? 58  ILE D CD1 1 
ATOM   5086  N N   . LEU D 2 59  ? 143.331 -32.441  42.138  1.00 149.99 ? 59  LEU D N   1 
ATOM   5087  C CA  . LEU D 2 59  ? 143.921 -33.592  42.827  1.00 150.77 ? 59  LEU D CA  1 
ATOM   5088  C C   . LEU D 2 59  ? 143.697 -34.909  42.085  1.00 152.58 ? 59  LEU D C   1 
ATOM   5089  O O   . LEU D 2 59  ? 144.517 -35.827  42.178  1.00 151.83 ? 59  LEU D O   1 
ATOM   5090  C CB  . LEU D 2 59  ? 143.379 -33.697  44.258  1.00 149.51 ? 59  LEU D CB  1 
ATOM   5091  C CG  . LEU D 2 59  ? 143.802 -32.630  45.277  1.00 148.53 ? 59  LEU D CG  1 
ATOM   5092  C CD1 . LEU D 2 59  ? 142.814 -32.565  46.433  1.00 148.29 ? 59  LEU D CD1 1 
ATOM   5093  C CD2 . LEU D 2 59  ? 145.211 -32.885  45.795  1.00 147.41 ? 59  LEU D CD2 1 
ATOM   5094  N N   . LEU D 2 60  ? 142.586 -34.992  41.354  1.00 155.74 ? 60  LEU D N   1 
ATOM   5095  C CA  . LEU D 2 60  ? 142.260 -36.177  40.568  1.00 159.73 ? 60  LEU D CA  1 
ATOM   5096  C C   . LEU D 2 60  ? 143.201 -36.292  39.373  1.00 158.15 ? 60  LEU D C   1 
ATOM   5097  O O   . LEU D 2 60  ? 143.823 -37.334  39.170  1.00 157.52 ? 60  LEU D O   1 
ATOM   5098  C CB  . LEU D 2 60  ? 140.804 -36.128  40.092  1.00 165.60 ? 60  LEU D CB  1 
ATOM   5099  C CG  . LEU D 2 60  ? 139.938 -37.397  40.147  1.00 170.86 ? 60  LEU D CG  1 
ATOM   5100  C CD1 . LEU D 2 60  ? 138.695 -37.208  39.285  1.00 175.45 ? 60  LEU D CD1 1 
ATOM   5101  C CD2 . LEU D 2 60  ? 140.678 -38.665  39.731  1.00 171.41 ? 60  LEU D CD2 1 
ATOM   5102  N N   . ALA D 2 61  ? 143.304 -35.212  38.598  1.00 157.20 ? 61  ALA D N   1 
ATOM   5103  C CA  . ALA D 2 61  ? 144.206 -35.146  37.448  1.00 158.31 ? 61  ALA D CA  1 
ATOM   5104  C C   . ALA D 2 61  ? 145.663 -35.347  37.859  1.00 160.59 ? 61  ALA D C   1 
ATOM   5105  O O   . ALA D 2 61  ? 146.474 -35.842  37.073  1.00 160.69 ? 61  ALA D O   1 
ATOM   5106  C CB  . ALA D 2 61  ? 144.038 -33.823  36.721  1.00 157.12 ? 61  ALA D CB  1 
ATOM   5107  N N   . LEU D 2 62  ? 145.981 -34.953  39.091  1.00 163.98 ? 62  LEU D N   1 
ATOM   5108  C CA  . LEU D 2 62  ? 147.298 -35.186  39.674  1.00 166.73 ? 62  LEU D CA  1 
ATOM   5109  C C   . LEU D 2 62  ? 147.564 -36.675  39.880  1.00 164.43 ? 62  LEU D C   1 
ATOM   5110  O O   . LEU D 2 62  ? 148.587 -37.188  39.427  1.00 165.34 ? 62  LEU D O   1 
ATOM   5111  C CB  . LEU D 2 62  ? 147.450 -34.431  40.998  1.00 171.92 ? 62  LEU D CB  1 
ATOM   5112  C CG  . LEU D 2 62  ? 148.026 -33.011  40.951  1.00 175.75 ? 62  LEU D CG  1 
ATOM   5113  C CD1 . LEU D 2 62  ? 147.614 -32.232  42.192  1.00 178.91 ? 62  LEU D CD1 1 
ATOM   5114  C CD2 . LEU D 2 62  ? 149.543 -33.030  40.800  1.00 176.76 ? 62  LEU D CD2 1 
ATOM   5115  N N   . LEU D 2 63  ? 146.640 -37.362  40.553  1.00 160.29 ? 63  LEU D N   1 
ATOM   5116  C CA  . LEU D 2 63  ? 146.783 -38.797  40.796  1.00 156.70 ? 63  LEU D CA  1 
ATOM   5117  C C   . LEU D 2 63  ? 146.684 -39.598  39.500  1.00 162.06 ? 63  LEU D C   1 
ATOM   5118  O O   . LEU D 2 63  ? 147.389 -40.591  39.334  1.00 160.57 ? 63  LEU D O   1 
ATOM   5119  C CB  . LEU D 2 63  ? 145.767 -39.294  41.830  1.00 149.01 ? 63  LEU D CB  1 
ATOM   5120  C CG  . LEU D 2 63  ? 146.012 -40.705  42.380  1.00 143.44 ? 63  LEU D CG  1 
ATOM   5121  C CD1 . LEU D 2 63  ? 145.870 -40.740  43.894  1.00 142.24 ? 63  LEU D CD1 1 
ATOM   5122  C CD2 . LEU D 2 63  ? 145.108 -41.735  41.715  1.00 141.30 ? 63  LEU D CD2 1 
ATOM   5123  N N   . LEU D 2 64  ? 145.820 -39.153  38.587  1.00 171.11 ? 64  LEU D N   1 
ATOM   5124  C CA  . LEU D 2 64  ? 145.666 -39.790  37.274  1.00 180.53 ? 64  LEU D CA  1 
ATOM   5125  C C   . LEU D 2 64  ? 146.923 -39.681  36.413  1.00 185.84 ? 64  LEU D C   1 
ATOM   5126  O O   . LEU D 2 64  ? 147.239 -40.593  35.649  1.00 190.21 ? 64  LEU D O   1 
ATOM   5127  C CB  . LEU D 2 64  ? 144.470 -39.205  36.514  1.00 181.20 ? 64  LEU D CB  1 
ATOM   5128  C CG  . LEU D 2 64  ? 143.057 -39.614  36.946  1.00 181.76 ? 64  LEU D CG  1 
ATOM   5129  C CD1 . LEU D 2 64  ? 142.027 -38.813  36.165  1.00 181.19 ? 64  LEU D CD1 1 
ATOM   5130  C CD2 . LEU D 2 64  ? 142.812 -41.110  36.777  1.00 183.32 ? 64  LEU D CD2 1 
ATOM   5131  N N   . GLY D 2 65  ? 147.624 -38.556  36.527  1.00 188.75 ? 65  GLY D N   1 
ATOM   5132  C CA  . GLY D 2 65  ? 148.889 -38.370  35.828  1.00 189.57 ? 65  GLY D CA  1 
ATOM   5133  C C   . GLY D 2 65  ? 150.025 -39.101  36.517  1.00 190.78 ? 65  GLY D C   1 
ATOM   5134  O O   . GLY D 2 65  ? 150.814 -39.787  35.864  1.00 191.58 ? 65  GLY D O   1 
ATOM   5135  N N   . SER D 2 66  ? 150.086 -38.967  37.842  1.00 189.65 ? 66  SER D N   1 
ATOM   5136  C CA  . SER D 2 66  ? 151.189 -39.501  38.645  1.00 187.58 ? 66  SER D CA  1 
ATOM   5137  C C   . SER D 2 66  ? 151.237 -41.026  38.704  1.00 187.36 ? 66  SER D C   1 
ATOM   5138  O O   . SER D 2 66  ? 152.253 -41.624  38.347  1.00 185.47 ? 66  SER D O   1 
ATOM   5139  C CB  . SER D 2 66  ? 151.156 -38.928  40.065  1.00 186.48 ? 66  SER D CB  1 
ATOM   5140  O OG  . SER D 2 66  ? 150.058 -39.444  40.799  1.00 185.09 ? 66  SER D OG  1 
ATOM   5141  N N   . VAL D 2 67  ? 150.149 -41.649  39.156  1.00 188.39 ? 67  VAL D N   1 
ATOM   5142  C CA  . VAL D 2 67  ? 150.129 -43.104  39.352  1.00 191.03 ? 67  VAL D CA  1 
ATOM   5143  C C   . VAL D 2 67  ? 150.234 -43.887  38.036  1.00 198.01 ? 67  VAL D C   1 
ATOM   5144  O O   . VAL D 2 67  ? 150.849 -44.954  38.001  1.00 200.87 ? 67  VAL D O   1 
ATOM   5145  C CB  . VAL D 2 67  ? 148.931 -43.592  40.219  1.00 186.89 ? 67  VAL D CB  1 
ATOM   5146  C CG1 . VAL D 2 67  ? 148.899 -42.864  41.557  1.00 182.72 ? 67  VAL D CG1 1 
ATOM   5147  C CG2 . VAL D 2 67  ? 147.600 -43.452  39.489  1.00 184.16 ? 67  VAL D CG2 1 
ATOM   5148  N N   . VAL D 2 68  ? 149.654 -43.342  36.964  1.00 204.30 ? 68  VAL D N   1 
ATOM   5149  C CA  . VAL D 2 68  ? 149.697 -43.959  35.628  1.00 207.51 ? 68  VAL D CA  1 
ATOM   5150  C C   . VAL D 2 68  ? 151.123 -44.015  35.076  1.00 207.65 ? 68  VAL D C   1 
ATOM   5151  O O   . VAL D 2 68  ? 151.555 -45.043  34.548  1.00 206.03 ? 68  VAL D O   1 
ATOM   5152  C CB  . VAL D 2 68  ? 148.736 -43.247  34.636  1.00 208.66 ? 68  VAL D CB  1 
ATOM   5153  C CG1 . VAL D 2 68  ? 149.171 -43.424  33.184  1.00 206.43 ? 68  VAL D CG1 1 
ATOM   5154  C CG2 . VAL D 2 68  ? 147.310 -43.745  34.828  1.00 211.31 ? 68  VAL D CG2 1 
ATOM   5155  N N   . ALA D 2 69  ? 151.849 -42.910  35.217  1.00 210.04 ? 69  ALA D N   1 
ATOM   5156  C CA  . ALA D 2 69  ? 153.219 -42.824  34.731  1.00 212.59 ? 69  ALA D CA  1 
ATOM   5157  C C   . ALA D 2 69  ? 154.211 -43.532  35.654  1.00 211.63 ? 69  ALA D C   1 
ATOM   5158  O O   . ALA D 2 69  ? 155.151 -44.171  35.178  1.00 212.36 ? 69  ALA D O   1 
ATOM   5159  C CB  . ALA D 2 69  ? 153.615 -41.375  34.531  1.00 215.97 ? 69  ALA D CB  1 
ATOM   5160  N N   . TRP D 2 70  ? 153.995 -43.414  36.966  1.00 208.43 ? 70  TRP D N   1 
ATOM   5161  C CA  . TRP D 2 70  ? 154.825 -44.089  37.968  1.00 205.77 ? 70  TRP D CA  1 
ATOM   5162  C C   . TRP D 2 70  ? 154.868 -45.588  37.703  1.00 206.65 ? 70  TRP D C   1 
ATOM   5163  O O   . TRP D 2 70  ? 155.919 -46.221  37.807  1.00 201.44 ? 70  TRP D O   1 
ATOM   5164  C CB  . TRP D 2 70  ? 154.285 -43.836  39.378  1.00 204.26 ? 70  TRP D CB  1 
ATOM   5165  C CG  . TRP D 2 70  ? 155.186 -44.341  40.461  1.00 206.54 ? 70  TRP D CG  1 
ATOM   5166  C CD1 . TRP D 2 70  ? 155.259 -45.619  40.941  1.00 204.78 ? 70  TRP D CD1 1 
ATOM   5167  C CD2 . TRP D 2 70  ? 156.148 -43.580  41.197  1.00 212.18 ? 70  TRP D CD2 1 
ATOM   5168  N NE1 . TRP D 2 70  ? 156.208 -45.700  41.931  1.00 207.79 ? 70  TRP D NE1 1 
ATOM   5169  C CE2 . TRP D 2 70  ? 156.769 -44.463  42.109  1.00 213.42 ? 70  TRP D CE2 1 
ATOM   5170  C CE3 . TRP D 2 70  ? 156.545 -42.236  41.177  1.00 217.83 ? 70  TRP D CE3 1 
ATOM   5171  C CZ2 . TRP D 2 70  ? 157.768 -44.046  42.995  1.00 219.60 ? 70  TRP D CZ2 1 
ATOM   5172  C CZ3 . TRP D 2 70  ? 157.538 -41.821  42.058  1.00 222.90 ? 70  TRP D CZ3 1 
ATOM   5173  C CH2 . TRP D 2 70  ? 158.138 -42.725  42.954  1.00 224.19 ? 70  TRP D CH2 1 
ATOM   5174  N N   . TRP D 2 71  ? 153.704 -46.134  37.364  1.00 215.04 ? 71  TRP D N   1 
ATOM   5175  C CA  . TRP D 2 71  ? 153.541 -47.540  37.026  1.00 228.02 ? 71  TRP D CA  1 
ATOM   5176  C C   . TRP D 2 71  ? 154.247 -47.884  35.714  1.00 215.74 ? 71  TRP D C   1 
ATOM   5177  O O   . TRP D 2 71  ? 155.050 -48.818  35.668  1.00 217.08 ? 71  TRP D O   1 
ATOM   5178  C CB  . TRP D 2 71  ? 152.044 -47.874  36.965  1.00 255.72 ? 71  TRP D CB  1 
ATOM   5179  C CG  . TRP D 2 71  ? 151.678 -49.174  36.297  1.00 284.86 ? 71  TRP D CG  1 
ATOM   5180  C CD1 . TRP D 2 71  ? 152.105 -50.427  36.641  1.00 291.48 ? 71  TRP D CD1 1 
ATOM   5181  C CD2 . TRP D 2 71  ? 150.777 -49.347  35.193  1.00 298.40 ? 71  TRP D CD2 1 
ATOM   5182  N NE1 . TRP D 2 71  ? 151.540 -51.365  35.809  1.00 298.15 ? 71  TRP D NE1 1 
ATOM   5183  C CE2 . TRP D 2 71  ? 150.720 -50.731  34.912  1.00 302.97 ? 71  TRP D CE2 1 
ATOM   5184  C CE3 . TRP D 2 71  ? 150.018 -48.465  34.409  1.00 305.21 ? 71  TRP D CE3 1 
ATOM   5185  C CZ2 . TRP D 2 71  ? 149.935 -51.257  33.879  1.00 306.76 ? 71  TRP D CZ2 1 
ATOM   5186  C CZ3 . TRP D 2 71  ? 149.235 -48.990  33.381  1.00 306.81 ? 71  TRP D CZ3 1 
ATOM   5187  C CH2 . TRP D 2 71  ? 149.202 -50.374  33.127  1.00 304.75 ? 71  TRP D CH2 1 
ATOM   5188  N N   . ALA D 2 72  ? 153.960 -47.114  34.664  1.00 200.78 ? 72  ALA D N   1 
ATOM   5189  C CA  . ALA D 2 72  ? 154.535 -47.340  33.336  1.00 188.28 ? 72  ALA D CA  1 
ATOM   5190  C C   . ALA D 2 72  ? 156.062 -47.288  33.340  1.00 181.11 ? 72  ALA D C   1 
ATOM   5191  O O   . ALA D 2 72  ? 156.714 -47.980  32.559  1.00 177.41 ? 72  ALA D O   1 
ATOM   5192  C CB  . ALA D 2 72  ? 153.973 -46.340  32.337  1.00 187.13 ? 72  ALA D CB  1 
ATOM   5193  N N   . ALA D 2 73  ? 156.618 -46.474  34.233  1.00 175.73 ? 73  ALA D N   1 
ATOM   5194  C CA  . ALA D 2 73  ? 158.061 -46.272  34.325  1.00 173.35 ? 73  ALA D CA  1 
ATOM   5195  C C   . ALA D 2 73  ? 158.806 -47.469  34.910  1.00 174.29 ? 73  ALA D C   1 
ATOM   5196  O O   . ALA D 2 73  ? 159.879 -47.832  34.425  1.00 171.16 ? 73  ALA D O   1 
ATOM   5197  C CB  . ALA D 2 73  ? 158.359 -45.021  35.133  1.00 171.42 ? 73  ALA D CB  1 
ATOM   5198  N N   . VAL D 2 74  ? 158.235 -48.076  35.948  1.00 180.69 ? 74  VAL D N   1 
ATOM   5199  C CA  . VAL D 2 74  ? 158.892 -49.173  36.663  1.00 190.47 ? 74  VAL D CA  1 
ATOM   5200  C C   . VAL D 2 74  ? 158.716 -50.524  35.956  1.00 197.17 ? 74  VAL D C   1 
ATOM   5201  O O   . VAL D 2 74  ? 159.617 -51.367  35.993  1.00 196.23 ? 74  VAL D O   1 
ATOM   5202  C CB  . VAL D 2 74  ? 158.419 -49.260  38.137  1.00 192.34 ? 74  VAL D CB  1 
ATOM   5203  C CG1 . VAL D 2 74  ? 159.192 -50.330  38.899  1.00 195.08 ? 74  VAL D CG1 1 
ATOM   5204  C CG2 . VAL D 2 74  ? 158.585 -47.917  38.834  1.00 191.66 ? 74  VAL D CG2 1 
ATOM   5205  N N   . ARG D 2 75  ? 157.570 -50.719  35.303  1.00 207.67 ? 75  ARG D N   1 
ATOM   5206  C CA  . ARG D 2 75  ? 157.232 -52.014  34.691  1.00 216.86 ? 75  ARG D CA  1 
ATOM   5207  C C   . ARG D 2 75  ? 157.655 -52.190  33.219  1.00 219.22 ? 75  ARG D C   1 
ATOM   5208  O O   . ARG D 2 75  ? 157.278 -53.178  32.580  1.00 225.32 ? 75  ARG D O   1 
ATOM   5209  C CB  . ARG D 2 75  ? 155.734 -52.326  34.856  1.00 220.70 ? 75  ARG D CB  1 
ATOM   5210  C CG  . ARG D 2 75  ? 155.342 -52.921  36.205  1.00 219.56 ? 75  ARG D CG  1 
ATOM   5211  C CD  . ARG D 2 75  ? 153.997 -53.636  36.123  1.00 215.23 ? 75  ARG D CD  1 
ATOM   5212  N NE  . ARG D 2 75  ? 153.427 -53.933  37.439  1.00 207.30 ? 75  ARG D NE  1 
ATOM   5213  C CZ  . ARG D 2 75  ? 152.243 -54.509  37.642  1.00 201.85 ? 75  ARG D CZ  1 
ATOM   5214  N NH1 . ARG D 2 75  ? 151.476 -54.865  36.617  1.00 197.89 ? 75  ARG D NH1 1 
ATOM   5215  N NH2 . ARG D 2 75  ? 151.820 -54.730  38.881  1.00 199.19 ? 75  ARG D NH2 1 
ATOM   5216  N N   . VAL D 2 76  ? 158.434 -51.248  32.688  1.00 215.66 ? 76  VAL D N   1 
ATOM   5217  C CA  . VAL D 2 76  ? 158.945 -51.355  31.314  1.00 210.61 ? 76  VAL D CA  1 
ATOM   5218  C C   . VAL D 2 76  ? 160.422 -51.777  31.311  1.00 204.82 ? 76  VAL D C   1 
ATOM   5219  O O   . VAL D 2 76  ? 161.212 -51.292  32.127  1.00 206.19 ? 76  VAL D O   1 
ATOM   5220  C CB  . VAL D 2 76  ? 158.708 -50.050  30.510  1.00 211.54 ? 76  VAL D CB  1 
ATOM   5221  C CG1 . VAL D 2 76  ? 159.584 -49.987  29.266  1.00 213.98 ? 76  VAL D CG1 1 
ATOM   5222  C CG2 . VAL D 2 76  ? 157.241 -49.929  30.119  1.00 209.54 ? 76  VAL D CG2 1 
ATOM   5223  N N   . ALA D 2 77  ? 160.777 -52.686  30.398  1.00 195.16 ? 77  ALA D N   1 
ATOM   5224  C CA  . ALA D 2 77  ? 162.144 -53.210  30.271  1.00 186.11 ? 77  ALA D CA  1 
ATOM   5225  C C   . ALA D 2 77  ? 163.179 -52.106  30.052  1.00 183.29 ? 77  ALA D C   1 
ATOM   5226  O O   . ALA D 2 77  ? 162.874 -51.068  29.462  1.00 183.78 ? 77  ALA D O   1 
ATOM   5227  C CB  . ALA D 2 77  ? 162.218 -54.241  29.154  1.00 182.05 ? 77  ALA D CB  1 
ATOM   5228  N N   . MET D 2 78  ? 164.401 -52.345  30.525  1.00 180.74 ? 78  MET D N   1 
ATOM   5229  C CA  . MET D 2 78  ? 165.459 -51.328  30.526  1.00 182.67 ? 78  MET D CA  1 
ATOM   5230  C C   . MET D 2 78  ? 165.905 -50.847  29.143  1.00 191.05 ? 78  MET D C   1 
ATOM   5231  O O   . MET D 2 78  ? 166.299 -49.687  28.990  1.00 190.30 ? 78  MET D O   1 
ATOM   5232  C CB  . MET D 2 78  ? 166.670 -51.814  31.326  1.00 176.48 ? 78  MET D CB  1 
ATOM   5233  C CG  . MET D 2 78  ? 166.527 -51.671  32.833  1.00 172.08 ? 78  MET D CG  1 
ATOM   5234  S SD  . MET D 2 78  ? 166.441 -49.951  33.372  1.00 168.73 ? 78  MET D SD  1 
ATOM   5235  C CE  . MET D 2 78  ? 168.101 -49.373  33.017  1.00 169.20 ? 78  MET D CE  1 
ATOM   5236  N N   . THR D 2 79  ? 165.846 -51.733  28.150  1.00 202.80 ? 79  THR D N   1 
ATOM   5237  C CA  . THR D 2 79  ? 166.257 -51.403  26.775  1.00 213.61 ? 79  THR D CA  1 
ATOM   5238  C C   . THR D 2 79  ? 165.290 -50.443  26.067  1.00 216.80 ? 79  THR D C   1 
ATOM   5239  O O   . THR D 2 79  ? 165.688 -49.707  25.157  1.00 217.02 ? 79  THR D O   1 
ATOM   5240  C CB  . THR D 2 79  ? 166.499 -52.670  25.912  1.00 216.43 ? 79  THR D CB  1 
ATOM   5241  O OG1 . THR D 2 79  ? 166.659 -52.300  24.534  1.00 217.10 ? 79  THR D OG1 1 
ATOM   5242  C CG2 . THR D 2 79  ? 165.345 -53.665  26.038  1.00 216.92 ? 79  THR D CG2 1 
ATOM   5243  N N   . ASP D 2 80  ? 164.030 -50.456  26.499  1.00 219.63 ? 80  ASP D N   1 
ATOM   5244  C CA  . ASP D 2 80  ? 162.981 -49.624  25.907  1.00 218.31 ? 80  ASP D CA  1 
ATOM   5245  C C   . ASP D 2 80  ? 162.891 -48.243  26.577  1.00 211.12 ? 80  ASP D C   1 
ATOM   5246  O O   . ASP D 2 80  ? 161.803 -47.671  26.694  1.00 216.17 ? 80  ASP D O   1 
ATOM   5247  C CB  . ASP D 2 80  ? 161.617 -50.336  25.990  1.00 222.01 ? 80  ASP D CB  1 
ATOM   5248  C CG  . ASP D 2 80  ? 161.662 -51.778  25.494  1.00 221.76 ? 80  ASP D CG  1 
ATOM   5249  O OD1 . ASP D 2 80  ? 162.277 -52.628  26.172  1.00 220.48 ? 80  ASP D OD1 1 
ATOM   5250  O OD2 . ASP D 2 80  ? 161.054 -52.068  24.442  1.00 221.72 ? 80  ASP D OD2 1 
ATOM   5251  N N   . MET D 2 81  ? 164.036 -47.702  26.995  1.00 196.80 ? 81  MET D N   1 
ATOM   5252  C CA  . MET D 2 81  ? 164.063 -46.468  27.788  1.00 183.69 ? 81  MET D CA  1 
ATOM   5253  C C   . MET D 2 81  ? 164.166 -45.140  27.012  1.00 176.27 ? 81  MET D C   1 
ATOM   5254  O O   . MET D 2 81  ? 163.768 -44.100  27.543  1.00 175.96 ? 81  MET D O   1 
ATOM   5255  C CB  . MET D 2 81  ? 165.155 -46.546  28.860  1.00 181.99 ? 81  MET D CB  1 
ATOM   5256  C CG  . MET D 2 81  ? 164.834 -45.767  30.127  1.00 182.70 ? 81  MET D CG  1 
ATOM   5257  S SD  . MET D 2 81  ? 163.348 -46.319  30.990  1.00 185.27 ? 81  MET D SD  1 
ATOM   5258  C CE  . MET D 2 81  ? 163.874 -47.912  31.618  1.00 184.55 ? 81  MET D CE  1 
ATOM   5259  N N   . PRO D 2 82  ? 164.695 -45.158  25.767  1.00 170.13 ? 82  PRO D N   1 
ATOM   5260  C CA  . PRO D 2 82  ? 164.835 -43.893  25.025  1.00 169.02 ? 82  PRO D CA  1 
ATOM   5261  C C   . PRO D 2 82  ? 163.515 -43.165  24.767  1.00 170.96 ? 82  PRO D C   1 
ATOM   5262  O O   . PRO D 2 82  ? 163.458 -41.937  24.874  1.00 169.32 ? 82  PRO D O   1 
ATOM   5263  C CB  . PRO D 2 82  ? 165.453 -44.323  23.690  1.00 166.14 ? 82  PRO D CB  1 
ATOM   5264  C CG  . PRO D 2 82  ? 165.228 -45.792  23.595  1.00 164.94 ? 82  PRO D CG  1 
ATOM   5265  C CD  . PRO D 2 82  ? 165.228 -46.298  25.000  1.00 166.78 ? 82  PRO D CD  1 
ATOM   5266  N N   . GLN D 2 83  ? 162.475 -43.923  24.431  1.00 175.91 ? 83  GLN D N   1 
ATOM   5267  C CA  . GLN D 2 83  ? 161.157 -43.360  24.135  1.00 181.42 ? 83  GLN D CA  1 
ATOM   5268  C C   . GLN D 2 83  ? 160.397 -42.894  25.382  1.00 180.51 ? 83  GLN D C   1 
ATOM   5269  O O   . GLN D 2 83  ? 159.524 -42.026  25.287  1.00 182.31 ? 83  GLN D O   1 
ATOM   5270  C CB  . GLN D 2 83  ? 160.303 -44.339  23.313  1.00 186.65 ? 83  GLN D CB  1 
ATOM   5271  C CG  . GLN D 2 83  ? 160.357 -45.796  23.760  1.00 192.19 ? 83  GLN D CG  1 
ATOM   5272  C CD  . GLN D 2 83  ? 161.399 -46.610  23.012  1.00 194.94 ? 83  GLN D CD  1 
ATOM   5273  O OE1 . GLN D 2 83  ? 162.494 -46.130  22.725  1.00 194.20 ? 83  GLN D OE1 1 
ATOM   5274  N NE2 . GLN D 2 83  ? 161.059 -47.852  22.692  1.00 199.61 ? 83  GLN D NE2 1 
ATOM   5275  N N   . MET D 2 84  ? 160.729 -43.470  26.538  1.00 176.71 ? 84  MET D N   1 
ATOM   5276  C CA  . MET D 2 84  ? 160.112 -43.078  27.811  1.00 170.60 ? 84  MET D CA  1 
ATOM   5277  C C   . MET D 2 84  ? 160.460 -41.634  28.160  1.00 160.84 ? 84  MET D C   1 
ATOM   5278  O O   . MET D 2 84  ? 159.626 -40.901  28.692  1.00 158.56 ? 84  MET D O   1 
ATOM   5279  C CB  . MET D 2 84  ? 160.521 -44.025  28.945  1.00 175.92 ? 84  MET D CB  1 
ATOM   5280  C CG  . MET D 2 84  ? 159.986 -45.445  28.796  1.00 181.43 ? 84  MET D CG  1 
ATOM   5281  S SD  . MET D 2 84  ? 158.188 -45.580  28.904  1.00 186.14 ? 84  MET D SD  1 
ATOM   5282  C CE  . MET D 2 84  ? 157.959 -45.621  30.676  1.00 185.30 ? 84  MET D CE  1 
ATOM   5283  N N   . VAL D 2 85  ? 161.691 -41.236  27.842  1.00 150.18 ? 85  VAL D N   1 
ATOM   5284  C CA  . VAL D 2 85  ? 162.106 -39.840  27.936  1.00 140.08 ? 85  VAL D CA  1 
ATOM   5285  C C   . VAL D 2 85  ? 161.249 -38.992  27.001  1.00 134.91 ? 85  VAL D C   1 
ATOM   5286  O O   . VAL D 2 85  ? 160.738 -37.955  27.407  1.00 134.55 ? 85  VAL D O   1 
ATOM   5287  C CB  . VAL D 2 85  ? 163.603 -39.652  27.597  1.00 138.38 ? 85  VAL D CB  1 
ATOM   5288  C CG1 . VAL D 2 85  ? 163.986 -38.177  27.634  1.00 135.27 ? 85  VAL D CG1 1 
ATOM   5289  C CG2 . VAL D 2 85  ? 164.471 -40.445  28.561  1.00 139.10 ? 85  VAL D CG2 1 
ATOM   5290  N N   . ALA D 2 86  ? 161.077 -39.461  25.765  1.00 128.48 ? 86  ALA D N   1 
ATOM   5291  C CA  . ALA D 2 86  ? 160.315 -38.748  24.736  1.00 122.26 ? 86  ALA D CA  1 
ATOM   5292  C C   . ALA D 2 86  ? 158.827 -38.565  25.057  1.00 117.90 ? 86  ALA D C   1 
ATOM   5293  O O   . ALA D 2 86  ? 158.268 -37.501  24.799  1.00 117.11 ? 86  ALA D O   1 
ATOM   5294  C CB  . ALA D 2 86  ? 160.486 -39.425  23.384  1.00 122.11 ? 86  ALA D CB  1 
ATOM   5295  N N   . ILE D 2 87  ? 158.188 -39.595  25.610  1.00 112.84 ? 87  ILE D N   1 
ATOM   5296  C CA  . ILE D 2 87  ? 156.753 -39.528  25.914  1.00 108.35 ? 87  ILE D CA  1 
ATOM   5297  C C   . ILE D 2 87  ? 156.440 -38.637  27.121  1.00 110.50 ? 87  ILE D C   1 
ATOM   5298  O O   . ILE D 2 87  ? 155.448 -37.911  27.101  1.00 109.07 ? 87  ILE D O   1 
ATOM   5299  C CB  . ILE D 2 87  ? 156.101 -40.929  26.051  1.00 104.81 ? 87  ILE D CB  1 
ATOM   5300  C CG1 . ILE D 2 87  ? 154.571 -40.829  26.024  1.00 102.09 ? 87  ILE D CG1 1 
ATOM   5301  C CG2 . ILE D 2 87  ? 156.576 -41.654  27.304  1.00 104.78 ? 87  ILE D CG2 1 
ATOM   5302  C CD1 . ILE D 2 87  ? 153.995 -40.551  24.653  1.00 100.37 ? 87  ILE D CD1 1 
ATOM   5303  N N   . TYR D 2 88  ? 157.282 -38.695  28.155  1.00 114.50 ? 88  TYR D N   1 
ATOM   5304  C CA  . TYR D 2 88  ? 157.193 -37.766  29.286  1.00 118.70 ? 88  TYR D CA  1 
ATOM   5305  C C   . TYR D 2 88  ? 157.569 -36.365  28.814  1.00 121.74 ? 88  TYR D C   1 
ATOM   5306  O O   . TYR D 2 88  ? 156.940 -35.376  29.197  1.00 123.48 ? 88  TYR D O   1 
ATOM   5307  C CB  . TYR D 2 88  ? 158.110 -38.190  30.439  1.00 118.17 ? 88  TYR D CB  1 
ATOM   5308  C CG  . TYR D 2 88  ? 157.840 -39.566  30.999  1.00 118.12 ? 88  TYR D CG  1 
ATOM   5309  C CD1 . TYR D 2 88  ? 156.535 -40.016  31.199  1.00 119.47 ? 88  TYR D CD1 1 
ATOM   5310  C CD2 . TYR D 2 88  ? 158.891 -40.409  31.357  1.00 117.33 ? 88  TYR D CD2 1 
ATOM   5311  C CE1 . TYR D 2 88  ? 156.286 -41.274  31.716  1.00 121.38 ? 88  TYR D CE1 1 
ATOM   5312  C CE2 . TYR D 2 88  ? 158.652 -41.672  31.869  1.00 118.90 ? 88  TYR D CE2 1 
ATOM   5313  C CZ  . TYR D 2 88  ? 157.349 -42.096  32.051  1.00 121.28 ? 88  TYR D CZ  1 
ATOM   5314  O OH  . TYR D 2 88  ? 157.104 -43.343  32.572  1.00 124.18 ? 88  TYR D OH  1 
ATOM   5315  N N   . ASN D 2 89  ? 158.606 -36.311  27.976  1.00 123.28 ? 89  ASN D N   1 
ATOM   5316  C CA  . ASN D 2 89  ? 159.012 -35.116  27.234  1.00 122.24 ? 89  ASN D CA  1 
ATOM   5317  C C   . ASN D 2 89  ? 157.863 -34.598  26.365  1.00 120.74 ? 89  ASN D C   1 
ATOM   5318  O O   . ASN D 2 89  ? 157.770 -33.399  26.085  1.00 122.16 ? 89  ASN D O   1 
ATOM   5319  C CB  . ASN D 2 89  ? 160.238 -35.463  26.379  1.00 121.28 ? 89  ASN D CB  1 
ATOM   5320  C CG  . ASN D 2 89  ? 160.819 -34.276  25.644  1.00 120.20 ? 89  ASN D CG  1 
ATOM   5321  O OD1 . ASN D 2 89  ? 160.719 -33.134  26.087  1.00 120.33 ? 89  ASN D OD1 1 
ATOM   5322  N ND2 . ASN D 2 89  ? 161.456 -34.553  24.514  1.00 119.06 ? 89  ASN D ND2 1 
ATOM   5323  N N   . GLY D 2 90  ? 156.992 -35.517  25.949  1.00 116.96 ? 90  GLY D N   1 
ATOM   5324  C CA  . GLY D 2 90  ? 155.744 -35.177  25.275  1.00 110.61 ? 90  GLY D CA  1 
ATOM   5325  C C   . GLY D 2 90  ? 154.723 -34.648  26.265  1.00 106.24 ? 90  GLY D C   1 
ATOM   5326  O O   . GLY D 2 90  ? 154.212 -33.540  26.095  1.00 105.88 ? 90  GLY D O   1 
ATOM   5327  N N   . MET D 2 91  ? 154.437 -35.437  27.304  1.00 101.41 ? 91  MET D N   1 
ATOM   5328  C CA  . MET D 2 91  ? 153.484 -35.057  28.357  1.00 97.21  ? 91  MET D CA  1 
ATOM   5329  C C   . MET D 2 91  ? 153.712 -33.615  28.812  1.00 96.48  ? 91  MET D C   1 
ATOM   5330  O O   . MET D 2 91  ? 152.797 -32.791  28.771  1.00 95.07  ? 91  MET D O   1 
ATOM   5331  C CB  . MET D 2 91  ? 153.574 -36.002  29.567  1.00 95.07  ? 91  MET D CB  1 
ATOM   5332  C CG  . MET D 2 91  ? 153.483 -37.496  29.280  1.00 93.17  ? 91  MET D CG  1 
ATOM   5333  S SD  . MET D 2 91  ? 151.990 -38.053  28.438  1.00 91.73  ? 91  MET D SD  1 
ATOM   5334  C CE  . MET D 2 91  ? 150.849 -38.274  29.800  1.00 90.87  ? 91  MET D CE  1 
ATOM   5335  N N   . GLY D 2 92  ? 154.945 -33.322  29.224  1.00 96.73  ? 92  GLY D N   1 
ATOM   5336  C CA  . GLY D 2 92  ? 155.348 -31.979  29.635  1.00 97.97  ? 92  GLY D CA  1 
ATOM   5337  C C   . GLY D 2 92  ? 155.152 -30.929  28.558  1.00 99.56  ? 92  GLY D C   1 
ATOM   5338  O O   . GLY D 2 92  ? 154.704 -29.820  28.846  1.00 100.11 ? 92  GLY D O   1 
ATOM   5339  N N   . GLY D 2 93  ? 155.487 -31.284  27.318  1.00 101.11 ? 93  GLY D N   1 
ATOM   5340  C CA  . GLY D 2 93  ? 155.274 -30.411  26.163  1.00 103.24 ? 93  GLY D CA  1 
ATOM   5341  C C   . GLY D 2 93  ? 153.804 -30.088  25.964  1.00 105.49 ? 93  GLY D C   1 
ATOM   5342  O O   . GLY D 2 93  ? 153.446 -28.944  25.684  1.00 105.44 ? 93  GLY D O   1 
ATOM   5343  N N   . GLY D 2 94  ? 152.957 -31.104  26.114  1.00 107.76 ? 94  GLY D N   1 
ATOM   5344  C CA  . GLY D 2 94  ? 151.509 -30.927  26.052  1.00 112.10 ? 94  GLY D CA  1 
ATOM   5345  C C   . GLY D 2 94  ? 151.040 -30.025  27.170  1.00 116.24 ? 94  GLY D C   1 
ATOM   5346  O O   . GLY D 2 94  ? 150.311 -29.063  26.935  1.00 116.43 ? 94  GLY D O   1 
ATOM   5347  N N   . ALA D 2 95  ? 151.489 -30.333  28.384  1.00 121.46 ? 95  ALA D N   1 
ATOM   5348  C CA  . ALA D 2 95  ? 151.173 -29.549  29.577  1.00 128.41 ? 95  ALA D CA  1 
ATOM   5349  C C   . ALA D 2 95  ? 151.664 -28.099  29.496  1.00 133.93 ? 95  ALA D C   1 
ATOM   5350  O O   . ALA D 2 95  ? 151.134 -27.223  30.182  1.00 134.90 ? 95  ALA D O   1 
ATOM   5351  C CB  . ALA D 2 95  ? 151.737 -30.233  30.810  1.00 128.48 ? 95  ALA D CB  1 
ATOM   5352  N N   . ALA D 2 96  ? 152.675 -27.857  28.663  1.00 140.82 ? 96  ALA D N   1 
ATOM   5353  C CA  . ALA D 2 96  ? 153.196 -26.509  28.431  1.00 147.61 ? 96  ALA D CA  1 
ATOM   5354  C C   . ALA D 2 96  ? 152.329 -25.744  27.433  1.00 151.45 ? 96  ALA D C   1 
ATOM   5355  O O   . ALA D 2 96  ? 152.090 -24.543  27.594  1.00 150.92 ? 96  ALA D O   1 
ATOM   5356  C CB  . ALA D 2 96  ? 154.637 -26.572  27.948  1.00 149.43 ? 96  ALA D CB  1 
ATOM   5357  N N   . ALA D 2 97  ? 151.865 -26.452  26.405  1.00 156.61 ? 97  ALA D N   1 
ATOM   5358  C CA  . ALA D 2 97  ? 150.965 -25.889  25.403  1.00 162.71 ? 97  ALA D CA  1 
ATOM   5359  C C   . ALA D 2 97  ? 149.599 -25.559  26.004  1.00 169.40 ? 97  ALA D C   1 
ATOM   5360  O O   . ALA D 2 97  ? 148.887 -24.687  25.497  1.00 168.03 ? 97  ALA D O   1 
ATOM   5361  C CB  . ALA D 2 97  ? 150.817 -26.845  24.231  1.00 161.35 ? 97  ALA D CB  1 
ATOM   5362  N N   . THR D 2 98  ? 149.248 -26.257  27.087  1.00 180.35 ? 98  THR D N   1 
ATOM   5363  C CA  . THR D 2 98  ? 147.981 -26.037  27.795  1.00 190.46 ? 98  THR D CA  1 
ATOM   5364  C C   . THR D 2 98  ? 147.967 -24.717  28.571  1.00 193.31 ? 98  THR D C   1 
ATOM   5365  O O   . THR D 2 98  ? 146.943 -24.032  28.613  1.00 198.31 ? 98  THR D O   1 
ATOM   5366  C CB  . THR D 2 98  ? 147.622 -27.198  28.757  1.00 192.82 ? 98  THR D CB  1 
ATOM   5367  O OG1 . THR D 2 98  ? 148.644 -27.346  29.751  1.00 191.98 ? 98  THR D OG1 1 
ATOM   5368  C CG2 . THR D 2 98  ? 147.444 -28.513  28.003  1.00 194.12 ? 98  THR D CG2 1 
ATOM   5369  N N   . ILE D 2 99  ? 149.101 -24.368  29.181  1.00 192.69 ? 99  ILE D N   1 
ATOM   5370  C CA  . ILE D 2 99  ? 149.237 -23.113  29.931  1.00 191.09 ? 99  ILE D CA  1 
ATOM   5371  C C   . ILE D 2 99  ? 149.069 -21.910  28.999  1.00 191.42 ? 99  ILE D C   1 
ATOM   5372  O O   . ILE D 2 99  ? 148.522 -20.876  29.394  1.00 188.73 ? 99  ILE D O   1 
ATOM   5373  C CB  . ILE D 2 99  ? 150.585 -23.038  30.687  1.00 190.62 ? 99  ILE D CB  1 
ATOM   5374  C CG1 . ILE D 2 99  ? 150.731 -24.234  31.634  1.00 191.34 ? 99  ILE D CG1 1 
ATOM   5375  C CG2 . ILE D 2 99  ? 150.701 -21.735  31.471  1.00 189.31 ? 99  ILE D CG2 1 
ATOM   5376  C CD1 . ILE D 2 99  ? 152.155 -24.531  32.054  1.00 193.25 ? 99  ILE D CD1 1 
ATOM   5377  N N   . ALA D 2 100 ? 149.532 -22.064  27.761  1.00 194.30 ? 100 ALA D N   1 
ATOM   5378  C CA  . ALA D 2 100 ? 149.332 -21.066  26.717  1.00 200.80 ? 100 ALA D CA  1 
ATOM   5379  C C   . ALA D 2 100 ? 147.875 -21.008  26.266  1.00 209.39 ? 100 ALA D C   1 
ATOM   5380  O O   . ALA D 2 100 ? 147.376 -19.941  25.917  1.00 211.59 ? 100 ALA D O   1 
ATOM   5381  C CB  . ALA D 2 100 ? 150.231 -21.360  25.530  1.00 196.60 ? 100 ALA D CB  1 
ATOM   5382  N N   . ALA D 2 101 ? 147.201 -22.157  26.284  1.00 221.35 ? 101 ALA D N   1 
ATOM   5383  C CA  . ALA D 2 101 ? 145.843 -22.288  25.746  1.00 233.46 ? 101 ALA D CA  1 
ATOM   5384  C C   . ALA D 2 101 ? 144.748 -21.631  26.595  1.00 240.40 ? 101 ALA D C   1 
ATOM   5385  O O   . ALA D 2 101 ? 143.901 -20.910  26.062  1.00 245.49 ? 101 ALA D O   1 
ATOM   5386  C CB  . ALA D 2 101 ? 145.513 -23.754  25.491  1.00 234.89 ? 101 ALA D CB  1 
ATOM   5387  N N   . VAL D 2 102 ? 144.767 -21.884  27.903  1.00 244.26 ? 102 VAL D N   1 
ATOM   5388  C CA  . VAL D 2 102 ? 143.711 -21.408  28.806  1.00 245.21 ? 102 VAL D CA  1 
ATOM   5389  C C   . VAL D 2 102 ? 143.820 -19.906  29.080  1.00 242.54 ? 102 VAL D C   1 
ATOM   5390  O O   . VAL D 2 102 ? 142.804 -19.213  29.181  1.00 241.71 ? 102 VAL D O   1 
ATOM   5391  C CB  . VAL D 2 102 ? 143.685 -22.204  30.134  1.00 249.02 ? 102 VAL D CB  1 
ATOM   5392  C CG1 . VAL D 2 102 ? 142.533 -21.749  31.022  1.00 251.57 ? 102 VAL D CG1 1 
ATOM   5393  C CG2 . VAL D 2 102 ? 143.568 -23.698  29.858  1.00 252.26 ? 102 VAL D CG2 1 
ATOM   5394  N N   . GLU D 2 103 ? 145.050 -19.408  29.182  1.00 240.25 ? 103 GLU D N   1 
ATOM   5395  C CA  . GLU D 2 103 ? 145.287 -17.986  29.436  1.00 240.89 ? 103 GLU D CA  1 
ATOM   5396  C C   . GLU D 2 103 ? 145.239 -17.128  28.159  1.00 247.45 ? 103 GLU D C   1 
ATOM   5397  O O   . GLU D 2 103 ? 145.695 -15.982  28.153  1.00 248.81 ? 103 GLU D O   1 
ATOM   5398  C CB  . GLU D 2 103 ? 146.600 -17.780  30.206  1.00 235.31 ? 103 GLU D CB  1 
ATOM   5399  C CG  . GLU D 2 103 ? 146.586 -18.314  31.636  1.00 230.50 ? 103 GLU D CG  1 
ATOM   5400  C CD  . GLU D 2 103 ? 145.654 -17.548  32.565  1.00 228.06 ? 103 GLU D CD  1 
ATOM   5401  O OE1 . GLU D 2 103 ? 145.614 -16.300  32.491  1.00 227.94 ? 103 GLU D OE1 1 
ATOM   5402  O OE2 . GLU D 2 103 ? 144.966 -18.194  33.384  1.00 224.32 ? 103 GLU D OE2 1 
ATOM   5403  N N   . LEU D 2 104 ? 144.681 -17.693  27.087  1.00 254.90 ? 104 LEU D N   1 
ATOM   5404  C CA  . LEU D 2 104 ? 144.385 -16.946  25.859  1.00 259.63 ? 104 LEU D CA  1 
ATOM   5405  C C   . LEU D 2 104 ? 142.882 -16.933  25.549  1.00 260.99 ? 104 LEU D C   1 
ATOM   5406  O O   . LEU D 2 104 ? 142.416 -16.140  24.725  1.00 256.70 ? 104 LEU D O   1 
ATOM   5407  C CB  . LEU D 2 104 ? 145.177 -17.496  24.663  1.00 261.49 ? 104 LEU D CB  1 
ATOM   5408  C CG  . LEU D 2 104 ? 146.671 -17.166  24.525  1.00 261.38 ? 104 LEU D CG  1 
ATOM   5409  C CD1 . LEU D 2 104 ? 147.258 -17.893  23.324  1.00 260.94 ? 104 LEU D CD1 1 
ATOM   5410  C CD2 . LEU D 2 104 ? 146.926 -15.669  24.415  1.00 261.48 ? 104 LEU D CD2 1 
ATOM   5411  N N   . LEU D 2 105 ? 142.137 -17.817  26.214  1.00 265.05 ? 105 LEU D N   1 
ATOM   5412  C CA  . LEU D 2 105 ? 140.676 -17.863  26.113  1.00 269.49 ? 105 LEU D CA  1 
ATOM   5413  C C   . LEU D 2 105 ? 140.022 -16.825  27.021  1.00 279.14 ? 105 LEU D C   1 
ATOM   5414  O O   . LEU D 2 105 ? 138.905 -16.373  26.760  1.00 281.57 ? 105 LEU D O   1 
ATOM   5415  C CB  . LEU D 2 105 ? 140.155 -19.256  26.478  1.00 264.52 ? 105 LEU D CB  1 
ATOM   5416  C CG  . LEU D 2 105 ? 140.413 -20.415  25.512  1.00 262.57 ? 105 LEU D CG  1 
ATOM   5417  C CD1 . LEU D 2 105 ? 140.158 -21.744  26.207  1.00 261.28 ? 105 LEU D CD1 1 
ATOM   5418  C CD2 . LEU D 2 105 ? 139.553 -20.287  24.261  1.00 262.51 ? 105 LEU D CD2 1 
ATOM   5419  N N   . LYS D 2 106 ? 140.730 -16.467  28.090  1.00 287.38 ? 106 LYS D N   1 
ATOM   5420  C CA  . LYS D 2 106 ? 140.266 -15.484  29.070  1.00 288.13 ? 106 LYS D CA  1 
ATOM   5421  C C   . LYS D 2 106 ? 140.497 -14.048  28.587  1.00 287.47 ? 106 LYS D C   1 
ATOM   5422  O O   . LYS D 2 106 ? 139.729 -13.141  28.923  1.00 290.56 ? 106 LYS D O   1 
ATOM   5423  C CB  . LYS D 2 106 ? 140.990 -15.697  30.405  1.00 293.05 ? 106 LYS D CB  1 
ATOM   5424  C CG  . LYS D 2 106 ? 140.707 -17.031  31.088  1.00 283.76 ? 106 LYS D CG  1 
ATOM   5425  C CD  . LYS D 2 106 ? 139.937 -16.859  32.391  1.00 275.33 ? 106 LYS D CD  1 
ATOM   5426  C CE  . LYS D 2 106 ? 140.874 -16.534  33.548  1.00 269.95 ? 106 LYS D CE  1 
ATOM   5427  N NZ  . LYS D 2 106 ? 140.155 -16.450  34.848  1.00 264.89 ? 106 LYS D NZ  1 
ATOM   5428  N N   . GLY D 2 107 ? 141.555 -13.857  27.796  1.00 295.77 ? 107 GLY D N   1 
ATOM   5429  C CA  . GLY D 2 107 ? 142.007 -12.526  27.386  1.00 295.45 ? 107 GLY D CA  1 
ATOM   5430  C C   . GLY D 2 107 ? 142.682 -11.825  28.551  1.00 296.59 ? 107 GLY D C   1 
ATOM   5431  O O   . GLY D 2 107 ? 142.312 -10.703  28.907  1.00 295.67 ? 107 GLY D O   1 
ATOM   5432  N N   . ALA D 2 108 ? 143.679 -12.493  29.133  1.00 290.44 ? 108 ALA D N   1 
ATOM   5433  C CA  . ALA D 2 108 ? 144.270 -12.083  30.412  1.00 278.97 ? 108 ALA D CA  1 
ATOM   5434  C C   . ALA D 2 108 ? 145.750 -11.679  30.343  1.00 264.90 ? 108 ALA D C   1 
ATOM   5435  O O   . ALA D 2 108 ? 146.554 -12.058  31.205  1.00 258.11 ? 108 ALA D O   1 
ATOM   5436  C CB  . ALA D 2 108 ? 144.054 -13.168  31.462  1.00 283.61 ? 108 ALA D CB  1 
ATOM   5437  N N   . PHE D 2 109 ? 146.100 -10.903  29.321  1.00 250.32 ? 109 PHE D N   1 
ATOM   5438  C CA  . PHE D 2 109 ? 147.429 -10.308  29.230  1.00 240.08 ? 109 PHE D CA  1 
ATOM   5439  C C   . PHE D 2 109 ? 147.340 -8.811   28.980  1.00 251.44 ? 109 PHE D C   1 
ATOM   5440  O O   . PHE D 2 109 ? 147.007 -8.377   27.874  1.00 260.04 ? 109 PHE D O   1 
ATOM   5441  C CB  . PHE D 2 109 ? 148.253 -10.969  28.128  1.00 222.50 ? 109 PHE D CB  1 
ATOM   5442  C CG  . PHE D 2 109 ? 148.774 -12.322  28.493  1.00 211.16 ? 109 PHE D CG  1 
ATOM   5443  C CD1 . PHE D 2 109 ? 149.854 -12.449  29.354  1.00 207.56 ? 109 PHE D CD1 1 
ATOM   5444  C CD2 . PHE D 2 109 ? 148.189 -13.469  27.974  1.00 207.56 ? 109 PHE D CD2 1 
ATOM   5445  C CE1 . PHE D 2 109 ? 150.341 -13.698  29.695  1.00 208.03 ? 109 PHE D CE1 1 
ATOM   5446  C CE2 . PHE D 2 109 ? 148.672 -14.722  28.309  1.00 206.95 ? 109 PHE D CE2 1 
ATOM   5447  C CZ  . PHE D 2 109 ? 149.748 -14.836  29.173  1.00 207.74 ? 109 PHE D CZ  1 
ATOM   5448  N N   . GLU D 2 110 ? 147.637 -8.027   30.015  1.00 260.36 ? 110 GLU D N   1 
ATOM   5449  C CA  . GLU D 2 110 ? 147.650 -6.566   29.905  1.00 269.30 ? 110 GLU D CA  1 
ATOM   5450  C C   . GLU D 2 110 ? 148.953 -6.033   29.291  1.00 267.79 ? 110 GLU D C   1 
ATOM   5451  O O   . GLU D 2 110 ? 149.248 -4.837   29.387  1.00 269.97 ? 110 GLU D O   1 
ATOM   5452  C CB  . GLU D 2 110 ? 147.380 -5.903   31.267  1.00 274.60 ? 110 GLU D CB  1 
ATOM   5453  C CG  . GLU D 2 110 ? 146.022 -5.213   31.392  1.00 281.84 ? 110 GLU D CG  1 
ATOM   5454  C CD  . GLU D 2 110 ? 144.973 -6.034   32.129  1.00 286.62 ? 110 GLU D CD  1 
ATOM   5455  O OE1 . GLU D 2 110 ? 143.766 -5.742   31.960  1.00 289.70 ? 110 GLU D OE1 1 
ATOM   5456  O OE2 . GLU D 2 110 ? 145.347 -6.957   32.888  1.00 289.76 ? 110 GLU D OE2 1 
ATOM   5457  N N   . ASN D 2 111 ? 149.722 -6.919   28.657  1.00 263.52 ? 111 ASN D N   1 
ATOM   5458  C CA  . ASN D 2 111 ? 150.979 -6.543   28.005  1.00 258.02 ? 111 ASN D CA  1 
ATOM   5459  C C   . ASN D 2 111 ? 151.204 -7.283   26.684  1.00 247.01 ? 111 ASN D C   1 
ATOM   5460  O O   . ASN D 2 111 ? 150.893 -8.472   26.564  1.00 247.29 ? 111 ASN D O   1 
ATOM   5461  C CB  . ASN D 2 111 ? 152.161 -6.763   28.956  1.00 264.10 ? 111 ASN D CB  1 
ATOM   5462  C CG  . ASN D 2 111 ? 153.386 -5.940   28.583  1.00 268.60 ? 111 ASN D CG  1 
ATOM   5463  O OD1 . ASN D 2 111 ? 153.866 -5.983   27.447  1.00 270.53 ? 111 ASN D OD1 1 
ATOM   5464  N ND2 . ASN D 2 111 ? 153.909 -5.195   29.552  1.00 269.07 ? 111 ASN D ND2 1 
ATOM   5465  N N   . THR D 2 112 ? 151.752 -6.563   25.704  1.00 230.48 ? 112 THR D N   1 
ATOM   5466  C CA  . THR D 2 112 ? 151.983 -7.085   24.353  1.00 214.56 ? 112 THR D CA  1 
ATOM   5467  C C   . THR D 2 112 ? 153.105 -8.128   24.320  1.00 215.44 ? 112 THR D C   1 
ATOM   5468  O O   . THR D 2 112 ? 152.994 -9.144   23.631  1.00 216.99 ? 112 THR D O   1 
ATOM   5469  C CB  . THR D 2 112 ? 152.301 -5.945   23.357  1.00 203.87 ? 112 THR D CB  1 
ATOM   5470  O OG1 . THR D 2 112 ? 151.408 -4.845   23.576  1.00 194.71 ? 112 THR D OG1 1 
ATOM   5471  C CG2 . THR D 2 112 ? 152.163 -6.420   21.915  1.00 199.30 ? 112 THR D CG2 1 
ATOM   5472  N N   . GLY D 2 113 ? 154.177 -7.867   25.066  1.00 214.24 ? 113 GLY D N   1 
ATOM   5473  C CA  . GLY D 2 113 ? 155.331 -8.765   25.129  1.00 210.63 ? 113 GLY D CA  1 
ATOM   5474  C C   . GLY D 2 113 ? 155.071 -10.075  25.853  1.00 206.06 ? 113 GLY D C   1 
ATOM   5475  O O   . GLY D 2 113 ? 155.684 -11.095  25.532  1.00 204.23 ? 113 GLY D O   1 
ATOM   5476  N N   . LEU D 2 114 ? 154.163 -10.044  26.829  1.00 201.39 ? 114 LEU D N   1 
ATOM   5477  C CA  . LEU D 2 114 ? 153.816 -11.225  27.625  1.00 194.56 ? 114 LEU D CA  1 
ATOM   5478  C C   . LEU D 2 114 ? 153.054 -12.264  26.808  1.00 186.52 ? 114 LEU D C   1 
ATOM   5479  O O   . LEU D 2 114 ? 153.332 -13.460  26.911  1.00 183.14 ? 114 LEU D O   1 
ATOM   5480  C CB  . LEU D 2 114 ? 153.010 -10.837  28.872  1.00 198.52 ? 114 LEU D CB  1 
ATOM   5481  C CG  . LEU D 2 114 ? 153.619 -9.907   29.931  1.00 201.87 ? 114 LEU D CG  1 
ATOM   5482  C CD1 . LEU D 2 114 ? 152.636 -9.725   31.080  1.00 201.26 ? 114 LEU D CD1 1 
ATOM   5483  C CD2 . LEU D 2 114 ? 154.964 -10.403  30.450  1.00 203.51 ? 114 LEU D CD2 1 
ATOM   5484  N N   . MET D 2 115 ? 152.094 -11.803  26.006  1.00 180.38 ? 115 MET D N   1 
ATOM   5485  C CA  . MET D 2 115 ? 151.419 -12.659  25.032  1.00 176.74 ? 115 MET D CA  1 
ATOM   5486  C C   . MET D 2 115 ? 152.446 -13.271  24.083  1.00 172.19 ? 115 MET D C   1 
ATOM   5487  O O   . MET D 2 115 ? 152.392 -14.465  23.793  1.00 170.14 ? 115 MET D O   1 
ATOM   5488  C CB  . MET D 2 115 ? 150.382 -11.867  24.231  1.00 181.81 ? 115 MET D CB  1 
ATOM   5489  C CG  . MET D 2 115 ? 149.047 -11.687  24.932  1.00 186.55 ? 115 MET D CG  1 
ATOM   5490  S SD  . MET D 2 115 ? 147.779 -10.916  23.905  1.00 193.82 ? 115 MET D SD  1 
ATOM   5491  C CE  . MET D 2 115 ? 147.339 -12.275  22.824  1.00 192.63 ? 115 MET D CE  1 
ATOM   5492  N N   . ALA D 2 116 ? 153.391 -12.444  23.631  1.00 168.12 ? 116 ALA D N   1 
ATOM   5493  C CA  . ALA D 2 116 ? 154.466 -12.862  22.722  1.00 163.62 ? 116 ALA D CA  1 
ATOM   5494  C C   . ALA D 2 116 ? 155.413 -13.889  23.345  1.00 159.46 ? 116 ALA D C   1 
ATOM   5495  O O   . ALA D 2 116 ? 156.168 -14.557  22.631  1.00 159.00 ? 116 ALA D O   1 
ATOM   5496  C CB  . ALA D 2 116 ? 155.248 -11.651  22.232  1.00 163.72 ? 116 ALA D CB  1 
ATOM   5497  N N   . LEU D 2 117 ? 155.378 -13.993  24.673  1.00 153.91 ? 117 LEU D N   1 
ATOM   5498  C CA  . LEU D 2 117 ? 156.137 -15.012  25.394  1.00 149.55 ? 117 LEU D CA  1 
ATOM   5499  C C   . LEU D 2 117 ? 155.235 -16.184  25.807  1.00 148.15 ? 117 LEU D C   1 
ATOM   5500  O O   . LEU D 2 117 ? 155.723 -17.284  26.082  1.00 149.48 ? 117 LEU D O   1 
ATOM   5501  C CB  . LEU D 2 117 ? 156.850 -14.407  26.615  1.00 146.08 ? 117 LEU D CB  1 
ATOM   5502  C CG  . LEU D 2 117 ? 157.792 -13.203  26.431  1.00 143.20 ? 117 LEU D CG  1 
ATOM   5503  C CD1 . LEU D 2 117 ? 158.251 -12.664  27.779  1.00 140.27 ? 117 LEU D CD1 1 
ATOM   5504  C CD2 . LEU D 2 117 ? 158.992 -13.517  25.543  1.00 142.55 ? 117 LEU D CD2 1 
ATOM   5505  N N   . ALA D 2 118 ? 153.924 -15.940  25.838  1.00 144.99 ? 118 ALA D N   1 
ATOM   5506  C CA  . ALA D 2 118 ? 152.935 -16.973  26.159  1.00 142.37 ? 118 ALA D CA  1 
ATOM   5507  C C   . ALA D 2 118 ? 152.622 -17.837  24.945  1.00 141.34 ? 118 ALA D C   1 
ATOM   5508  O O   . ALA D 2 118 ? 152.519 -19.058  25.048  1.00 140.40 ? 118 ALA D O   1 
ATOM   5509  C CB  . ALA D 2 118 ? 151.660 -16.340  26.691  1.00 141.78 ? 118 ALA D CB  1 
ATOM   5510  N N   . ILE D 2 119 ? 152.463 -17.184  23.798  1.00 141.43 ? 119 ILE D N   1 
ATOM   5511  C CA  . ILE D 2 119 ? 152.153 -17.853  22.538  1.00 142.37 ? 119 ILE D CA  1 
ATOM   5512  C C   . ILE D 2 119 ? 153.365 -18.641  22.028  1.00 140.48 ? 119 ILE D C   1 
ATOM   5513  O O   . ILE D 2 119 ? 153.227 -19.781  21.576  1.00 142.19 ? 119 ILE D O   1 
ATOM   5514  C CB  . ILE D 2 119 ? 151.657 -16.834  21.483  1.00 144.37 ? 119 ILE D CB  1 
ATOM   5515  C CG1 . ILE D 2 119 ? 150.335 -16.202  21.940  1.00 144.51 ? 119 ILE D CG1 1 
ATOM   5516  C CG2 . ILE D 2 119 ? 151.480 -17.486  20.119  1.00 146.58 ? 119 ILE D CG2 1 
ATOM   5517  C CD1 . ILE D 2 119 ? 150.076 -14.819  21.380  1.00 144.53 ? 119 ILE D CD1 1 
ATOM   5518  N N   . LEU D 2 120 ? 154.546 -18.034  22.128  1.00 136.86 ? 120 LEU D N   1 
ATOM   5519  C CA  . LEU D 2 120 ? 155.787 -18.640  21.648  1.00 133.36 ? 120 LEU D CA  1 
ATOM   5520  C C   . LEU D 2 120 ? 156.139 -19.910  22.427  1.00 133.20 ? 120 LEU D C   1 
ATOM   5521  O O   . LEU D 2 120 ? 156.699 -20.850  21.865  1.00 130.93 ? 120 LEU D O   1 
ATOM   5522  C CB  . LEU D 2 120 ? 156.932 -17.626  21.720  1.00 131.97 ? 120 LEU D CB  1 
ATOM   5523  C CG  . LEU D 2 120 ? 157.756 -17.390  20.449  1.00 130.41 ? 120 LEU D CG  1 
ATOM   5524  C CD1 . LEU D 2 120 ? 158.513 -16.071  20.537  1.00 129.09 ? 120 LEU D CD1 1 
ATOM   5525  C CD2 . LEU D 2 120 ? 158.705 -18.549  20.172  1.00 131.29 ? 120 LEU D CD2 1 
ATOM   5526  N N   . GLY D 2 121 ? 155.802 -19.927  23.717  1.00 135.05 ? 121 GLY D N   1 
ATOM   5527  C CA  . GLY D 2 121 ? 155.967 -21.113  24.557  1.00 138.96 ? 121 GLY D CA  1 
ATOM   5528  C C   . GLY D 2 121 ? 155.030 -22.236  24.150  1.00 142.59 ? 121 GLY D C   1 
ATOM   5529  O O   . GLY D 2 121 ? 155.418 -23.406  24.150  1.00 142.97 ? 121 GLY D O   1 
ATOM   5530  N N   . GLY D 2 122 ? 153.796 -21.874  23.802  1.00 146.10 ? 122 GLY D N   1 
ATOM   5531  C CA  . GLY D 2 122 ? 152.807 -22.827  23.295  1.00 150.66 ? 122 GLY D CA  1 
ATOM   5532  C C   . GLY D 2 122 ? 153.186 -23.384  21.934  1.00 153.80 ? 122 GLY D C   1 
ATOM   5533  O O   . GLY D 2 122 ? 152.893 -24.544  21.629  1.00 154.87 ? 122 GLY D O   1 
ATOM   5534  N N   . LEU D 2 123 ? 153.831 -22.544  21.120  1.00 155.46 ? 123 LEU D N   1 
ATOM   5535  C CA  . LEU D 2 123 ? 154.398 -22.943  19.827  1.00 155.43 ? 123 LEU D CA  1 
ATOM   5536  C C   . LEU D 2 123 ? 155.357 -24.102  20.033  1.00 156.38 ? 123 LEU D C   1 
ATOM   5537  O O   . LEU D 2 123 ? 155.287 -25.118  19.342  1.00 156.48 ? 123 LEU D O   1 
ATOM   5538  C CB  . LEU D 2 123 ? 155.143 -21.757  19.190  1.00 153.16 ? 123 LEU D CB  1 
ATOM   5539  C CG  . LEU D 2 123 ? 155.882 -21.862  17.844  1.00 151.40 ? 123 LEU D CG  1 
ATOM   5540  C CD1 . LEU D 2 123 ? 156.130 -20.463  17.296  1.00 151.50 ? 123 LEU D CD1 1 
ATOM   5541  C CD2 . LEU D 2 123 ? 157.200 -22.628  17.931  1.00 148.56 ? 123 LEU D CD2 1 
ATOM   5542  N N   . ILE D 2 124 ? 156.254 -23.923  20.997  1.00 157.91 ? 124 ILE D N   1 
ATOM   5543  C CA  . ILE D 2 124 ? 157.256 -24.915  21.341  1.00 160.48 ? 124 ILE D CA  1 
ATOM   5544  C C   . ILE D 2 124 ? 156.611 -26.108  22.051  1.00 160.21 ? 124 ILE D C   1 
ATOM   5545  O O   . ILE D 2 124 ? 156.992 -27.255  21.818  1.00 161.71 ? 124 ILE D O   1 
ATOM   5546  C CB  . ILE D 2 124 ? 158.357 -24.291  22.223  1.00 162.29 ? 124 ILE D CB  1 
ATOM   5547  C CG1 . ILE D 2 124 ? 158.939 -23.039  21.556  1.00 163.28 ? 124 ILE D CG1 1 
ATOM   5548  C CG2 . ILE D 2 124 ? 159.465 -25.292  22.477  1.00 163.65 ? 124 ILE D CG2 1 
ATOM   5549  C CD1 . ILE D 2 124 ? 159.673 -22.112  22.505  1.00 164.65 ? 124 ILE D CD1 1 
ATOM   5550  N N   . GLY D 2 125 ? 155.625 -25.826  22.902  1.00 159.03 ? 125 GLY D N   1 
ATOM   5551  C CA  . GLY D 2 125 ? 154.917 -26.856  23.659  1.00 157.03 ? 125 GLY D CA  1 
ATOM   5552  C C   . GLY D 2 125 ? 154.204 -27.877  22.793  1.00 156.24 ? 125 GLY D C   1 
ATOM   5553  O O   . GLY D 2 125 ? 154.404 -29.081  22.957  1.00 153.78 ? 125 GLY D O   1 
ATOM   5554  N N   . SER D 2 126 ? 153.379 -27.389  21.868  1.00 157.89 ? 126 SER D N   1 
ATOM   5555  C CA  . SER D 2 126 ? 152.617 -28.244  20.955  1.00 160.45 ? 126 SER D CA  1 
ATOM   5556  C C   . SER D 2 126 ? 153.516 -29.070  20.037  1.00 163.96 ? 126 SER D C   1 
ATOM   5557  O O   . SER D 2 126 ? 153.259 -30.253  19.814  1.00 161.87 ? 126 SER D O   1 
ATOM   5558  C CB  . SER D 2 126 ? 151.648 -27.407  20.120  1.00 159.78 ? 126 SER D CB  1 
ATOM   5559  O OG  . SER D 2 126 ? 150.647 -26.823  20.932  1.00 159.34 ? 126 SER D OG  1 
ATOM   5560  N N   . VAL D 2 127 ? 154.564 -28.434  19.512  1.00 170.68 ? 127 VAL D N   1 
ATOM   5561  C CA  . VAL D 2 127 ? 155.544 -29.096  18.646  1.00 177.12 ? 127 VAL D CA  1 
ATOM   5562  C C   . VAL D 2 127 ? 156.290 -30.206  19.403  1.00 180.61 ? 127 VAL D C   1 
ATOM   5563  O O   . VAL D 2 127 ? 156.340 -31.350  18.938  1.00 184.64 ? 127 VAL D O   1 
ATOM   5564  C CB  . VAL D 2 127 ? 156.533 -28.075  18.015  1.00 177.48 ? 127 VAL D CB  1 
ATOM   5565  C CG1 . VAL D 2 127 ? 157.722 -28.772  17.371  1.00 179.01 ? 127 VAL D CG1 1 
ATOM   5566  C CG2 . VAL D 2 127 ? 155.829 -27.201  16.986  1.00 175.03 ? 127 VAL D CG2 1 
ATOM   5567  N N   . ALA D 2 128 ? 156.838 -29.867  20.574  1.00 180.13 ? 128 ALA D N   1 
ATOM   5568  C CA  . ALA D 2 128 ? 157.621 -30.803  21.398  1.00 175.59 ? 128 ALA D CA  1 
ATOM   5569  C C   . ALA D 2 128 ? 156.780 -31.932  21.989  1.00 170.82 ? 128 ALA D C   1 
ATOM   5570  O O   . ALA D 2 128 ? 157.303 -32.995  22.335  1.00 171.02 ? 128 ALA D O   1 
ATOM   5571  C CB  . ALA D 2 128 ? 158.357 -30.058  22.505  1.00 174.91 ? 128 ALA D CB  1 
ATOM   5572  N N   . PHE D 2 129 ? 155.479 -31.687  22.108  1.00 164.14 ? 129 PHE D N   1 
ATOM   5573  C CA  . PHE D 2 129 ? 154.538 -32.695  22.564  1.00 157.71 ? 129 PHE D CA  1 
ATOM   5574  C C   . PHE D 2 129 ? 154.269 -33.716  21.463  1.00 148.41 ? 129 PHE D C   1 
ATOM   5575  O O   . PHE D 2 129 ? 154.533 -34.908  21.634  1.00 145.97 ? 129 PHE D O   1 
ATOM   5576  C CB  . PHE D 2 129 ? 153.237 -32.024  23.014  1.00 163.66 ? 129 PHE D CB  1 
ATOM   5577  C CG  . PHE D 2 129 ? 152.083 -32.969  23.179  1.00 171.32 ? 129 PHE D CG  1 
ATOM   5578  C CD1 . PHE D 2 129 ? 152.085 -33.931  24.185  1.00 173.65 ? 129 PHE D CD1 1 
ATOM   5579  C CD2 . PHE D 2 129 ? 150.984 -32.888  22.335  1.00 176.04 ? 129 PHE D CD2 1 
ATOM   5580  C CE1 . PHE D 2 129 ? 151.019 -34.800  24.341  1.00 178.61 ? 129 PHE D CE1 1 
ATOM   5581  C CE2 . PHE D 2 129 ? 149.912 -33.755  22.485  1.00 180.72 ? 129 PHE D CE2 1 
ATOM   5582  C CZ  . PHE D 2 129 ? 149.930 -34.712  23.489  1.00 181.11 ? 129 PHE D CZ  1 
ATOM   5583  N N   . THR D 2 130 ? 153.764 -33.231  20.331  1.00 138.27 ? 130 THR D N   1 
ATOM   5584  C CA  . THR D 2 130 ? 153.308 -34.090  19.241  1.00 129.93 ? 130 THR D CA  1 
ATOM   5585  C C   . THR D 2 130 ? 154.444 -34.798  18.492  1.00 125.51 ? 130 THR D C   1 
ATOM   5586  O O   . THR D 2 130 ? 154.266 -35.912  17.995  1.00 124.01 ? 130 THR D O   1 
ATOM   5587  C CB  . THR D 2 130 ? 152.392 -33.323  18.261  1.00 128.61 ? 130 THR D CB  1 
ATOM   5588  O OG1 . THR D 2 130 ? 151.702 -34.253  17.422  1.00 128.40 ? 130 THR D OG1 1 
ATOM   5589  C CG2 . THR D 2 130 ? 153.183 -32.343  17.401  1.00 127.34 ? 130 THR D CG2 1 
ATOM   5590  N N   . GLY D 2 131 ? 155.602 -34.146  18.422  1.00 121.85 ? 131 GLY D N   1 
ATOM   5591  C CA  . GLY D 2 131 ? 156.783 -34.714  17.777  1.00 118.45 ? 131 GLY D CA  1 
ATOM   5592  C C   . GLY D 2 131 ? 157.344 -35.886  18.555  1.00 116.90 ? 131 GLY D C   1 
ATOM   5593  O O   . GLY D 2 131 ? 157.798 -36.872  17.969  1.00 115.43 ? 131 GLY D O   1 
ATOM   5594  N N   . SER D 2 132 ? 157.301 -35.769  19.882  1.00 116.68 ? 132 SER D N   1 
ATOM   5595  C CA  . SER D 2 132 ? 157.741 -36.825  20.792  1.00 116.74 ? 132 SER D CA  1 
ATOM   5596  C C   . SER D 2 132 ? 156.769 -37.999  20.826  1.00 117.20 ? 132 SER D C   1 
ATOM   5597  O O   . SER D 2 132 ? 157.095 -39.067  21.350  1.00 116.76 ? 132 SER D O   1 
ATOM   5598  C CB  . SER D 2 132 ? 157.924 -36.267  22.203  1.00 116.45 ? 132 SER D CB  1 
ATOM   5599  O OG  . SER D 2 132 ? 159.176 -35.620  22.342  1.00 116.79 ? 132 SER D OG  1 
ATOM   5600  N N   . LEU D 2 133 ? 155.572 -37.785  20.280  1.00 118.75 ? 133 LEU D N   1 
ATOM   5601  C CA  . LEU D 2 133 ? 154.582 -38.847  20.126  1.00 121.54 ? 133 LEU D CA  1 
ATOM   5602  C C   . LEU D 2 133 ? 154.761 -39.599  18.808  1.00 126.24 ? 133 LEU D C   1 
ATOM   5603  O O   . LEU D 2 133 ? 154.342 -40.753  18.684  1.00 126.82 ? 133 LEU D O   1 
ATOM   5604  C CB  . LEU D 2 133 ? 153.164 -38.280  20.227  1.00 118.65 ? 133 LEU D CB  1 
ATOM   5605  C CG  . LEU D 2 133 ? 152.457 -38.342  21.587  1.00 116.83 ? 133 LEU D CG  1 
ATOM   5606  C CD1 . LEU D 2 133 ? 153.207 -37.591  22.681  1.00 115.54 ? 133 LEU D CD1 1 
ATOM   5607  C CD2 . LEU D 2 133 ? 151.036 -37.811  21.452  1.00 116.71 ? 133 LEU D CD2 1 
ATOM   5608  N N   . ILE D 2 134 ? 155.373 -38.935  17.828  1.00 131.83 ? 134 ILE D N   1 
ATOM   5609  C CA  . ILE D 2 134 ? 155.720 -39.566  16.552  1.00 137.24 ? 134 ILE D CA  1 
ATOM   5610  C C   . ILE D 2 134 ? 157.064 -40.272  16.675  1.00 143.45 ? 134 ILE D C   1 
ATOM   5611  O O   . ILE D 2 134 ? 157.257 -41.355  16.119  1.00 144.68 ? 134 ILE D O   1 
ATOM   5612  C CB  . ILE D 2 134 ? 155.756 -38.545  15.393  1.00 135.51 ? 134 ILE D CB  1 
ATOM   5613  C CG1 . ILE D 2 134 ? 154.399 -37.842  15.244  1.00 135.43 ? 134 ILE D CG1 1 
ATOM   5614  C CG2 . ILE D 2 134 ? 156.194 -39.196  14.082  1.00 134.22 ? 134 ILE D CG2 1 
ATOM   5615  C CD1 . ILE D 2 134 ? 153.204 -38.766  15.085  1.00 134.98 ? 134 ILE D CD1 1 
ATOM   5616  N N   . ALA D 2 135 ? 157.987 -39.645  17.404  1.00 150.62 ? 135 ALA D N   1 
ATOM   5617  C CA  . ALA D 2 135 ? 159.242 -40.282  17.792  1.00 158.37 ? 135 ALA D CA  1 
ATOM   5618  C C   . ALA D 2 135 ? 158.941 -41.572  18.554  1.00 164.86 ? 135 ALA D C   1 
ATOM   5619  O O   . ALA D 2 135 ? 159.506 -42.626  18.256  1.00 165.01 ? 135 ALA D O   1 
ATOM   5620  C CB  . ALA D 2 135 ? 160.073 -39.335  18.645  1.00 157.89 ? 135 ALA D CB  1 
ATOM   5621  N N   . PHE D 2 136 ? 158.028 -41.468  19.521  1.00 173.20 ? 136 PHE D N   1 
ATOM   5622  C CA  . PHE D 2 136 ? 157.492 -42.607  20.269  1.00 179.68 ? 136 PHE D CA  1 
ATOM   5623  C C   . PHE D 2 136 ? 157.014 -43.725  19.336  1.00 172.91 ? 136 PHE D C   1 
ATOM   5624  O O   . PHE D 2 136 ? 157.338 -44.897  19.542  1.00 171.43 ? 136 PHE D O   1 
ATOM   5625  C CB  . PHE D 2 136 ? 156.346 -42.125  21.175  1.00 191.63 ? 136 PHE D CB  1 
ATOM   5626  C CG  . PHE D 2 136 ? 155.657 -43.220  21.942  1.00 203.38 ? 136 PHE D CG  1 
ATOM   5627  C CD1 . PHE D 2 136 ? 156.194 -43.702  23.132  1.00 207.62 ? 136 PHE D CD1 1 
ATOM   5628  C CD2 . PHE D 2 136 ? 154.454 -43.753  21.488  1.00 207.58 ? 136 PHE D CD2 1 
ATOM   5629  C CE1 . PHE D 2 136 ? 155.555 -44.708  23.844  1.00 211.77 ? 136 PHE D CE1 1 
ATOM   5630  C CE2 . PHE D 2 136 ? 153.811 -44.759  22.194  1.00 211.02 ? 136 PHE D CE2 1 
ATOM   5631  C CZ  . PHE D 2 136 ? 154.361 -45.236  23.374  1.00 212.24 ? 136 PHE D CZ  1 
ATOM   5632  N N   . ALA D 2 137 ? 156.261 -43.344  18.304  1.00 164.64 ? 137 ALA D N   1 
ATOM   5633  C CA  . ALA D 2 137 ? 155.690 -44.289  17.343  1.00 155.32 ? 137 ALA D CA  1 
ATOM   5634  C C   . ALA D 2 137 ? 156.743 -44.998  16.486  1.00 149.91 ? 137 ALA D C   1 
ATOM   5635  O O   . ALA D 2 137 ? 156.477 -46.061  15.923  1.00 147.01 ? 137 ALA D O   1 
ATOM   5636  C CB  . ALA D 2 137 ? 154.673 -43.583  16.454  1.00 153.94 ? 137 ALA D CB  1 
ATOM   5637  N N   . LYS D 2 138 ? 157.934 -44.412  16.400  1.00 145.96 ? 138 LYS D N   1 
ATOM   5638  C CA  . LYS D 2 138 ? 158.972 -44.917  15.505  1.00 144.03 ? 138 LYS D CA  1 
ATOM   5639  C C   . LYS D 2 138 ? 160.092 -45.674  16.229  1.00 145.93 ? 138 LYS D C   1 
ATOM   5640  O O   . LYS D 2 138 ? 160.910 -46.340  15.589  1.00 144.22 ? 138 LYS D O   1 
ATOM   5641  C CB  . LYS D 2 138 ? 159.511 -43.781  14.623  1.00 140.38 ? 138 LYS D CB  1 
ATOM   5642  C CG  . LYS D 2 138 ? 158.454 -43.215  13.678  1.00 135.75 ? 138 LYS D CG  1 
ATOM   5643  C CD  . LYS D 2 138 ? 158.791 -41.827  13.151  1.00 129.79 ? 138 LYS D CD  1 
ATOM   5644  C CE  . LYS D 2 138 ? 159.463 -41.887  11.788  1.00 126.29 ? 138 LYS D CE  1 
ATOM   5645  N NZ  . LYS D 2 138 ? 159.491 -40.543  11.142  1.00 121.33 ? 138 LYS D NZ  1 
ATOM   5646  N N   . LEU D 2 139 ? 160.117 -45.579  17.557  1.00 151.14 ? 139 LEU D N   1 
ATOM   5647  C CA  . LEU D 2 139 ? 161.024 -46.396  18.360  1.00 160.19 ? 139 LEU D CA  1 
ATOM   5648  C C   . LEU D 2 139 ? 160.336 -47.659  18.879  1.00 171.27 ? 139 LEU D C   1 
ATOM   5649  O O   . LEU D 2 139 ? 160.988 -48.688  19.057  1.00 176.28 ? 139 LEU D O   1 
ATOM   5650  C CB  . LEU D 2 139 ? 161.626 -45.605  19.530  1.00 155.97 ? 139 LEU D CB  1 
ATOM   5651  C CG  . LEU D 2 139 ? 162.750 -44.604  19.247  1.00 153.22 ? 139 LEU D CG  1 
ATOM   5652  C CD1 . LEU D 2 139 ? 162.263 -43.186  19.483  1.00 151.70 ? 139 LEU D CD1 1 
ATOM   5653  C CD2 . LEU D 2 139 ? 163.962 -44.877  20.125  1.00 151.65 ? 139 LEU D CD2 1 
ATOM   5654  N N   . GLN D 2 140 ? 159.023 -47.577  19.104  1.00 184.12 ? 140 GLN D N   1 
ATOM   5655  C CA  . GLN D 2 140 ? 158.266 -48.666  19.737  1.00 201.90 ? 140 GLN D CA  1 
ATOM   5656  C C   . GLN D 2 140 ? 158.050 -49.857  18.801  1.00 218.70 ? 140 GLN D C   1 
ATOM   5657  O O   . GLN D 2 140 ? 158.515 -50.962  19.089  1.00 226.37 ? 140 GLN D O   1 
ATOM   5658  C CB  . GLN D 2 140 ? 156.926 -48.156  20.287  1.00 199.15 ? 140 GLN D CB  1 
ATOM   5659  C CG  . GLN D 2 140 ? 156.602 -48.624  21.704  1.00 198.70 ? 140 GLN D CG  1 
ATOM   5660  C CD  . GLN D 2 140 ? 156.241 -50.099  21.798  1.00 197.72 ? 140 GLN D CD  1 
ATOM   5661  O OE1 . GLN D 2 140 ? 155.349 -50.584  21.098  1.00 196.65 ? 140 GLN D OE1 1 
ATOM   5662  N NE2 . GLN D 2 140 ? 156.925 -50.818  22.683  1.00 196.81 ? 140 GLN D NE2 1 
ATOM   5663  N N   . GLY D 2 141 ? 157.341 -49.640  17.694  1.00 236.38 ? 141 GLY D N   1 
ATOM   5664  C CA  . GLY D 2 141 ? 157.195 -50.679  16.674  1.00 259.80 ? 141 GLY D CA  1 
ATOM   5665  C C   . GLY D 2 141 ? 155.807 -51.013  16.146  1.00 275.25 ? 141 GLY D C   1 
ATOM   5666  O O   . GLY D 2 141 ? 155.688 -51.802  15.203  1.00 286.82 ? 141 GLY D O   1 
ATOM   5667  N N   . ILE D 2 142 ? 154.759 -50.437  16.738  1.00 278.48 ? 142 ILE D N   1 
ATOM   5668  C CA  . ILE D 2 142 ? 153.382 -50.669  16.251  1.00 273.39 ? 142 ILE D CA  1 
ATOM   5669  C C   . ILE D 2 142 ? 153.052 -49.942  14.927  1.00 274.60 ? 142 ILE D C   1 
ATOM   5670  O O   . ILE D 2 142 ? 152.088 -50.304  14.241  1.00 283.76 ? 142 ILE D O   1 
ATOM   5671  C CB  . ILE D 2 142 ? 152.281 -50.475  17.338  1.00 262.36 ? 142 ILE D CB  1 
ATOM   5672  C CG1 . ILE D 2 142 ? 152.876 -49.973  18.662  1.00 254.79 ? 142 ILE D CG1 1 
ATOM   5673  C CG2 . ILE D 2 142 ? 151.536 -51.787  17.569  1.00 254.42 ? 142 ILE D CG2 1 
ATOM   5674  C CD1 . ILE D 2 142 ? 151.861 -49.755  19.769  1.00 244.60 ? 142 ILE D CD1 1 
ATOM   5675  N N   . MET D 2 143 ? 153.855 -48.929  14.586  1.00 261.63 ? 143 MET D N   1 
ATOM   5676  C CA  . MET D 2 143 ? 153.912 -48.341  13.231  1.00 237.91 ? 143 MET D CA  1 
ATOM   5677  C C   . MET D 2 143 ? 155.282 -47.659  13.045  1.00 234.40 ? 143 MET D C   1 
ATOM   5678  O O   . MET D 2 143 ? 155.372 -46.453  12.783  1.00 234.27 ? 143 MET D O   1 
ATOM   5679  C CB  . MET D 2 143 ? 152.741 -47.371  12.969  1.00 223.12 ? 143 MET D CB  1 
ATOM   5680  C CG  . MET D 2 143 ? 152.428 -47.098  11.494  1.00 200.96 ? 143 MET D CG  1 
ATOM   5681  S SD  . MET D 2 143 ? 151.467 -48.370  10.637  1.00 181.71 ? 143 MET D SD  1 
ATOM   5682  C CE  . MET D 2 143 ? 151.060 -47.537  9.103   1.00 175.16 ? 143 MET D CE  1 
ATOM   5683  N N   . LYS D 2 144 ? 156.340 -48.459  13.200  1.00 226.91 ? 144 LYS D N   1 
ATOM   5684  C CA  . LYS D 2 144 ? 157.733 -48.011  13.080  1.00 218.05 ? 144 LYS D CA  1 
ATOM   5685  C C   . LYS D 2 144 ? 158.060 -47.580  11.653  1.00 220.72 ? 144 LYS D C   1 
ATOM   5686  O O   . LYS D 2 144 ? 157.494 -48.109  10.691  1.00 223.19 ? 144 LYS D O   1 
ATOM   5687  C CB  . LYS D 2 144 ? 158.690 -49.136  13.511  1.00 207.00 ? 144 LYS D CB  1 
ATOM   5688  C CG  . LYS D 2 144 ? 160.174 -48.791  13.422  1.00 196.20 ? 144 LYS D CG  1 
ATOM   5689  C CD  . LYS D 2 144 ? 161.005 -49.972  12.938  1.00 189.79 ? 144 LYS D CD  1 
ATOM   5690  C CE  . LYS D 2 144 ? 161.604 -50.768  14.088  1.00 186.20 ? 144 LYS D CE  1 
ATOM   5691  N NZ  . LYS D 2 144 ? 162.796 -50.085  14.667  1.00 181.62 ? 144 LYS D NZ  1 
ATOM   5692  N N   . SER D 2 145 ? 158.975 -46.620  11.528  1.00 221.82 ? 145 SER D N   1 
ATOM   5693  C CA  . SER D 2 145 ? 159.453 -46.161  10.228  1.00 222.69 ? 145 SER D CA  1 
ATOM   5694  C C   . SER D 2 145 ? 160.838 -45.542  10.307  1.00 227.17 ? 145 SER D C   1 
ATOM   5695  O O   . SER D 2 145 ? 161.247 -45.026  11.350  1.00 229.63 ? 145 SER D O   1 
ATOM   5696  C CB  . SER D 2 145 ? 158.482 -45.145  9.618   1.00 218.78 ? 145 SER D CB  1 
ATOM   5697  O OG  . SER D 2 145 ? 157.329 -45.785  9.099   1.00 217.41 ? 145 SER D OG  1 
ATOM   5698  N N   . ARG D 2 146 ? 161.553 -45.609  9.189   1.00 231.82 ? 146 ARG D N   1 
ATOM   5699  C CA  . ARG D 2 146 ? 162.740 -44.795  8.973   1.00 240.53 ? 146 ARG D CA  1 
ATOM   5700  C C   . ARG D 2 146 ? 162.249 -43.457  8.396   1.00 257.02 ? 146 ARG D C   1 
ATOM   5701  O O   . ARG D 2 146 ? 161.041 -43.190  8.430   1.00 253.16 ? 146 ARG D O   1 
ATOM   5702  C CB  . ARG D 2 146 ? 163.708 -45.498  8.019   1.00 231.10 ? 146 ARG D CB  1 
ATOM   5703  C CG  . ARG D 2 146 ? 163.982 -46.961  8.328   1.00 218.82 ? 146 ARG D CG  1 
ATOM   5704  C CD  . ARG D 2 146 ? 163.312 -47.853  7.296   1.00 211.91 ? 146 ARG D CD  1 
ATOM   5705  N NE  . ARG D 2 146 ? 164.210 -48.917  6.855   1.00 206.31 ? 146 ARG D NE  1 
ATOM   5706  C CZ  . ARG D 2 146 ? 165.179 -48.762  5.953   1.00 205.44 ? 146 ARG D CZ  1 
ATOM   5707  N NH1 . ARG D 2 146 ? 165.391 -47.581  5.380   1.00 205.00 ? 146 ARG D NH1 1 
ATOM   5708  N NH2 . ARG D 2 146 ? 165.942 -49.794  5.627   1.00 204.20 ? 146 ARG D NH2 1 
ATOM   5709  N N   . PRO D 2 147 ? 163.161 -42.602  7.874   1.00 275.47 ? 147 PRO D N   1 
ATOM   5710  C CA  . PRO D 2 147 ? 162.648 -41.367  7.274   1.00 281.46 ? 147 PRO D CA  1 
ATOM   5711  C C   . PRO D 2 147 ? 161.736 -41.650  6.085   1.00 277.38 ? 147 PRO D C   1 
ATOM   5712  O O   . PRO D 2 147 ? 162.057 -42.494  5.242   1.00 277.12 ? 147 PRO D O   1 
ATOM   5713  C CB  . PRO D 2 147 ? 163.914 -40.645  6.795   1.00 288.49 ? 147 PRO D CB  1 
ATOM   5714  C CG  . PRO D 2 147 ? 165.023 -41.224  7.597   1.00 289.10 ? 147 PRO D CG  1 
ATOM   5715  C CD  . PRO D 2 147 ? 164.636 -42.653  7.838   1.00 283.95 ? 147 PRO D CD  1 
ATOM   5716  N N   . ILE D 2 148 ? 160.604 -40.957  6.033   1.00 270.14 ? 148 ILE D N   1 
ATOM   5717  C CA  . ILE D 2 148 ? 159.688 -41.083  4.903   1.00 263.44 ? 148 ILE D CA  1 
ATOM   5718  C C   . ILE D 2 148 ? 160.188 -40.267  3.703   1.00 261.75 ? 148 ILE D C   1 
ATOM   5719  O O   . ILE D 2 148 ? 160.035 -40.689  2.555   1.00 260.19 ? 148 ILE D O   1 
ATOM   5720  C CB  . ILE D 2 148 ? 158.224 -40.744  5.290   1.00 262.01 ? 148 ILE D CB  1 
ATOM   5721  C CG1 . ILE D 2 148 ? 158.104 -39.341  5.894   1.00 262.16 ? 148 ILE D CG1 1 
ATOM   5722  C CG2 . ILE D 2 148 ? 157.676 -41.781  6.263   1.00 259.75 ? 148 ILE D CG2 1 
ATOM   5723  C CD1 . ILE D 2 148 ? 157.697 -38.276  4.898   1.00 262.62 ? 148 ILE D CD1 1 
ATOM   5724  N N   . LEU D 2 149 ? 160.795 -39.113  3.991   1.00 260.52 ? 149 LEU D N   1 
ATOM   5725  C CA  . LEU D 2 149 ? 161.432 -38.233  2.994   1.00 259.37 ? 149 LEU D CA  1 
ATOM   5726  C C   . LEU D 2 149 ? 160.630 -37.980  1.705   1.00 263.14 ? 149 LEU D C   1 
ATOM   5727  O O   . LEU D 2 149 ? 161.057 -38.388  0.620   1.00 263.30 ? 149 LEU D O   1 
ATOM   5728  C CB  . LEU D 2 149 ? 162.857 -38.725  2.662   1.00 254.76 ? 149 LEU D CB  1 
ATOM   5729  C CG  . LEU D 2 149 ? 164.088 -37.903  3.084   1.00 251.20 ? 149 LEU D CG  1 
ATOM   5730  C CD1 . LEU D 2 149 ? 164.118 -37.592  4.573   1.00 249.95 ? 149 LEU D CD1 1 
ATOM   5731  C CD2 . LEU D 2 149 ? 165.378 -38.605  2.680   1.00 249.56 ? 149 LEU D CD2 1 
ATOM   5732  N N   . PHE D 2 150 ? 159.483 -37.308  1.819   1.00 268.66 ? 150 PHE D N   1 
ATOM   5733  C CA  . PHE D 2 150 ? 158.669 -37.015  0.628   1.00 273.73 ? 150 PHE D CA  1 
ATOM   5734  C C   . PHE D 2 150 ? 159.189 -35.811  -0.175  1.00 280.02 ? 150 PHE D C   1 
ATOM   5735  O O   . PHE D 2 150 ? 159.770 -34.893  0.404   1.00 282.94 ? 150 PHE D O   1 
ATOM   5736  C CB  . PHE D 2 150 ? 157.148 -36.988  0.929   1.00 268.26 ? 150 PHE D CB  1 
ATOM   5737  C CG  . PHE D 2 150 ? 156.648 -35.745  1.626   1.00 260.11 ? 150 PHE D CG  1 
ATOM   5738  C CD1 . PHE D 2 150 ? 156.218 -34.642  0.892   1.00 256.26 ? 150 PHE D CD1 1 
ATOM   5739  C CD2 . PHE D 2 150 ? 156.533 -35.705  3.013   1.00 255.75 ? 150 PHE D CD2 1 
ATOM   5740  C CE1 . PHE D 2 150 ? 155.730 -33.511  1.530   1.00 251.21 ? 150 PHE D CE1 1 
ATOM   5741  C CE2 . PHE D 2 150 ? 156.044 -34.578  3.658   1.00 250.91 ? 150 PHE D CE2 1 
ATOM   5742  C CZ  . PHE D 2 150 ? 155.641 -33.480  2.915   1.00 249.87 ? 150 PHE D CZ  1 
ATOM   5743  N N   . PRO D 2 151 ? 159.014 -35.829  -1.516  1.00 283.30 ? 151 PRO D N   1 
ATOM   5744  C CA  . PRO D 2 151 ? 159.621 -34.827  -2.410  1.00 279.86 ? 151 PRO D CA  1 
ATOM   5745  C C   . PRO D 2 151 ? 159.196 -33.387  -2.141  1.00 276.40 ? 151 PRO D C   1 
ATOM   5746  O O   . PRO D 2 151 ? 158.002 -33.099  -2.024  1.00 273.27 ? 151 PRO D O   1 
ATOM   5747  C CB  . PRO D 2 151 ? 159.153 -35.263  -3.806  1.00 281.69 ? 151 PRO D CB  1 
ATOM   5748  C CG  . PRO D 2 151 ? 157.962 -36.125  -3.566  1.00 286.35 ? 151 PRO D CG  1 
ATOM   5749  C CD  . PRO D 2 151 ? 158.256 -36.835  -2.281  1.00 286.88 ? 151 PRO D CD  1 
ATOM   5750  N N   . GLY D 2 152 ? 160.185 -32.499  -2.053  1.00 274.67 ? 152 GLY D N   1 
ATOM   5751  C CA  . GLY D 2 152 ? 159.950 -31.088  -1.761  1.00 280.36 ? 152 GLY D CA  1 
ATOM   5752  C C   . GLY D 2 152 ? 159.224 -30.872  -0.446  1.00 287.87 ? 152 GLY D C   1 
ATOM   5753  O O   . GLY D 2 152 ? 158.360 -29.997  -0.344  1.00 283.58 ? 152 GLY D O   1 
ATOM   5754  N N   . GLN D 2 153 ? 159.571 -31.679  0.557   1.00 298.76 ? 153 GLN D N   1 
ATOM   5755  C CA  . GLN D 2 153 ? 158.964 -31.582  1.887   1.00 306.92 ? 153 GLN D CA  1 
ATOM   5756  C C   . GLN D 2 153 ? 159.503 -30.389  2.672   1.00 303.73 ? 153 GLN D C   1 
ATOM   5757  O O   . GLN D 2 153 ? 158.792 -29.810  3.493   1.00 305.17 ? 153 GLN D O   1 
ATOM   5758  C CB  . GLN D 2 153 ? 159.158 -32.879  2.688   1.00 302.40 ? 153 GLN D CB  1 
ATOM   5759  C CG  . GLN D 2 153 ? 160.597 -33.203  3.075   1.00 295.12 ? 153 GLN D CG  1 
ATOM   5760  C CD  . GLN D 2 153 ? 160.729 -34.473  3.897   1.00 293.41 ? 153 GLN D CD  1 
ATOM   5761  O OE1 . GLN D 2 153 ? 159.775 -34.932  4.529   1.00 293.32 ? 153 GLN D OE1 1 
ATOM   5762  N NE2 . GLN D 2 153 ? 161.928 -35.042  3.899   1.00 286.58 ? 153 GLN D NE2 1 
ATOM   5763  N N   . LYS D 2 154 ? 160.759 -30.031  2.403   1.00 295.13 ? 154 LYS D N   1 
ATOM   5764  C CA  . LYS D 2 154 ? 161.430 -28.914  3.070   1.00 300.14 ? 154 LYS D CA  1 
ATOM   5765  C C   . LYS D 2 154 ? 160.781 -27.574  2.700   1.00 296.68 ? 154 LYS D C   1 
ATOM   5766  O O   . LYS D 2 154 ? 160.976 -26.571  3.391   1.00 299.95 ? 154 LYS D O   1 
ATOM   5767  C CB  . LYS D 2 154 ? 162.925 -28.913  2.720   1.00 303.00 ? 154 LYS D CB  1 
ATOM   5768  C CG  . LYS D 2 154 ? 163.829 -28.268  3.761   1.00 297.79 ? 154 LYS D CG  1 
ATOM   5769  C CD  . LYS D 2 154 ? 165.286 -28.294  3.319   1.00 285.84 ? 154 LYS D CD  1 
ATOM   5770  C CE  . LYS D 2 154 ? 166.182 -27.569  4.310   1.00 274.74 ? 154 LYS D CE  1 
ATOM   5771  N NZ  . LYS D 2 154 ? 167.592 -27.494  3.836   1.00 264.18 ? 154 LYS D NZ  1 
ATOM   5772  N N   . ALA D 2 155 ? 160.005 -27.577  1.616   1.00 275.41 ? 155 ALA D N   1 
ATOM   5773  C CA  . ALA D 2 155 ? 159.286 -26.393  1.146   1.00 251.56 ? 155 ALA D CA  1 
ATOM   5774  C C   . ALA D 2 155 ? 157.882 -26.290  1.740   1.00 236.18 ? 155 ALA D C   1 
ATOM   5775  O O   . ALA D 2 155 ? 157.382 -25.188  1.967   1.00 231.50 ? 155 ALA D O   1 
ATOM   5776  C CB  . ALA D 2 155 ? 159.219 -26.385  -0.374  1.00 250.72 ? 155 ALA D CB  1 
ATOM   5777  N N   . VAL D 2 156 ? 157.252 -27.438  1.983   1.00 222.78 ? 156 VAL D N   1 
ATOM   5778  C CA  . VAL D 2 156 ? 155.897 -27.475  2.541   1.00 215.84 ? 156 VAL D CA  1 
ATOM   5779  C C   . VAL D 2 156 ? 155.894 -27.522  4.073   1.00 221.54 ? 156 VAL D C   1 
ATOM   5780  O O   . VAL D 2 156 ? 154.906 -27.145  4.706   1.00 218.01 ? 156 VAL D O   1 
ATOM   5781  C CB  . VAL D 2 156 ? 155.047 -28.627  1.950   1.00 208.35 ? 156 VAL D CB  1 
ATOM   5782  C CG1 . VAL D 2 156 ? 154.992 -28.526  0.432   1.00 203.46 ? 156 VAL D CG1 1 
ATOM   5783  C CG2 . VAL D 2 156 ? 155.583 -29.985  2.377   1.00 206.00 ? 156 VAL D CG2 1 
ATOM   5784  N N   . ASN D 2 157 ? 156.998 -27.990  4.655   1.00 232.98 ? 157 ASN D N   1 
ATOM   5785  C CA  . ASN D 2 157 ? 157.201 -27.952  6.104   1.00 242.94 ? 157 ASN D CA  1 
ATOM   5786  C C   . ASN D 2 157 ? 157.548 -26.543  6.567   1.00 242.07 ? 157 ASN D C   1 
ATOM   5787  O O   . ASN D 2 157 ? 157.095 -26.098  7.623   1.00 249.04 ? 157 ASN D O   1 
ATOM   5788  C CB  . ASN D 2 157 ? 158.305 -28.923  6.531   1.00 250.61 ? 157 ASN D CB  1 
ATOM   5789  C CG  . ASN D 2 157 ? 157.808 -30.348  6.709   1.00 255.30 ? 157 ASN D CG  1 
ATOM   5790  O OD1 . ASN D 2 157 ? 158.381 -31.112  7.484   1.00 258.64 ? 157 ASN D OD1 1 
ATOM   5791  N ND2 . ASN D 2 157 ? 156.746 -30.714  5.992   1.00 254.65 ? 157 ASN D ND2 1 
ATOM   5792  N N   . ALA D 2 158 ? 158.361 -25.853  5.767   1.00 234.42 ? 158 ALA D N   1 
ATOM   5793  C CA  . ALA D 2 158 ? 158.696 -24.452  6.009   1.00 225.71 ? 158 ALA D CA  1 
ATOM   5794  C C   . ALA D 2 158 ? 157.528 -23.532  5.645   1.00 220.54 ? 158 ALA D C   1 
ATOM   5795  O O   . ALA D 2 158 ? 157.544 -22.343  5.970   1.00 224.25 ? 158 ALA D O   1 
ATOM   5796  C CB  . ALA D 2 158 ? 159.950 -24.063  5.239   1.00 223.31 ? 158 ALA D CB  1 
ATOM   5797  N N   . LEU D 2 159 ? 156.522 -24.088  4.970   1.00 210.07 ? 159 LEU D N   1 
ATOM   5798  C CA  . LEU D 2 159 ? 155.296 -23.356  4.659   1.00 197.37 ? 159 LEU D CA  1 
ATOM   5799  C C   . LEU D 2 159 ? 154.345 -23.400  5.853   1.00 188.90 ? 159 LEU D C   1 
ATOM   5800  O O   . LEU D 2 159 ? 153.839 -22.363  6.282   1.00 184.77 ? 159 LEU D O   1 
ATOM   5801  C CB  . LEU D 2 159 ? 154.609 -23.935  3.418   1.00 196.34 ? 159 LEU D CB  1 
ATOM   5802  C CG  . LEU D 2 159 ? 154.029 -22.986  2.358   1.00 194.93 ? 159 LEU D CG  1 
ATOM   5803  C CD1 . LEU D 2 159 ? 153.168 -23.778  1.384   1.00 195.03 ? 159 LEU D CD1 1 
ATOM   5804  C CD2 . LEU D 2 159 ? 153.235 -21.820  2.938   1.00 192.71 ? 159 LEU D CD2 1 
ATOM   5805  N N   . VAL D 2 160 ? 154.115 -24.604  6.381   1.00 180.75 ? 160 VAL D N   1 
ATOM   5806  C CA  . VAL D 2 160 ? 153.269 -24.809  7.561   1.00 175.36 ? 160 VAL D CA  1 
ATOM   5807  C C   . VAL D 2 160 ? 153.740 -23.934  8.726   1.00 180.25 ? 160 VAL D C   1 
ATOM   5808  O O   . VAL D 2 160 ? 152.949 -23.174  9.284   1.00 176.26 ? 160 VAL D O   1 
ATOM   5809  C CB  . VAL D 2 160 ? 153.215 -26.300  7.980   1.00 169.22 ? 160 VAL D CB  1 
ATOM   5810  C CG1 . VAL D 2 160 ? 152.474 -26.476  9.299   1.00 166.05 ? 160 VAL D CG1 1 
ATOM   5811  C CG2 . VAL D 2 160 ? 152.552 -27.138  6.897   1.00 165.57 ? 160 VAL D CG2 1 
ATOM   5812  N N   . LEU D 2 161 ? 155.030 -24.032  9.058   1.00 190.51 ? 161 LEU D N   1 
ATOM   5813  C CA  . LEU D 2 161 ? 155.653 -23.246  10.134  1.00 200.28 ? 161 LEU D CA  1 
ATOM   5814  C C   . LEU D 2 161 ? 155.330 -21.755  10.003  1.00 199.12 ? 161 LEU D C   1 
ATOM   5815  O O   . LEU D 2 161 ? 154.809 -21.142  10.939  1.00 202.15 ? 161 LEU D O   1 
ATOM   5816  C CB  . LEU D 2 161 ? 157.180 -23.454  10.140  1.00 207.50 ? 161 LEU D CB  1 
ATOM   5817  C CG  . LEU D 2 161 ? 158.027 -23.423  11.429  1.00 210.96 ? 161 LEU D CG  1 
ATOM   5818  C CD1 . LEU D 2 161 ? 159.507 -23.546  11.085  1.00 209.61 ? 161 LEU D CD1 1 
ATOM   5819  C CD2 . LEU D 2 161 ? 157.799 -22.196  12.303  1.00 213.48 ? 161 LEU D CD2 1 
ATOM   5820  N N   . ALA D 2 162 ? 155.630 -21.190  8.832   1.00 194.31 ? 162 ALA D N   1 
ATOM   5821  C CA  . ALA D 2 162 ? 155.404 -19.771  8.546   1.00 185.65 ? 162 ALA D CA  1 
ATOM   5822  C C   . ALA D 2 162 ? 153.931 -19.391  8.635   1.00 176.65 ? 162 ALA D C   1 
ATOM   5823  O O   . ALA D 2 162 ? 153.596 -18.249  8.954   1.00 176.43 ? 162 ALA D O   1 
ATOM   5824  C CB  . ALA D 2 162 ? 155.960 -19.412  7.176   1.00 189.20 ? 162 ALA D CB  1 
ATOM   5825  N N   . LEU D 2 163 ? 153.060 -20.354  8.349   1.00 164.41 ? 163 LEU D N   1 
ATOM   5826  C CA  . LEU D 2 163 ? 151.622 -20.148  8.456   1.00 154.85 ? 163 LEU D CA  1 
ATOM   5827  C C   . LEU D 2 163 ? 151.149 -20.200  9.911   1.00 151.26 ? 163 LEU D C   1 
ATOM   5828  O O   . LEU D 2 163 ? 150.235 -19.468  10.284  1.00 151.09 ? 163 LEU D O   1 
ATOM   5829  C CB  . LEU D 2 163 ? 150.856 -21.147  7.583   1.00 150.90 ? 163 LEU D CB  1 
ATOM   5830  C CG  . LEU D 2 163 ? 151.140 -21.127  6.074   1.00 147.88 ? 163 LEU D CG  1 
ATOM   5831  C CD1 . LEU D 2 163 ? 150.513 -22.338  5.402   1.00 147.22 ? 163 LEU D CD1 1 
ATOM   5832  C CD2 . LEU D 2 163 ? 150.690 -19.834  5.403   1.00 145.98 ? 163 LEU D CD2 1 
ATOM   5833  N N   . THR D 2 164 ? 151.774 -21.049  10.729  1.00 146.95 ? 164 THR D N   1 
ATOM   5834  C CA  . THR D 2 164 ? 151.496 -21.073  12.172  1.00 144.61 ? 164 THR D CA  1 
ATOM   5835  C C   . THR D 2 164 ? 151.939 -19.753  12.804  1.00 143.78 ? 164 THR D C   1 
ATOM   5836  O O   . THR D 2 164 ? 151.253 -19.214  13.675  1.00 140.43 ? 164 THR D O   1 
ATOM   5837  C CB  . THR D 2 164 ? 152.213 -22.226  12.917  1.00 145.61 ? 164 THR D CB  1 
ATOM   5838  O OG1 . THR D 2 164 ? 153.545 -21.829  13.261  1.00 148.66 ? 164 THR D OG1 1 
ATOM   5839  C CG2 . THR D 2 164 ? 152.276 -23.488  12.082  1.00 145.45 ? 164 THR D CG2 1 
ATOM   5840  N N   . VAL D 2 165 ? 153.096 -19.259  12.354  1.00 145.85 ? 165 VAL D N   1 
ATOM   5841  C CA  . VAL D 2 165 ? 153.690 -17.999  12.818  1.00 147.83 ? 165 VAL D CA  1 
ATOM   5842  C C   . VAL D 2 165 ? 152.773 -16.812  12.525  1.00 150.21 ? 165 VAL D C   1 
ATOM   5843  O O   . VAL D 2 165 ? 152.571 -15.954  13.388  1.00 152.11 ? 165 VAL D O   1 
ATOM   5844  C CB  . VAL D 2 165 ? 155.098 -17.771  12.201  1.00 146.58 ? 165 VAL D CB  1 
ATOM   5845  C CG1 . VAL D 2 165 ? 155.546 -16.320  12.332  1.00 144.38 ? 165 VAL D CG1 1 
ATOM   5846  C CG2 . VAL D 2 165 ? 156.121 -18.694  12.845  1.00 147.59 ? 165 VAL D CG2 1 
ATOM   5847  N N   . VAL D 2 166 ? 152.220 -16.777  11.313  1.00 151.69 ? 166 VAL D N   1 
ATOM   5848  C CA  . VAL D 2 166 ? 151.272 -15.731  10.914  1.00 151.24 ? 166 VAL D CA  1 
ATOM   5849  C C   . VAL D 2 166 ? 149.960 -15.837  11.715  1.00 148.23 ? 166 VAL D C   1 
ATOM   5850  O O   . VAL D 2 166 ? 149.366 -14.813  12.067  1.00 151.14 ? 166 VAL D O   1 
ATOM   5851  C CB  . VAL D 2 166 ? 151.036 -15.714  9.376   1.00 152.25 ? 166 VAL D CB  1 
ATOM   5852  C CG1 . VAL D 2 166 ? 149.867 -14.814  8.994   1.00 152.56 ? 166 VAL D CG1 1 
ATOM   5853  C CG2 . VAL D 2 166 ? 152.292 -15.254  8.647   1.00 151.00 ? 166 VAL D CG2 1 
ATOM   5854  N N   . ILE D 2 167 ? 149.528 -17.065  12.019  1.00 140.52 ? 167 ILE D N   1 
ATOM   5855  C CA  . ILE D 2 167 ? 148.358 -17.282  12.883  1.00 131.97 ? 167 ILE D CA  1 
ATOM   5856  C C   . ILE D 2 167 ? 148.682 -16.903  14.327  1.00 131.90 ? 167 ILE D C   1 
ATOM   5857  O O   . ILE D 2 167 ? 147.848 -16.326  15.024  1.00 129.54 ? 167 ILE D O   1 
ATOM   5858  C CB  . ILE D 2 167 ? 147.838 -18.736  12.840  1.00 126.91 ? 167 ILE D CB  1 
ATOM   5859  C CG1 . ILE D 2 167 ? 147.470 -19.138  11.413  1.00 124.85 ? 167 ILE D CG1 1 
ATOM   5860  C CG2 . ILE D 2 167 ? 146.607 -18.886  13.725  1.00 125.00 ? 167 ILE D CG2 1 
ATOM   5861  C CD1 . ILE D 2 167 ? 147.234 -20.621  11.237  1.00 122.40 ? 167 ILE D CD1 1 
ATOM   5862  N N   . GLY D 2 168 ? 149.897 -17.232  14.761  1.00 133.88 ? 168 GLY D N   1 
ATOM   5863  C CA  . GLY D 2 168 ? 150.385 -16.869  16.090  1.00 138.74 ? 168 GLY D CA  1 
ATOM   5864  C C   . GLY D 2 168 ? 150.457 -15.367  16.303  1.00 142.71 ? 168 GLY D C   1 
ATOM   5865  O O   . GLY D 2 168 ? 149.926 -14.851  17.290  1.00 143.11 ? 168 GLY D O   1 
ATOM   5866  N N   . LEU D 2 169 ? 151.108 -14.669  15.371  1.00 146.37 ? 169 LEU D N   1 
ATOM   5867  C CA  . LEU D 2 169 ? 151.212 -13.203  15.398  1.00 148.35 ? 169 LEU D CA  1 
ATOM   5868  C C   . LEU D 2 169 ? 149.865 -12.496  15.243  1.00 150.55 ? 169 LEU D C   1 
ATOM   5869  O O   . LEU D 2 169 ? 149.752 -11.298  15.523  1.00 148.94 ? 169 LEU D O   1 
ATOM   5870  C CB  . LEU D 2 169 ? 152.180 -12.700  14.318  1.00 146.99 ? 169 LEU D CB  1 
ATOM   5871  C CG  . LEU D 2 169 ? 153.599 -12.285  14.722  1.00 145.90 ? 169 LEU D CG  1 
ATOM   5872  C CD1 . LEU D 2 169 ? 154.486 -12.199  13.490  1.00 145.33 ? 169 LEU D CD1 1 
ATOM   5873  C CD2 . LEU D 2 169 ? 153.589 -10.955  15.469  1.00 144.28 ? 169 LEU D CD2 1 
ATOM   5874  N N   . SER D 2 170 ? 148.853 -13.239  14.793  1.00 154.32 ? 170 SER D N   1 
ATOM   5875  C CA  . SER D 2 170 ? 147.503 -12.702  14.631  1.00 157.34 ? 170 SER D CA  1 
ATOM   5876  C C   . SER D 2 170 ? 146.747 -12.624  15.959  1.00 160.78 ? 170 SER D C   1 
ATOM   5877  O O   . SER D 2 170 ? 145.684 -12.009  16.032  1.00 163.72 ? 170 SER D O   1 
ATOM   5878  C CB  . SER D 2 170 ? 146.701 -13.513  13.602  1.00 155.10 ? 170 SER D CB  1 
ATOM   5879  O OG  . SER D 2 170 ? 146.169 -14.702  14.164  1.00 151.30 ? 170 SER D OG  1 
ATOM   5880  N N   . LEU D 2 171 ? 147.297 -13.245  17.002  1.00 163.59 ? 171 LEU D N   1 
ATOM   5881  C CA  . LEU D 2 171 ? 146.685 -13.214  18.332  1.00 167.51 ? 171 LEU D CA  1 
ATOM   5882  C C   . LEU D 2 171 ? 146.900 -11.890  19.068  1.00 173.48 ? 171 LEU D C   1 
ATOM   5883  O O   . LEU D 2 171 ? 146.102 -11.528  19.935  1.00 173.86 ? 171 LEU D O   1 
ATOM   5884  C CB  . LEU D 2 171 ? 147.177 -14.384  19.198  1.00 164.87 ? 171 LEU D CB  1 
ATOM   5885  C CG  . LEU D 2 171 ? 146.524 -15.773  19.119  1.00 164.08 ? 171 LEU D CG  1 
ATOM   5886  C CD1 . LEU D 2 171 ? 145.002 -15.692  19.106  1.00 164.55 ? 171 LEU D CD1 1 
ATOM   5887  C CD2 . LEU D 2 171 ? 147.030 -16.575  17.929  1.00 163.18 ? 171 LEU D CD2 1 
ATOM   5888  N N   . LEU D 2 172 ? 147.969 -11.175  18.716  1.00 182.24 ? 172 LEU D N   1 
ATOM   5889  C CA  . LEU D 2 172 ? 148.302 -9.882   19.331  1.00 192.67 ? 172 LEU D CA  1 
ATOM   5890  C C   . LEU D 2 172 ? 147.180 -8.847   19.213  1.00 202.63 ? 172 LEU D C   1 
ATOM   5891  O O   . LEU D 2 172 ? 146.758 -8.264   20.216  1.00 199.18 ? 172 LEU D O   1 
ATOM   5892  C CB  . LEU D 2 172 ? 149.602 -9.317   18.739  1.00 192.08 ? 172 LEU D CB  1 
ATOM   5893  C CG  . LEU D 2 172 ? 150.925 -9.462   19.506  1.00 192.76 ? 172 LEU D CG  1 
ATOM   5894  C CD1 . LEU D 2 172 ? 151.244 -10.925  19.821  1.00 194.88 ? 172 LEU D CD1 1 
ATOM   5895  C CD2 . LEU D 2 172 ? 152.055 -8.844   18.685  1.00 192.20 ? 172 LEU D CD2 1 
ATOM   5896  N N   . TRP D 2 173 ? 146.706 -8.627   17.988  1.00 221.79 ? 173 TRP D N   1 
ATOM   5897  C CA  . TRP D 2 173 ? 145.629 -7.668   17.731  1.00 239.88 ? 173 TRP D CA  1 
ATOM   5898  C C   . TRP D 2 173 ? 144.241 -8.315   17.695  1.00 243.54 ? 173 TRP D C   1 
ATOM   5899  O O   . TRP D 2 173 ? 143.230 -7.636   17.894  1.00 242.71 ? 173 TRP D O   1 
ATOM   5900  C CB  . TRP D 2 173 ? 145.897 -6.853   16.451  1.00 254.10 ? 173 TRP D CB  1 
ATOM   5901  C CG  . TRP D 2 173 ? 145.966 -7.648   15.157  1.00 266.06 ? 173 TRP D CG  1 
ATOM   5902  C CD1 . TRP D 2 173 ? 147.019 -8.398   14.708  1.00 269.98 ? 173 TRP D CD1 1 
ATOM   5903  C CD2 . TRP D 2 173 ? 144.953 -7.733   14.140  1.00 268.22 ? 173 TRP D CD2 1 
ATOM   5904  N NE1 . TRP D 2 173 ? 146.719 -8.956   13.486  1.00 272.32 ? 173 TRP D NE1 1 
ATOM   5905  C CE2 . TRP D 2 173 ? 145.459 -8.565   13.114  1.00 270.44 ? 173 TRP D CE2 1 
ATOM   5906  C CE3 . TRP D 2 173 ? 143.664 -7.194   14.000  1.00 265.59 ? 173 TRP D CE3 1 
ATOM   5907  C CZ2 . TRP D 2 173 ? 144.720 -8.872   11.962  1.00 268.88 ? 173 TRP D CZ2 1 
ATOM   5908  C CZ3 . TRP D 2 173 ? 142.929 -7.500   12.852  1.00 263.35 ? 173 TRP D CZ3 1 
ATOM   5909  C CH2 . TRP D 2 173 ? 143.462 -8.331   11.851  1.00 265.17 ? 173 TRP D CH2 1 
ATOM   5910  N N   . ASN D 2 174 ? 144.206 -9.626   17.457  1.00 248.91 ? 174 ASN D N   1 
ATOM   5911  C CA  . ASN D 2 174 ? 142.955 -10.380  17.342  1.00 250.58 ? 174 ASN D CA  1 
ATOM   5912  C C   . ASN D 2 174 ? 143.017 -11.696  18.131  1.00 245.37 ? 174 ASN D C   1 
ATOM   5913  O O   . ASN D 2 174 ? 143.296 -12.760  17.566  1.00 249.25 ? 174 ASN D O   1 
ATOM   5914  C CB  . ASN D 2 174 ? 142.627 -10.626  15.855  1.00 253.65 ? 174 ASN D CB  1 
ATOM   5915  C CG  . ASN D 2 174 ? 141.223 -11.176  15.632  1.00 254.31 ? 174 ASN D CG  1 
ATOM   5916  O OD1 . ASN D 2 174 ? 141.052 -12.223  15.005  1.00 250.88 ? 174 ASN D OD1 1 
ATOM   5917  N ND2 . ASN D 2 174 ? 140.213 -10.462  16.123  1.00 256.55 ? 174 ASN D ND2 1 
ATOM   5918  N N   . ASP D 2 175 ? 142.762 -11.613  19.440  1.00 231.18 ? 175 ASP D N   1 
ATOM   5919  C CA  . ASP D 2 175 ? 142.784 -12.791  20.324  1.00 214.33 ? 175 ASP D CA  1 
ATOM   5920  C C   . ASP D 2 175 ? 141.501 -13.639  20.245  1.00 207.43 ? 175 ASP D C   1 
ATOM   5921  O O   . ASP D 2 175 ? 140.949 -14.057  21.269  1.00 204.55 ? 175 ASP D O   1 
ATOM   5922  C CB  . ASP D 2 175 ? 143.140 -12.410  21.782  1.00 204.40 ? 175 ASP D CB  1 
ATOM   5923  C CG  . ASP D 2 175 ? 142.446 -11.131  22.266  1.00 195.89 ? 175 ASP D CG  1 
ATOM   5924  O OD1 . ASP D 2 175 ? 141.304 -10.849  21.847  1.00 193.12 ? 175 ASP D OD1 1 
ATOM   5925  O OD2 . ASP D 2 175 ? 143.047 -10.407  23.090  1.00 186.29 ? 175 ASP D OD2 1 
ATOM   5926  N N   . ALA D 2 176 ? 141.054 -13.897  19.015  1.00 199.68 ? 176 ALA D N   1 
ATOM   5927  C CA  . ALA D 2 176 ? 139.839 -14.666  18.749  1.00 189.96 ? 176 ALA D CA  1 
ATOM   5928  C C   . ALA D 2 176 ? 140.028 -16.144  19.068  1.00 183.77 ? 176 ALA D C   1 
ATOM   5929  O O   . ALA D 2 176 ? 141.116 -16.690  18.881  1.00 182.28 ? 176 ALA D O   1 
ATOM   5930  C CB  . ALA D 2 176 ? 139.409 -14.488  17.300  1.00 190.03 ? 176 ALA D CB  1 
ATOM   5931  N N   . THR D 2 177 ? 138.958 -16.776  19.546  1.00 178.43 ? 177 THR D N   1 
ATOM   5932  C CA  . THR D 2 177 ? 138.952 -18.205  19.864  1.00 177.14 ? 177 THR D CA  1 
ATOM   5933  C C   . THR D 2 177 ? 139.287 -19.056  18.634  1.00 181.16 ? 177 THR D C   1 
ATOM   5934  O O   . THR D 2 177 ? 139.945 -20.094  18.750  1.00 181.22 ? 177 THR D O   1 
ATOM   5935  C CB  . THR D 2 177 ? 137.596 -18.630  20.466  1.00 174.10 ? 177 THR D CB  1 
ATOM   5936  O OG1 . THR D 2 177 ? 137.246 -17.735  21.529  1.00 170.34 ? 177 THR D OG1 1 
ATOM   5937  C CG2 . THR D 2 177 ? 137.656 -20.050  21.014  1.00 174.29 ? 177 THR D CG2 1 
ATOM   5938  N N   . ALA D 2 178 ? 138.841 -18.601  17.464  1.00 186.04 ? 178 ALA D N   1 
ATOM   5939  C CA  . ALA D 2 178 ? 139.159 -19.246  16.190  1.00 189.58 ? 178 ALA D CA  1 
ATOM   5940  C C   . ALA D 2 178 ? 140.652 -19.160  15.868  1.00 190.13 ? 178 ALA D C   1 
ATOM   5941  O O   . ALA D 2 178 ? 141.244 -20.132  15.393  1.00 195.28 ? 178 ALA D O   1 
ATOM   5942  C CB  . ALA D 2 178 ? 138.332 -18.639  15.065  1.00 191.37 ? 178 ALA D CB  1 
ATOM   5943  N N   . SER D 2 179 ? 141.251 -17.999  16.140  1.00 185.21 ? 179 SER D N   1 
ATOM   5944  C CA  . SER D 2 179 ? 142.681 -17.768  15.898  1.00 178.40 ? 179 SER D CA  1 
ATOM   5945  C C   . SER D 2 179 ? 143.588 -18.539  16.869  1.00 175.26 ? 179 SER D C   1 
ATOM   5946  O O   . SER D 2 179 ? 144.789 -18.685  16.623  1.00 176.78 ? 179 SER D O   1 
ATOM   5947  C CB  . SER D 2 179 ? 143.001 -16.267  15.939  1.00 174.50 ? 179 SER D CB  1 
ATOM   5948  O OG  . SER D 2 179 ? 142.375 -15.571  14.873  1.00 168.95 ? 179 SER D OG  1 
ATOM   5949  N N   . ILE D 2 180 ? 143.004 -19.029  17.964  1.00 167.37 ? 180 ILE D N   1 
ATOM   5950  C CA  . ILE D 2 180 ? 143.726 -19.822  18.965  1.00 156.31 ? 180 ILE D CA  1 
ATOM   5951  C C   . ILE D 2 180 ? 143.877 -21.282  18.516  1.00 147.37 ? 180 ILE D C   1 
ATOM   5952  O O   . ILE D 2 180 ? 144.974 -21.841  18.566  1.00 143.38 ? 180 ILE D O   1 
ATOM   5953  C CB  . ILE D 2 180 ? 143.043 -19.749  20.357  1.00 156.79 ? 180 ILE D CB  1 
ATOM   5954  C CG1 . ILE D 2 180 ? 142.954 -18.297  20.846  1.00 155.98 ? 180 ILE D CG1 1 
ATOM   5955  C CG2 . ILE D 2 180 ? 143.792 -20.594  21.377  1.00 156.65 ? 180 ILE D CG2 1 
ATOM   5956  C CD1 . ILE D 2 180 ? 141.964 -18.062  21.970  1.00 153.41 ? 180 ILE D CD1 1 
ATOM   5957  N N   . VAL D 2 181 ? 142.774 -21.877  18.061  1.00 139.01 ? 181 VAL D N   1 
ATOM   5958  C CA  . VAL D 2 181 ? 142.726 -23.296  17.693  1.00 133.01 ? 181 VAL D CA  1 
ATOM   5959  C C   . VAL D 2 181 ? 143.637 -23.646  16.510  1.00 133.60 ? 181 VAL D C   1 
ATOM   5960  O O   . VAL D 2 181 ? 144.497 -24.520  16.634  1.00 132.05 ? 181 VAL D O   1 
ATOM   5961  C CB  . VAL D 2 181 ? 141.279 -23.762  17.403  1.00 129.77 ? 181 VAL D CB  1 
ATOM   5962  C CG1 . VAL D 2 181 ? 141.235 -25.261  17.154  1.00 128.39 ? 181 VAL D CG1 1 
ATOM   5963  C CG2 . VAL D 2 181 ? 140.356 -23.400  18.556  1.00 129.03 ? 181 VAL D CG2 1 
ATOM   5964  N N   . LEU D 2 182 ? 143.444 -22.960  15.379  1.00 136.27 ? 182 LEU D N   1 
ATOM   5965  C CA  . LEU D 2 182 ? 144.211 -23.205  14.144  1.00 138.33 ? 182 LEU D CA  1 
ATOM   5966  C C   . LEU D 2 182 ? 145.711 -23.110  14.398  1.00 134.68 ? 182 LEU D C   1 
ATOM   5967  O O   . LEU D 2 182 ? 146.493 -23.907  13.876  1.00 135.15 ? 182 LEU D O   1 
ATOM   5968  C CB  . LEU D 2 182 ? 143.818 -22.200  13.047  1.00 142.92 ? 182 LEU D CB  1 
ATOM   5969  C CG  . LEU D 2 182 ? 143.692 -22.598  11.561  1.00 144.72 ? 182 LEU D CG  1 
ATOM   5970  C CD1 . LEU D 2 182 ? 143.570 -21.355  10.688  1.00 144.92 ? 182 LEU D CD1 1 
ATOM   5971  C CD2 . LEU D 2 182 ? 144.818 -23.487  11.046  1.00 144.32 ? 182 LEU D CD2 1 
ATOM   5972  N N   . PHE D 2 183 ? 146.097 -22.121  15.199  1.00 129.55 ? 183 PHE D N   1 
ATOM   5973  C CA  . PHE D 2 183 ? 147.477 -21.950  15.610  1.00 124.78 ? 183 PHE D CA  1 
ATOM   5974  C C   . PHE D 2 183 ? 148.017 -23.215  16.273  1.00 120.35 ? 183 PHE D C   1 
ATOM   5975  O O   . PHE D 2 183 ? 149.086 -23.701  15.900  1.00 119.41 ? 183 PHE D O   1 
ATOM   5976  C CB  . PHE D 2 183 ? 147.600 -20.757  16.555  1.00 127.71 ? 183 PHE D CB  1 
ATOM   5977  C CG  . PHE D 2 183 ? 148.891 -20.721  17.304  1.00 132.19 ? 183 PHE D CG  1 
ATOM   5978  C CD1 . PHE D 2 183 ? 150.074 -20.393  16.652  1.00 133.73 ? 183 PHE D CD1 1 
ATOM   5979  C CD2 . PHE D 2 183 ? 148.930 -21.034  18.657  1.00 135.25 ? 183 PHE D CD2 1 
ATOM   5980  C CE1 . PHE D 2 183 ? 151.275 -20.369  17.340  1.00 137.86 ? 183 PHE D CE1 1 
ATOM   5981  C CE2 . PHE D 2 183 ? 150.127 -21.012  19.351  1.00 139.12 ? 183 PHE D CE2 1 
ATOM   5982  C CZ  . PHE D 2 183 ? 151.301 -20.681  18.691  1.00 140.18 ? 183 PHE D CZ  1 
ATOM   5983  N N   . PHE D 2 184 ? 147.272 -23.732  17.252  1.00 115.14 ? 184 PHE D N   1 
ATOM   5984  C CA  . PHE D 2 184 ? 147.632 -24.972  17.942  1.00 111.80 ? 184 PHE D CA  1 
ATOM   5985  C C   . PHE D 2 184 ? 147.664 -26.165  16.991  1.00 113.86 ? 184 PHE D C   1 
ATOM   5986  O O   . PHE D 2 184 ? 148.605 -26.959  17.020  1.00 114.35 ? 184 PHE D O   1 
ATOM   5987  C CB  . PHE D 2 184 ? 146.683 -25.246  19.116  1.00 105.96 ? 184 PHE D CB  1 
ATOM   5988  C CG  . PHE D 2 184 ? 147.017 -24.471  20.357  1.00 100.88 ? 184 PHE D CG  1 
ATOM   5989  C CD1 . PHE D 2 184 ? 148.059 -24.875  21.185  1.00 99.42  ? 184 PHE D CD1 1 
ATOM   5990  C CD2 . PHE D 2 184 ? 146.292 -23.341  20.702  1.00 98.10  ? 184 PHE D CD2 1 
ATOM   5991  C CE1 . PHE D 2 184 ? 148.374 -24.161  22.329  1.00 97.30  ? 184 PHE D CE1 1 
ATOM   5992  C CE2 . PHE D 2 184 ? 146.602 -22.622  21.845  1.00 96.54  ? 184 PHE D CE2 1 
ATOM   5993  C CZ  . PHE D 2 184 ? 147.644 -23.032  22.659  1.00 96.24  ? 184 PHE D CZ  1 
ATOM   5994  N N   . LEU D 2 185 ? 146.638 -26.273  16.146  1.00 115.69 ? 185 LEU D N   1 
ATOM   5995  C CA  . LEU D 2 185 ? 146.545 -27.337  15.144  1.00 116.53 ? 185 LEU D CA  1 
ATOM   5996  C C   . LEU D 2 185 ? 147.752 -27.362  14.215  1.00 115.65 ? 185 LEU D C   1 
ATOM   5997  O O   . LEU D 2 185 ? 148.318 -28.425  13.957  1.00 113.47 ? 185 LEU D O   1 
ATOM   5998  C CB  . LEU D 2 185 ? 145.263 -27.193  14.317  1.00 118.63 ? 185 LEU D CB  1 
ATOM   5999  C CG  . LEU D 2 185 ? 143.936 -27.628  14.942  1.00 120.43 ? 185 LEU D CG  1 
ATOM   6000  C CD1 . LEU D 2 185 ? 142.770 -27.039  14.164  1.00 121.38 ? 185 LEU D CD1 1 
ATOM   6001  C CD2 . LEU D 2 185 ? 143.827 -29.145  15.002  1.00 121.59 ? 185 LEU D CD2 1 
ATOM   6002  N N   . LEU D 2 186 ? 148.135 -26.184  13.723  1.00 116.71 ? 186 LEU D N   1 
ATOM   6003  C CA  . LEU D 2 186 ? 149.287 -26.038  12.837  1.00 117.45 ? 186 LEU D CA  1 
ATOM   6004  C C   . LEU D 2 186 ? 150.604 -26.329  13.547  1.00 115.80 ? 186 LEU D C   1 
ATOM   6005  O O   . LEU D 2 186 ? 151.528 -26.880  12.947  1.00 115.45 ? 186 LEU D O   1 
ATOM   6006  C CB  . LEU D 2 186 ? 149.326 -24.640  12.213  1.00 119.86 ? 186 LEU D CB  1 
ATOM   6007  C CG  . LEU D 2 186 ? 148.420 -24.282  11.031  1.00 121.92 ? 186 LEU D CG  1 
ATOM   6008  C CD1 . LEU D 2 186 ? 149.125 -23.267  10.146  1.00 122.16 ? 186 LEU D CD1 1 
ATOM   6009  C CD2 . LEU D 2 186 ? 148.028 -25.498  10.205  1.00 124.25 ? 186 LEU D CD2 1 
ATOM   6010  N N   . ALA D 2 187 ? 150.684 -25.945  14.820  1.00 114.18 ? 187 ALA D N   1 
ATOM   6011  C CA  . ALA D 2 187 ? 151.845 -26.249  15.651  1.00 112.51 ? 187 ALA D CA  1 
ATOM   6012  C C   . ALA D 2 187 ? 151.920 -27.749  15.923  1.00 110.99 ? 187 ALA D C   1 
ATOM   6013  O O   . ALA D 2 187 ? 153.005 -28.332  15.946  1.00 109.94 ? 187 ALA D O   1 
ATOM   6014  C CB  . ALA D 2 187 ? 151.788 -25.468  16.954  1.00 113.17 ? 187 ALA D CB  1 
ATOM   6015  N N   . LEU D 2 188 ? 150.758 -28.366  16.115  1.00 109.99 ? 188 LEU D N   1 
ATOM   6016  C CA  . LEU D 2 188 ? 150.669 -29.812  16.268  1.00 110.17 ? 188 LEU D CA  1 
ATOM   6017  C C   . LEU D 2 188 ? 150.822 -30.517  14.923  1.00 112.66 ? 188 LEU D C   1 
ATOM   6018  O O   . LEU D 2 188 ? 151.177 -31.693  14.876  1.00 112.43 ? 188 LEU D O   1 
ATOM   6019  C CB  . LEU D 2 188 ? 149.355 -30.213  16.944  1.00 108.53 ? 188 LEU D CB  1 
ATOM   6020  C CG  . LEU D 2 188 ? 149.166 -29.800  18.410  1.00 107.99 ? 188 LEU D CG  1 
ATOM   6021  C CD1 . LEU D 2 188 ? 147.692 -29.797  18.785  1.00 107.92 ? 188 LEU D CD1 1 
ATOM   6022  C CD2 . LEU D 2 188 ? 149.964 -30.681  19.360  1.00 107.79 ? 188 LEU D CD2 1 
ATOM   6023  N N   . LEU D 2 189 ? 150.555 -29.795  13.835  1.00 116.96 ? 189 LEU D N   1 
ATOM   6024  C CA  . LEU D 2 189 ? 150.767 -30.312  12.484  1.00 122.76 ? 189 LEU D CA  1 
ATOM   6025  C C   . LEU D 2 189 ? 152.254 -30.281  12.155  1.00 125.96 ? 189 LEU D C   1 
ATOM   6026  O O   . LEU D 2 189 ? 152.832 -31.301  11.773  1.00 127.67 ? 189 LEU D O   1 
ATOM   6027  C CB  . LEU D 2 189 ? 149.996 -29.482  11.450  1.00 124.00 ? 189 LEU D CB  1 
ATOM   6028  C CG  . LEU D 2 189 ? 149.561 -30.062  10.090  1.00 125.78 ? 189 LEU D CG  1 
ATOM   6029  C CD1 . LEU D 2 189 ? 149.276 -28.920  9.126   1.00 127.48 ? 189 LEU D CD1 1 
ATOM   6030  C CD2 . LEU D 2 189 ? 150.557 -31.029  9.461   1.00 125.83 ? 189 LEU D CD2 1 
ATOM   6031  N N   . PHE D 2 190 ? 152.866 -29.106  12.302  1.00 129.04 ? 190 PHE D N   1 
ATOM   6032  C CA  . PHE D 2 190 ? 154.288 -28.936  12.020  1.00 134.29 ? 190 PHE D CA  1 
ATOM   6033  C C   . PHE D 2 190 ? 155.145 -29.832  12.905  1.00 133.26 ? 190 PHE D C   1 
ATOM   6034  O O   . PHE D 2 190 ? 156.077 -30.466  12.419  1.00 134.01 ? 190 PHE D O   1 
ATOM   6035  C CB  . PHE D 2 190 ? 154.720 -27.475  12.169  1.00 141.61 ? 190 PHE D CB  1 
ATOM   6036  C CG  . PHE D 2 190 ? 156.206 -27.271  12.052  1.00 149.01 ? 190 PHE D CG  1 
ATOM   6037  C CD1 . PHE D 2 190 ? 156.868 -27.540  10.855  1.00 152.69 ? 190 PHE D CD1 1 
ATOM   6038  C CD2 . PHE D 2 190 ? 156.948 -26.817  13.137  1.00 150.04 ? 190 PHE D CD2 1 
ATOM   6039  C CE1 . PHE D 2 190 ? 158.238 -27.360  10.744  1.00 154.79 ? 190 PHE D CE1 1 
ATOM   6040  C CE2 . PHE D 2 190 ? 158.317 -26.631  13.030  1.00 150.99 ? 190 PHE D CE2 1 
ATOM   6041  C CZ  . PHE D 2 190 ? 158.964 -26.907  11.834  1.00 153.11 ? 190 PHE D CZ  1 
ATOM   6042  N N   . GLY D 2 191 ? 154.818 -29.882  14.196  1.00 133.99 ? 191 GLY D N   1 
ATOM   6043  C CA  . GLY D 2 191 ? 155.514 -30.747  15.148  1.00 135.80 ? 191 GLY D CA  1 
ATOM   6044  C C   . GLY D 2 191 ? 155.615 -32.189  14.682  1.00 137.92 ? 191 GLY D C   1 
ATOM   6045  O O   . GLY D 2 191 ? 156.604 -32.870  14.961  1.00 136.03 ? 191 GLY D O   1 
ATOM   6046  N N   . VAL D 2 192 ? 154.584 -32.644  13.970  1.00 142.07 ? 192 VAL D N   1 
ATOM   6047  C CA  . VAL D 2 192 ? 154.577 -33.969  13.351  1.00 145.83 ? 192 VAL D CA  1 
ATOM   6048  C C   . VAL D 2 192 ? 155.311 -33.953  12.008  1.00 143.94 ? 192 VAL D C   1 
ATOM   6049  O O   . VAL D 2 192 ? 156.302 -34.668  11.844  1.00 144.66 ? 192 VAL D O   1 
ATOM   6050  C CB  . VAL D 2 192 ? 153.144 -34.518  13.167  1.00 149.93 ? 192 VAL D CB  1 
ATOM   6051  C CG1 . VAL D 2 192 ? 153.157 -35.822  12.378  1.00 153.03 ? 192 VAL D CG1 1 
ATOM   6052  C CG2 . VAL D 2 192 ? 152.477 -34.730  14.516  1.00 151.09 ? 192 VAL D CG2 1 
ATOM   6053  N N   . LEU D 2 193 ? 154.830 -33.140  11.060  1.00 140.21 ? 193 LEU D N   1 
ATOM   6054  C CA  . LEU D 2 193 ? 155.451 -33.024  9.731   1.00 137.33 ? 193 LEU D CA  1 
ATOM   6055  C C   . LEU D 2 193 ? 156.970 -32.884  9.816   1.00 143.69 ? 193 LEU D C   1 
ATOM   6056  O O   . LEU D 2 193 ? 157.692 -33.322  8.920   1.00 145.79 ? 193 LEU D O   1 
ATOM   6057  C CB  . LEU D 2 193 ? 154.862 -31.852  8.932   1.00 128.78 ? 193 LEU D CB  1 
ATOM   6058  C CG  . LEU D 2 193 ? 153.835 -32.111  7.813   1.00 122.74 ? 193 LEU D CG  1 
ATOM   6059  C CD1 . LEU D 2 193 ? 153.398 -30.794  7.196   1.00 120.12 ? 193 LEU D CD1 1 
ATOM   6060  C CD2 . LEU D 2 193 ? 154.363 -33.038  6.723   1.00 120.63 ? 193 LEU D CD2 1 
ATOM   6061  N N   . MET D 2 194 ? 157.435 -32.284  10.912  1.00 149.77 ? 194 MET D N   1 
ATOM   6062  C CA  . MET D 2 194 ? 158.857 -32.084  11.188  1.00 154.57 ? 194 MET D CA  1 
ATOM   6063  C C   . MET D 2 194 ? 159.590 -33.382  11.562  1.00 152.82 ? 194 MET D C   1 
ATOM   6064  O O   . MET D 2 194 ? 160.726 -33.593  11.132  1.00 155.70 ? 194 MET D O   1 
ATOM   6065  C CB  . MET D 2 194 ? 159.025 -31.033  12.292  1.00 160.18 ? 194 MET D CB  1 
ATOM   6066  C CG  . MET D 2 194 ? 160.457 -30.744  12.705  1.00 166.25 ? 194 MET D CG  1 
ATOM   6067  S SD  . MET D 2 194 ? 160.566 -30.480  14.484  1.00 172.81 ? 194 MET D SD  1 
ATOM   6068  C CE  . MET D 2 194 ? 160.271 -28.720  14.614  1.00 170.09 ? 194 MET D CE  1 
ATOM   6069  N N   . THR D 2 195 ? 158.950 -34.239  12.364  1.00 146.69 ? 195 THR D N   1 
ATOM   6070  C CA  . THR D 2 195 ? 159.528 -35.545  12.743  1.00 139.91 ? 195 THR D CA  1 
ATOM   6071  C C   . THR D 2 195 ? 159.199 -36.650  11.724  1.00 142.87 ? 195 THR D C   1 
ATOM   6072  O O   . THR D 2 195 ? 159.101 -37.835  12.067  1.00 137.07 ? 195 THR D O   1 
ATOM   6073  C CB  . THR D 2 195 ? 159.165 -35.965  14.193  1.00 133.16 ? 195 THR D CB  1 
ATOM   6074  O OG1 . THR D 2 195 ? 159.558 -37.325  14.426  1.00 126.65 ? 195 THR D OG1 1 
ATOM   6075  C CG2 . THR D 2 195 ? 157.682 -35.830  14.449  1.00 130.47 ? 195 THR D CG2 1 
ATOM   6076  N N   . LEU D 2 196 ? 159.036 -36.233  10.470  1.00 151.80 ? 196 LEU D N   1 
ATOM   6077  C CA  . LEU D 2 196 ? 158.874 -37.144  9.339   1.00 160.70 ? 196 LEU D CA  1 
ATOM   6078  C C   . LEU D 2 196 ? 160.219 -37.496  8.675   1.00 170.02 ? 196 LEU D C   1 
ATOM   6079  O O   . LEU D 2 196 ? 160.487 -38.677  8.446   1.00 170.63 ? 196 LEU D O   1 
ATOM   6080  C CB  . LEU D 2 196 ? 157.882 -36.573  8.310   1.00 159.15 ? 196 LEU D CB  1 
ATOM   6081  C CG  . LEU D 2 196 ? 156.416 -37.031  8.306   1.00 157.27 ? 196 LEU D CG  1 
ATOM   6082  C CD1 . LEU D 2 196 ? 155.728 -36.849  9.651   1.00 157.36 ? 196 LEU D CD1 1 
ATOM   6083  C CD2 . LEU D 2 196 ? 155.638 -36.312  7.213   1.00 154.81 ? 196 LEU D CD2 1 
ATOM   6084  N N   . PRO D 2 197 ? 161.071 -36.483  8.369   1.00 179.35 ? 197 PRO D N   1 
ATOM   6085  C CA  . PRO D 2 197 ? 162.386 -36.774  7.783   1.00 188.19 ? 197 PRO D CA  1 
ATOM   6086  C C   . PRO D 2 197 ? 163.447 -37.185  8.810   1.00 200.83 ? 197 PRO D C   1 
ATOM   6087  O O   . PRO D 2 197 ? 164.643 -37.000  8.564   1.00 201.89 ? 197 PRO D O   1 
ATOM   6088  C CB  . PRO D 2 197 ? 162.793 -35.442  7.122   1.00 183.30 ? 197 PRO D CB  1 
ATOM   6089  C CG  . PRO D 2 197 ? 161.665 -34.490  7.337   1.00 180.48 ? 197 PRO D CG  1 
ATOM   6090  C CD  . PRO D 2 197 ? 160.853 -35.030  8.470   1.00 179.98 ? 197 PRO D CD  1 
ATOM   6091  N N   . ILE D 2 198 ? 163.010 -37.746  9.936   1.00 215.83 ? 198 ILE D N   1 
ATOM   6092  C CA  . ILE D 2 198 ? 163.916 -38.154  11.012  1.00 229.36 ? 198 ILE D CA  1 
ATOM   6093  C C   . ILE D 2 198 ? 164.052 -39.675  11.066  1.00 226.48 ? 198 ILE D C   1 
ATOM   6094  O O   . ILE D 2 198 ? 163.050 -40.397  11.092  1.00 228.32 ? 198 ILE D O   1 
ATOM   6095  C CB  . ILE D 2 198 ? 163.456 -37.604  12.388  1.00 239.47 ? 198 ILE D CB  1 
ATOM   6096  C CG1 . ILE D 2 198 ? 163.250 -36.078  12.340  1.00 247.91 ? 198 ILE D CG1 1 
ATOM   6097  C CG2 . ILE D 2 198 ? 164.419 -38.012  13.501  1.00 243.78 ? 198 ILE D CG2 1 
ATOM   6098  C CD1 . ILE D 2 198 ? 164.463 -35.261  11.928  1.00 253.27 ? 198 ILE D CD1 1 
ATOM   6099  N N   . GLY D 2 199 ? 165.298 -40.145  11.080  1.00 221.47 ? 199 GLY D N   1 
ATOM   6100  C CA  . GLY D 2 199 ? 165.598 -41.573  11.110  1.00 215.15 ? 199 GLY D CA  1 
ATOM   6101  C C   . GLY D 2 199 ? 165.240 -42.249  12.416  1.00 210.34 ? 199 GLY D C   1 
ATOM   6102  O O   . GLY D 2 199 ? 165.428 -41.674  13.491  1.00 210.51 ? 199 GLY D O   1 
ATOM   6103  N N   . GLY D 2 200 ? 164.724 -43.475  12.314  1.00 205.79 ? 200 GLY D N   1 
ATOM   6104  C CA  . GLY D 2 200 ? 164.448 -44.325  13.477  1.00 198.01 ? 200 GLY D CA  1 
ATOM   6105  C C   . GLY D 2 200 ? 165.706 -44.571  14.289  1.00 191.23 ? 200 GLY D C   1 
ATOM   6106  O O   . GLY D 2 200 ? 165.671 -45.212  15.342  1.00 191.63 ? 200 GLY D O   1 
ATOM   6107  N N   . GLY D 2 201 ? 166.821 -44.061  13.770  1.00 184.21 ? 201 GLY D N   1 
ATOM   6108  C CA  . GLY D 2 201 ? 168.080 -44.021  14.486  1.00 175.25 ? 201 GLY D CA  1 
ATOM   6109  C C   . GLY D 2 201 ? 168.291 -42.662  15.124  1.00 168.40 ? 201 GLY D C   1 
ATOM   6110  O O   . GLY D 2 201 ? 168.364 -42.561  16.345  1.00 168.34 ? 201 GLY D O   1 
ATOM   6111  N N   . ASP D 2 202 ? 168.369 -41.621  14.293  1.00 161.54 ? 202 ASP D N   1 
ATOM   6112  C CA  . ASP D 2 202 ? 168.711 -40.251  14.718  1.00 158.56 ? 202 ASP D CA  1 
ATOM   6113  C C   . ASP D 2 202 ? 167.854 -39.682  15.858  1.00 164.50 ? 202 ASP D C   1 
ATOM   6114  O O   . ASP D 2 202 ? 168.056 -38.538  16.281  1.00 161.00 ? 202 ASP D O   1 
ATOM   6115  C CB  . ASP D 2 202 ? 168.645 -39.300  13.516  1.00 150.29 ? 202 ASP D CB  1 
ATOM   6116  C CG  . ASP D 2 202 ? 169.184 -39.925  12.240  1.00 145.35 ? 202 ASP D CG  1 
ATOM   6117  O OD1 . ASP D 2 202 ? 170.159 -40.702  12.312  1.00 142.71 ? 202 ASP D OD1 1 
ATOM   6118  O OD2 . ASP D 2 202 ? 168.628 -39.638  11.159  1.00 141.98 ? 202 ASP D OD2 1 
ATOM   6119  N N   . MET D 2 203 ? 166.909 -40.488  16.341  1.00 176.50 ? 203 MET D N   1 
ATOM   6120  C CA  . MET D 2 203 ? 165.949 -40.097  17.383  1.00 187.84 ? 203 MET D CA  1 
ATOM   6121  C C   . MET D 2 203 ? 166.564 -39.568  18.694  1.00 185.45 ? 203 MET D C   1 
ATOM   6122  O O   . MET D 2 203 ? 166.021 -38.630  19.276  1.00 189.34 ? 203 MET D O   1 
ATOM   6123  C CB  . MET D 2 203 ? 164.953 -41.236  17.666  1.00 197.55 ? 203 MET D CB  1 
ATOM   6124  C CG  . MET D 2 203 ? 164.025 -41.575  16.505  1.00 207.24 ? 203 MET D CG  1 
ATOM   6125  S SD  . MET D 2 203 ? 162.671 -40.400  16.279  1.00 216.51 ? 203 MET D SD  1 
ATOM   6126  C CE  . MET D 2 203 ? 162.044 -40.896  14.674  1.00 215.29 ? 203 MET D CE  1 
ATOM   6127  N N   . PRO D 2 204 ? 167.671 -40.176  19.180  1.00 180.45 ? 204 PRO D N   1 
ATOM   6128  C CA  . PRO D 2 204 ? 168.439 -39.566  20.271  1.00 173.86 ? 204 PRO D CA  1 
ATOM   6129  C C   . PRO D 2 204 ? 168.753 -38.079  20.080  1.00 164.26 ? 204 PRO D C   1 
ATOM   6130  O O   . PRO D 2 204 ? 168.665 -37.308  21.039  1.00 166.67 ? 204 PRO D O   1 
ATOM   6131  C CB  . PRO D 2 204 ? 169.743 -40.369  20.268  1.00 177.06 ? 204 PRO D CB  1 
ATOM   6132  C CG  . PRO D 2 204 ? 169.425 -41.657  19.576  1.00 179.87 ? 204 PRO D CG  1 
ATOM   6133  C CD  . PRO D 2 204 ? 168.025 -41.598  19.037  1.00 180.32 ? 204 PRO D CD  1 
ATOM   6134  N N   . VAL D 2 205 ? 169.116 -37.686  18.859  1.00 150.40 ? 205 VAL D N   1 
ATOM   6135  C CA  . VAL D 2 205 ? 169.395 -36.283  18.533  1.00 138.86 ? 205 VAL D CA  1 
ATOM   6136  C C   . VAL D 2 205 ? 168.103 -35.472  18.385  1.00 136.36 ? 205 VAL D C   1 
ATOM   6137  O O   . VAL D 2 205 ? 168.137 -34.244  18.291  1.00 131.71 ? 205 VAL D O   1 
ATOM   6138  C CB  . VAL D 2 205 ? 170.275 -36.163  17.265  1.00 134.93 ? 205 VAL D CB  1 
ATOM   6139  C CG1 . VAL D 2 205 ? 170.326 -34.731  16.750  1.00 132.44 ? 205 VAL D CG1 1 
ATOM   6140  C CG2 . VAL D 2 205 ? 171.684 -36.638  17.568  1.00 134.47 ? 205 VAL D CG2 1 
ATOM   6141  N N   . ALA D 2 206 ? 166.967 -36.163  18.378  1.00 138.25 ? 206 ALA D N   1 
ATOM   6142  C CA  . ALA D 2 206 ? 165.667 -35.505  18.274  1.00 141.75 ? 206 ALA D CA  1 
ATOM   6143  C C   . ALA D 2 206 ? 164.923 -35.391  19.614  1.00 144.74 ? 206 ALA D C   1 
ATOM   6144  O O   . ALA D 2 206 ? 164.255 -34.386  19.860  1.00 144.69 ? 206 ALA D O   1 
ATOM   6145  C CB  . ALA D 2 206 ? 164.802 -36.199  17.233  1.00 142.87 ? 206 ALA D CB  1 
ATOM   6146  N N   . ILE D 2 207 ? 165.038 -36.411  20.470  1.00 148.11 ? 207 ILE D N   1 
ATOM   6147  C CA  . ILE D 2 207 ? 164.353 -36.434  21.778  1.00 149.00 ? 207 ILE D CA  1 
ATOM   6148  C C   . ILE D 2 207 ? 164.871 -35.341  22.711  1.00 155.73 ? 207 ILE D C   1 
ATOM   6149  O O   . ILE D 2 207 ? 164.079 -34.631  23.332  1.00 153.77 ? 207 ILE D O   1 
ATOM   6150  C CB  . ILE D 2 207 ? 164.453 -37.815  22.478  1.00 143.57 ? 207 ILE D CB  1 
ATOM   6151  C CG1 . ILE D 2 207 ? 163.709 -38.883  21.669  1.00 141.37 ? 207 ILE D CG1 1 
ATOM   6152  C CG2 . ILE D 2 207 ? 163.895 -37.752  23.898  1.00 139.32 ? 207 ILE D CG2 1 
ATOM   6153  C CD1 . ILE D 2 207 ? 164.043 -40.309  22.057  1.00 138.59 ? 207 ILE D CD1 1 
ATOM   6154  N N   . SER D 2 208 ? 166.196 -35.222  22.804  1.00 166.82 ? 208 SER D N   1 
ATOM   6155  C CA  . SER D 2 208 ? 166.840 -34.148  23.563  1.00 176.33 ? 208 SER D CA  1 
ATOM   6156  C C   . SER D 2 208 ? 166.572 -32.798  22.911  1.00 175.52 ? 208 SER D C   1 
ATOM   6157  O O   . SER D 2 208 ? 166.459 -31.777  23.592  1.00 175.13 ? 208 SER D O   1 
ATOM   6158  C CB  . SER D 2 208 ? 168.347 -34.384  23.675  1.00 184.53 ? 208 SER D CB  1 
ATOM   6159  O OG  . SER D 2 208 ? 168.982 -33.306  24.345  1.00 191.61 ? 208 SER D OG  1 
ATOM   6160  N N   . PHE D 2 209 ? 166.485 -32.811  21.583  1.00 173.90 ? 209 PHE D N   1 
ATOM   6161  C CA  . PHE D 2 209 ? 166.087 -31.649  20.809  1.00 171.73 ? 209 PHE D CA  1 
ATOM   6162  C C   . PHE D 2 209 ? 164.680 -31.227  21.221  1.00 167.99 ? 209 PHE D C   1 
ATOM   6163  O O   . PHE D 2 209 ? 164.408 -30.041  21.398  1.00 163.04 ? 209 PHE D O   1 
ATOM   6164  C CB  . PHE D 2 209 ? 166.149 -31.981  19.320  1.00 175.52 ? 209 PHE D CB  1 
ATOM   6165  C CG  . PHE D 2 209 ? 165.799 -30.837  18.428  1.00 183.02 ? 209 PHE D CG  1 
ATOM   6166  C CD1 . PHE D 2 209 ? 166.741 -29.861  18.132  1.00 188.36 ? 209 PHE D CD1 1 
ATOM   6167  C CD2 . PHE D 2 209 ? 164.530 -30.737  17.875  1.00 186.88 ? 209 PHE D CD2 1 
ATOM   6168  C CE1 . PHE D 2 209 ? 166.420 -28.798  17.306  1.00 195.73 ? 209 PHE D CE1 1 
ATOM   6169  C CE2 . PHE D 2 209 ? 164.202 -29.677  17.048  1.00 194.49 ? 209 PHE D CE2 1 
ATOM   6170  C CZ  . PHE D 2 209 ? 165.149 -28.706  16.762  1.00 198.13 ? 209 PHE D CZ  1 
ATOM   6171  N N   . TYR D 2 210 ? 163.798 -32.211  21.385  1.00 169.41 ? 210 TYR D N   1 
ATOM   6172  C CA  . TYR D 2 210 ? 162.454 -31.979  21.902  1.00 172.66 ? 210 TYR D CA  1 
ATOM   6173  C C   . TYR D 2 210 ? 162.469 -31.746  23.416  1.00 166.90 ? 210 TYR D C   1 
ATOM   6174  O O   . TYR D 2 210 ? 161.566 -31.105  23.959  1.00 164.52 ? 210 TYR D O   1 
ATOM   6175  C CB  . TYR D 2 210 ? 161.530 -33.153  21.556  1.00 183.91 ? 210 TYR D CB  1 
ATOM   6176  C CG  . TYR D 2 210 ? 161.082 -33.219  20.106  1.00 196.22 ? 210 TYR D CG  1 
ATOM   6177  C CD1 . TYR D 2 210 ? 160.478 -32.124  19.488  1.00 202.46 ? 210 TYR D CD1 1 
ATOM   6178  C CD2 . TYR D 2 210 ? 161.231 -34.391  19.361  1.00 201.64 ? 210 TYR D CD2 1 
ATOM   6179  C CE1 . TYR D 2 210 ? 160.058 -32.186  18.166  1.00 208.22 ? 210 TYR D CE1 1 
ATOM   6180  C CE2 . TYR D 2 210 ? 160.814 -34.463  18.039  1.00 206.06 ? 210 TYR D CE2 1 
ATOM   6181  C CZ  . TYR D 2 210 ? 160.228 -33.359  17.447  1.00 207.89 ? 210 TYR D CZ  1 
ATOM   6182  O OH  . TYR D 2 210 ? 159.810 -33.426  16.137  1.00 208.26 ? 210 TYR D OH  1 
ATOM   6183  N N   . ASN D 2 211 ? 163.493 -32.275  24.085  1.00 162.77 ? 211 ASN D N   1 
ATOM   6184  C CA  . ASN D 2 211 ? 163.662 -32.126  25.532  1.00 160.20 ? 211 ASN D CA  1 
ATOM   6185  C C   . ASN D 2 211 ? 164.077 -30.710  25.907  1.00 159.14 ? 211 ASN D C   1 
ATOM   6186  O O   . ASN D 2 211 ? 163.570 -30.141  26.877  1.00 159.27 ? 211 ASN D O   1 
ATOM   6187  C CB  . ASN D 2 211 ? 164.676 -33.144  26.062  1.00 161.47 ? 211 ASN D CB  1 
ATOM   6188  C CG  . ASN D 2 211 ? 164.728 -33.191  27.575  1.00 163.70 ? 211 ASN D CG  1 
ATOM   6189  O OD1 . ASN D 2 211 ? 163.693 -33.276  28.240  1.00 165.15 ? 211 ASN D OD1 1 
ATOM   6190  N ND2 . ASN D 2 211 ? 165.941 -33.151  28.127  1.00 164.63 ? 211 ASN D ND2 1 
ATOM   6191  N N   . ALA D 2 212 ? 165.007 -30.158  25.130  1.00 157.07 ? 212 ALA D N   1 
ATOM   6192  C CA  . ALA D 2 212 ? 165.421 -28.768  25.257  1.00 155.45 ? 212 ALA D CA  1 
ATOM   6193  C C   . ALA D 2 212 ? 164.256 -27.853  24.906  1.00 154.39 ? 212 ALA D C   1 
ATOM   6194  O O   . ALA D 2 212 ? 164.029 -26.841  25.572  1.00 156.05 ? 212 ALA D O   1 
ATOM   6195  C CB  . ALA D 2 212 ? 166.604 -28.486  24.346  1.00 154.41 ? 212 ALA D CB  1 
ATOM   6196  N N   . PHE D 2 213 ? 163.524 -28.226  23.857  1.00 151.65 ? 213 PHE D N   1 
ATOM   6197  C CA  . PHE D 2 213 ? 162.330 -27.505  23.430  1.00 149.15 ? 213 PHE D CA  1 
ATOM   6198  C C   . PHE D 2 213 ? 161.295 -27.401  24.548  1.00 142.26 ? 213 PHE D C   1 
ATOM   6199  O O   . PHE D 2 213 ? 160.839 -26.305  24.875  1.00 140.68 ? 213 PHE D O   1 
ATOM   6200  C CB  . PHE D 2 213 ? 161.731 -28.159  22.179  1.00 155.52 ? 213 PHE D CB  1 
ATOM   6201  C CG  . PHE D 2 213 ? 162.085 -27.455  20.896  1.00 162.41 ? 213 PHE D CG  1 
ATOM   6202  C CD1 . PHE D 2 213 ? 163.408 -27.148  20.588  1.00 164.39 ? 213 PHE D CD1 1 
ATOM   6203  C CD2 . PHE D 2 213 ? 161.090 -27.103  19.986  1.00 166.48 ? 213 PHE D CD2 1 
ATOM   6204  C CE1 . PHE D 2 213 ? 163.729 -26.497  19.406  1.00 167.99 ? 213 PHE D CE1 1 
ATOM   6205  C CE2 . PHE D 2 213 ? 161.405 -26.452  18.801  1.00 168.51 ? 213 PHE D CE2 1 
ATOM   6206  C CZ  . PHE D 2 213 ? 162.726 -26.150  18.511  1.00 169.30 ? 213 PHE D CZ  1 
ATOM   6207  N N   . THR D 2 214 ? 160.948 -28.540  25.142  1.00 135.49 ? 214 THR D N   1 
ATOM   6208  C CA  . THR D 2 214 ? 160.043 -28.570  26.289  1.00 131.05 ? 214 THR D CA  1 
ATOM   6209  C C   . THR D 2 214 ? 160.550 -27.645  27.399  1.00 130.95 ? 214 THR D C   1 
ATOM   6210  O O   . THR D 2 214 ? 159.759 -26.949  28.038  1.00 130.84 ? 214 THR D O   1 
ATOM   6211  C CB  . THR D 2 214 ? 159.850 -30.005  26.818  1.00 129.21 ? 214 THR D CB  1 
ATOM   6212  O OG1 . THR D 2 214 ? 159.535 -30.874  25.724  1.00 127.39 ? 214 THR D OG1 1 
ATOM   6213  C CG2 . THR D 2 214 ? 158.718 -30.066  27.838  1.00 128.52 ? 214 THR D CG2 1 
ATOM   6214  N N   . GLY D 2 215 ? 161.867 -27.629  27.605  1.00 131.16 ? 215 GLY D N   1 
ATOM   6215  C CA  . GLY D 2 215 ? 162.506 -26.707  28.545  1.00 132.28 ? 215 GLY D CA  1 
ATOM   6216  C C   . GLY D 2 215 ? 162.258 -25.245  28.206  1.00 133.57 ? 215 GLY D C   1 
ATOM   6217  O O   . GLY D 2 215 ? 161.852 -24.467  29.072  1.00 132.71 ? 215 GLY D O   1 
ATOM   6218  N N   . MET D 2 216 ? 162.500 -24.877  26.945  1.00 135.57 ? 216 MET D N   1 
ATOM   6219  C CA  . MET D 2 216 ? 162.250 -23.512  26.458  1.00 136.35 ? 216 MET D CA  1 
ATOM   6220  C C   . MET D 2 216 ? 160.786 -23.122  26.637  1.00 136.14 ? 216 MET D C   1 
ATOM   6221  O O   . MET D 2 216 ? 160.482 -22.048  27.162  1.00 133.60 ? 216 MET D O   1 
ATOM   6222  C CB  . MET D 2 216 ? 162.662 -23.351  24.986  1.00 136.82 ? 216 MET D CB  1 
ATOM   6223  C CG  . MET D 2 216 ? 164.142 -23.031  24.762  1.00 136.00 ? 216 MET D CG  1 
ATOM   6224  S SD  . MET D 2 216 ? 164.489 -22.337  23.127  1.00 132.71 ? 216 MET D SD  1 
ATOM   6225  C CE  . MET D 2 216 ? 166.293 -22.165  23.195  1.00 130.75 ? 216 MET D CE  1 
ATOM   6226  N N   . ALA D 2 217 ? 159.893 -24.011  26.203  1.00 138.04 ? 217 ALA D N   1 
ATOM   6227  C CA  . ALA D 2 217 ? 158.453 -23.835  26.364  1.00 140.78 ? 217 ALA D CA  1 
ATOM   6228  C C   . ALA D 2 217 ? 158.104 -23.497  27.813  1.00 142.49 ? 217 ALA D C   1 
ATOM   6229  O O   . ALA D 2 217 ? 157.473 -22.473  28.078  1.00 144.32 ? 217 ALA D O   1 
ATOM   6230  C CB  . ALA D 2 217 ? 157.715 -25.086  25.908  1.00 141.11 ? 217 ALA D CB  1 
ATOM   6231  N N   . VAL D 2 218 ? 158.545 -24.352  28.738  1.00 142.79 ? 218 VAL D N   1 
ATOM   6232  C CA  . VAL D 2 218 ? 158.318 -24.171  30.179  1.00 141.20 ? 218 VAL D CA  1 
ATOM   6233  C C   . VAL D 2 218 ? 158.940 -22.865  30.684  1.00 139.01 ? 218 VAL D C   1 
ATOM   6234  O O   . VAL D 2 218 ? 158.347 -22.165  31.510  1.00 138.43 ? 218 VAL D O   1 
ATOM   6235  C CB  . VAL D 2 218 ? 158.843 -25.385  30.992  1.00 141.47 ? 218 VAL D CB  1 
ATOM   6236  C CG1 . VAL D 2 218 ? 158.897 -25.083  32.484  1.00 140.03 ? 218 VAL D CG1 1 
ATOM   6237  C CG2 . VAL D 2 218 ? 157.977 -26.612  30.743  1.00 142.20 ? 218 VAL D CG2 1 
ATOM   6238  N N   . GLY D 2 219 ? 160.129 -22.546  30.173  1.00 136.67 ? 219 GLY D N   1 
ATOM   6239  C CA  . GLY D 2 219 ? 160.809 -21.295  30.494  1.00 134.90 ? 219 GLY D CA  1 
ATOM   6240  C C   . GLY D 2 219 ? 159.945 -20.089  30.192  1.00 134.48 ? 219 GLY D C   1 
ATOM   6241  O O   . GLY D 2 219 ? 159.624 -19.310  31.089  1.00 133.68 ? 219 GLY D O   1 
ATOM   6242  N N   . PHE D 2 220 ? 159.545 -19.961  28.928  1.00 135.27 ? 220 PHE D N   1 
ATOM   6243  C CA  . PHE D 2 220 ? 158.772 -18.813  28.453  1.00 138.70 ? 220 PHE D CA  1 
ATOM   6244  C C   . PHE D 2 220 ? 157.390 -18.668  29.098  1.00 143.67 ? 220 PHE D C   1 
ATOM   6245  O O   . PHE D 2 220 ? 156.956 -17.548  29.376  1.00 145.21 ? 220 PHE D O   1 
ATOM   6246  C CB  . PHE D 2 220 ? 158.644 -18.839  26.926  1.00 136.52 ? 220 PHE D CB  1 
ATOM   6247  C CG  . PHE D 2 220 ? 159.958 -18.724  26.199  1.00 134.55 ? 220 PHE D CG  1 
ATOM   6248  C CD1 . PHE D 2 220 ? 160.798 -17.633  26.410  1.00 134.41 ? 220 PHE D CD1 1 
ATOM   6249  C CD2 . PHE D 2 220 ? 160.347 -19.696  25.285  1.00 133.22 ? 220 PHE D CD2 1 
ATOM   6250  C CE1 . PHE D 2 220 ? 162.007 -17.525  25.736  1.00 133.28 ? 220 PHE D CE1 1 
ATOM   6251  C CE2 . PHE D 2 220 ? 161.554 -19.594  24.608  1.00 132.37 ? 220 PHE D CE2 1 
ATOM   6252  C CZ  . PHE D 2 220 ? 162.385 -18.507  24.833  1.00 132.08 ? 220 PHE D CZ  1 
ATOM   6253  N N   . GLU D 2 221 ? 156.709 -19.791  29.331  1.00 149.74 ? 221 GLU D N   1 
ATOM   6254  C CA  . GLU D 2 221 ? 155.391 -19.783  29.981  1.00 155.08 ? 221 GLU D CA  1 
ATOM   6255  C C   . GLU D 2 221 ? 155.485 -19.275  31.417  1.00 157.59 ? 221 GLU D C   1 
ATOM   6256  O O   . GLU D 2 221 ? 154.578 -18.599  31.902  1.00 155.30 ? 221 GLU D O   1 
ATOM   6257  C CB  . GLU D 2 221 ? 154.747 -21.175  29.969  1.00 157.06 ? 221 GLU D CB  1 
ATOM   6258  C CG  . GLU D 2 221 ? 154.426 -21.738  28.589  1.00 158.69 ? 221 GLU D CG  1 
ATOM   6259  C CD  . GLU D 2 221 ? 153.249 -21.066  27.900  1.00 158.51 ? 221 GLU D CD  1 
ATOM   6260  O OE1 . GLU D 2 221 ? 152.346 -20.541  28.588  1.00 157.83 ? 221 GLU D OE1 1 
ATOM   6261  O OE2 . GLU D 2 221 ? 153.227 -21.081  26.653  1.00 158.74 ? 221 GLU D OE2 1 
ATOM   6262  N N   . GLY D 2 222 ? 156.588 -19.611  32.085  1.00 162.82 ? 222 GLY D N   1 
ATOM   6263  C CA  . GLY D 2 222 ? 156.874 -19.121  33.430  1.00 171.40 ? 222 GLY D CA  1 
ATOM   6264  C C   . GLY D 2 222 ? 157.027 -17.613  33.462  1.00 179.25 ? 222 GLY D C   1 
ATOM   6265  O O   . GLY D 2 222 ? 156.509 -16.952  34.366  1.00 176.23 ? 222 GLY D O   1 
ATOM   6266  N N   . PHE D 2 223 ? 157.742 -17.075  32.472  1.00 191.03 ? 223 PHE D N   1 
ATOM   6267  C CA  . PHE D 2 223 ? 157.887 -15.626  32.299  1.00 203.87 ? 223 PHE D CA  1 
ATOM   6268  C C   . PHE D 2 223 ? 156.541 -14.978  32.006  1.00 212.33 ? 223 PHE D C   1 
ATOM   6269  O O   . PHE D 2 223 ? 156.298 -13.832  32.389  1.00 217.79 ? 223 PHE D O   1 
ATOM   6270  C CB  . PHE D 2 223 ? 158.858 -15.298  31.157  1.00 204.18 ? 223 PHE D CB  1 
ATOM   6271  C CG  . PHE D 2 223 ? 160.295 -15.607  31.465  1.00 205.75 ? 223 PHE D CG  1 
ATOM   6272  C CD1 . PHE D 2 223 ? 161.044 -14.771  32.289  1.00 206.88 ? 223 PHE D CD1 1 
ATOM   6273  C CD2 . PHE D 2 223 ? 160.910 -16.723  30.913  1.00 206.01 ? 223 PHE D CD2 1 
ATOM   6274  C CE1 . PHE D 2 223 ? 162.372 -15.056  32.569  1.00 207.78 ? 223 PHE D CE1 1 
ATOM   6275  C CE2 . PHE D 2 223 ? 162.237 -17.015  31.189  1.00 207.48 ? 223 PHE D CE2 1 
ATOM   6276  C CZ  . PHE D 2 223 ? 162.970 -16.179  32.018  1.00 207.96 ? 223 PHE D CZ  1 
ATOM   6277  N N   . ALA D 2 224 ? 155.678 -15.726  31.322  1.00 219.68 ? 224 ALA D N   1 
ATOM   6278  C CA  . ALA D 2 224 ? 154.363 -15.245  30.914  1.00 225.17 ? 224 ALA D CA  1 
ATOM   6279  C C   . ALA D 2 224 ? 153.349 -15.223  32.061  1.00 223.54 ? 224 ALA D C   1 
ATOM   6280  O O   . ALA D 2 224 ? 152.487 -14.342  32.111  1.00 236.07 ? 224 ALA D O   1 
ATOM   6281  C CB  . ALA D 2 224 ? 153.836 -16.074  29.753  1.00 227.62 ? 224 ALA D CB  1 
ATOM   6282  N N   . VAL D 2 225 ? 153.453 -16.187  32.976  1.00 208.34 ? 225 VAL D N   1 
ATOM   6283  C CA  . VAL D 2 225 ? 152.512 -16.287  34.100  1.00 193.88 ? 225 VAL D CA  1 
ATOM   6284  C C   . VAL D 2 225 ? 153.065 -15.687  35.397  1.00 185.44 ? 225 VAL D C   1 
ATOM   6285  O O   . VAL D 2 225 ? 152.386 -15.678  36.428  1.00 181.76 ? 225 VAL D O   1 
ATOM   6286  C CB  . VAL D 2 225 ? 152.031 -17.742  34.339  1.00 191.61 ? 225 VAL D CB  1 
ATOM   6287  C CG1 . VAL D 2 225 ? 151.265 -18.265  33.132  1.00 192.01 ? 225 VAL D CG1 1 
ATOM   6288  C CG2 . VAL D 2 225 ? 153.195 -18.662  34.673  1.00 188.29 ? 225 VAL D CG2 1 
ATOM   6289  N N   . GLY D 2 226 ? 154.293 -15.177  35.331  1.00 179.35 ? 226 GLY D N   1 
ATOM   6290  C CA  . GLY D 2 226 ? 154.972 -14.626  36.500  1.00 175.90 ? 226 GLY D CA  1 
ATOM   6291  C C   . GLY D 2 226 ? 155.321 -15.717  37.491  1.00 176.11 ? 226 GLY D C   1 
ATOM   6292  O O   . GLY D 2 226 ? 155.293 -15.497  38.702  1.00 174.55 ? 226 GLY D O   1 
ATOM   6293  N N   . ASN D 2 227 ? 155.641 -16.897  36.964  1.00 179.61 ? 227 ASN D N   1 
ATOM   6294  C CA  . ASN D 2 227 ? 155.972 -18.062  37.776  1.00 187.16 ? 227 ASN D CA  1 
ATOM   6295  C C   . ASN D 2 227 ? 157.481 -18.327  37.758  1.00 184.53 ? 227 ASN D C   1 
ATOM   6296  O O   . ASN D 2 227 ? 158.016 -18.791  36.750  1.00 186.47 ? 227 ASN D O   1 
ATOM   6297  C CB  . ASN D 2 227 ? 155.199 -19.289  37.283  1.00 196.20 ? 227 ASN D CB  1 
ATOM   6298  C CG  . ASN D 2 227 ? 154.856 -20.261  38.399  1.00 204.85 ? 227 ASN D CG  1 
ATOM   6299  O OD1 . ASN D 2 227 ? 153.684 -20.454  38.727  1.00 206.74 ? 227 ASN D OD1 1 
ATOM   6300  N ND2 . ASN D 2 227 ? 155.876 -20.878  38.987  1.00 210.43 ? 227 ASN D ND2 1 
ATOM   6301  N N   . PRO D 2 228 ? 158.164 -18.035  38.883  1.00 180.09 ? 228 PRO D N   1 
ATOM   6302  C CA  . PRO D 2 228 ? 159.628 -18.061  39.011  1.00 174.90 ? 228 PRO D CA  1 
ATOM   6303  C C   . PRO D 2 228 ? 160.268 -19.448  38.907  1.00 170.67 ? 228 PRO D C   1 
ATOM   6304  O O   . PRO D 2 228 ? 161.402 -19.558  38.441  1.00 167.39 ? 228 PRO D O   1 
ATOM   6305  C CB  . PRO D 2 228 ? 159.872 -17.472  40.407  1.00 175.01 ? 228 PRO D CB  1 
ATOM   6306  C CG  . PRO D 2 228 ? 158.591 -16.823  40.805  1.00 177.90 ? 228 PRO D CG  1 
ATOM   6307  C CD  . PRO D 2 228 ? 157.524 -17.636  40.147  1.00 179.79 ? 228 PRO D CD  1 
ATOM   6308  N N   . ALA D 2 229 ? 159.558 -20.485  39.348  1.00 169.18 ? 229 ALA D N   1 
ATOM   6309  C CA  . ALA D 2 229 ? 160.061 -21.858  39.267  1.00 168.05 ? 229 ALA D CA  1 
ATOM   6310  C C   . ALA D 2 229 ? 160.115 -22.352  37.822  1.00 168.19 ? 229 ALA D C   1 
ATOM   6311  O O   . ALA D 2 229 ? 161.109 -22.945  37.406  1.00 166.23 ? 229 ALA D O   1 
ATOM   6312  C CB  . ALA D 2 229 ? 159.222 -22.793  40.124  1.00 168.31 ? 229 ALA D CB  1 
ATOM   6313  N N   . LEU D 2 230 ? 159.046 -22.100  37.067  1.00 170.82 ? 230 LEU D N   1 
ATOM   6314  C CA  . LEU D 2 230 ? 159.006 -22.413  35.636  1.00 173.11 ? 230 LEU D CA  1 
ATOM   6315  C C   . LEU D 2 230 ? 159.895 -21.468  34.831  1.00 175.11 ? 230 LEU D C   1 
ATOM   6316  O O   . LEU D 2 230 ? 160.350 -21.818  33.739  1.00 173.64 ? 230 LEU D O   1 
ATOM   6317  C CB  . LEU D 2 230 ? 157.569 -22.374  35.103  1.00 174.88 ? 230 LEU D CB  1 
ATOM   6318  C CG  . LEU D 2 230 ? 156.765 -23.679  35.101  1.00 175.90 ? 230 LEU D CG  1 
ATOM   6319  C CD1 . LEU D 2 230 ? 156.313 -24.076  36.500  1.00 177.70 ? 230 LEU D CD1 1 
ATOM   6320  C CD2 . LEU D 2 230 ? 155.569 -23.558  34.167  1.00 177.80 ? 230 LEU D CD2 1 
ATOM   6321  N N   . MET D 2 231 ? 160.126 -20.271  35.374  1.00 179.17 ? 231 MET D N   1 
ATOM   6322  C CA  . MET D 2 231 ? 161.084 -19.319  34.812  1.00 182.40 ? 231 MET D CA  1 
ATOM   6323  C C   . MET D 2 231 ? 162.499 -19.875  34.895  1.00 180.50 ? 231 MET D C   1 
ATOM   6324  O O   . MET D 2 231 ? 163.176 -20.012  33.876  1.00 182.33 ? 231 MET D O   1 
ATOM   6325  C CB  . MET D 2 231 ? 161.028 -17.982  35.556  1.00 187.34 ? 231 MET D CB  1 
ATOM   6326  C CG  . MET D 2 231 ? 159.973 -17.014  35.053  1.00 192.58 ? 231 MET D CG  1 
ATOM   6327  S SD  . MET D 2 231 ? 159.659 -15.643  36.182  1.00 197.68 ? 231 MET D SD  1 
ATOM   6328  C CE  . MET D 2 231 ? 161.214 -14.756  36.093  1.00 198.08 ? 231 MET D CE  1 
ATOM   6329  N N   . VAL D 2 232 ? 162.927 -20.199  36.115  1.00 175.40 ? 232 VAL D N   1 
ATOM   6330  C CA  . VAL D 2 232 ? 164.290 -20.664  36.383  1.00 169.25 ? 232 VAL D CA  1 
ATOM   6331  C C   . VAL D 2 232 ? 164.535 -22.075  35.845  1.00 163.46 ? 232 VAL D C   1 
ATOM   6332  O O   . VAL D 2 232 ? 165.450 -22.279  35.044  1.00 161.49 ? 232 VAL D O   1 
ATOM   6333  C CB  . VAL D 2 232 ? 164.632 -20.588  37.892  1.00 169.30 ? 232 VAL D CB  1 
ATOM   6334  C CG1 . VAL D 2 232 ? 165.999 -21.198  38.179  1.00 169.65 ? 232 VAL D CG1 1 
ATOM   6335  C CG2 . VAL D 2 232 ? 164.595 -19.145  38.368  1.00 167.43 ? 232 VAL D CG2 1 
ATOM   6336  N N   . ALA D 2 233 ? 163.714 -23.032  36.278  1.00 155.35 ? 233 ALA D N   1 
ATOM   6337  C CA  . ALA D 2 233 ? 163.874 -24.436  35.891  1.00 145.61 ? 233 ALA D CA  1 
ATOM   6338  C C   . ALA D 2 233 ? 163.721 -24.665  34.386  1.00 136.50 ? 233 ALA D C   1 
ATOM   6339  O O   . ALA D 2 233 ? 164.475 -25.440  33.798  1.00 133.51 ? 233 ALA D O   1 
ATOM   6340  C CB  . ALA D 2 233 ? 162.915 -25.324  36.672  1.00 148.30 ? 233 ALA D CB  1 
ATOM   6341  N N   . GLY D 2 234 ? 162.750 -23.987  33.775  1.00 126.43 ? 234 GLY D N   1 
ATOM   6342  C CA  . GLY D 2 234 ? 162.520 -24.077  32.334  1.00 113.78 ? 234 GLY D CA  1 
ATOM   6343  C C   . GLY D 2 234 ? 163.793 -23.844  31.546  1.00 104.87 ? 234 GLY D C   1 
ATOM   6344  O O   . GLY D 2 234 ? 164.242 -24.719  30.803  1.00 103.03 ? 234 GLY D O   1 
ATOM   6345  N N   . THR D 2 235 ? 164.384 -22.665  31.731  1.00 97.69  ? 235 THR D N   1 
ATOM   6346  C CA  . THR D 2 235 ? 165.656 -22.320  31.093  1.00 91.59  ? 235 THR D CA  1 
ATOM   6347  C C   . THR D 2 235 ? 166.841 -23.072  31.707  1.00 86.83  ? 235 THR D C   1 
ATOM   6348  O O   . THR D 2 235 ? 167.911 -23.155  31.104  1.00 85.12  ? 235 THR D O   1 
ATOM   6349  C CB  . THR D 2 235 ? 165.916 -20.794  31.093  1.00 92.28  ? 235 THR D CB  1 
ATOM   6350  O OG1 . THR D 2 235 ? 167.205 -20.526  30.527  1.00 92.34  ? 235 THR D OG1 1 
ATOM   6351  C CG2 . THR D 2 235 ? 165.872 -20.222  32.497  1.00 92.88  ? 235 THR D CG2 1 
ATOM   6352  N N   . LEU D 2 236 ? 166.645 -23.615  32.905  1.00 83.04  ? 236 LEU D N   1 
ATOM   6353  C CA  . LEU D 2 236 ? 167.653 -24.452  33.542  1.00 81.14  ? 236 LEU D CA  1 
ATOM   6354  C C   . LEU D 2 236 ? 167.642 -25.849  32.924  1.00 82.26  ? 236 LEU D C   1 
ATOM   6355  O O   . LEU D 2 236 ? 168.639 -26.566  32.995  1.00 81.84  ? 236 LEU D O   1 
ATOM   6356  C CB  . LEU D 2 236 ? 167.414 -24.514  35.055  1.00 79.10  ? 236 LEU D CB  1 
ATOM   6357  C CG  . LEU D 2 236 ? 168.441 -25.047  36.063  1.00 77.69  ? 236 LEU D CG  1 
ATOM   6358  C CD1 . LEU D 2 236 ? 168.172 -26.506  36.402  1.00 77.16  ? 236 LEU D CD1 1 
ATOM   6359  C CD2 . LEU D 2 236 ? 169.887 -24.837  35.630  1.00 77.56  ? 236 LEU D CD2 1 
ATOM   6360  N N   . VAL D 2 237 ? 166.515 -26.223  32.318  1.00 85.25  ? 237 VAL D N   1 
ATOM   6361  C CA  . VAL D 2 237 ? 166.371 -27.513  31.633  1.00 89.72  ? 237 VAL D CA  1 
ATOM   6362  C C   . VAL D 2 237 ? 166.671 -27.385  30.143  1.00 95.36  ? 237 VAL D C   1 
ATOM   6363  O O   . VAL D 2 237 ? 167.397 -28.208  29.578  1.00 95.81  ? 237 VAL D O   1 
ATOM   6364  C CB  . VAL D 2 237 ? 164.960 -28.120  31.835  1.00 88.44  ? 237 VAL D CB  1 
ATOM   6365  C CG1 . VAL D 2 237 ? 164.660 -29.201  30.802  1.00 87.49  ? 237 VAL D CG1 1 
ATOM   6366  C CG2 . VAL D 2 237 ? 164.827 -28.689  33.235  1.00 88.49  ? 237 VAL D CG2 1 
ATOM   6367  N N   . GLY D 2 238 ? 166.103 -26.354  29.520  1.00 102.71 ? 238 GLY D N   1 
ATOM   6368  C CA  . GLY D 2 238 ? 166.266 -26.114  28.089  1.00 113.87 ? 238 GLY D CA  1 
ATOM   6369  C C   . GLY D 2 238 ? 167.716 -26.027  27.652  1.00 121.20 ? 238 GLY D C   1 
ATOM   6370  O O   . GLY D 2 238 ? 168.148 -26.772  26.770  1.00 123.88 ? 238 GLY D O   1 
ATOM   6371  N N   . ALA D 2 239 ? 168.465 -25.123  28.284  1.00 126.41 ? 239 ALA D N   1 
ATOM   6372  C CA  . ALA D 2 239 ? 169.881 -24.900  27.973  1.00 129.10 ? 239 ALA D CA  1 
ATOM   6373  C C   . ALA D 2 239 ? 170.738 -26.145  28.212  1.00 129.52 ? 239 ALA D C   1 
ATOM   6374  O O   . ALA D 2 239 ? 171.694 -26.399  27.474  1.00 130.40 ? 239 ALA D O   1 
ATOM   6375  C CB  . ALA D 2 239 ? 170.420 -23.720  28.769  1.00 130.21 ? 239 ALA D CB  1 
ATOM   6376  N N   . ALA D 2 240 ? 170.390 -26.910  29.246  1.00 128.63 ? 240 ALA D N   1 
ATOM   6377  C CA  . ALA D 2 240 ? 171.043 -28.184  29.529  1.00 125.98 ? 240 ALA D CA  1 
ATOM   6378  C C   . ALA D 2 240 ? 170.764 -29.174  28.405  1.00 123.56 ? 240 ALA D C   1 
ATOM   6379  O O   . ALA D 2 240 ? 171.679 -29.834  27.916  1.00 120.30 ? 240 ALA D O   1 
ATOM   6380  C CB  . ALA D 2 240 ? 170.572 -28.739  30.864  1.00 127.78 ? 240 ALA D CB  1 
ATOM   6381  N N   . GLY D 2 241 ? 169.498 -29.253  27.996  1.00 123.33 ? 241 GLY D N   1 
ATOM   6382  C CA  . GLY D 2 241 ? 169.083 -30.072  26.862  1.00 125.88 ? 241 GLY D CA  1 
ATOM   6383  C C   . GLY D 2 241 ? 169.677 -29.590  25.551  1.00 130.14 ? 241 GLY D C   1 
ATOM   6384  O O   . GLY D 2 241 ? 169.913 -30.388  24.646  1.00 128.61 ? 241 GLY D O   1 
ATOM   6385  N N   . THR D 2 242 ? 169.914 -28.281  25.457  1.00 137.70 ? 242 THR D N   1 
ATOM   6386  C CA  . THR D 2 242 ? 170.505 -27.660  24.268  1.00 147.60 ? 242 THR D CA  1 
ATOM   6387  C C   . THR D 2 242 ? 171.926 -28.176  24.035  1.00 153.91 ? 242 THR D C   1 
ATOM   6388  O O   . THR D 2 242 ? 172.200 -28.790  23.001  1.00 154.73 ? 242 THR D O   1 
ATOM   6389  C CB  . THR D 2 242 ? 170.501 -26.115  24.367  1.00 148.48 ? 242 THR D CB  1 
ATOM   6390  O OG1 . THR D 2 242 ? 169.159 -25.647  24.552  1.00 149.67 ? 242 THR D OG1 1 
ATOM   6391  C CG2 . THR D 2 242 ? 171.079 -25.479  23.107  1.00 149.47 ? 242 THR D CG2 1 
ATOM   6392  N N   . LEU D 2 243 ? 172.815 -27.931  25.001  1.00 162.49 ? 243 LEU D N   1 
ATOM   6393  C CA  . LEU D 2 243 ? 174.191 -28.432  24.952  1.00 171.39 ? 243 LEU D CA  1 
ATOM   6394  C C   . LEU D 2 243 ? 174.173 -29.953  24.837  1.00 172.18 ? 243 LEU D C   1 
ATOM   6395  O O   . LEU D 2 243 ? 174.984 -30.541  24.118  1.00 173.83 ? 243 LEU D O   1 
ATOM   6396  C CB  . LEU D 2 243 ? 174.967 -28.011  26.209  1.00 177.66 ? 243 LEU D CB  1 
ATOM   6397  C CG  . LEU D 2 243 ? 176.477 -27.707  26.165  1.00 182.81 ? 243 LEU D CG  1 
ATOM   6398  C CD1 . LEU D 2 243 ? 176.941 -27.177  27.517  1.00 184.97 ? 243 LEU D CD1 1 
ATOM   6399  C CD2 . LEU D 2 243 ? 177.338 -28.897  25.752  1.00 183.70 ? 243 LEU D CD2 1 
ATOM   6400  N N   . LEU D 2 244 ? 173.230 -30.572  25.546  1.00 172.24 ? 244 LEU D N   1 
ATOM   6401  C CA  . LEU D 2 244 ? 173.048 -32.021  25.548  1.00 173.29 ? 244 LEU D CA  1 
ATOM   6402  C C   . LEU D 2 244 ? 172.801 -32.577  24.144  1.00 165.87 ? 244 LEU D C   1 
ATOM   6403  O O   . LEU D 2 244 ? 173.395 -33.589  23.762  1.00 166.90 ? 244 LEU D O   1 
ATOM   6404  C CB  . LEU D 2 244 ? 171.895 -32.404  26.482  1.00 182.86 ? 244 LEU D CB  1 
ATOM   6405  C CG  . LEU D 2 244 ? 171.745 -33.836  27.000  1.00 193.04 ? 244 LEU D CG  1 
ATOM   6406  C CD1 . LEU D 2 244 ? 172.861 -34.202  27.970  1.00 197.69 ? 244 LEU D CD1 1 
ATOM   6407  C CD2 . LEU D 2 244 ? 170.386 -34.001  27.667  1.00 196.44 ? 244 LEU D CD2 1 
ATOM   6408  N N   . THR D 2 245 ? 171.932 -31.912  23.384  1.00 155.43 ? 245 THR D N   1 
ATOM   6409  C CA  . THR D 2 245 ? 171.614 -32.335  22.020  1.00 146.24 ? 245 THR D CA  1 
ATOM   6410  C C   . THR D 2 245 ? 172.849 -32.253  21.124  1.00 139.36 ? 245 THR D C   1 
ATOM   6411  O O   . THR D 2 245 ? 173.099 -33.157  20.326  1.00 134.24 ? 245 THR D O   1 
ATOM   6412  C CB  . THR D 2 245 ? 170.465 -31.506  21.409  1.00 147.53 ? 245 THR D CB  1 
ATOM   6413  O OG1 . THR D 2 245 ? 169.400 -31.377  22.360  1.00 148.87 ? 245 THR D OG1 1 
ATOM   6414  C CG2 . THR D 2 245 ? 169.926 -32.174  20.147  1.00 147.51 ? 245 THR D CG2 1 
ATOM   6415  N N   . VAL D 2 246 ? 173.618 -31.176  21.279  1.00 135.85 ? 246 VAL D N   1 
ATOM   6416  C CA  . VAL D 2 246 ? 174.835 -30.957  20.495  1.00 135.18 ? 246 VAL D CA  1 
ATOM   6417  C C   . VAL D 2 246 ? 175.933 -31.957  20.877  1.00 136.13 ? 246 VAL D C   1 
ATOM   6418  O O   . VAL D 2 246 ? 176.509 -32.595  19.994  1.00 137.77 ? 246 VAL D O   1 
ATOM   6419  C CB  . VAL D 2 246 ? 175.352 -29.499  20.599  1.00 134.54 ? 246 VAL D CB  1 
ATOM   6420  C CG1 . VAL D 2 246 ? 176.481 -29.253  19.608  1.00 134.65 ? 246 VAL D CG1 1 
ATOM   6421  C CG2 . VAL D 2 246 ? 174.226 -28.508  20.344  1.00 133.99 ? 246 VAL D CG2 1 
ATOM   6422  N N   . LEU D 2 247 ? 176.212 -32.100  22.178  1.00 136.39 ? 247 LEU D N   1 
ATOM   6423  C CA  . LEU D 2 247 ? 177.203 -33.081  22.661  1.00 135.19 ? 247 LEU D CA  1 
ATOM   6424  C C   . LEU D 2 247 ? 176.870 -34.511  22.230  1.00 137.48 ? 247 LEU D C   1 
ATOM   6425  O O   . LEU D 2 247 ? 177.777 -35.297  21.959  1.00 142.21 ? 247 LEU D O   1 
ATOM   6426  C CB  . LEU D 2 247 ? 177.410 -33.015  24.189  1.00 129.94 ? 247 LEU D CB  1 
ATOM   6427  C CG  . LEU D 2 247 ? 178.782 -32.613  24.770  1.00 124.52 ? 247 LEU D CG  1 
ATOM   6428  C CD1 . LEU D 2 247 ? 178.699 -32.401  26.275  1.00 122.16 ? 247 LEU D CD1 1 
ATOM   6429  C CD2 . LEU D 2 247 ? 179.874 -33.630  24.453  1.00 121.28 ? 247 LEU D CD2 1 
ATOM   6430  N N   . MET D 2 248 ? 175.576 -34.835  22.166  1.00 135.28 ? 248 MET D N   1 
ATOM   6431  C CA  . MET D 2 248 ? 175.119 -36.141  21.673  1.00 133.14 ? 248 MET D CA  1 
ATOM   6432  C C   . MET D 2 248 ? 174.752 -36.141  20.186  1.00 137.69 ? 248 MET D C   1 
ATOM   6433  O O   . MET D 2 248 ? 174.222 -37.129  19.670  1.00 137.81 ? 248 MET D O   1 
ATOM   6434  C CB  . MET D 2 248 ? 173.962 -36.679  22.518  1.00 124.18 ? 248 MET D CB  1 
ATOM   6435  C CG  . MET D 2 248 ? 174.266 -37.998  23.219  1.00 116.30 ? 248 MET D CG  1 
ATOM   6436  S SD  . MET D 2 248 ? 172.962 -38.529  24.347  1.00 106.99 ? 248 MET D SD  1 
ATOM   6437  C CE  . MET D 2 248 ? 171.508 -37.852  23.537  1.00 109.48 ? 248 MET D CE  1 
ATOM   6438  N N   . ALA D 2 249 ? 175.033 -35.029  19.509  1.00 144.60 ? 249 ALA D N   1 
ATOM   6439  C CA  . ALA D 2 249 ? 174.950 -34.968  18.052  1.00 153.87 ? 249 ALA D CA  1 
ATOM   6440  C C   . ALA D 2 249 ? 176.348 -35.091  17.450  1.00 163.08 ? 249 ALA D C   1 
ATOM   6441  O O   . ALA D 2 249 ? 176.543 -35.788  16.456  1.00 160.57 ? 249 ALA D O   1 
ATOM   6442  C CB  . ALA D 2 249 ? 174.287 -33.676  17.602  1.00 153.19 ? 249 ALA D CB  1 
ATOM   6443  N N   . ARG D 2 250 ? 177.310 -34.406  18.064  1.00 179.11 ? 250 ARG D N   1 
ATOM   6444  C CA  . ARG D 2 250 ? 178.706 -34.439  17.628  1.00 194.45 ? 250 ARG D CA  1 
ATOM   6445  C C   . ARG D 2 250 ? 179.458 -35.672  18.147  1.00 197.64 ? 250 ARG D C   1 
ATOM   6446  O O   . ARG D 2 250 ? 180.502 -36.039  17.601  1.00 199.30 ? 250 ARG D O   1 
ATOM   6447  C CB  . ARG D 2 250 ? 179.423 -33.136  18.006  1.00 206.56 ? 250 ARG D CB  1 
ATOM   6448  C CG  . ARG D 2 250 ? 179.383 -32.075  16.909  1.00 215.32 ? 250 ARG D CG  1 
ATOM   6449  C CD  . ARG D 2 250 ? 179.309 -30.645  17.442  1.00 222.91 ? 250 ARG D CD  1 
ATOM   6450  N NE  . ARG D 2 250 ? 180.417 -30.287  18.333  1.00 227.76 ? 250 ARG D NE  1 
ATOM   6451  C CZ  . ARG D 2 250 ? 180.735 -29.039  18.680  1.00 226.97 ? 250 ARG D CZ  1 
ATOM   6452  N NH1 . ARG D 2 250 ? 180.043 -28.008  18.205  1.00 223.03 ? 250 ARG D NH1 1 
ATOM   6453  N NH2 . ARG D 2 250 ? 181.757 -28.816  19.499  1.00 228.12 ? 250 ARG D NH2 1 
ATOM   6454  N N   . ALA D 2 251 ? 178.925 -36.302  19.195  1.00 200.74 ? 251 ALA D N   1 
ATOM   6455  C CA  . ALA D 2 251 ? 179.383 -37.630  19.611  1.00 200.57 ? 251 ALA D CA  1 
ATOM   6456  C C   . ALA D 2 251 ? 178.931 -38.645  18.567  1.00 195.18 ? 251 ALA D C   1 
ATOM   6457  O O   . ALA D 2 251 ? 179.584 -39.671  18.359  1.00 195.18 ? 251 ALA D O   1 
ATOM   6458  C CB  . ALA D 2 251 ? 178.839 -37.995  20.982  1.00 207.74 ? 251 ALA D CB  1 
ATOM   6459  N N   . MET D 2 252 ? 177.804 -38.344  17.921  1.00 186.52 ? 252 MET D N   1 
ATOM   6460  C CA  . MET D 2 252 ? 177.379 -39.058  16.727  1.00 178.04 ? 252 MET D CA  1 
ATOM   6461  C C   . MET D 2 252 ? 178.280 -38.697  15.558  1.00 171.52 ? 252 MET D C   1 
ATOM   6462  O O   . MET D 2 252 ? 178.952 -37.662  15.569  1.00 168.61 ? 252 MET D O   1 
ATOM   6463  C CB  . MET D 2 252 ? 175.931 -38.726  16.363  1.00 180.77 ? 252 MET D CB  1 
ATOM   6464  C CG  . MET D 2 252 ? 174.883 -39.397  17.227  1.00 186.52 ? 252 MET D CG  1 
ATOM   6465  S SD  . MET D 2 252 ? 173.305 -39.503  16.367  1.00 191.43 ? 252 MET D SD  1 
ATOM   6466  C CE  . MET D 2 252 ? 172.265 -40.106  17.690  1.00 194.06 ? 252 MET D CE  1 
ATOM   6467  N N   . ASN D 2 253 ? 178.266 -39.558  14.546  1.00 166.77 ? 253 ASN D N   1 
ATOM   6468  C CA  . ASN D 2 253 ? 179.020 -39.368  13.309  1.00 165.92 ? 253 ASN D CA  1 
ATOM   6469  C C   . ASN D 2 253 ? 178.586 -38.112  12.570  1.00 168.35 ? 253 ASN D C   1 
ATOM   6470  O O   . ASN D 2 253 ? 179.066 -37.812  11.472  1.00 167.78 ? 253 ASN D O   1 
ATOM   6471  C CB  . ASN D 2 253 ? 178.795 -40.569  12.386  1.00 161.42 ? 253 ASN D CB  1 
ATOM   6472  C CG  . ASN D 2 253 ? 178.725 -41.890  13.134  1.00 158.49 ? 253 ASN D CG  1 
ATOM   6473  O OD1 . ASN D 2 253 ? 178.719 -41.933  14.365  1.00 157.74 ? 253 ASN D OD1 1 
ATOM   6474  N ND2 . ASN D 2 253 ? 178.675 -42.981  12.385  1.00 155.98 ? 253 ASN D ND2 1 
ATOM   6475  N N   . ARG D 2 254 ? 177.677 -37.378  13.196  1.00 173.35 ? 254 ARG D N   1 
ATOM   6476  C CA  . ARG D 2 254 ? 176.867 -36.401  12.507  1.00 183.10 ? 254 ARG D CA  1 
ATOM   6477  C C   . ARG D 2 254 ? 176.972 -35.040  13.187  1.00 195.01 ? 254 ARG D C   1 
ATOM   6478  O O   . ARG D 2 254 ? 177.638 -34.898  14.214  1.00 192.26 ? 254 ARG D O   1 
ATOM   6479  C CB  . ARG D 2 254 ? 175.420 -36.905  12.490  1.00 181.35 ? 254 ARG D CB  1 
ATOM   6480  C CG  . ARG D 2 254 ? 175.321 -38.415  12.301  1.00 180.00 ? 254 ARG D CG  1 
ATOM   6481  C CD  . ARG D 2 254 ? 174.038 -39.004  12.862  1.00 181.87 ? 254 ARG D CD  1 
ATOM   6482  N NE  . ARG D 2 254 ? 173.028 -39.201  11.825  1.00 184.50 ? 254 ARG D NE  1 
ATOM   6483  C CZ  . ARG D 2 254 ? 172.966 -40.259  11.018  1.00 185.48 ? 254 ARG D CZ  1 
ATOM   6484  N NH1 . ARG D 2 254 ? 172.005 -40.336  10.108  1.00 187.34 ? 254 ARG D NH1 1 
ATOM   6485  N NH2 . ARG D 2 254 ? 173.858 -41.239  11.115  1.00 185.32 ? 254 ARG D NH2 1 
ATOM   6486  N N   . SER D 2 255 ? 176.341 -34.039  12.582  1.00 215.61 ? 255 SER D N   1 
ATOM   6487  C CA  . SER D 2 255 ? 176.191 -32.720  13.193  1.00 236.77 ? 255 SER D CA  1 
ATOM   6488  C C   . SER D 2 255 ? 174.707 -32.458  13.470  1.00 254.79 ? 255 SER D C   1 
ATOM   6489  O O   . SER D 2 255 ? 173.905 -33.395  13.478  1.00 273.11 ? 255 SER D O   1 
ATOM   6490  C CB  . SER D 2 255 ? 176.809 -31.632  12.306  1.00 233.44 ? 255 SER D CB  1 
ATOM   6491  O OG  . SER D 2 255 ? 176.442 -31.800  10.947  1.00 232.38 ? 255 SER D OG  1 
ATOM   6492  N N   . VAL D 2 256 ? 174.343 -31.196  13.697  1.00 262.17 ? 256 VAL D N   1 
ATOM   6493  C CA  . VAL D 2 256 ? 172.969 -30.845  14.075  1.00 264.71 ? 256 VAL D CA  1 
ATOM   6494  C C   . VAL D 2 256 ? 172.130 -30.431  12.854  1.00 258.76 ? 256 VAL D C   1 
ATOM   6495  O O   . VAL D 2 256 ? 171.301 -29.513  12.935  1.00 254.92 ? 256 VAL D O   1 
ATOM   6496  C CB  . VAL D 2 256 ? 172.940 -29.730  15.153  1.00 268.38 ? 256 VAL D CB  1 
ATOM   6497  C CG1 . VAL D 2 256 ? 171.720 -29.888  16.051  1.00 274.83 ? 256 VAL D CG1 1 
ATOM   6498  C CG2 . VAL D 2 256 ? 174.210 -29.748  15.996  1.00 267.74 ? 256 VAL D CG2 1 
ATOM   6499  N N   . TRP D 2 257 ? 172.332 -31.119  11.726  1.00 254.17 ? 257 TRP D N   1 
ATOM   6500  C CA  . TRP D 2 257 ? 171.726 -30.687  10.463  1.00 247.63 ? 257 TRP D CA  1 
ATOM   6501  C C   . TRP D 2 257 ? 171.380 -31.801  9.457   1.00 238.52 ? 257 TRP D C   1 
ATOM   6502  O O   . TRP D 2 257 ? 170.412 -31.665  8.702   1.00 239.13 ? 257 TRP D O   1 
ATOM   6503  C CB  . TRP D 2 257 ? 172.614 -29.623  9.805   1.00 254.52 ? 257 TRP D CB  1 
ATOM   6504  C CG  . TRP D 2 257 ? 171.873 -28.386  9.376   1.00 262.07 ? 257 TRP D CG  1 
ATOM   6505  C CD1 . TRP D 2 257 ? 170.755 -27.853  9.957   1.00 263.11 ? 257 TRP D CD1 1 
ATOM   6506  C CD2 . TRP D 2 257 ? 172.219 -27.506  8.297   1.00 266.79 ? 257 TRP D CD2 1 
ATOM   6507  N NE1 . TRP D 2 257 ? 170.374 -26.712  9.295   1.00 267.86 ? 257 TRP D NE1 1 
ATOM   6508  C CE2 . TRP D 2 257 ? 171.255 -26.473  8.273   1.00 267.71 ? 257 TRP D CE2 1 
ATOM   6509  C CE3 . TRP D 2 257 ? 173.245 -27.496  7.340   1.00 269.50 ? 257 TRP D CE3 1 
ATOM   6510  C CZ2 . TRP D 2 257 ? 171.285 -25.438  7.330   1.00 267.09 ? 257 TRP D CZ2 1 
ATOM   6511  C CZ3 . TRP D 2 257 ? 173.275 -26.465  6.402   1.00 268.26 ? 257 TRP D CZ3 1 
ATOM   6512  C CH2 . TRP D 2 257 ? 172.299 -25.451  6.406   1.00 266.40 ? 257 TRP D CH2 1 
ATOM   6513  N N   . SER D 2 258 ? 172.156 -32.887  9.444   1.00 225.58 ? 258 SER D N   1 
ATOM   6514  C CA  . SER D 2 258 ? 171.930 -34.000  8.500   1.00 210.12 ? 258 SER D CA  1 
ATOM   6515  C C   . SER D 2 258 ? 170.668 -34.824  8.826   1.00 205.21 ? 258 SER D C   1 
ATOM   6516  O O   . SER D 2 258 ? 170.128 -35.513  7.951   1.00 202.01 ? 258 SER D O   1 
ATOM   6517  C CB  . SER D 2 258 ? 173.150 -34.923  8.476   1.00 20.00  ? 258 SER D CB  1 
ATOM   6518  O OG  . SER D 2 258 ? 173.336 -35.556  9.730   1.00 20.00  ? 258 SER D OG  1 
ATOM   6519  N N   . VAL D 2 259 ? 170.202 -34.735  10.074  1.00 198.86 ? 259 VAL D N   1 
ATOM   6520  C CA  . VAL D 2 259 ? 168.975 -35.412  10.508  1.00 187.93 ? 259 VAL D CA  1 
ATOM   6521  C C   . VAL D 2 259 ? 167.723 -34.783  9.888   1.00 173.94 ? 259 VAL D C   1 
ATOM   6522  O O   . VAL D 2 259 ? 166.973 -35.460  9.181   1.00 173.88 ? 259 VAL D O   1 
ATOM   6523  C CB  . VAL D 2 259 ? 168.836 -35.390  12.041  1.00 20.00  ? 259 VAL D CB  1 
ATOM   6524  C CG1 . VAL D 2 259 ? 167.507 -35.994  12.465  1.00 20.00  ? 259 VAL D CG1 1 
ATOM   6525  C CG2 . VAL D 2 259 ? 169.996 -36.128  12.692  1.00 20.00  ? 259 VAL D CG2 1 
ATOM   6526  N N   . LEU D 2 260 ? 167.517 -33.489  10.143  1.00 155.76 ? 260 LEU D N   1 
ATOM   6527  C CA  . LEU D 2 260 ? 166.338 -32.757  9.657   1.00 139.22 ? 260 LEU D CA  1 
ATOM   6528  C C   . LEU D 2 260 ? 166.286 -32.690  8.129   1.00 135.29 ? 260 LEU D C   1 
ATOM   6529  O O   . LEU D 2 260 ? 165.231 -32.888  7.525   1.00 129.22 ? 260 LEU D O   1 
ATOM   6530  C CB  . LEU D 2 260 ? 166.317 -31.342  10.239  1.00 20.00  ? 260 LEU D CB  1 
ATOM   6531  C CG  . LEU D 2 260 ? 166.155 -31.236  11.758  1.00 20.00  ? 260 LEU D CG  1 
ATOM   6532  C CD1 . LEU D 2 260 ? 166.299 -29.792  12.213  1.00 20.00  ? 260 LEU D CD1 1 
ATOM   6533  C CD2 . LEU D 2 260 ? 164.817 -31.811  12.197  1.00 20.00  ? 260 LEU D CD2 1 
ATOM   6534  N N   . LYS D 2 274 ? 189.054 -55.436  -1.274  1.00 184.48 ? 274 LYS D N   1 
ATOM   6535  C CA  . LYS D 2 274 ? 190.516 -55.441  -0.974  1.00 187.95 ? 274 LYS D CA  1 
ATOM   6536  C C   . LYS D 2 274 ? 191.005 -56.806  -0.471  1.00 193.14 ? 274 LYS D C   1 
ATOM   6537  O O   . LYS D 2 274 ? 191.831 -57.447  -1.123  1.00 198.24 ? 274 LYS D O   1 
ATOM   6538  C CB  . LYS D 2 274 ? 190.860 -54.336  0.020   1.00 182.56 ? 274 LYS D CB  1 
ATOM   6539  N N   . GLY D 2 275 ? 190.486 -57.245  0.677   1.00 195.58 ? 275 GLY D N   1 
ATOM   6540  C CA  . GLY D 2 275 ? 190.913 -58.501  1.309   1.00 195.17 ? 275 GLY D CA  1 
ATOM   6541  C C   . GLY D 2 275 ? 189.944 -59.655  1.113   1.00 194.87 ? 275 GLY D C   1 
ATOM   6542  O O   . GLY D 2 275 ? 189.449 -59.874  0.004   1.00 194.87 ? 275 GLY D O   1 
ATOM   6543  N N   . SER D 2 276 ? 189.681 -60.396  2.191   1.00 195.19 ? 276 SER D N   1 
ATOM   6544  C CA  . SER D 2 276 ? 188.736 -61.518  2.167   1.00 198.29 ? 276 SER D CA  1 
ATOM   6545  C C   . SER D 2 276 ? 188.223 -61.869  3.563   1.00 206.51 ? 276 SER D C   1 
ATOM   6546  O O   . SER D 2 276 ? 188.949 -61.728  4.551   1.00 209.20 ? 276 SER D O   1 
ATOM   6547  C CB  . SER D 2 276 ? 189.376 -62.754  1.528   1.00 194.19 ? 276 SER D CB  1 
ATOM   6548  O OG  . SER D 2 276 ? 188.439 -63.810  1.403   1.00 190.29 ? 276 SER D OG  1 
ATOM   6549  N N   . LEU D 2 277 ? 186.972 -62.327  3.633   1.00 216.81 ? 277 LEU D N   1 
ATOM   6550  C CA  . LEU D 2 277 ? 186.385 -62.814  4.885   1.00 228.32 ? 277 LEU D CA  1 
ATOM   6551  C C   . LEU D 2 277 ? 186.996 -64.147  5.305   1.00 234.93 ? 277 LEU D C   1 
ATOM   6552  O O   . LEU D 2 277 ? 187.161 -65.055  4.484   1.00 236.82 ? 277 LEU D O   1 
ATOM   6553  C CB  . LEU D 2 277 ? 184.857 -62.935  4.776   1.00 230.95 ? 277 LEU D CB  1 
ATOM   6554  C CG  . LEU D 2 277 ? 183.978 -61.913  5.515   1.00 232.02 ? 277 LEU D CG  1 
ATOM   6555  C CD1 . LEU D 2 277 ? 184.194 -60.498  4.996   1.00 233.82 ? 277 LEU D CD1 1 
ATOM   6556  C CD2 . LEU D 2 277 ? 182.504 -62.290  5.412   1.00 233.71 ? 277 LEU D CD2 1 
ATOM   6557  N N   . LYS D 2 278 ? 187.336 -64.249  6.588   1.00 239.91 ? 278 LYS D N   1 
ATOM   6558  C CA  . LYS D 2 278 ? 187.980 -65.439  7.137   1.00 241.12 ? 278 LYS D CA  1 
ATOM   6559  C C   . LYS D 2 278 ? 187.198 -65.958  8.349   1.00 242.02 ? 278 LYS D C   1 
ATOM   6560  O O   . LYS D 2 278 ? 187.326 -65.417  9.451   1.00 236.62 ? 278 LYS D O   1 
ATOM   6561  C CB  . LYS D 2 278 ? 189.441 -65.140  7.497   1.00 242.12 ? 278 LYS D CB  1 
ATOM   6562  C CG  . LYS D 2 278 ? 190.301 -64.730  6.306   1.00 244.99 ? 278 LYS D CG  1 
ATOM   6563  C CD  . LYS D 2 278 ? 191.556 -63.986  6.739   1.00 246.23 ? 278 LYS D CD  1 
ATOM   6564  C CE  . LYS D 2 278 ? 192.320 -63.422  5.548   1.00 246.75 ? 278 LYS D CE  1 
ATOM   6565  N NZ  . LYS D 2 278 ? 191.683 -62.210  4.958   1.00 244.49 ? 278 LYS D NZ  1 
ATOM   6566  N N   . PRO D 2 279 ? 186.370 -67.004  8.138   1.00 240.52 ? 279 PRO D N   1 
ATOM   6567  C CA  . PRO D 2 279 ? 185.489 -67.577  9.166   1.00 241.09 ? 279 PRO D CA  1 
ATOM   6568  C C   . PRO D 2 279 ? 186.236 -68.327  10.274  1.00 242.42 ? 279 PRO D C   1 
ATOM   6569  O O   . PRO D 2 279 ? 187.412 -68.665  10.109  1.00 240.55 ? 279 PRO D O   1 
ATOM   6570  C CB  . PRO D 2 279 ? 184.605 -68.556  8.372   1.00 240.13 ? 279 PRO D CB  1 
ATOM   6571  C CG  . PRO D 2 279 ? 184.783 -68.189  6.935   1.00 239.64 ? 279 PRO D CG  1 
ATOM   6572  C CD  . PRO D 2 279 ? 186.186 -67.676  6.839   1.00 240.88 ? 279 PRO D CD  1 
ATOM   6573  N N   . ILE D 2 280 ? 185.545 -68.579  11.389  1.00 244.92 ? 280 ILE D N   1 
ATOM   6574  C CA  . ILE D 2 280 ? 186.119 -69.291  12.541  1.00 245.78 ? 280 ILE D CA  1 
ATOM   6575  C C   . ILE D 2 280 ? 185.051 -70.041  13.360  1.00 244.66 ? 280 ILE D C   1 
ATOM   6576  O O   . ILE D 2 280 ? 183.884 -69.640  13.392  1.00 246.07 ? 280 ILE D O   1 
ATOM   6577  C CB  . ILE D 2 280 ? 186.967 -68.341  13.436  1.00 246.27 ? 280 ILE D CB  1 
ATOM   6578  C CG1 . ILE D 2 280 ? 188.010 -69.131  14.238  1.00 248.75 ? 280 ILE D CG1 1 
ATOM   6579  C CG2 . ILE D 2 280 ? 186.085 -67.464  14.327  1.00 246.30 ? 280 ILE D CG2 1 
ATOM   6580  C CD1 . ILE D 2 280 ? 189.147 -68.296  14.792  1.00 252.48 ? 280 ILE D CD1 1 
ATOM   6581  N N   . ASP D 2 281 ? 185.462 -71.133  14.006  1.00 245.46 ? 281 ASP D N   1 
ATOM   6582  C CA  . ASP D 2 281 ? 184.568 -71.952  14.826  1.00 240.58 ? 281 ASP D CA  1 
ATOM   6583  C C   . ASP D 2 281 ? 184.552 -71.467  16.278  1.00 233.04 ? 281 ASP D C   1 
ATOM   6584  O O   . ASP D 2 281 ? 185.508 -70.835  16.737  1.00 228.30 ? 281 ASP D O   1 
ATOM   6585  C CB  . ASP D 2 281 ? 184.990 -73.426  14.760  1.00 242.80 ? 281 ASP D CB  1 
ATOM   6586  C CG  . ASP D 2 281 ? 183.875 -74.380  15.162  1.00 244.67 ? 281 ASP D CG  1 
ATOM   6587  O OD1 . ASP D 2 281 ? 182.786 -74.333  14.548  1.00 246.40 ? 281 ASP D OD1 1 
ATOM   6588  O OD2 . ASP D 2 281 ? 184.094 -75.190  16.087  1.00 244.77 ? 281 ASP D OD2 1 
ATOM   6589  N N   . VAL D 2 282 ? 183.463 -71.769  16.988  1.00 227.89 ? 282 VAL D N   1 
ATOM   6590  C CA  . VAL D 2 282 ? 183.292 -71.374  18.396  1.00 222.63 ? 282 VAL D CA  1 
ATOM   6591  C C   . VAL D 2 282 ? 184.381 -71.935  19.311  1.00 215.45 ? 282 VAL D C   1 
ATOM   6592  O O   . VAL D 2 282 ? 184.748 -71.309  20.310  1.00 218.19 ? 282 VAL D O   1 
ATOM   6593  C CB  . VAL D 2 282 ? 181.894 -71.750  18.954  1.00 224.66 ? 282 VAL D CB  1 
ATOM   6594  C CG1 . VAL D 2 282 ? 180.842 -70.774  18.449  1.00 227.31 ? 282 VAL D CG1 1 
ATOM   6595  C CG2 . VAL D 2 282 ? 181.519 -73.189  18.612  1.00 223.26 ? 282 VAL D CG2 1 
ATOM   6596  N N   . GLU D 2 283 ? 184.887 -73.113  18.957  1.00 203.99 ? 283 GLU D N   1 
ATOM   6597  C CA  . GLU D 2 283 ? 185.975 -73.752  19.687  1.00 192.07 ? 283 GLU D CA  1 
ATOM   6598  C C   . GLU D 2 283 ? 187.319 -73.074  19.408  1.00 179.47 ? 283 GLU D C   1 
ATOM   6599  O O   . GLU D 2 283 ? 188.156 -72.961  20.307  1.00 182.16 ? 283 GLU D O   1 
ATOM   6600  C CB  . GLU D 2 283 ? 186.034 -75.250  19.366  1.00 195.12 ? 283 GLU D CB  1 
ATOM   6601  C CG  . GLU D 2 283 ? 185.090 -76.115  20.199  1.00 196.58 ? 283 GLU D CG  1 
ATOM   6602  C CD  . GLU D 2 283 ? 183.619 -75.930  19.851  1.00 195.39 ? 283 GLU D CD  1 
ATOM   6603  O OE1 . GLU D 2 283 ? 183.232 -76.191  18.692  1.00 194.76 ? 283 GLU D OE1 1 
ATOM   6604  O OE2 . GLU D 2 283 ? 182.840 -75.537  20.748  1.00 193.53 ? 283 GLU D OE2 1 
ATOM   6605  N N   . ASP D 2 284 ? 187.513 -72.621  18.168  1.00 161.21 ? 284 ASP D N   1 
ATOM   6606  C CA  . ASP D 2 284 ? 188.721 -71.885  17.781  1.00 146.45 ? 284 ASP D CA  1 
ATOM   6607  C C   . ASP D 2 284 ? 188.777 -70.487  18.407  1.00 139.60 ? 284 ASP D C   1 
ATOM   6608  O O   . ASP D 2 284 ? 189.862 -69.970  18.689  1.00 139.16 ? 284 ASP D O   1 
ATOM   6609  C CB  . ASP D 2 284 ? 188.826 -71.778  16.255  1.00 142.26 ? 284 ASP D CB  1 
ATOM   6610  C CG  . ASP D 2 284 ? 189.381 -73.038  15.606  1.00 139.31 ? 284 ASP D CG  1 
ATOM   6611  O OD1 . ASP D 2 284 ? 190.356 -73.616  16.131  1.00 137.95 ? 284 ASP D OD1 1 
ATOM   6612  O OD2 . ASP D 2 284 ? 188.849 -73.441  14.550  1.00 136.86 ? 284 ASP D OD2 1 
ATOM   6613  N N   . ALA D 2 285 ? 187.608 -69.886  18.619  1.00 131.41 ? 285 ALA D N   1 
ATOM   6614  C CA  . ALA D 2 285 ? 187.508 -68.542  19.193  1.00 125.00 ? 285 ALA D CA  1 
ATOM   6615  C C   . ALA D 2 285 ? 187.728 -68.520  20.707  1.00 121.15 ? 285 ALA D C   1 
ATOM   6616  O O   . ALA D 2 285 ? 188.220 -67.528  21.253  1.00 119.58 ? 285 ALA D O   1 
ATOM   6617  C CB  . ALA D 2 285 ? 186.171 -67.911  18.836  1.00 124.79 ? 285 ALA D CB  1 
ATOM   6618  N N   . ALA D 2 286 ? 187.358 -69.610  21.377  1.00 118.09 ? 286 ALA D N   1 
ATOM   6619  C CA  . ALA D 2 286 ? 187.574 -69.755  22.817  1.00 115.68 ? 286 ALA D CA  1 
ATOM   6620  C C   . ALA D 2 286 ? 189.057 -69.929  23.146  1.00 114.23 ? 286 ALA D C   1 
ATOM   6621  O O   . ALA D 2 286 ? 189.511 -69.512  24.215  1.00 113.35 ? 286 ALA D O   1 
ATOM   6622  C CB  . ALA D 2 286 ? 186.762 -70.918  23.367  1.00 116.00 ? 286 ALA D CB  1 
ATOM   6623  N N   . VAL D 2 287 ? 189.798 -70.544  22.220  1.00 113.37 ? 287 VAL D N   1 
ATOM   6624  C CA  . VAL D 2 287 ? 191.251 -70.729  22.347  1.00 111.94 ? 287 VAL D CA  1 
ATOM   6625  C C   . VAL D 2 287 ? 191.970 -69.380  22.306  1.00 108.39 ? 287 VAL D C   1 
ATOM   6626  O O   . VAL D 2 287 ? 192.953 -69.169  23.021  1.00 108.16 ? 287 VAL D O   1 
ATOM   6627  C CB  . VAL D 2 287 ? 191.817 -71.681  21.257  1.00 113.87 ? 287 VAL D CB  1 
ATOM   6628  C CG1 . VAL D 2 287 ? 193.343 -71.691  21.258  1.00 113.66 ? 287 VAL D CG1 1 
ATOM   6629  C CG2 . VAL D 2 287 ? 191.293 -73.097  21.456  1.00 115.79 ? 287 VAL D CG2 1 
ATOM   6630  N N   . MET D 2 288 ? 191.467 -68.470  21.475  1.00 104.18 ? 288 MET D N   1 
ATOM   6631  C CA  . MET D 2 288 ? 192.001 -67.115  21.406  1.00 101.44 ? 288 MET D CA  1 
ATOM   6632  C C   . MET D 2 288 ? 191.767 -66.333  22.695  1.00 103.12 ? 288 MET D C   1 
ATOM   6633  O O   . MET D 2 288 ? 192.594 -65.507  23.071  1.00 103.26 ? 288 MET D O   1 
ATOM   6634  C CB  . MET D 2 288 ? 191.408 -66.351  20.224  1.00 97.24  ? 288 MET D CB  1 
ATOM   6635  C CG  . MET D 2 288 ? 192.094 -66.635  18.901  1.00 93.77  ? 288 MET D CG  1 
ATOM   6636  S SD  . MET D 2 288 ? 192.649 -65.111  18.119  1.00 90.03  ? 288 MET D SD  1 
ATOM   6637  C CE  . MET D 2 288 ? 194.040 -64.715  19.169  1.00 89.97  ? 288 MET D CE  1 
ATOM   6638  N N   . LEU D 2 289 ? 190.649 -66.610  23.366  1.00 105.41 ? 289 LEU D N   1 
ATOM   6639  C CA  . LEU D 2 289 ? 190.241 -65.878  24.570  1.00 107.90 ? 289 LEU D CA  1 
ATOM   6640  C C   . LEU D 2 289 ? 191.048 -66.219  25.827  1.00 110.85 ? 289 LEU D C   1 
ATOM   6641  O O   . LEU D 2 289 ? 191.493 -65.319  26.544  1.00 110.48 ? 289 LEU D O   1 
ATOM   6642  C CB  . LEU D 2 289 ? 188.743 -66.079  24.842  1.00 106.43 ? 289 LEU D CB  1 
ATOM   6643  C CG  . LEU D 2 289 ? 187.707 -65.318  24.005  1.00 105.38 ? 289 LEU D CG  1 
ATOM   6644  C CD1 . LEU D 2 289 ? 186.322 -65.914  24.199  1.00 103.72 ? 289 LEU D CD1 1 
ATOM   6645  C CD2 . LEU D 2 289 ? 187.692 -63.835  24.349  1.00 105.53 ? 289 LEU D CD2 1 
ATOM   6646  N N   . ALA D 2 290 ? 191.228 -67.515  26.085  1.00 115.09 ? 290 ALA D N   1 
ATOM   6647  C CA  . ALA D 2 290 ? 191.872 -67.997  27.314  1.00 119.75 ? 290 ALA D CA  1 
ATOM   6648  C C   . ALA D 2 290 ? 193.337 -67.577  27.451  1.00 124.04 ? 290 ALA D C   1 
ATOM   6649  O O   . ALA D 2 290 ? 193.776 -67.209  28.543  1.00 124.05 ? 290 ALA D O   1 
ATOM   6650  C CB  . ALA D 2 290 ? 191.736 -69.509  27.433  1.00 118.97 ? 290 ALA D CB  1 
ATOM   6651  N N   . TYR D 2 291 ? 194.081 -67.635  26.347  1.00 130.64 ? 291 TYR D N   1 
ATOM   6652  C CA  . TYR D 2 291 ? 195.495 -67.244  26.331  1.00 135.38 ? 291 TYR D CA  1 
ATOM   6653  C C   . TYR D 2 291 ? 195.681 -65.746  26.081  1.00 131.60 ? 291 TYR D C   1 
ATOM   6654  O O   . TYR D 2 291 ? 196.773 -65.204  26.294  1.00 130.15 ? 291 TYR D O   1 
ATOM   6655  C CB  . TYR D 2 291 ? 196.277 -68.055  25.288  1.00 144.19 ? 291 TYR D CB  1 
ATOM   6656  C CG  . TYR D 2 291 ? 196.328 -69.548  25.557  1.00 152.01 ? 291 TYR D CG  1 
ATOM   6657  C CD1 . TYR D 2 291 ? 197.096 -70.065  26.602  1.00 154.87 ? 291 TYR D CD1 1 
ATOM   6658  C CD2 . TYR D 2 291 ? 195.620 -70.445  24.755  1.00 156.03 ? 291 TYR D CD2 1 
ATOM   6659  C CE1 . TYR D 2 291 ? 197.146 -71.430  26.849  1.00 157.73 ? 291 TYR D CE1 1 
ATOM   6660  C CE2 . TYR D 2 291 ? 195.666 -71.813  24.993  1.00 158.49 ? 291 TYR D CE2 1 
ATOM   6661  C CZ  . TYR D 2 291 ? 196.429 -72.300  26.040  1.00 158.65 ? 291 TYR D CZ  1 
ATOM   6662  O OH  . TYR D 2 291 ? 196.477 -73.655  26.280  1.00 158.39 ? 291 TYR D OH  1 
ATOM   6663  N N   . ALA D 2 292 ? 194.612 -65.089  25.629  1.00 127.37 ? 292 ALA D N   1 
ATOM   6664  C CA  . ALA D 2 292 ? 194.626 -63.652  25.369  1.00 122.76 ? 292 ALA D CA  1 
ATOM   6665  C C   . ALA D 2 292 ? 194.735 -62.869  26.666  1.00 119.33 ? 292 ALA D C   1 
ATOM   6666  O O   . ALA D 2 292 ? 193.902 -63.018  27.562  1.00 118.44 ? 292 ALA D O   1 
ATOM   6667  C CB  . ALA D 2 292 ? 193.379 -63.233  24.610  1.00 122.52 ? 292 ALA D CB  1 
ATOM   6668  N N   . GLY D 2 293 ? 195.771 -62.040  26.756  1.00 115.30 ? 293 GLY D N   1 
ATOM   6669  C CA  . GLY D 2 293 ? 195.996 -61.206  27.931  1.00 110.12 ? 293 GLY D CA  1 
ATOM   6670  C C   . GLY D 2 293 ? 194.992 -60.074  28.032  1.00 105.35 ? 293 GLY D C   1 
ATOM   6671  O O   . GLY D 2 293 ? 194.214 -60.004  28.987  1.00 106.65 ? 293 GLY D O   1 
ATOM   6672  N N   . LYS D 2 294 ? 195.001 -59.194  27.035  1.00 98.94  ? 294 LYS D N   1 
ATOM   6673  C CA  . LYS D 2 294 ? 194.142 -58.017  27.039  1.00 92.31  ? 294 LYS D CA  1 
ATOM   6674  C C   . LYS D 2 294 ? 192.985 -58.177  26.060  1.00 89.25  ? 294 LYS D C   1 
ATOM   6675  O O   . LYS D 2 294 ? 193.185 -58.219  24.848  1.00 89.40  ? 294 LYS D O   1 
ATOM   6676  C CB  . LYS D 2 294 ? 194.966 -56.773  26.713  1.00 90.40  ? 294 LYS D CB  1 
ATOM   6677  C CG  . LYS D 2 294 ? 194.373 -55.480  27.234  1.00 88.34  ? 294 LYS D CG  1 
ATOM   6678  C CD  . LYS D 2 294 ? 195.486 -54.525  27.621  1.00 87.53  ? 294 LYS D CD  1 
ATOM   6679  C CE  . LYS D 2 294 ? 194.922 -53.247  28.206  1.00 87.39  ? 294 LYS D CE  1 
ATOM   6680  N NZ  . LYS D 2 294 ? 195.939 -52.527  29.022  1.00 87.53  ? 294 LYS D NZ  1 
ATOM   6681  N N   . VAL D 2 295 ? 191.774 -58.276  26.597  1.00 85.59  ? 295 VAL D N   1 
ATOM   6682  C CA  . VAL D 2 295 ? 190.580 -58.460  25.777  1.00 83.09  ? 295 VAL D CA  1 
ATOM   6683  C C   . VAL D 2 295 ? 189.675 -57.234  25.870  1.00 81.92  ? 295 VAL D C   1 
ATOM   6684  O O   . VAL D 2 295 ? 189.526 -56.644  26.943  1.00 81.46  ? 295 VAL D O   1 
ATOM   6685  C CB  . VAL D 2 295 ? 189.821 -59.754  26.165  1.00 82.58  ? 295 VAL D CB  1 
ATOM   6686  C CG1 . VAL D 2 295 ? 188.433 -59.802  25.541  1.00 82.90  ? 295 VAL D CG1 1 
ATOM   6687  C CG2 . VAL D 2 295 ? 190.618 -60.979  25.744  1.00 82.00  ? 295 VAL D CG2 1 
ATOM   6688  N N   . VAL D 2 296 ? 189.095 -56.846  24.735  1.00 81.05  ? 296 VAL D N   1 
ATOM   6689  C CA  . VAL D 2 296 ? 188.127 -55.752  24.693  1.00 80.90  ? 296 VAL D CA  1 
ATOM   6690  C C   . VAL D 2 296 ? 186.852 -56.152  23.943  1.00 81.68  ? 296 VAL D C   1 
ATOM   6691  O O   . VAL D 2 296 ? 186.900 -56.562  22.779  1.00 80.61  ? 296 VAL D O   1 
ATOM   6692  C CB  . VAL D 2 296 ? 188.742 -54.456  24.109  1.00 80.27  ? 296 VAL D CB  1 
ATOM   6693  C CG1 . VAL D 2 296 ? 187.660 -53.458  23.723  1.00 80.26  ? 296 VAL D CG1 1 
ATOM   6694  C CG2 . VAL D 2 296 ? 189.697 -53.823  25.111  1.00 79.90  ? 296 VAL D CG2 1 
ATOM   6695  N N   . PHE D 2 297 ? 185.720 -56.043  24.636  1.00 83.96  ? 297 PHE D N   1 
ATOM   6696  C CA  . PHE D 2 297 ? 184.411 -56.271  24.035  1.00 86.51  ? 297 PHE D CA  1 
ATOM   6697  C C   . PHE D 2 297 ? 183.863 -54.976  23.449  1.00 88.95  ? 297 PHE D C   1 
ATOM   6698  O O   . PHE D 2 297 ? 183.806 -53.949  24.134  1.00 88.79  ? 297 PHE D O   1 
ATOM   6699  C CB  . PHE D 2 297 ? 183.419 -56.841  25.055  1.00 86.40  ? 297 PHE D CB  1 
ATOM   6700  C CG  . PHE D 2 297 ? 183.724 -58.249  25.486  1.00 86.51  ? 297 PHE D CG  1 
ATOM   6701  C CD1 . PHE D 2 297 ? 183.644 -59.304  24.581  1.00 86.40  ? 297 PHE D CD1 1 
ATOM   6702  C CD2 . PHE D 2 297 ? 184.071 -58.525  26.804  1.00 86.88  ? 297 PHE D CD2 1 
ATOM   6703  C CE1 . PHE D 2 297 ? 183.920 -60.604  24.979  1.00 86.33  ? 297 PHE D CE1 1 
ATOM   6704  C CE2 . PHE D 2 297 ? 184.347 -59.823  27.209  1.00 86.93  ? 297 PHE D CE2 1 
ATOM   6705  C CZ  . PHE D 2 297 ? 184.272 -60.863  26.295  1.00 86.62  ? 297 PHE D CZ  1 
ATOM   6706  N N   . VAL D 2 298 ? 183.472 -55.033  22.178  1.00 92.61  ? 298 VAL D N   1 
ATOM   6707  C CA  . VAL D 2 298 ? 182.853 -53.896  21.496  1.00 96.43  ? 298 VAL D CA  1 
ATOM   6708  C C   . VAL D 2 298 ? 181.406 -54.246  21.116  1.00 99.77  ? 298 VAL D C   1 
ATOM   6709  O O   . VAL D 2 298 ? 181.170 -54.894  20.088  1.00 100.27 ? 298 VAL D O   1 
ATOM   6710  C CB  . VAL D 2 298 ? 183.658 -53.452  20.249  1.00 95.99  ? 298 VAL D CB  1 
ATOM   6711  C CG1 . VAL D 2 298 ? 183.041 -52.206  19.630  1.00 95.74  ? 298 VAL D CG1 1 
ATOM   6712  C CG2 . VAL D 2 298 ? 185.114 -53.188  20.610  1.00 95.83  ? 298 VAL D CG2 1 
ATOM   6713  N N   . PRO D 2 299 ? 180.434 -53.827  21.954  1.00 102.51 ? 299 PRO D N   1 
ATOM   6714  C CA  . PRO D 2 299 ? 179.026 -54.163  21.731  1.00 103.11 ? 299 PRO D CA  1 
ATOM   6715  C C   . PRO D 2 299 ? 178.264 -53.174  20.835  1.00 102.21 ? 299 PRO D C   1 
ATOM   6716  O O   . PRO D 2 299 ? 178.659 -52.011  20.709  1.00 102.61 ? 299 PRO D O   1 
ATOM   6717  C CB  . PRO D 2 299 ? 178.447 -54.183  23.151  1.00 103.84 ? 299 PRO D CB  1 
ATOM   6718  C CG  . PRO D 2 299 ? 179.321 -53.264  23.947  1.00 103.41 ? 299 PRO D CG  1 
ATOM   6719  C CD  . PRO D 2 299 ? 180.629 -53.090  23.219  1.00 103.24 ? 299 PRO D CD  1 
ATOM   6720  N N   . GLY D 2 300 ? 177.181 -53.651  20.223  1.00 100.29 ? 300 GLY D N   1 
ATOM   6721  C CA  . GLY D 2 300 ? 176.328 -52.825  19.369  1.00 97.85  ? 300 GLY D CA  1 
ATOM   6722  C C   . GLY D 2 300 ? 174.871 -53.253  19.409  1.00 97.06  ? 300 GLY D C   1 
ATOM   6723  O O   . GLY D 2 300 ? 174.440 -53.929  20.348  1.00 96.00  ? 300 GLY D O   1 
ATOM   6724  N N   . TYR D 2 301 ? 174.120 -52.862  18.379  1.00 97.67  ? 301 TYR D N   1 
ATOM   6725  C CA  . TYR D 2 301 ? 172.681 -53.154  18.269  1.00 99.35  ? 301 TYR D CA  1 
ATOM   6726  C C   . TYR D 2 301 ? 172.364 -54.654  18.286  1.00 96.57  ? 301 TYR D C   1 
ATOM   6727  O O   . TYR D 2 301 ? 171.315 -55.063  18.789  1.00 97.25  ? 301 TYR D O   1 
ATOM   6728  C CB  . TYR D 2 301 ? 172.099 -52.478  17.011  1.00 103.92 ? 301 TYR D CB  1 
ATOM   6729  C CG  . TYR D 2 301 ? 170.611 -52.704  16.730  1.00 108.07 ? 301 TYR D CG  1 
ATOM   6730  C CD1 . TYR D 2 301 ? 169.637 -52.467  17.708  1.00 109.20 ? 301 TYR D CD1 1 
ATOM   6731  C CD2 . TYR D 2 301 ? 170.179 -53.119  15.466  1.00 109.65 ? 301 TYR D CD2 1 
ATOM   6732  C CE1 . TYR D 2 301 ? 168.285 -52.663  17.441  1.00 109.44 ? 301 TYR D CE1 1 
ATOM   6733  C CE2 . TYR D 2 301 ? 168.830 -53.311  15.190  1.00 109.26 ? 301 TYR D CE2 1 
ATOM   6734  C CZ  . TYR D 2 301 ? 167.887 -53.081  16.178  1.00 108.94 ? 301 TYR D CZ  1 
ATOM   6735  O OH  . TYR D 2 301 ? 166.549 -53.276  15.907  1.00 107.08 ? 301 TYR D OH  1 
ATOM   6736  N N   . GLY D 2 302 ? 173.277 -55.463  17.751  1.00 92.56  ? 302 GLY D N   1 
ATOM   6737  C CA  . GLY D 2 302 ? 173.092 -56.915  17.668  1.00 87.47  ? 302 GLY D CA  1 
ATOM   6738  C C   . GLY D 2 302 ? 172.952 -57.608  19.008  1.00 81.79  ? 302 GLY D C   1 
ATOM   6739  O O   . GLY D 2 302 ? 172.174 -58.558  19.153  1.00 80.85  ? 302 GLY D O   1 
ATOM   6740  N N   . MET D 2 303 ? 173.716 -57.129  19.984  1.00 77.51  ? 303 MET D N   1 
ATOM   6741  C CA  . MET D 2 303 ? 173.615 -57.598  21.356  1.00 74.01  ? 303 MET D CA  1 
ATOM   6742  C C   . MET D 2 303 ? 172.231 -57.286  21.921  1.00 72.71  ? 303 MET D C   1 
ATOM   6743  O O   . MET D 2 303 ? 171.685 -58.065  22.701  1.00 71.72  ? 303 MET D O   1 
ATOM   6744  C CB  . MET D 2 303 ? 174.698 -56.940  22.206  1.00 73.38  ? 303 MET D CB  1 
ATOM   6745  C CG  . MET D 2 303 ? 174.717 -57.382  23.659  1.00 73.09  ? 303 MET D CG  1 
ATOM   6746  S SD  . MET D 2 303 ? 175.640 -56.242  24.704  1.00 73.33  ? 303 MET D SD  1 
ATOM   6747  C CE  . MET D 2 303 ? 174.611 -54.777  24.632  1.00 73.28  ? 303 MET D CE  1 
ATOM   6748  N N   . ALA D 2 304 ? 171.668 -56.150  21.513  1.00 72.55  ? 304 ALA D N   1 
ATOM   6749  C CA  . ALA D 2 304 ? 170.341 -55.738  21.960  1.00 73.72  ? 304 ALA D CA  1 
ATOM   6750  C C   . ALA D 2 304 ? 169.218 -56.573  21.337  1.00 75.38  ? 304 ALA D C   1 
ATOM   6751  O O   . ALA D 2 304 ? 168.395 -57.125  22.066  1.00 75.53  ? 304 ALA D O   1 
ATOM   6752  C CB  . ALA D 2 304 ? 170.121 -54.254  21.702  1.00 73.21  ? 304 ALA D CB  1 
ATOM   6753  N N   . LEU D 2 305 ? 169.193 -56.673  20.005  1.00 78.12  ? 305 LEU D N   1 
ATOM   6754  C CA  . LEU D 2 305 ? 168.132 -57.407  19.288  1.00 80.81  ? 305 LEU D CA  1 
ATOM   6755  C C   . LEU D 2 305 ? 167.948 -58.847  19.762  1.00 82.90  ? 305 LEU D C   1 
ATOM   6756  O O   . LEU D 2 305 ? 166.820 -59.335  19.863  1.00 82.83  ? 305 LEU D O   1 
ATOM   6757  C CB  . LEU D 2 305 ? 168.361 -57.400  17.768  1.00 80.73  ? 305 LEU D CB  1 
ATOM   6758  C CG  . LEU D 2 305 ? 167.580 -56.443  16.853  1.00 80.50  ? 305 LEU D CG  1 
ATOM   6759  C CD1 . LEU D 2 305 ? 167.894 -56.740  15.393  1.00 80.15  ? 305 LEU D CD1 1 
ATOM   6760  C CD2 . LEU D 2 305 ? 166.075 -56.502  17.084  1.00 80.10  ? 305 LEU D CD2 1 
ATOM   6761  N N   . SER D 2 306 ? 169.057 -59.522  20.044  1.00 86.03  ? 306 SER D N   1 
ATOM   6762  C CA  . SER D 2 306 ? 169.017 -60.904  20.498  1.00 90.21  ? 306 SER D CA  1 
ATOM   6763  C C   . SER D 2 306 ? 168.849 -60.994  22.011  1.00 94.84  ? 306 SER D C   1 
ATOM   6764  O O   . SER D 2 306 ? 168.382 -62.012  22.530  1.00 94.81  ? 306 SER D O   1 
ATOM   6765  C CB  . SER D 2 306 ? 170.290 -61.630  20.076  1.00 89.43  ? 306 SER D CB  1 
ATOM   6766  O OG  . SER D 2 306 ? 170.068 -63.024  19.986  1.00 89.12  ? 306 SER D OG  1 
ATOM   6767  N N   . GLN D 2 307 ? 169.221 -59.915  22.702  1.00 101.51 ? 307 GLN D N   1 
ATOM   6768  C CA  . GLN D 2 307 ? 169.305 -59.865  24.170  1.00 108.22 ? 307 GLN D CA  1 
ATOM   6769  C C   . GLN D 2 307 ? 170.465 -60.711  24.697  1.00 110.99 ? 307 GLN D C   1 
ATOM   6770  O O   . GLN D 2 307 ? 170.294 -61.568  25.570  1.00 111.25 ? 307 GLN D O   1 
ATOM   6771  C CB  . GLN D 2 307 ? 167.970 -60.222  24.844  1.00 110.80 ? 307 GLN D CB  1 
ATOM   6772  C CG  . GLN D 2 307 ? 166.941 -59.102  24.792  1.00 114.38 ? 307 GLN D CG  1 
ATOM   6773  C CD  . GLN D 2 307 ? 167.418 -57.830  25.476  1.00 116.44 ? 307 GLN D CD  1 
ATOM   6774  O OE1 . GLN D 2 307 ? 167.517 -57.770  26.703  1.00 117.56 ? 307 GLN D OE1 1 
ATOM   6775  N NE2 . GLN D 2 307 ? 167.710 -56.803  24.683  1.00 117.24 ? 307 GLN D NE2 1 
ATOM   6776  N N   . ALA D 2 308 ? 171.651 -60.435  24.154  1.00 114.20 ? 308 ALA D N   1 
ATOM   6777  C CA  . ALA D 2 308 ? 172.863 -61.201  24.440  1.00 117.05 ? 308 ALA D CA  1 
ATOM   6778  C C   . ALA D 2 308 ? 173.621 -60.707  25.670  1.00 118.63 ? 308 ALA D C   1 
ATOM   6779  O O   . ALA D 2 308 ? 174.532 -61.385  26.154  1.00 118.13 ? 308 ALA D O   1 
ATOM   6780  C CB  . ALA D 2 308 ? 173.779 -61.193  23.225  1.00 117.45 ? 308 ALA D CB  1 
ATOM   6781  N N   . GLN D 2 309 ? 173.237 -59.531  26.164  1.00 120.62 ? 309 GLN D N   1 
ATOM   6782  C CA  . GLN D 2 309 ? 173.911 -58.866  27.287  1.00 121.75 ? 309 GLN D CA  1 
ATOM   6783  C C   . GLN D 2 309 ? 174.275 -59.789  28.454  1.00 122.00 ? 309 GLN D C   1 
ATOM   6784  O O   . GLN D 2 309 ? 175.393 -59.731  28.974  1.00 121.78 ? 309 GLN D O   1 
ATOM   6785  C CB  . GLN D 2 309 ? 173.094 -57.656  27.781  1.00 121.76 ? 309 GLN D CB  1 
ATOM   6786  C CG  . GLN D 2 309 ? 171.712 -57.970  28.353  1.00 121.53 ? 309 GLN D CG  1 
ATOM   6787  C CD  . GLN D 2 309 ? 170.661 -58.229  27.286  1.00 121.45 ? 309 GLN D CD  1 
ATOM   6788  O OE1 . GLN D 2 309 ? 170.689 -57.633  26.206  1.00 120.76 ? 309 GLN D OE1 1 
ATOM   6789  N NE2 . GLN D 2 309 ? 169.720 -59.117  27.589  1.00 121.78 ? 309 GLN D NE2 1 
ATOM   6790  N N   . HIS D 2 310 ? 173.336 -60.651  28.840  1.00 122.57 ? 310 HIS D N   1 
ATOM   6791  C CA  . HIS D 2 310 ? 173.513 -61.553  29.977  1.00 121.58 ? 310 HIS D CA  1 
ATOM   6792  C C   . HIS D 2 310 ? 174.512 -62.671  29.685  1.00 114.68 ? 310 HIS D C   1 
ATOM   6793  O O   . HIS D 2 310 ? 175.067 -63.276  30.604  1.00 112.65 ? 310 HIS D O   1 
ATOM   6794  C CB  . HIS D 2 310 ? 172.162 -62.127  30.418  1.00 129.39 ? 310 HIS D CB  1 
ATOM   6795  C CG  . HIS D 2 310 ? 171.204 -61.092  30.928  1.00 135.87 ? 310 HIS D CG  1 
ATOM   6796  N ND1 . HIS D 2 310 ? 171.372 -60.453  32.138  1.00 138.49 ? 310 HIS D ND1 1 
ATOM   6797  C CD2 . HIS D 2 310 ? 170.066 -60.588  30.393  1.00 138.29 ? 310 HIS D CD2 1 
ATOM   6798  C CE1 . HIS D 2 310 ? 170.381 -59.598  32.325  1.00 139.79 ? 310 HIS D CE1 1 
ATOM   6799  N NE2 . HIS D 2 310 ? 169.575 -59.661  31.281  1.00 139.92 ? 310 HIS D NE2 1 
ATOM   6800  N N   . LYS D 2 311 ? 174.742 -62.934  28.404  1.00 108.36 ? 311 LYS D N   1 
ATOM   6801  C CA  . LYS D 2 311 ? 175.730 -63.918  27.992  1.00 105.09 ? 311 LYS D CA  1 
ATOM   6802  C C   . LYS D 2 311 ? 177.068 -63.274  27.627  1.00 105.76 ? 311 LYS D C   1 
ATOM   6803  O O   . LYS D 2 311 ? 178.004 -63.968  27.229  1.00 106.15 ? 311 LYS D O   1 
ATOM   6804  C CB  . LYS D 2 311 ? 175.190 -64.768  26.840  1.00 102.82 ? 311 LYS D CB  1 
ATOM   6805  C CG  . LYS D 2 311 ? 174.094 -65.733  27.261  1.00 102.09 ? 311 LYS D CG  1 
ATOM   6806  C CD  . LYS D 2 311 ? 174.602 -66.712  28.308  1.00 102.92 ? 311 LYS D CD  1 
ATOM   6807  C CE  . LYS D 2 311 ? 173.497 -67.629  28.799  1.00 104.57 ? 311 LYS D CE  1 
ATOM   6808  N NZ  . LYS D 2 311 ? 174.004 -68.602  29.806  1.00 106.23 ? 311 LYS D NZ  1 
ATOM   6809  N N   . LEU D 2 312 ? 177.153 -61.953  27.779  1.00 107.08 ? 312 LEU D N   1 
ATOM   6810  C CA  . LEU D 2 312 ? 178.392 -61.216  27.516  1.00 109.47 ? 312 LEU D CA  1 
ATOM   6811  C C   . LEU D 2 312 ? 179.208 -60.967  28.787  1.00 113.30 ? 312 LEU D C   1 
ATOM   6812  O O   . LEU D 2 312 ? 180.439 -61.046  28.760  1.00 114.21 ? 312 LEU D O   1 
ATOM   6813  C CB  . LEU D 2 312 ? 178.109 -59.892  26.790  1.00 106.89 ? 312 LEU D CB  1 
ATOM   6814  C CG  . LEU D 2 312 ? 179.310 -59.034  26.359  1.00 105.12 ? 312 LEU D CG  1 
ATOM   6815  C CD1 . LEU D 2 312 ? 180.132 -59.716  25.272  1.00 104.35 ? 312 LEU D CD1 1 
ATOM   6816  C CD2 . LEU D 2 312 ? 178.858 -57.657  25.897  1.00 104.30 ? 312 LEU D CD2 1 
ATOM   6817  N N   . LYS D 2 313 ? 178.523 -60.659  29.889  1.00 117.93 ? 313 LYS D N   1 
ATOM   6818  C CA  . LYS D 2 313 ? 179.189 -60.425  31.175  1.00 123.35 ? 313 LYS D CA  1 
ATOM   6819  C C   . LYS D 2 313 ? 179.704 -61.733  31.761  1.00 124.80 ? 313 LYS D C   1 
ATOM   6820  O O   . LYS D 2 313 ? 180.729 -61.753  32.448  1.00 125.76 ? 313 LYS D O   1 
ATOM   6821  C CB  . LYS D 2 313 ? 178.247 -59.739  32.172  1.00 126.17 ? 313 LYS D CB  1 
ATOM   6822  C CG  . LYS D 2 313 ? 178.935 -58.765  33.127  1.00 129.97 ? 313 LYS D CG  1 
ATOM   6823  C CD  . LYS D 2 313 ? 179.418 -59.398  34.430  1.00 131.91 ? 313 LYS D CD  1 
ATOM   6824  C CE  . LYS D 2 313 ? 180.026 -58.345  35.352  1.00 133.06 ? 313 LYS D CE  1 
ATOM   6825  N NZ  . LYS D 2 313 ? 180.510 -58.893  36.653  1.00 133.58 ? 313 LYS D NZ  1 
ATOM   6826  N N   . GLU D 2 314 ? 178.985 -62.820  31.479  1.00 125.95 ? 314 GLU D N   1 
ATOM   6827  C CA  . GLU D 2 314 ? 179.377 -64.161  31.908  1.00 127.38 ? 314 GLU D CA  1 
ATOM   6828  C C   . GLU D 2 314 ? 180.689 -64.600  31.241  1.00 130.31 ? 314 GLU D C   1 
ATOM   6829  O O   . GLU D 2 314 ? 181.429 -65.418  31.796  1.00 132.38 ? 314 GLU D O   1 
ATOM   6830  C CB  . GLU D 2 314 ? 178.252 -65.162  31.620  1.00 124.38 ? 314 GLU D CB  1 
ATOM   6831  C CG  . GLU D 2 314 ? 178.236 -66.373  32.543  1.00 121.64 ? 314 GLU D CG  1 
ATOM   6832  C CD  . GLU D 2 314 ? 176.985 -67.222  32.390  1.00 119.94 ? 314 GLU D CD  1 
ATOM   6833  O OE1 . GLU D 2 314 ? 175.880 -66.652  32.247  1.00 119.01 ? 314 GLU D OE1 1 
ATOM   6834  O OE2 . GLU D 2 314 ? 177.104 -68.465  32.422  1.00 119.34 ? 314 GLU D OE2 1 
ATOM   6835  N N   . LEU D 2 315 ? 180.966 -64.048  30.057  1.00 131.54 ? 315 LEU D N   1 
ATOM   6836  C CA  . LEU D 2 315 ? 182.242 -64.252  29.359  1.00 129.85 ? 315 LEU D CA  1 
ATOM   6837  C C   . LEU D 2 315 ? 183.311 -63.274  29.862  1.00 128.68 ? 315 LEU D C   1 
ATOM   6838  O O   . LEU D 2 315 ? 184.504 -63.586  29.839  1.00 129.80 ? 315 LEU D O   1 
ATOM   6839  C CB  . LEU D 2 315 ? 182.060 -64.127  27.834  1.00 127.79 ? 315 LEU D CB  1 
ATOM   6840  C CG  . LEU D 2 315 ? 183.204 -64.483  26.867  1.00 124.66 ? 315 LEU D CG  1 
ATOM   6841  C CD1 . LEU D 2 315 ? 183.564 -65.960  26.919  1.00 123.34 ? 315 LEU D CD1 1 
ATOM   6842  C CD2 . LEU D 2 315 ? 182.852 -64.088  25.441  1.00 122.69 ? 315 LEU D CD2 1 
ATOM   6843  N N   . ALA D 2 316 ? 182.875 -62.099  30.316  1.00 125.42 ? 316 ALA D N   1 
ATOM   6844  C CA  . ALA D 2 316 ? 183.774 -61.083  30.869  1.00 121.24 ? 316 ALA D CA  1 
ATOM   6845  C C   . ALA D 2 316 ? 184.288 -61.462  32.255  1.00 119.57 ? 316 ALA D C   1 
ATOM   6846  O O   . ALA D 2 316 ? 185.390 -61.070  32.641  1.00 117.73 ? 316 ALA D O   1 
ATOM   6847  C CB  . ALA D 2 316 ? 183.082 -59.731  30.916  1.00 119.89 ? 316 ALA D CB  1 
ATOM   6848  N N   . ASP D 2 317 ? 183.479 -62.218  32.996  1.00 119.77 ? 317 ASP D N   1 
ATOM   6849  C CA  . ASP D 2 317 ? 183.839 -62.679  34.337  1.00 120.19 ? 317 ASP D CA  1 
ATOM   6850  C C   . ASP D 2 317 ? 184.698 -63.941  34.323  1.00 118.86 ? 317 ASP D C   1 
ATOM   6851  O O   . ASP D 2 317 ? 185.604 -64.083  35.146  1.00 119.13 ? 317 ASP D O   1 
ATOM   6852  C CB  . ASP D 2 317 ? 182.585 -62.904  35.187  1.00 122.85 ? 317 ASP D CB  1 
ATOM   6853  C CG  . ASP D 2 317 ? 182.012 -61.611  35.744  1.00 124.87 ? 317 ASP D CG  1 
ATOM   6854  O OD1 . ASP D 2 317 ? 182.604 -60.532  35.512  1.00 124.97 ? 317 ASP D OD1 1 
ATOM   6855  O OD2 . ASP D 2 317 ? 180.968 -61.675  36.425  1.00 127.33 ? 317 ASP D OD2 1 
ATOM   6856  N N   . LEU D 2 318 ? 184.406 -64.854  33.397  1.00 117.02 ? 318 LEU D N   1 
ATOM   6857  C CA  . LEU D 2 318 ? 185.173 -66.094  33.253  1.00 115.57 ? 318 LEU D CA  1 
ATOM   6858  C C   . LEU D 2 318 ? 186.598 -65.817  32.773  1.00 118.09 ? 318 LEU D C   1 
ATOM   6859  O O   . LEU D 2 318 ? 187.539 -66.508  33.176  1.00 118.72 ? 318 LEU D O   1 
ATOM   6860  C CB  . LEU D 2 318 ? 184.465 -67.070  32.305  1.00 111.56 ? 318 LEU D CB  1 
ATOM   6861  C CG  . LEU D 2 318 ? 185.043 -68.483  32.155  1.00 108.61 ? 318 LEU D CG  1 
ATOM   6862  C CD1 . LEU D 2 318 ? 184.809 -69.320  33.404  1.00 107.17 ? 318 LEU D CD1 1 
ATOM   6863  C CD2 . LEU D 2 318 ? 184.455 -69.172  30.934  1.00 107.55 ? 318 LEU D CD2 1 
ATOM   6864  N N   . LEU D 2 319 ? 186.744 -64.810  31.911  1.00 120.54 ? 319 LEU D N   1 
ATOM   6865  C CA  . LEU D 2 319 ? 188.057 -64.333  31.476  1.00 121.95 ? 319 LEU D CA  1 
ATOM   6866  C C   . LEU D 2 319 ? 188.807 -63.680  32.637  1.00 123.91 ? 319 LEU D C   1 
ATOM   6867  O O   . LEU D 2 319 ? 190.015 -63.866  32.782  1.00 123.45 ? 319 LEU D O   1 
ATOM   6868  C CB  . LEU D 2 319 ? 187.929 -63.350  30.306  1.00 120.18 ? 319 LEU D CB  1 
ATOM   6869  C CG  . LEU D 2 319 ? 187.635 -63.867  28.893  1.00 119.52 ? 319 LEU D CG  1 
ATOM   6870  C CD1 . LEU D 2 319 ? 187.344 -62.702  27.960  1.00 118.63 ? 319 LEU D CD1 1 
ATOM   6871  C CD2 . LEU D 2 319 ? 188.768 -64.718  28.341  1.00 118.98 ? 319 LEU D CD2 1 
ATOM   6872  N N   . GLU D 2 320 ? 188.076 -62.931  33.464  1.00 126.68 ? 320 GLU D N   1 
ATOM   6873  C CA  . GLU D 2 320 ? 188.643 -62.270  34.646  1.00 127.91 ? 320 GLU D CA  1 
ATOM   6874  C C   . GLU D 2 320 ? 189.020 -63.236  35.777  1.00 124.33 ? 320 GLU D C   1 
ATOM   6875  O O   . GLU D 2 320 ? 189.945 -62.962  36.548  1.00 125.48 ? 320 GLU D O   1 
ATOM   6876  C CB  . GLU D 2 320 ? 187.697 -61.183  35.173  1.00 132.36 ? 320 GLU D CB  1 
ATOM   6877  C CG  . GLU D 2 320 ? 187.859 -59.828  34.497  1.00 135.82 ? 320 GLU D CG  1 
ATOM   6878  C CD  . GLU D 2 320 ? 187.297 -58.685  35.326  1.00 137.89 ? 320 GLU D CD  1 
ATOM   6879  O OE1 . GLU D 2 320 ? 186.054 -58.578  35.441  1.00 138.27 ? 320 GLU D OE1 1 
ATOM   6880  O OE2 . GLU D 2 320 ? 188.104 -57.889  35.856  1.00 138.64 ? 320 GLU D OE2 1 
ATOM   6881  N N   . ALA D 2 321 ? 188.301 -64.355  35.873  1.00 117.86 ? 321 ALA D N   1 
ATOM   6882  C CA  . ALA D 2 321 ? 188.603 -65.406  36.851  1.00 110.05 ? 321 ALA D CA  1 
ATOM   6883  C C   . ALA D 2 321 ? 189.870 -66.167  36.466  1.00 104.87 ? 321 ALA D C   1 
ATOM   6884  O O   . ALA D 2 321 ? 190.582 -66.686  37.330  1.00 102.95 ? 321 ALA D O   1 
ATOM   6885  C CB  . ALA D 2 321 ? 187.429 -66.362  36.988  1.00 109.92 ? 321 ALA D CB  1 
ATOM   6886  N N   . ARG D 2 322 ? 190.129 -66.233  35.161  1.00 99.19  ? 322 ARG D N   1 
ATOM   6887  C CA  . ARG D 2 322 ? 191.363 -66.793  34.617  1.00 94.62  ? 322 ARG D CA  1 
ATOM   6888  C C   . ARG D 2 322 ? 192.500 -65.778  34.678  1.00 96.07  ? 322 ARG D C   1 
ATOM   6889  O O   . ARG D 2 322 ? 193.672 -66.155  34.757  1.00 96.85  ? 322 ARG D O   1 
ATOM   6890  C CB  . ARG D 2 322 ? 191.154 -67.228  33.169  1.00 88.65  ? 322 ARG D CB  1 
ATOM   6891  C CG  . ARG D 2 322 ? 190.360 -68.508  33.010  1.00 82.24  ? 322 ARG D CG  1 
ATOM   6892  C CD  . ARG D 2 322 ? 190.187 -68.832  31.539  1.00 77.49  ? 322 ARG D CD  1 
ATOM   6893  N NE  . ARG D 2 322 ? 190.344 -70.260  31.290  1.00 73.27  ? 322 ARG D NE  1 
ATOM   6894  C CZ  . ARG D 2 322 ? 191.516 -70.862  31.106  1.00 71.27  ? 322 ARG D CZ  1 
ATOM   6895  N NH1 . ARG D 2 322 ? 192.646 -70.166  31.142  1.00 69.43  ? 322 ARG D NH1 1 
ATOM   6896  N NH2 . ARG D 2 322 ? 191.564 -72.165  30.888  1.00 70.74  ? 322 ARG D NH2 1 
ATOM   6897  N N   . GLY D 2 323 ? 192.146 -64.495  34.627  1.00 97.12  ? 323 GLY D N   1 
ATOM   6898  C CA  . GLY D 2 323 ? 193.120 -63.407  34.706  1.00 97.33  ? 323 GLY D CA  1 
ATOM   6899  C C   . GLY D 2 323 ? 192.952 -62.338  33.639  1.00 96.84  ? 323 GLY D C   1 
ATOM   6900  O O   . GLY D 2 323 ? 193.255 -61.167  33.878  1.00 97.82  ? 323 GLY D O   1 
ATOM   6901  N N   . VAL D 2 324 ? 192.465 -62.751  32.469  1.00 95.14  ? 324 VAL D N   1 
ATOM   6902  C CA  . VAL D 2 324 ? 192.315 -61.892  31.285  1.00 93.81  ? 324 VAL D CA  1 
ATOM   6903  C C   . VAL D 2 324 ? 191.805 -60.484  31.610  1.00 96.23  ? 324 VAL D C   1 
ATOM   6904  O O   . VAL D 2 324 ? 190.712 -60.324  32.158  1.00 96.01  ? 324 VAL D O   1 
ATOM   6905  C CB  . VAL D 2 324 ? 191.388 -62.555  30.240  1.00 90.84  ? 324 VAL D CB  1 
ATOM   6906  C CG1 . VAL D 2 324 ? 191.241 -61.682  29.007  1.00 88.87  ? 324 VAL D CG1 1 
ATOM   6907  C CG2 . VAL D 2 324 ? 191.905 -63.937  29.865  1.00 89.85  ? 324 VAL D CG2 1 
ATOM   6908  N N   . GLU D 2 325 ? 192.611 -59.477  31.272  1.00 99.90  ? 325 GLU D N   1 
ATOM   6909  C CA  . GLU D 2 325 ? 192.262 -58.074  31.505  1.00 103.31 ? 325 GLU D CA  1 
ATOM   6910  C C   . GLU D 2 325 ? 191.159 -57.652  30.540  1.00 107.38 ? 325 GLU D C   1 
ATOM   6911  O O   . GLU D 2 325 ? 191.394 -57.480  29.340  1.00 107.94 ? 325 GLU D O   1 
ATOM   6912  C CB  . GLU D 2 325 ? 193.488 -57.167  31.349  1.00 101.02 ? 325 GLU D CB  1 
ATOM   6913  C CG  . GLU D 2 325 ? 193.460 -55.931  32.235  1.00 98.36  ? 325 GLU D CG  1 
ATOM   6914  C CD  . GLU D 2 325 ? 194.070 -54.719  31.562  1.00 96.92  ? 325 GLU D CD  1 
ATOM   6915  O OE1 . GLU D 2 325 ? 195.269 -54.447  31.786  1.00 95.78  ? 325 GLU D OE1 1 
ATOM   6916  O OE2 . GLU D 2 325 ? 193.345 -54.043  30.802  1.00 96.44  ? 325 GLU D OE2 1 
ATOM   6917  N N   . VAL D 2 326 ? 189.954 -57.494  31.082  1.00 112.46 ? 326 VAL D N   1 
ATOM   6918  C CA  . VAL D 2 326 ? 188.754 -57.259  30.280  1.00 116.09 ? 326 VAL D CA  1 
ATOM   6919  C C   . VAL D 2 326 ? 188.241 -55.825  30.430  1.00 117.80 ? 326 VAL D C   1 
ATOM   6920  O O   . VAL D 2 326 ? 188.038 -55.338  31.546  1.00 118.62 ? 326 VAL D O   1 
ATOM   6921  C CB  . VAL D 2 326 ? 187.640 -58.279  30.629  1.00 116.33 ? 326 VAL D CB  1 
ATOM   6922  C CG1 . VAL D 2 326 ? 186.327 -57.928  29.939  1.00 116.52 ? 326 VAL D CG1 1 
ATOM   6923  C CG2 . VAL D 2 326 ? 188.071 -59.689  30.250  1.00 115.58 ? 326 VAL D CG2 1 
ATOM   6924  N N   . LYS D 2 327 ? 188.047 -55.162  29.291  1.00 118.67 ? 327 LYS D N   1 
ATOM   6925  C CA  . LYS D 2 327 ? 187.481 -53.815  29.244  1.00 118.71 ? 327 LYS D CA  1 
ATOM   6926  C C   . LYS D 2 327 ? 186.434 -53.697  28.134  1.00 119.08 ? 327 LYS D C   1 
ATOM   6927  O O   . LYS D 2 327 ? 186.495 -54.413  27.134  1.00 119.58 ? 327 LYS D O   1 
ATOM   6928  C CB  . LYS D 2 327 ? 188.586 -52.770  29.058  1.00 117.84 ? 327 LYS D CB  1 
ATOM   6929  C CG  . LYS D 2 327 ? 189.434 -52.535  30.298  1.00 116.72 ? 327 LYS D CG  1 
ATOM   6930  C CD  . LYS D 2 327 ? 190.384 -51.366  30.111  1.00 115.82 ? 327 LYS D CD  1 
ATOM   6931  C CE  . LYS D 2 327 ? 191.211 -51.128  31.363  1.00 115.31 ? 327 LYS D CE  1 
ATOM   6932  N NZ  . LYS D 2 327 ? 192.123 -49.960  31.209  1.00 115.30 ? 327 LYS D NZ  1 
ATOM   6933  N N   . PHE D 2 328 ? 185.476 -52.790  28.320  1.00 118.70 ? 328 PHE D N   1 
ATOM   6934  C CA  . PHE D 2 328 ? 184.374 -52.605  27.376  1.00 118.01 ? 328 PHE D CA  1 
ATOM   6935  C C   . PHE D 2 328 ? 184.450 -51.255  26.675  1.00 120.16 ? 328 PHE D C   1 
ATOM   6936  O O   . PHE D 2 328 ? 184.212 -50.214  27.291  1.00 121.93 ? 328 PHE D O   1 
ATOM   6937  C CB  . PHE D 2 328 ? 183.027 -52.745  28.092  1.00 115.37 ? 328 PHE D CB  1 
ATOM   6938  C CG  . PHE D 2 328 ? 182.733 -54.137  28.561  1.00 113.98 ? 328 PHE D CG  1 
ATOM   6939  C CD1 . PHE D 2 328 ? 183.278 -54.617  29.749  1.00 113.64 ? 328 PHE D CD1 1 
ATOM   6940  C CD2 . PHE D 2 328 ? 181.911 -54.971  27.816  1.00 113.27 ? 328 PHE D CD2 1 
ATOM   6941  C CE1 . PHE D 2 328 ? 183.012 -55.906  30.179  1.00 113.21 ? 328 PHE D CE1 1 
ATOM   6942  C CE2 . PHE D 2 328 ? 181.638 -56.260  28.242  1.00 113.27 ? 328 PHE D CE2 1 
ATOM   6943  C CZ  . PHE D 2 328 ? 182.188 -56.726  29.425  1.00 113.24 ? 328 PHE D CZ  1 
ATOM   6944  N N   . ALA D 2 329 ? 184.788 -51.283  25.388  1.00 122.16 ? 329 ALA D N   1 
ATOM   6945  C CA  . ALA D 2 329 ? 184.807 -50.077  24.565  1.00 123.00 ? 329 ALA D CA  1 
ATOM   6946  C C   . ALA D 2 329 ? 183.377 -49.656  24.253  1.00 123.22 ? 329 ALA D C   1 
ATOM   6947  O O   . ALA D 2 329 ? 182.615 -50.414  23.649  1.00 125.36 ? 329 ALA D O   1 
ATOM   6948  C CB  . ALA D 2 329 ? 185.593 -50.311  23.283  1.00 123.51 ? 329 ALA D CB  1 
ATOM   6949  N N   . ILE D 2 330 ? 183.015 -48.450  24.682  1.00 124.74 ? 330 ILE D N   1 
ATOM   6950  C CA  . ILE D 2 330 ? 181.646 -47.957  24.542  1.00 125.25 ? 330 ILE D CA  1 
ATOM   6951  C C   . ILE D 2 330 ? 181.574 -46.762  23.595  1.00 124.29 ? 330 ILE D C   1 
ATOM   6952  O O   . ILE D 2 330 ? 181.917 -45.632  23.959  1.00 123.56 ? 330 ILE D O   1 
ATOM   6953  C CB  . ILE D 2 330 ? 181.005 -47.609  25.913  1.00 125.99 ? 330 ILE D CB  1 
ATOM   6954  C CG1 . ILE D 2 330 ? 181.164 -48.765  26.917  1.00 125.18 ? 330 ILE D CG1 1 
ATOM   6955  C CG2 . ILE D 2 330 ? 179.539 -47.211  25.751  1.00 127.47 ? 330 ILE D CG2 1 
ATOM   6956  C CD1 . ILE D 2 330 ? 180.639 -50.111  26.451  1.00 122.91 ? 330 ILE D CD1 1 
ATOM   6957  N N   . HIS D 2 331 ? 181.133 -47.036  22.371  1.00 122.75 ? 331 HIS D N   1 
ATOM   6958  C CA  . HIS D 2 331 ? 180.856 -45.996  21.396  1.00 120.08 ? 331 HIS D CA  1 
ATOM   6959  C C   . HIS D 2 331 ? 179.554 -45.322  21.819  1.00 114.06 ? 331 HIS D C   1 
ATOM   6960  O O   . HIS D 2 331 ? 178.526 -45.990  21.954  1.00 112.73 ? 331 HIS D O   1 
ATOM   6961  C CB  . HIS D 2 331 ? 180.721 -46.602  19.997  1.00 124.77 ? 331 HIS D CB  1 
ATOM   6962  C CG  . HIS D 2 331 ? 181.183 -45.701  18.892  1.00 128.30 ? 331 HIS D CG  1 
ATOM   6963  N ND1 . HIS D 2 331 ? 180.527 -44.538  18.554  1.00 129.12 ? 331 HIS D ND1 1 
ATOM   6964  C CD2 . HIS D 2 331 ? 182.229 -45.805  18.038  1.00 129.46 ? 331 HIS D CD2 1 
ATOM   6965  C CE1 . HIS D 2 331 ? 181.152 -43.960  17.542  1.00 129.99 ? 331 HIS D CE1 1 
ATOM   6966  N NE2 . HIS D 2 331 ? 182.187 -44.710  17.209  1.00 130.02 ? 331 HIS D NE2 1 
ATOM   6967  N N   . PRO D 2 332 ? 179.598 -43.998  22.055  1.00 109.46 ? 332 PRO D N   1 
ATOM   6968  C CA  . PRO D 2 332 ? 178.428 -43.231  22.491  1.00 108.41 ? 332 PRO D CA  1 
ATOM   6969  C C   . PRO D 2 332 ? 177.224 -43.428  21.578  1.00 109.20 ? 332 PRO D C   1 
ATOM   6970  O O   . PRO D 2 332 ? 176.093 -43.115  21.964  1.00 105.97 ? 332 PRO D O   1 
ATOM   6971  C CB  . PRO D 2 332 ? 178.912 -41.785  22.402  1.00 107.80 ? 332 PRO D CB  1 
ATOM   6972  C CG  . PRO D 2 332 ? 180.383 -41.876  22.612  1.00 107.10 ? 332 PRO D CG  1 
ATOM   6973  C CD  . PRO D 2 332 ? 180.796 -43.146  21.930  1.00 107.61 ? 332 PRO D CD  1 
ATOM   6974  N N   . VAL D 2 333 ? 177.479 -43.948  20.379  1.00 114.30 ? 333 VAL D N   1 
ATOM   6975  C CA  . VAL D 2 333 ? 176.433 -44.159  19.386  1.00 122.46 ? 333 VAL D CA  1 
ATOM   6976  C C   . VAL D 2 333 ? 176.187 -45.642  19.066  1.00 127.94 ? 333 VAL D C   1 
ATOM   6977  O O   . VAL D 2 333 ? 175.488 -45.968  18.104  1.00 130.59 ? 333 VAL D O   1 
ATOM   6978  C CB  . VAL D 2 333 ? 176.686 -43.334  18.095  1.00 123.10 ? 333 VAL D CB  1 
ATOM   6979  C CG1 . VAL D 2 333 ? 177.151 -41.932  18.452  1.00 123.25 ? 333 VAL D CG1 1 
ATOM   6980  C CG2 . VAL D 2 333 ? 177.708 -44.006  17.188  1.00 124.94 ? 333 VAL D CG2 1 
ATOM   6981  N N   . ALA D 2 334 ? 176.741 -46.536  19.880  1.00 133.08 ? 334 ALA D N   1 
ATOM   6982  C CA  . ALA D 2 334 ? 176.529 -47.969  19.679  1.00 139.54 ? 334 ALA D CA  1 
ATOM   6983  C C   . ALA D 2 334 ? 175.116 -48.385  20.097  1.00 145.66 ? 334 ALA D C   1 
ATOM   6984  O O   . ALA D 2 334 ? 174.825 -48.505  21.289  1.00 147.51 ? 334 ALA D O   1 
ATOM   6985  C CB  . ALA D 2 334 ? 177.584 -48.781  20.418  1.00 137.78 ? 334 ALA D CB  1 
ATOM   6986  N N   . GLY D 2 335 ? 174.242 -48.580  19.106  1.00 153.09 ? 335 GLY D N   1 
ATOM   6987  C CA  . GLY D 2 335 ? 172.850 -48.990  19.342  1.00 163.27 ? 335 GLY D CA  1 
ATOM   6988  C C   . GLY D 2 335 ? 171.793 -48.190  18.587  1.00 170.10 ? 335 GLY D C   1 
ATOM   6989  O O   . GLY D 2 335 ? 172.039 -47.722  17.472  1.00 169.82 ? 335 GLY D O   1 
ATOM   6990  N N   . ARG D 2 336 ? 170.613 -48.049  19.199  1.00 176.63 ? 336 ARG D N   1 
ATOM   6991  C CA  . ARG D 2 336 ? 169.497 -47.266  18.637  1.00 180.24 ? 336 ARG D CA  1 
ATOM   6992  C C   . ARG D 2 336 ? 168.981 -46.178  19.598  1.00 180.17 ? 336 ARG D C   1 
ATOM   6993  O O   . ARG D 2 336 ? 167.849 -45.697  19.456  1.00 178.54 ? 336 ARG D O   1 
ATOM   6994  C CB  . ARG D 2 336 ? 168.338 -48.182  18.208  1.00 182.89 ? 336 ARG D CB  1 
ATOM   6995  C CG  . ARG D 2 336 ? 168.638 -49.131  17.052  1.00 187.63 ? 336 ARG D CG  1 
ATOM   6996  C CD  . ARG D 2 336 ? 168.676 -48.435  15.698  1.00 192.56 ? 336 ARG D CD  1 
ATOM   6997  N NE  . ARG D 2 336 ? 168.749 -49.394  14.592  1.00 198.06 ? 336 ARG D NE  1 
ATOM   6998  C CZ  . ARG D 2 336 ? 169.875 -49.912  14.101  1.00 200.45 ? 336 ARG D CZ  1 
ATOM   6999  N NH1 . ARG D 2 336 ? 171.056 -49.576  14.610  1.00 201.76 ? 336 ARG D NH1 1 
ATOM   7000  N NH2 . ARG D 2 336 ? 169.818 -50.775  13.095  1.00 202.33 ? 336 ARG D NH2 1 
ATOM   7001  N N   . MET D 2 337 ? 169.817 -45.804  20.571  1.00 181.13 ? 337 MET D N   1 
ATOM   7002  C CA  . MET D 2 337 ? 169.533 -44.705  21.510  1.00 178.65 ? 337 MET D CA  1 
ATOM   7003  C C   . MET D 2 337 ? 170.824 -44.144  22.150  1.00 174.53 ? 337 MET D C   1 
ATOM   7004  O O   . MET D 2 337 ? 171.913 -44.664  21.893  1.00 180.83 ? 337 MET D O   1 
ATOM   7005  C CB  . MET D 2 337 ? 168.510 -45.132  22.577  1.00 177.77 ? 337 MET D CB  1 
ATOM   7006  C CG  . MET D 2 337 ? 169.036 -46.011  23.703  1.00 176.31 ? 337 MET D CG  1 
ATOM   7007  S SD  . MET D 2 337 ? 168.509 -45.415  25.324  1.00 173.01 ? 337 MET D SD  1 
ATOM   7008  C CE  . MET D 2 337 ? 168.633 -46.910  26.295  1.00 169.76 ? 337 MET D CE  1 
ATOM   7009  N N   . PRO D 2 338 ? 170.716 -43.076  22.974  1.00 164.83 ? 338 PRO D N   1 
ATOM   7010  C CA  . PRO D 2 338 ? 171.923 -42.589  23.647  1.00 156.07 ? 338 PRO D CA  1 
ATOM   7011  C C   . PRO D 2 338 ? 172.258 -43.447  24.856  1.00 151.54 ? 338 PRO D C   1 
ATOM   7012  O O   . PRO D 2 338 ? 171.419 -43.619  25.736  1.00 149.54 ? 338 PRO D O   1 
ATOM   7013  C CB  . PRO D 2 338 ? 171.542 -41.182  24.106  1.00 153.72 ? 338 PRO D CB  1 
ATOM   7014  C CG  . PRO D 2 338 ? 170.094 -40.997  23.791  1.00 156.84 ? 338 PRO D CG  1 
ATOM   7015  C CD  . PRO D 2 338 ? 169.522 -42.307  23.365  1.00 161.98 ? 338 PRO D CD  1 
ATOM   7016  N N   . GLY D 2 339 ? 173.475 -43.980  24.890  1.00 148.79 ? 339 GLY D N   1 
ATOM   7017  C CA  . GLY D 2 339 ? 173.887 -44.896  25.950  1.00 148.56 ? 339 GLY D CA  1 
ATOM   7018  C C   . GLY D 2 339 ? 173.034 -46.152  26.024  1.00 149.97 ? 339 GLY D C   1 
ATOM   7019  O O   . GLY D 2 339 ? 172.609 -46.555  27.111  1.00 146.67 ? 339 GLY D O   1 
ATOM   7020  N N   . HIS D 2 340 ? 172.775 -46.752  24.860  1.00 154.67 ? 340 HIS D N   1 
ATOM   7021  C CA  . HIS D 2 340 ? 172.068 -48.036  24.750  1.00 157.65 ? 340 HIS D CA  1 
ATOM   7022  C C   . HIS D 2 340 ? 172.927 -49.119  25.400  1.00 152.23 ? 340 HIS D C   1 
ATOM   7023  O O   . HIS D 2 340 ? 172.414 -49.995  26.099  1.00 154.37 ? 340 HIS D O   1 
ATOM   7024  C CB  . HIS D 2 340 ? 171.800 -48.385  23.271  1.00 166.16 ? 340 HIS D CB  1 
ATOM   7025  C CG  . HIS D 2 340 ? 170.580 -49.236  23.036  1.00 169.81 ? 340 HIS D CG  1 
ATOM   7026  N ND1 . HIS D 2 340 ? 169.734 -49.040  21.963  1.00 170.02 ? 340 HIS D ND1 1 
ATOM   7027  C CD2 . HIS D 2 340 ? 170.072 -50.288  23.723  1.00 170.83 ? 340 HIS D CD2 1 
ATOM   7028  C CE1 . HIS D 2 340 ? 168.759 -49.931  22.000  1.00 168.06 ? 340 HIS D CE1 1 
ATOM   7029  N NE2 . HIS D 2 340 ? 168.939 -50.699  23.059  1.00 169.01 ? 340 HIS D NE2 1 
ATOM   7030  N N   . MET D 2 341 ? 174.239 -49.039  25.171  1.00 143.24 ? 341 MET D N   1 
ATOM   7031  C CA  . MET D 2 341 ? 175.201 -49.960  25.773  1.00 135.15 ? 341 MET D CA  1 
ATOM   7032  C C   . MET D 2 341 ? 175.270 -49.749  27.276  1.00 132.41 ? 341 MET D C   1 
ATOM   7033  O O   . MET D 2 341 ? 175.374 -50.708  28.033  1.00 129.90 ? 341 MET D O   1 
ATOM   7034  C CB  . MET D 2 341 ? 176.591 -49.781  25.157  1.00 132.77 ? 341 MET D CB  1 
ATOM   7035  C CG  . MET D 2 341 ? 176.661 -49.999  23.653  1.00 132.28 ? 341 MET D CG  1 
ATOM   7036  S SD  . MET D 2 341 ? 176.194 -51.656  23.116  1.00 132.06 ? 341 MET D SD  1 
ATOM   7037  C CE  . MET D 2 341 ? 174.470 -51.453  22.677  1.00 133.49 ? 341 MET D CE  1 
ATOM   7038  N N   . ASN D 2 342 ? 175.187 -48.489  27.695  1.00 131.84 ? 342 ASN D N   1 
ATOM   7039  C CA  . ASN D 2 342 ? 175.291 -48.111  29.102  1.00 133.25 ? 342 ASN D CA  1 
ATOM   7040  C C   . ASN D 2 342 ? 174.257 -48.776  29.996  1.00 135.08 ? 342 ASN D C   1 
ATOM   7041  O O   . ASN D 2 342 ? 174.607 -49.390  31.003  1.00 134.86 ? 342 ASN D O   1 
ATOM   7042  C CB  . ASN D 2 342 ? 175.186 -46.592  29.254  1.00 132.60 ? 342 ASN D CB  1 
ATOM   7043  C CG  . ASN D 2 342 ? 176.255 -45.852  28.478  1.00 133.29 ? 342 ASN D CG  1 
ATOM   7044  O OD1 . ASN D 2 342 ? 176.586 -46.213  27.346  1.00 134.42 ? 342 ASN D OD1 1 
ATOM   7045  N ND2 . ASN D 2 342 ? 176.792 -44.800  29.081  1.00 133.26 ? 342 ASN D ND2 1 
ATOM   7046  N N   . VAL D 2 343 ? 172.988 -48.655  29.618  1.00 138.25 ? 343 VAL D N   1 
ATOM   7047  C CA  . VAL D 2 343 ? 171.888 -49.148  30.446  1.00 142.55 ? 343 VAL D CA  1 
ATOM   7048  C C   . VAL D 2 343 ? 171.706 -50.669  30.380  1.00 146.76 ? 343 VAL D C   1 
ATOM   7049  O O   . VAL D 2 343 ? 171.155 -51.265  31.309  1.00 149.70 ? 343 VAL D O   1 
ATOM   7050  C CB  . VAL D 2 343 ? 170.566 -48.399  30.155  1.00 141.40 ? 343 VAL D CB  1 
ATOM   7051  C CG1 . VAL D 2 343 ? 170.766 -46.903  30.343  1.00 139.67 ? 343 VAL D CG1 1 
ATOM   7052  C CG2 . VAL D 2 343 ? 170.066 -48.694  28.750  1.00 141.51 ? 343 VAL D CG2 1 
ATOM   7053  N N   . LEU D 2 344 ? 172.171 -51.289  29.293  1.00 148.92 ? 344 LEU D N   1 
ATOM   7054  C CA  . LEU D 2 344 ? 172.185 -52.755  29.182  1.00 147.83 ? 344 LEU D CA  1 
ATOM   7055  C C   . LEU D 2 344 ? 173.377 -53.351  29.922  1.00 142.75 ? 344 LEU D C   1 
ATOM   7056  O O   . LEU D 2 344 ? 173.239 -54.361  30.618  1.00 142.66 ? 344 LEU D O   1 
ATOM   7057  C CB  . LEU D 2 344 ? 172.174 -53.225  27.720  1.00 151.73 ? 344 LEU D CB  1 
ATOM   7058  C CG  . LEU D 2 344 ? 170.836 -53.602  27.065  1.00 154.17 ? 344 LEU D CG  1 
ATOM   7059  C CD1 . LEU D 2 344 ? 171.053 -54.057  25.628  1.00 154.69 ? 344 LEU D CD1 1 
ATOM   7060  C CD2 . LEU D 2 344 ? 170.091 -54.677  27.849  1.00 153.94 ? 344 LEU D CD2 1 
ATOM   7061  N N   . LEU D 2 345 ? 174.544 -52.723  29.768  1.00 135.87 ? 345 LEU D N   1 
ATOM   7062  C CA  . LEU D 2 345 ? 175.728 -53.085  30.549  1.00 129.24 ? 345 LEU D CA  1 
ATOM   7063  C C   . LEU D 2 345 ? 175.548 -52.629  32.004  1.00 124.60 ? 345 LEU D C   1 
ATOM   7064  O O   . LEU D 2 345 ? 176.396 -52.886  32.863  1.00 122.30 ? 345 LEU D O   1 
ATOM   7065  C CB  . LEU D 2 345 ? 177.009 -52.510  29.920  1.00 128.18 ? 345 LEU D CB  1 
ATOM   7066  C CG  . LEU D 2 345 ? 177.412 -53.000  28.515  1.00 126.69 ? 345 LEU D CG  1 
ATOM   7067  C CD1 . LEU D 2 345 ? 178.274 -51.980  27.789  1.00 123.86 ? 345 LEU D CD1 1 
ATOM   7068  C CD2 . LEU D 2 345 ? 178.115 -54.350  28.544  1.00 127.56 ? 345 LEU D CD2 1 
ATOM   7069  N N   . ALA D 2 346 ? 174.429 -51.954  32.263  1.00 120.42 ? 346 ALA D N   1 
ATOM   7070  C CA  . ALA D 2 346 ? 173.984 -51.663  33.619  1.00 117.31 ? 346 ALA D CA  1 
ATOM   7071  C C   . ALA D 2 346 ? 173.016 -52.740  34.115  1.00 116.45 ? 346 ALA D C   1 
ATOM   7072  O O   . ALA D 2 346 ? 173.191 -53.260  35.217  1.00 117.22 ? 346 ALA D O   1 
ATOM   7073  C CB  . ALA D 2 346 ? 173.346 -50.285  33.695  1.00 116.95 ? 346 ALA D CB  1 
ATOM   7074  N N   . GLU D 2 347 ? 172.013 -53.079  33.296  1.00 115.05 ? 347 GLU D N   1 
ATOM   7075  C CA  . GLU D 2 347 ? 170.979 -54.070  33.659  1.00 113.17 ? 347 GLU D CA  1 
ATOM   7076  C C   . GLU D 2 347 ? 171.557 -55.460  33.939  1.00 113.53 ? 347 GLU D C   1 
ATOM   7077  O O   . GLU D 2 347 ? 171.029 -56.203  34.772  1.00 113.64 ? 347 GLU D O   1 
ATOM   7078  C CB  . GLU D 2 347 ? 169.890 -54.167  32.576  1.00 110.34 ? 347 GLU D CB  1 
ATOM   7079  C CG  . GLU D 2 347 ? 168.621 -54.886  33.027  1.00 106.86 ? 347 GLU D CG  1 
ATOM   7080  C CD  . GLU D 2 347 ? 167.861 -55.535  31.883  1.00 105.03 ? 347 GLU D CD  1 
ATOM   7081  O OE1 . GLU D 2 347 ? 167.193 -54.815  31.113  1.00 103.59 ? 347 GLU D OE1 1 
ATOM   7082  O OE2 . GLU D 2 347 ? 167.916 -56.776  31.762  1.00 104.63 ? 347 GLU D OE2 1 
ATOM   7083  N N   . ALA D 2 348 ? 172.632 -55.803  33.233  1.00 113.58 ? 348 ALA D N   1 
ATOM   7084  C CA  . ALA D 2 348 ? 173.345 -57.056  33.461  1.00 113.66 ? 348 ALA D CA  1 
ATOM   7085  C C   . ALA D 2 348 ? 174.179 -56.981  34.739  1.00 113.68 ? 348 ALA D C   1 
ATOM   7086  O O   . ALA D 2 348 ? 174.119 -57.883  35.576  1.00 114.36 ? 348 ALA D O   1 
ATOM   7087  C CB  . ALA D 2 348 ? 174.220 -57.399  32.264  1.00 113.87 ? 348 ALA D CB  1 
ATOM   7088  N N   . GLY D 2 349 ? 174.949 -55.903  34.881  1.00 112.93 ? 349 GLY D N   1 
ATOM   7089  C CA  . GLY D 2 349 ? 175.728 -55.657  36.093  1.00 112.21 ? 349 GLY D CA  1 
ATOM   7090  C C   . GLY D 2 349 ? 177.221 -55.498  35.883  1.00 111.91 ? 349 GLY D C   1 
ATOM   7091  O O   . GLY D 2 349 ? 178.013 -55.810  36.774  1.00 110.59 ? 349 GLY D O   1 
ATOM   7092  N N   . VAL D 2 350 ? 177.610 -55.012  34.707  1.00 113.67 ? 350 VAL D N   1 
ATOM   7093  C CA  . VAL D 2 350 ? 179.017 -54.750  34.423  1.00 117.05 ? 350 VAL D CA  1 
ATOM   7094  C C   . VAL D 2 350 ? 179.437 -53.516  35.200  1.00 118.42 ? 350 VAL D C   1 
ATOM   7095  O O   . VAL D 2 350 ? 178.693 -52.535  35.262  1.00 115.79 ? 350 VAL D O   1 
ATOM   7096  C CB  . VAL D 2 350 ? 179.288 -54.499  32.926  1.00 119.00 ? 350 VAL D CB  1 
ATOM   7097  C CG1 . VAL D 2 350 ? 180.777 -54.616  32.630  1.00 119.61 ? 350 VAL D CG1 1 
ATOM   7098  C CG2 . VAL D 2 350 ? 178.499 -55.466  32.060  1.00 121.66 ? 350 VAL D CG2 1 
ATOM   7099  N N   . ASP D 2 351 ? 180.622 -53.576  35.799  1.00 123.99 ? 351 ASP D N   1 
ATOM   7100  C CA  . ASP D 2 351 ? 181.177 -52.423  36.489  1.00 132.03 ? 351 ASP D CA  1 
ATOM   7101  C C   . ASP D 2 351 ? 181.510 -51.345  35.465  1.00 140.83 ? 351 ASP D C   1 
ATOM   7102  O O   . ASP D 2 351 ? 182.075 -51.632  34.405  1.00 139.35 ? 351 ASP D O   1 
ATOM   7103  C CB  . ASP D 2 351 ? 182.416 -52.807  37.301  1.00 129.31 ? 351 ASP D CB  1 
ATOM   7104  C CG  . ASP D 2 351 ? 182.642 -51.892  38.500  1.00 127.27 ? 351 ASP D CG  1 
ATOM   7105  O OD1 . ASP D 2 351 ? 182.367 -50.674  38.399  1.00 125.84 ? 351 ASP D OD1 1 
ATOM   7106  O OD2 . ASP D 2 351 ? 183.101 -52.394  39.549  1.00 125.82 ? 351 ASP D OD2 1 
ATOM   7107  N N   . TYR D 2 352 ? 181.140 -50.109  35.790  1.00 156.59 ? 352 TYR D N   1 
ATOM   7108  C CA  . TYR D 2 352 ? 181.319 -48.966  34.894  1.00 169.17 ? 352 TYR D CA  1 
ATOM   7109  C C   . TYR D 2 352 ? 182.790 -48.663  34.612  1.00 155.95 ? 352 TYR D C   1 
ATOM   7110  O O   . TYR D 2 352 ? 183.119 -47.969  33.650  1.00 150.92 ? 352 TYR D O   1 
ATOM   7111  C CB  . TYR D 2 352 ? 180.624 -47.723  35.466  1.00 199.79 ? 352 TYR D CB  1 
ATOM   7112  C CG  . TYR D 2 352 ? 179.103 -47.727  35.375  1.00 229.95 ? 352 TYR D CG  1 
ATOM   7113  C CD1 . TYR D 2 352 ? 178.449 -48.124  34.203  1.00 240.92 ? 352 TYR D CD1 1 
ATOM   7114  C CD2 . TYR D 2 352 ? 178.318 -47.301  36.450  1.00 244.92 ? 352 TYR D CD2 1 
ATOM   7115  C CE1 . TYR D 2 352 ? 177.061 -48.113  34.113  1.00 246.21 ? 352 TYR D CE1 1 
ATOM   7116  C CE2 . TYR D 2 352 ? 176.929 -47.286  36.367  1.00 248.13 ? 352 TYR D CE2 1 
ATOM   7117  C CZ  . TYR D 2 352 ? 176.305 -47.693  35.198  1.00 247.24 ? 352 TYR D CZ  1 
ATOM   7118  O OH  . TYR D 2 352 ? 174.929 -47.682  35.107  1.00 247.57 ? 352 TYR D OH  1 
ATOM   7119  N N   . ASP D 2 353 ? 183.665 -49.193  35.459  1.00 145.46 ? 353 ASP D N   1 
ATOM   7120  C CA  . ASP D 2 353 ? 185.102 -49.019  35.308  1.00 137.61 ? 353 ASP D CA  1 
ATOM   7121  C C   . ASP D 2 353 ? 185.662 -50.010  34.289  1.00 129.27 ? 353 ASP D C   1 
ATOM   7122  O O   . ASP D 2 353 ? 186.815 -49.900  33.864  1.00 128.78 ? 353 ASP D O   1 
ATOM   7123  C CB  . ASP D 2 353 ? 185.784 -49.160  36.668  1.00 141.60 ? 353 ASP D CB  1 
ATOM   7124  C CG  . ASP D 2 353 ? 185.113 -48.316  37.742  1.00 143.49 ? 353 ASP D CG  1 
ATOM   7125  O OD1 . ASP D 2 353 ? 185.008 -47.083  37.558  1.00 144.03 ? 353 ASP D OD1 1 
ATOM   7126  O OD2 . ASP D 2 353 ? 184.683 -48.887  38.767  1.00 144.45 ? 353 ASP D OD2 1 
ATOM   7127  N N   . LYS D 2 354 ? 184.836 -50.983  33.913  1.00 119.69 ? 354 LYS D N   1 
ATOM   7128  C CA  . LYS D 2 354 ? 185.100 -51.809  32.745  1.00 112.30 ? 354 LYS D CA  1 
ATOM   7129  C C   . LYS D 2 354 ? 184.541 -51.111  31.513  1.00 108.38 ? 354 LYS D C   1 
ATOM   7130  O O   . LYS D 2 354 ? 184.985 -51.367  30.397  1.00 107.98 ? 354 LYS D O   1 
ATOM   7131  C CB  . LYS D 2 354 ? 184.485 -53.204  32.900  1.00 111.06 ? 354 LYS D CB  1 
ATOM   7132  C CG  . LYS D 2 354 ? 185.428 -54.253  33.472  1.00 110.22 ? 354 LYS D CG  1 
ATOM   7133  C CD  . LYS D 2 354 ? 185.584 -54.134  34.982  1.00 109.54 ? 354 LYS D CD  1 
ATOM   7134  C CE  . LYS D 2 354 ? 186.684 -55.052  35.491  1.00 108.73 ? 354 LYS D CE  1 
ATOM   7135  N NZ  . LYS D 2 354 ? 186.877 -54.957  36.966  1.00 107.56 ? 354 LYS D NZ  1 
ATOM   7136  N N   . LEU D 2 355 ? 183.574 -50.221  31.727  1.00 104.33 ? 355 LEU D N   1 
ATOM   7137  C CA  . LEU D 2 355 ? 182.974 -49.451  30.640  1.00 102.44 ? 355 LEU D CA  1 
ATOM   7138  C C   . LEU D 2 355 ? 183.741 -48.173  30.338  1.00 102.52 ? 355 LEU D C   1 
ATOM   7139  O O   . LEU D 2 355 ? 183.726 -47.214  31.114  1.00 100.95 ? 355 LEU D O   1 
ATOM   7140  C CB  . LEU D 2 355 ? 181.505 -49.143  30.931  1.00 101.24 ? 355 LEU D CB  1 
ATOM   7141  C CG  . LEU D 2 355 ? 180.476 -50.063  30.273  1.00 100.66 ? 355 LEU D CG  1 
ATOM   7142  C CD1 . LEU D 2 355 ? 180.527 -51.476  30.836  1.00 99.97  ? 355 LEU D CD1 1 
ATOM   7143  C CD2 . LEU D 2 355 ? 179.084 -49.471  30.419  1.00 101.21 ? 355 LEU D CD2 1 
ATOM   7144  N N   . LYS D 2 356 ? 184.410 -48.176  29.192  1.00 104.60 ? 356 LYS D N   1 
ATOM   7145  C CA  . LYS D 2 356 ? 185.207 -47.045  28.743  1.00 106.27 ? 356 LYS D CA  1 
ATOM   7146  C C   . LYS D 2 356 ? 184.629 -46.527  27.437  1.00 106.33 ? 356 LYS D C   1 
ATOM   7147  O O   . LYS D 2 356 ? 184.346 -47.309  26.529  1.00 107.22 ? 356 LYS D O   1 
ATOM   7148  C CB  . LYS D 2 356 ? 186.664 -47.472  28.510  1.00 107.38 ? 356 LYS D CB  1 
ATOM   7149  C CG  . LYS D 2 356 ? 187.238 -48.477  29.504  1.00 107.90 ? 356 LYS D CG  1 
ATOM   7150  C CD  . LYS D 2 356 ? 188.009 -47.817  30.639  1.00 107.98 ? 356 LYS D CD  1 
ATOM   7151  C CE  . LYS D 2 356 ? 187.104 -47.453  31.805  1.00 108.17 ? 356 LYS D CE  1 
ATOM   7152  N NZ  . LYS D 2 356 ? 187.897 -47.120  33.022  1.00 108.38 ? 356 LYS D NZ  1 
ATOM   7153  N N   . ASP D 2 357 ? 184.450 -45.213  27.340  1.00 105.61 ? 357 ASP D N   1 
ATOM   7154  C CA  . ASP D 2 357 ? 184.112 -44.599  26.060  1.00 106.25 ? 357 ASP D CA  1 
ATOM   7155  C C   . ASP D 2 357 ? 185.343 -44.589  25.153  1.00 111.10 ? 357 ASP D C   1 
ATOM   7156  O O   . ASP D 2 357 ? 186.438 -44.956  25.581  1.00 112.25 ? 357 ASP D O   1 
ATOM   7157  C CB  . ASP D 2 357 ? 183.547 -43.192  26.251  1.00 101.99 ? 357 ASP D CB  1 
ATOM   7158  C CG  . ASP D 2 357 ? 184.378 -42.355  27.195  1.00 100.18 ? 357 ASP D CG  1 
ATOM   7159  O OD1 . ASP D 2 357 ? 185.453 -41.876  26.782  1.00 99.28  ? 357 ASP D OD1 1 
ATOM   7160  O OD2 . ASP D 2 357 ? 183.946 -42.171  28.352  1.00 99.12  ? 357 ASP D OD2 1 
ATOM   7161  N N   . LEU D 2 358 ? 185.154 -44.166  23.907  1.00 117.60 ? 358 LEU D N   1 
ATOM   7162  C CA  . LEU D 2 358 ? 186.188 -44.258  22.870  1.00 124.20 ? 358 LEU D CA  1 
ATOM   7163  C C   . LEU D 2 358 ? 187.557 -43.670  23.245  1.00 127.60 ? 358 LEU D C   1 
ATOM   7164  O O   . LEU D 2 358 ? 188.585 -44.336  23.106  1.00 127.49 ? 358 LEU D O   1 
ATOM   7165  C CB  . LEU D 2 358 ? 185.680 -43.633  21.560  1.00 125.77 ? 358 LEU D CB  1 
ATOM   7166  C CG  . LEU D 2 358 ? 185.467 -42.113  21.472  1.00 125.86 ? 358 LEU D CG  1 
ATOM   7167  C CD1 . LEU D 2 358 ? 185.647 -41.631  20.041  1.00 127.33 ? 358 LEU D CD1 1 
ATOM   7168  C CD2 . LEU D 2 358 ? 184.125 -41.661  22.037  1.00 124.48 ? 358 LEU D CD2 1 
ATOM   7169  N N   . GLU D 2 359 ? 187.549 -42.438  23.745  1.00 132.34 ? 359 GLU D N   1 
ATOM   7170  C CA  . GLU D 2 359 ? 188.753 -41.613  23.873  1.00 135.78 ? 359 GLU D CA  1 
ATOM   7171  C C   . GLU D 2 359 ? 189.744 -42.079  24.944  1.00 134.23 ? 359 GLU D C   1 
ATOM   7172  O O   . GLU D 2 359 ? 190.930 -41.750  24.881  1.00 132.04 ? 359 GLU D O   1 
ATOM   7173  C CB  . GLU D 2 359 ? 188.349 -40.154  24.111  1.00 143.30 ? 359 GLU D CB  1 
ATOM   7174  C CG  . GLU D 2 359 ? 187.600 -39.528  22.936  1.00 151.69 ? 359 GLU D CG  1 
ATOM   7175  C CD  . GLU D 2 359 ? 186.457 -38.593  23.376  1.00 158.48 ? 359 GLU D CD  1 
ATOM   7176  O OE1 . GLU D 2 359 ? 186.146 -37.625  22.634  1.00 162.72 ? 359 GLU D OE1 1 
ATOM   7177  O OE2 . GLU D 2 359 ? 185.852 -38.833  24.448  1.00 161.43 ? 359 GLU D OE2 1 
ATOM   7178  N N   . GLU D 2 360 ? 189.252 -42.845  25.913  1.00 134.59 ? 360 GLU D N   1 
ATOM   7179  C CA  . GLU D 2 360 ? 190.079 -43.362  27.006  1.00 135.58 ? 360 GLU D CA  1 
ATOM   7180  C C   . GLU D 2 360 ? 190.570 -44.791  26.750  1.00 136.32 ? 360 GLU D C   1 
ATOM   7181  O O   . GLU D 2 360 ? 191.401 -45.311  27.502  1.00 135.70 ? 360 GLU D O   1 
ATOM   7182  C CB  . GLU D 2 360 ? 189.306 -43.303  28.328  1.00 136.27 ? 360 GLU D CB  1 
ATOM   7183  C CG  . GLU D 2 360 ? 187.954 -44.002  28.282  1.00 138.13 ? 360 GLU D CG  1 
ATOM   7184  C CD  . GLU D 2 360 ? 187.271 -44.080  29.632  1.00 139.67 ? 360 GLU D CD  1 
ATOM   7185  O OE1 . GLU D 2 360 ? 187.952 -44.389  30.634  1.00 140.47 ? 360 GLU D OE1 1 
ATOM   7186  O OE2 . GLU D 2 360 ? 186.045 -43.844  29.688  1.00 139.96 ? 360 GLU D OE2 1 
ATOM   7187  N N   . ILE D 2 361 ? 190.053 -45.416  25.693  1.00 137.63 ? 361 ILE D N   1 
ATOM   7188  C CA  . ILE D 2 361 ? 190.381 -46.809  25.376  1.00 138.22 ? 361 ILE D CA  1 
ATOM   7189  C C   . ILE D 2 361 ? 190.988 -47.000  23.974  1.00 137.71 ? 361 ILE D C   1 
ATOM   7190  O O   . ILE D 2 361 ? 191.493 -48.080  23.660  1.00 139.45 ? 361 ILE D O   1 
ATOM   7191  C CB  . ILE D 2 361 ? 189.160 -47.747  25.589  1.00 138.71 ? 361 ILE D CB  1 
ATOM   7192  C CG1 . ILE D 2 361 ? 189.624 -49.189  25.855  1.00 139.09 ? 361 ILE D CG1 1 
ATOM   7193  C CG2 . ILE D 2 361 ? 188.179 -47.648  24.421  1.00 138.35 ? 361 ILE D CG2 1 
ATOM   7194  C CD1 . ILE D 2 361 ? 188.548 -50.115  26.383  1.00 139.46 ? 361 ILE D CD1 1 
ATOM   7195  N N   . ASN D 2 362 ? 190.942 -45.958  23.143  1.00 134.87 ? 362 ASN D N   1 
ATOM   7196  C CA  . ASN D 2 362 ? 191.506 -46.021  21.786  1.00 132.42 ? 362 ASN D CA  1 
ATOM   7197  C C   . ASN D 2 362 ? 193.018 -46.312  21.700  1.00 134.63 ? 362 ASN D C   1 
ATOM   7198  O O   . ASN D 2 362 ? 193.427 -47.179  20.923  1.00 135.15 ? 362 ASN D O   1 
ATOM   7199  C CB  . ASN D 2 362 ? 191.135 -44.778  20.965  1.00 127.50 ? 362 ASN D CB  1 
ATOM   7200  C CG  . ASN D 2 362 ? 189.714 -44.828  20.438  1.00 124.39 ? 362 ASN D CG  1 
ATOM   7201  O OD1 . ASN D 2 362 ? 189.178 -45.898  20.141  1.00 121.93 ? 362 ASN D OD1 1 
ATOM   7202  N ND2 . ASN D 2 362 ? 189.093 -43.661  20.320  1.00 123.05 ? 362 ASN D ND2 1 
ATOM   7203  N N   . PRO D 2 363 ? 193.852 -45.597  22.493  1.00 136.18 ? 363 PRO D N   1 
ATOM   7204  C CA  . PRO D 2 363 ? 195.301 -45.858  22.455  1.00 134.24 ? 363 PRO D CA  1 
ATOM   7205  C C   . PRO D 2 363 ? 195.721 -47.127  23.209  1.00 130.09 ? 363 PRO D C   1 
ATOM   7206  O O   . PRO D 2 363 ? 196.909 -47.321  23.486  1.00 128.71 ? 363 PRO D O   1 
ATOM   7207  C CB  . PRO D 2 363 ? 195.893 -44.618  23.132  1.00 136.62 ? 363 PRO D CB  1 
ATOM   7208  C CG  . PRO D 2 363 ? 194.829 -44.171  24.074  1.00 138.45 ? 363 PRO D CG  1 
ATOM   7209  C CD  . PRO D 2 363 ? 193.527 -44.465  23.386  1.00 138.10 ? 363 PRO D CD  1 
ATOM   7210  N N   . GLU D 2 364 ? 194.747 -47.978  23.521  1.00 125.87 ? 364 GLU D N   1 
ATOM   7211  C CA  . GLU D 2 364 ? 194.968 -49.201  24.285  1.00 121.39 ? 364 GLU D CA  1 
ATOM   7212  C C   . GLU D 2 364 ? 194.875 -50.433  23.378  1.00 119.58 ? 364 GLU D C   1 
ATOM   7213  O O   . GLU D 2 364 ? 195.238 -51.540  23.781  1.00 118.74 ? 364 GLU D O   1 
ATOM   7214  C CB  . GLU D 2 364 ? 193.922 -49.289  25.403  1.00 119.60 ? 364 GLU D CB  1 
ATOM   7215  C CG  . GLU D 2 364 ? 194.408 -49.888  26.712  1.00 117.21 ? 364 GLU D CG  1 
ATOM   7216  C CD  . GLU D 2 364 ? 193.431 -49.661  27.856  1.00 115.88 ? 364 GLU D CD  1 
ATOM   7217  O OE1 . GLU D 2 364 ? 192.961 -48.516  28.034  1.00 114.77 ? 364 GLU D OE1 1 
ATOM   7218  O OE2 . GLU D 2 364 ? 193.139 -50.628  28.587  1.00 115.39 ? 364 GLU D OE2 1 
ATOM   7219  N N   . PHE D 2 365 ? 194.410 -50.219  22.147  1.00 118.08 ? 365 PHE D N   1 
ATOM   7220  C CA  . PHE D 2 365 ? 194.053 -51.302  21.221  1.00 116.03 ? 365 PHE D CA  1 
ATOM   7221  C C   . PHE D 2 365 ? 195.196 -52.104  20.578  1.00 109.01 ? 365 PHE D C   1 
ATOM   7222  O O   . PHE D 2 365 ? 195.105 -53.332  20.515  1.00 105.57 ? 365 PHE D O   1 
ATOM   7223  C CB  . PHE D 2 365 ? 193.096 -50.797  20.136  1.00 123.66 ? 365 PHE D CB  1 
ATOM   7224  C CG  . PHE D 2 365 ? 191.651 -50.799  20.551  1.00 131.06 ? 365 PHE D CG  1 
ATOM   7225  C CD1 . PHE D 2 365 ? 190.910 -51.977  20.524  1.00 134.13 ? 365 PHE D CD1 1 
ATOM   7226  C CD2 . PHE D 2 365 ? 191.024 -49.623  20.952  1.00 134.08 ? 365 PHE D CD2 1 
ATOM   7227  C CE1 . PHE D 2 365 ? 189.574 -51.983  20.900  1.00 137.52 ? 365 PHE D CE1 1 
ATOM   7228  C CE2 . PHE D 2 365 ? 189.687 -49.622  21.328  1.00 136.05 ? 365 PHE D CE2 1 
ATOM   7229  C CZ  . PHE D 2 365 ? 188.963 -50.804  21.303  1.00 137.53 ? 365 PHE D CZ  1 
ATOM   7230  N N   . PRO D 2 366 ? 196.258 -51.428  20.083  1.00 105.08 ? 366 PRO D N   1 
ATOM   7231  C CA  . PRO D 2 366 ? 197.350 -52.193  19.465  1.00 104.13 ? 366 PRO D CA  1 
ATOM   7232  C C   . PRO D 2 366 ? 197.955 -53.231  20.410  1.00 105.13 ? 366 PRO D C   1 
ATOM   7233  O O   . PRO D 2 366 ? 198.686 -54.120  19.968  1.00 103.41 ? 366 PRO D O   1 
ATOM   7234  C CB  . PRO D 2 366 ? 198.385 -51.118  19.127  1.00 103.13 ? 366 PRO D CB  1 
ATOM   7235  C CG  . PRO D 2 366 ? 197.590 -49.869  18.971  1.00 102.64 ? 366 PRO D CG  1 
ATOM   7236  C CD  . PRO D 2 366 ? 196.510 -49.975  20.007  1.00 103.69 ? 366 PRO D CD  1 
ATOM   7237  N N   . THR D 2 367 ? 197.631 -53.110  21.696  1.00 108.87 ? 367 THR D N   1 
ATOM   7238  C CA  . THR D 2 367 ? 198.103 -54.027  22.731  1.00 113.28 ? 367 THR D CA  1 
ATOM   7239  C C   . THR D 2 367 ? 196.987 -54.930  23.257  1.00 113.44 ? 367 THR D C   1 
ATOM   7240  O O   . THR D 2 367 ? 197.234 -55.823  24.073  1.00 114.29 ? 367 THR D O   1 
ATOM   7241  C CB  . THR D 2 367 ? 198.726 -53.268  23.918  1.00 116.18 ? 367 THR D CB  1 
ATOM   7242  O OG1 . THR D 2 367 ? 197.807 -52.270  24.384  1.00 118.47 ? 367 THR D OG1 1 
ATOM   7243  C CG2 . THR D 2 367 ? 200.037 -52.608  23.506  1.00 117.84 ? 367 THR D CG2 1 
ATOM   7244  N N   . VAL D 2 368 ? 195.762 -54.686  22.798  1.00 113.08 ? 368 VAL D N   1 
ATOM   7245  C CA  . VAL D 2 368 ? 194.639 -55.562  23.118  1.00 113.84 ? 368 VAL D CA  1 
ATOM   7246  C C   . VAL D 2 368 ? 194.798 -56.853  22.314  1.00 117.03 ? 368 VAL D C   1 
ATOM   7247  O O   . VAL D 2 368 ? 194.725 -56.841  21.080  1.00 117.57 ? 368 VAL D O   1 
ATOM   7248  C CB  . VAL D 2 368 ? 193.278 -54.872  22.862  1.00 111.65 ? 368 VAL D CB  1 
ATOM   7249  C CG1 . VAL D 2 368 ? 192.131 -55.871  22.903  1.00 110.69 ? 368 VAL D CG1 1 
ATOM   7250  C CG2 . VAL D 2 368 ? 193.047 -53.777  23.889  1.00 110.45 ? 368 VAL D CG2 1 
ATOM   7251  N N   . ASP D 2 369 ? 195.051 -57.948  23.034  1.00 120.41 ? 369 ASP D N   1 
ATOM   7252  C CA  . ASP D 2 369 ? 195.288 -59.273  22.448  1.00 122.08 ? 369 ASP D CA  1 
ATOM   7253  C C   . ASP D 2 369 ? 194.152 -59.717  21.526  1.00 121.61 ? 369 ASP D C   1 
ATOM   7254  O O   . ASP D 2 369 ? 194.403 -60.170  20.407  1.00 122.55 ? 369 ASP D O   1 
ATOM   7255  C CB  . ASP D 2 369 ? 195.512 -60.320  23.551  1.00 123.16 ? 369 ASP D CB  1 
ATOM   7256  C CG  . ASP D 2 369 ? 196.933 -60.311  24.097  1.00 123.68 ? 369 ASP D CG  1 
ATOM   7257  O OD1 . ASP D 2 369 ? 197.826 -60.899  23.448  1.00 123.70 ? 369 ASP D OD1 1 
ATOM   7258  O OD2 . ASP D 2 369 ? 197.155 -59.737  25.185  1.00 123.68 ? 369 ASP D OD2 1 
ATOM   7259  N N   . VAL D 2 370 ? 192.914 -59.588  22.007  1.00 119.51 ? 370 VAL D N   1 
ATOM   7260  C CA  . VAL D 2 370 ? 191.718 -59.905  21.218  1.00 115.92 ? 370 VAL D CA  1 
ATOM   7261  C C   . VAL D 2 370 ? 190.624 -58.851  21.434  1.00 110.36 ? 370 VAL D C   1 
ATOM   7262  O O   . VAL D 2 370 ? 190.209 -58.596  22.566  1.00 110.22 ? 370 VAL D O   1 
ATOM   7263  C CB  . VAL D 2 370 ? 191.155 -61.315  21.536  1.00 117.92 ? 370 VAL D CB  1 
ATOM   7264  C CG1 . VAL D 2 370 ? 189.906 -61.594  20.713  1.00 119.23 ? 370 VAL D CG1 1 
ATOM   7265  C CG2 . VAL D 2 370 ? 192.192 -62.398  21.272  1.00 117.99 ? 370 VAL D CG2 1 
ATOM   7266  N N   . ALA D 2 371 ? 190.167 -58.246  20.340  1.00 103.02 ? 371 ALA D N   1 
ATOM   7267  C CA  . ALA D 2 371 ? 189.071 -57.286  20.387  1.00 95.81  ? 371 ALA D CA  1 
ATOM   7268  C C   . ALA D 2 371 ? 187.781 -57.923  19.875  1.00 91.54  ? 371 ALA D C   1 
ATOM   7269  O O   . ALA D 2 371 ? 187.481 -57.878  18.679  1.00 89.64  ? 371 ALA D O   1 
ATOM   7270  C CB  . ALA D 2 371 ? 189.420 -56.038  19.590  1.00 95.47  ? 371 ALA D CB  1 
ATOM   7271  N N   . VAL D 2 372 ? 187.030 -58.527  20.791  1.00 88.22  ? 372 VAL D N   1 
ATOM   7272  C CA  . VAL D 2 372 ? 185.776 -59.186  20.447  1.00 86.79  ? 372 VAL D CA  1 
ATOM   7273  C C   . VAL D 2 372 ? 184.707 -58.135  20.185  1.00 86.68  ? 372 VAL D C   1 
ATOM   7274  O O   . VAL D 2 372 ? 184.437 -57.288  21.033  1.00 85.35  ? 372 VAL D O   1 
ATOM   7275  C CB  . VAL D 2 372 ? 185.300 -60.151  21.556  1.00 86.42  ? 372 VAL D CB  1 
ATOM   7276  C CG1 . VAL D 2 372 ? 184.044 -60.893  21.125  1.00 86.26  ? 372 VAL D CG1 1 
ATOM   7277  C CG2 . VAL D 2 372 ? 186.394 -61.142  21.917  1.00 86.71  ? 372 VAL D CG2 1 
ATOM   7278  N N   . VAL D 2 373 ? 184.119 -58.191  18.996  1.00 88.55  ? 373 VAL D N   1 
ATOM   7279  C CA  . VAL D 2 373 ? 183.044 -57.285  18.617  1.00 91.68  ? 373 VAL D CA  1 
ATOM   7280  C C   . VAL D 2 373 ? 181.739 -58.069  18.516  1.00 94.37  ? 373 VAL D C   1 
ATOM   7281  O O   . VAL D 2 373 ? 181.681 -59.109  17.861  1.00 95.07  ? 373 VAL D O   1 
ATOM   7282  C CB  . VAL D 2 373 ? 183.351 -56.566  17.286  1.00 91.61  ? 373 VAL D CB  1 
ATOM   7283  C CG1 . VAL D 2 373 ? 182.219 -55.623  16.903  1.00 91.41  ? 373 VAL D CG1 1 
ATOM   7284  C CG2 . VAL D 2 373 ? 184.663 -55.802  17.383  1.00 91.88  ? 373 VAL D CG2 1 
ATOM   7285  N N   . ILE D 2 374 ? 180.702 -57.565  19.179  1.00 97.94  ? 374 ILE D N   1 
ATOM   7286  C CA  . ILE D 2 374 ? 179.402 -58.238  19.226  1.00 101.16 ? 374 ILE D CA  1 
ATOM   7287  C C   . ILE D 2 374 ? 178.281 -57.355  18.669  1.00 100.89 ? 374 ILE D C   1 
ATOM   7288  O O   . ILE D 2 374 ? 177.959 -56.303  19.229  1.00 101.70 ? 374 ILE D O   1 
ATOM   7289  C CB  . ILE D 2 374 ? 179.076 -58.776  20.652  1.00 103.23 ? 374 ILE D CB  1 
ATOM   7290  C CG1 . ILE D 2 374 ? 177.582 -59.092  20.818  1.00 104.20 ? 374 ILE D CG1 1 
ATOM   7291  C CG2 . ILE D 2 374 ? 179.539 -57.813  21.737  1.00 104.05 ? 374 ILE D CG2 1 
ATOM   7292  C CD1 . ILE D 2 374 ? 177.186 -60.479  20.363  1.00 105.02 ? 374 ILE D CD1 1 
ATOM   7293  N N   . GLY D 2 375 ? 177.711 -57.796  17.549  1.00 100.08 ? 375 GLY D N   1 
ATOM   7294  C CA  . GLY D 2 375 ? 176.589 -57.115  16.904  1.00 99.17  ? 375 GLY D CA  1 
ATOM   7295  C C   . GLY D 2 375 ? 176.805 -55.643  16.603  1.00 98.32  ? 375 GLY D C   1 
ATOM   7296  O O   . GLY D 2 375 ? 175.896 -54.830  16.777  1.00 98.81  ? 375 GLY D O   1 
ATOM   7297  N N   . ALA D 2 376 ? 178.011 -55.303  16.155  1.00 96.84  ? 376 ALA D N   1 
ATOM   7298  C CA  . ALA D 2 376 ? 178.352 -53.928  15.802  1.00 95.91  ? 376 ALA D CA  1 
ATOM   7299  C C   . ALA D 2 376 ? 178.976 -53.856  14.408  1.00 95.46  ? 376 ALA D C   1 
ATOM   7300  O O   . ALA D 2 376 ? 179.639 -54.801  13.974  1.00 96.12  ? 376 ALA D O   1 
ATOM   7301  C CB  . ALA D 2 376 ? 179.287 -53.329  16.841  1.00 95.07  ? 376 ALA D CB  1 
ATOM   7302  N N   . ASN D 2 377 ? 178.758 -52.737  13.715  1.00 94.61  ? 377 ASN D N   1 
ATOM   7303  C CA  . ASN D 2 377 ? 179.273 -52.548  12.353  1.00 93.14  ? 377 ASN D CA  1 
ATOM   7304  C C   . ASN D 2 377 ? 179.840 -51.149  12.089  1.00 92.30  ? 377 ASN D C   1 
ATOM   7305  O O   . ASN D 2 377 ? 181.049 -50.991  11.924  1.00 92.95  ? 377 ASN D O   1 
ATOM   7306  C CB  . ASN D 2 377 ? 178.201 -52.906  11.310  1.00 92.73  ? 377 ASN D CB  1 
ATOM   7307  C CG  . ASN D 2 377 ? 178.780 -53.140  9.921   1.00 92.15  ? 377 ASN D CG  1 
ATOM   7308  O OD1 . ASN D 2 377 ? 179.449 -52.274  9.353   1.00 91.54  ? 377 ASN D OD1 1 
ATOM   7309  N ND2 . ASN D 2 377 ? 178.508 -54.313  9.360   1.00 92.44  ? 377 ASN D ND2 1 
ATOM   7310  N N   . ASP D 2 378 ? 178.968 -50.143  12.050  1.00 91.17  ? 378 ASP D N   1 
ATOM   7311  C CA  . ASP D 2 378 ? 179.364 -48.784  11.668  1.00 91.02  ? 378 ASP D CA  1 
ATOM   7312  C C   . ASP D 2 378 ? 180.252 -48.074  12.685  1.00 92.95  ? 378 ASP D C   1 
ATOM   7313  O O   . ASP D 2 378 ? 181.094 -47.260  12.306  1.00 91.98  ? 378 ASP D O   1 
ATOM   7314  C CB  . ASP D 2 378 ? 178.134 -47.927  11.380  1.00 89.40  ? 378 ASP D CB  1 
ATOM   7315  C CG  . ASP D 2 378 ? 177.446 -48.302  10.084  1.00 88.21  ? 378 ASP D CG  1 
ATOM   7316  O OD1 . ASP D 2 378 ? 177.902 -49.247  9.406   1.00 87.49  ? 378 ASP D OD1 1 
ATOM   7317  O OD2 . ASP D 2 378 ? 176.441 -47.644  9.744   1.00 87.97  ? 378 ASP D OD2 1 
ATOM   7318  N N   . VAL D 2 379 ? 180.052 -48.383  13.966  1.00 96.82  ? 379 VAL D N   1 
ATOM   7319  C CA  . VAL D 2 379 ? 180.824 -47.779  15.063  1.00 101.09 ? 379 VAL D CA  1 
ATOM   7320  C C   . VAL D 2 379 ? 182.308 -48.112  14.975  1.00 103.77 ? 379 VAL D C   1 
ATOM   7321  O O   . VAL D 2 379 ? 183.158 -47.371  15.471  1.00 102.30 ? 379 VAL D O   1 
ATOM   7322  C CB  . VAL D 2 379 ? 180.303 -48.213  16.457  1.00 102.04 ? 379 VAL D CB  1 
ATOM   7323  C CG1 . VAL D 2 379 ? 178.897 -47.685  16.698  1.00 104.03 ? 379 VAL D CG1 1 
ATOM   7324  C CG2 . VAL D 2 379 ? 180.357 -49.727  16.634  1.00 101.52 ? 379 VAL D CG2 1 
ATOM   7325  N N   . VAL D 2 380 ? 182.599 -49.236  14.333  1.00 109.92 ? 380 VAL D N   1 
ATOM   7326  C CA  . VAL D 2 380 ? 183.951 -49.761  14.232  1.00 116.80 ? 380 VAL D CA  1 
ATOM   7327  C C   . VAL D 2 380 ? 184.378 -49.895  12.764  1.00 122.89 ? 380 VAL D C   1 
ATOM   7328  O O   . VAL D 2 380 ? 185.277 -50.675  12.431  1.00 125.61 ? 380 VAL D O   1 
ATOM   7329  C CB  . VAL D 2 380 ? 184.075 -51.104  14.988  1.00 116.39 ? 380 VAL D CB  1 
ATOM   7330  C CG1 . VAL D 2 380 ? 184.194 -50.857  16.485  1.00 114.69 ? 380 VAL D CG1 1 
ATOM   7331  C CG2 . VAL D 2 380 ? 182.891 -52.017  14.688  1.00 116.65 ? 380 VAL D CG2 1 
ATOM   7332  N N   . ASN D 2 381 ? 183.730 -49.112  11.900  1.00 127.69 ? 381 ASN D N   1 
ATOM   7333  C CA  . ASN D 2 381 ? 183.987 -49.114  10.458  1.00 129.95 ? 381 ASN D CA  1 
ATOM   7334  C C   . ASN D 2 381 ? 185.021 -48.049  10.069  1.00 129.91 ? 381 ASN D C   1 
ATOM   7335  O O   . ASN D 2 381 ? 184.755 -46.850  10.207  1.00 133.03 ? 381 ASN D O   1 
ATOM   7336  C CB  . ASN D 2 381 ? 182.671 -48.896  9.694   1.00 130.19 ? 381 ASN D CB  1 
ATOM   7337  C CG  . ASN D 2 381 ? 182.790 -49.165  8.197   1.00 129.90 ? 381 ASN D CG  1 
ATOM   7338  O OD1 . ASN D 2 381 ? 183.882 -49.178  7.625   1.00 129.31 ? 381 ASN D OD1 1 
ATOM   7339  N ND2 . ASN D 2 381 ? 181.649 -49.376  7.555   1.00 130.20 ? 381 ASN D ND2 1 
ATOM   7340  N N   . PRO D 2 382 ? 186.200 -48.488  9.573   1.00 127.07 ? 382 PRO D N   1 
ATOM   7341  C CA  . PRO D 2 382 ? 187.313 -47.602  9.195   1.00 124.15 ? 382 PRO D CA  1 
ATOM   7342  C C   . PRO D 2 382 ? 187.005 -46.621  8.052   1.00 121.44 ? 382 PRO D C   1 
ATOM   7343  O O   . PRO D 2 382 ? 187.862 -45.804  7.697   1.00 121.02 ? 382 PRO D O   1 
ATOM   7344  C CB  . PRO D 2 382 ? 188.415 -48.585  8.774   1.00 124.19 ? 382 PRO D CB  1 
ATOM   7345  C CG  . PRO D 2 382 ? 188.071 -49.863  9.460   1.00 124.63 ? 382 PRO D CG  1 
ATOM   7346  C CD  . PRO D 2 382 ? 186.573 -49.908  9.429   1.00 125.87 ? 382 PRO D CD  1 
ATOM   7347  N N   . ALA D 2 383 ? 185.797 -46.701  7.491   1.00 118.21 ? 383 ALA D N   1 
ATOM   7348  C CA  . ALA D 2 383 ? 185.349 -45.778  6.445   1.00 115.27 ? 383 ALA D CA  1 
ATOM   7349  C C   . ALA D 2 383 ? 185.107 -44.366  6.984   1.00 113.66 ? 383 ALA D C   1 
ATOM   7350  O O   . ALA D 2 383 ? 185.188 -43.387  6.240   1.00 113.53 ? 383 ALA D O   1 
ATOM   7351  C CB  . ALA D 2 383 ? 184.095 -46.312  5.766   1.00 114.21 ? 383 ALA D CB  1 
ATOM   7352  N N   . ALA D 2 384 ? 184.824 -44.275  8.282   1.00 112.15 ? 384 ALA D N   1 
ATOM   7353  C CA  . ALA D 2 384 ? 184.560 -43.005  8.960   1.00 110.87 ? 384 ALA D CA  1 
ATOM   7354  C C   . ALA D 2 384 ? 185.764 -42.055  9.007   1.00 110.65 ? 384 ALA D C   1 
ATOM   7355  O O   . ALA D 2 384 ? 185.643 -40.909  9.453   1.00 109.61 ? 384 ALA D O   1 
ATOM   7356  C CB  . ALA D 2 384 ? 184.055 -43.277  10.364  1.00 110.06 ? 384 ALA D CB  1 
ATOM   7357  N N   . ARG D 2 385 ? 186.915 -42.539  8.545   1.00 111.38 ? 385 ARG D N   1 
ATOM   7358  C CA  . ARG D 2 385 ? 188.162 -41.775  8.565   1.00 112.43 ? 385 ARG D CA  1 
ATOM   7359  C C   . ARG D 2 385 ? 188.294 -40.834  7.365   1.00 115.50 ? 385 ARG D C   1 
ATOM   7360  O O   . ARG D 2 385 ? 188.763 -39.703  7.505   1.00 113.35 ? 385 ARG D O   1 
ATOM   7361  C CB  . ARG D 2 385 ? 189.369 -42.724  8.610   1.00 110.33 ? 385 ARG D CB  1 
ATOM   7362  C CG  . ARG D 2 385 ? 189.482 -43.585  9.865   1.00 108.16 ? 385 ARG D CG  1 
ATOM   7363  C CD  . ARG D 2 385 ? 190.782 -44.385  9.860   1.00 105.11 ? 385 ARG D CD  1 
ATOM   7364  N NE  . ARG D 2 385 ? 191.081 -45.030  11.143  1.00 101.39 ? 385 ARG D NE  1 
ATOM   7365  C CZ  . ARG D 2 385 ? 191.285 -46.338  11.309  1.00 98.64  ? 385 ARG D CZ  1 
ATOM   7366  N NH1 . ARG D 2 385 ? 191.225 -47.171  10.275  1.00 97.33  ? 385 ARG D NH1 1 
ATOM   7367  N NH2 . ARG D 2 385 ? 191.555 -46.819  12.514  1.00 97.24  ? 385 ARG D NH2 1 
ATOM   7368  N N   . ARG D 2 386 ? 187.873 -41.310  6.195   1.00 122.77 ? 386 ARG D N   1 
ATOM   7369  C CA  . ARG D 2 386 ? 188.077 -40.600  4.927   1.00 130.55 ? 386 ARG D CA  1 
ATOM   7370  C C   . ARG D 2 386 ? 186.869 -39.741  4.520   1.00 133.16 ? 386 ARG D C   1 
ATOM   7371  O O   . ARG D 2 386 ? 185.740 -40.030  4.925   1.00 134.71 ? 386 ARG D O   1 
ATOM   7372  C CB  . ARG D 2 386 ? 188.407 -41.599  3.813   1.00 136.54 ? 386 ARG D CB  1 
ATOM   7373  C CG  . ARG D 2 386 ? 189.613 -42.484  4.093   1.00 142.63 ? 386 ARG D CG  1 
ATOM   7374  C CD  . ARG D 2 386 ? 189.716 -43.622  3.086   1.00 150.54 ? 386 ARG D CD  1 
ATOM   7375  N NE  . ARG D 2 386 ? 188.441 -44.317  2.895   1.00 158.29 ? 386 ARG D NE  1 
ATOM   7376  C CZ  . ARG D 2 386 ? 187.991 -45.309  3.661   1.00 162.47 ? 386 ARG D CZ  1 
ATOM   7377  N NH1 . ARG D 2 386 ? 188.706 -45.746  4.692   1.00 163.98 ? 386 ARG D NH1 1 
ATOM   7378  N NH2 . ARG D 2 386 ? 186.816 -45.865  3.393   1.00 165.89 ? 386 ARG D NH2 1 
ATOM   7379  N N   . PRO D 2 387 ? 187.106 -38.679  3.716   1.00 134.86 ? 387 PRO D N   1 
ATOM   7380  C CA  . PRO D 2 387 ? 186.047 -37.774  3.238   1.00 136.37 ? 387 PRO D CA  1 
ATOM   7381  C C   . PRO D 2 387 ? 185.237 -38.288  2.035   1.00 138.35 ? 387 PRO D C   1 
ATOM   7382  O O   . PRO D 2 387 ? 184.318 -37.600  1.574   1.00 138.38 ? 387 PRO D O   1 
ATOM   7383  C CB  . PRO D 2 387 ? 186.819 -36.500  2.844   1.00 135.18 ? 387 PRO D CB  1 
ATOM   7384  C CG  . PRO D 2 387 ? 188.193 -36.668  3.404   1.00 134.42 ? 387 PRO D CG  1 
ATOM   7385  C CD  . PRO D 2 387 ? 188.440 -38.142  3.398   1.00 134.49 ? 387 PRO D CD  1 
ATOM   7386  N N   . GLY D 2 388 ? 185.573 -39.477  1.539   1.00 140.29 ? 388 GLY D N   1 
ATOM   7387  C CA  . GLY D 2 388 ? 184.892 -40.064  0.384   1.00 142.41 ? 388 GLY D CA  1 
ATOM   7388  C C   . GLY D 2 388 ? 183.632 -40.833  0.733   1.00 145.27 ? 388 GLY D C   1 
ATOM   7389  O O   . GLY D 2 388 ? 182.595 -40.669  0.086   1.00 143.86 ? 388 GLY D O   1 
ATOM   7390  N N   . SER D 2 389 ? 183.735 -41.678  1.757   1.00 150.35 ? 389 SER D N   1 
ATOM   7391  C CA  . SER D 2 389 ? 182.621 -42.499  2.230   1.00 157.07 ? 389 SER D CA  1 
ATOM   7392  C C   . SER D 2 389 ? 181.628 -41.685  3.079   1.00 165.44 ? 389 SER D C   1 
ATOM   7393  O O   . SER D 2 389 ? 181.970 -40.598  3.556   1.00 166.51 ? 389 SER D O   1 
ATOM   7394  C CB  . SER D 2 389 ? 183.156 -43.699  3.019   1.00 154.22 ? 389 SER D CB  1 
ATOM   7395  O OG  . SER D 2 389 ? 183.906 -43.276  4.142   1.00 153.63 ? 389 SER D OG  1 
ATOM   7396  N N   . PRO D 2 390 ? 180.393 -42.204  3.258   1.00 173.81 ? 390 PRO D N   1 
ATOM   7397  C CA  . PRO D 2 390 ? 179.335 -41.500  4.004   1.00 179.78 ? 390 PRO D CA  1 
ATOM   7398  C C   . PRO D 2 390 ? 179.528 -41.374  5.526   1.00 184.10 ? 390 PRO D C   1 
ATOM   7399  O O   . PRO D 2 390 ? 178.962 -40.458  6.133   1.00 188.38 ? 390 PRO D O   1 
ATOM   7400  C CB  . PRO D 2 390 ? 178.078 -42.332  3.702   1.00 178.92 ? 390 PRO D CB  1 
ATOM   7401  C CG  . PRO D 2 390 ? 178.398 -43.079  2.451   1.00 176.70 ? 390 PRO D CG  1 
ATOM   7402  C CD  . PRO D 2 390 ? 179.858 -43.394  2.570   1.00 175.11 ? 390 PRO D CD  1 
ATOM   7403  N N   . LEU D 2 391 ? 180.316 -42.266  6.130   1.00 184.26 ? 391 LEU D N   1 
ATOM   7404  C CA  . LEU D 2 391 ? 180.462 -42.308  7.595   1.00 181.59 ? 391 LEU D CA  1 
ATOM   7405  C C   . LEU D 2 391 ? 181.353 -41.222  8.202   1.00 182.33 ? 391 LEU D C   1 
ATOM   7406  O O   . LEU D 2 391 ? 181.674 -41.281  9.391   1.00 179.79 ? 391 LEU D O   1 
ATOM   7407  C CB  . LEU D 2 391 ? 180.954 -43.690  8.053   1.00 178.02 ? 391 LEU D CB  1 
ATOM   7408  C CG  . LEU D 2 391 ? 179.935 -44.785  8.383   1.00 176.04 ? 391 LEU D CG  1 
ATOM   7409  C CD1 . LEU D 2 391 ? 180.652 -46.102  8.620   1.00 174.23 ? 391 LEU D CD1 1 
ATOM   7410  C CD2 . LEU D 2 391 ? 179.088 -44.425  9.594   1.00 173.87 ? 391 LEU D CD2 1 
ATOM   7411  N N   . TYR D 2 392 ? 181.732 -40.225  7.403   1.00 185.01 ? 392 TYR D N   1 
ATOM   7412  C CA  . TYR D 2 392 ? 182.636 -39.174  7.872   1.00 187.85 ? 392 TYR D CA  1 
ATOM   7413  C C   . TYR D 2 392 ? 181.986 -38.201  8.852   1.00 185.93 ? 392 TYR D C   1 
ATOM   7414  O O   . TYR D 2 392 ? 180.808 -37.850  8.724   1.00 183.50 ? 392 TYR D O   1 
ATOM   7415  C CB  . TYR D 2 392 ? 183.280 -38.415  6.707   1.00 192.48 ? 392 TYR D CB  1 
ATOM   7416  C CG  . TYR D 2 392 ? 184.407 -37.504  7.149   1.00 197.91 ? 392 TYR D CG  1 
ATOM   7417  C CD1 . TYR D 2 392 ? 185.643 -38.029  7.537   1.00 198.84 ? 392 TYR D CD1 1 
ATOM   7418  C CD2 . TYR D 2 392 ? 184.234 -36.121  7.197   1.00 200.30 ? 392 TYR D CD2 1 
ATOM   7419  C CE1 . TYR D 2 392 ? 186.675 -37.201  7.951   1.00 200.22 ? 392 TYR D CE1 1 
ATOM   7420  C CE2 . TYR D 2 392 ? 185.262 -35.286  7.609   1.00 202.43 ? 392 TYR D CE2 1 
ATOM   7421  C CZ  . TYR D 2 392 ? 186.478 -35.831  7.984   1.00 202.04 ? 392 TYR D CZ  1 
ATOM   7422  O OH  . TYR D 2 392 ? 187.501 -35.007  8.392   1.00 202.69 ? 392 TYR D OH  1 
ATOM   7423  N N   . GLY D 2 393 ? 182.790 -37.758  9.815   1.00 185.02 ? 393 GLY D N   1 
ATOM   7424  C CA  . GLY D 2 393 ? 182.315 -36.980  10.948  1.00 181.50 ? 393 GLY D CA  1 
ATOM   7425  C C   . GLY D 2 393 ? 182.224 -37.870  12.172  1.00 177.20 ? 393 GLY D C   1 
ATOM   7426  O O   . GLY D 2 393 ? 181.851 -37.412  13.253  1.00 182.91 ? 393 GLY D O   1 
ATOM   7427  N N   . MET D 2 394 ? 182.573 -39.146  11.996  1.00 166.35 ? 394 MET D N   1 
ATOM   7428  C CA  . MET D 2 394 ? 182.470 -40.128  13.067  1.00 153.09 ? 394 MET D CA  1 
ATOM   7429  C C   . MET D 2 394 ? 183.664 -40.103  14.006  1.00 154.44 ? 394 MET D C   1 
ATOM   7430  O O   . MET D 2 394 ? 184.815 -40.150  13.557  1.00 149.90 ? 394 MET D O   1 
ATOM   7431  C CB  . MET D 2 394 ? 182.281 -41.542  12.513  1.00 139.18 ? 394 MET D CB  1 
ATOM   7432  C CG  . MET D 2 394 ? 181.885 -42.566  13.563  1.00 125.72 ? 394 MET D CG  1 
ATOM   7433  S SD  . MET D 2 394 ? 181.542 -44.189  12.872  1.00 113.58 ? 394 MET D SD  1 
ATOM   7434  C CE  . MET D 2 394 ? 183.090 -45.009  13.226  1.00 112.92 ? 394 MET D CE  1 
ATOM   7435  N N   . PRO D 2 395 ? 183.388 -40.011  15.318  1.00 158.57 ? 395 PRO D N   1 
ATOM   7436  C CA  . PRO D 2 395 ? 184.389 -40.365  16.306  1.00 161.20 ? 395 PRO D CA  1 
ATOM   7437  C C   . PRO D 2 395 ? 184.645 -41.861  16.160  1.00 163.76 ? 395 PRO D C   1 
ATOM   7438  O O   . PRO D 2 395 ? 183.855 -42.683  16.627  1.00 163.38 ? 395 PRO D O   1 
ATOM   7439  C CB  . PRO D 2 395 ? 183.701 -40.043  17.638  1.00 161.75 ? 395 PRO D CB  1 
ATOM   7440  C CG  . PRO D 2 395 ? 182.649 -39.047  17.294  1.00 162.35 ? 395 PRO D CG  1 
ATOM   7441  C CD  . PRO D 2 395 ? 182.164 -39.482  15.946  1.00 161.46 ? 395 PRO D CD  1 
ATOM   7442  N N   . ILE D 2 396 ? 185.735 -42.192  15.477  1.00 168.17 ? 396 ILE D N   1 
ATOM   7443  C CA  . ILE D 2 396 ? 186.038 -43.563  15.067  1.00 173.56 ? 396 ILE D CA  1 
ATOM   7444  C C   . ILE D 2 396 ? 186.535 -44.445  16.224  1.00 170.62 ? 396 ILE D C   1 
ATOM   7445  O O   . ILE D 2 396 ? 187.289 -43.985  17.084  1.00 175.67 ? 396 ILE D O   1 
ATOM   7446  C CB  . ILE D 2 396 ? 187.035 -43.561  13.872  1.00 179.78 ? 396 ILE D CB  1 
ATOM   7447  C CG1 . ILE D 2 396 ? 187.564 -44.968  13.559  1.00 185.07 ? 396 ILE D CG1 1 
ATOM   7448  C CG2 . ILE D 2 396 ? 188.196 -42.606  14.123  1.00 181.70 ? 396 ILE D CG2 1 
ATOM   7449  C CD1 . ILE D 2 396 ? 186.620 -45.827  12.745  1.00 188.28 ? 396 ILE D CD1 1 
ATOM   7450  N N   . LEU D 2 397 ? 186.093 -45.705  16.240  1.00 162.15 ? 397 LEU D N   1 
ATOM   7451  C CA  . LEU D 2 397 ? 186.550 -46.686  17.229  1.00 153.55 ? 397 LEU D CA  1 
ATOM   7452  C C   . LEU D 2 397 ? 187.652 -47.562  16.633  1.00 154.42 ? 397 LEU D C   1 
ATOM   7453  O O   . LEU D 2 397 ? 187.395 -48.389  15.753  1.00 151.90 ? 397 LEU D O   1 
ATOM   7454  C CB  . LEU D 2 397 ? 185.382 -47.550  17.719  1.00 145.98 ? 397 LEU D CB  1 
ATOM   7455  C CG  . LEU D 2 397 ? 185.393 -48.081  19.159  1.00 141.22 ? 397 LEU D CG  1 
ATOM   7456  C CD1 . LEU D 2 397 ? 184.008 -48.591  19.533  1.00 139.62 ? 397 LEU D CD1 1 
ATOM   7457  C CD2 . LEU D 2 397 ? 186.434 -49.177  19.363  1.00 138.84 ? 397 LEU D CD2 1 
ATOM   7458  N N   . ASP D 2 398 ? 188.874 -47.376  17.129  1.00 158.94 ? 398 ASP D N   1 
ATOM   7459  C CA  . ASP D 2 398 ? 190.062 -48.030  16.576  1.00 163.98 ? 398 ASP D CA  1 
ATOM   7460  C C   . ASP D 2 398 ? 190.174 -49.509  16.944  1.00 163.07 ? 398 ASP D C   1 
ATOM   7461  O O   . ASP D 2 398 ? 190.978 -49.886  17.796  1.00 166.37 ? 398 ASP D O   1 
ATOM   7462  C CB  . ASP D 2 398 ? 191.334 -47.285  17.007  1.00 169.99 ? 398 ASP D CB  1 
ATOM   7463  C CG  . ASP D 2 398 ? 191.616 -46.058  16.157  1.00 174.10 ? 398 ASP D CG  1 
ATOM   7464  O OD1 . ASP D 2 398 ? 191.094 -45.967  15.025  1.00 176.12 ? 398 ASP D OD1 1 
ATOM   7465  O OD2 . ASP D 2 398 ? 192.377 -45.183  16.623  1.00 177.67 ? 398 ASP D OD2 1 
ATOM   7466  N N   . VAL D 2 399 ? 189.377 -50.342  16.284  1.00 158.61 ? 399 VAL D N   1 
ATOM   7467  C CA  . VAL D 2 399 ? 189.400 -51.787  16.520  1.00 153.71 ? 399 VAL D CA  1 
ATOM   7468  C C   . VAL D 2 399 ? 190.345 -52.507  15.542  1.00 147.81 ? 399 VAL D C   1 
ATOM   7469  O O   . VAL D 2 399 ? 190.823 -53.610  15.825  1.00 145.80 ? 399 VAL D O   1 
ATOM   7470  C CB  . VAL D 2 399 ? 187.970 -52.377  16.471  1.00 155.49 ? 399 VAL D CB  1 
ATOM   7471  C CG1 . VAL D 2 399 ? 187.372 -52.221  15.082  1.00 155.94 ? 399 VAL D CG1 1 
ATOM   7472  C CG2 . VAL D 2 399 ? 187.950 -53.833  16.920  1.00 156.64 ? 399 VAL D CG2 1 
ATOM   7473  N N   . ASP D 2 400 ? 190.621 -51.863  14.408  1.00 141.47 ? 400 ASP D N   1 
ATOM   7474  C CA  . ASP D 2 400 ? 191.455 -52.438  13.346  1.00 135.72 ? 400 ASP D CA  1 
ATOM   7475  C C   . ASP D 2 400 ? 192.938 -52.597  13.710  1.00 132.91 ? 400 ASP D C   1 
ATOM   7476  O O   . ASP D 2 400 ? 193.626 -53.456  13.149  1.00 132.73 ? 400 ASP D O   1 
ATOM   7477  C CB  . ASP D 2 400 ? 191.302 -51.642  12.039  1.00 134.10 ? 400 ASP D CB  1 
ATOM   7478  C CG  . ASP D 2 400 ? 191.455 -50.139  12.239  1.00 132.56 ? 400 ASP D CG  1 
ATOM   7479  O OD1 . ASP D 2 400 ? 190.599 -49.532  12.920  1.00 130.83 ? 400 ASP D OD1 1 
ATOM   7480  O OD2 . ASP D 2 400 ? 192.422 -49.561  11.697  1.00 131.63 ? 400 ASP D OD2 1 
ATOM   7481  N N   . LYS D 2 401 ? 193.417 -51.775  14.644  1.00 128.25 ? 401 LYS D N   1 
ATOM   7482  C CA  . LYS D 2 401 ? 194.822 -51.800  15.079  1.00 122.45 ? 401 LYS D CA  1 
ATOM   7483  C C   . LYS D 2 401 ? 195.124 -52.862  16.148  1.00 120.77 ? 401 LYS D C   1 
ATOM   7484  O O   . LYS D 2 401 ? 196.287 -53.077  16.501  1.00 120.56 ? 401 LYS D O   1 
ATOM   7485  C CB  . LYS D 2 401 ? 195.278 -50.412  15.561  1.00 117.50 ? 401 LYS D CB  1 
ATOM   7486  C CG  . LYS D 2 401 ? 195.570 -49.412  14.448  1.00 110.01 ? 401 LYS D CG  1 
ATOM   7487  C CD  . LYS D 2 401 ? 196.279 -48.177  14.986  1.00 103.20 ? 401 LYS D CD  1 
ATOM   7488  C CE  . LYS D 2 401 ? 196.405 -47.092  13.927  1.00 98.63  ? 401 LYS D CE  1 
ATOM   7489  N NZ  . LYS D 2 401 ? 197.323 -47.475  12.818  1.00 95.88  ? 401 LYS D NZ  1 
ATOM   7490  N N   . ALA D 2 402 ? 194.082 -53.519  16.657  1.00 118.29 ? 402 ALA D N   1 
ATOM   7491  C CA  . ALA D 2 402 ? 194.248 -54.630  17.593  1.00 116.48 ? 402 ALA D CA  1 
ATOM   7492  C C   . ALA D 2 402 ? 194.872 -55.832  16.882  1.00 117.25 ? 402 ALA D C   1 
ATOM   7493  O O   . ALA D 2 402 ? 194.729 -55.981  15.666  1.00 117.99 ? 402 ALA D O   1 
ATOM   7494  C CB  . ALA D 2 402 ? 192.912 -55.005  18.218  1.00 114.91 ? 402 ALA D CB  1 
ATOM   7495  N N   . LYS D 2 403 ? 195.565 -56.679  17.641  1.00 117.80 ? 403 LYS D N   1 
ATOM   7496  C CA  . LYS D 2 403 ? 196.298 -57.818  17.068  1.00 118.26 ? 403 LYS D CA  1 
ATOM   7497  C C   . LYS D 2 403 ? 195.407 -58.960  16.570  1.00 119.44 ? 403 LYS D C   1 
ATOM   7498  O O   . LYS D 2 403 ? 195.793 -59.686  15.649  1.00 119.85 ? 403 LYS D O   1 
ATOM   7499  C CB  . LYS D 2 403 ? 197.355 -58.335  18.048  1.00 116.73 ? 403 LYS D CB  1 
ATOM   7500  C CG  . LYS D 2 403 ? 198.569 -57.427  18.137  1.00 115.78 ? 403 LYS D CG  1 
ATOM   7501  C CD  . LYS D 2 403 ? 199.529 -57.844  19.236  1.00 115.73 ? 403 LYS D CD  1 
ATOM   7502  C CE  . LYS D 2 403 ? 200.658 -56.832  19.352  1.00 115.89 ? 403 LYS D CE  1 
ATOM   7503  N NZ  . LYS D 2 403 ? 201.587 -57.132  20.474  1.00 117.09 ? 403 LYS D NZ  1 
ATOM   7504  N N   . ASN D 2 404 ? 194.230 -59.112  17.181  1.00 119.74 ? 404 ASN D N   1 
ATOM   7505  C CA  . ASN D 2 404 ? 193.238 -60.126  16.788  1.00 117.77 ? 404 ASN D CA  1 
ATOM   7506  C C   . ASN D 2 404 ? 191.801 -59.631  17.027  1.00 117.06 ? 404 ASN D C   1 
ATOM   7507  O O   . ASN D 2 404 ? 191.486 -59.143  18.114  1.00 118.90 ? 404 ASN D O   1 
ATOM   7508  C CB  . ASN D 2 404 ? 193.478 -61.444  17.542  1.00 115.24 ? 404 ASN D CB  1 
ATOM   7509  C CG  . ASN D 2 404 ? 194.877 -62.002  17.329  1.00 112.91 ? 404 ASN D CG  1 
ATOM   7510  O OD1 . ASN D 2 404 ? 195.194 -62.525  16.262  1.00 112.09 ? 404 ASN D OD1 1 
ATOM   7511  N ND2 . ASN D 2 404 ? 195.720 -61.897  18.352  1.00 110.96 ? 404 ASN D ND2 1 
ATOM   7512  N N   . VAL D 2 405 ? 190.939 -59.746  16.015  1.00 113.51 ? 405 VAL D N   1 
ATOM   7513  C CA  . VAL D 2 405 ? 189.556 -59.248  16.110  1.00 108.90 ? 405 VAL D CA  1 
ATOM   7514  C C   . VAL D 2 405 ? 188.529 -60.339  15.797  1.00 105.34 ? 405 VAL D C   1 
ATOM   7515  O O   . VAL D 2 405 ? 188.644 -61.049  14.795  1.00 103.81 ? 405 VAL D O   1 
ATOM   7516  C CB  . VAL D 2 405 ? 189.312 -58.015  15.199  1.00 109.33 ? 405 VAL D CB  1 
ATOM   7517  C CG1 . VAL D 2 405 ? 187.902 -57.468  15.388  1.00 109.16 ? 405 VAL D CG1 1 
ATOM   7518  C CG2 . VAL D 2 405 ? 190.329 -56.917  15.478  1.00 109.73 ? 405 VAL D CG2 1 
ATOM   7519  N N   . ILE D 2 406 ? 187.530 -60.461  16.669  1.00 102.41 ? 406 ILE D N   1 
ATOM   7520  C CA  . ILE D 2 406 ? 186.450 -61.430  16.495  1.00 101.01 ? 406 ILE D CA  1 
ATOM   7521  C C   . ILE D 2 406 ? 185.104 -60.710  16.427  1.00 101.54 ? 406 ILE D C   1 
ATOM   7522  O O   . ILE D 2 406 ? 184.738 -59.976  17.345  1.00 100.13 ? 406 ILE D O   1 
ATOM   7523  C CB  . ILE D 2 406 ? 186.451 -62.490  17.620  1.00 100.15 ? 406 ILE D CB  1 
ATOM   7524  C CG1 . ILE D 2 406 ? 187.757 -63.294  17.591  1.00 99.94  ? 406 ILE D CG1 1 
ATOM   7525  C CG2 . ILE D 2 406 ? 185.248 -63.417  17.488  1.00 99.95  ? 406 ILE D CG2 1 
ATOM   7526  C CD1 . ILE D 2 406 ? 187.992 -64.165  18.808  1.00 100.29 ? 406 ILE D CD1 1 
ATOM   7527  N N   . VAL D 2 407 ? 184.376 -60.932  15.332  1.00 103.88 ? 407 VAL D N   1 
ATOM   7528  C CA  . VAL D 2 407 ? 183.112 -60.238  15.064  1.00 106.80 ? 407 VAL D CA  1 
ATOM   7529  C C   . VAL D 2 407 ? 181.919 -61.191  15.146  1.00 107.82 ? 407 VAL D C   1 
ATOM   7530  O O   . VAL D 2 407 ? 181.942 -62.262  14.546  1.00 108.11 ? 407 VAL D O   1 
ATOM   7531  C CB  . VAL D 2 407 ? 183.132 -59.566  13.670  1.00 107.98 ? 407 VAL D CB  1 
ATOM   7532  C CG1 . VAL D 2 407 ? 181.817 -58.852  13.388  1.00 109.00 ? 407 VAL D CG1 1 
ATOM   7533  C CG2 . VAL D 2 407 ? 184.298 -58.596  13.557  1.00 108.81 ? 407 VAL D CG2 1 
ATOM   7534  N N   . ILE D 2 408 ? 180.875 -60.791  15.873  1.00 109.38 ? 408 ILE D N   1 
ATOM   7535  C CA  . ILE D 2 408 ? 179.669 -61.616  16.017  1.00 111.28 ? 408 ILE D CA  1 
ATOM   7536  C C   . ILE D 2 408 ? 178.454 -61.022  15.291  1.00 113.08 ? 408 ILE D C   1 
ATOM   7537  O O   . ILE D 2 408 ? 177.974 -59.938  15.637  1.00 111.66 ? 408 ILE D O   1 
ATOM   7538  C CB  . ILE D 2 408 ? 179.327 -61.902  17.500  1.00 111.36 ? 408 ILE D CB  1 
ATOM   7539  C CG1 . ILE D 2 408 ? 180.520 -62.558  18.208  1.00 112.22 ? 408 ILE D CG1 1 
ATOM   7540  C CG2 . ILE D 2 408 ? 178.092 -62.792  17.599  1.00 110.53 ? 408 ILE D CG2 1 
ATOM   7541  C CD1 . ILE D 2 408 ? 180.492 -62.449  19.720  1.00 113.60 ? 408 ILE D CD1 1 
ATOM   7542  N N   . LYS D 2 409 ? 177.977 -61.755  14.285  1.00 117.19 ? 409 LYS D N   1 
ATOM   7543  C CA  . LYS D 2 409 ? 176.793 -61.399  13.487  1.00 122.73 ? 409 LYS D CA  1 
ATOM   7544  C C   . LYS D 2 409 ? 176.288 -62.624  12.710  1.00 131.08 ? 409 LYS D C   1 
ATOM   7545  O O   . LYS D 2 409 ? 177.077 -63.503  12.370  1.00 134.32 ? 409 LYS D O   1 
ATOM   7546  C CB  . LYS D 2 409 ? 177.096 -60.231  12.535  1.00 117.66 ? 409 LYS D CB  1 
ATOM   7547  C CG  . LYS D 2 409 ? 178.352 -60.397  11.686  1.00 113.57 ? 409 LYS D CG  1 
ATOM   7548  C CD  . LYS D 2 409 ? 178.783 -59.079  11.060  1.00 110.61 ? 409 LYS D CD  1 
ATOM   7549  C CE  . LYS D 2 409 ? 178.035 -58.777  9.769   1.00 108.72 ? 409 LYS D CE  1 
ATOM   7550  N NZ  . LYS D 2 409 ? 178.529 -59.585  8.614   1.00 106.54 ? 409 LYS D NZ  1 
ATOM   7551  N N   . ARG D 2 410 ? 174.983 -62.671  12.429  1.00 140.76 ? 410 ARG D N   1 
ATOM   7552  C CA  . ARG D 2 410 ? 174.330 -63.853  11.825  1.00 149.10 ? 410 ARG D CA  1 
ATOM   7553  C C   . ARG D 2 410 ? 174.841 -64.276  10.440  1.00 156.92 ? 410 ARG D C   1 
ATOM   7554  O O   . ARG D 2 410 ? 175.110 -65.458  10.212  1.00 157.24 ? 410 ARG D O   1 
ATOM   7555  C CB  . ARG D 2 410 ? 172.807 -63.674  11.767  1.00 147.87 ? 410 ARG D CB  1 
ATOM   7556  C CG  . ARG D 2 410 ? 172.046 -64.177  12.987  1.00 146.84 ? 410 ARG D CG  1 
ATOM   7557  C CD  . ARG D 2 410 ? 170.545 -64.055  12.771  1.00 147.19 ? 410 ARG D CD  1 
ATOM   7558  N NE  . ARG D 2 410 ? 170.150 -62.672  12.506  1.00 151.49 ? 410 ARG D NE  1 
ATOM   7559  C CZ  . ARG D 2 410 ? 169.087 -62.311  11.791  1.00 154.12 ? 410 ARG D CZ  1 
ATOM   7560  N NH1 . ARG D 2 410 ? 168.294 -63.234  11.255  1.00 152.93 ? 410 ARG D NH1 1 
ATOM   7561  N NH2 . ARG D 2 410 ? 168.816 -61.024  11.607  1.00 158.26 ? 410 ARG D NH2 1 
ATOM   7562  N N   . GLY D 2 411 ? 174.954 -63.318  9.522   1.00 167.28 ? 411 GLY D N   1 
ATOM   7563  C CA  . GLY D 2 411 ? 175.358 -63.619  8.149   1.00 181.52 ? 411 GLY D CA  1 
ATOM   7564  C C   . GLY D 2 411 ? 175.916 -62.440  7.375   1.00 193.97 ? 411 GLY D C   1 
ATOM   7565  O O   . GLY D 2 411 ? 177.004 -61.944  7.677   1.00 192.05 ? 411 GLY D O   1 
ATOM   7566  N N   . GLN D 2 412 ? 175.162 -61.992  6.373   1.00 209.89 ? 412 GLN D N   1 
ATOM   7567  C CA  . GLN D 2 412 ? 175.619 -60.939  5.464   1.00 226.90 ? 412 GLN D CA  1 
ATOM   7568  C C   . GLN D 2 412 ? 174.785 -59.657  5.566   1.00 241.05 ? 412 GLN D C   1 
ATOM   7569  O O   . GLN D 2 412 ? 174.328 -59.114  4.545   1.00 240.47 ? 412 GLN D O   1 
ATOM   7570  C CB  . GLN D 2 412 ? 175.637 -61.453  4.016   1.00 223.91 ? 412 GLN D CB  1 
ATOM   7571  C CG  . GLN D 2 412 ? 176.549 -62.648  3.772   1.00 222.45 ? 412 GLN D CG  1 
ATOM   7572  C CD  . GLN D 2 412 ? 177.955 -62.445  4.309   1.00 222.77 ? 412 GLN D CD  1 
ATOM   7573  O OE1 . GLN D 2 412 ? 178.442 -63.247  5.104   1.00 221.81 ? 412 GLN D OE1 1 
ATOM   7574  N NE2 . GLN D 2 412 ? 178.609 -61.367  3.886   1.00 222.90 ? 412 GLN D NE2 1 
ATOM   7575  N N   . GLY D 2 413 ? 174.603 -59.176  6.803   1.00 241.01 ? 413 GLY D N   1 
ATOM   7576  C CA  . GLY D 2 413 ? 173.798 -57.977  7.066   1.00 240.20 ? 413 GLY D CA  1 
ATOM   7577  C C   . GLY D 2 413 ? 174.606 -56.719  7.349   1.00 243.27 ? 413 GLY D C   1 
ATOM   7578  O O   . GLY D 2 413 ? 175.773 -56.795  7.746   1.00 250.28 ? 413 GLY D O   1 
ATOM   7579  N N   . LYS D 2 414 ? 173.972 -55.561  7.146   1.00 243.53 ? 414 LYS D N   1 
ATOM   7580  C CA  . LYS D 2 414 ? 174.608 -54.250  7.351   1.00 241.44 ? 414 LYS D CA  1 
ATOM   7581  C C   . LYS D 2 414 ? 173.960 -53.461  8.506   1.00 238.10 ? 414 LYS D C   1 
ATOM   7582  O O   . LYS D 2 414 ? 172.991 -53.924  9.124   1.00 242.04 ? 414 LYS D O   1 
ATOM   7583  C CB  . LYS D 2 414 ? 174.586 -53.416  6.055   1.00 242.95 ? 414 LYS D CB  1 
ATOM   7584  C CG  . LYS D 2 414 ? 175.306 -54.028  4.855   1.00 245.01 ? 414 LYS D CG  1 
ATOM   7585  C CD  . LYS D 2 414 ? 175.513 -52.987  3.758   1.00 248.02 ? 414 LYS D CD  1 
ATOM   7586  C CE  . LYS D 2 414 ? 175.752 -53.622  2.393   1.00 248.97 ? 414 LYS D CE  1 
ATOM   7587  N NZ  . LYS D 2 414 ? 174.478 -54.042  1.709   1.00 248.28 ? 414 LYS D NZ  1 
ATOM   7588  N N   . GLY D 2 415 ? 174.501 -52.271  8.780   1.00 236.03 ? 415 GLY D N   1 
ATOM   7589  C CA  . GLY D 2 415 ? 174.062 -51.437  9.905   1.00 234.86 ? 415 GLY D CA  1 
ATOM   7590  C C   . GLY D 2 415 ? 172.990 -50.405  9.590   1.00 235.42 ? 415 GLY D C   1 
ATOM   7591  O O   . GLY D 2 415 ? 171.858 -50.761  9.253   1.00 232.69 ? 415 GLY D O   1 
ATOM   7592  N N   . PHE D 2 416 ? 173.350 -49.125  9.710   1.00 236.47 ? 416 PHE D N   1 
ATOM   7593  C CA  . PHE D 2 416 ? 172.400 -48.015  9.539   1.00 236.64 ? 416 PHE D CA  1 
ATOM   7594  C C   . PHE D 2 416 ? 172.754 -47.063  8.392   1.00 229.09 ? 416 PHE D C   1 
ATOM   7595  O O   . PHE D 2 416 ? 171.910 -46.785  7.537   1.00 225.59 ? 416 PHE D O   1 
ATOM   7596  C CB  . PHE D 2 416 ? 172.238 -47.229  10.851  1.00 238.71 ? 416 PHE D CB  1 
ATOM   7597  C CG  . PHE D 2 416 ? 171.399 -45.980  10.720  1.00 240.05 ? 416 PHE D CG  1 
ATOM   7598  C CD1 . PHE D 2 416 ? 170.008 -46.048  10.760  1.00 240.48 ? 416 PHE D CD1 1 
ATOM   7599  C CD2 . PHE D 2 416 ? 172.001 -44.732  10.567  1.00 242.83 ? 416 PHE D CD2 1 
ATOM   7600  C CE1 . PHE D 2 416 ? 169.236 -44.899  10.642  1.00 242.16 ? 416 PHE D CE1 1 
ATOM   7601  C CE2 . PHE D 2 416 ? 171.234 -43.582  10.448  1.00 244.07 ? 416 PHE D CE2 1 
ATOM   7602  C CZ  . PHE D 2 416 ? 169.850 -43.665  10.487  1.00 243.78 ? 416 PHE D CZ  1 
ATOM   7603  N N   . ALA D 2 417 ? 173.986 -46.554  8.392   1.00 219.03 ? 417 ALA D N   1 
ATOM   7604  C CA  . ALA D 2 417 ? 174.435 -45.588  7.384   1.00 213.44 ? 417 ALA D CA  1 
ATOM   7605  C C   . ALA D 2 417 ? 174.379 -46.158  5.967   1.00 214.72 ? 417 ALA D C   1 
ATOM   7606  O O   . ALA D 2 417 ? 174.117 -45.425  5.011   1.00 209.39 ? 417 ALA D O   1 
ATOM   7607  C CB  . ALA D 2 417 ? 175.833 -45.083  7.706   1.00 210.34 ? 417 ALA D CB  1 
ATOM   7608  N N   . GLY D 2 418 ? 174.636 -47.460  5.847   1.00 222.52 ? 418 GLY D N   1 
ATOM   7609  C CA  . GLY D 2 418 ? 174.425 -48.190  4.597   1.00 234.83 ? 418 GLY D CA  1 
ATOM   7610  C C   . GLY D 2 418 ? 175.664 -48.687  3.871   1.00 241.07 ? 418 GLY D C   1 
ATOM   7611  O O   . GLY D 2 418 ? 175.661 -48.788  2.640   1.00 240.72 ? 418 GLY D O   1 
ATOM   7612  N N   . VAL D 2 419 ? 176.718 -49.008  4.620   1.00 241.91 ? 419 VAL D N   1 
ATOM   7613  C CA  . VAL D 2 419 ? 177.980 -49.470  4.022   1.00 241.90 ? 419 VAL D CA  1 
ATOM   7614  C C   . VAL D 2 419 ? 178.466 -50.811  4.577   1.00 235.87 ? 419 VAL D C   1 
ATOM   7615  O O   . VAL D 2 419 ? 178.278 -51.110  5.760   1.00 236.92 ? 419 VAL D O   1 
ATOM   7616  C CB  . VAL D 2 419 ? 179.117 -48.420  4.156   1.00 245.20 ? 419 VAL D CB  1 
ATOM   7617  C CG1 . VAL D 2 419 ? 178.945 -47.299  3.140   1.00 245.65 ? 419 VAL D CG1 1 
ATOM   7618  C CG2 . VAL D 2 419 ? 179.200 -47.866  5.575   1.00 246.89 ? 419 VAL D CG2 1 
ATOM   7619  N N   . GLU D 2 420 ? 179.086 -51.613  3.712   1.00 227.02 ? 420 GLU D N   1 
ATOM   7620  C CA  . GLU D 2 420 ? 179.783 -52.825  4.142   1.00 218.83 ? 420 GLU D CA  1 
ATOM   7621  C C   . GLU D 2 420 ? 181.046 -52.441  4.907   1.00 214.03 ? 420 GLU D C   1 
ATOM   7622  O O   . GLU D 2 420 ? 181.639 -51.388  4.654   1.00 215.07 ? 420 GLU D O   1 
ATOM   7623  C CB  . GLU D 2 420 ? 180.130 -53.723  2.951   1.00 217.58 ? 420 GLU D CB  1 
ATOM   7624  C CG  . GLU D 2 420 ? 178.965 -54.563  2.448   1.00 213.67 ? 420 GLU D CG  1 
ATOM   7625  C CD  . GLU D 2 420 ? 179.398 -55.753  1.611   1.00 212.20 ? 420 GLU D CD  1 
ATOM   7626  O OE1 . GLU D 2 420 ? 180.116 -55.560  0.607   1.00 213.30 ? 420 GLU D OE1 1 
ATOM   7627  O OE2 . GLU D 2 420 ? 179.006 -56.889  1.954   1.00 209.67 ? 420 GLU D OE2 1 
ATOM   7628  N N   . ASN D 2 421 ? 181.450 -53.294  5.843   1.00 205.72 ? 421 ASN D N   1 
ATOM   7629  C CA  . ASN D 2 421 ? 182.583 -52.992  6.709   1.00 198.52 ? 421 ASN D CA  1 
ATOM   7630  C C   . ASN D 2 421 ? 183.895 -53.566  6.192   1.00 199.06 ? 421 ASN D C   1 
ATOM   7631  O O   . ASN D 2 421 ? 184.001 -54.769  5.945   1.00 200.05 ? 421 ASN D O   1 
ATOM   7632  C CB  . ASN D 2 421 ? 182.313 -53.493  8.125   1.00 191.79 ? 421 ASN D CB  1 
ATOM   7633  C CG  . ASN D 2 421 ? 183.064 -52.705  9.177   1.00 188.13 ? 421 ASN D CG  1 
ATOM   7634  O OD1 . ASN D 2 421 ? 184.170 -52.214  8.941   1.00 184.35 ? 421 ASN D OD1 1 
ATOM   7635  N ND2 . ASN D 2 421 ? 182.465 -52.581  10.353  1.00 188.24 ? 421 ASN D ND2 1 
ATOM   7636  N N   . GLU D 2 422 ? 184.893 -52.696  6.040   1.00 200.31 ? 422 GLU D N   1 
ATOM   7637  C CA  . GLU D 2 422 ? 186.219 -53.110  5.576   1.00 202.05 ? 422 GLU D CA  1 
ATOM   7638  C C   . GLU D 2 422 ? 187.091 -53.653  6.711   1.00 198.44 ? 422 GLU D C   1 
ATOM   7639  O O   . GLU D 2 422 ? 188.232 -54.068  6.484   1.00 202.23 ? 422 GLU D O   1 
ATOM   7640  C CB  . GLU D 2 422 ? 186.929 -51.978  4.813   1.00 207.60 ? 422 GLU D CB  1 
ATOM   7641  C CG  . GLU D 2 422 ? 187.395 -50.801  5.661   1.00 213.17 ? 422 GLU D CG  1 
ATOM   7642  C CD  . GLU D 2 422 ? 188.330 -49.863  4.911   1.00 216.96 ? 422 GLU D CD  1 
ATOM   7643  O OE1 . GLU D 2 422 ? 189.093 -50.333  4.035   1.00 216.71 ? 422 GLU D OE1 1 
ATOM   7644  O OE2 . GLU D 2 422 ? 188.310 -48.649  5.206   1.00 219.76 ? 422 GLU D OE2 1 
ATOM   7645  N N   . LEU D 2 423 ? 186.550 -53.644  7.928   1.00 190.61 ? 423 LEU D N   1 
ATOM   7646  C CA  . LEU D 2 423 ? 187.196 -54.295  9.061   1.00 186.21 ? 423 LEU D CA  1 
ATOM   7647  C C   . LEU D 2 423 ? 187.085 -55.812  8.932   1.00 191.28 ? 423 LEU D C   1 
ATOM   7648  O O   . LEU D 2 423 ? 188.004 -56.535  9.314   1.00 190.98 ? 423 LEU D O   1 
ATOM   7649  C CB  . LEU D 2 423 ? 186.583 -53.831  10.385  1.00 178.05 ? 423 LEU D CB  1 
ATOM   7650  C CG  . LEU D 2 423 ? 187.023 -54.585  11.643  1.00 173.95 ? 423 LEU D CG  1 
ATOM   7651  C CD1 . LEU D 2 423 ? 188.403 -54.146  12.112  1.00 171.14 ? 423 LEU D CD1 1 
ATOM   7652  C CD2 . LEU D 2 423 ? 185.992 -54.433  12.748  1.00 174.59 ? 423 LEU D CD2 1 
ATOM   7653  N N   . PHE D 2 424 ? 185.963 -56.277  8.382   1.00 199.15 ? 424 PHE D N   1 
ATOM   7654  C CA  . PHE D 2 424 ? 185.705 -57.709  8.191   1.00 209.65 ? 424 PHE D CA  1 
ATOM   7655  C C   . PHE D 2 424 ? 186.773 -58.407  7.335   1.00 223.55 ? 424 PHE D C   1 
ATOM   7656  O O   . PHE D 2 424 ? 187.086 -59.578  7.565   1.00 228.45 ? 424 PHE D O   1 
ATOM   7657  C CB  . PHE D 2 424 ? 184.327 -57.947  7.549   1.00 202.02 ? 424 PHE D CB  1 
ATOM   7658  C CG  . PHE D 2 424 ? 183.157 -57.415  8.341   1.00 194.80 ? 424 PHE D CG  1 
ATOM   7659  C CD1 . PHE D 2 424 ? 183.250 -57.176  9.710   1.00 193.27 ? 424 PHE D CD1 1 
ATOM   7660  C CD2 . PHE D 2 424 ? 181.936 -57.193  7.709   1.00 191.35 ? 424 PHE D CD2 1 
ATOM   7661  C CE1 . PHE D 2 424 ? 182.159 -56.697  10.421  1.00 192.22 ? 424 PHE D CE1 1 
ATOM   7662  C CE2 . PHE D 2 424 ? 180.842 -56.721  8.415   1.00 189.84 ? 424 PHE D CE2 1 
ATOM   7663  C CZ  . PHE D 2 424 ? 180.955 -56.471  9.773   1.00 190.67 ? 424 PHE D CZ  1 
ATOM   7664  N N   . TYR D 2 425 ? 187.326 -57.677  6.362   1.00 236.17 ? 425 TYR D N   1 
ATOM   7665  C CA  . TYR D 2 425 ? 188.212 -58.240  5.328   1.00 241.51 ? 425 TYR D CA  1 
ATOM   7666  C C   . TYR D 2 425 ? 189.720 -58.196  5.642   1.00 232.42 ? 425 TYR D C   1 
ATOM   7667  O O   . TYR D 2 425 ? 190.508 -58.893  4.993   1.00 229.31 ? 425 TYR D O   1 
ATOM   7668  C CB  . TYR D 2 425 ? 187.957 -57.558  3.972   1.00 252.52 ? 425 TYR D CB  1 
ATOM   7669  C CG  . TYR D 2 425 ? 186.585 -57.802  3.360   1.00 254.80 ? 425 TYR D CG  1 
ATOM   7670  C CD1 . TYR D 2 425 ? 185.494 -56.999  3.698   1.00 255.34 ? 425 TYR D CD1 1 
ATOM   7671  C CD2 . TYR D 2 425 ? 186.386 -58.817  2.422   1.00 258.02 ? 425 TYR D CD2 1 
ATOM   7672  C CE1 . TYR D 2 425 ? 184.242 -57.212  3.135   1.00 255.48 ? 425 TYR D CE1 1 
ATOM   7673  C CE2 . TYR D 2 425 ? 185.139 -59.036  1.852   1.00 257.00 ? 425 TYR D CE2 1 
ATOM   7674  C CZ  . TYR D 2 425 ? 184.071 -58.232  2.212   1.00 256.47 ? 425 TYR D CZ  1 
ATOM   7675  O OH  . TYR D 2 425 ? 182.831 -58.444  1.652   1.00 255.96 ? 425 TYR D OH  1 
ATOM   7676  N N   . ALA D 2 426 ? 190.116 -57.377  6.618   1.00 220.67 ? 426 ALA D N   1 
ATOM   7677  C CA  . ALA D 2 426 ? 191.529 -57.224  6.992   1.00 208.42 ? 426 ALA D CA  1 
ATOM   7678  C C   . ALA D 2 426 ? 192.145 -58.543  7.455   1.00 204.56 ? 426 ALA D C   1 
ATOM   7679  O O   . ALA D 2 426 ? 191.440 -59.420  7.961   1.00 203.87 ? 426 ALA D O   1 
ATOM   7680  C CB  . ALA D 2 426 ? 191.685 -56.157  8.068   1.00 205.10 ? 426 ALA D CB  1 
ATOM   7681  N N   . GLU D 2 427 ? 193.459 -58.672  7.281   1.00 203.13 ? 427 GLU D N   1 
ATOM   7682  C CA  . GLU D 2 427 ? 194.186 -59.896  7.644   1.00 206.28 ? 427 GLU D CA  1 
ATOM   7683  C C   . GLU D 2 427 ? 194.068 -60.290  9.122   1.00 201.60 ? 427 GLU D C   1 
ATOM   7684  O O   . GLU D 2 427 ? 194.233 -61.462  9.467   1.00 206.06 ? 427 GLU D O   1 
ATOM   7685  C CB  . GLU D 2 427 ? 195.665 -59.789  7.244   1.00 214.08 ? 427 GLU D CB  1 
ATOM   7686  C CG  . GLU D 2 427 ? 196.050 -60.568  5.987   1.00 219.10 ? 427 GLU D CG  1 
ATOM   7687  C CD  . GLU D 2 427 ? 196.679 -61.928  6.278   1.00 221.17 ? 427 GLU D CD  1 
ATOM   7688  O OE1 . GLU D 2 427 ? 196.244 -62.930  5.667   1.00 220.95 ? 427 GLU D OE1 1 
ATOM   7689  O OE2 . GLU D 2 427 ? 197.618 -62.000  7.104   1.00 223.22 ? 427 GLU D OE2 1 
ATOM   7690  N N   . ASN D 2 428 ? 193.774 -59.318  9.984   1.00 191.27 ? 428 ASN D N   1 
ATOM   7691  C CA  . ASN D 2 428 ? 193.713 -59.556  11.429  1.00 182.25 ? 428 ASN D CA  1 
ATOM   7692  C C   . ASN D 2 428 ? 192.330 -59.925  11.983  1.00 176.76 ? 428 ASN D C   1 
ATOM   7693  O O   . ASN D 2 428 ? 192.231 -60.524  13.058  1.00 178.63 ? 428 ASN D O   1 
ATOM   7694  C CB  . ASN D 2 428 ? 194.284 -58.352  12.190  1.00 179.72 ? 428 ASN D CB  1 
ATOM   7695  C CG  . ASN D 2 428 ? 195.801 -58.287  12.132  1.00 177.06 ? 428 ASN D CG  1 
ATOM   7696  O OD1 . ASN D 2 428 ? 196.495 -59.181  12.622  1.00 175.71 ? 428 ASN D OD1 1 
ATOM   7697  N ND2 . ASN D 2 428 ? 196.322 -57.216  11.544  1.00 174.12 ? 428 ASN D ND2 1 
ATOM   7698  N N   . THR D 2 429 ? 191.273 -59.582  11.249  1.00 167.58 ? 429 THR D N   1 
ATOM   7699  C CA  . THR D 2 429 ? 189.900 -59.775  11.724  1.00 157.90 ? 429 THR D CA  1 
ATOM   7700  C C   . THR D 2 429 ? 189.287 -61.094  11.253  1.00 150.80 ? 429 THR D C   1 
ATOM   7701  O O   . THR D 2 429 ? 189.486 -61.514  10.112  1.00 148.79 ? 429 THR D O   1 
ATOM   7702  C CB  . THR D 2 429 ? 188.995 -58.602  11.292  1.00 158.28 ? 429 THR D CB  1 
ATOM   7703  O OG1 . THR D 2 429 ? 189.566 -57.364  11.736  1.00 158.64 ? 429 THR D OG1 1 
ATOM   7704  C CG2 . THR D 2 429 ? 187.589 -58.739  11.868  1.00 157.22 ? 429 THR D CG2 1 
ATOM   7705  N N   . ARG D 2 430 ? 188.544 -61.738  12.149  1.00 144.52 ? 430 ARG D N   1 
ATOM   7706  C CA  . ARG D 2 430 ? 187.800 -62.947  11.819  1.00 141.43 ? 430 ARG D CA  1 
ATOM   7707  C C   . ARG D 2 430 ? 186.351 -62.847  12.288  1.00 138.07 ? 430 ARG D C   1 
ATOM   7708  O O   . ARG D 2 430 ? 186.051 -62.181  13.281  1.00 135.24 ? 430 ARG D O   1 
ATOM   7709  C CB  . ARG D 2 430 ? 188.488 -64.181  12.401  1.00 144.78 ? 430 ARG D CB  1 
ATOM   7710  C CG  . ARG D 2 430 ? 189.735 -64.590  11.633  1.00 149.24 ? 430 ARG D CG  1 
ATOM   7711  C CD  . ARG D 2 430 ? 190.494 -65.701  12.336  1.00 154.43 ? 430 ARG D CD  1 
ATOM   7712  N NE  . ARG D 2 430 ? 191.759 -66.001  11.668  1.00 159.14 ? 430 ARG D NE  1 
ATOM   7713  C CZ  . ARG D 2 430 ? 192.909 -65.373  11.908  1.00 161.93 ? 430 ARG D CZ  1 
ATOM   7714  N NH1 . ARG D 2 430 ? 192.973 -64.398  12.808  1.00 163.37 ? 430 ARG D NH1 1 
ATOM   7715  N NH2 . ARG D 2 430 ? 194.003 -65.724  11.246  1.00 164.41 ? 430 ARG D NH2 1 
ATOM   7716  N N   . MET D 2 431 ? 185.464 -63.517  11.557  1.00 137.01 ? 431 MET D N   1 
ATOM   7717  C CA  . MET D 2 431 ? 184.021 -63.428  11.779  1.00 138.64 ? 431 MET D CA  1 
ATOM   7718  C C   . MET D 2 431 ? 183.489 -64.627  12.563  1.00 145.69 ? 431 MET D C   1 
ATOM   7719  O O   . MET D 2 431 ? 184.013 -65.734  12.442  1.00 148.19 ? 431 MET D O   1 
ATOM   7720  C CB  . MET D 2 431 ? 183.294 -63.341  10.434  1.00 132.88 ? 431 MET D CB  1 
ATOM   7721  C CG  . MET D 2 431 ? 183.853 -62.298  9.479   1.00 127.61 ? 431 MET D CG  1 
ATOM   7722  S SD  . MET D 2 431 ? 183.285 -60.636  9.865   1.00 123.72 ? 431 MET D SD  1 
ATOM   7723  C CE  . MET D 2 431 ? 181.659 -60.656  9.114   1.00 122.59 ? 431 MET D CE  1 
ATOM   7724  N N   . LEU D 2 432 ? 182.444 -64.398  13.358  1.00 153.46 ? 432 LEU D N   1 
ATOM   7725  C CA  . LEU D 2 432 ? 181.773 -65.462  14.108  1.00 161.89 ? 432 LEU D CA  1 
ATOM   7726  C C   . LEU D 2 432 ? 180.272 -65.434  13.798  1.00 169.77 ? 432 LEU D C   1 
ATOM   7727  O O   . LEU D 2 432 ? 179.545 -64.569  14.296  1.00 171.32 ? 432 LEU D O   1 
ATOM   7728  C CB  . LEU D 2 432 ? 182.020 -65.295  15.616  1.00 160.63 ? 432 LEU D CB  1 
ATOM   7729  C CG  . LEU D 2 432 ? 182.226 -66.531  16.502  1.00 160.65 ? 432 LEU D CG  1 
ATOM   7730  C CD1 . LEU D 2 432 ? 182.631 -66.113  17.909  1.00 160.81 ? 432 LEU D CD1 1 
ATOM   7731  C CD2 . LEU D 2 432 ? 181.001 -67.434  16.545  1.00 160.68 ? 432 LEU D CD2 1 
ATOM   7732  N N   . TYR D 2 433 ? 179.819 -66.382  12.975  1.00 179.07 ? 433 TYR D N   1 
ATOM   7733  C CA  . TYR D 2 433 ? 178.430 -66.406  12.490  1.00 185.93 ? 433 TYR D CA  1 
ATOM   7734  C C   . TYR D 2 433 ? 177.429 -67.043  13.456  1.00 187.84 ? 433 TYR D C   1 
ATOM   7735  O O   . TYR D 2 433 ? 177.681 -68.116  14.012  1.00 189.31 ? 433 TYR D O   1 
ATOM   7736  C CB  . TYR D 2 433 ? 178.330 -67.078  11.109  1.00 187.82 ? 433 TYR D CB  1 
ATOM   7737  C CG  . TYR D 2 433 ? 178.802 -66.218  9.951   1.00 189.39 ? 433 TYR D CG  1 
ATOM   7738  C CD1 . TYR D 2 433 ? 178.502 -64.856  9.898   1.00 190.51 ? 433 TYR D CD1 1 
ATOM   7739  C CD2 . TYR D 2 433 ? 179.527 -66.771  8.896   1.00 189.05 ? 433 TYR D CD2 1 
ATOM   7740  C CE1 . TYR D 2 433 ? 178.930 -64.067  8.844   1.00 189.85 ? 433 TYR D CE1 1 
ATOM   7741  C CE2 . TYR D 2 433 ? 179.954 -65.989  7.833   1.00 188.95 ? 433 TYR D CE2 1 
ATOM   7742  C CZ  . TYR D 2 433 ? 179.651 -64.639  7.815   1.00 189.16 ? 433 TYR D CZ  1 
ATOM   7743  O OH  . TYR D 2 433 ? 180.069 -63.855  6.772   1.00 188.61 ? 433 TYR D OH  1 
ATOM   7744  N N   . GLY D 2 434 ? 176.290 -66.373  13.637  1.00 188.39 ? 434 GLY D N   1 
ATOM   7745  C CA  . GLY D 2 434 ? 175.194 -66.891  14.457  1.00 184.66 ? 434 GLY D CA  1 
ATOM   7746  C C   . GLY D 2 434 ? 174.462 -65.850  15.289  1.00 180.07 ? 434 GLY D C   1 
ATOM   7747  O O   . GLY D 2 434 ? 174.898 -64.699  15.392  1.00 181.69 ? 434 GLY D O   1 
ATOM   7748  N N   . ASP D 2 435 ? 173.341 -66.268  15.876  1.00 173.20 ? 435 ASP D N   1 
ATOM   7749  C CA  . ASP D 2 435 ? 172.565 -65.442  16.801  1.00 165.03 ? 435 ASP D CA  1 
ATOM   7750  C C   . ASP D 2 435 ? 173.440 -65.065  17.997  1.00 163.78 ? 435 ASP D C   1 
ATOM   7751  O O   . ASP D 2 435 ? 174.171 -65.905  18.526  1.00 162.69 ? 435 ASP D O   1 
ATOM   7752  C CB  . ASP D 2 435 ? 171.313 -66.197  17.257  1.00 160.12 ? 435 ASP D CB  1 
ATOM   7753  C CG  . ASP D 2 435 ? 170.226 -65.277  17.787  1.00 155.64 ? 435 ASP D CG  1 
ATOM   7754  O OD1 . ASP D 2 435 ? 169.885 -64.285  17.105  1.00 152.65 ? 435 ASP D OD1 1 
ATOM   7755  O OD2 . ASP D 2 435 ? 169.697 -65.559  18.883  1.00 154.76 ? 435 ASP D OD2 1 
ATOM   7756  N N   . ALA D 2 436 ? 173.355 -63.801  18.409  1.00 162.41 ? 436 ALA D N   1 
ATOM   7757  C CA  . ALA D 2 436 ? 174.295 -63.198  19.364  1.00 162.57 ? 436 ALA D CA  1 
ATOM   7758  C C   . ALA D 2 436 ? 174.530 -63.987  20.655  1.00 164.06 ? 436 ALA D C   1 
ATOM   7759  O O   . ALA D 2 436 ? 175.675 -64.316  20.975  1.00 164.18 ? 436 ALA D O   1 
ATOM   7760  C CB  . ALA D 2 436 ? 173.882 -61.766  19.677  1.00 160.74 ? 436 ALA D CB  1 
ATOM   7761  N N   . GLN D 2 437 ? 173.457 -64.290  21.387  1.00 166.10 ? 437 GLN D N   1 
ATOM   7762  C CA  . GLN D 2 437 ? 173.577 -65.038  22.647  1.00 164.81 ? 437 GLN D CA  1 
ATOM   7763  C C   . GLN D 2 437 ? 173.733 -66.546  22.428  1.00 157.65 ? 437 GLN D C   1 
ATOM   7764  O O   . GLN D 2 437 ? 174.190 -67.262  23.322  1.00 159.99 ? 437 GLN D O   1 
ATOM   7765  C CB  . GLN D 2 437 ? 172.435 -64.705  23.630  1.00 170.61 ? 437 GLN D CB  1 
ATOM   7766  C CG  . GLN D 2 437 ? 171.102 -65.405  23.399  1.00 174.78 ? 437 GLN D CG  1 
ATOM   7767  C CD  . GLN D 2 437 ? 170.086 -65.090  24.488  1.00 175.78 ? 437 GLN D CD  1 
ATOM   7768  O OE1 . GLN D 2 437 ? 169.427 -64.049  24.459  1.00 174.89 ? 437 GLN D OE1 1 
ATOM   7769  N NE2 . GLN D 2 437 ? 169.949 -65.995  25.450  1.00 176.73 ? 437 GLN D NE2 1 
ATOM   7770  N N   . LYS D 2 438 ? 173.361 -67.016  21.237  1.00 145.51 ? 438 LYS D N   1 
ATOM   7771  C CA  . LYS D 2 438 ? 173.612 -68.397  20.820  1.00 132.77 ? 438 LYS D CA  1 
ATOM   7772  C C   . LYS D 2 438 ? 175.103 -68.591  20.506  1.00 129.49 ? 438 LYS D C   1 
ATOM   7773  O O   . LYS D 2 438 ? 175.608 -69.715  20.514  1.00 129.91 ? 438 LYS D O   1 
ATOM   7774  C CB  . LYS D 2 438 ? 172.734 -68.757  19.612  1.00 125.67 ? 438 LYS D CB  1 
ATOM   7775  C CG  . LYS D 2 438 ? 172.864 -70.189  19.113  1.00 118.29 ? 438 LYS D CG  1 
ATOM   7776  C CD  . LYS D 2 438 ? 172.088 -70.393  17.822  1.00 114.19 ? 438 LYS D CD  1 
ATOM   7777  C CE  . LYS D 2 438 ? 172.765 -71.404  16.908  1.00 111.45 ? 438 LYS D CE  1 
ATOM   7778  N NZ  . LYS D 2 438 ? 172.742 -72.795  17.440  1.00 109.65 ? 438 LYS D NZ  1 
ATOM   7779  N N   . VAL D 2 439 ? 175.796 -67.485  20.240  1.00 124.46 ? 439 VAL D N   1 
ATOM   7780  C CA  . VAL D 2 439 ? 177.239 -67.486  19.990  1.00 120.11 ? 439 VAL D CA  1 
ATOM   7781  C C   . VAL D 2 439 ? 178.040 -67.424  21.294  1.00 120.10 ? 439 VAL D C   1 
ATOM   7782  O O   . VAL D 2 439 ? 178.979 -68.200  21.492  1.00 118.29 ? 439 VAL D O   1 
ATOM   7783  C CB  . VAL D 2 439 ? 177.644 -66.317  19.059  1.00 117.81 ? 439 VAL D CB  1 
ATOM   7784  C CG1 . VAL D 2 439 ? 179.120 -65.973  19.207  1.00 116.27 ? 439 VAL D CG1 1 
ATOM   7785  C CG2 . VAL D 2 439 ? 177.315 -66.647  17.612  1.00 117.16 ? 439 VAL D CG2 1 
ATOM   7786  N N   . LEU D 2 440 ? 177.658 -66.500  22.174  1.00 122.37 ? 440 LEU D N   1 
ATOM   7787  C CA  . LEU D 2 440 ? 178.390 -66.245  23.414  1.00 125.56 ? 440 LEU D CA  1 
ATOM   7788  C C   . LEU D 2 440 ? 178.319 -67.403  24.401  1.00 127.03 ? 440 LEU D C   1 
ATOM   7789  O O   . LEU D 2 440 ? 179.310 -67.715  25.058  1.00 126.65 ? 440 LEU D O   1 
ATOM   7790  C CB  . LEU D 2 440 ? 177.899 -64.955  24.077  1.00 127.41 ? 440 LEU D CB  1 
ATOM   7791  C CG  . LEU D 2 440 ? 178.218 -63.627  23.381  1.00 129.15 ? 440 LEU D CG  1 
ATOM   7792  C CD1 . LEU D 2 440 ? 177.407 -62.499  24.002  1.00 130.19 ? 440 LEU D CD1 1 
ATOM   7793  C CD2 . LEU D 2 440 ? 179.707 -63.309  23.428  1.00 129.90 ? 440 LEU D CD2 1 
ATOM   7794  N N   . THR D 2 441 ? 177.149 -68.033  24.500  1.00 130.26 ? 441 THR D N   1 
ATOM   7795  C CA  . THR D 2 441 ? 176.972 -69.223  25.335  1.00 134.14 ? 441 THR D CA  1 
ATOM   7796  C C   . THR D 2 441 ? 177.853 -70.361  24.814  1.00 136.25 ? 441 THR D C   1 
ATOM   7797  O O   . THR D 2 441 ? 178.411 -71.131  25.598  1.00 136.83 ? 441 THR D O   1 
ATOM   7798  C CB  . THR D 2 441 ? 175.497 -69.679  25.388  1.00 135.13 ? 441 THR D CB  1 
ATOM   7799  O OG1 . THR D 2 441 ? 174.646 -68.540  25.561  1.00 136.11 ? 441 THR D OG1 1 
ATOM   7800  C CG2 . THR D 2 441 ? 175.266 -70.655  26.541  1.00 135.24 ? 441 THR D CG2 1 
ATOM   7801  N N   . GLU D 2 442 ? 177.979 -70.448  23.489  1.00 139.33 ? 442 GLU D N   1 
ATOM   7802  C CA  . GLU D 2 442 ? 178.883 -71.403  22.849  1.00 142.18 ? 442 GLU D CA  1 
ATOM   7803  C C   . GLU D 2 442 ? 180.349 -71.032  23.079  1.00 142.51 ? 442 GLU D C   1 
ATOM   7804  O O   . GLU D 2 442 ? 181.215 -71.906  23.087  1.00 141.47 ? 442 GLU D O   1 
ATOM   7805  C CB  . GLU D 2 442 ? 178.586 -71.527  21.349  1.00 145.35 ? 442 GLU D CB  1 
ATOM   7806  C CG  . GLU D 2 442 ? 177.452 -72.488  21.009  1.00 149.53 ? 442 GLU D CG  1 
ATOM   7807  C CD  . GLU D 2 442 ? 177.147 -72.574  19.518  1.00 151.57 ? 442 GLU D CD  1 
ATOM   7808  O OE1 . GLU D 2 442 ? 177.747 -71.818  18.724  1.00 153.16 ? 442 GLU D OE1 1 
ATOM   7809  O OE2 . GLU D 2 442 ? 176.294 -73.405  19.133  1.00 152.30 ? 442 GLU D OE2 1 
ATOM   7810  N N   . LEU D 2 443 ? 180.615 -69.738  23.265  1.00 144.19 ? 443 LEU D N   1 
ATOM   7811  C CA  . LEU D 2 443 ? 181.955 -69.254  23.614  1.00 147.55 ? 443 LEU D CA  1 
ATOM   7812  C C   . LEU D 2 443 ? 182.322 -69.569  25.060  1.00 152.98 ? 443 LEU D C   1 
ATOM   7813  O O   . LEU D 2 443 ? 183.449 -69.982  25.339  1.00 154.23 ? 443 LEU D O   1 
ATOM   7814  C CB  . LEU D 2 443 ? 182.086 -67.747  23.367  1.00 143.90 ? 443 LEU D CB  1 
ATOM   7815  C CG  . LEU D 2 443 ? 182.725 -67.266  22.061  1.00 142.17 ? 443 LEU D CG  1 
ATOM   7816  C CD1 . LEU D 2 443 ? 182.703 -65.745  22.008  1.00 140.41 ? 443 LEU D CD1 1 
ATOM   7817  C CD2 . LEU D 2 443 ? 184.155 -67.777  21.938  1.00 142.16 ? 443 LEU D CD2 1 
ATOM   7818  N N   . ILE D 2 444 ? 181.370 -69.360  25.969  1.00 159.47 ? 444 ILE D N   1 
ATOM   7819  C CA  . ILE D 2 444 ? 181.564 -69.633  27.395  1.00 166.15 ? 444 ILE D CA  1 
ATOM   7820  C C   . ILE D 2 444 ? 181.792 -71.126  27.635  1.00 168.57 ? 444 ILE D C   1 
ATOM   7821  O O   . ILE D 2 444 ? 182.784 -71.515  28.254  1.00 170.35 ? 444 ILE D O   1 
ATOM   7822  C CB  . ILE D 2 444 ? 180.368 -69.136  28.247  1.00 168.02 ? 444 ILE D CB  1 
ATOM   7823  C CG1 . ILE D 2 444 ? 180.168 -67.626  28.075  1.00 169.33 ? 444 ILE D CG1 1 
ATOM   7824  C CG2 . ILE D 2 444 ? 180.577 -69.469  29.721  1.00 168.91 ? 444 ILE D CG2 1 
ATOM   7825  C CD1 . ILE D 2 444 ? 178.759 -67.145  28.365  1.00 169.67 ? 444 ILE D CD1 1 
ATOM   7826  N N   . GLN D 2 445 ? 180.878 -71.949  27.120  1.00 170.35 ? 445 GLN D N   1 
ATOM   7827  C CA  . GLN D 2 445 ? 180.906 -73.398  27.338  1.00 169.73 ? 445 GLN D CA  1 
ATOM   7828  C C   . GLN D 2 445 ? 182.076 -74.102  26.637  1.00 164.60 ? 445 GLN D C   1 
ATOM   7829  O O   . GLN D 2 445 ? 182.488 -75.184  27.054  1.00 163.76 ? 445 GLN D O   1 
ATOM   7830  C CB  . GLN D 2 445 ? 179.555 -74.029  26.962  1.00 174.81 ? 445 GLN D CB  1 
ATOM   7831  C CG  . GLN D 2 445 ? 178.425 -73.683  27.934  1.00 178.39 ? 445 GLN D CG  1 
ATOM   7832  C CD  . GLN D 2 445 ? 177.045 -74.128  27.466  1.00 179.88 ? 445 GLN D CD  1 
ATOM   7833  O OE1 . GLN D 2 445 ? 176.894 -74.741  26.408  1.00 183.08 ? 445 GLN D OE1 1 
ATOM   7834  N NE2 . GLN D 2 445 ? 176.025 -73.815  28.262  1.00 177.62 ? 445 GLN D NE2 1 
ATOM   7835  N N   . ALA D 2 446 ? 182.611 -73.483  25.585  1.00 159.13 ? 446 ALA D N   1 
ATOM   7836  C CA  . ALA D 2 446 ? 183.825 -73.980  24.937  1.00 155.83 ? 446 ALA D CA  1 
ATOM   7837  C C   . ALA D 2 446 ? 185.072 -73.544  25.702  1.00 156.04 ? 446 ALA D C   1 
ATOM   7838  O O   . ALA D 2 446 ? 186.056 -74.282  25.764  1.00 151.30 ? 446 ALA D O   1 
ATOM   7839  C CB  . ALA D 2 446 ? 183.895 -73.518  23.491  1.00 154.70 ? 446 ALA D CB  1 
ATOM   7840  N N   . LEU D 2 447 ? 185.019 -72.343  26.279  1.00 161.93 ? 447 LEU D N   1 
ATOM   7841  C CA  . LEU D 2 447 ? 186.105 -71.817  27.108  1.00 170.81 ? 447 LEU D CA  1 
ATOM   7842  C C   . LEU D 2 447 ? 186.148 -72.551  28.447  1.00 180.63 ? 447 LEU D C   1 
ATOM   7843  O O   . LEU D 2 447 ? 187.220 -72.726  29.030  1.00 182.29 ? 447 LEU D O   1 
ATOM   7844  C CB  . LEU D 2 447 ? 185.932 -70.312  27.337  1.00 168.68 ? 447 LEU D CB  1 
ATOM   7845  C CG  . LEU D 2 447 ? 187.162 -69.393  27.341  1.00 167.83 ? 447 LEU D CG  1 
ATOM   7846  C CD1 . LEU D 2 447 ? 186.714 -67.942  27.298  1.00 167.30 ? 447 LEU D CD1 1 
ATOM   7847  C CD2 . LEU D 2 447 ? 188.079 -69.622  28.534  1.00 167.91 ? 447 LEU D CD2 1 
ATOM   7848  N N   . LYS D 2 448 ? 184.975 -72.971  28.923  1.00 194.31 ? 448 LYS D N   1 
ATOM   7849  C CA  . LYS D 2 448 ? 184.853 -73.798  30.127  1.00 208.92 ? 448 LYS D CA  1 
ATOM   7850  C C   . LYS D 2 448 ? 185.491 -75.175  29.929  1.00 216.93 ? 448 LYS D C   1 
ATOM   7851  O O   . LYS D 2 448 ? 185.867 -75.840  30.897  1.00 225.45 ? 448 LYS D O   1 
ATOM   7852  C CB  . LYS D 2 448 ? 183.382 -73.972  30.520  1.00 210.63 ? 448 LYS D CB  1 
ATOM   7853  C CG  . LYS D 2 448 ? 182.789 -72.839  31.343  1.00 210.25 ? 448 LYS D CG  1 
ATOM   7854  C CD  . LYS D 2 448 ? 181.377 -73.191  31.787  1.00 209.05 ? 448 LYS D CD  1 
ATOM   7855  C CE  . LYS D 2 448 ? 180.742 -72.080  32.605  1.00 207.61 ? 448 LYS D CE  1 
ATOM   7856  N NZ  . LYS D 2 448 ? 179.346 -72.429  32.993  1.00 205.43 ? 448 LYS D NZ  1 
ATOM   7857  N N   . ARG D 2 449 ? 185.602 -75.589  28.667  1.00 219.54 ? 449 ARG D N   1 
ATOM   7858  C CA  . ARG D 2 449 ? 186.199 -76.873  28.302  1.00 221.89 ? 449 ARG D CA  1 
ATOM   7859  C C   . ARG D 2 449 ? 187.703 -76.757  28.014  1.00 224.22 ? 449 ARG D C   1 
ATOM   7860  O O   . ARG D 2 449 ? 188.303 -77.664  27.427  1.00 226.17 ? 449 ARG D O   1 
ATOM   7861  C CB  . ARG D 2 449 ? 185.458 -77.477  27.099  1.00 220.15 ? 449 ARG D CB  1 
ATOM   7862  C CG  . ARG D 2 449 ? 184.062 -77.997  27.422  1.00 219.83 ? 449 ARG D CG  1 
ATOM   7863  C CD  . ARG D 2 449 ? 183.297 -78.432  26.178  1.00 219.35 ? 449 ARG D CD  1 
ATOM   7864  N NE  . ARG D 2 449 ? 182.847 -77.303  25.360  1.00 215.78 ? 449 ARG D NE  1 
ATOM   7865  C CZ  . ARG D 2 449 ? 181.913 -77.378  24.413  1.00 214.25 ? 449 ARG D CZ  1 
ATOM   7866  N NH1 . ARG D 2 449 ? 181.304 -78.530  24.150  1.00 214.35 ? 449 ARG D NH1 1 
ATOM   7867  N NH2 . ARG D 2 449 ? 181.578 -76.292  23.727  1.00 210.48 ? 449 ARG D NH2 1 
ATOM   7868  N N   . LEU D 2 450 ? 188.305 -75.642  28.435  1.00 225.65 ? 450 LEU D N   1 
ATOM   7869  C CA  . LEU D 2 450 ? 189.731 -75.379  28.204  1.00 225.08 ? 450 LEU D CA  1 
ATOM   7870  C C   . LEU D 2 450 ? 190.429 -74.766  29.422  1.00 225.45 ? 450 LEU D C   1 
ATOM   7871  O O   . LEU D 2 450 ? 189.793 -74.242  30.338  1.00 227.52 ? 450 LEU D O   1 
ATOM   7872  C CB  . LEU D 2 450 ? 189.921 -74.468  26.984  1.00 222.85 ? 450 LEU D CB  1 
ATOM   7873  C CG  . LEU D 2 450 ? 189.395 -74.932  25.619  1.00 220.03 ? 450 LEU D CG  1 
ATOM   7874  C CD1 . LEU D 2 450 ? 189.273 -73.750  24.670  1.00 220.49 ? 450 LEU D CD1 1 
ATOM   7875  C CD2 . LEU D 2 450 ? 190.269 -76.027  25.015  1.00 218.23 ? 450 LEU D CD2 1 
ATOM   7876  N N   . MET E 3 10  ? 253.772 -46.890  38.240  1.00 49.66  ? 1   MET E N   1 
ATOM   7877  C CA  . MET E 3 10  ? 252.917 -47.045  37.027  1.00 50.45  ? 1   MET E CA  1 
ATOM   7878  C C   . MET E 3 10  ? 252.599 -48.523  36.789  1.00 51.21  ? 1   MET E C   1 
ATOM   7879  O O   . MET E 3 10  ? 253.465 -49.301  36.376  1.00 50.64  ? 1   MET E O   1 
ATOM   7880  C CB  . MET E 3 10  ? 253.599 -46.409  35.811  1.00 49.75  ? 1   MET E CB  1 
ATOM   7881  C CG  . MET E 3 10  ? 252.644 -45.973  34.709  1.00 49.43  ? 1   MET E CG  1 
ATOM   7882  S SD  . MET E 3 10  ? 253.306 -44.656  33.660  1.00 49.05  ? 1   MET E SD  1 
ATOM   7883  C CE  . MET E 3 10  ? 252.924 -43.202  34.639  1.00 48.59  ? 1   MET E CE  1 
ATOM   7884  N N   . VAL E 3 11  ? 251.346 -48.889  37.056  1.00 53.13  ? 2   VAL E N   1 
ATOM   7885  C CA  . VAL E 3 11  ? 250.906 -50.289  37.108  1.00 55.30  ? 2   VAL E CA  1 
ATOM   7886  C C   . VAL E 3 11  ? 250.846 -50.985  35.746  1.00 56.99  ? 2   VAL E C   1 
ATOM   7887  O O   . VAL E 3 11  ? 250.798 -50.337  34.697  1.00 56.66  ? 2   VAL E O   1 
ATOM   7888  C CB  . VAL E 3 11  ? 249.540 -50.426  37.842  1.00 55.47  ? 2   VAL E CB  1 
ATOM   7889  C CG1 . VAL E 3 11  ? 248.401 -49.849  37.009  1.00 55.24  ? 2   VAL E CG1 1 
ATOM   7890  C CG2 . VAL E 3 11  ? 249.251 -51.875  38.222  1.00 55.39  ? 2   VAL E CG2 1 
ATOM   7891  N N   . THR E 3 12  ? 250.871 -52.314  35.793  1.00 59.93  ? 3   THR E N   1 
ATOM   7892  C CA  . THR E 3 12  ? 250.644 -53.163  34.636  1.00 62.99  ? 3   THR E CA  1 
ATOM   7893  C C   . THR E 3 12  ? 249.613 -54.236  35.002  1.00 64.56  ? 3   THR E C   1 
ATOM   7894  O O   . THR E 3 12  ? 249.607 -54.753  36.122  1.00 64.42  ? 3   THR E O   1 
ATOM   7895  C CB  . THR E 3 12  ? 251.948 -53.833  34.151  1.00 63.58  ? 3   THR E CB  1 
ATOM   7896  O OG1 . THR E 3 12  ? 252.501 -54.624  35.208  1.00 64.93  ? 3   THR E OG1 1 
ATOM   7897  C CG2 . THR E 3 12  ? 252.980 -52.790  33.721  1.00 63.42  ? 3   THR E CG2 1 
ATOM   7898  N N   . VAL E 3 13  ? 248.734 -54.552  34.058  1.00 66.97  ? 4   VAL E N   1 
ATOM   7899  C CA  . VAL E 3 13  ? 247.698 -55.558  34.274  1.00 69.87  ? 4   VAL E CA  1 
ATOM   7900  C C   . VAL E 3 13  ? 247.620 -56.505  33.078  1.00 73.68  ? 4   VAL E C   1 
ATOM   7901  O O   . VAL E 3 13  ? 247.698 -56.072  31.926  1.00 73.76  ? 4   VAL E O   1 
ATOM   7902  C CB  . VAL E 3 13  ? 246.326 -54.912  34.593  1.00 68.88  ? 4   VAL E CB  1 
ATOM   7903  C CG1 . VAL E 3 13  ? 246.011 -53.778  33.626  1.00 69.00  ? 4   VAL E CG1 1 
ATOM   7904  C CG2 . VAL E 3 13  ? 245.213 -55.949  34.595  1.00 68.84  ? 4   VAL E CG2 1 
ATOM   7905  N N   . ALA E 3 14  ? 247.477 -57.796  33.364  1.00 79.43  ? 5   ALA E N   1 
ATOM   7906  C CA  . ALA E 3 14  ? 247.451 -58.822  32.325  1.00 86.54  ? 5   ALA E CA  1 
ATOM   7907  C C   . ALA E 3 14  ? 246.042 -59.368  32.054  1.00 92.16  ? 5   ALA E C   1 
ATOM   7908  O O   . ALA E 3 14  ? 245.127 -59.172  32.859  1.00 93.96  ? 5   ALA E O   1 
ATOM   7909  C CB  . ALA E 3 14  ? 248.407 -59.951  32.682  1.00 86.31  ? 5   ALA E CB  1 
ATOM   7910  N N   . VAL E 3 15  ? 245.886 -60.035  30.907  1.00 98.21  ? 6   VAL E N   1 
ATOM   7911  C CA  . VAL E 3 15  ? 244.647 -60.740  30.525  1.00 103.53 ? 6   VAL E CA  1 
ATOM   7912  C C   . VAL E 3 15  ? 244.973 -61.943  29.622  1.00 107.78 ? 6   VAL E C   1 
ATOM   7913  O O   . VAL E 3 15  ? 245.592 -61.779  28.567  1.00 106.25 ? 6   VAL E O   1 
ATOM   7914  C CB  . VAL E 3 15  ? 243.595 -59.797  29.876  1.00 103.63 ? 6   VAL E CB  1 
ATOM   7915  C CG1 . VAL E 3 15  ? 244.234 -58.862  28.857  1.00 104.52 ? 6   VAL E CG1 1 
ATOM   7916  C CG2 . VAL E 3 15  ? 242.455 -60.591  29.249  1.00 102.96 ? 6   VAL E CG2 1 
ATOM   7917  N N   . PRO E 3 16  ? 244.562 -63.158  30.039  1.00 113.94 ? 7   PRO E N   1 
ATOM   7918  C CA  . PRO E 3 16  ? 245.017 -64.368  29.374  1.00 121.04 ? 7   PRO E CA  1 
ATOM   7919  C C   . PRO E 3 16  ? 244.013 -65.020  28.422  1.00 131.12 ? 7   PRO E C   1 
ATOM   7920  O O   . PRO E 3 16  ? 242.871 -64.566  28.288  1.00 130.63 ? 7   PRO E O   1 
ATOM   7921  C CB  . PRO E 3 16  ? 245.269 -65.306  30.555  1.00 118.78 ? 7   PRO E CB  1 
ATOM   7922  C CG  . PRO E 3 16  ? 244.238 -64.903  31.565  1.00 116.69 ? 7   PRO E CG  1 
ATOM   7923  C CD  . PRO E 3 16  ? 243.808 -63.487  31.262  1.00 115.22 ? 7   PRO E CD  1 
ATOM   7924  N N   . LYS E 3 17  ? 244.482 -66.083  27.772  1.00 146.19 ? 8   LYS E N   1 
ATOM   7925  C CA  . LYS E 3 17  ? 243.674 -66.987  26.964  1.00 161.43 ? 8   LYS E CA  1 
ATOM   7926  C C   . LYS E 3 17  ? 243.249 -68.146  27.878  1.00 167.61 ? 8   LYS E C   1 
ATOM   7927  O O   . LYS E 3 17  ? 244.100 -68.853  28.425  1.00 172.13 ? 8   LYS E O   1 
ATOM   7928  C CB  . LYS E 3 17  ? 244.525 -67.498  25.791  1.00 166.80 ? 8   LYS E CB  1 
ATOM   7929  C CG  . LYS E 3 17  ? 243.796 -68.245  24.682  1.00 171.02 ? 8   LYS E CG  1 
ATOM   7930  C CD  . LYS E 3 17  ? 244.804 -68.851  23.708  1.00 171.49 ? 8   LYS E CD  1 
ATOM   7931  C CE  . LYS E 3 17  ? 244.139 -69.607  22.567  1.00 171.94 ? 8   LYS E CE  1 
ATOM   7932  N NZ  . LYS E 3 17  ? 243.706 -68.712  21.458  1.00 171.94 ? 8   LYS E NZ  1 
ATOM   7933  N N   . GLU E 3 18  ? 241.940 -68.322  28.056  1.00 171.03 ? 9   GLU E N   1 
ATOM   7934  C CA  . GLU E 3 18  ? 241.401 -69.307  29.010  1.00 173.22 ? 9   GLU E CA  1 
ATOM   7935  C C   . GLU E 3 18  ? 241.515 -70.752  28.521  1.00 177.12 ? 9   GLU E C   1 
ATOM   7936  O O   . GLU E 3 18  ? 241.326 -71.029  27.335  1.00 179.14 ? 9   GLU E O   1 
ATOM   7937  C CB  . GLU E 3 18  ? 239.949 -68.975  29.367  1.00 170.82 ? 9   GLU E CB  1 
ATOM   7938  C CG  . GLU E 3 18  ? 239.770 -67.640  30.078  1.00 169.84 ? 9   GLU E CG  1 
ATOM   7939  C CD  . GLU E 3 18  ? 240.387 -67.611  31.469  1.00 169.54 ? 9   GLU E CD  1 
ATOM   7940  O OE1 . GLU E 3 18  ? 240.999 -66.582  31.824  1.00 170.10 ? 9   GLU E OE1 1 
ATOM   7941  O OE2 . GLU E 3 18  ? 240.263 -68.613  32.206  1.00 168.19 ? 9   GLU E OE2 1 
ATOM   7942  N N   . ARG E 3 19  ? 241.805 -71.667  29.449  1.00 181.03 ? 10  ARG E N   1 
ATOM   7943  C CA  . ARG E 3 19  ? 242.123 -73.064  29.109  1.00 184.20 ? 10  ARG E CA  1 
ATOM   7944  C C   . ARG E 3 19  ? 240.998 -74.091  29.286  1.00 184.38 ? 10  ARG E C   1 
ATOM   7945  O O   . ARG E 3 19  ? 241.025 -75.144  28.643  1.00 185.97 ? 10  ARG E O   1 
ATOM   7946  C CB  . ARG E 3 19  ? 243.375 -73.536  29.859  1.00 186.63 ? 10  ARG E CB  1 
ATOM   7947  C CG  . ARG E 3 19  ? 244.653 -73.424  29.045  1.00 191.03 ? 10  ARG E CG  1 
ATOM   7948  C CD  . ARG E 3 19  ? 245.786 -74.229  29.662  1.00 195.33 ? 10  ARG E CD  1 
ATOM   7949  N NE  . ARG E 3 19  ? 246.868 -74.462  28.704  1.00 200.66 ? 10  ARG E NE  1 
ATOM   7950  C CZ  . ARG E 3 19  ? 248.011 -75.085  28.986  1.00 204.11 ? 10  ARG E CZ  1 
ATOM   7951  N NH1 . ARG E 3 19  ? 248.245 -75.549  30.208  1.00 205.59 ? 10  ARG E NH1 1 
ATOM   7952  N NH2 . ARG E 3 19  ? 248.926 -75.246  28.038  1.00 206.35 ? 10  ARG E NH2 1 
ATOM   7953  N N   . ALA E 3 20  ? 240.030 -73.796  30.154  1.00 183.58 ? 11  ALA E N   1 
ATOM   7954  C CA  . ALA E 3 20  ? 238.907 -74.707  30.418  1.00 180.42 ? 11  ALA E CA  1 
ATOM   7955  C C   . ALA E 3 20  ? 238.186 -75.131  29.125  1.00 173.97 ? 11  ALA E C   1 
ATOM   7956  O O   . ALA E 3 20  ? 237.968 -74.296  28.242  1.00 175.52 ? 11  ALA E O   1 
ATOM   7957  C CB  . ALA E 3 20  ? 237.930 -74.074  31.400  1.00 184.33 ? 11  ALA E CB  1 
ATOM   7958  N N   . PRO E 3 21  ? 237.825 -76.430  29.008  1.00 164.99 ? 12  PRO E N   1 
ATOM   7959  C CA  . PRO E 3 21  ? 237.238 -76.963  27.769  1.00 157.58 ? 12  PRO E CA  1 
ATOM   7960  C C   . PRO E 3 21  ? 235.947 -76.256  27.350  1.00 152.00 ? 12  PRO E C   1 
ATOM   7961  O O   . PRO E 3 21  ? 234.983 -76.217  28.118  1.00 153.48 ? 12  PRO E O   1 
ATOM   7962  C CB  . PRO E 3 21  ? 236.947 -78.431  28.114  1.00 157.16 ? 12  PRO E CB  1 
ATOM   7963  C CG  . PRO E 3 21  ? 237.860 -78.748  29.246  1.00 159.22 ? 12  PRO E CG  1 
ATOM   7964  C CD  . PRO E 3 21  ? 237.959 -77.478  30.038  1.00 162.75 ? 12  PRO E CD  1 
ATOM   7965  N N   . GLY E 3 22  ? 235.949 -75.695  26.142  1.00 144.67 ? 13  GLY E N   1 
ATOM   7966  C CA  . GLY E 3 22  ? 234.754 -75.078  25.560  1.00 137.80 ? 13  GLY E CA  1 
ATOM   7967  C C   . GLY E 3 22  ? 234.558 -73.599  25.842  1.00 133.31 ? 13  GLY E C   1 
ATOM   7968  O O   . GLY E 3 22  ? 233.580 -73.003  25.383  1.00 131.33 ? 13  GLY E O   1 
ATOM   7969  N N   . GLU E 3 23  ? 235.484 -73.009  26.597  1.00 130.49 ? 14  GLU E N   1 
ATOM   7970  C CA  . GLU E 3 23  ? 235.440 -71.584  26.928  1.00 127.55 ? 14  GLU E CA  1 
ATOM   7971  C C   . GLU E 3 23  ? 235.868 -70.742  25.725  1.00 129.39 ? 14  GLU E C   1 
ATOM   7972  O O   . GLU E 3 23  ? 236.932 -70.976  25.146  1.00 131.68 ? 14  GLU E O   1 
ATOM   7973  C CB  . GLU E 3 23  ? 236.330 -71.286  28.143  1.00 123.44 ? 14  GLU E CB  1 
ATOM   7974  C CG  . GLU E 3 23  ? 236.209 -69.873  28.699  1.00 117.85 ? 14  GLU E CG  1 
ATOM   7975  C CD  . GLU E 3 23  ? 234.901 -69.643  29.426  1.00 114.72 ? 14  GLU E CD  1 
ATOM   7976  O OE1 . GLU E 3 23  ? 233.919 -69.254  28.763  1.00 112.19 ? 14  GLU E OE1 1 
ATOM   7977  O OE2 . GLU E 3 23  ? 234.847 -69.866  30.654  1.00 112.93 ? 14  GLU E OE2 1 
ATOM   7978  N N   . ARG E 3 24  ? 235.033 -69.771  25.352  1.00 128.90 ? 15  ARG E N   1 
ATOM   7979  C CA  . ARG E 3 24  ? 235.298 -68.907  24.191  1.00 127.28 ? 15  ARG E CA  1 
ATOM   7980  C C   . ARG E 3 24  ? 235.363 -67.418  24.575  1.00 126.97 ? 15  ARG E C   1 
ATOM   7981  O O   . ARG E 3 24  ? 235.088 -66.541  23.752  1.00 126.87 ? 15  ARG E O   1 
ATOM   7982  C CB  . ARG E 3 24  ? 234.253 -69.144  23.082  1.00 124.07 ? 15  ARG E CB  1 
ATOM   7983  C CG  . ARG E 3 24  ? 234.191 -70.573  22.550  1.00 119.84 ? 15  ARG E CG  1 
ATOM   7984  C CD  . ARG E 3 24  ? 233.068 -70.780  21.538  1.00 114.97 ? 15  ARG E CD  1 
ATOM   7985  N NE  . ARG E 3 24  ? 233.469 -70.452  20.168  1.00 110.91 ? 15  ARG E NE  1 
ATOM   7986  C CZ  . ARG E 3 24  ? 232.951 -69.468  19.436  1.00 108.46 ? 15  ARG E CZ  1 
ATOM   7987  N NH1 . ARG E 3 24  ? 231.990 -68.694  19.924  1.00 107.90 ? 15  ARG E NH1 1 
ATOM   7988  N NH2 . ARG E 3 24  ? 233.390 -69.263  18.202  1.00 105.90 ? 15  ARG E NH2 1 
ATOM   7989  N N   . ARG E 3 25  ? 235.755 -67.146  25.819  1.00 125.83 ? 16  ARG E N   1 
ATOM   7990  C CA  . ARG E 3 25  ? 235.737 -65.788  26.370  1.00 123.67 ? 16  ARG E CA  1 
ATOM   7991  C C   . ARG E 3 25  ? 237.137 -65.172  26.540  1.00 120.94 ? 16  ARG E C   1 
ATOM   7992  O O   . ARG E 3 25  ? 238.153 -65.848  26.355  1.00 119.74 ? 16  ARG E O   1 
ATOM   7993  C CB  . ARG E 3 25  ? 234.979 -65.778  27.708  1.00 123.93 ? 16  ARG E CB  1 
ATOM   7994  C CG  . ARG E 3 25  ? 233.475 -65.997  27.590  1.00 122.09 ? 16  ARG E CG  1 
ATOM   7995  C CD  . ARG E 3 25  ? 232.791 -65.951  28.950  1.00 118.90 ? 16  ARG E CD  1 
ATOM   7996  N NE  . ARG E 3 25  ? 232.807 -67.248  29.625  1.00 115.21 ? 16  ARG E NE  1 
ATOM   7997  C CZ  . ARG E 3 25  ? 232.303 -67.484  30.834  1.00 113.18 ? 16  ARG E CZ  1 
ATOM   7998  N NH1 . ARG E 3 25  ? 231.728 -66.513  31.531  1.00 112.87 ? 16  ARG E NH1 1 
ATOM   7999  N NH2 . ARG E 3 25  ? 232.374 -68.703  31.349  1.00 111.84 ? 16  ARG E NH2 1 
ATOM   8000  N N   . VAL E 3 26  ? 237.169 -63.881  26.875  1.00 117.93 ? 17  VAL E N   1 
ATOM   8001  C CA  . VAL E 3 26  ? 238.401 -63.167  27.229  1.00 114.06 ? 17  VAL E CA  1 
ATOM   8002  C C   . VAL E 3 26  ? 238.091 -62.111  28.298  1.00 114.23 ? 17  VAL E C   1 
ATOM   8003  O O   . VAL E 3 26  ? 237.073 -61.420  28.216  1.00 114.79 ? 17  VAL E O   1 
ATOM   8004  C CB  . VAL E 3 26  ? 239.096 -62.547  25.988  1.00 111.69 ? 17  VAL E CB  1 
ATOM   8005  C CG1 . VAL E 3 26  ? 238.240 -61.459  25.346  1.00 110.61 ? 17  VAL E CG1 1 
ATOM   8006  C CG2 . VAL E 3 26  ? 240.476 -62.016  26.349  1.00 110.00 ? 17  VAL E CG2 1 
ATOM   8007  N N   . ALA E 3 27  ? 238.962 -61.996  29.298  1.00 113.92 ? 18  ALA E N   1 
ATOM   8008  C CA  . ALA E 3 27  ? 238.694 -61.145  30.460  1.00 115.08 ? 18  ALA E CA  1 
ATOM   8009  C C   . ALA E 3 27  ? 238.588 -59.659  30.138  1.00 118.09 ? 18  ALA E C   1 
ATOM   8010  O O   . ALA E 3 27  ? 237.783 -58.950  30.740  1.00 116.93 ? 18  ALA E O   1 
ATOM   8011  C CB  . ALA E 3 27  ? 239.723 -61.383  31.548  1.00 113.56 ? 18  ALA E CB  1 
ATOM   8012  N N   . LEU E 3 28  ? 239.397 -59.196  29.189  1.00 124.28 ? 19  LEU E N   1 
ATOM   8013  C CA  . LEU E 3 28  ? 239.379 -57.794  28.779  1.00 132.19 ? 19  LEU E CA  1 
ATOM   8014  C C   . LEU E 3 28  ? 239.265 -57.651  27.262  1.00 139.35 ? 19  LEU E C   1 
ATOM   8015  O O   . LEU E 3 28  ? 239.905 -58.393  26.513  1.00 140.63 ? 19  LEU E O   1 
ATOM   8016  C CB  . LEU E 3 28  ? 240.621 -57.059  29.300  1.00 130.71 ? 19  LEU E CB  1 
ATOM   8017  C CG  . LEU E 3 28  ? 240.811 -56.917  30.817  1.00 129.76 ? 19  LEU E CG  1 
ATOM   8018  C CD1 . LEU E 3 28  ? 242.218 -56.435  31.136  1.00 129.91 ? 19  LEU E CD1 1 
ATOM   8019  C CD2 . LEU E 3 28  ? 239.775 -55.988  31.436  1.00 129.80 ? 19  LEU E CD2 1 
ATOM   8020  N N   . VAL E 3 29  ? 238.435 -56.704  26.825  1.00 147.90 ? 20  VAL E N   1 
ATOM   8021  C CA  . VAL E 3 29  ? 238.247 -56.398  25.398  1.00 153.47 ? 20  VAL E CA  1 
ATOM   8022  C C   . VAL E 3 29  ? 239.043 -55.149  24.998  1.00 153.48 ? 20  VAL E C   1 
ATOM   8023  O O   . VAL E 3 29  ? 239.373 -54.331  25.860  1.00 153.92 ? 20  VAL E O   1 
ATOM   8024  C CB  . VAL E 3 29  ? 236.750 -56.227  25.017  1.00 156.61 ? 20  VAL E CB  1 
ATOM   8025  C CG1 . VAL E 3 29  ? 236.012 -57.557  25.095  1.00 158.55 ? 20  VAL E CG1 1 
ATOM   8026  C CG2 . VAL E 3 29  ? 236.069 -55.164  25.873  1.00 158.83 ? 20  VAL E CG2 1 
ATOM   8027  N N   . PRO E 3 30  ? 239.345 -54.991  23.690  1.00 153.00 ? 21  PRO E N   1 
ATOM   8028  C CA  . PRO E 3 30  ? 240.156 -53.864  23.214  1.00 153.98 ? 21  PRO E CA  1 
ATOM   8029  C C   . PRO E 3 30  ? 239.594 -52.492  23.588  1.00 158.00 ? 21  PRO E C   1 
ATOM   8030  O O   . PRO E 3 30  ? 240.358 -51.535  23.707  1.00 158.21 ? 21  PRO E O   1 
ATOM   8031  C CB  . PRO E 3 30  ? 240.136 -54.039  21.694  1.00 151.74 ? 21  PRO E CB  1 
ATOM   8032  C CG  . PRO E 3 30  ? 239.903 -55.493  21.491  1.00 151.26 ? 21  PRO E CG  1 
ATOM   8033  C CD  . PRO E 3 30  ? 238.940 -55.867  22.574  1.00 152.04 ? 21  PRO E CD  1 
ATOM   8034  N N   . GLU E 3 31  ? 238.276 -52.408  23.773  1.00 163.13 ? 22  GLU E N   1 
ATOM   8035  C CA  . GLU E 3 31  ? 237.605 -51.160  24.146  1.00 168.02 ? 22  GLU E CA  1 
ATOM   8036  C C   . GLU E 3 31  ? 237.930 -50.737  25.585  1.00 163.80 ? 22  GLU E C   1 
ATOM   8037  O O   . GLU E 3 31  ? 238.352 -49.602  25.822  1.00 165.01 ? 22  GLU E O   1 
ATOM   8038  C CB  . GLU E 3 31  ? 236.087 -51.284  23.944  1.00 175.15 ? 22  GLU E CB  1 
ATOM   8039  C CG  . GLU E 3 31  ? 235.321 -49.965  23.975  1.00 184.23 ? 22  GLU E CG  1 
ATOM   8040  C CD  . GLU E 3 31  ? 235.059 -49.450  25.383  1.00 189.46 ? 22  GLU E CD  1 
ATOM   8041  O OE1 . GLU E 3 31  ? 235.461 -48.304  25.682  1.00 194.03 ? 22  GLU E OE1 1 
ATOM   8042  O OE2 . GLU E 3 31  ? 234.457 -50.189  26.193  1.00 192.20 ? 22  GLU E OE2 1 
ATOM   8043  N N   . VAL E 3 32  ? 237.721 -51.649  26.533  1.00 156.36 ? 23  VAL E N   1 
ATOM   8044  C CA  . VAL E 3 32  ? 238.002 -51.396  27.950  1.00 147.89 ? 23  VAL E CA  1 
ATOM   8045  C C   . VAL E 3 32  ? 239.508 -51.248  28.174  1.00 143.81 ? 23  VAL E C   1 
ATOM   8046  O O   . VAL E 3 32  ? 239.947 -50.421  28.980  1.00 141.49 ? 23  VAL E O   1 
ATOM   8047  C CB  . VAL E 3 32  ? 237.401 -52.499  28.854  1.00 146.49 ? 23  VAL E CB  1 
ATOM   8048  C CG1 . VAL E 3 32  ? 237.888 -52.369  30.290  1.00 145.28 ? 23  VAL E CG1 1 
ATOM   8049  C CG2 . VAL E 3 32  ? 235.881 -52.442  28.812  1.00 145.51 ? 23  VAL E CG2 1 
ATOM   8050  N N   . VAL E 3 33  ? 240.287 -52.044  27.442  1.00 140.60 ? 24  VAL E N   1 
ATOM   8051  C CA  . VAL E 3 33  ? 241.744 -51.919  27.420  1.00 138.91 ? 24  VAL E CA  1 
ATOM   8052  C C   . VAL E 3 33  ? 242.150 -50.516  26.955  1.00 138.87 ? 24  VAL E C   1 
ATOM   8053  O O   . VAL E 3 33  ? 243.057 -49.909  27.530  1.00 139.33 ? 24  VAL E O   1 
ATOM   8054  C CB  . VAL E 3 33  ? 242.397 -53.011  26.535  1.00 138.23 ? 24  VAL E CB  1 
ATOM   8055  C CG1 . VAL E 3 33  ? 243.860 -52.698  26.252  1.00 138.84 ? 24  VAL E CG1 1 
ATOM   8056  C CG2 . VAL E 3 33  ? 242.278 -54.375  27.198  1.00 137.41 ? 24  VAL E CG2 1 
ATOM   8057  N N   . ALA E 3 34  ? 241.458 -50.001  25.937  1.00 138.73 ? 25  ALA E N   1 
ATOM   8058  C CA  . ALA E 3 34  ? 241.736 -48.667  25.395  1.00 139.11 ? 25  ALA E CA  1 
ATOM   8059  C C   . ALA E 3 34  ? 241.576 -47.551  26.425  1.00 140.40 ? 25  ALA E C   1 
ATOM   8060  O O   . ALA E 3 34  ? 242.375 -46.619  26.444  1.00 141.76 ? 25  ALA E O   1 
ATOM   8061  C CB  . ALA E 3 34  ? 240.878 -48.387  24.168  1.00 137.80 ? 25  ALA E CB  1 
ATOM   8062  N N   . ARG E 3 35  ? 240.560 -47.652  27.281  1.00 142.40 ? 26  ARG E N   1 
ATOM   8063  C CA  . ARG E 3 35  ? 240.287 -46.610  28.276  1.00 145.96 ? 26  ARG E CA  1 
ATOM   8064  C C   . ARG E 3 35  ? 241.114 -46.753  29.560  1.00 148.64 ? 26  ARG E C   1 
ATOM   8065  O O   . ARG E 3 35  ? 241.168 -45.831  30.381  1.00 146.91 ? 26  ARG E O   1 
ATOM   8066  C CB  . ARG E 3 35  ? 238.794 -46.547  28.606  1.00 147.28 ? 26  ARG E CB  1 
ATOM   8067  C CG  . ARG E 3 35  ? 238.318 -45.172  29.054  1.00 149.27 ? 26  ARG E CG  1 
ATOM   8068  C CD  . ARG E 3 35  ? 236.925 -45.238  29.656  1.00 152.45 ? 26  ARG E CD  1 
ATOM   8069  N NE  . ARG E 3 35  ? 235.937 -45.726  28.695  1.00 155.19 ? 26  ARG E NE  1 
ATOM   8070  C CZ  . ARG E 3 35  ? 234.789 -46.314  29.024  1.00 157.39 ? 26  ARG E CZ  1 
ATOM   8071  N NH1 . ARG E 3 35  ? 233.960 -46.720  28.073  1.00 157.81 ? 26  ARG E NH1 1 
ATOM   8072  N NH2 . ARG E 3 35  ? 234.466 -46.501  30.299  1.00 159.14 ? 26  ARG E NH2 1 
ATOM   8073  N N   . LEU E 3 36  ? 241.750 -47.910  29.728  1.00 154.57 ? 27  LEU E N   1 
ATOM   8074  C CA  . LEU E 3 36  ? 242.633 -48.147  30.869  1.00 162.13 ? 27  LEU E CA  1 
ATOM   8075  C C   . LEU E 3 36  ? 244.049 -47.639  30.626  1.00 168.40 ? 27  LEU E C   1 
ATOM   8076  O O   . LEU E 3 36  ? 244.716 -47.192  31.561  1.00 169.03 ? 27  LEU E O   1 
ATOM   8077  C CB  . LEU E 3 36  ? 242.656 -49.627  31.246  1.00 163.32 ? 27  LEU E CB  1 
ATOM   8078  C CG  . LEU E 3 36  ? 241.551 -50.079  32.202  1.00 164.72 ? 27  LEU E CG  1 
ATOM   8079  C CD1 . LEU E 3 36  ? 241.436 -51.596  32.199  1.00 167.54 ? 27  LEU E CD1 1 
ATOM   8080  C CD2 . LEU E 3 36  ? 241.793 -49.554  33.614  1.00 163.94 ? 27  LEU E CD2 1 
ATOM   8081  N N   . VAL E 3 37  ? 244.506 -47.719  29.375  1.00 176.40 ? 28  VAL E N   1 
ATOM   8082  C CA  . VAL E 3 37  ? 245.753 -47.066  28.959  1.00 182.89 ? 28  VAL E CA  1 
ATOM   8083  C C   . VAL E 3 37  ? 245.490 -45.556  28.871  1.00 187.43 ? 28  VAL E C   1 
ATOM   8084  O O   . VAL E 3 37  ? 246.407 -44.745  29.034  1.00 189.62 ? 28  VAL E O   1 
ATOM   8085  C CB  . VAL E 3 37  ? 246.306 -47.627  27.622  1.00 182.40 ? 28  VAL E CB  1 
ATOM   8086  C CG1 . VAL E 3 37  ? 247.687 -47.056  27.317  1.00 179.86 ? 28  VAL E CG1 1 
ATOM   8087  C CG2 . VAL E 3 37  ? 246.381 -49.147  27.661  1.00 182.79 ? 28  VAL E CG2 1 
ATOM   8088  N N   . LYS E 3 38  ? 244.227 -45.196  28.622  1.00 190.17 ? 29  LYS E N   1 
ATOM   8089  C CA  . LYS E 3 38  ? 243.745 -43.815  28.763  1.00 188.81 ? 29  LYS E CA  1 
ATOM   8090  C C   . LYS E 3 38  ? 243.671 -43.437  30.245  1.00 184.56 ? 29  LYS E C   1 
ATOM   8091  O O   . LYS E 3 38  ? 243.762 -42.260  30.600  1.00 181.35 ? 29  LYS E O   1 
ATOM   8092  C CB  . LYS E 3 38  ? 242.364 -43.633  28.114  1.00 191.38 ? 29  LYS E CB  1 
ATOM   8093  C CG  . LYS E 3 38  ? 242.343 -43.581  26.589  1.00 193.32 ? 29  LYS E CG  1 
ATOM   8094  C CD  . LYS E 3 38  ? 240.913 -43.639  26.058  1.00 191.09 ? 29  LYS E CD  1 
ATOM   8095  C CE  . LYS E 3 38  ? 240.845 -44.025  24.584  1.00 187.60 ? 29  LYS E CE  1 
ATOM   8096  N NZ  . LYS E 3 38  ? 241.040 -42.868  23.665  1.00 185.60 ? 29  LYS E NZ  1 
ATOM   8097  N N   . GLY E 3 39  ? 243.486 -44.445  31.098  1.00 181.55 ? 30  GLY E N   1 
ATOM   8098  C CA  . GLY E 3 39  ? 243.552 -44.276  32.548  1.00 178.91 ? 30  GLY E CA  1 
ATOM   8099  C C   . GLY E 3 39  ? 244.979 -44.046  33.020  1.00 178.61 ? 30  GLY E C   1 
ATOM   8100  O O   . GLY E 3 39  ? 245.216 -43.222  33.904  1.00 179.76 ? 30  GLY E O   1 
ATOM   8101  N N   . GLY E 3 40  ? 245.924 -44.784  32.433  1.00 177.00 ? 31  GLY E N   1 
ATOM   8102  C CA  . GLY E 3 40  ? 247.358 -44.576  32.678  1.00 172.40 ? 31  GLY E CA  1 
ATOM   8103  C C   . GLY E 3 40  ? 248.180 -45.813  33.009  1.00 167.62 ? 31  GLY E C   1 
ATOM   8104  O O   . GLY E 3 40  ? 249.159 -45.727  33.756  1.00 168.96 ? 31  GLY E O   1 
ATOM   8105  N N   . ALA E 3 41  ? 247.802 -46.957  32.437  1.00 160.58 ? 32  ALA E N   1 
ATOM   8106  C CA  . ALA E 3 41  ? 248.443 -48.237  32.757  1.00 152.10 ? 32  ALA E CA  1 
ATOM   8107  C C   . ALA E 3 41  ? 248.985 -48.976  31.529  1.00 145.61 ? 32  ALA E C   1 
ATOM   8108  O O   . ALA E 3 41  ? 248.640 -48.650  30.390  1.00 145.75 ? 32  ALA E O   1 
ATOM   8109  C CB  . ALA E 3 41  ? 247.473 -49.125  33.525  1.00 152.30 ? 32  ALA E CB  1 
ATOM   8110  N N   . ARG E 3 42  ? 249.844 -49.964  31.777  1.00 136.51 ? 33  ARG E N   1 
ATOM   8111  C CA  . ARG E 3 42  ? 250.340 -50.855  30.730  1.00 128.66 ? 33  ARG E CA  1 
ATOM   8112  C C   . ARG E 3 42  ? 249.543 -52.155  30.743  1.00 126.35 ? 33  ARG E C   1 
ATOM   8113  O O   . ARG E 3 42  ? 249.342 -52.758  31.799  1.00 125.54 ? 33  ARG E O   1 
ATOM   8114  C CB  . ARG E 3 42  ? 251.827 -51.160  30.931  1.00 124.87 ? 33  ARG E CB  1 
ATOM   8115  C CG  . ARG E 3 42  ? 252.778 -50.015  30.620  1.00 121.13 ? 33  ARG E CG  1 
ATOM   8116  C CD  . ARG E 3 42  ? 253.060 -49.915  29.129  1.00 117.99 ? 33  ARG E CD  1 
ATOM   8117  N NE  . ARG E 3 42  ? 254.295 -49.184  28.856  1.00 114.45 ? 33  ARG E NE  1 
ATOM   8118  C CZ  . ARG E 3 42  ? 254.366 -47.874  28.624  1.00 112.91 ? 33  ARG E CZ  1 
ATOM   8119  N NH1 . ARG E 3 42  ? 255.542 -47.310  28.387  1.00 111.17 ? 33  ARG E NH1 1 
ATOM   8120  N NH2 . ARG E 3 42  ? 253.269 -47.122  28.623  1.00 112.22 ? 33  ARG E NH2 1 
ATOM   8121  N N   . VAL E 3 43  ? 249.087 -52.581  29.569  1.00 123.85 ? 34  VAL E N   1 
ATOM   8122  C CA  . VAL E 3 43  ? 248.293 -53.802  29.466  1.00 122.75 ? 34  VAL E CA  1 
ATOM   8123  C C   . VAL E 3 43  ? 249.072 -54.894  28.747  1.00 123.33 ? 34  VAL E C   1 
ATOM   8124  O O   . VAL E 3 43  ? 249.591 -54.690  27.649  1.00 118.87 ? 34  VAL E O   1 
ATOM   8125  C CB  . VAL E 3 43  ? 246.932 -53.562  28.775  1.00 122.65 ? 34  VAL E CB  1 
ATOM   8126  C CG1 . VAL E 3 43  ? 246.112 -54.844  28.736  1.00 122.27 ? 34  VAL E CG1 1 
ATOM   8127  C CG2 . VAL E 3 43  ? 246.152 -52.470  29.491  1.00 123.72 ? 34  VAL E CG2 1 
ATOM   8128  N N   . ARG E 3 44  ? 249.152 -56.049  29.394  1.00 129.98 ? 35  ARG E N   1 
ATOM   8129  C CA  . ARG E 3 44  ? 249.815 -57.210  28.831  1.00 139.09 ? 35  ARG E CA  1 
ATOM   8130  C C   . ARG E 3 44  ? 248.759 -58.223  28.416  1.00 143.76 ? 35  ARG E C   1 
ATOM   8131  O O   . ARG E 3 44  ? 247.903 -58.600  29.217  1.00 142.43 ? 35  ARG E O   1 
ATOM   8132  C CB  . ARG E 3 44  ? 250.776 -57.819  29.852  1.00 145.04 ? 35  ARG E CB  1 
ATOM   8133  C CG  . ARG E 3 44  ? 251.792 -56.835  30.415  1.00 152.20 ? 35  ARG E CG  1 
ATOM   8134  C CD  . ARG E 3 44  ? 252.804 -57.523  31.319  1.00 159.59 ? 35  ARG E CD  1 
ATOM   8135  N NE  . ARG E 3 44  ? 253.738 -58.365  30.569  1.00 167.12 ? 35  ARG E NE  1 
ATOM   8136  C CZ  . ARG E 3 44  ? 254.895 -57.947  30.060  1.00 172.27 ? 35  ARG E CZ  1 
ATOM   8137  N NH1 . ARG E 3 44  ? 255.283 -56.686  30.212  1.00 175.32 ? 35  ARG E NH1 1 
ATOM   8138  N NH2 . ARG E 3 44  ? 255.669 -58.794  29.394  1.00 175.89 ? 35  ARG E NH2 1 
ATOM   8139  N N   . VAL E 3 45  ? 248.810 -58.645  27.156  1.00 152.18 ? 36  VAL E N   1 
ATOM   8140  C CA  . VAL E 3 45  ? 247.827 -59.583  26.610  1.00 162.37 ? 36  VAL E CA  1 
ATOM   8141  C C   . VAL E 3 45  ? 248.525 -60.756  25.920  1.00 167.13 ? 36  VAL E C   1 
ATOM   8142  O O   . VAL E 3 45  ? 249.537 -60.569  25.241  1.00 168.09 ? 36  VAL E O   1 
ATOM   8143  C CB  . VAL E 3 45  ? 246.872 -58.897  25.602  1.00 165.66 ? 36  VAL E CB  1 
ATOM   8144  C CG1 . VAL E 3 45  ? 245.617 -59.735  25.393  1.00 169.42 ? 36  VAL E CG1 1 
ATOM   8145  C CG2 . VAL E 3 45  ? 246.491 -57.497  26.064  1.00 165.99 ? 36  VAL E CG2 1 
ATOM   8146  N N   . GLU E 3 46  ? 247.979 -61.959  26.100  1.00 172.41 ? 37  GLU E N   1 
ATOM   8147  C CA  . GLU E 3 46  ? 248.506 -63.161  25.450  1.00 177.98 ? 37  GLU E CA  1 
ATOM   8148  C C   . GLU E 3 46  ? 248.160 -63.180  23.955  1.00 184.23 ? 37  GLU E C   1 
ATOM   8149  O O   . GLU E 3 46  ? 247.292 -62.432  23.499  1.00 186.47 ? 37  GLU E O   1 
ATOM   8150  C CB  . GLU E 3 46  ? 247.982 -64.424  26.142  1.00 175.24 ? 37  GLU E CB  1 
ATOM   8151  C CG  . GLU E 3 46  ? 248.860 -65.653  25.941  1.00 173.34 ? 37  GLU E CG  1 
ATOM   8152  C CD  . GLU E 3 46  ? 248.136 -66.954  26.225  1.00 172.61 ? 37  GLU E CD  1 
ATOM   8153  O OE1 . GLU E 3 46  ? 247.594 -67.108  27.340  1.00 173.23 ? 37  GLU E OE1 1 
ATOM   8154  O OE2 . GLU E 3 46  ? 248.120 -67.828  25.332  1.00 171.53 ? 37  GLU E OE2 1 
ATOM   8155  N N   . ARG E 3 47  ? 248.847 -64.038  23.203  1.00 191.54 ? 38  ARG E N   1 
ATOM   8156  C CA  . ARG E 3 47  ? 248.669 -64.141  21.757  1.00 199.63 ? 38  ARG E CA  1 
ATOM   8157  C C   . ARG E 3 47  ? 247.385 -64.900  21.397  1.00 200.05 ? 38  ARG E C   1 
ATOM   8158  O O   . ARG E 3 47  ? 247.357 -66.135  21.405  1.00 200.53 ? 38  ARG E O   1 
ATOM   8159  C CB  . ARG E 3 47  ? 249.893 -64.824  21.133  1.00 208.19 ? 38  ARG E CB  1 
ATOM   8160  C CG  . ARG E 3 47  ? 250.193 -64.431  19.693  1.00 219.50 ? 38  ARG E CG  1 
ATOM   8161  C CD  . ARG E 3 47  ? 251.309 -65.295  19.124  1.00 229.73 ? 38  ARG E CD  1 
ATOM   8162  N NE  . ARG E 3 47  ? 251.937 -64.702  17.944  1.00 237.10 ? 38  ARG E NE  1 
ATOM   8163  C CZ  . ARG E 3 47  ? 251.608 -64.982  16.684  1.00 243.00 ? 38  ARG E CZ  1 
ATOM   8164  N NH1 . ARG E 3 47  ? 252.248 -64.383  15.689  1.00 244.61 ? 38  ARG E NH1 1 
ATOM   8165  N NH2 . ARG E 3 47  ? 250.645 -65.857  16.412  1.00 249.43 ? 38  ARG E NH2 1 
ATOM   8166  N N   . GLY E 3 48  ? 246.325 -64.150  21.097  1.00 199.60 ? 39  GLY E N   1 
ATOM   8167  C CA  . GLY E 3 48  ? 245.059 -64.721  20.626  1.00 198.84 ? 39  GLY E CA  1 
ATOM   8168  C C   . GLY E 3 48  ? 244.013 -65.007  21.691  1.00 197.85 ? 39  GLY E C   1 
ATOM   8169  O O   . GLY E 3 48  ? 243.257 -65.974  21.575  1.00 200.39 ? 39  GLY E O   1 
ATOM   8170  N N   . ALA E 3 49  ? 243.958 -64.159  22.717  1.00 194.07 ? 40  ALA E N   1 
ATOM   8171  C CA  . ALA E 3 49  ? 243.032 -64.344  23.838  1.00 187.25 ? 40  ALA E CA  1 
ATOM   8172  C C   . ALA E 3 49  ? 241.597 -63.942  23.492  1.00 179.91 ? 40  ALA E C   1 
ATOM   8173  O O   . ALA E 3 49  ? 240.641 -64.596  23.916  1.00 175.84 ? 40  ALA E O   1 
ATOM   8174  C CB  . ALA E 3 49  ? 243.521 -63.582  25.061  1.00 189.20 ? 40  ALA E CB  1 
ATOM   8175  N N   . GLY E 3 50  ? 241.459 -62.867  22.720  1.00 173.74 ? 41  GLY E N   1 
ATOM   8176  C CA  . GLY E 3 50  ? 240.152 -62.363  22.315  1.00 168.36 ? 41  GLY E CA  1 
ATOM   8177  C C   . GLY E 3 50  ? 239.580 -63.034  21.080  1.00 166.07 ? 41  GLY E C   1 
ATOM   8178  O O   . GLY E 3 50  ? 238.468 -62.710  20.661  1.00 166.43 ? 41  GLY E O   1 
ATOM   8179  N N   . GLU E 3 51  ? 240.338 -63.967  20.500  1.00 164.36 ? 42  GLU E N   1 
ATOM   8180  C CA  . GLU E 3 51  ? 239.932 -64.675  19.277  1.00 163.08 ? 42  GLU E CA  1 
ATOM   8181  C C   . GLU E 3 51  ? 238.633 -65.470  19.433  1.00 161.25 ? 42  GLU E C   1 
ATOM   8182  O O   . GLU E 3 51  ? 237.942 -65.740  18.447  1.00 161.61 ? 42  GLU E O   1 
ATOM   8183  C CB  . GLU E 3 51  ? 241.056 -65.586  18.770  1.00 163.60 ? 42  GLU E CB  1 
ATOM   8184  C CG  . GLU E 3 51  ? 242.173 -64.854  18.036  1.00 163.49 ? 42  GLU E CG  1 
ATOM   8185  C CD  . GLU E 3 51  ? 243.064 -65.776  17.217  1.00 163.88 ? 42  GLU E CD  1 
ATOM   8186  O OE1 . GLU E 3 51  ? 242.885 -67.013  17.278  1.00 164.68 ? 42  GLU E OE1 1 
ATOM   8187  O OE2 . GLU E 3 51  ? 243.949 -65.257  16.504  1.00 163.19 ? 42  GLU E OE2 1 
ATOM   8188  N N   . GLY E 3 52  ? 238.315 -65.848  20.670  1.00 158.31 ? 43  GLY E N   1 
ATOM   8189  C CA  . GLY E 3 52  ? 237.052 -66.514  20.979  1.00 154.95 ? 43  GLY E CA  1 
ATOM   8190  C C   . GLY E 3 52  ? 235.884 -65.547  20.939  1.00 153.06 ? 43  GLY E C   1 
ATOM   8191  O O   . GLY E 3 52  ? 234.768 -65.924  20.575  1.00 151.28 ? 43  GLY E O   1 
ATOM   8192  N N   . ALA E 3 53  ? 236.152 -64.297  21.317  1.00 152.69 ? 44  ALA E N   1 
ATOM   8193  C CA  . ALA E 3 53  ? 235.150 -63.230  21.303  1.00 154.07 ? 44  ALA E CA  1 
ATOM   8194  C C   . ALA E 3 53  ? 235.245 -62.363  20.038  1.00 156.59 ? 44  ALA E C   1 
ATOM   8195  O O   . ALA E 3 53  ? 234.714 -61.248  19.996  1.00 158.33 ? 44  ALA E O   1 
ATOM   8196  C CB  . ALA E 3 53  ? 235.279 -62.375  22.557  1.00 151.80 ? 44  ALA E CB  1 
ATOM   8197  N N   . TYR E 3 54  ? 235.926 -62.893  19.019  1.00 158.28 ? 45  TYR E N   1 
ATOM   8198  C CA  . TYR E 3 54  ? 236.088 -62.259  17.693  1.00 156.74 ? 45  TYR E CA  1 
ATOM   8199  C C   . TYR E 3 54  ? 236.777 -60.885  17.690  1.00 152.23 ? 45  TYR E C   1 
ATOM   8200  O O   . TYR E 3 54  ? 236.600 -60.085  16.762  1.00 148.73 ? 45  TYR E O   1 
ATOM   8201  C CB  . TYR E 3 54  ? 234.763 -62.252  16.907  1.00 159.76 ? 45  TYR E CB  1 
ATOM   8202  C CG  . TYR E 3 54  ? 234.221 -63.642  16.619  1.00 161.01 ? 45  TYR E CG  1 
ATOM   8203  C CD1 . TYR E 3 54  ? 234.699 -64.395  15.543  1.00 160.15 ? 45  TYR E CD1 1 
ATOM   8204  C CD2 . TYR E 3 54  ? 233.233 -64.207  17.428  1.00 161.45 ? 45  TYR E CD2 1 
ATOM   8205  C CE1 . TYR E 3 54  ? 234.207 -65.667  15.283  1.00 158.05 ? 45  TYR E CE1 1 
ATOM   8206  C CE2 . TYR E 3 54  ? 232.735 -65.478  17.174  1.00 159.10 ? 45  TYR E CE2 1 
ATOM   8207  C CZ  . TYR E 3 54  ? 233.224 -66.203  16.102  1.00 157.30 ? 45  TYR E CZ  1 
ATOM   8208  O OH  . TYR E 3 54  ? 232.729 -67.464  15.853  1.00 154.00 ? 45  TYR E OH  1 
ATOM   8209  N N   . HIS E 3 55  ? 237.563 -60.630  18.735  1.00 148.15 ? 46  HIS E N   1 
ATOM   8210  C CA  . HIS E 3 55  ? 238.465 -59.486  18.781  1.00 143.18 ? 46  HIS E CA  1 
ATOM   8211  C C   . HIS E 3 55  ? 239.866 -59.974  18.407  1.00 139.42 ? 46  HIS E C   1 
ATOM   8212  O O   . HIS E 3 55  ? 240.520 -60.652  19.206  1.00 139.12 ? 46  HIS E O   1 
ATOM   8213  C CB  . HIS E 3 55  ? 238.471 -58.839  20.172  1.00 142.57 ? 46  HIS E CB  1 
ATOM   8214  C CG  . HIS E 3 55  ? 237.172 -58.195  20.554  1.00 140.45 ? 46  HIS E CG  1 
ATOM   8215  N ND1 . HIS E 3 55  ? 236.678 -57.078  19.914  1.00 138.91 ? 46  HIS E ND1 1 
ATOM   8216  C CD2 . HIS E 3 55  ? 236.277 -58.499  21.524  1.00 139.03 ? 46  HIS E CD2 1 
ATOM   8217  C CE1 . HIS E 3 55  ? 235.528 -56.729  20.465  1.00 137.03 ? 46  HIS E CE1 1 
ATOM   8218  N NE2 . HIS E 3 55  ? 235.263 -57.575  21.445  1.00 137.19 ? 46  HIS E NE2 1 
ATOM   8219  N N   . PRO E 3 56  ? 240.325 -59.646  17.182  1.00 135.47 ? 47  PRO E N   1 
ATOM   8220  C CA  . PRO E 3 56  ? 241.621 -60.113  16.674  1.00 133.99 ? 47  PRO E CA  1 
ATOM   8221  C C   . PRO E 3 56  ? 242.815 -59.661  17.523  1.00 133.80 ? 47  PRO E C   1 
ATOM   8222  O O   . PRO E 3 56  ? 242.657 -58.834  18.425  1.00 132.66 ? 47  PRO E O   1 
ATOM   8223  C CB  . PRO E 3 56  ? 241.694 -59.496  15.268  1.00 133.29 ? 47  PRO E CB  1 
ATOM   8224  C CG  . PRO E 3 56  ? 240.698 -58.385  15.265  1.00 131.84 ? 47  PRO E CG  1 
ATOM   8225  C CD  . PRO E 3 56  ? 239.605 -58.836  16.181  1.00 132.91 ? 47  PRO E CD  1 
ATOM   8226  N N   . ASP E 3 57  ? 243.992 -60.214  17.237  1.00 134.82 ? 48  ASP E N   1 
ATOM   8227  C CA  . ASP E 3 57  ? 245.224 -59.831  17.929  1.00 137.48 ? 48  ASP E CA  1 
ATOM   8228  C C   . ASP E 3 57  ? 245.556 -58.348  17.794  1.00 142.22 ? 48  ASP E C   1 
ATOM   8229  O O   . ASP E 3 57  ? 245.971 -57.715  18.766  1.00 144.72 ? 48  ASP E O   1 
ATOM   8230  C CB  . ASP E 3 57  ? 246.408 -60.680  17.457  1.00 134.59 ? 48  ASP E CB  1 
ATOM   8231  C CG  . ASP E 3 57  ? 246.842 -61.703  18.488  1.00 132.37 ? 48  ASP E CG  1 
ATOM   8232  O OD1 . ASP E 3 57  ? 246.036 -62.031  19.383  1.00 130.59 ? 48  ASP E OD1 1 
ATOM   8233  O OD2 . ASP E 3 57  ? 247.995 -62.175  18.406  1.00 132.02 ? 48  ASP E OD2 1 
ATOM   8234  N N   . GLU E 3 58  ? 245.364 -57.798  16.594  1.00 146.41 ? 49  GLU E N   1 
ATOM   8235  C CA  . GLU E 3 58  ? 245.658 -56.382  16.337  1.00 148.80 ? 49  GLU E CA  1 
ATOM   8236  C C   . GLU E 3 58  ? 244.637 -55.405  16.936  1.00 149.12 ? 49  GLU E C   1 
ATOM   8237  O O   . GLU E 3 58  ? 244.892 -54.200  16.986  1.00 151.99 ? 49  GLU E O   1 
ATOM   8238  C CB  . GLU E 3 58  ? 245.874 -56.095  14.838  1.00 148.77 ? 49  GLU E CB  1 
ATOM   8239  C CG  . GLU E 3 58  ? 244.937 -56.811  13.875  1.00 149.10 ? 49  GLU E CG  1 
ATOM   8240  C CD  . GLU E 3 58  ? 245.622 -57.924  13.100  1.00 149.55 ? 49  GLU E CD  1 
ATOM   8241  O OE1 . GLU E 3 58  ? 244.909 -58.834  12.628  1.00 153.19 ? 49  GLU E OE1 1 
ATOM   8242  O OE2 . GLU E 3 58  ? 246.868 -57.889  12.951  1.00 147.00 ? 49  GLU E OE2 1 
ATOM   8243  N N   . ALA E 3 59  ? 243.499 -55.921  17.398  1.00 146.56 ? 50  ALA E N   1 
ATOM   8244  C CA  . ALA E 3 59  ? 242.467 -55.090  18.024  1.00 142.81 ? 50  ALA E CA  1 
ATOM   8245  C C   . ALA E 3 59  ? 242.925 -54.494  19.361  1.00 140.14 ? 50  ALA E C   1 
ATOM   8246  O O   . ALA E 3 59  ? 242.518 -53.391  19.730  1.00 136.77 ? 50  ALA E O   1 
ATOM   8247  C CB  . ALA E 3 59  ? 241.179 -55.881  18.197  1.00 143.06 ? 50  ALA E CB  1 
ATOM   8248  N N   . TYR E 3 60  ? 243.784 -55.225  20.066  1.00 140.22 ? 51  TYR E N   1 
ATOM   8249  C CA  . TYR E 3 60  ? 244.322 -54.784  21.351  1.00 142.27 ? 51  TYR E CA  1 
ATOM   8250  C C   . TYR E 3 60  ? 245.550 -53.887  21.206  1.00 145.03 ? 51  TYR E C   1 
ATOM   8251  O O   . TYR E 3 60  ? 245.737 -52.962  21.997  1.00 144.60 ? 51  TYR E O   1 
ATOM   8252  C CB  . TYR E 3 60  ? 244.677 -55.991  22.218  1.00 142.68 ? 51  TYR E CB  1 
ATOM   8253  C CG  . TYR E 3 60  ? 243.491 -56.820  22.645  1.00 142.70 ? 51  TYR E CG  1 
ATOM   8254  C CD1 . TYR E 3 60  ? 242.822 -56.546  23.836  1.00 142.92 ? 51  TYR E CD1 1 
ATOM   8255  C CD2 . TYR E 3 60  ? 243.043 -57.887  21.866  1.00 142.77 ? 51  TYR E CD2 1 
ATOM   8256  C CE1 . TYR E 3 60  ? 241.738 -57.308  24.237  1.00 143.51 ? 51  TYR E CE1 1 
ATOM   8257  C CE2 . TYR E 3 60  ? 241.957 -58.655  22.258  1.00 143.18 ? 51  TYR E CE2 1 
ATOM   8258  C CZ  . TYR E 3 60  ? 241.310 -58.362  23.444  1.00 143.60 ? 51  TYR E CZ  1 
ATOM   8259  O OH  . TYR E 3 60  ? 240.231 -59.122  23.835  1.00 143.78 ? 51  TYR E OH  1 
ATOM   8260  N N   . GLN E 3 61  ? 246.387 -54.174  20.208  1.00 149.84 ? 52  GLN E N   1 
ATOM   8261  C CA  . GLN E 3 61  ? 247.609 -53.400  19.954  1.00 153.83 ? 52  GLN E CA  1 
ATOM   8262  C C   . GLN E 3 61  ? 247.299 -51.948  19.599  1.00 153.35 ? 52  GLN E C   1 
ATOM   8263  O O   . GLN E 3 61  ? 248.065 -51.039  19.932  1.00 153.07 ? 52  GLN E O   1 
ATOM   8264  C CB  . GLN E 3 61  ? 248.449 -54.046  18.844  1.00 157.89 ? 52  GLN E CB  1 
ATOM   8265  C CG  . GLN E 3 61  ? 249.220 -55.287  19.276  1.00 161.24 ? 52  GLN E CG  1 
ATOM   8266  C CD  . GLN E 3 61  ? 250.163 -55.817  18.206  1.00 163.19 ? 52  GLN E CD  1 
ATOM   8267  O OE1 . GLN E 3 61  ? 251.315 -56.147  18.491  1.00 164.30 ? 52  GLN E OE1 1 
ATOM   8268  N NE2 . GLN E 3 61  ? 249.677 -55.906  16.969  1.00 163.91 ? 52  GLN E NE2 1 
ATOM   8269  N N   . GLU E 3 62  ? 246.169 -51.746  18.926  1.00 153.60 ? 53  GLU E N   1 
ATOM   8270  C CA  . GLU E 3 62  ? 245.677 -50.414  18.591  1.00 153.87 ? 53  GLU E CA  1 
ATOM   8271  C C   . GLU E 3 62  ? 245.208 -49.675  19.841  1.00 149.81 ? 53  GLU E C   1 
ATOM   8272  O O   . GLU E 3 62  ? 245.240 -48.445  19.890  1.00 148.46 ? 53  GLU E O   1 
ATOM   8273  C CB  . GLU E 3 62  ? 244.534 -50.512  17.577  1.00 161.02 ? 53  GLU E CB  1 
ATOM   8274  C CG  . GLU E 3 62  ? 244.969 -50.961  16.188  1.00 170.44 ? 53  GLU E CG  1 
ATOM   8275  C CD  . GLU E 3 62  ? 243.846 -51.602  15.386  1.00 177.39 ? 53  GLU E CD  1 
ATOM   8276  O OE1 . GLU E 3 62  ? 242.677 -51.176  15.526  1.00 180.44 ? 53  GLU E OE1 1 
ATOM   8277  O OE2 . GLU E 3 62  ? 244.137 -52.536  14.606  1.00 182.42 ? 53  GLU E OE2 1 
ATOM   8278  N N   . ALA E 3 63  ? 244.782 -50.435  20.848  1.00 146.64 ? 54  ALA E N   1 
ATOM   8279  C CA  . ALA E 3 63  ? 244.308 -49.871  22.110  1.00 146.01 ? 54  ALA E CA  1 
ATOM   8280  C C   . ALA E 3 63  ? 245.440 -49.308  22.978  1.00 146.50 ? 54  ALA E C   1 
ATOM   8281  O O   . ALA E 3 63  ? 245.218 -48.383  23.761  1.00 147.62 ? 54  ALA E O   1 
ATOM   8282  C CB  . ALA E 3 63  ? 243.502 -50.904  22.882  1.00 145.06 ? 54  ALA E CB  1 
ATOM   8283  N N   . GLY E 3 64  ? 246.642 -49.866  22.836  1.00 146.37 ? 55  GLY E N   1 
ATOM   8284  C CA  . GLY E 3 64  ? 247.813 -49.405  23.592  1.00 145.34 ? 55  GLY E CA  1 
ATOM   8285  C C   . GLY E 3 64  ? 248.407 -50.454  24.517  1.00 145.02 ? 55  GLY E C   1 
ATOM   8286  O O   . GLY E 3 64  ? 249.275 -50.149  25.341  1.00 142.89 ? 55  GLY E O   1 
ATOM   8287  N N   . ALA E 3 65  ? 247.932 -51.691  24.372  1.00 146.03 ? 56  ALA E N   1 
ATOM   8288  C CA  . ALA E 3 65  ? 248.388 -52.825  25.172  1.00 146.21 ? 56  ALA E CA  1 
ATOM   8289  C C   . ALA E 3 65  ? 249.663 -53.434  24.591  1.00 147.62 ? 56  ALA E C   1 
ATOM   8290  O O   . ALA E 3 65  ? 250.393 -52.772  23.847  1.00 149.36 ? 56  ALA E O   1 
ATOM   8291  C CB  . ALA E 3 65  ? 247.290 -53.873  25.255  1.00 145.30 ? 56  ALA E CB  1 
ATOM   8292  N N   . GLU E 3 66  ? 249.930 -54.693  24.937  1.00 148.72 ? 57  GLU E N   1 
ATOM   8293  C CA  . GLU E 3 66  ? 251.082 -55.409  24.398  1.00 152.75 ? 57  GLU E CA  1 
ATOM   8294  C C   . GLU E 3 66  ? 250.765 -56.895  24.229  1.00 152.26 ? 57  GLU E C   1 
ATOM   8295  O O   . GLU E 3 66  ? 250.430 -57.579  25.199  1.00 149.33 ? 57  GLU E O   1 
ATOM   8296  C CB  . GLU E 3 66  ? 252.311 -55.194  25.290  1.00 158.13 ? 57  GLU E CB  1 
ATOM   8297  C CG  . GLU E 3 66  ? 253.628 -55.111  24.526  1.00 165.54 ? 57  GLU E CG  1 
ATOM   8298  C CD  . GLU E 3 66  ? 254.679 -54.259  25.226  1.00 169.11 ? 57  GLU E CD  1 
ATOM   8299  O OE1 . GLU E 3 66  ? 254.310 -53.296  25.936  1.00 171.34 ? 57  GLU E OE1 1 
ATOM   8300  O OE2 . GLU E 3 66  ? 255.885 -54.542  25.051  1.00 170.15 ? 57  GLU E OE2 1 
ATOM   8301  N N   . VAL E 3 67  ? 250.855 -57.375  22.989  1.00 155.43 ? 58  VAL E N   1 
ATOM   8302  C CA  . VAL E 3 67  ? 250.566 -58.775  22.656  1.00 160.62 ? 58  VAL E CA  1 
ATOM   8303  C C   . VAL E 3 67  ? 251.843 -59.611  22.663  1.00 167.97 ? 58  VAL E C   1 
ATOM   8304  O O   . VAL E 3 67  ? 252.768 -59.365  21.884  1.00 165.46 ? 58  VAL E O   1 
ATOM   8305  C CB  . VAL E 3 67  ? 249.839 -58.913  21.295  1.00 158.78 ? 58  VAL E CB  1 
ATOM   8306  C CG1 . VAL E 3 67  ? 249.740 -60.373  20.868  1.00 156.76 ? 58  VAL E CG1 1 
ATOM   8307  C CG2 . VAL E 3 67  ? 248.451 -58.296  21.370  1.00 159.72 ? 58  VAL E CG2 1 
ATOM   8308  N N   . VAL E 3 68  ? 251.876 -60.599  23.553  1.00 182.06 ? 59  VAL E N   1 
ATOM   8309  C CA  . VAL E 3 68  ? 253.045 -61.462  23.738  1.00 197.80 ? 59  VAL E CA  1 
ATOM   8310  C C   . VAL E 3 68  ? 252.643 -62.935  23.891  1.00 208.46 ? 59  VAL E C   1 
ATOM   8311  O O   . VAL E 3 68  ? 251.471 -63.285  23.730  1.00 209.48 ? 59  VAL E O   1 
ATOM   8312  C CB  . VAL E 3 68  ? 253.905 -61.012  24.949  1.00 199.63 ? 59  VAL E CB  1 
ATOM   8313  C CG1 . VAL E 3 68  ? 254.788 -59.826  24.578  1.00 198.62 ? 59  VAL E CG1 1 
ATOM   8314  C CG2 . VAL E 3 68  ? 253.032 -60.691  26.158  1.00 202.80 ? 59  VAL E CG2 1 
ATOM   8315  N N   . GLU E 3 69  ? 253.626 -63.788  24.185  1.00 221.28 ? 60  GLU E N   1 
ATOM   8316  C CA  . GLU E 3 69  ? 253.389 -65.210  24.457  1.00 229.64 ? 60  GLU E CA  1 
ATOM   8317  C C   . GLU E 3 69  ? 253.280 -65.507  25.957  1.00 232.69 ? 60  GLU E C   1 
ATOM   8318  O O   . GLU E 3 69  ? 253.859 -64.797  26.786  1.00 233.82 ? 60  GLU E O   1 
ATOM   8319  C CB  . GLU E 3 69  ? 254.483 -66.081  23.820  1.00 232.33 ? 60  GLU E CB  1 
ATOM   8320  C CG  . GLU E 3 69  ? 254.026 -66.918  22.627  1.00 232.63 ? 60  GLU E CG  1 
ATOM   8321  C CD  . GLU E 3 69  ? 254.219 -66.235  21.278  1.00 232.52 ? 60  GLU E CD  1 
ATOM   8322  O OE1 . GLU E 3 69  ? 253.959 -65.017  21.162  1.00 233.51 ? 60  GLU E OE1 1 
ATOM   8323  O OE2 . GLU E 3 69  ? 254.622 -66.929  20.319  1.00 229.92 ? 60  GLU E OE2 1 
ATOM   8324  N N   . ARG E 3 70  ? 252.533 -66.562  26.283  1.00 234.89 ? 61  ARG E N   1 
ATOM   8325  C CA  . ARG E 3 70  ? 252.310 -67.015  27.661  1.00 236.55 ? 61  ARG E CA  1 
ATOM   8326  C C   . ARG E 3 70  ? 253.635 -67.360  28.350  1.00 233.77 ? 61  ARG E C   1 
ATOM   8327  O O   . ARG E 3 70  ? 254.526 -67.948  27.733  1.00 238.80 ? 61  ARG E O   1 
ATOM   8328  C CB  . ARG E 3 70  ? 251.381 -68.234  27.651  1.00 241.23 ? 61  ARG E CB  1 
ATOM   8329  C CG  . ARG E 3 70  ? 250.598 -68.496  28.931  1.00 246.21 ? 61  ARG E CG  1 
ATOM   8330  C CD  . ARG E 3 70  ? 249.724 -69.729  28.740  1.00 250.32 ? 61  ARG E CD  1 
ATOM   8331  N NE  . ARG E 3 70  ? 248.941 -70.102  29.919  1.00 253.32 ? 61  ARG E NE  1 
ATOM   8332  C CZ  . ARG E 3 70  ? 247.622 -69.952  30.031  1.00 255.44 ? 61  ARG E CZ  1 
ATOM   8333  N NH1 . ARG E 3 70  ? 247.003 -70.338  31.138  1.00 255.22 ? 61  ARG E NH1 1 
ATOM   8334  N NH2 . ARG E 3 70  ? 246.916 -69.423  29.039  1.00 257.72 ? 61  ARG E NH2 1 
ATOM   8335  N N   . GLY E 3 71  ? 253.754 -66.986  29.623  1.00 226.23 ? 62  GLY E N   1 
ATOM   8336  C CA  . GLY E 3 71  ? 254.996 -67.168  30.381  1.00 213.27 ? 62  GLY E CA  1 
ATOM   8337  C C   . GLY E 3 71  ? 255.758 -65.863  30.506  1.00 199.73 ? 62  GLY E C   1 
ATOM   8338  O O   . GLY E 3 71  ? 256.145 -65.456  31.605  1.00 199.67 ? 62  GLY E O   1 
ATOM   8339  N N   . GLU E 3 72  ? 255.974 -65.212  29.364  1.00 185.34 ? 63  GLU E N   1 
ATOM   8340  C CA  . GLU E 3 72  ? 256.515 -63.858  29.314  1.00 173.56 ? 63  GLU E CA  1 
ATOM   8341  C C   . GLU E 3 72  ? 255.463 -62.853  29.791  1.00 172.97 ? 63  GLU E C   1 
ATOM   8342  O O   . GLU E 3 72  ? 255.782 -61.701  30.089  1.00 172.62 ? 63  GLU E O   1 
ATOM   8343  C CB  . GLU E 3 72  ? 256.951 -63.517  27.885  1.00 166.16 ? 63  GLU E CB  1 
ATOM   8344  C CG  . GLU E 3 72  ? 258.207 -64.239  27.410  1.00 160.01 ? 63  GLU E CG  1 
ATOM   8345  C CD  . GLU E 3 72  ? 259.490 -63.522  27.800  1.00 157.67 ? 63  GLU E CD  1 
ATOM   8346  O OE1 . GLU E 3 72  ? 260.453 -64.214  28.203  1.00 154.04 ? 63  GLU E OE1 1 
ATOM   8347  O OE2 . GLU E 3 72  ? 259.538 -62.275  27.699  1.00 158.19 ? 63  GLU E OE2 1 
ATOM   8348  N N   . LEU E 3 73  ? 254.215 -63.314  29.868  1.00 172.95 ? 64  LEU E N   1 
ATOM   8349  C CA  . LEU E 3 73  ? 253.058 -62.478  30.193  1.00 172.87 ? 64  LEU E CA  1 
ATOM   8350  C C   . LEU E 3 73  ? 253.020 -62.001  31.648  1.00 167.96 ? 64  LEU E C   1 
ATOM   8351  O O   . LEU E 3 73  ? 252.688 -60.844  31.915  1.00 165.78 ? 64  LEU E O   1 
ATOM   8352  C CB  . LEU E 3 73  ? 251.762 -63.231  29.846  1.00 178.74 ? 64  LEU E CB  1 
ATOM   8353  C CG  . LEU E 3 73  ? 250.378 -62.597  30.052  1.00 182.33 ? 64  LEU E CG  1 
ATOM   8354  C CD1 . LEU E 3 73  ? 250.140 -61.439  29.094  1.00 183.63 ? 64  LEU E CD1 1 
ATOM   8355  C CD2 . LEU E 3 73  ? 249.286 -63.645  29.890  1.00 183.72 ? 64  LEU E CD2 1 
ATOM   8356  N N   . LEU E 3 74  ? 253.363 -62.888  32.580  1.00 163.62 ? 65  LEU E N   1 
ATOM   8357  C CA  . LEU E 3 74  ? 253.144 -62.618  34.002  1.00 161.25 ? 65  LEU E CA  1 
ATOM   8358  C C   . LEU E 3 74  ? 254.378 -62.140  34.771  1.00 157.36 ? 65  LEU E C   1 
ATOM   8359  O O   . LEU E 3 74  ? 254.300 -61.866  35.971  1.00 155.99 ? 65  LEU E O   1 
ATOM   8360  C CB  . LEU E 3 74  ? 252.512 -63.838  34.686  1.00 165.76 ? 65  LEU E CB  1 
ATOM   8361  C CG  . LEU E 3 74  ? 251.749 -63.599  35.997  1.00 170.45 ? 65  LEU E CG  1 
ATOM   8362  C CD1 . LEU E 3 74  ? 250.717 -62.482  35.872  1.00 173.46 ? 65  LEU E CD1 1 
ATOM   8363  C CD2 . LEU E 3 74  ? 251.090 -64.882  36.474  1.00 173.06 ? 65  LEU E CD2 1 
ATOM   8364  N N   . LYS E 3 75  ? 255.510 -62.028  34.085  1.00 154.95 ? 66  LYS E N   1 
ATOM   8365  C CA  . LYS E 3 75  ? 256.704 -61.471  34.711  1.00 154.54 ? 66  LYS E CA  1 
ATOM   8366  C C   . LYS E 3 75  ? 256.619 -59.937  34.755  1.00 153.34 ? 66  LYS E C   1 
ATOM   8367  O O   . LYS E 3 75  ? 256.703 -59.268  33.722  1.00 155.54 ? 66  LYS E O   1 
ATOM   8368  C CB  . LYS E 3 75  ? 257.982 -61.973  34.014  1.00 154.97 ? 66  LYS E CB  1 
ATOM   8369  C CG  . LYS E 3 75  ? 258.347 -63.419  34.355  1.00 152.54 ? 66  LYS E CG  1 
ATOM   8370  C CD  . LYS E 3 75  ? 259.732 -63.828  33.855  1.00 149.58 ? 66  LYS E CD  1 
ATOM   8371  C CE  . LYS E 3 75  ? 259.673 -64.596  32.539  1.00 146.94 ? 66  LYS E CE  1 
ATOM   8372  N NZ  . LYS E 3 75  ? 260.985 -65.210  32.180  1.00 142.83 ? 66  LYS E NZ  1 
ATOM   8373  N N   . GLY E 3 76  ? 256.414 -59.399  35.958  1.00 149.58 ? 67  GLY E N   1 
ATOM   8374  C CA  . GLY E 3 76  ? 256.342 -57.951  36.181  1.00 144.98 ? 67  GLY E CA  1 
ATOM   8375  C C   . GLY E 3 76  ? 254.983 -57.435  36.627  1.00 142.47 ? 67  GLY E C   1 
ATOM   8376  O O   . GLY E 3 76  ? 254.899 -56.419  37.325  1.00 141.94 ? 67  GLY E O   1 
ATOM   8377  N N   . ALA E 3 77  ? 253.926 -58.146  36.230  1.00 140.10 ? 68  ALA E N   1 
ATOM   8378  C CA  . ALA E 3 77  ? 252.538 -57.721  36.453  1.00 136.06 ? 68  ALA E CA  1 
ATOM   8379  C C   . ALA E 3 77  ? 252.150 -57.592  37.927  1.00 131.20 ? 68  ALA E C   1 
ATOM   8380  O O   . ALA E 3 77  ? 252.692 -58.287  38.791  1.00 133.08 ? 68  ALA E O   1 
ATOM   8381  C CB  . ALA E 3 77  ? 251.576 -58.655  35.728  1.00 137.17 ? 68  ALA E CB  1 
ATOM   8382  N N   . HIS E 3 78  ? 251.215 -56.685  38.199  1.00 121.75 ? 69  HIS E N   1 
ATOM   8383  C CA  . HIS E 3 78  ? 250.668 -56.499  39.538  1.00 112.42 ? 69  HIS E CA  1 
ATOM   8384  C C   . HIS E 3 78  ? 249.218 -56.969  39.586  1.00 109.30 ? 69  HIS E C   1 
ATOM   8385  O O   . HIS E 3 78  ? 248.712 -57.343  40.645  1.00 108.62 ? 69  HIS E O   1 
ATOM   8386  C CB  . HIS E 3 78  ? 250.759 -55.033  39.962  1.00 108.35 ? 69  HIS E CB  1 
ATOM   8387  C CG  . HIS E 3 78  ? 252.161 -54.516  40.064  1.00 103.88 ? 69  HIS E CG  1 
ATOM   8388  N ND1 . HIS E 3 78  ? 252.696 -53.634  39.152  1.00 102.75 ? 69  HIS E ND1 1 
ATOM   8389  C CD2 . HIS E 3 78  ? 253.136 -54.757  40.972  1.00 100.86 ? 69  HIS E CD2 1 
ATOM   8390  C CE1 . HIS E 3 78  ? 253.942 -53.353  39.492  1.00 100.76 ? 69  HIS E CE1 1 
ATOM   8391  N NE2 . HIS E 3 78  ? 254.233 -54.022  40.593  1.00 99.53  ? 69  HIS E NE2 1 
ATOM   8392  N N   . LEU E 3 79  ? 248.558 -56.945  38.431  1.00 105.82 ? 70  LEU E N   1 
ATOM   8393  C CA  . LEU E 3 79  ? 247.164 -57.344  38.336  1.00 104.64 ? 70  LEU E CA  1 
ATOM   8394  C C   . LEU E 3 79  ? 246.947 -58.370  37.246  1.00 107.56 ? 70  LEU E C   1 
ATOM   8395  O O   . LEU E 3 79  ? 247.356 -58.175  36.102  1.00 103.00 ? 70  LEU E O   1 
ATOM   8396  C CB  . LEU E 3 79  ? 246.278 -56.131  38.076  1.00 102.33 ? 70  LEU E CB  1 
ATOM   8397  C CG  . LEU E 3 79  ? 246.149 -55.103  39.195  1.00 102.22 ? 70  LEU E CG  1 
ATOM   8398  C CD1 . LEU E 3 79  ? 245.653 -53.790  38.618  1.00 102.17 ? 70  LEU E CD1 1 
ATOM   8399  C CD2 . LEU E 3 79  ? 245.226 -55.602  40.299  1.00 102.53 ? 70  LEU E CD2 1 
ATOM   8400  N N   . LEU E 3 80  ? 246.301 -59.467  37.620  1.00 117.41 ? 71  LEU E N   1 
ATOM   8401  C CA  . LEU E 3 80  ? 245.902 -60.489  36.670  1.00 131.68 ? 71  LEU E CA  1 
ATOM   8402  C C   . LEU E 3 80  ? 244.381 -60.509  36.590  1.00 136.44 ? 71  LEU E C   1 
ATOM   8403  O O   . LEU E 3 80  ? 243.698 -60.549  37.618  1.00 137.81 ? 71  LEU E O   1 
ATOM   8404  C CB  . LEU E 3 80  ? 246.418 -61.864  37.106  1.00 140.27 ? 71  LEU E CB  1 
ATOM   8405  C CG  . LEU E 3 80  ? 246.892 -62.896  36.066  1.00 148.58 ? 71  LEU E CG  1 
ATOM   8406  C CD1 . LEU E 3 80  ? 246.794 -64.298  36.652  1.00 152.78 ? 71  LEU E CD1 1 
ATOM   8407  C CD2 . LEU E 3 80  ? 246.142 -62.829  34.740  1.00 151.51 ? 71  LEU E CD2 1 
ATOM   8408  N N   . PHE E 3 81  ? 243.862 -60.472  35.365  1.00 141.86 ? 72  PHE E N   1 
ATOM   8409  C CA  . PHE E 3 81  ? 242.422 -60.458  35.113  1.00 145.13 ? 72  PHE E CA  1 
ATOM   8410  C C   . PHE E 3 81  ? 242.013 -61.699  34.309  1.00 147.57 ? 72  PHE E C   1 
ATOM   8411  O O   . PHE E 3 81  ? 242.125 -61.713  33.082  1.00 148.35 ? 72  PHE E O   1 
ATOM   8412  C CB  . PHE E 3 81  ? 242.032 -59.165  34.372  1.00 143.83 ? 72  PHE E CB  1 
ATOM   8413  C CG  . PHE E 3 81  ? 242.004 -57.927  35.245  1.00 142.59 ? 72  PHE E CG  1 
ATOM   8414  C CD1 . PHE E 3 81  ? 242.811 -57.812  36.377  1.00 141.80 ? 72  PHE E CD1 1 
ATOM   8415  C CD2 . PHE E 3 81  ? 241.181 -56.856  34.913  1.00 141.93 ? 72  PHE E CD2 1 
ATOM   8416  C CE1 . PHE E 3 81  ? 242.781 -56.674  37.167  1.00 141.39 ? 72  PHE E CE1 1 
ATOM   8417  C CE2 . PHE E 3 81  ? 241.147 -55.713  35.698  1.00 141.91 ? 72  PHE E CE2 1 
ATOM   8418  C CZ  . PHE E 3 81  ? 241.949 -55.621  36.825  1.00 141.93 ? 72  PHE E CZ  1 
ATOM   8419  N N   . THR E 3 82  ? 241.553 -62.739  35.010  1.00 149.13 ? 73  THR E N   1 
ATOM   8420  C CA  . THR E 3 82  ? 241.171 -64.018  34.388  1.00 149.21 ? 73  THR E CA  1 
ATOM   8421  C C   . THR E 3 82  ? 239.658 -64.214  34.359  1.00 150.35 ? 73  THR E C   1 
ATOM   8422  O O   . THR E 3 82  ? 238.950 -63.708  35.229  1.00 151.27 ? 73  THR E O   1 
ATOM   8423  C CB  . THR E 3 82  ? 241.765 -65.233  35.143  1.00 147.78 ? 73  THR E CB  1 
ATOM   8424  O OG1 . THR E 3 82  ? 241.326 -65.220  36.509  1.00 146.11 ? 73  THR E OG1 1 
ATOM   8425  C CG2 . THR E 3 82  ? 243.284 -65.231  35.099  1.00 147.20 ? 73  THR E CG2 1 
ATOM   8426  N N   . VAL E 3 83  ? 239.171 -64.959  33.366  1.00 150.57 ? 74  VAL E N   1 
ATOM   8427  C CA  . VAL E 3 83  ? 237.775 -65.403  33.351  1.00 149.26 ? 74  VAL E CA  1 
ATOM   8428  C C   . VAL E 3 83  ? 237.643 -66.553  34.350  1.00 146.93 ? 74  VAL E C   1 
ATOM   8429  O O   . VAL E 3 83  ? 237.229 -66.340  35.489  1.00 146.77 ? 74  VAL E O   1 
ATOM   8430  C CB  . VAL E 3 83  ? 237.296 -65.828  31.940  1.00 150.20 ? 74  VAL E CB  1 
ATOM   8431  C CG1 . VAL E 3 83  ? 235.825 -66.230  31.961  1.00 149.57 ? 74  VAL E CG1 1 
ATOM   8432  C CG2 . VAL E 3 83  ? 237.522 -64.709  30.934  1.00 151.46 ? 74  VAL E CG2 1 
ATOM   8433  N N   . GLN E 3 84  ? 238.012 -67.760  33.926  1.00 143.95 ? 75  GLN E N   1 
ATOM   8434  C CA  . GLN E 3 84  ? 238.072 -68.906  34.826  1.00 142.04 ? 75  GLN E CA  1 
ATOM   8435  C C   . GLN E 3 84  ? 239.390 -68.906  35.599  1.00 141.85 ? 75  GLN E C   1 
ATOM   8436  O O   . GLN E 3 84  ? 240.348 -68.254  35.178  1.00 141.13 ? 75  GLN E O   1 
ATOM   8437  C CB  . GLN E 3 84  ? 237.901 -70.216  34.056  1.00 141.13 ? 75  GLN E CB  1 
ATOM   8438  C CG  . GLN E 3 84  ? 236.464 -70.706  34.011  1.00 141.09 ? 75  GLN E CG  1 
ATOM   8439  C CD  . GLN E 3 84  ? 236.343 -72.202  34.244  1.00 141.09 ? 75  GLN E CD  1 
ATOM   8440  O OE1 . GLN E 3 84  ? 237.054 -72.778  35.075  1.00 138.76 ? 75  GLN E OE1 1 
ATOM   8441  N NE2 . GLN E 3 84  ? 235.429 -72.838  33.521  1.00 142.64 ? 75  GLN E NE2 1 
ATOM   8442  N N   . PRO E 3 85  ? 239.443 -69.634  36.733  1.00 142.49 ? 76  PRO E N   1 
ATOM   8443  C CA  . PRO E 3 85  ? 240.660 -69.688  37.543  1.00 145.41 ? 76  PRO E CA  1 
ATOM   8444  C C   . PRO E 3 85  ? 241.894 -70.055  36.716  1.00 149.95 ? 76  PRO E C   1 
ATOM   8445  O O   . PRO E 3 85  ? 241.841 -71.011  35.936  1.00 150.51 ? 76  PRO E O   1 
ATOM   8446  C CB  . PRO E 3 85  ? 240.356 -70.793  38.565  1.00 143.57 ? 76  PRO E CB  1 
ATOM   8447  C CG  . PRO E 3 85  ? 239.188 -71.534  38.009  1.00 140.15 ? 76  PRO E CG  1 
ATOM   8448  C CD  . PRO E 3 85  ? 238.391 -70.496  37.295  1.00 140.69 ? 76  PRO E CD  1 
ATOM   8449  N N   . PRO E 3 86  ? 242.993 -69.287  36.872  1.00 154.25 ? 77  PRO E N   1 
ATOM   8450  C CA  . PRO E 3 86  ? 244.248 -69.534  36.158  1.00 159.40 ? 77  PRO E CA  1 
ATOM   8451  C C   . PRO E 3 86  ? 244.835 -70.908  36.485  1.00 169.02 ? 77  PRO E C   1 
ATOM   8452  O O   . PRO E 3 86  ? 244.788 -71.331  37.641  1.00 167.72 ? 77  PRO E O   1 
ATOM   8453  C CB  . PRO E 3 86  ? 245.173 -68.423  36.669  1.00 156.03 ? 77  PRO E CB  1 
ATOM   8454  C CG  . PRO E 3 86  ? 244.572 -67.977  37.958  1.00 154.86 ? 77  PRO E CG  1 
ATOM   8455  C CD  . PRO E 3 86  ? 243.095 -68.114  37.758  1.00 154.11 ? 77  PRO E CD  1 
ATOM   8456  N N   . PRO E 3 87  ? 245.368 -71.610  35.466  1.00 180.38 ? 78  PRO E N   1 
ATOM   8457  C CA  . PRO E 3 87  ? 245.925 -72.958  35.618  1.00 188.46 ? 78  PRO E CA  1 
ATOM   8458  C C   . PRO E 3 87  ? 247.358 -72.982  36.168  1.00 193.34 ? 78  PRO E C   1 
ATOM   8459  O O   . PRO E 3 87  ? 247.919 -71.928  36.479  1.00 191.85 ? 78  PRO E O   1 
ATOM   8460  C CB  . PRO E 3 87  ? 245.895 -73.519  34.182  1.00 189.61 ? 78  PRO E CB  1 
ATOM   8461  C CG  . PRO E 3 87  ? 245.120 -72.532  33.365  1.00 187.84 ? 78  PRO E CG  1 
ATOM   8462  C CD  . PRO E 3 87  ? 245.309 -71.216  34.050  1.00 183.94 ? 78  PRO E CD  1 
ATOM   8463  N N   . GLU E 3 88  ? 247.922 -74.190  36.277  1.00 199.70 ? 79  GLU E N   1 
ATOM   8464  C CA  . GLU E 3 88  ? 249.291 -74.440  36.768  1.00 201.33 ? 79  GLU E CA  1 
ATOM   8465  C C   . GLU E 3 88  ? 250.322 -73.416  36.291  1.00 195.55 ? 79  GLU E C   1 
ATOM   8466  O O   . GLU E 3 88  ? 250.821 -72.616  37.085  1.00 200.14 ? 79  GLU E O   1 
ATOM   8467  C CB  . GLU E 3 88  ? 249.752 -75.856  36.373  1.00 207.59 ? 79  GLU E CB  1 
ATOM   8468  C CG  . GLU E 3 88  ? 249.716 -76.906  37.481  1.00 211.91 ? 79  GLU E CG  1 
ATOM   8469  C CD  . GLU E 3 88  ? 251.102 -77.331  37.950  1.00 212.20 ? 79  GLU E CD  1 
ATOM   8470  O OE1 . GLU E 3 88  ? 251.497 -78.487  37.678  1.00 209.82 ? 79  GLU E OE1 1 
ATOM   8471  O OE2 . GLU E 3 88  ? 251.803 -76.515  38.587  1.00 213.97 ? 79  GLU E OE2 1 
ATOM   8472  N N   . ASP E 3 89  ? 250.620 -73.443  34.992  1.00 183.83 ? 80  ASP E N   1 
ATOM   8473  C CA  . ASP E 3 89  ? 251.658 -72.602  34.384  1.00 173.32 ? 80  ASP E CA  1 
ATOM   8474  C C   . ASP E 3 89  ? 251.468 -71.096  34.601  1.00 168.07 ? 80  ASP E C   1 
ATOM   8475  O O   . ASP E 3 89  ? 252.420 -70.323  34.461  1.00 165.57 ? 80  ASP E O   1 
ATOM   8476  C CB  . ASP E 3 89  ? 251.786 -72.912  32.889  1.00 171.23 ? 80  ASP E CB  1 
ATOM   8477  C CG  . ASP E 3 89  ? 250.452 -72.879  32.168  1.00 170.89 ? 80  ASP E CG  1 
ATOM   8478  O OD1 . ASP E 3 89  ? 249.546 -73.659  32.536  1.00 169.96 ? 80  ASP E OD1 1 
ATOM   8479  O OD2 . ASP E 3 89  ? 250.314 -72.078  31.223  1.00 171.53 ? 80  ASP E OD2 1 
ATOM   8480  N N   . LEU E 3 90  ? 250.245 -70.688  34.935  1.00 163.35 ? 81  LEU E N   1 
ATOM   8481  C CA  . LEU E 3 90  ? 249.970 -69.304  35.318  1.00 161.30 ? 81  LEU E CA  1 
ATOM   8482  C C   . LEU E 3 90  ? 250.188 -69.078  36.810  1.00 164.38 ? 81  LEU E C   1 
ATOM   8483  O O   . LEU E 3 90  ? 250.813 -68.093  37.205  1.00 164.26 ? 81  LEU E O   1 
ATOM   8484  C CB  . LEU E 3 90  ? 248.547 -68.892  34.932  1.00 157.44 ? 81  LEU E CB  1 
ATOM   8485  C CG  . LEU E 3 90  ? 248.258 -68.531  33.474  1.00 156.00 ? 81  LEU E CG  1 
ATOM   8486  C CD1 . LEU E 3 90  ? 246.890 -67.874  33.373  1.00 154.72 ? 81  LEU E CD1 1 
ATOM   8487  C CD2 . LEU E 3 90  ? 249.325 -67.621  32.880  1.00 156.00 ? 81  LEU E CD2 1 
ATOM   8488  N N   . ILE E 3 91  ? 249.670 -69.995  37.625  1.00 169.07 ? 82  ILE E N   1 
ATOM   8489  C CA  . ILE E 3 91  ? 249.802 -69.934  39.085  1.00 175.16 ? 82  ILE E CA  1 
ATOM   8490  C C   . ILE E 3 91  ? 251.272 -69.880  39.531  1.00 188.58 ? 82  ILE E C   1 
ATOM   8491  O O   . ILE E 3 91  ? 251.610 -69.179  40.490  1.00 191.86 ? 82  ILE E O   1 
ATOM   8492  C CB  . ILE E 3 91  ? 249.069 -71.118  39.763  1.00 166.57 ? 82  ILE E CB  1 
ATOM   8493  C CG1 . ILE E 3 91  ? 247.559 -71.024  39.524  1.00 159.77 ? 82  ILE E CG1 1 
ATOM   8494  C CG2 . ILE E 3 91  ? 249.356 -71.152  41.256  1.00 164.69 ? 82  ILE E CG2 1 
ATOM   8495  C CD1 . ILE E 3 91  ? 246.815 -72.321  39.755  1.00 153.82 ? 82  ILE E CD1 1 
ATOM   8496  N N   . GLN E 3 92  ? 252.133 -70.611  38.824  1.00 203.78 ? 83  GLN E N   1 
ATOM   8497  C CA  . GLN E 3 92  ? 253.571 -70.643  39.116  1.00 212.64 ? 83  GLN E CA  1 
ATOM   8498  C C   . GLN E 3 92  ? 254.288 -69.371  38.653  1.00 203.20 ? 83  GLN E C   1 
ATOM   8499  O O   . GLN E 3 92  ? 255.282 -68.959  39.256  1.00 203.77 ? 83  GLN E O   1 
ATOM   8500  C CB  . GLN E 3 92  ? 254.228 -71.880  38.486  1.00 229.02 ? 83  GLN E CB  1 
ATOM   8501  C CG  . GLN E 3 92  ? 253.770 -73.217  39.059  1.00 243.89 ? 83  GLN E CG  1 
ATOM   8502  C CD  . GLN E 3 92  ? 254.509 -73.612  40.328  1.00 250.85 ? 83  GLN E CD  1 
ATOM   8503  O OE1 . GLN E 3 92  ? 253.959 -73.543  41.428  1.00 255.72 ? 83  GLN E OE1 1 
ATOM   8504  N NE2 . GLN E 3 92  ? 255.762 -74.030  40.179  1.00 253.08 ? 83  GLN E NE2 1 
ATOM   8505  N N   . ALA E 3 93  ? 253.775 -68.754  37.588  1.00 190.75 ? 84  ALA E N   1 
ATOM   8506  C CA  . ALA E 3 93  ? 254.349 -67.523  37.040  1.00 178.89 ? 84  ALA E CA  1 
ATOM   8507  C C   . ALA E 3 93  ? 254.049 -66.292  37.904  1.00 172.89 ? 84  ALA E C   1 
ATOM   8508  O O   . ALA E 3 93  ? 254.380 -65.164  37.528  1.00 169.92 ? 84  ALA E O   1 
ATOM   8509  C CB  . ALA E 3 93  ? 253.870 -67.308  35.610  1.00 176.57 ? 84  ALA E CB  1 
ATOM   8510  N N   . LEU E 3 94  ? 253.437 -66.523  39.066  1.00 168.12 ? 85  LEU E N   1 
ATOM   8511  C CA  . LEU E 3 94  ? 253.011 -65.453  39.969  1.00 163.75 ? 85  LEU E CA  1 
ATOM   8512  C C   . LEU E 3 94  ? 254.132 -64.807  40.767  1.00 159.05 ? 85  LEU E C   1 
ATOM   8513  O O   . LEU E 3 94  ? 255.021 -65.485  41.286  1.00 158.34 ? 85  LEU E O   1 
ATOM   8514  C CB  . LEU E 3 94  ? 251.930 -65.948  40.932  1.00 165.24 ? 85  LEU E CB  1 
ATOM   8515  C CG  . LEU E 3 94  ? 250.512 -65.448  40.659  1.00 166.69 ? 85  LEU E CG  1 
ATOM   8516  C CD1 . LEU E 3 94  ? 249.491 -66.507  41.038  1.00 167.61 ? 85  LEU E CD1 1 
ATOM   8517  C CD2 . LEU E 3 94  ? 250.245 -64.132  41.381  1.00 165.28 ? 85  LEU E CD2 1 
ATOM   8518  N N   . GLU E 3 95  ? 254.057 -63.484  40.860  1.00 153.80 ? 86  GLU E N   1 
ATOM   8519  C CA  . GLU E 3 95  ? 254.946 -62.697  41.697  1.00 149.05 ? 86  GLU E CA  1 
ATOM   8520  C C   . GLU E 3 95  ? 254.225 -62.380  43.010  1.00 145.99 ? 86  GLU E C   1 
ATOM   8521  O O   . GLU E 3 95  ? 252.991 -62.350  43.045  1.00 143.39 ? 86  GLU E O   1 
ATOM   8522  C CB  . GLU E 3 95  ? 255.350 -61.403  40.978  1.00 148.01 ? 86  GLU E CB  1 
ATOM   8523  C CG  . GLU E 3 95  ? 256.065 -61.615  39.646  1.00 145.57 ? 86  GLU E CG  1 
ATOM   8524  C CD  . GLU E 3 95  ? 256.580 -60.327  39.021  1.00 143.02 ? 86  GLU E CD  1 
ATOM   8525  O OE1 . GLU E 3 95  ? 257.519 -60.407  38.199  1.00 141.84 ? 86  GLU E OE1 1 
ATOM   8526  O OE2 . GLU E 3 95  ? 256.056 -59.235  39.340  1.00 141.14 ? 86  GLU E OE2 1 
ATOM   8527  N N   . PRO E 3 96  ? 254.986 -62.170  44.102  1.00 144.43 ? 87  PRO E N   1 
ATOM   8528  C CA  . PRO E 3 96  ? 254.355 -61.697  45.338  1.00 142.76 ? 87  PRO E CA  1 
ATOM   8529  C C   . PRO E 3 96  ? 253.825 -60.265  45.208  1.00 140.29 ? 87  PRO E C   1 
ATOM   8530  O O   . PRO E 3 96  ? 254.345 -59.479  44.413  1.00 142.38 ? 87  PRO E O   1 
ATOM   8531  C CB  . PRO E 3 96  ? 255.491 -61.765  46.369  1.00 143.77 ? 87  PRO E CB  1 
ATOM   8532  C CG  . PRO E 3 96  ? 256.752 -61.818  45.574  1.00 144.42 ? 87  PRO E CG  1 
ATOM   8533  C CD  . PRO E 3 96  ? 256.399 -62.538  44.309  1.00 144.75 ? 87  PRO E CD  1 
ATOM   8534  N N   . GLY E 3 97  ? 252.788 -59.943  45.978  1.00 135.57 ? 88  GLY E N   1 
ATOM   8535  C CA  . GLY E 3 97  ? 252.167 -58.620  45.930  1.00 129.12 ? 88  GLY E CA  1 
ATOM   8536  C C   . GLY E 3 97  ? 251.317 -58.412  44.691  1.00 124.65 ? 88  GLY E C   1 
ATOM   8537  O O   . GLY E 3 97  ? 250.919 -57.287  44.385  1.00 122.77 ? 88  GLY E O   1 
ATOM   8538  N N   . ALA E 3 98  ? 251.053 -59.503  43.976  1.00 121.73 ? 89  ALA E N   1 
ATOM   8539  C CA  . ALA E 3 98  ? 250.193 -59.482  42.802  1.00 119.92 ? 89  ALA E CA  1 
ATOM   8540  C C   . ALA E 3 98  ? 248.815 -60.006  43.172  1.00 119.28 ? 89  ALA E C   1 
ATOM   8541  O O   . ALA E 3 98  ? 248.691 -60.953  43.955  1.00 116.11 ? 89  ALA E O   1 
ATOM   8542  C CB  . ALA E 3 98  ? 250.796 -60.314  41.684  1.00 119.92 ? 89  ALA E CB  1 
ATOM   8543  N N   . ILE E 3 99  ? 247.787 -59.386  42.597  1.00 121.48 ? 90  ILE E N   1 
ATOM   8544  C CA  . ILE E 3 99  ? 246.401 -59.708  42.928  1.00 124.88 ? 90  ILE E CA  1 
ATOM   8545  C C   . ILE E 3 99  ? 245.712 -60.468  41.795  1.00 129.91 ? 90  ILE E C   1 
ATOM   8546  O O   . ILE E 3 99  ? 245.678 -60.007  40.650  1.00 129.24 ? 90  ILE E O   1 
ATOM   8547  C CB  . ILE E 3 99  ? 245.597 -58.443  43.306  1.00 123.20 ? 90  ILE E CB  1 
ATOM   8548  C CG1 . ILE E 3 99  ? 246.280 -57.711  44.465  1.00 122.92 ? 90  ILE E CG1 1 
ATOM   8549  C CG2 . ILE E 3 99  ? 244.163 -58.800  43.684  1.00 121.65 ? 90  ILE E CG2 1 
ATOM   8550  C CD1 . ILE E 3 99  ? 245.870 -56.260  44.605  1.00 123.82 ? 90  ILE E CD1 1 
ATOM   8551  N N   . VAL E 3 100 ? 245.169 -61.635  42.142  1.00 137.34 ? 91  VAL E N   1 
ATOM   8552  C CA  . VAL E 3 100 ? 244.473 -62.517  41.203  1.00 142.70 ? 91  VAL E CA  1 
ATOM   8553  C C   . VAL E 3 100 ? 242.974 -62.219  41.202  1.00 139.65 ? 91  VAL E C   1 
ATOM   8554  O O   . VAL E 3 100 ? 242.243 -62.604  42.120  1.00 139.33 ? 91  VAL E O   1 
ATOM   8555  C CB  . VAL E 3 100 ? 244.702 -64.013  41.538  1.00 148.22 ? 91  VAL E CB  1 
ATOM   8556  C CG1 . VAL E 3 100 ? 244.056 -64.913  40.490  1.00 151.09 ? 91  VAL E CG1 1 
ATOM   8557  C CG2 . VAL E 3 100 ? 246.188 -64.323  41.671  1.00 151.12 ? 91  VAL E CG2 1 
ATOM   8558  N N   . VAL E 3 101 ? 242.531 -61.534  40.154  1.00 135.47 ? 92  VAL E N   1 
ATOM   8559  C CA  . VAL E 3 101 ? 241.136 -61.149  40.016  1.00 131.02 ? 92  VAL E CA  1 
ATOM   8560  C C   . VAL E 3 101 ? 240.436 -62.104  39.053  1.00 124.63 ? 92  VAL E C   1 
ATOM   8561  O O   . VAL E 3 101 ? 240.971 -62.430  37.991  1.00 124.07 ? 92  VAL E O   1 
ATOM   8562  C CB  . VAL E 3 101 ? 241.000 -59.690  39.518  1.00 134.23 ? 92  VAL E CB  1 
ATOM   8563  C CG1 . VAL E 3 101 ? 239.591 -59.171  39.756  1.00 136.73 ? 92  VAL E CG1 1 
ATOM   8564  C CG2 . VAL E 3 101 ? 242.012 -58.783  40.210  1.00 135.03 ? 92  VAL E CG2 1 
ATOM   8565  N N   . GLY E 3 102 ? 239.250 -62.565  39.437  1.00 118.02 ? 93  GLY E N   1 
ATOM   8566  C CA  . GLY E 3 102 ? 238.440 -63.389  38.553  1.00 112.77 ? 93  GLY E CA  1 
ATOM   8567  C C   . GLY E 3 102 ? 237.732 -64.531  39.241  1.00 109.94 ? 93  GLY E C   1 
ATOM   8568  O O   . GLY E 3 102 ? 237.970 -64.806  40.421  1.00 105.66 ? 93  GLY E O   1 
ATOM   8569  N N   . PHE E 3 103 ? 236.854 -65.190  38.486  1.00 111.97 ? 94  PHE E N   1 
ATOM   8570  C CA  . PHE E 3 103 ? 236.162 -66.385  38.947  1.00 114.86 ? 94  PHE E CA  1 
ATOM   8571  C C   . PHE E 3 103 ? 237.162 -67.401  39.451  1.00 113.47 ? 94  PHE E C   1 
ATOM   8572  O O   . PHE E 3 103 ? 238.255 -67.550  38.898  1.00 112.89 ? 94  PHE E O   1 
ATOM   8573  C CB  . PHE E 3 103 ? 235.351 -67.034  37.823  1.00 120.06 ? 94  PHE E CB  1 
ATOM   8574  C CG  . PHE E 3 103 ? 233.997 -66.424  37.606  1.00 125.16 ? 94  PHE E CG  1 
ATOM   8575  C CD1 . PHE E 3 103 ? 233.008 -66.515  38.582  1.00 127.18 ? 94  PHE E CD1 1 
ATOM   8576  C CD2 . PHE E 3 103 ? 233.696 -65.789  36.406  1.00 128.12 ? 94  PHE E CD2 1 
ATOM   8577  C CE1 . PHE E 3 103 ? 231.753 -65.961  38.373  1.00 129.87 ? 94  PHE E CE1 1 
ATOM   8578  C CE2 . PHE E 3 103 ? 232.443 -65.234  36.190  1.00 130.40 ? 94  PHE E CE2 1 
ATOM   8579  C CZ  . PHE E 3 103 ? 231.470 -65.320  37.175  1.00 130.79 ? 94  PHE E CZ  1 
ATOM   8580  N N   . VAL E 3 104 ? 236.776 -68.091  40.512  1.00 112.85 ? 95  VAL E N   1 
ATOM   8581  C CA  . VAL E 3 104 ? 237.573 -69.175  41.045  1.00 112.47 ? 95  VAL E CA  1 
ATOM   8582  C C   . VAL E 3 104 ? 236.701 -70.429  41.082  1.00 110.01 ? 95  VAL E C   1 
ATOM   8583  O O   . VAL E 3 104 ? 237.084 -71.473  40.546  1.00 108.07 ? 95  VAL E O   1 
ATOM   8584  C CB  . VAL E 3 104 ? 238.145 -68.823  42.440  1.00 114.37 ? 95  VAL E CB  1 
ATOM   8585  C CG1 . VAL E 3 104 ? 238.900 -70.004  43.032  1.00 116.16 ? 95  VAL E CG1 1 
ATOM   8586  C CG2 . VAL E 3 104 ? 239.058 -67.604  42.355  1.00 114.07 ? 95  VAL E CG2 1 
ATOM   8587  N N   . GLN E 3 105 ? 235.510 -70.293  41.672  1.00 108.28 ? 96  GLN E N   1 
ATOM   8588  C CA  . GLN E 3 105 ? 234.606 -71.415  41.947  1.00 107.91 ? 96  GLN E CA  1 
ATOM   8589  C C   . GLN E 3 105 ? 235.375 -72.599  42.541  1.00 113.47 ? 96  GLN E C   1 
ATOM   8590  O O   . GLN E 3 105 ? 235.729 -73.538  41.818  1.00 112.37 ? 96  GLN E O   1 
ATOM   8591  C CB  . GLN E 3 105 ? 233.804 -71.818  40.702  1.00 101.55 ? 96  GLN E CB  1 
ATOM   8592  C CG  . GLN E 3 105 ? 232.631 -70.895  40.395  1.00 95.98  ? 96  GLN E CG  1 
ATOM   8593  C CD  . GLN E 3 105 ? 231.599 -71.525  39.473  1.00 92.44  ? 96  GLN E CD  1 
ATOM   8594  O OE1 . GLN E 3 105 ? 230.395 -71.392  39.691  1.00 89.50  ? 96  GLN E OE1 1 
ATOM   8595  N NE2 . GLN E 3 105 ? 232.066 -72.217  38.439  1.00 91.91  ? 96  GLN E NE2 1 
ATOM   8596  N N   . PRO E 3 106 ? 235.640 -72.548  43.864  1.00 120.26 ? 97  PRO E N   1 
ATOM   8597  C CA  . PRO E 3 106 ? 236.528 -73.492  44.552  1.00 125.53 ? 97  PRO E CA  1 
ATOM   8598  C C   . PRO E 3 106 ? 236.092 -74.951  44.420  1.00 130.75 ? 97  PRO E C   1 
ATOM   8599  O O   . PRO E 3 106 ? 236.932 -75.825  44.209  1.00 131.16 ? 97  PRO E O   1 
ATOM   8600  C CB  . PRO E 3 106 ? 236.453 -73.047  46.022  1.00 124.79 ? 97  PRO E CB  1 
ATOM   8601  C CG  . PRO E 3 106 ? 235.954 -71.643  45.983  1.00 123.58 ? 97  PRO E CG  1 
ATOM   8602  C CD  . PRO E 3 106 ? 235.024 -71.598  44.810  1.00 121.94 ? 97  PRO E CD  1 
ATOM   8603  N N   . HIS E 3 107 ? 234.788 -75.192  44.527  1.00 137.64 ? 98  HIS E N   1 
ATOM   8604  C CA  . HIS E 3 107 ? 234.216 -76.542  44.514  1.00 141.91 ? 98  HIS E CA  1 
ATOM   8605  C C   . HIS E 3 107 ? 234.478 -77.332  43.223  1.00 136.20 ? 98  HIS E C   1 
ATOM   8606  O O   . HIS E 3 107 ? 234.658 -78.551  43.269  1.00 131.92 ? 98  HIS E O   1 
ATOM   8607  C CB  . HIS E 3 107 ? 232.714 -76.484  44.822  1.00 154.26 ? 98  HIS E CB  1 
ATOM   8608  C CG  . HIS E 3 107 ? 231.945 -75.553  43.934  1.00 167.62 ? 98  HIS E CG  1 
ATOM   8609  N ND1 . HIS E 3 107 ? 231.105 -76.003  42.938  1.00 174.17 ? 98  HIS E ND1 1 
ATOM   8610  C CD2 . HIS E 3 107 ? 231.888 -74.200  43.891  1.00 173.73 ? 98  HIS E CD2 1 
ATOM   8611  C CE1 . HIS E 3 107 ? 230.563 -74.968  42.320  1.00 178.11 ? 98  HIS E CE1 1 
ATOM   8612  N NE2 . HIS E 3 107 ? 231.023 -73.862  42.877  1.00 178.05 ? 98  HIS E NE2 1 
ATOM   8613  N N   . LYS E 3 108 ? 234.502 -76.636  42.086  1.00 132.75 ? 99  LYS E N   1 
ATOM   8614  C CA  . LYS E 3 108 ? 234.775 -77.266  40.788  1.00 129.52 ? 99  LYS E CA  1 
ATOM   8615  C C   . LYS E 3 108 ? 236.250 -77.218  40.385  1.00 126.86 ? 99  LYS E C   1 
ATOM   8616  O O   . LYS E 3 108 ? 236.739 -78.116  39.697  1.00 128.76 ? 99  LYS E O   1 
ATOM   8617  C CB  . LYS E 3 108 ? 233.904 -76.657  39.678  1.00 129.45 ? 99  LYS E CB  1 
ATOM   8618  C CG  . LYS E 3 108 ? 232.692 -77.497  39.280  1.00 127.48 ? 99  LYS E CG  1 
ATOM   8619  C CD  . LYS E 3 108 ? 233.060 -78.615  38.307  1.00 124.04 ? 99  LYS E CD  1 
ATOM   8620  C CE  . LYS E 3 108 ? 231.861 -79.490  37.962  1.00 119.92 ? 99  LYS E CE  1 
ATOM   8621  N NZ  . LYS E 3 108 ? 232.223 -80.628  37.067  1.00 115.62 ? 99  LYS E NZ  1 
ATOM   8622  N N   . ASN E 3 109 ? 236.949 -76.169  40.811  1.00 121.22 ? 100 ASN E N   1 
ATOM   8623  C CA  . ASN E 3 109 ? 238.359 -75.996  40.475  1.00 117.21 ? 100 ASN E CA  1 
ATOM   8624  C C   . ASN E 3 109 ? 239.279 -76.210  41.681  1.00 122.34 ? 100 ASN E C   1 
ATOM   8625  O O   . ASN E 3 109 ? 240.265 -75.490  41.852  1.00 124.38 ? 100 ASN E O   1 
ATOM   8626  C CB  . ASN E 3 109 ? 238.583 -74.616  39.852  1.00 108.07 ? 100 ASN E CB  1 
ATOM   8627  C CG  . ASN E 3 109 ? 237.824 -74.433  38.552  1.00 101.77 ? 100 ASN E CG  1 
ATOM   8628  O OD1 . ASN E 3 109 ? 238.223 -74.947  37.507  1.00 97.24  ? 100 ASN E OD1 1 
ATOM   8629  N ND2 . ASN E 3 109 ? 236.730 -73.684  38.609  1.00 99.05  ? 100 ASN E ND2 1 
ATOM   8630  N N   . LEU E 3 110 ? 238.957 -77.222  42.491  1.00 126.97 ? 101 LEU E N   1 
ATOM   8631  C CA  . LEU E 3 110 ? 239.652 -77.516  43.755  1.00 131.00 ? 101 LEU E CA  1 
ATOM   8632  C C   . LEU E 3 110 ? 241.173 -77.648  43.614  1.00 136.36 ? 101 LEU E C   1 
ATOM   8633  O O   . LEU E 3 110 ? 241.920 -77.284  44.527  1.00 136.55 ? 101 LEU E O   1 
ATOM   8634  C CB  . LEU E 3 110 ? 239.079 -78.793  44.388  1.00 128.42 ? 101 LEU E CB  1 
ATOM   8635  C CG  . LEU E 3 110 ? 238.706 -78.868  45.879  1.00 127.11 ? 101 LEU E CG  1 
ATOM   8636  C CD1 . LEU E 3 110 ? 239.682 -78.135  46.795  1.00 125.92 ? 101 LEU E CD1 1 
ATOM   8637  C CD2 . LEU E 3 110 ? 237.284 -78.370  46.103  1.00 126.99 ? 101 LEU E CD2 1 
ATOM   8638  N N   . GLU E 3 111 ? 241.614 -78.177  42.472  1.00 142.89 ? 102 GLU E N   1 
ATOM   8639  C CA  . GLU E 3 111 ? 243.038 -78.339  42.157  1.00 147.71 ? 102 GLU E CA  1 
ATOM   8640  C C   . GLU E 3 111 ? 243.739 -76.996  41.939  1.00 144.01 ? 102 GLU E C   1 
ATOM   8641  O O   . GLU E 3 111 ? 244.761 -76.708  42.569  1.00 143.37 ? 102 GLU E O   1 
ATOM   8642  C CB  . GLU E 3 111 ? 243.214 -79.261  40.934  1.00 154.16 ? 102 GLU E CB  1 
ATOM   8643  C CG  . GLU E 3 111 ? 244.443 -79.003  40.058  1.00 160.61 ? 102 GLU E CG  1 
ATOM   8644  C CD  . GLU E 3 111 ? 245.748 -79.529  40.640  1.00 164.71 ? 102 GLU E CD  1 
ATOM   8645  O OE1 . GLU E 3 111 ? 246.039 -79.273  41.830  1.00 169.01 ? 102 GLU E OE1 1 
ATOM   8646  O OE2 . GLU E 3 111 ? 246.499 -80.192  39.889  1.00 166.44 ? 102 GLU E OE2 1 
ATOM   8647  N N   . LEU E 3 112 ? 243.175 -76.182  41.049  1.00 139.21 ? 103 LEU E N   1 
ATOM   8648  C CA  . LEU E 3 112 ? 243.740 -74.883  40.699  1.00 134.81 ? 103 LEU E CA  1 
ATOM   8649  C C   . LEU E 3 112 ? 243.804 -73.978  41.934  1.00 135.24 ? 103 LEU E C   1 
ATOM   8650  O O   . LEU E 3 112 ? 244.629 -73.064  42.003  1.00 132.66 ? 103 LEU E O   1 
ATOM   8651  C CB  . LEU E 3 112 ? 242.927 -74.234  39.567  1.00 131.73 ? 103 LEU E CB  1 
ATOM   8652  C CG  . LEU E 3 112 ? 242.361 -75.136  38.451  1.00 129.09 ? 103 LEU E CG  1 
ATOM   8653  C CD1 . LEU E 3 112 ? 241.462 -74.358  37.502  1.00 126.43 ? 103 LEU E CD1 1 
ATOM   8654  C CD2 . LEU E 3 112 ? 243.442 -75.869  37.665  1.00 128.86 ? 103 LEU E CD2 1 
ATOM   8655  N N   . VAL E 3 113 ? 242.933 -74.265  42.905  1.00 138.13 ? 104 VAL E N   1 
ATOM   8656  C CA  . VAL E 3 113 ? 242.897 -73.581  44.201  1.00 140.08 ? 104 VAL E CA  1 
ATOM   8657  C C   . VAL E 3 113 ? 244.143 -73.909  45.027  1.00 136.68 ? 104 VAL E C   1 
ATOM   8658  O O   . VAL E 3 113 ? 244.958 -73.026  45.297  1.00 140.55 ? 104 VAL E O   1 
ATOM   8659  C CB  . VAL E 3 113 ? 241.609 -73.925  45.000  1.00 142.83 ? 104 VAL E CB  1 
ATOM   8660  C CG1 . VAL E 3 113 ? 241.674 -73.394  46.429  1.00 144.41 ? 104 VAL E CG1 1 
ATOM   8661  C CG2 . VAL E 3 113 ? 240.374 -73.379  44.297  1.00 145.01 ? 104 VAL E CG2 1 
ATOM   8662  N N   . ARG E 3 114 ? 244.292 -75.178  45.406  1.00 129.22 ? 105 ARG E N   1 
ATOM   8663  C CA  . ARG E 3 114 ? 245.403 -75.616  46.256  1.00 123.57 ? 105 ARG E CA  1 
ATOM   8664  C C   . ARG E 3 114 ? 246.771 -75.375  45.608  1.00 125.38 ? 105 ARG E C   1 
ATOM   8665  O O   . ARG E 3 114 ? 247.801 -75.411  46.285  1.00 125.63 ? 105 ARG E O   1 
ATOM   8666  C CB  . ARG E 3 114 ? 245.241 -77.088  46.643  1.00 116.70 ? 105 ARG E CB  1 
ATOM   8667  C CG  . ARG E 3 114 ? 243.999 -77.387  47.466  1.00 109.07 ? 105 ARG E CG  1 
ATOM   8668  C CD  . ARG E 3 114 ? 243.913 -78.870  47.776  1.00 104.12 ? 105 ARG E CD  1 
ATOM   8669  N NE  . ARG E 3 114 ? 242.596 -79.250  48.273  1.00 100.19 ? 105 ARG E NE  1 
ATOM   8670  C CZ  . ARG E 3 114 ? 242.246 -79.255  49.555  1.00 98.65  ? 105 ARG E CZ  1 
ATOM   8671  N NH1 . ARG E 3 114 ? 241.021 -79.622  49.901  1.00 97.91  ? 105 ARG E NH1 1 
ATOM   8672  N NH2 . ARG E 3 114 ? 243.115 -78.898  50.493  1.00 97.51  ? 105 ARG E NH2 1 
ATOM   8673  N N   . ALA E 3 115 ? 246.764 -75.121  44.300  1.00 127.29 ? 106 ALA E N   1 
ATOM   8674  C CA  . ALA E 3 115 ? 247.972 -74.774  43.557  1.00 131.01 ? 106 ALA E CA  1 
ATOM   8675  C C   . ALA E 3 115 ? 248.431 -73.348  43.861  1.00 136.31 ? 106 ALA E C   1 
ATOM   8676  O O   . ALA E 3 115 ? 249.631 -73.069  43.882  1.00 136.11 ? 106 ALA E O   1 
ATOM   8677  C CB  . ALA E 3 115 ? 247.742 -74.953  42.065  1.00 128.02 ? 106 ALA E CB  1 
ATOM   8678  N N   . LEU E 3 116 ? 247.471 -72.457  44.103  1.00 145.43 ? 107 LEU E N   1 
ATOM   8679  C CA  . LEU E 3 116 ? 247.749 -71.043  44.380  1.00 156.36 ? 107 LEU E CA  1 
ATOM   8680  C C   . LEU E 3 116 ? 248.359 -70.769  45.763  1.00 166.64 ? 107 LEU E C   1 
ATOM   8681  O O   . LEU E 3 116 ? 248.896 -69.682  46.001  1.00 167.50 ? 107 LEU E O   1 
ATOM   8682  C CB  . LEU E 3 116 ? 246.481 -70.201  44.183  1.00 155.36 ? 107 LEU E CB  1 
ATOM   8683  C CG  . LEU E 3 116 ? 246.071 -69.847  42.751  1.00 153.88 ? 107 LEU E CG  1 
ATOM   8684  C CD1 . LEU E 3 116 ? 244.563 -69.695  42.633  1.00 155.08 ? 107 LEU E CD1 1 
ATOM   8685  C CD2 . LEU E 3 116 ? 246.772 -68.580  42.289  1.00 153.50 ? 107 LEU E CD2 1 
ATOM   8686  N N   . GLN E 3 117 ? 248.276 -71.752  46.661  1.00 180.60 ? 108 GLN E N   1 
ATOM   8687  C CA  . GLN E 3 117 ? 248.786 -71.616  48.032  1.00 191.66 ? 108 GLN E CA  1 
ATOM   8688  C C   . GLN E 3 117 ? 250.299 -71.830  48.149  1.00 190.82 ? 108 GLN E C   1 
ATOM   8689  O O   . GLN E 3 117 ? 250.950 -71.212  48.996  1.00 193.87 ? 108 GLN E O   1 
ATOM   8690  C CB  . GLN E 3 117 ? 248.049 -72.563  48.992  1.00 203.53 ? 108 GLN E CB  1 
ATOM   8691  C CG  . GLN E 3 117 ? 246.697 -72.051  49.477  1.00 215.60 ? 108 GLN E CG  1 
ATOM   8692  C CD  . GLN E 3 117 ? 246.109 -72.880  50.612  1.00 222.82 ? 108 GLN E CD  1 
ATOM   8693  O OE1 . GLN E 3 117 ? 245.834 -72.359  51.694  1.00 227.61 ? 108 GLN E OE1 1 
ATOM   8694  N NE2 . GLN E 3 117 ? 245.910 -74.174  50.368  1.00 223.93 ? 108 GLN E NE2 1 
ATOM   8695  N N   . ALA E 3 118 ? 250.848 -72.701  47.301  1.00 186.84 ? 109 ALA E N   1 
ATOM   8696  C CA  . ALA E 3 118 ? 252.278 -73.038  47.330  1.00 181.79 ? 109 ALA E CA  1 
ATOM   8697  C C   . ALA E 3 118 ? 253.174 -71.908  46.818  1.00 178.26 ? 109 ALA E C   1 
ATOM   8698  O O   . ALA E 3 118 ? 254.396 -71.934  47.016  1.00 174.89 ? 109 ALA E O   1 
ATOM   8699  C CB  . ALA E 3 118 ? 252.538 -74.319  46.549  1.00 181.83 ? 109 ALA E CB  1 
ATOM   8700  N N   . LYS E 3 119 ? 252.561 -70.925  46.160  1.00 175.78 ? 110 LYS E N   1 
ATOM   8701  C CA  . LYS E 3 119 ? 253.276 -69.754  45.662  1.00 172.47 ? 110 LYS E CA  1 
ATOM   8702  C C   . LYS E 3 119 ? 252.883 -68.473  46.410  1.00 171.20 ? 110 LYS E C   1 
ATOM   8703  O O   . LYS E 3 119 ? 253.466 -67.408  46.179  1.00 176.75 ? 110 LYS E O   1 
ATOM   8704  C CB  . LYS E 3 119 ? 253.068 -69.598  44.149  1.00 169.60 ? 110 LYS E CB  1 
ATOM   8705  C CG  . LYS E 3 119 ? 254.272 -69.037  43.395  1.00 165.83 ? 110 LYS E CG  1 
ATOM   8706  C CD  . LYS E 3 119 ? 255.423 -70.038  43.304  1.00 161.84 ? 110 LYS E CD  1 
ATOM   8707  C CE  . LYS E 3 119 ? 256.390 -69.917  44.477  1.00 158.75 ? 110 LYS E CE  1 
ATOM   8708  N NZ  . LYS E 3 119 ? 257.258 -71.119  44.647  1.00 154.68 ? 110 LYS E NZ  1 
ATOM   8709  N N   . LYS E 3 120 ? 251.902 -68.597  47.307  1.00 162.66 ? 111 LYS E N   1 
ATOM   8710  C CA  . LYS E 3 120 ? 251.437 -67.501  48.175  1.00 150.55 ? 111 LYS E CA  1 
ATOM   8711  C C   . LYS E 3 120 ? 251.046 -66.232  47.400  1.00 140.78 ? 111 LYS E C   1 
ATOM   8712  O O   . LYS E 3 120 ? 251.732 -65.206  47.459  1.00 140.50 ? 111 LYS E O   1 
ATOM   8713  C CB  . LYS E 3 120 ? 252.454 -67.209  49.297  1.00 150.39 ? 111 LYS E CB  1 
ATOM   8714  C CG  . LYS E 3 120 ? 252.489 -68.262  50.403  1.00 147.27 ? 111 LYS E CG  1 
ATOM   8715  C CD  . LYS E 3 120 ? 253.871 -68.400  51.032  1.00 143.09 ? 111 LYS E CD  1 
ATOM   8716  C CE  . LYS E 3 120 ? 254.154 -67.317  52.062  1.00 139.89 ? 111 LYS E CE  1 
ATOM   8717  N NZ  . LYS E 3 120 ? 255.600 -67.265  52.414  1.00 137.13 ? 111 LYS E NZ  1 
ATOM   8718  N N   . ALA E 3 121 ? 249.935 -66.324  46.675  1.00 127.57 ? 112 ALA E N   1 
ATOM   8719  C CA  . ALA E 3 121 ? 249.450 -65.229  45.845  1.00 116.56 ? 112 ALA E CA  1 
ATOM   8720  C C   . ALA E 3 121 ? 248.132 -64.675  46.365  1.00 111.39 ? 112 ALA E C   1 
ATOM   8721  O O   . ALA E 3 121 ? 247.350 -65.391  46.997  1.00 109.98 ? 112 ALA E O   1 
ATOM   8722  C CB  . ALA E 3 121 ? 249.290 -65.696  44.413  1.00 114.74 ? 112 ALA E CB  1 
ATOM   8723  N N   . THR E 3 122 ? 247.894 -63.398  46.084  1.00 106.93 ? 113 THR E N   1 
ATOM   8724  C CA  . THR E 3 122 ? 246.686 -62.716  46.527  1.00 104.62 ? 113 THR E CA  1 
ATOM   8725  C C   . THR E 3 122 ? 245.562 -62.971  45.527  1.00 104.06 ? 113 THR E C   1 
ATOM   8726  O O   . THR E 3 122 ? 245.597 -62.439  44.422  1.00 105.69 ? 113 THR E O   1 
ATOM   8727  C CB  . THR E 3 122 ? 246.920 -61.193  46.631  1.00 103.32 ? 113 THR E CB  1 
ATOM   8728  O OG1 . THR E 3 122 ? 248.290 -60.929  46.963  1.00 101.72 ? 113 THR E OG1 1 
ATOM   8729  C CG2 . THR E 3 122 ? 246.008 -60.574  47.677  1.00 103.18 ? 113 THR E CG2 1 
ATOM   8730  N N   . VAL E 3 123 ? 244.574 -63.784  45.904  1.00 102.04 ? 114 VAL E N   1 
ATOM   8731  C CA  . VAL E 3 123 ? 243.431 -64.044  45.015  1.00 99.80  ? 114 VAL E CA  1 
ATOM   8732  C C   . VAL E 3 123 ? 242.118 -63.456  45.531  1.00 100.68 ? 114 VAL E C   1 
ATOM   8733  O O   . VAL E 3 123 ? 241.796 -63.557  46.715  1.00 99.33  ? 114 VAL E O   1 
ATOM   8734  C CB  . VAL E 3 123 ? 243.270 -65.545  44.649  1.00 97.19  ? 114 VAL E CB  1 
ATOM   8735  C CG1 . VAL E 3 123 ? 243.077 -66.396  45.885  1.00 94.90  ? 114 VAL E CG1 1 
ATOM   8736  C CG2 . VAL E 3 123 ? 242.114 -65.759  43.678  1.00 95.74  ? 114 VAL E CG2 1 
ATOM   8737  N N   . ILE E 3 124 ? 241.387 -62.826  44.618  1.00 102.75 ? 115 ILE E N   1 
ATOM   8738  C CA  . ILE E 3 124 ? 240.029 -62.375  44.870  1.00 104.65 ? 115 ILE E CA  1 
ATOM   8739  C C   . ILE E 3 124 ? 239.089 -63.070  43.882  1.00 104.71 ? 115 ILE E C   1 
ATOM   8740  O O   . ILE E 3 124 ? 239.263 -62.988  42.661  1.00 102.00 ? 115 ILE E O   1 
ATOM   8741  C CB  . ILE E 3 124 ? 239.911 -60.825  44.853  1.00 106.50 ? 115 ILE E CB  1 
ATOM   8742  C CG1 . ILE E 3 124 ? 238.465 -60.377  45.105  1.00 108.04 ? 115 ILE E CG1 1 
ATOM   8743  C CG2 . ILE E 3 124 ? 240.476 -60.229  43.566  1.00 106.85 ? 115 ILE E CG2 1 
ATOM   8744  C CD1 . ILE E 3 124 ? 238.341 -58.982  45.685  1.00 109.81 ? 115 ILE E CD1 1 
ATOM   8745  N N   . ALA E 3 125 ? 238.121 -63.793  44.433  1.00 107.64 ? 116 ALA E N   1 
ATOM   8746  C CA  . ALA E 3 125 ? 237.150 -64.524  43.638  1.00 112.12 ? 116 ALA E CA  1 
ATOM   8747  C C   . ALA E 3 125 ? 235.998 -63.607  43.263  1.00 116.61 ? 116 ALA E C   1 
ATOM   8748  O O   . ALA E 3 125 ? 235.436 -62.926  44.124  1.00 116.18 ? 116 ALA E O   1 
ATOM   8749  C CB  . ALA E 3 125 ? 236.645 -65.727  44.411  1.00 112.88 ? 116 ALA E CB  1 
ATOM   8750  N N   . MET E 3 126 ? 235.650 -63.592  41.980  1.00 123.94 ? 117 MET E N   1 
ATOM   8751  C CA  . MET E 3 126 ? 234.589 -62.714  41.483  1.00 133.27 ? 117 MET E CA  1 
ATOM   8752  C C   . MET E 3 126 ? 233.173 -63.184  41.826  1.00 137.30 ? 117 MET E C   1 
ATOM   8753  O O   . MET E 3 126 ? 232.220 -62.407  41.726  1.00 138.78 ? 117 MET E O   1 
ATOM   8754  C CB  . MET E 3 126 ? 234.731 -62.477  39.976  1.00 137.15 ? 117 MET E CB  1 
ATOM   8755  C CG  . MET E 3 126 ? 235.593 -61.273  39.625  1.00 141.94 ? 117 MET E CG  1 
ATOM   8756  S SD  . MET E 3 126 ? 234.875 -59.691  40.127  1.00 147.54 ? 117 MET E SD  1 
ATOM   8757  C CE  . MET E 3 126 ? 233.873 -59.275  38.702  1.00 145.70 ? 117 MET E CE  1 
ATOM   8758  N N   . GLU E 3 127 ? 233.040 -64.444  42.236  1.00 142.20 ? 118 GLU E N   1 
ATOM   8759  C CA  . GLU E 3 127 ? 231.738 -65.001  42.619  1.00 146.43 ? 118 GLU E CA  1 
ATOM   8760  C C   . GLU E 3 127 ? 231.292 -64.561  44.017  1.00 146.74 ? 118 GLU E C   1 
ATOM   8761  O O   . GLU E 3 127 ? 230.137 -64.769  44.407  1.00 148.24 ? 118 GLU E O   1 
ATOM   8762  C CB  . GLU E 3 127 ? 231.736 -66.535  42.511  1.00 148.32 ? 118 GLU E CB  1 
ATOM   8763  C CG  . GLU E 3 127 ? 232.614 -67.266  43.522  1.00 148.80 ? 118 GLU E CG  1 
ATOM   8764  C CD  . GLU E 3 127 ? 234.021 -67.536  43.017  1.00 149.49 ? 118 GLU E CD  1 
ATOM   8765  O OE1 . GLU E 3 127 ? 234.473 -66.869  42.059  1.00 149.19 ? 118 GLU E OE1 1 
ATOM   8766  O OE2 . GLU E 3 127 ? 234.683 -68.425  43.589  1.00 150.40 ? 118 GLU E OE2 1 
ATOM   8767  N N   . LEU E 3 128 ? 232.213 -63.953  44.760  1.00 145.03 ? 119 LEU E N   1 
ATOM   8768  C CA  . LEU E 3 128 ? 231.947 -63.547  46.135  1.00 142.56 ? 119 LEU E CA  1 
ATOM   8769  C C   . LEU E 3 128 ? 231.757 -62.037  46.274  1.00 142.61 ? 119 LEU E C   1 
ATOM   8770  O O   . LEU E 3 128 ? 231.821 -61.496  47.379  1.00 142.88 ? 119 LEU E O   1 
ATOM   8771  C CB  . LEU E 3 128 ? 233.051 -64.065  47.065  1.00 139.67 ? 119 LEU E CB  1 
ATOM   8772  C CG  . LEU E 3 128 ? 233.429 -65.542  46.886  1.00 137.47 ? 119 LEU E CG  1 
ATOM   8773  C CD1 . LEU E 3 128 ? 234.689 -65.855  47.673  1.00 137.20 ? 119 LEU E CD1 1 
ATOM   8774  C CD2 . LEU E 3 128 ? 232.291 -66.485  47.263  1.00 134.98 ? 119 LEU E CD2 1 
ATOM   8775  N N   . ILE E 3 129 ? 231.518 -61.368  45.146  1.00 141.52 ? 120 ILE E N   1 
ATOM   8776  C CA  . ILE E 3 129 ? 231.118 -59.962  45.134  1.00 138.79 ? 120 ILE E CA  1 
ATOM   8777  C C   . ILE E 3 129 ? 229.791 -59.832  45.889  1.00 135.52 ? 120 ILE E C   1 
ATOM   8778  O O   . ILE E 3 129 ? 228.802 -60.475  45.519  1.00 135.29 ? 120 ILE E O   1 
ATOM   8779  C CB  . ILE E 3 129 ? 230.976 -59.422  43.685  1.00 139.73 ? 120 ILE E CB  1 
ATOM   8780  C CG1 . ILE E 3 129 ? 232.352 -59.272  43.008  1.00 139.85 ? 120 ILE E CG1 1 
ATOM   8781  C CG2 . ILE E 3 129 ? 230.191 -58.114  43.648  1.00 140.24 ? 120 ILE E CG2 1 
ATOM   8782  C CD1 . ILE E 3 129 ? 233.205 -58.112  43.499  1.00 138.83 ? 120 ILE E CD1 1 
ATOM   8783  N N   . PRO E 3 130 ? 229.770 -59.020  46.965  1.00 132.11 ? 121 PRO E N   1 
ATOM   8784  C CA  . PRO E 3 130 ? 228.528 -58.819  47.722  1.00 130.84 ? 121 PRO E CA  1 
ATOM   8785  C C   . PRO E 3 130 ? 227.449 -58.127  46.877  1.00 130.87 ? 121 PRO E C   1 
ATOM   8786  O O   . PRO E 3 130 ? 227.773 -57.473  45.883  1.00 132.17 ? 121 PRO E O   1 
ATOM   8787  C CB  . PRO E 3 130 ? 228.965 -57.944  48.904  1.00 129.84 ? 121 PRO E CB  1 
ATOM   8788  C CG  . PRO E 3 130 ? 230.238 -57.299  48.469  1.00 129.26 ? 121 PRO E CG  1 
ATOM   8789  C CD  . PRO E 3 130 ? 230.902 -58.266  47.538  1.00 129.92 ? 121 PRO E CD  1 
ATOM   8790  N N   . ARG E 3 131 ? 226.182 -58.272  47.266  1.00 129.78 ? 122 ARG E N   1 
ATOM   8791  C CA  . ARG E 3 131 ? 225.063 -57.842  46.415  1.00 127.87 ? 122 ARG E CA  1 
ATOM   8792  C C   . ARG E 3 131 ? 224.366 -56.533  46.820  1.00 131.70 ? 122 ARG E C   1 
ATOM   8793  O O   . ARG E 3 131 ? 223.200 -56.317  46.469  1.00 128.29 ? 122 ARG E O   1 
ATOM   8794  C CB  . ARG E 3 131 ? 224.024 -58.962  46.289  1.00 123.18 ? 122 ARG E CB  1 
ATOM   8795  C CG  . ARG E 3 131 ? 223.167 -58.894  45.030  1.00 117.92 ? 122 ARG E CG  1 
ATOM   8796  C CD  . ARG E 3 131 ? 223.678 -59.843  43.961  1.00 115.14 ? 122 ARG E CD  1 
ATOM   8797  N NE  . ARG E 3 131 ? 223.760 -61.212  44.471  1.00 113.53 ? 122 ARG E NE  1 
ATOM   8798  C CZ  . ARG E 3 131 ? 224.011 -62.281  43.722  1.00 111.75 ? 122 ARG E CZ  1 
ATOM   8799  N NH1 . ARG E 3 131 ? 224.199 -62.153  42.411  1.00 110.51 ? 122 ARG E NH1 1 
ATOM   8800  N NH2 . ARG E 3 131 ? 224.067 -63.483  44.284  1.00 111.14 ? 122 ARG E NH2 1 
ATOM   8801  N N   . ILE E 3 132 ? 225.061 -55.658  47.546  1.00 139.91 ? 123 ILE E N   1 
ATOM   8802  C CA  . ILE E 3 132 ? 224.552 -54.293  47.737  1.00 146.26 ? 123 ILE E CA  1 
ATOM   8803  C C   . ILE E 3 132 ? 224.667 -53.521  46.418  1.00 146.86 ? 123 ILE E C   1 
ATOM   8804  O O   . ILE E 3 132 ? 224.716 -54.124  45.342  1.00 144.23 ? 123 ILE E O   1 
ATOM   8805  C CB  . ILE E 3 132 ? 225.212 -53.508  48.910  1.00 150.45 ? 123 ILE E CB  1 
ATOM   8806  C CG1 . ILE E 3 132 ? 226.738 -53.736  48.993  1.00 156.55 ? 123 ILE E CG1 1 
ATOM   8807  C CG2 . ILE E 3 132 ? 224.455 -53.734  50.222  1.00 148.18 ? 123 ILE E CG2 1 
ATOM   8808  C CD1 . ILE E 3 132 ? 227.194 -54.841  49.934  1.00 160.40 ? 123 ILE E CD1 1 
ATOM   8809  N N   . THR E 3 133 ? 224.726 -52.196  46.504  1.00 149.59 ? 124 THR E N   1 
ATOM   8810  C CA  . THR E 3 133 ? 224.660 -51.345  45.316  1.00 151.60 ? 124 THR E CA  1 
ATOM   8811  C C   . THR E 3 133 ? 226.019 -50.983  44.714  1.00 151.56 ? 124 THR E C   1 
ATOM   8812  O O   . THR E 3 133 ? 226.129 -50.777  43.501  1.00 150.00 ? 124 THR E O   1 
ATOM   8813  C CB  . THR E 3 133 ? 223.870 -50.060  45.605  1.00 153.26 ? 124 THR E CB  1 
ATOM   8814  O OG1 . THR E 3 133 ? 224.520 -49.339  46.653  1.00 153.62 ? 124 THR E OG1 1 
ATOM   8815  C CG2 . THR E 3 133 ? 222.452 -50.392  46.044  1.00 154.51 ? 124 THR E CG2 1 
ATOM   8816  N N   . ARG E 3 134 ? 227.039 -50.910  45.568  1.00 152.52 ? 125 ARG E N   1 
ATOM   8817  C CA  . ARG E 3 134 ? 228.385 -50.471  45.183  1.00 152.25 ? 125 ARG E CA  1 
ATOM   8818  C C   . ARG E 3 134 ? 228.937 -51.174  43.945  1.00 150.93 ? 125 ARG E C   1 
ATOM   8819  O O   . ARG E 3 134 ? 229.306 -50.527  42.959  1.00 149.00 ? 125 ARG E O   1 
ATOM   8820  C CB  . ARG E 3 134 ? 229.362 -50.646  46.355  1.00 153.37 ? 125 ARG E CB  1 
ATOM   8821  C CG  . ARG E 3 134 ? 229.107 -49.746  47.558  1.00 152.49 ? 125 ARG E CG  1 
ATOM   8822  C CD  . ARG E 3 134 ? 230.415 -49.377  48.239  1.00 151.94 ? 125 ARG E CD  1 
ATOM   8823  N NE  . ARG E 3 134 ? 231.315 -48.673  47.323  1.00 152.08 ? 125 ARG E NE  1 
ATOM   8824  C CZ  . ARG E 3 134 ? 232.638 -48.810  47.309  1.00 152.36 ? 125 ARG E CZ  1 
ATOM   8825  N NH1 . ARG E 3 134 ? 233.365 -48.129  46.432  1.00 151.59 ? 125 ARG E NH1 1 
ATOM   8826  N NH2 . ARG E 3 134 ? 233.239 -49.634  48.161  1.00 153.01 ? 125 ARG E NH2 1 
ATOM   8827  N N   . ALA E 3 135 ? 228.975 -52.501  44.013  1.00 150.65 ? 126 ALA E N   1 
ATOM   8828  C CA  . ALA E 3 135 ? 229.586 -53.323  42.980  1.00 148.72 ? 126 ALA E CA  1 
ATOM   8829  C C   . ALA E 3 135 ? 228.547 -54.000  42.092  1.00 145.66 ? 126 ALA E C   1 
ATOM   8830  O O   . ALA E 3 135 ? 228.746 -55.131  41.650  1.00 147.61 ? 126 ALA E O   1 
ATOM   8831  C CB  . ALA E 3 135 ? 230.507 -54.358  43.613  1.00 150.39 ? 126 ALA E CB  1 
ATOM   8832  N N   . GLN E 3 136 ? 227.435 -53.313  41.841  1.00 139.47 ? 127 GLN E N   1 
ATOM   8833  C CA  . GLN E 3 136 ? 226.464 -53.789  40.863  1.00 134.50 ? 127 GLN E CA  1 
ATOM   8834  C C   . GLN E 3 136 ? 226.983 -53.533  39.455  1.00 132.51 ? 127 GLN E C   1 
ATOM   8835  O O   . GLN E 3 136 ? 226.696 -54.294  38.532  1.00 131.89 ? 127 GLN E O   1 
ATOM   8836  C CB  . GLN E 3 136 ? 225.102 -53.144  41.079  1.00 132.76 ? 127 GLN E CB  1 
ATOM   8837  C CG  . GLN E 3 136 ? 224.230 -53.919  42.051  1.00 130.90 ? 127 GLN E CG  1 
ATOM   8838  C CD  . GLN E 3 136 ? 223.229 -53.044  42.778  1.00 131.05 ? 127 GLN E CD  1 
ATOM   8839  O OE1 . GLN E 3 136 ? 222.660 -53.456  43.786  1.00 129.85 ? 127 GLN E OE1 1 
ATOM   8840  N NE2 . GLN E 3 136 ? 223.018 -51.828  42.281  1.00 132.46 ? 127 GLN E NE2 1 
ATOM   8841  N N   . SER E 3 137 ? 227.765 -52.464  39.312  1.00 130.13 ? 128 SER E N   1 
ATOM   8842  C CA  . SER E 3 137 ? 228.518 -52.200  38.090  1.00 129.61 ? 128 SER E CA  1 
ATOM   8843  C C   . SER E 3 137 ? 229.722 -53.146  37.972  1.00 132.34 ? 128 SER E C   1 
ATOM   8844  O O   . SER E 3 137 ? 230.483 -53.080  37.005  1.00 132.45 ? 128 SER E O   1 
ATOM   8845  C CB  . SER E 3 137 ? 228.966 -50.734  38.041  1.00 126.89 ? 128 SER E CB  1 
ATOM   8846  O OG  . SER E 3 137 ? 229.709 -50.378  39.195  1.00 124.43 ? 128 SER E OG  1 
ATOM   8847  N N   . MET E 3 138 ? 229.878 -54.019  38.969  1.00 136.46 ? 129 MET E N   1 
ATOM   8848  C CA  . MET E 3 138 ? 230.918 -55.054  38.987  1.00 139.33 ? 129 MET E CA  1 
ATOM   8849  C C   . MET E 3 138 ? 230.296 -56.438  39.216  1.00 138.62 ? 129 MET E C   1 
ATOM   8850  O O   . MET E 3 138 ? 231.003 -57.450  39.224  1.00 137.18 ? 129 MET E O   1 
ATOM   8851  C CB  . MET E 3 138 ? 231.956 -54.767  40.079  1.00 143.69 ? 129 MET E CB  1 
ATOM   8852  C CG  . MET E 3 138 ? 232.394 -53.314  40.184  1.00 149.20 ? 129 MET E CG  1 
ATOM   8853  S SD  . MET E 3 138 ? 233.245 -52.953  41.733  1.00 155.25 ? 129 MET E SD  1 
ATOM   8854  C CE  . MET E 3 138 ? 232.715 -51.264  42.021  1.00 155.97 ? 129 MET E CE  1 
ATOM   8855  N N   . ASP E 3 139 ? 228.973 -56.461  39.402  1.00 138.46 ? 130 ASP E N   1 
ATOM   8856  C CA  . ASP E 3 139 ? 228.196 -57.678  39.683  1.00 137.23 ? 130 ASP E CA  1 
ATOM   8857  C C   . ASP E 3 139 ? 228.241 -58.624  38.481  1.00 139.08 ? 130 ASP E C   1 
ATOM   8858  O O   . ASP E 3 139 ? 227.364 -58.586  37.614  1.00 141.46 ? 130 ASP E O   1 
ATOM   8859  C CB  . ASP E 3 139 ? 226.738 -57.303  40.025  1.00 132.10 ? 130 ASP E CB  1 
ATOM   8860  C CG  . ASP E 3 139 ? 226.081 -58.255  41.032  1.00 127.05 ? 130 ASP E CG  1 
ATOM   8861  O OD1 . ASP E 3 139 ? 226.524 -59.415  41.172  1.00 125.57 ? 130 ASP E OD1 1 
ATOM   8862  O OD2 . ASP E 3 139 ? 225.098 -57.832  41.683  1.00 122.20 ? 130 ASP E OD2 1 
ATOM   8863  N N   . ALA E 3 140 ? 229.277 -59.461  38.436  1.00 139.15 ? 131 ALA E N   1 
ATOM   8864  C CA  . ALA E 3 140 ? 229.487 -60.399  37.330  1.00 138.58 ? 131 ALA E CA  1 
ATOM   8865  C C   . ALA E 3 140 ? 228.460 -61.529  37.324  1.00 137.75 ? 131 ALA E C   1 
ATOM   8866  O O   . ALA E 3 140 ? 228.100 -62.043  36.260  1.00 137.86 ? 131 ALA E O   1 
ATOM   8867  C CB  . ALA E 3 140 ? 230.898 -60.963  37.372  1.00 139.23 ? 131 ALA E CB  1 
ATOM   8868  N N   . LEU E 3 141 ? 228.004 -61.908  38.519  1.00 135.99 ? 132 LEU E N   1 
ATOM   8869  C CA  . LEU E 3 141 ? 226.934 -62.892  38.701  1.00 133.75 ? 132 LEU E CA  1 
ATOM   8870  C C   . LEU E 3 141 ? 225.700 -62.525  37.891  1.00 131.06 ? 132 LEU E C   1 
ATOM   8871  O O   . LEU E 3 141 ? 225.061 -63.387  37.285  1.00 130.01 ? 132 LEU E O   1 
ATOM   8872  C CB  . LEU E 3 141 ? 226.550 -62.982  40.179  1.00 134.65 ? 132 LEU E CB  1 
ATOM   8873  C CG  . LEU E 3 141 ? 227.316 -63.948  41.086  1.00 136.13 ? 132 LEU E CG  1 
ATOM   8874  C CD1 . LEU E 3 141 ? 227.300 -63.449  42.525  1.00 135.30 ? 132 LEU E CD1 1 
ATOM   8875  C CD2 . LEU E 3 141 ? 226.731 -65.351  40.990  1.00 137.88 ? 132 LEU E CD2 1 
ATOM   8876  N N   . SER E 3 142 ? 225.376 -61.234  37.899  1.00 128.43 ? 133 SER E N   1 
ATOM   8877  C CA  . SER E 3 142 ? 224.246 -60.700  37.156  1.00 125.64 ? 133 SER E CA  1 
ATOM   8878  C C   . SER E 3 142 ? 224.503 -60.699  35.645  1.00 123.49 ? 133 SER E C   1 
ATOM   8879  O O   . SER E 3 142 ? 223.648 -61.126  34.869  1.00 122.01 ? 133 SER E O   1 
ATOM   8880  C CB  . SER E 3 142 ? 223.901 -59.288  37.649  1.00 125.60 ? 133 SER E CB  1 
ATOM   8881  O OG  . SER E 3 142 ? 223.639 -59.276  39.046  1.00 124.23 ? 133 SER E OG  1 
ATOM   8882  N N   . SER E 3 143 ? 225.688 -60.240  35.243  1.00 121.50 ? 134 SER E N   1 
ATOM   8883  C CA  . SER E 3 143 ? 226.023 -60.043  33.828  1.00 119.42 ? 134 SER E CA  1 
ATOM   8884  C C   . SER E 3 143 ? 226.075 -61.329  33.005  1.00 118.41 ? 134 SER E C   1 
ATOM   8885  O O   . SER E 3 143 ? 225.603 -61.358  31.867  1.00 117.21 ? 134 SER E O   1 
ATOM   8886  C CB  . SER E 3 143 ? 227.352 -59.291  33.693  1.00 119.18 ? 134 SER E CB  1 
ATOM   8887  O OG  . SER E 3 143 ? 228.448 -60.108  34.070  1.00 118.55 ? 134 SER E OG  1 
ATOM   8888  N N   . GLN E 3 144 ? 226.649 -62.381  33.581  1.00 118.46 ? 135 GLN E N   1 
ATOM   8889  C CA  . GLN E 3 144 ? 226.887 -63.624  32.847  1.00 119.41 ? 135 GLN E CA  1 
ATOM   8890  C C   . GLN E 3 144 ? 225.691 -64.572  32.866  1.00 120.20 ? 135 GLN E C   1 
ATOM   8891  O O   . GLN E 3 144 ? 225.449 -65.282  31.887  1.00 122.83 ? 135 GLN E O   1 
ATOM   8892  C CB  . GLN E 3 144 ? 228.156 -64.324  33.351  1.00 118.92 ? 135 GLN E CB  1 
ATOM   8893  C CG  . GLN E 3 144 ? 229.414 -63.459  33.313  1.00 118.18 ? 135 GLN E CG  1 
ATOM   8894  C CD  . GLN E 3 144 ? 229.662 -62.800  31.963  1.00 117.62 ? 135 GLN E CD  1 
ATOM   8895  O OE1 . GLN E 3 144 ? 229.697 -63.465  30.927  1.00 118.15 ? 135 GLN E OE1 1 
ATOM   8896  N NE2 . GLN E 3 144 ? 229.848 -61.484  31.976  1.00 116.31 ? 135 GLN E NE2 1 
ATOM   8897  N N   . ALA E 3 145 ? 224.949 -64.583  33.973  1.00 119.02 ? 136 ALA E N   1 
ATOM   8898  C CA  . ALA E 3 145 ? 223.708 -65.355  34.056  1.00 117.61 ? 136 ALA E CA  1 
ATOM   8899  C C   . ALA E 3 145 ? 222.626 -64.726  33.175  1.00 115.93 ? 136 ALA E C   1 
ATOM   8900  O O   . ALA E 3 145 ? 221.670 -65.393  32.777  1.00 117.70 ? 136 ALA E O   1 
ATOM   8901  C CB  . ALA E 3 145 ? 223.241 -65.472  35.498  1.00 117.48 ? 136 ALA E CB  1 
ATOM   8902  N N   . THR E 3 146 ? 222.797 -63.440  32.875  1.00 112.06 ? 137 THR E N   1 
ATOM   8903  C CA  . THR E 3 146 ? 221.981 -62.730  31.893  1.00 108.79 ? 137 THR E CA  1 
ATOM   8904  C C   . THR E 3 146 ? 222.166 -63.335  30.495  1.00 108.32 ? 137 THR E C   1 
ATOM   8905  O O   . THR E 3 146 ? 221.193 -63.684  29.828  1.00 108.33 ? 137 THR E O   1 
ATOM   8906  C CB  . THR E 3 146 ? 222.330 -61.225  31.887  1.00 107.38 ? 137 THR E CB  1 
ATOM   8907  O OG1 . THR E 3 146 ? 221.829 -60.616  33.084  1.00 106.37 ? 137 THR E OG1 1 
ATOM   8908  C CG2 . THR E 3 146 ? 221.745 -60.512  30.673  1.00 107.20 ? 137 THR E CG2 1 
ATOM   8909  N N   . VAL E 3 147 ? 223.422 -63.467  30.072  1.00 107.83 ? 138 VAL E N   1 
ATOM   8910  C CA  . VAL E 3 147 ? 223.769 -64.044  28.768  1.00 107.55 ? 138 VAL E CA  1 
ATOM   8911  C C   . VAL E 3 147 ? 223.255 -65.480  28.632  1.00 106.45 ? 138 VAL E C   1 
ATOM   8912  O O   . VAL E 3 147 ? 222.734 -65.869  27.581  1.00 105.33 ? 138 VAL E O   1 
ATOM   8913  C CB  . VAL E 3 147 ? 225.300 -64.008  28.536  1.00 108.56 ? 138 VAL E CB  1 
ATOM   8914  C CG1 . VAL E 3 147 ? 225.681 -64.695  27.231  1.00 108.46 ? 138 VAL E CG1 1 
ATOM   8915  C CG2 . VAL E 3 147 ? 225.811 -62.575  28.549  1.00 109.50 ? 138 VAL E CG2 1 
ATOM   8916  N N   . ALA E 3 148 ? 223.399 -66.251  29.707  1.00 106.11 ? 139 ALA E N   1 
ATOM   8917  C CA  . ALA E 3 148 ? 223.001 -67.655  29.734  1.00 104.92 ? 139 ALA E CA  1 
ATOM   8918  C C   . ALA E 3 148 ? 221.489 -67.840  29.608  1.00 103.68 ? 139 ALA E C   1 
ATOM   8919  O O   . ALA E 3 148 ? 221.027 -68.617  28.770  1.00 101.92 ? 139 ALA E O   1 
ATOM   8920  C CB  . ALA E 3 148 ? 223.526 -68.323  30.996  1.00 105.93 ? 139 ALA E CB  1 
ATOM   8921  N N   . GLY E 3 149 ? 220.731 -67.111  30.429  1.00 103.40 ? 140 GLY E N   1 
ATOM   8922  C CA  . GLY E 3 149 ? 219.266 -67.165  30.425  1.00 102.51 ? 140 GLY E CA  1 
ATOM   8923  C C   . GLY E 3 149 ? 218.658 -66.778  29.091  1.00 102.00 ? 140 GLY E C   1 
ATOM   8924  O O   . GLY E 3 149 ? 217.587 -67.263  28.722  1.00 99.61  ? 140 GLY E O   1 
ATOM   8925  N N   . TYR E 3 150 ? 219.352 -65.896  28.375  1.00 104.20 ? 141 TYR E N   1 
ATOM   8926  C CA  . TYR E 3 150 ? 218.971 -65.503  27.023  1.00 107.48 ? 141 TYR E CA  1 
ATOM   8927  C C   . TYR E 3 150 ? 219.024 -66.708  26.089  1.00 104.11 ? 141 TYR E C   1 
ATOM   8928  O O   . TYR E 3 150 ? 217.990 -67.141  25.574  1.00 103.34 ? 141 TYR E O   1 
ATOM   8929  C CB  . TYR E 3 150 ? 219.882 -64.374  26.519  1.00 114.62 ? 141 TYR E CB  1 
ATOM   8930  C CG  . TYR E 3 150 ? 219.815 -64.105  25.025  1.00 121.52 ? 141 TYR E CG  1 
ATOM   8931  C CD1 . TYR E 3 150 ? 218.751 -63.389  24.469  1.00 123.52 ? 141 TYR E CD1 1 
ATOM   8932  C CD2 . TYR E 3 150 ? 220.827 -64.549  24.171  1.00 124.74 ? 141 TYR E CD2 1 
ATOM   8933  C CE1 . TYR E 3 150 ? 218.692 -63.138  23.105  1.00 126.12 ? 141 TYR E CE1 1 
ATOM   8934  C CE2 . TYR E 3 150 ? 220.775 -64.303  22.807  1.00 127.49 ? 141 TYR E CE2 1 
ATOM   8935  C CZ  . TYR E 3 150 ? 219.708 -63.597  22.279  1.00 127.61 ? 141 TYR E CZ  1 
ATOM   8936  O OH  . TYR E 3 150 ? 219.654 -63.350  20.926  1.00 128.84 ? 141 TYR E OH  1 
ATOM   8937  N N   . LEU E 3 151 ? 220.226 -67.252  25.895  1.00 100.76 ? 142 LEU E N   1 
ATOM   8938  C CA  . LEU E 3 151 ? 220.429 -68.405  25.019  1.00 98.15  ? 142 LEU E CA  1 
ATOM   8939  C C   . LEU E 3 151 ? 219.604 -69.604  25.474  1.00 96.37  ? 142 LEU E C   1 
ATOM   8940  O O   . LEU E 3 151 ? 219.200 -70.430  24.654  1.00 96.63  ? 142 LEU E O   1 
ATOM   8941  C CB  . LEU E 3 151 ? 221.916 -68.773  24.922  1.00 97.73  ? 142 LEU E CB  1 
ATOM   8942  C CG  . LEU E 3 151 ? 222.807 -67.964  23.968  1.00 97.32  ? 142 LEU E CG  1 
ATOM   8943  C CD1 . LEU E 3 151 ? 224.274 -68.183  24.307  1.00 96.65  ? 142 LEU E CD1 1 
ATOM   8944  C CD2 . LEU E 3 151 ? 222.548 -68.313  22.506  1.00 97.03  ? 142 LEU E CD2 1 
ATOM   8945  N N   . ALA E 3 152 ? 219.344 -69.677  26.779  1.00 94.20  ? 143 ALA E N   1 
ATOM   8946  C CA  . ALA E 3 152 ? 218.492 -70.716  27.359  1.00 93.14  ? 143 ALA E CA  1 
ATOM   8947  C C   . ALA E 3 152 ? 217.109 -70.746  26.712  1.00 92.17  ? 143 ALA E C   1 
ATOM   8948  O O   . ALA E 3 152 ? 216.523 -71.815  26.525  1.00 91.78  ? 143 ALA E O   1 
ATOM   8949  C CB  . ALA E 3 152 ? 218.368 -70.521  28.862  1.00 93.65  ? 143 ALA E CB  1 
ATOM   8950  N N   . ALA E 3 153 ? 216.599 -69.568  26.368  1.00 91.55  ? 144 ALA E N   1 
ATOM   8951  C CA  . ALA E 3 153 ? 215.312 -69.453  25.699  1.00 91.97  ? 144 ALA E CA  1 
ATOM   8952  C C   . ALA E 3 153 ? 215.444 -69.607  24.184  1.00 92.11  ? 144 ALA E C   1 
ATOM   8953  O O   . ALA E 3 153 ? 214.553 -70.157  23.533  1.00 91.47  ? 144 ALA E O   1 
ATOM   8954  C CB  . ALA E 3 153 ? 214.653 -68.132  26.050  1.00 92.69  ? 144 ALA E CB  1 
ATOM   8955  N N   . ILE E 3 154 ? 216.554 -69.118  23.631  1.00 93.06  ? 145 ILE E N   1 
ATOM   8956  C CA  . ILE E 3 154 ? 216.812 -69.207  22.192  1.00 94.65  ? 145 ILE E CA  1 
ATOM   8957  C C   . ILE E 3 154 ? 216.903 -70.665  21.755  1.00 96.84  ? 145 ILE E C   1 
ATOM   8958  O O   . ILE E 3 154 ? 216.283 -71.065  20.766  1.00 95.13  ? 145 ILE E O   1 
ATOM   8959  C CB  . ILE E 3 154 ? 218.108 -68.467  21.786  1.00 94.42  ? 145 ILE E CB  1 
ATOM   8960  C CG1 . ILE E 3 154 ? 218.068 -66.993  22.216  1.00 94.82  ? 145 ILE E CG1 1 
ATOM   8961  C CG2 . ILE E 3 154 ? 218.351 -68.596  20.289  1.00 93.78  ? 145 ILE E CG2 1 
ATOM   8962  C CD1 . ILE E 3 154 ? 217.022 -66.141  21.524  1.00 94.66  ? 145 ILE E CD1 1 
ATOM   8963  N N   . HIS E 3 155 ? 217.678 -71.446  22.506  1.00 102.01 ? 146 HIS E N   1 
ATOM   8964  C CA  . HIS E 3 155 ? 217.786 -72.886  22.296  1.00 107.46 ? 146 HIS E CA  1 
ATOM   8965  C C   . HIS E 3 155 ? 216.431 -73.565  22.481  1.00 108.69 ? 146 HIS E C   1 
ATOM   8966  O O   . HIS E 3 155 ? 216.108 -74.509  21.763  1.00 110.61 ? 146 HIS E O   1 
ATOM   8967  C CB  . HIS E 3 155 ? 218.810 -73.505  23.255  1.00 110.91 ? 146 HIS E CB  1 
ATOM   8968  C CG  . HIS E 3 155 ? 220.236 -73.278  22.855  1.00 114.17 ? 146 HIS E CG  1 
ATOM   8969  N ND1 . HIS E 3 155 ? 220.848 -73.988  21.845  1.00 115.30 ? 146 HIS E ND1 1 
ATOM   8970  C CD2 . HIS E 3 155 ? 221.177 -72.435  23.344  1.00 115.96 ? 146 HIS E CD2 1 
ATOM   8971  C CE1 . HIS E 3 155 ? 222.101 -73.585  21.721  1.00 116.47 ? 146 HIS E CE1 1 
ATOM   8972  N NE2 . HIS E 3 155 ? 222.326 -72.643  22.619  1.00 116.61 ? 146 HIS E NE2 1 
ATOM   8973  N N   . ALA E 3 156 ? 215.644 -73.070  23.436  1.00 109.40 ? 147 ALA E N   1 
ATOM   8974  C CA  . ALA E 3 156 ? 214.322 -73.626  23.732  1.00 110.70 ? 147 ALA E CA  1 
ATOM   8975  C C   . ALA E 3 156 ? 213.356 -73.522  22.551  1.00 112.37 ? 147 ALA E C   1 
ATOM   8976  O O   . ALA E 3 156 ? 212.518 -74.400  22.364  1.00 112.88 ? 147 ALA E O   1 
ATOM   8977  C CB  . ALA E 3 156 ? 213.728 -72.973  24.972  1.00 109.71 ? 147 ALA E CB  1 
ATOM   8978  N N   . ALA E 3 157 ? 213.481 -72.456  21.761  1.00 114.09 ? 148 ALA E N   1 
ATOM   8979  C CA  . ALA E 3 157 ? 212.668 -72.281  20.556  1.00 116.40 ? 148 ALA E CA  1 
ATOM   8980  C C   . ALA E 3 157 ? 213.298 -72.965  19.345  1.00 119.04 ? 148 ALA E C   1 
ATOM   8981  O O   . ALA E 3 157 ? 212.597 -73.346  18.403  1.00 117.42 ? 148 ALA E O   1 
ATOM   8982  C CB  . ALA E 3 157 ? 212.444 -70.806  20.279  1.00 115.68 ? 148 ALA E CB  1 
ATOM   8983  N N   . ARG E 3 158 ? 214.625 -73.097  19.379  1.00 124.36 ? 149 ARG E N   1 
ATOM   8984  C CA  . ARG E 3 158 ? 215.391 -73.813  18.352  1.00 130.95 ? 149 ARG E CA  1 
ATOM   8985  C C   . ARG E 3 158 ? 215.095 -75.310  18.384  1.00 138.98 ? 149 ARG E C   1 
ATOM   8986  O O   . ARG E 3 158 ? 214.974 -75.947  17.333  1.00 141.25 ? 149 ARG E O   1 
ATOM   8987  C CB  . ARG E 3 158 ? 216.902 -73.510  18.495  1.00 127.89 ? 149 ARG E CB  1 
ATOM   8988  C CG  . ARG E 3 158 ? 217.853 -74.700  18.662  1.00 124.84 ? 149 ARG E CG  1 
ATOM   8989  C CD  . ARG E 3 158 ? 218.435 -75.234  17.355  1.00 121.17 ? 149 ARG E CD  1 
ATOM   8990  N NE  . ARG E 3 158 ? 219.446 -76.276  17.594  1.00 116.31 ? 149 ARG E NE  1 
ATOM   8991  C CZ  . ARG E 3 158 ? 219.975 -77.060  16.652  1.00 113.41 ? 149 ARG E CZ  1 
ATOM   8992  N NH1 . ARG E 3 158 ? 219.601 -76.944  15.380  1.00 112.38 ? 149 ARG E NH1 1 
ATOM   8993  N NH2 . ARG E 3 158 ? 220.883 -77.973  16.983  1.00 110.95 ? 149 ARG E NH2 1 
ATOM   8994  N N   . LEU E 3 159 ? 214.959 -75.853  19.592  1.00 147.82 ? 150 LEU E N   1 
ATOM   8995  C CA  . LEU E 3 159 ? 214.782 -77.290  19.783  1.00 153.52 ? 150 LEU E CA  1 
ATOM   8996  C C   . LEU E 3 159 ? 213.310 -77.698  19.937  1.00 153.66 ? 150 LEU E C   1 
ATOM   8997  O O   . LEU E 3 159 ? 212.959 -78.856  19.692  1.00 155.88 ? 150 LEU E O   1 
ATOM   8998  C CB  . LEU E 3 159 ? 215.620 -77.786  20.975  1.00 156.34 ? 150 LEU E CB  1 
ATOM   8999  C CG  . LEU E 3 159 ? 217.147 -77.579  20.958  1.00 156.40 ? 150 LEU E CG  1 
ATOM   9000  C CD1 . LEU E 3 159 ? 217.735 -77.709  22.358  1.00 156.08 ? 150 LEU E CD1 1 
ATOM   9001  C CD2 . LEU E 3 159 ? 217.854 -78.518  19.986  1.00 156.41 ? 150 LEU E CD2 1 
ATOM   9002  N N   . SER E 3 160 ? 212.457 -76.749  20.330  1.00 150.42 ? 151 SER E N   1 
ATOM   9003  C CA  . SER E 3 160 ? 211.028 -77.019  20.495  1.00 145.57 ? 151 SER E CA  1 
ATOM   9004  C C   . SER E 3 160 ? 210.363 -77.339  19.164  1.00 146.17 ? 151 SER E C   1 
ATOM   9005  O O   . SER E 3 160 ? 210.516 -76.589  18.196  1.00 145.67 ? 151 SER E O   1 
ATOM   9006  C CB  . SER E 3 160 ? 210.305 -75.848  21.161  1.00 141.59 ? 151 SER E CB  1 
ATOM   9007  O OG  . SER E 3 160 ? 208.929 -76.133  21.352  1.00 136.81 ? 151 SER E OG  1 
ATOM   9008  N N   . PRO E 3 161 ? 209.615 -78.456  19.117  1.00 146.94 ? 152 PRO E N   1 
ATOM   9009  C CA  . PRO E 3 161 ? 208.872 -78.841  17.922  1.00 147.87 ? 152 PRO E CA  1 
ATOM   9010  C C   . PRO E 3 161 ? 207.613 -77.990  17.778  1.00 146.93 ? 152 PRO E C   1 
ATOM   9011  O O   . PRO E 3 161 ? 206.772 -78.254  16.914  1.00 150.32 ? 152 PRO E O   1 
ATOM   9012  C CB  . PRO E 3 161 ? 208.499 -80.296  18.211  1.00 148.34 ? 152 PRO E CB  1 
ATOM   9013  C CG  . PRO E 3 161 ? 208.365 -80.352  19.696  1.00 147.06 ? 152 PRO E CG  1 
ATOM   9014  C CD  . PRO E 3 161 ? 209.382 -79.387  20.239  1.00 146.31 ? 152 PRO E CD  1 
ATOM   9015  N N   . ARG E 3 162 ? 207.507 -76.969  18.624  1.00 141.45 ? 153 ARG E N   1 
ATOM   9016  C CA  . ARG E 3 162 ? 206.290 -76.188  18.760  1.00 135.02 ? 153 ARG E CA  1 
ATOM   9017  C C   . ARG E 3 162 ? 206.540 -74.701  18.591  1.00 128.08 ? 153 ARG E C   1 
ATOM   9018  O O   . ARG E 3 162 ? 207.619 -74.195  18.913  1.00 124.66 ? 153 ARG E O   1 
ATOM   9019  C CB  . ARG E 3 162 ? 205.669 -76.438  20.134  1.00 138.23 ? 153 ARG E CB  1 
ATOM   9020  C CG  . ARG E 3 162 ? 205.311 -77.891  20.403  1.00 142.40 ? 153 ARG E CG  1 
ATOM   9021  C CD  . ARG E 3 162 ? 204.532 -78.045  21.697  1.00 145.51 ? 153 ARG E CD  1 
ATOM   9022  N NE  . ARG E 3 162 ? 203.432 -77.085  21.802  1.00 150.73 ? 153 ARG E NE  1 
ATOM   9023  C CZ  . ARG E 3 162 ? 202.239 -77.229  21.228  1.00 154.89 ? 153 ARG E CZ  1 
ATOM   9024  N NH1 . ARG E 3 162 ? 201.966 -78.300  20.490  1.00 158.74 ? 153 ARG E NH1 1 
ATOM   9025  N NH2 . ARG E 3 162 ? 201.314 -76.292  21.389  1.00 156.79 ? 153 ARG E NH2 1 
ATOM   9026  N N   . PHE E 3 163 ? 205.528 -74.013  18.075  1.00 122.87 ? 154 PHE E N   1 
ATOM   9027  C CA  . PHE E 3 163 ? 205.506 -72.566  18.071  1.00 120.58 ? 154 PHE E CA  1 
ATOM   9028  C C   . PHE E 3 163 ? 205.470 -72.072  19.496  1.00 120.93 ? 154 PHE E C   1 
ATOM   9029  O O   . PHE E 3 163 ? 204.602 -72.464  20.279  1.00 119.65 ? 154 PHE E O   1 
ATOM   9030  C CB  . PHE E 3 163 ? 204.264 -72.042  17.359  1.00 119.69 ? 154 PHE E CB  1 
ATOM   9031  C CG  . PHE E 3 163 ? 204.398 -71.980  15.875  1.00 120.65 ? 154 PHE E CG  1 
ATOM   9032  C CD1 . PHE E 3 163 ? 205.201 -71.017  15.276  1.00 121.26 ? 154 PHE E CD1 1 
ATOM   9033  C CD2 . PHE E 3 163 ? 203.705 -72.872  15.071  1.00 121.24 ? 154 PHE E CD2 1 
ATOM   9034  C CE1 . PHE E 3 163 ? 205.320 -70.957  13.898  1.00 123.21 ? 154 PHE E CE1 1 
ATOM   9035  C CE2 . PHE E 3 163 ? 203.817 -72.819  13.692  1.00 122.74 ? 154 PHE E CE2 1 
ATOM   9036  C CZ  . PHE E 3 163 ? 204.627 -71.860  13.105  1.00 123.72 ? 154 PHE E CZ  1 
ATOM   9037  N N   . PHE E 3 164 ? 206.429 -71.221  19.831  1.00 123.64 ? 155 PHE E N   1 
ATOM   9038  C CA  . PHE E 3 164 ? 206.356 -70.454  21.061  1.00 127.32 ? 155 PHE E CA  1 
ATOM   9039  C C   . PHE E 3 164 ? 205.271 -69.382  20.943  1.00 127.32 ? 155 PHE E C   1 
ATOM   9040  O O   . PHE E 3 164 ? 204.535 -69.154  21.902  1.00 127.40 ? 155 PHE E O   1 
ATOM   9041  C CB  . PHE E 3 164 ? 207.716 -69.845  21.406  1.00 130.33 ? 155 PHE E CB  1 
ATOM   9042  C CG  . PHE E 3 164 ? 208.599 -70.754  22.212  1.00 133.21 ? 155 PHE E CG  1 
ATOM   9043  C CD1 . PHE E 3 164 ? 208.926 -72.027  21.751  1.00 133.96 ? 155 PHE E CD1 1 
ATOM   9044  C CD2 . PHE E 3 164 ? 209.112 -70.333  23.433  1.00 134.60 ? 155 PHE E CD2 1 
ATOM   9045  C CE1 . PHE E 3 164 ? 209.736 -72.862  22.501  1.00 134.84 ? 155 PHE E CE1 1 
ATOM   9046  C CE2 . PHE E 3 164 ? 209.929 -71.163  24.184  1.00 135.54 ? 155 PHE E CE2 1 
ATOM   9047  C CZ  . PHE E 3 164 ? 210.242 -72.430  23.716  1.00 135.47 ? 155 PHE E CZ  1 
ATOM   9048  N N   . PRO E 3 165 ? 205.155 -68.731  19.765  1.00 127.50 ? 156 PRO E N   1 
ATOM   9049  C CA  . PRO E 3 165 ? 204.054 -67.792  19.584  1.00 130.95 ? 156 PRO E CA  1 
ATOM   9050  C C   . PRO E 3 165 ? 202.705 -68.478  19.424  1.00 138.05 ? 156 PRO E C   1 
ATOM   9051  O O   . PRO E 3 165 ? 202.628 -69.590  18.894  1.00 137.67 ? 156 PRO E O   1 
ATOM   9052  C CB  . PRO E 3 165 ? 204.413 -67.075  18.277  1.00 127.24 ? 156 PRO E CB  1 
ATOM   9053  C CG  . PRO E 3 165 ? 205.285 -68.029  17.544  1.00 124.25 ? 156 PRO E CG  1 
ATOM   9054  C CD  . PRO E 3 165 ? 206.079 -68.707  18.615  1.00 124.87 ? 156 PRO E CD  1 
ATOM   9055  N N   . MET E 3 166 ? 201.660 -67.808  19.903  1.00 148.25 ? 157 MET E N   1 
ATOM   9056  C CA  . MET E 3 166 ? 200.288 -68.135  19.544  1.00 158.24 ? 157 MET E CA  1 
ATOM   9057  C C   . MET E 3 166 ? 200.152 -67.789  18.065  1.00 163.87 ? 157 MET E C   1 
ATOM   9058  O O   . MET E 3 166 ? 200.022 -66.614  17.702  1.00 167.75 ? 157 MET E O   1 
ATOM   9059  C CB  . MET E 3 166 ? 199.312 -67.311  20.394  1.00 160.12 ? 157 MET E CB  1 
ATOM   9060  C CG  . MET E 3 166 ? 197.848 -67.383  19.973  1.00 161.06 ? 157 MET E CG  1 
ATOM   9061  S SD  . MET E 3 166 ? 196.860 -66.033  20.654  1.00 161.13 ? 157 MET E SD  1 
ATOM   9062  C CE  . MET E 3 166 ? 197.623 -64.599  19.892  1.00 160.22 ? 157 MET E CE  1 
ATOM   9063  N N   . LEU E 3 167 ? 200.218 -68.809  17.212  1.00 167.81 ? 158 LEU E N   1 
ATOM   9064  C CA  . LEU E 3 167 ? 200.190 -68.576  15.773  1.00 169.38 ? 158 LEU E CA  1 
ATOM   9065  C C   . LEU E 3 167 ? 198.785 -68.717  15.200  1.00 169.15 ? 158 LEU E C   1 
ATOM   9066  O O   . LEU E 3 167 ? 198.185 -69.797  15.233  1.00 169.99 ? 158 LEU E O   1 
ATOM   9067  C CB  . LEU E 3 167 ? 201.190 -69.482  15.038  1.00 169.98 ? 158 LEU E CB  1 
ATOM   9068  C CG  . LEU E 3 167 ? 202.113 -68.839  13.987  1.00 169.20 ? 158 LEU E CG  1 
ATOM   9069  C CD1 . LEU E 3 167 ? 201.355 -68.190  12.833  1.00 169.16 ? 158 LEU E CD1 1 
ATOM   9070  C CD2 . LEU E 3 167 ? 203.059 -67.840  14.636  1.00 166.68 ? 158 LEU E CD2 1 
ATOM   9071  N N   . THR E 3 168 ? 198.272 -67.605  14.685  1.00 167.07 ? 159 THR E N   1 
ATOM   9072  C CA  . THR E 3 168 ? 196.947 -67.563  14.085  1.00 163.93 ? 159 THR E CA  1 
ATOM   9073  C C   . THR E 3 168 ? 197.039 -67.235  12.594  1.00 159.85 ? 159 THR E C   1 
ATOM   9074  O O   . THR E 3 168 ? 197.600 -66.209  12.197  1.00 157.96 ? 159 THR E O   1 
ATOM   9075  C CB  . THR E 3 168 ? 195.999 -66.595  14.839  1.00 165.98 ? 159 THR E CB  1 
ATOM   9076  O OG1 . THR E 3 168 ? 194.754 -66.489  14.139  1.00 167.83 ? 159 THR E OG1 1 
ATOM   9077  C CG2 . THR E 3 168 ? 196.621 -65.203  14.998  1.00 166.59 ? 159 THR E CG2 1 
ATOM   9078  N N   . THR E 3 169 ? 196.507 -68.141  11.781  1.00 156.53 ? 160 THR E N   1 
ATOM   9079  C CA  . THR E 3 169 ? 196.464 -67.983  10.330  1.00 155.70 ? 160 THR E CA  1 
ATOM   9080  C C   . THR E 3 169 ? 195.139 -68.534  9.808   1.00 160.51 ? 160 THR E C   1 
ATOM   9081  O O   . THR E 3 169 ? 194.338 -69.074  10.579  1.00 159.79 ? 160 THR E O   1 
ATOM   9082  C CB  . THR E 3 169 ? 197.638 -68.713  9.640   1.00 151.61 ? 160 THR E CB  1 
ATOM   9083  O OG1 . THR E 3 169 ? 197.911 -69.944  10.324  1.00 148.71 ? 160 THR E OG1 1 
ATOM   9084  C CG2 . THR E 3 169 ? 198.894 -67.847  9.640   1.00 149.44 ? 160 THR E CG2 1 
ATOM   9085  N N   . ALA E 3 170 ? 194.913 -68.395  8.502   1.00 167.24 ? 161 ALA E N   1 
ATOM   9086  C CA  . ALA E 3 170 ? 193.715 -68.932  7.853   1.00 173.37 ? 161 ALA E CA  1 
ATOM   9087  C C   . ALA E 3 170 ? 193.706 -70.465  7.848   1.00 176.51 ? 161 ALA E C   1 
ATOM   9088  O O   . ALA E 3 170 ? 192.725 -71.088  7.431   1.00 180.61 ? 161 ALA E O   1 
ATOM   9089  C CB  . ALA E 3 170 ? 193.593 -68.389  6.435   1.00 174.27 ? 161 ALA E CB  1 
ATOM   9090  N N   . ALA E 3 171 ? 194.803 -71.056  8.324   1.00 176.43 ? 162 ALA E N   1 
ATOM   9091  C CA  . ALA E 3 171 ? 194.965 -72.508  8.385   1.00 173.80 ? 162 ALA E CA  1 
ATOM   9092  C C   . ALA E 3 171 ? 194.381 -73.102  9.666   1.00 168.62 ? 162 ALA E C   1 
ATOM   9093  O O   . ALA E 3 171 ? 193.728 -74.146  9.629   1.00 171.02 ? 162 ALA E O   1 
ATOM   9094  C CB  . ALA E 3 171 ? 196.435 -72.882  8.246   1.00 175.64 ? 162 ALA E CB  1 
ATOM   9095  N N   . GLY E 3 172 ? 194.622 -72.435  10.793  1.00 159.62 ? 163 GLY E N   1 
ATOM   9096  C CA  . GLY E 3 172 ? 194.116 -72.896  12.082  1.00 149.38 ? 163 GLY E CA  1 
ATOM   9097  C C   . GLY E 3 172 ? 194.708 -72.150  13.257  1.00 143.34 ? 163 GLY E C   1 
ATOM   9098  O O   . GLY E 3 172 ? 195.578 -71.291  13.087  1.00 141.61 ? 163 GLY E O   1 
ATOM   9099  N N   . THR E 3 173 ? 194.234 -72.484  14.455  1.00 139.03 ? 164 THR E N   1 
ATOM   9100  C CA  . THR E 3 173 ? 194.691 -71.824  15.672  1.00 135.12 ? 164 THR E CA  1 
ATOM   9101  C C   . THR E 3 173 ? 195.700 -72.676  16.431  1.00 130.12 ? 164 THR E C   1 
ATOM   9102  O O   . THR E 3 173 ? 195.381 -73.756  16.937  1.00 129.23 ? 164 THR E O   1 
ATOM   9103  C CB  . THR E 3 173 ? 193.521 -71.439  16.602  1.00 136.98 ? 164 THR E CB  1 
ATOM   9104  O OG1 . THR E 3 173 ? 192.499 -70.785  15.840  1.00 138.61 ? 164 THR E OG1 1 
ATOM   9105  C CG2 . THR E 3 173 ? 194.001 -70.500  17.710  1.00 136.80 ? 164 THR E CG2 1 
ATOM   9106  N N   . ILE E 3 174 ? 196.924 -72.171  16.491  1.00 124.58 ? 165 ILE E N   1 
ATOM   9107  C CA  . ILE E 3 174 ? 197.983 -72.798  17.254  1.00 119.52 ? 165 ILE E CA  1 
ATOM   9108  C C   . ILE E 3 174 ? 198.124 -72.055  18.576  1.00 116.54 ? 165 ILE E C   1 
ATOM   9109  O O   . ILE E 3 174 ? 198.333 -70.839  18.602  1.00 115.27 ? 165 ILE E O   1 
ATOM   9110  C CB  . ILE E 3 174 ? 199.299 -72.826  16.445  1.00 119.48 ? 165 ILE E CB  1 
ATOM   9111  C CG1 . ILE E 3 174 ? 199.290 -74.027  15.494  1.00 118.64 ? 165 ILE E CG1 1 
ATOM   9112  C CG2 . ILE E 3 174 ? 200.518 -72.855  17.357  1.00 118.71 ? 165 ILE E CG2 1 
ATOM   9113  C CD1 . ILE E 3 174 ? 200.261 -73.917  14.341  1.00 118.66 ? 165 ILE E CD1 1 
ATOM   9114  N N   . ARG E 3 175 ? 197.964 -72.791  19.670  1.00 114.42 ? 166 ARG E N   1 
ATOM   9115  C CA  . ARG E 3 175 ? 198.166 -72.236  21.000  1.00 114.73 ? 166 ARG E CA  1 
ATOM   9116  C C   . ARG E 3 175 ? 199.664 -72.030  21.253  1.00 116.87 ? 166 ARG E C   1 
ATOM   9117  O O   . ARG E 3 175 ? 200.489 -72.768  20.706  1.00 116.51 ? 166 ARG E O   1 
ATOM   9118  C CB  . ARG E 3 175 ? 197.540 -73.143  22.067  1.00 113.47 ? 166 ARG E CB  1 
ATOM   9119  C CG  . ARG E 3 175 ? 198.159 -74.527  22.180  1.00 113.19 ? 166 ARG E CG  1 
ATOM   9120  C CD  . ARG E 3 175 ? 197.948 -75.107  23.568  1.00 113.40 ? 166 ARG E CD  1 
ATOM   9121  N NE  . ARG E 3 175 ? 198.865 -76.213  23.843  1.00 113.81 ? 166 ARG E NE  1 
ATOM   9122  C CZ  . ARG E 3 175 ? 200.056 -76.087  24.425  1.00 113.91 ? 166 ARG E CZ  1 
ATOM   9123  N NH1 . ARG E 3 175 ? 200.500 -74.896  24.810  1.00 113.60 ? 166 ARG E NH1 1 
ATOM   9124  N NH2 . ARG E 3 175 ? 200.808 -77.160  24.625  1.00 114.00 ? 166 ARG E NH2 1 
ATOM   9125  N N   . PRO E 3 176 ? 200.024 -71.017  22.069  1.00 119.50 ? 167 PRO E N   1 
ATOM   9126  C CA  . PRO E 3 176 ? 201.438 -70.802  22.376  1.00 121.48 ? 167 PRO E CA  1 
ATOM   9127  C C   . PRO E 3 176 ? 201.975 -71.897  23.292  1.00 123.62 ? 167 PRO E C   1 
ATOM   9128  O O   . PRO E 3 176 ? 201.239 -72.403  24.143  1.00 123.60 ? 167 PRO E O   1 
ATOM   9129  C CB  . PRO E 3 176 ? 201.441 -69.451  23.098  1.00 120.91 ? 167 PRO E CB  1 
ATOM   9130  C CG  . PRO E 3 176 ? 200.082 -69.330  23.693  1.00 120.60 ? 167 PRO E CG  1 
ATOM   9131  C CD  . PRO E 3 176 ? 199.153 -70.035  22.745  1.00 120.26 ? 167 PRO E CD  1 
ATOM   9132  N N   . ALA E 3 177 ? 203.241 -72.262  23.106  1.00 126.60 ? 168 ALA E N   1 
ATOM   9133  C CA  . ALA E 3 177 ? 203.882 -73.273  23.943  1.00 129.70 ? 168 ALA E CA  1 
ATOM   9134  C C   . ALA E 3 177 ? 203.953 -72.804  25.397  1.00 132.19 ? 168 ALA E C   1 
ATOM   9135  O O   . ALA E 3 177 ? 204.231 -71.632  25.665  1.00 132.08 ? 168 ALA E O   1 
ATOM   9136  C CB  . ALA E 3 177 ? 205.269 -73.602  23.412  1.00 129.94 ? 168 ALA E CB  1 
ATOM   9137  N N   . LYS E 3 178 ? 203.678 -73.718  26.325  1.00 135.26 ? 169 LYS E N   1 
ATOM   9138  C CA  . LYS E 3 178 ? 203.730 -73.417  27.759  1.00 138.17 ? 169 LYS E CA  1 
ATOM   9139  C C   . LYS E 3 178 ? 205.109 -73.739  28.343  1.00 142.22 ? 169 LYS E C   1 
ATOM   9140  O O   . LYS E 3 178 ? 205.537 -74.897  28.347  1.00 146.40 ? 169 LYS E O   1 
ATOM   9141  C CB  . LYS E 3 178 ? 202.632 -74.173  28.521  1.00 135.22 ? 169 LYS E CB  1 
ATOM   9142  C CG  . LYS E 3 178 ? 201.213 -73.711  28.222  1.00 131.90 ? 169 LYS E CG  1 
ATOM   9143  C CD  . LYS E 3 178 ? 200.208 -74.380  29.151  1.00 129.40 ? 169 LYS E CD  1 
ATOM   9144  C CE  . LYS E 3 178 ? 198.781 -74.007  28.782  1.00 127.88 ? 169 LYS E CE  1 
ATOM   9145  N NZ  . LYS E 3 178 ? 197.786 -74.502  29.780  1.00 126.73 ? 169 LYS E NZ  1 
ATOM   9146  N N   . VAL E 3 179 ? 205.794 -72.706  28.836  1.00 143.09 ? 170 VAL E N   1 
ATOM   9147  C CA  . VAL E 3 179 ? 207.162 -72.837  29.356  1.00 141.56 ? 170 VAL E CA  1 
ATOM   9148  C C   . VAL E 3 179 ? 207.193 -72.648  30.876  1.00 138.02 ? 170 VAL E C   1 
ATOM   9149  O O   . VAL E 3 179 ? 206.527 -71.757  31.403  1.00 139.79 ? 170 VAL E O   1 
ATOM   9150  C CB  . VAL E 3 179 ? 208.124 -71.821  28.688  1.00 142.84 ? 170 VAL E CB  1 
ATOM   9151  C CG1 . VAL E 3 179 ? 209.570 -72.099  29.076  1.00 143.50 ? 170 VAL E CG1 1 
ATOM   9152  C CG2 . VAL E 3 179 ? 207.973 -71.840  27.174  1.00 143.75 ? 170 VAL E CG2 1 
ATOM   9153  N N   . MET E 3 180 ? 207.960 -73.487  31.573  1.00 131.03 ? 171 MET E N   1 
ATOM   9154  C CA  . MET E 3 180 ? 208.113 -73.359  33.024  1.00 124.03 ? 171 MET E CA  1 
ATOM   9155  C C   . MET E 3 180 ? 209.568 -73.149  33.446  1.00 122.91 ? 171 MET E C   1 
ATOM   9156  O O   . MET E 3 180 ? 210.428 -74.005  33.217  1.00 120.35 ? 171 MET E O   1 
ATOM   9157  C CB  . MET E 3 180 ? 207.502 -74.560  33.754  1.00 118.17 ? 171 MET E CB  1 
ATOM   9158  C CG  . MET E 3 180 ? 207.544 -74.454  35.272  1.00 113.16 ? 171 MET E CG  1 
ATOM   9159  S SD  . MET E 3 180 ? 207.246 -76.015  36.123  1.00 107.49 ? 171 MET E SD  1 
ATOM   9160  C CE  . MET E 3 180 ? 205.460 -76.108  36.069  1.00 108.42 ? 171 MET E CE  1 
ATOM   9161  N N   . VAL E 3 181 ? 209.820 -71.995  34.060  1.00 123.31 ? 172 VAL E N   1 
ATOM   9162  C CA  . VAL E 3 181 ? 211.130 -71.666  34.615  1.00 123.37 ? 172 VAL E CA  1 
ATOM   9163  C C   . VAL E 3 181 ? 211.175 -72.070  36.084  1.00 123.77 ? 172 VAL E C   1 
ATOM   9164  O O   . VAL E 3 181 ? 210.513 -71.472  36.937  1.00 122.05 ? 172 VAL E O   1 
ATOM   9165  C CB  . VAL E 3 181 ? 211.488 -70.177  34.413  1.00 123.44 ? 172 VAL E CB  1 
ATOM   9166  C CG1 . VAL E 3 181 ? 212.621 -69.746  35.335  1.00 122.60 ? 172 VAL E CG1 1 
ATOM   9167  C CG2 . VAL E 3 181 ? 211.869 -69.930  32.961  1.00 124.65 ? 172 VAL E CG2 1 
ATOM   9168  N N   . MET E 3 182 ? 211.967 -73.102  36.354  1.00 126.05 ? 173 MET E N   1 
ATOM   9169  C CA  . MET E 3 182 ? 212.006 -73.748  37.658  1.00 128.24 ? 173 MET E CA  1 
ATOM   9170  C C   . MET E 3 182 ? 213.284 -73.353  38.383  1.00 128.01 ? 173 MET E C   1 
ATOM   9171  O O   . MET E 3 182 ? 214.363 -73.890  38.124  1.00 128.83 ? 173 MET E O   1 
ATOM   9172  C CB  . MET E 3 182 ? 211.891 -75.262  37.487  1.00 130.22 ? 173 MET E CB  1 
ATOM   9173  C CG  . MET E 3 182 ? 210.805 -75.657  36.494  1.00 131.36 ? 173 MET E CG  1 
ATOM   9174  S SD  . MET E 3 182 ? 210.635 -77.420  36.175  1.00 133.35 ? 173 MET E SD  1 
ATOM   9175  C CE  . MET E 3 182 ? 210.124 -78.012  37.788  1.00 134.25 ? 173 MET E CE  1 
ATOM   9176  N N   . GLY E 3 183 ? 213.137 -72.406  39.301  1.00 126.94 ? 174 GLY E N   1 
ATOM   9177  C CA  . GLY E 3 183 ? 214.267 -71.673  39.831  1.00 126.45 ? 174 GLY E CA  1 
ATOM   9178  C C   . GLY E 3 183 ? 214.284 -70.331  39.138  1.00 126.71 ? 174 GLY E C   1 
ATOM   9179  O O   . GLY E 3 183 ? 214.526 -70.251  37.935  1.00 126.70 ? 174 GLY E O   1 
ATOM   9180  N N   . VAL E 3 184 ? 214.005 -69.277  39.895  1.00 127.05 ? 175 VAL E N   1 
ATOM   9181  C CA  . VAL E 3 184 ? 213.920 -67.932  39.339  1.00 129.42 ? 175 VAL E CA  1 
ATOM   9182  C C   . VAL E 3 184 ? 215.021 -67.040  39.921  1.00 133.97 ? 175 VAL E C   1 
ATOM   9183  O O   . VAL E 3 184 ? 214.884 -66.486  41.018  1.00 134.22 ? 175 VAL E O   1 
ATOM   9184  C CB  . VAL E 3 184 ? 212.514 -67.320  39.548  1.00 127.08 ? 175 VAL E CB  1 
ATOM   9185  C CG1 . VAL E 3 184 ? 212.413 -65.954  38.888  1.00 128.00 ? 175 VAL E CG1 1 
ATOM   9186  C CG2 . VAL E 3 184 ? 211.437 -68.240  38.990  1.00 124.30 ? 175 VAL E CG2 1 
ATOM   9187  N N   . GLY E 3 185 ? 216.123 -66.937  39.177  1.00 138.71 ? 176 GLY E N   1 
ATOM   9188  C CA  . GLY E 3 185 ? 217.248 -66.070  39.528  1.00 142.64 ? 176 GLY E CA  1 
ATOM   9189  C C   . GLY E 3 185 ? 217.685 -65.228  38.342  1.00 144.01 ? 176 GLY E C   1 
ATOM   9190  O O   . GLY E 3 185 ? 216.879 -64.944  37.451  1.00 147.17 ? 176 GLY E O   1 
ATOM   9191  N N   . VAL E 3 186 ? 218.960 -64.839  38.321  1.00 141.95 ? 177 VAL E N   1 
ATOM   9192  C CA  . VAL E 3 186 ? 219.485 -63.950  37.275  1.00 138.46 ? 177 VAL E CA  1 
ATOM   9193  C C   . VAL E 3 186 ? 219.298 -64.543  35.876  1.00 135.00 ? 177 VAL E C   1 
ATOM   9194  O O   . VAL E 3 186 ? 218.928 -63.836  34.934  1.00 132.90 ? 177 VAL E O   1 
ATOM   9195  C CB  . VAL E 3 186 ? 220.972 -63.591  37.495  1.00 138.84 ? 177 VAL E CB  1 
ATOM   9196  C CG1 . VAL E 3 186 ? 221.334 -62.368  36.669  1.00 138.61 ? 177 VAL E CG1 1 
ATOM   9197  C CG2 . VAL E 3 186 ? 221.267 -63.336  38.967  1.00 139.62 ? 177 VAL E CG2 1 
ATOM   9198  N N   . ALA E 3 187 ? 219.551 -65.844  35.759  1.00 132.18 ? 178 ALA E N   1 
ATOM   9199  C CA  . ALA E 3 187 ? 219.316 -66.576  34.521  1.00 130.08 ? 178 ALA E CA  1 
ATOM   9200  C C   . ALA E 3 187 ? 217.826 -66.840  34.312  1.00 127.99 ? 178 ALA E C   1 
ATOM   9201  O O   . ALA E 3 187 ? 217.323 -66.750  33.189  1.00 125.89 ? 178 ALA E O   1 
ATOM   9202  C CB  . ALA E 3 187 ? 220.096 -67.883  34.527  1.00 131.06 ? 178 ALA E CB  1 
ATOM   9203  N N   . GLY E 3 188 ? 217.133 -67.161  35.405  1.00 126.76 ? 179 GLY E N   1 
ATOM   9204  C CA  . GLY E 3 188 ? 215.706 -67.476  35.379  1.00 125.97 ? 179 GLY E CA  1 
ATOM   9205  C C   . GLY E 3 188 ? 214.859 -66.363  34.797  1.00 125.15 ? 179 GLY E C   1 
ATOM   9206  O O   . GLY E 3 188 ? 214.153 -66.568  33.808  1.00 124.37 ? 179 GLY E O   1 
ATOM   9207  N N   . LEU E 3 189 ? 214.941 -65.184  35.412  1.00 125.33 ? 180 LEU E N   1 
ATOM   9208  C CA  . LEU E 3 189 ? 214.233 -63.990  34.945  1.00 123.96 ? 180 LEU E CA  1 
ATOM   9209  C C   . LEU E 3 189 ? 214.559 -63.694  33.489  1.00 116.93 ? 180 LEU E C   1 
ATOM   9210  O O   . LEU E 3 189 ? 213.687 -63.305  32.709  1.00 113.84 ? 180 LEU E O   1 
ATOM   9211  C CB  . LEU E 3 189 ? 214.600 -62.777  35.807  1.00 131.06 ? 180 LEU E CB  1 
ATOM   9212  C CG  . LEU E 3 189 ? 213.922 -62.603  37.171  1.00 136.95 ? 180 LEU E CG  1 
ATOM   9213  C CD1 . LEU E 3 189 ? 214.706 -61.634  38.046  1.00 139.49 ? 180 LEU E CD1 1 
ATOM   9214  C CD2 . LEU E 3 189 ? 212.481 -62.137  37.015  1.00 139.34 ? 180 LEU E CD2 1 
ATOM   9215  N N   . MET E 3 190 ? 215.826 -63.891  33.142  1.00 111.76 ? 181 MET E N   1 
ATOM   9216  C CA  . MET E 3 190 ? 216.301 -63.703  31.787  1.00 109.82 ? 181 MET E CA  1 
ATOM   9217  C C   . MET E 3 190 ? 215.628 -64.673  30.829  1.00 105.76 ? 181 MET E C   1 
ATOM   9218  O O   . MET E 3 190 ? 215.247 -64.298  29.721  1.00 103.54 ? 181 MET E O   1 
ATOM   9219  C CB  . MET E 3 190 ? 217.813 -63.885  31.740  1.00 114.22 ? 181 MET E CB  1 
ATOM   9220  C CG  . MET E 3 190 ? 218.471 -63.166  30.581  1.00 120.17 ? 181 MET E CG  1 
ATOM   9221  S SD  . MET E 3 190 ? 218.018 -61.420  30.484  1.00 127.61 ? 181 MET E SD  1 
ATOM   9222  C CE  . MET E 3 190 ? 218.502 -60.813  32.105  1.00 126.00 ? 181 MET E CE  1 
ATOM   9223  N N   . ALA E 3 191 ? 215.486 -65.919  31.268  1.00 103.97 ? 182 ALA E N   1 
ATOM   9224  C CA  . ALA E 3 191 ? 214.825 -66.946  30.476  1.00 104.87 ? 182 ALA E CA  1 
ATOM   9225  C C   . ALA E 3 191 ? 213.325 -66.682  30.361  1.00 106.46 ? 182 ALA E C   1 
ATOM   9226  O O   . ALA E 3 191 ? 212.746 -66.862  29.289  1.00 106.80 ? 182 ALA E O   1 
ATOM   9227  C CB  . ALA E 3 191 ? 215.085 -68.321  31.068  1.00 104.78 ? 182 ALA E CB  1 
ATOM   9228  N N   . ILE E 3 192 ? 212.711 -66.253  31.465  1.00 108.85 ? 183 ILE E N   1 
ATOM   9229  C CA  . ILE E 3 192 ? 211.276 -65.940  31.511  1.00 111.81 ? 183 ILE E CA  1 
ATOM   9230  C C   . ILE E 3 192 ? 210.921 -64.873  30.483  1.00 111.43 ? 183 ILE E C   1 
ATOM   9231  O O   . ILE E 3 192 ? 209.965 -65.025  29.717  1.00 110.40 ? 183 ILE E O   1 
ATOM   9232  C CB  . ILE E 3 192 ? 210.834 -65.466  32.919  1.00 114.37 ? 183 ILE E CB  1 
ATOM   9233  C CG1 . ILE E 3 192 ? 210.861 -66.634  33.909  1.00 116.52 ? 183 ILE E CG1 1 
ATOM   9234  C CG2 . ILE E 3 192 ? 209.433 -64.864  32.882  1.00 114.99 ? 183 ILE E CG2 1 
ATOM   9235  C CD1 . ILE E 3 192 ? 211.005 -66.229  35.361  1.00 117.88 ? 183 ILE E CD1 1 
ATOM   9236  N N   . ALA E 3 193 ? 211.712 -63.804  30.475  1.00 112.61 ? 184 ALA E N   1 
ATOM   9237  C CA  . ALA E 3 193 ? 211.486 -62.660  29.605  1.00 115.69 ? 184 ALA E CA  1 
ATOM   9238  C C   . ALA E 3 193 ? 211.465 -63.044  28.125  1.00 117.36 ? 184 ALA E C   1 
ATOM   9239  O O   . ALA E 3 193 ? 210.468 -62.810  27.434  1.00 118.45 ? 184 ALA E O   1 
ATOM   9240  C CB  . ALA E 3 193 ? 212.535 -61.591  29.870  1.00 117.11 ? 184 ALA E CB  1 
ATOM   9241  N N   . THR E 3 194 ? 212.555 -63.651  27.654  1.00 118.50 ? 185 THR E N   1 
ATOM   9242  C CA  . THR E 3 194 ? 212.712 -63.994  26.237  1.00 119.33 ? 185 THR E CA  1 
ATOM   9243  C C   . THR E 3 194 ? 211.633 -64.974  25.764  1.00 118.46 ? 185 THR E C   1 
ATOM   9244  O O   . THR E 3 194 ? 211.266 -64.980  24.585  1.00 119.40 ? 185 THR E O   1 
ATOM   9245  C CB  . THR E 3 194 ? 214.115 -64.568  25.932  1.00 120.43 ? 185 THR E CB  1 
ATOM   9246  O OG1 . THR E 3 194 ? 215.062 -64.096  26.900  1.00 121.21 ? 185 THR E OG1 1 
ATOM   9247  C CG2 . THR E 3 194 ? 214.572 -64.162  24.530  1.00 120.72 ? 185 THR E CG2 1 
ATOM   9248  N N   . ALA E 3 195 ? 211.128 -65.790  26.690  1.00 116.18 ? 186 ALA E N   1 
ATOM   9249  C CA  . ALA E 3 195 ? 210.050 -66.738  26.403  1.00 113.15 ? 186 ALA E CA  1 
ATOM   9250  C C   . ALA E 3 195 ? 208.736 -66.031  26.061  1.00 111.35 ? 186 ALA E C   1 
ATOM   9251  O O   . ALA E 3 195 ? 207.983 -66.500  25.205  1.00 109.84 ? 186 ALA E O   1 
ATOM   9252  C CB  . ALA E 3 195 ? 209.860 -67.701  27.566  1.00 112.55 ? 186 ALA E CB  1 
ATOM   9253  N N   . LYS E 3 196 ? 208.470 -64.907  26.727  1.00 110.64 ? 187 LYS E N   1 
ATOM   9254  C CA  . LYS E 3 196 ? 207.294 -64.085  26.422  1.00 110.15 ? 187 LYS E CA  1 
ATOM   9255  C C   . LYS E 3 196 ? 207.529 -63.195  25.195  1.00 106.49 ? 187 LYS E C   1 
ATOM   9256  O O   . LYS E 3 196 ? 206.574 -62.831  24.504  1.00 105.95 ? 187 LYS E O   1 
ATOM   9257  C CB  . LYS E 3 196 ? 206.863 -63.246  27.638  1.00 113.41 ? 187 LYS E CB  1 
ATOM   9258  C CG  . LYS E 3 196 ? 205.473 -62.606  27.540  1.00 116.07 ? 187 LYS E CG  1 
ATOM   9259  C CD  . LYS E 3 196 ? 204.342 -63.593  27.826  1.00 117.29 ? 187 LYS E CD  1 
ATOM   9260  C CE  . LYS E 3 196 ? 203.013 -62.898  28.118  1.00 116.28 ? 187 LYS E CE  1 
ATOM   9261  N NZ  . LYS E 3 196 ? 202.186 -62.617  26.909  1.00 114.07 ? 187 LYS E NZ  1 
ATOM   9262  N N   . ARG E 3 197 ? 208.792 -62.849  24.929  1.00 102.25 ? 188 ARG E N   1 
ATOM   9263  C CA  . ARG E 3 197 ? 209.155 -62.131  23.703  1.00 99.90  ? 188 ARG E CA  1 
ATOM   9264  C C   . ARG E 3 197 ? 208.608 -62.872  22.493  1.00 103.73 ? 188 ARG E C   1 
ATOM   9265  O O   . ARG E 3 197 ? 208.022 -62.263  21.600  1.00 103.18 ? 188 ARG E O   1 
ATOM   9266  C CB  . ARG E 3 197 ? 210.674 -61.988  23.562  1.00 94.38  ? 188 ARG E CB  1 
ATOM   9267  C CG  . ARG E 3 197 ? 211.258 -60.718  24.153  1.00 89.46  ? 188 ARG E CG  1 
ATOM   9268  C CD  . ARG E 3 197 ? 212.675 -60.481  23.649  1.00 85.42  ? 188 ARG E CD  1 
ATOM   9269  N NE  . ARG E 3 197 ? 213.296 -59.310  24.269  1.00 82.79  ? 188 ARG E NE  1 
ATOM   9270  C CZ  . ARG E 3 197 ? 213.140 -58.053  23.855  1.00 81.70  ? 188 ARG E CZ  1 
ATOM   9271  N NH1 . ARG E 3 197 ? 212.381 -57.777  22.802  1.00 80.82  ? 188 ARG E NH1 1 
ATOM   9272  N NH2 . ARG E 3 197 ? 213.747 -57.062  24.496  1.00 80.66  ? 188 ARG E NH2 1 
ATOM   9273  N N   . LEU E 3 198 ? 208.789 -64.192  22.494  1.00 110.56 ? 189 LEU E N   1 
ATOM   9274  C CA  . LEU E 3 198 ? 208.370 -65.059  21.394  1.00 117.19 ? 189 LEU E CA  1 
ATOM   9275  C C   . LEU E 3 198 ? 206.868 -65.334  21.370  1.00 117.13 ? 189 LEU E C   1 
ATOM   9276  O O   . LEU E 3 198 ? 206.327 -65.703  20.328  1.00 118.25 ? 189 LEU E O   1 
ATOM   9277  C CB  . LEU E 3 198 ? 209.146 -66.379  21.425  1.00 122.81 ? 189 LEU E CB  1 
ATOM   9278  C CG  . LEU E 3 198 ? 210.662 -66.318  21.205  1.00 127.30 ? 189 LEU E CG  1 
ATOM   9279  C CD1 . LEU E 3 198 ? 211.317 -67.609  21.669  1.00 130.25 ? 189 LEU E CD1 1 
ATOM   9280  C CD2 . LEU E 3 198 ? 211.008 -66.029  19.751  1.00 129.12 ? 189 LEU E CD2 1 
ATOM   9281  N N   . GLY E 3 199 ? 206.204 -65.165  22.512  1.00 115.87 ? 190 GLY E N   1 
ATOM   9282  C CA  . GLY E 3 199 ? 204.748 -65.308  22.593  1.00 113.99 ? 190 GLY E CA  1 
ATOM   9283  C C   . GLY E 3 199 ? 204.251 -66.434  23.479  1.00 112.29 ? 190 GLY E C   1 
ATOM   9284  O O   . GLY E 3 199 ? 203.040 -66.625  23.627  1.00 111.02 ? 190 GLY E O   1 
ATOM   9285  N N   . ALA E 3 200 ? 205.186 -67.175  24.070  1.00 111.45 ? 191 ALA E N   1 
ATOM   9286  C CA  . ALA E 3 200 ? 204.861 -68.300  24.941  1.00 111.53 ? 191 ALA E CA  1 
ATOM   9287  C C   . ALA E 3 200 ? 204.175 -67.847  26.222  1.00 112.91 ? 191 ALA E C   1 
ATOM   9288  O O   . ALA E 3 200 ? 204.514 -66.805  26.781  1.00 113.72 ? 191 ALA E O   1 
ATOM   9289  C CB  . ALA E 3 200 ? 206.117 -69.094  25.266  1.00 110.00 ? 191 ALA E CB  1 
ATOM   9290  N N   . GLN E 3 201 ? 203.194 -68.626  26.666  1.00 115.13 ? 192 GLN E N   1 
ATOM   9291  C CA  . GLN E 3 201 ? 202.581 -68.427  27.972  1.00 118.52 ? 192 GLN E CA  1 
ATOM   9292  C C   . GLN E 3 201 ? 203.487 -69.107  28.998  1.00 119.86 ? 192 GLN E C   1 
ATOM   9293  O O   . GLN E 3 201 ? 203.657 -70.327  28.971  1.00 119.80 ? 192 GLN E O   1 
ATOM   9294  C CB  . GLN E 3 201 ? 201.174 -69.027  27.996  1.00 120.45 ? 192 GLN E CB  1 
ATOM   9295  C CG  . GLN E 3 201 ? 200.341 -68.638  29.208  1.00 123.97 ? 192 GLN E CG  1 
ATOM   9296  C CD  . GLN E 3 201 ? 199.157 -69.563  29.428  1.00 126.69 ? 192 GLN E CD  1 
ATOM   9297  O OE1 . GLN E 3 201 ? 199.278 -70.786  29.331  1.00 127.88 ? 192 GLN E OE1 1 
ATOM   9298  N NE2 . GLN E 3 201 ? 198.004 -68.981  29.738  1.00 128.33 ? 192 GLN E NE2 1 
ATOM   9299  N N   . VAL E 3 202 ? 204.072 -68.311  29.891  1.00 122.04 ? 193 VAL E N   1 
ATOM   9300  C CA  . VAL E 3 202 ? 205.160 -68.776  30.764  1.00 123.78 ? 193 VAL E CA  1 
ATOM   9301  C C   . VAL E 3 202 ? 204.747 -68.927  32.237  1.00 125.58 ? 193 VAL E C   1 
ATOM   9302  O O   . VAL E 3 202 ? 203.854 -68.226  32.722  1.00 127.04 ? 193 VAL E O   1 
ATOM   9303  C CB  . VAL E 3 202 ? 206.406 -67.857  30.651  1.00 123.37 ? 193 VAL E CB  1 
ATOM   9304  C CG1 . VAL E 3 202 ? 207.646 -68.540  31.209  1.00 123.51 ? 193 VAL E CG1 1 
ATOM   9305  C CG2 . VAL E 3 202 ? 206.654 -67.460  29.203  1.00 122.53 ? 193 VAL E CG2 1 
ATOM   9306  N N   . PHE E 3 203 ? 205.406 -69.860  32.926  1.00 126.52 ? 194 PHE E N   1 
ATOM   9307  C CA  . PHE E 3 203 ? 205.225 -70.105  34.360  1.00 126.31 ? 194 PHE E CA  1 
ATOM   9308  C C   . PHE E 3 203 ? 206.592 -70.000  35.054  1.00 124.62 ? 194 PHE E C   1 
ATOM   9309  O O   . PHE E 3 203 ? 207.623 -70.295  34.446  1.00 124.32 ? 194 PHE E O   1 
ATOM   9310  C CB  . PHE E 3 203 ? 204.615 -71.497  34.597  1.00 127.93 ? 194 PHE E CB  1 
ATOM   9311  C CG  . PHE E 3 203 ? 203.239 -71.690  33.994  1.00 128.23 ? 194 PHE E CG  1 
ATOM   9312  C CD1 . PHE E 3 203 ? 203.084 -71.999  32.642  1.00 128.12 ? 194 PHE E CD1 1 
ATOM   9313  C CD2 . PHE E 3 203 ? 202.095 -71.596  34.786  1.00 128.01 ? 194 PHE E CD2 1 
ATOM   9314  C CE1 . PHE E 3 203 ? 201.822 -72.188  32.093  1.00 127.23 ? 194 PHE E CE1 1 
ATOM   9315  C CE2 . PHE E 3 203 ? 200.831 -71.786  34.241  1.00 126.96 ? 194 PHE E CE2 1 
ATOM   9316  C CZ  . PHE E 3 203 ? 200.694 -72.082  32.894  1.00 126.69 ? 194 PHE E CZ  1 
ATOM   9317  N N   . ALA E 3 204 ? 206.605 -69.586  36.321  1.00 122.98 ? 195 ALA E N   1 
ATOM   9318  C CA  . ALA E 3 204 ? 207.864 -69.400  37.047  1.00 123.76 ? 195 ALA E CA  1 
ATOM   9319  C C   . ALA E 3 204 ? 207.843 -70.023  38.440  1.00 128.45 ? 195 ALA E C   1 
ATOM   9320  O O   . ALA E 3 204 ? 207.101 -69.573  39.316  1.00 127.22 ? 195 ALA E O   1 
ATOM   9321  C CB  . ALA E 3 204 ? 208.210 -67.922  37.129  1.00 120.22 ? 195 ALA E CB  1 
ATOM   9322  N N   . TYR E 3 205 ? 208.663 -71.055  38.637  1.00 137.97 ? 196 TYR E N   1 
ATOM   9323  C CA  . TYR E 3 205 ? 208.760 -71.743  39.928  1.00 149.37 ? 196 TYR E CA  1 
ATOM   9324  C C   . TYR E 3 205 ? 209.952 -71.276  40.752  1.00 149.14 ? 196 TYR E C   1 
ATOM   9325  O O   . TYR E 3 205 ? 211.070 -71.156  40.248  1.00 147.45 ? 196 TYR E O   1 
ATOM   9326  C CB  . TYR E 3 205 ? 208.811 -73.272  39.753  1.00 158.79 ? 196 TYR E CB  1 
ATOM   9327  C CG  . TYR E 3 205 ? 209.027 -74.056  41.046  1.00 166.83 ? 196 TYR E CG  1 
ATOM   9328  C CD1 . TYR E 3 205 ? 208.001 -74.196  41.987  1.00 169.13 ? 196 TYR E CD1 1 
ATOM   9329  C CD2 . TYR E 3 205 ? 210.255 -74.666  41.322  1.00 168.89 ? 196 TYR E CD2 1 
ATOM   9330  C CE1 . TYR E 3 205 ? 208.195 -74.910  43.164  1.00 170.30 ? 196 TYR E CE1 1 
ATOM   9331  C CE2 . TYR E 3 205 ? 210.456 -75.382  42.495  1.00 169.27 ? 196 TYR E CE2 1 
ATOM   9332  C CZ  . TYR E 3 205 ? 209.424 -75.503  43.411  1.00 169.83 ? 196 TYR E CZ  1 
ATOM   9333  O OH  . TYR E 3 205 ? 209.619 -76.216  44.574  1.00 168.38 ? 196 TYR E OH  1 
ATOM   9334  N N   . ASP E 3 206 ? 209.684 -71.021  42.029  1.00 149.05 ? 197 ASP E N   1 
ATOM   9335  C CA  . ASP E 3 206 ? 210.702 -70.665  43.003  1.00 146.56 ? 197 ASP E CA  1 
ATOM   9336  C C   . ASP E 3 206 ? 210.142 -70.887  44.405  1.00 150.22 ? 197 ASP E C   1 
ATOM   9337  O O   . ASP E 3 206 ? 209.041 -71.424  44.567  1.00 150.64 ? 197 ASP E O   1 
ATOM   9338  C CB  . ASP E 3 206 ? 211.126 -69.207  42.828  1.00 141.13 ? 197 ASP E CB  1 
ATOM   9339  C CG  . ASP E 3 206 ? 212.609 -69.018  42.998  1.00 136.28 ? 197 ASP E CG  1 
ATOM   9340  O OD1 . ASP E 3 206 ? 213.360 -69.545  42.158  1.00 133.62 ? 197 ASP E OD1 1 
ATOM   9341  O OD2 . ASP E 3 206 ? 213.026 -68.365  43.975  1.00 134.44 ? 197 ASP E OD2 1 
ATOM   9342  N N   . VAL E 3 207 ? 210.900 -70.473  45.414  1.00 154.51 ? 198 VAL E N   1 
ATOM   9343  C CA  . VAL E 3 207 ? 210.457 -70.586  46.802  1.00 159.03 ? 198 VAL E CA  1 
ATOM   9344  C C   . VAL E 3 207 ? 210.386 -69.228  47.488  1.00 154.08 ? 198 VAL E C   1 
ATOM   9345  O O   . VAL E 3 207 ? 209.533 -69.005  48.348  1.00 155.99 ? 198 VAL E O   1 
ATOM   9346  C CB  . VAL E 3 207 ? 211.344 -71.552  47.618  1.00 166.63 ? 198 VAL E CB  1 
ATOM   9347  C CG1 . VAL E 3 207 ? 211.066 -72.992  47.207  1.00 172.17 ? 198 VAL E CG1 1 
ATOM   9348  C CG2 . VAL E 3 207 ? 212.824 -71.212  47.466  1.00 170.00 ? 198 VAL E CG2 1 
ATOM   9349  N N   . ARG E 3 208 ? 211.281 -68.328  47.088  1.00 146.40 ? 199 ARG E N   1 
ATOM   9350  C CA  . ARG E 3 208 ? 211.338 -66.977  47.630  1.00 139.59 ? 199 ARG E CA  1 
ATOM   9351  C C   . ARG E 3 208 ? 210.141 -66.163  47.145  1.00 135.49 ? 199 ARG E C   1 
ATOM   9352  O O   . ARG E 3 208 ? 209.905 -66.059  45.941  1.00 135.87 ? 199 ARG E O   1 
ATOM   9353  C CB  . ARG E 3 208 ? 212.651 -66.296  47.225  1.00 139.04 ? 199 ARG E CB  1 
ATOM   9354  C CG  . ARG E 3 208 ? 213.910 -67.040  47.656  1.00 138.14 ? 199 ARG E CG  1 
ATOM   9355  C CD  . ARG E 3 208 ? 215.183 -66.305  47.252  1.00 137.50 ? 199 ARG E CD  1 
ATOM   9356  N NE  . ARG E 3 208 ? 215.472 -66.400  45.818  1.00 135.56 ? 199 ARG E NE  1 
ATOM   9357  C CZ  . ARG E 3 208 ? 215.438 -65.380  44.960  1.00 133.11 ? 199 ARG E CZ  1 
ATOM   9358  N NH1 . ARG E 3 208 ? 215.719 -65.584  43.680  1.00 131.51 ? 199 ARG E NH1 1 
ATOM   9359  N NH2 . ARG E 3 208 ? 215.129 -64.154  45.367  1.00 131.58 ? 199 ARG E NH2 1 
ATOM   9360  N N   . LYS E 3 209 ? 209.388 -65.597  48.088  1.00 130.37 ? 200 LYS E N   1 
ATOM   9361  C CA  . LYS E 3 209 ? 208.211 -64.784  47.769  1.00 126.93 ? 200 LYS E CA  1 
ATOM   9362  C C   . LYS E 3 209 ? 208.606 -63.463  47.106  1.00 128.31 ? 200 LYS E C   1 
ATOM   9363  O O   . LYS E 3 209 ? 207.768 -62.789  46.503  1.00 127.36 ? 200 LYS E O   1 
ATOM   9364  C CB  . LYS E 3 209 ? 207.378 -64.521  49.029  1.00 123.75 ? 200 LYS E CB  1 
ATOM   9365  C CG  . LYS E 3 209 ? 205.883 -64.339  48.788  1.00 121.16 ? 200 LYS E CG  1 
ATOM   9366  C CD  . LYS E 3 209 ? 205.099 -65.639  48.954  1.00 119.49 ? 200 LYS E CD  1 
ATOM   9367  C CE  . LYS E 3 209 ? 205.004 -66.444  47.664  1.00 117.63 ? 200 LYS E CE  1 
ATOM   9368  N NZ  . LYS E 3 209 ? 204.204 -65.743  46.621  1.00 115.62 ? 200 LYS E NZ  1 
ATOM   9369  N N   . ALA E 3 210 ? 209.882 -63.102  47.230  1.00 131.78 ? 201 ALA E N   1 
ATOM   9370  C CA  . ALA E 3 210 ? 210.439 -61.943  46.537  1.00 136.44 ? 201 ALA E CA  1 
ATOM   9371  C C   . ALA E 3 210 ? 210.757 -62.270  45.078  1.00 140.06 ? 201 ALA E C   1 
ATOM   9372  O O   . ALA E 3 210 ? 210.621 -61.411  44.206  1.00 139.60 ? 201 ALA E O   1 
ATOM   9373  C CB  . ALA E 3 210 ? 211.681 -61.437  47.254  1.00 137.57 ? 201 ALA E CB  1 
ATOM   9374  N N   . ALA E 3 211 ? 211.179 -63.509  44.826  1.00 145.07 ? 202 ALA E N   1 
ATOM   9375  C CA  . ALA E 3 211 ? 211.436 -63.989  43.466  1.00 149.92 ? 202 ALA E CA  1 
ATOM   9376  C C   . ALA E 3 211 ? 210.131 -64.191  42.689  1.00 153.51 ? 202 ALA E C   1 
ATOM   9377  O O   . ALA E 3 211 ? 210.086 -63.961  41.477  1.00 157.55 ? 202 ALA E O   1 
ATOM   9378  C CB  . ALA E 3 211 ? 212.245 -65.277  43.498  1.00 148.99 ? 202 ALA E CB  1 
ATOM   9379  N N   . LEU E 3 212 ? 209.080 -64.621  43.394  1.00 153.23 ? 203 LEU E N   1 
ATOM   9380  C CA  . LEU E 3 212 ? 207.740 -64.789  42.808  1.00 148.47 ? 203 LEU E CA  1 
ATOM   9381  C C   . LEU E 3 212 ? 207.089 -63.456  42.424  1.00 142.83 ? 203 LEU E C   1 
ATOM   9382  O O   . LEU E 3 212 ? 206.184 -63.420  41.585  1.00 142.09 ? 203 LEU E O   1 
ATOM   9383  C CB  . LEU E 3 212 ? 206.817 -65.584  43.746  1.00 149.03 ? 203 LEU E CB  1 
ATOM   9384  C CG  . LEU E 3 212 ? 206.681 -67.099  43.524  1.00 149.61 ? 203 LEU E CG  1 
ATOM   9385  C CD1 . LEU E 3 212 ? 207.862 -67.879  44.108  1.00 151.40 ? 203 LEU E CD1 1 
ATOM   9386  C CD2 . LEU E 3 212 ? 205.369 -67.607  44.119  1.00 147.51 ? 203 LEU E CD2 1 
ATOM   9387  N N   . GLU E 3 213 ? 207.550 -62.373  43.051  1.00 135.12 ? 204 GLU E N   1 
ATOM   9388  C CA  . GLU E 3 213 ? 207.144 -61.012  42.693  1.00 126.76 ? 204 GLU E CA  1 
ATOM   9389  C C   . GLU E 3 213 ? 207.945 -60.494  41.501  1.00 121.04 ? 204 GLU E C   1 
ATOM   9390  O O   . GLU E 3 213 ? 207.402 -59.815  40.626  1.00 119.45 ? 204 GLU E O   1 
ATOM   9391  C CB  . GLU E 3 213 ? 207.313 -60.063  43.881  1.00 126.12 ? 204 GLU E CB  1 
ATOM   9392  C CG  . GLU E 3 213 ? 206.157 -60.075  44.868  1.00 125.32 ? 204 GLU E CG  1 
ATOM   9393  C CD  . GLU E 3 213 ? 206.277 -58.987  45.918  1.00 124.01 ? 204 GLU E CD  1 
ATOM   9394  O OE1 . GLU E 3 213 ? 205.500 -58.009  45.852  1.00 122.70 ? 204 GLU E OE1 1 
ATOM   9395  O OE2 . GLU E 3 213 ? 207.153 -59.103  46.804  1.00 123.36 ? 204 GLU E OE2 1 
ATOM   9396  N N   . GLN E 3 214 ? 209.240 -60.813  41.486  1.00 115.18 ? 205 GLN E N   1 
ATOM   9397  C CA  . GLN E 3 214 ? 210.130 -60.492  40.371  1.00 111.48 ? 205 GLN E CA  1 
ATOM   9398  C C   . GLN E 3 214 ? 209.620 -61.111  39.066  1.00 114.36 ? 205 GLN E C   1 
ATOM   9399  O O   . GLN E 3 214 ? 209.817 -60.551  37.989  1.00 114.10 ? 205 GLN E O   1 
ATOM   9400  C CB  . GLN E 3 214 ? 211.556 -60.983  40.667  1.00 105.62 ? 205 GLN E CB  1 
ATOM   9401  C CG  . GLN E 3 214 ? 212.284 -60.220  41.770  1.00 99.22  ? 205 GLN E CG  1 
ATOM   9402  C CD  . GLN E 3 214 ? 213.347 -61.049  42.482  1.00 95.05  ? 205 GLN E CD  1 
ATOM   9403  O OE1 . GLN E 3 214 ? 214.002 -61.903  41.882  1.00 92.49  ? 205 GLN E OE1 1 
ATOM   9404  N NE2 . GLN E 3 214 ? 213.524 -60.793  43.771  1.00 93.04  ? 205 GLN E NE2 1 
ATOM   9405  N N   . ALA E 3 215 ? 208.952 -62.259  39.182  1.00 119.18 ? 206 ALA E N   1 
ATOM   9406  C CA  . ALA E 3 215 ? 208.430 -63.000  38.031  1.00 125.02 ? 206 ALA E CA  1 
ATOM   9407  C C   . ALA E 3 215 ? 207.259 -62.295  37.343  1.00 130.50 ? 206 ALA E C   1 
ATOM   9408  O O   . ALA E 3 215 ? 207.301 -62.061  36.132  1.00 129.65 ? 206 ALA E O   1 
ATOM   9409  C CB  . ALA E 3 215 ? 208.034 -64.411  38.446  1.00 124.09 ? 206 ALA E CB  1 
ATOM   9410  N N   . LEU E 3 216 ? 206.229 -61.956  38.120  1.00 139.70 ? 207 LEU E N   1 
ATOM   9411  C CA  . LEU E 3 216 ? 205.000 -61.350  37.588  1.00 150.14 ? 207 LEU E CA  1 
ATOM   9412  C C   . LEU E 3 216 ? 205.231 -59.954  36.994  1.00 151.60 ? 207 LEU E C   1 
ATOM   9413  O O   . LEU E 3 216 ? 204.409 -59.458  36.218  1.00 153.91 ? 207 LEU E O   1 
ATOM   9414  C CB  . LEU E 3 216 ? 203.896 -61.322  38.662  1.00 156.61 ? 207 LEU E CB  1 
ATOM   9415  C CG  . LEU E 3 216 ? 202.419 -61.248  38.233  1.00 161.16 ? 207 LEU E CG  1 
ATOM   9416  C CD1 . LEU E 3 216 ? 201.545 -62.140  39.105  1.00 162.62 ? 207 LEU E CD1 1 
ATOM   9417  C CD2 . LEU E 3 216 ? 201.883 -59.819  38.223  1.00 161.53 ? 207 LEU E CD2 1 
ATOM   9418  N N   . SER E 3 217 ? 206.358 -59.339  37.348  1.00 151.78 ? 208 SER E N   1 
ATOM   9419  C CA  . SER E 3 217 ? 206.726 -58.018  36.837  1.00 151.85 ? 208 SER E CA  1 
ATOM   9420  C C   . SER E 3 217 ? 206.988 -58.015  35.326  1.00 149.90 ? 208 SER E C   1 
ATOM   9421  O O   . SER E 3 217 ? 206.876 -56.975  34.672  1.00 150.22 ? 208 SER E O   1 
ATOM   9422  C CB  . SER E 3 217 ? 207.941 -57.471  37.590  1.00 153.41 ? 208 SER E CB  1 
ATOM   9423  O OG  . SER E 3 217 ? 209.075 -58.296  37.401  1.00 153.84 ? 208 SER E OG  1 
ATOM   9424  N N   . LEU E 3 218 ? 207.337 -59.178  34.781  1.00 147.22 ? 209 LEU E N   1 
ATOM   9425  C CA  . LEU E 3 218 ? 207.536 -59.329  33.342  1.00 146.68 ? 209 LEU E CA  1 
ATOM   9426  C C   . LEU E 3 218 ? 206.238 -59.708  32.643  1.00 150.47 ? 209 LEU E C   1 
ATOM   9427  O O   . LEU E 3 218 ? 206.010 -59.325  31.494  1.00 145.38 ? 209 LEU E O   1 
ATOM   9428  C CB  . LEU E 3 218 ? 208.616 -60.372  33.051  1.00 144.93 ? 209 LEU E CB  1 
ATOM   9429  C CG  . LEU E 3 218 ? 210.026 -60.076  33.570  1.00 145.98 ? 209 LEU E CG  1 
ATOM   9430  C CD1 . LEU E 3 218 ? 210.934 -61.274  33.343  1.00 146.40 ? 209 LEU E CD1 1 
ATOM   9431  C CD2 . LEU E 3 218 ? 210.609 -58.823  32.929  1.00 146.96 ? 209 LEU E CD2 1 
ATOM   9432  N N   . GLY E 3 219 ? 205.398 -60.464  33.346  1.00 161.49 ? 210 GLY E N   1 
ATOM   9433  C CA  . GLY E 3 219 ? 204.091 -60.876  32.835  1.00 179.90 ? 210 GLY E CA  1 
ATOM   9434  C C   . GLY E 3 219 ? 203.788 -62.354  33.016  1.00 192.37 ? 210 GLY E C   1 
ATOM   9435  O O   . GLY E 3 219 ? 202.992 -62.925  32.264  1.00 199.85 ? 210 GLY E O   1 
ATOM   9436  N N   . ALA E 3 220 ? 204.411 -62.968  34.022  1.00 197.93 ? 211 ALA E N   1 
ATOM   9437  C CA  . ALA E 3 220 ? 204.289 -64.409  34.259  1.00 197.72 ? 211 ALA E CA  1 
ATOM   9438  C C   . ALA E 3 220 ? 203.427 -64.750  35.474  1.00 192.84 ? 211 ALA E C   1 
ATOM   9439  O O   . ALA E 3 220 ? 203.399 -64.012  36.460  1.00 194.86 ? 211 ALA E O   1 
ATOM   9440  C CB  . ALA E 3 220 ? 205.669 -65.038  34.399  1.00 201.06 ? 211 ALA E CB  1 
ATOM   9441  N N   . LYS E 3 221 ? 202.725 -65.876  35.391  1.00 183.21 ? 212 LYS E N   1 
ATOM   9442  C CA  . LYS E 3 221 ? 201.981 -66.399  36.528  1.00 175.79 ? 212 LYS E CA  1 
ATOM   9443  C C   . LYS E 3 221 ? 202.915 -67.247  37.395  1.00 182.46 ? 212 LYS E C   1 
ATOM   9444  O O   . LYS E 3 221 ? 203.437 -68.264  36.933  1.00 183.74 ? 212 LYS E O   1 
ATOM   9445  C CB  . LYS E 3 221 ? 200.774 -67.212  36.056  1.00 165.08 ? 212 LYS E CB  1 
ATOM   9446  C CG  . LYS E 3 221 ? 199.640 -66.379  35.476  1.00 153.69 ? 212 LYS E CG  1 
ATOM   9447  C CD  . LYS E 3 221 ? 198.796 -65.746  36.573  1.00 147.42 ? 212 LYS E CD  1 
ATOM   9448  C CE  . LYS E 3 221 ? 197.333 -65.642  36.139  1.00 144.57 ? 212 LYS E CE  1 
ATOM   9449  N NZ  . LYS E 3 221 ? 196.730 -66.987  35.877  1.00 145.94 ? 212 LYS E NZ  1 
ATOM   9450  N N   . PRO E 3 222 ? 203.142 -66.818  38.652  1.00 188.31 ? 213 PRO E N   1 
ATOM   9451  C CA  . PRO E 3 222 ? 204.067 -67.495  39.561  1.00 196.54 ? 213 PRO E CA  1 
ATOM   9452  C C   . PRO E 3 222 ? 203.471 -68.782  40.123  1.00 209.37 ? 213 PRO E C   1 
ATOM   9453  O O   . PRO E 3 222 ? 202.273 -68.834  40.408  1.00 215.30 ? 213 PRO E O   1 
ATOM   9454  C CB  . PRO E 3 222 ? 204.276 -66.472  40.691  1.00 191.48 ? 213 PRO E CB  1 
ATOM   9455  C CG  . PRO E 3 222 ? 203.528 -65.239  40.293  1.00 187.89 ? 213 PRO E CG  1 
ATOM   9456  C CD  . PRO E 3 222 ? 202.492 -65.672  39.306  1.00 187.20 ? 213 PRO E CD  1 
ATOM   9457  N N   . ILE E 3 223 ? 204.306 -69.807  40.281  1.00 221.73 ? 214 ILE E N   1 
ATOM   9458  C CA  . ILE E 3 223 ? 203.851 -71.106  40.780  1.00 232.12 ? 214 ILE E CA  1 
ATOM   9459  C C   . ILE E 3 223 ? 203.813 -71.136  42.316  1.00 238.87 ? 214 ILE E C   1 
ATOM   9460  O O   . ILE E 3 223 ? 204.850 -71.250  42.980  1.00 236.17 ? 214 ILE E O   1 
ATOM   9461  C CB  . ILE E 3 223 ? 204.693 -72.280  40.201  1.00 232.38 ? 214 ILE E CB  1 
ATOM   9462  C CG1 . ILE E 3 223 ? 204.628 -72.309  38.661  1.00 232.71 ? 214 ILE E CG1 1 
ATOM   9463  C CG2 . ILE E 3 223 ? 204.266 -73.620  40.797  1.00 232.99 ? 214 ILE E CG2 1 
ATOM   9464  C CD1 . ILE E 3 223 ? 203.281 -72.685  38.069  1.00 232.97 ? 214 ILE E CD1 1 
ATOM   9465  N N   . GLU E 3 224 ? 202.606 -71.000  42.864  1.00 247.12 ? 215 GLU E N   1 
ATOM   9466  C CA  . GLU E 3 224 ? 202.361 -71.197  44.292  1.00 252.74 ? 215 GLU E CA  1 
ATOM   9467  C C   . GLU E 3 224 ? 201.616 -72.505  44.527  1.00 249.27 ? 215 GLU E C   1 
ATOM   9468  O O   . GLU E 3 224 ? 200.441 -72.642  44.170  1.00 246.94 ? 215 GLU E O   1 
ATOM   9469  C CB  . GLU E 3 224 ? 201.580 -70.027  44.902  1.00 253.26 ? 215 GLU E CB  1 
ATOM   9470  C CG  . GLU E 3 224 ? 202.419 -69.093  45.760  1.00 243.29 ? 215 GLU E CG  1 
ATOM   9471  C CD  . GLU E 3 224 ? 201.579 -68.218  46.683  1.00 238.56 ? 215 GLU E CD  1 
ATOM   9472  O OE1 . GLU E 3 224 ? 201.809 -66.990  46.707  1.00 235.26 ? 215 GLU E OE1 1 
ATOM   9473  O OE2 . GLU E 3 224 ? 200.694 -68.756  47.392  1.00 234.63 ? 215 GLU E OE2 1 
ATOM   9474  N N   . LEU E 3 225 ? 202.319 -73.458  45.131  1.00 247.67 ? 216 LEU E N   1 
ATOM   9475  C CA  . LEU E 3 225 ? 201.778 -74.782  45.442  1.00 246.49 ? 216 LEU E CA  1 
ATOM   9476  C C   . LEU E 3 225 ? 200.853 -74.690  46.678  1.00 244.64 ? 216 LEU E C   1 
ATOM   9477  O O   . LEU E 3 225 ? 200.740 -73.609  47.272  1.00 244.98 ? 216 LEU E O   1 
ATOM   9478  C CB  . LEU E 3 225 ? 202.943 -75.771  45.649  1.00 245.59 ? 216 LEU E CB  1 
ATOM   9479  C CG  . LEU E 3 225 ? 204.023 -75.839  44.547  1.00 245.05 ? 216 LEU E CG  1 
ATOM   9480  C CD1 . LEU E 3 225 ? 205.337 -76.423  45.051  1.00 244.62 ? 216 LEU E CD1 1 
ATOM   9481  C CD2 . LEU E 3 225 ? 203.543 -76.595  43.313  1.00 244.76 ? 216 LEU E CD2 1 
ATOM   9482  N N   . PRO E 3 226 ? 200.170 -75.802  47.059  1.00 242.80 ? 217 PRO E N   1 
ATOM   9483  C CA  . PRO E 3 226 ? 199.386 -75.776  48.311  1.00 243.77 ? 217 PRO E CA  1 
ATOM   9484  C C   . PRO E 3 226 ? 200.214 -75.417  49.558  1.00 244.59 ? 217 PRO E C   1 
ATOM   9485  O O   . PRO E 3 226 ? 199.643 -75.105  50.610  1.00 243.96 ? 217 PRO E O   1 
ATOM   9486  C CB  . PRO E 3 226 ? 198.855 -77.209  48.421  1.00 243.00 ? 217 PRO E CB  1 
ATOM   9487  C CG  . PRO E 3 226 ? 198.768 -77.681  47.011  1.00 243.16 ? 217 PRO E CG  1 
ATOM   9488  C CD  . PRO E 3 226 ? 199.928 -77.045  46.295  1.00 242.85 ? 217 PRO E CD  1 
ATOM   9489  N N   . ILE E 3 227 ? 201.542 -75.454  49.414  1.00 245.38 ? 218 ILE E N   1 
ATOM   9490  C CA  . ILE E 3 227 ? 202.509 -75.223  50.496  1.00 248.49 ? 218 ILE E CA  1 
ATOM   9491  C C   . ILE E 3 227 ? 203.539 -74.150  50.076  1.00 250.82 ? 218 ILE E C   1 
ATOM   9492  O O   . ILE E 3 227 ? 204.574 -74.468  49.475  1.00 247.59 ? 218 ILE E O   1 
ATOM   9493  C CB  . ILE E 3 227 ? 203.226 -76.556  50.887  1.00 248.38 ? 218 ILE E CB  1 
ATOM   9494  C CG1 . ILE E 3 227 ? 202.228 -77.651  51.338  1.00 247.82 ? 218 ILE E CG1 1 
ATOM   9495  C CG2 . ILE E 3 227 ? 204.350 -76.339  51.898  1.00 248.09 ? 218 ILE E CG2 1 
ATOM   9496  C CD1 . ILE E 3 227 ? 201.280 -77.290  52.469  1.00 248.99 ? 218 ILE E CD1 1 
ATOM   9497  N N   . SER E 3 228 ? 203.250 -72.882  50.371  1.00 218.95 ? 219 SER E N   1 
ATOM   9498  C CA  . SER E 3 228 ? 204.211 -71.814  50.097  1.00 188.91 ? 219 SER E CA  1 
ATOM   9499  C C   . SER E 3 228 ? 205.410 -71.991  51.019  1.00 176.62 ? 219 SER E C   1 
ATOM   9500  O O   . SER E 3 228 ? 205.282 -71.972  52.242  1.00 168.32 ? 219 SER E O   1 
ATOM   9501  C CB  . SER E 3 228 ? 203.582 -70.422  50.233  1.00 183.41 ? 219 SER E CB  1 
ATOM   9502  O OG  . SER E 3 228 ? 202.819 -70.306  51.417  1.00 178.10 ? 219 SER E OG  1 
ATOM   9503  N N   . ALA E 3 229 ? 206.573 -72.193  50.415  1.00 170.36 ? 220 ALA E N   1 
ATOM   9504  C CA  . ALA E 3 229 ? 207.760 -72.597  51.155  1.00 172.98 ? 220 ALA E CA  1 
ATOM   9505  C C   . ALA E 3 229 ? 208.466 -71.453  51.889  1.00 180.04 ? 220 ALA E C   1 
ATOM   9506  O O   . ALA E 3 229 ? 209.510 -71.663  52.502  1.00 177.21 ? 220 ALA E O   1 
ATOM   9507  C CB  . ALA E 3 229 ? 208.725 -73.318  50.227  1.00 171.75 ? 220 ALA E CB  1 
ATOM   9508  N N   . GLU E 3 230 ? 207.893 -70.251  51.839  1.00 194.45 ? 221 GLU E N   1 
ATOM   9509  C CA  . GLU E 3 230 ? 208.505 -69.068  52.457  1.00 210.71 ? 221 GLU E CA  1 
ATOM   9510  C C   . GLU E 3 230 ? 207.451 -68.096  53.007  1.00 226.59 ? 221 GLU E C   1 
ATOM   9511  O O   . GLU E 3 230 ? 206.300 -68.110  52.560  1.00 235.07 ? 221 GLU E O   1 
ATOM   9512  C CB  . GLU E 3 230 ? 209.398 -68.351  51.441  1.00 205.51 ? 221 GLU E CB  1 
ATOM   9513  C CG  . GLU E 3 230 ? 210.450 -67.441  52.051  1.00 199.11 ? 221 GLU E CG  1 
ATOM   9514  C CD  . GLU E 3 230 ? 210.658 -66.176  51.243  1.00 196.30 ? 221 GLU E CD  1 
ATOM   9515  O OE1 . GLU E 3 230 ? 211.781 -65.982  50.737  1.00 194.12 ? 221 GLU E OE1 1 
ATOM   9516  O OE2 . GLU E 3 230 ? 209.702 -65.380  51.114  1.00 194.96 ? 221 GLU E OE2 1 
ATOM   9517  N N   . GLY E 3 231 ? 207.850 -67.246  53.959  1.00 238.25 ? 222 GLY E N   1 
ATOM   9518  C CA  . GLY E 3 231 ? 206.920 -66.318  54.619  1.00 243.40 ? 222 GLY E CA  1 
ATOM   9519  C C   . GLY E 3 231 ? 207.450 -64.970  55.089  1.00 244.47 ? 222 GLY E C   1 
ATOM   9520  O O   . GLY E 3 231 ? 207.588 -64.038  54.290  1.00 240.97 ? 222 GLY E O   1 
ATOM   9521  N N   . GLU E 3 232 ? 207.729 -64.861  56.390  1.00 246.75 ? 223 GLU E N   1 
ATOM   9522  C CA  . GLU E 3 232 ? 208.059 -63.574  57.020  1.00 245.93 ? 223 GLU E CA  1 
ATOM   9523  C C   . GLU E 3 232 ? 209.446 -63.506  57.682  1.00 252.24 ? 223 GLU E C   1 
ATOM   9524  O O   . GLU E 3 232 ? 209.684 -64.132  58.722  1.00 262.64 ? 223 GLU E O   1 
ATOM   9525  C CB  . GLU E 3 232 ? 206.973 -63.192  58.032  1.00 235.68 ? 223 GLU E CB  1 
ATOM   9526  C CG  . GLU E 3 232 ? 205.893 -62.279  57.476  1.00 223.42 ? 223 GLU E CG  1 
ATOM   9527  C CD  . GLU E 3 232 ? 204.814 -63.005  56.702  1.00 217.00 ? 223 GLU E CD  1 
ATOM   9528  O OE1 . GLU E 3 232 ? 204.974 -63.176  55.475  1.00 209.30 ? 223 GLU E OE1 1 
ATOM   9529  O OE2 . GLU E 3 232 ? 203.789 -63.377  57.318  1.00 216.29 ? 223 GLU E OE2 1 
ATOM   9530  N N   . GLY E 3 233 ? 210.344 -62.726  57.077  1.00 248.47 ? 224 GLY E N   1 
ATOM   9531  C CA  . GLY E 3 233 ? 211.713 -62.561  57.575  1.00 237.05 ? 224 GLY E CA  1 
ATOM   9532  C C   . GLY E 3 233 ? 212.771 -62.801  56.510  1.00 230.88 ? 224 GLY E C   1 
ATOM   9533  O O   . GLY E 3 233 ? 213.655 -61.964  56.306  1.00 221.78 ? 224 GLY E O   1 
ATOM   9534  N N   . GLY E 3 234 ? 212.677 -63.951  55.841  1.00 232.55 ? 225 GLY E N   1 
ATOM   9535  C CA  . GLY E 3 234 ? 213.592 -64.322  54.754  1.00 232.17 ? 225 GLY E CA  1 
ATOM   9536  C C   . GLY E 3 234 ? 213.901 -65.810  54.645  1.00 230.75 ? 225 GLY E C   1 
ATOM   9537  O O   . GLY E 3 234 ? 214.568 -66.248  53.697  1.00 228.04 ? 225 GLY E O   1 
ATOM   9538  N N   . TYR E 3 235 ? 213.403 -66.584  55.608  1.00 230.75 ? 226 TYR E N   1 
ATOM   9539  C CA  . TYR E 3 235 ? 213.752 -67.999  55.745  1.00 225.67 ? 226 TYR E CA  1 
ATOM   9540  C C   . TYR E 3 235 ? 212.764 -68.932  55.024  1.00 212.51 ? 226 TYR E C   1 
ATOM   9541  O O   . TYR E 3 235 ? 211.547 -68.796  55.170  1.00 209.35 ? 226 TYR E O   1 
ATOM   9542  C CB  . TYR E 3 235 ? 213.874 -68.372  57.235  1.00 236.21 ? 226 TYR E CB  1 
ATOM   9543  C CG  . TYR E 3 235 ? 214.677 -67.386  58.082  1.00 240.46 ? 226 TYR E CG  1 
ATOM   9544  C CD1 . TYR E 3 235 ? 216.076 -67.398  58.074  1.00 239.57 ? 226 TYR E CD1 1 
ATOM   9545  C CD2 . TYR E 3 235 ? 214.035 -66.450  58.900  1.00 241.98 ? 226 TYR E CD2 1 
ATOM   9546  C CE1 . TYR E 3 235 ? 216.808 -66.505  58.845  1.00 235.29 ? 226 TYR E CE1 1 
ATOM   9547  C CE2 . TYR E 3 235 ? 214.761 -65.553  59.674  1.00 238.40 ? 226 TYR E CE2 1 
ATOM   9548  C CZ  . TYR E 3 235 ? 216.146 -65.586  59.642  1.00 235.57 ? 226 TYR E CZ  1 
ATOM   9549  O OH  . TYR E 3 235 ? 216.873 -64.702  60.406  1.00 232.98 ? 226 TYR E OH  1 
ATOM   9550  N N   . ALA E 3 236 ? 213.301 -69.868  54.243  1.00 200.16 ? 227 ALA E N   1 
ATOM   9551  C CA  . ALA E 3 236 ? 212.495 -70.879  53.553  1.00 194.87 ? 227 ALA E CA  1 
ATOM   9552  C C   . ALA E 3 236 ? 212.118 -72.031  54.496  1.00 197.48 ? 227 ALA E C   1 
ATOM   9553  O O   . ALA E 3 236 ? 212.755 -72.215  55.533  1.00 197.27 ? 227 ALA E O   1 
ATOM   9554  C CB  . ALA E 3 236 ? 213.240 -71.399  52.333  1.00 190.12 ? 227 ALA E CB  1 
ATOM   9555  N N   . ARG E 3 237 ? 211.089 -72.800  54.132  1.00 203.64 ? 228 ARG E N   1 
ATOM   9556  C CA  . ARG E 3 237 ? 210.568 -73.888  54.980  1.00 211.45 ? 228 ARG E CA  1 
ATOM   9557  C C   . ARG E 3 237 ? 211.390 -75.185  54.959  1.00 217.26 ? 228 ARG E C   1 
ATOM   9558  O O   . ARG E 3 237 ? 211.999 -75.535  53.945  1.00 221.14 ? 228 ARG E O   1 
ATOM   9559  C CB  . ARG E 3 237 ? 209.100 -74.194  54.639  1.00 208.41 ? 228 ARG E CB  1 
ATOM   9560  C CG  . ARG E 3 237 ? 208.090 -73.711  55.672  1.00 207.08 ? 228 ARG E CG  1 
ATOM   9561  C CD  . ARG E 3 237 ? 207.954 -74.685  56.840  1.00 208.67 ? 228 ARG E CD  1 
ATOM   9562  N NE  . ARG E 3 237 ? 206.885 -74.319  57.774  1.00 208.31 ? 228 ARG E NE  1 
ATOM   9563  C CZ  . ARG E 3 237 ? 207.067 -73.706  58.945  1.00 208.95 ? 228 ARG E CZ  1 
ATOM   9564  N NH1 . ARG E 3 237 ? 208.284 -73.363  59.350  1.00 207.97 ? 228 ARG E NH1 1 
ATOM   9565  N NH2 . ARG E 3 237 ? 206.024 -73.419  59.713  1.00 209.66 ? 228 ARG E NH2 1 
ATOM   9566  N N   . GLU E 3 238 ? 211.388 -75.886  56.094  1.00 219.53 ? 229 GLU E N   1 
ATOM   9567  C CA  . GLU E 3 238 ? 212.051 -77.184  56.240  1.00 214.58 ? 229 GLU E CA  1 
ATOM   9568  C C   . GLU E 3 238 ? 211.012 -78.294  56.348  1.00 209.40 ? 229 GLU E C   1 
ATOM   9569  O O   . GLU E 3 238 ? 210.631 -78.709  57.449  1.00 205.82 ? 229 GLU E O   1 
ATOM   9570  C CB  . GLU E 3 238 ? 212.947 -77.197  57.475  1.00 218.36 ? 229 GLU E CB  1 
ATOM   9571  C CG  . GLU E 3 238 ? 214.294 -76.517  57.302  1.00 223.52 ? 229 GLU E CG  1 
ATOM   9572  C CD  . GLU E 3 238 ? 214.924 -76.155  58.635  1.00 227.60 ? 229 GLU E CD  1 
ATOM   9573  O OE1 . GLU E 3 238 ? 214.389 -75.256  59.321  1.00 233.13 ? 229 GLU E OE1 1 
ATOM   9574  O OE2 . GLU E 3 238 ? 215.950 -76.769  58.999  1.00 227.02 ? 229 GLU E OE2 1 
ATOM   9575  N N   . LEU E 3 239 ? 210.567 -78.764  55.189  1.00 205.24 ? 230 LEU E N   1 
ATOM   9576  C CA  . LEU E 3 239 ? 209.503 -79.757  55.083  1.00 207.05 ? 230 LEU E CA  1 
ATOM   9577  C C   . LEU E 3 239 ? 209.870 -81.062  55.799  1.00 218.51 ? 230 LEU E C   1 
ATOM   9578  O O   . LEU E 3 239 ? 211.005 -81.534  55.686  1.00 217.32 ? 230 LEU E O   1 
ATOM   9579  C CB  . LEU E 3 239 ? 209.207 -80.029  53.603  1.00 194.62 ? 230 LEU E CB  1 
ATOM   9580  C CG  . LEU E 3 239 ? 208.550 -79.011  52.651  1.00 187.30 ? 230 LEU E CG  1 
ATOM   9581  C CD1 . LEU E 3 239 ? 208.420 -77.591  53.195  1.00 183.69 ? 230 LEU E CD1 1 
ATOM   9582  C CD2 . LEU E 3 239 ? 209.305 -79.015  51.329  1.00 182.61 ? 230 LEU E CD2 1 
ATOM   9583  N N   . THR E 3 240 ? 208.912 -81.621  56.544  1.00 233.67 ? 231 THR E N   1 
ATOM   9584  C CA  . THR E 3 240 ? 209.069 -82.937  57.197  1.00 239.55 ? 231 THR E CA  1 
ATOM   9585  C C   . THR E 3 240 ? 208.683 -84.083  56.238  1.00 241.70 ? 231 THR E C   1 
ATOM   9586  O O   . THR E 3 240 ? 209.057 -84.051  55.062  1.00 244.51 ? 231 THR E O   1 
ATOM   9587  C CB  . THR E 3 240 ? 208.290 -83.037  58.538  1.00 237.50 ? 231 THR E CB  1 
ATOM   9588  O OG1 . THR E 3 240 ? 206.962 -82.517  58.379  1.00 233.58 ? 231 THR E OG1 1 
ATOM   9589  C CG2 . THR E 3 240 ? 209.008 -82.267  59.646  1.00 236.04 ? 231 THR E CG2 1 
ATOM   9590  N N   . GLU E 3 241 ? 207.954 -85.087  56.735  1.00 242.81 ? 232 GLU E N   1 
ATOM   9591  C CA  . GLU E 3 241 ? 207.497 -86.221  55.908  1.00 242.92 ? 232 GLU E CA  1 
ATOM   9592  C C   . GLU E 3 241 ? 206.041 -86.107  55.413  1.00 240.59 ? 232 GLU E C   1 
ATOM   9593  O O   . GLU E 3 241 ? 205.560 -86.986  54.689  1.00 240.82 ? 232 GLU E O   1 
ATOM   9594  C CB  . GLU E 3 241 ? 207.708 -87.557  56.639  1.00 238.66 ? 232 GLU E CB  1 
ATOM   9595  C CG  . GLU E 3 241 ? 208.679 -88.518  55.958  1.00 234.25 ? 232 GLU E CG  1 
ATOM   9596  C CD  . GLU E 3 241 ? 210.140 -88.208  56.234  1.00 234.46 ? 232 GLU E CD  1 
ATOM   9597  O OE1 . GLU E 3 241 ? 210.485 -87.930  57.404  1.00 230.80 ? 232 GLU E OE1 1 
ATOM   9598  O OE2 . GLU E 3 241 ? 210.948 -88.266  55.279  1.00 238.42 ? 232 GLU E OE2 1 
ATOM   9599  N N   . GLU E 3 242 ? 205.360 -85.025  55.798  1.00 232.13 ? 233 GLU E N   1 
ATOM   9600  C CA  . GLU E 3 242 ? 203.947 -84.785  55.453  1.00 217.89 ? 233 GLU E CA  1 
ATOM   9601  C C   . GLU E 3 242 ? 203.771 -83.625  54.444  1.00 223.82 ? 233 GLU E C   1 
ATOM   9602  O O   . GLU E 3 242 ? 202.639 -83.215  54.153  1.00 221.68 ? 233 GLU E O   1 
ATOM   9603  C CB  . GLU E 3 242 ? 203.138 -84.535  56.746  1.00 199.55 ? 233 GLU E CB  1 
ATOM   9604  C CG  . GLU E 3 242 ? 201.641 -84.268  56.590  1.00 182.38 ? 233 GLU E CG  1 
ATOM   9605  C CD  . GLU E 3 242 ? 200.809 -85.525  56.412  1.00 176.23 ? 233 GLU E CD  1 
ATOM   9606  O OE1 . GLU E 3 242 ? 200.953 -86.469  57.219  1.00 169.82 ? 233 GLU E OE1 1 
ATOM   9607  O OE2 . GLU E 3 242 ? 199.988 -85.558  55.472  1.00 173.83 ? 233 GLU E OE2 1 
ATOM   9608  N N   . GLU E 3 243 ? 204.884 -83.117  53.899  1.00 230.35 ? 234 GLU E N   1 
ATOM   9609  C CA  . GLU E 3 243 ? 204.865 -81.902  53.054  1.00 228.72 ? 234 GLU E CA  1 
ATOM   9610  C C   . GLU E 3 243 ? 205.786 -81.850  51.812  1.00 222.63 ? 234 GLU E C   1 
ATOM   9611  O O   . GLU E 3 243 ? 205.418 -81.228  50.814  1.00 229.25 ? 234 GLU E O   1 
ATOM   9612  C CB  . GLU E 3 243 ? 205.078 -80.650  53.914  1.00 229.99 ? 234 GLU E CB  1 
ATOM   9613  C CG  . GLU E 3 243 ? 203.835 -80.203  54.668  1.00 228.37 ? 234 GLU E CG  1 
ATOM   9614  C CD  . GLU E 3 243 ? 204.160 -79.576  56.007  1.00 228.74 ? 234 GLU E CD  1 
ATOM   9615  O OE1 . GLU E 3 243 ? 203.549 -79.998  57.013  1.00 230.32 ? 234 GLU E OE1 1 
ATOM   9616  O OE2 . GLU E 3 243 ? 205.021 -78.667  56.057  1.00 227.17 ? 234 GLU E OE2 1 
ATOM   9617  N N   . LYS E 3 244 ? 206.967 -82.471  51.863  1.00 206.02 ? 235 LYS E N   1 
ATOM   9618  C CA  . LYS E 3 244 ? 207.883 -82.475  50.703  1.00 186.57 ? 235 LYS E CA  1 
ATOM   9619  C C   . LYS E 3 244 ? 207.395 -83.414  49.588  1.00 190.86 ? 235 LYS E C   1 
ATOM   9620  O O   . LYS E 3 244 ? 207.994 -83.481  48.508  1.00 182.96 ? 235 LYS E O   1 
ATOM   9621  C CB  . LYS E 3 244 ? 209.319 -82.811  51.126  1.00 168.27 ? 235 LYS E CB  1 
ATOM   9622  C CG  . LYS E 3 244 ? 210.392 -82.305  50.170  1.00 152.04 ? 235 LYS E CG  1 
ATOM   9623  C CD  . LYS E 3 244 ? 211.787 -82.718  50.615  1.00 144.02 ? 235 LYS E CD  1 
ATOM   9624  C CE  . LYS E 3 244 ? 212.507 -81.626  51.395  1.00 138.66 ? 235 LYS E CE  1 
ATOM   9625  N NZ  . LYS E 3 244 ? 212.020 -81.423  52.786  1.00 133.53 ? 235 LYS E NZ  1 
ATOM   9626  N N   . ARG E 3 245 ? 206.303 -84.126  49.876  1.00 203.61 ? 236 ARG E N   1 
ATOM   9627  C CA  . ARG E 3 245 ? 205.604 -84.987  48.917  1.00 214.73 ? 236 ARG E CA  1 
ATOM   9628  C C   . ARG E 3 245 ? 204.548 -84.210  48.115  1.00 220.12 ? 236 ARG E C   1 
ATOM   9629  O O   . ARG E 3 245 ? 204.437 -84.401  46.905  1.00 228.30 ? 236 ARG E O   1 
ATOM   9630  C CB  . ARG E 3 245 ? 204.957 -86.186  49.635  1.00 215.07 ? 236 ARG E CB  1 
ATOM   9631  C CG  . ARG E 3 245 ? 204.190 -87.146  48.728  1.00 212.95 ? 236 ARG E CG  1 
ATOM   9632  C CD  . ARG E 3 245 ? 203.339 -88.141  49.511  1.00 208.81 ? 236 ARG E CD  1 
ATOM   9633  N NE  . ARG E 3 245 ? 202.158 -87.531  50.129  1.00 203.64 ? 236 ARG E NE  1 
ATOM   9634  C CZ  . ARG E 3 245 ? 200.937 -87.512  49.592  1.00 198.15 ? 236 ARG E CZ  1 
ATOM   9635  N NH1 . ARG E 3 245 ? 199.938 -86.931  50.243  1.00 195.01 ? 236 ARG E NH1 1 
ATOM   9636  N NH2 . ARG E 3 245 ? 200.706 -88.068  48.408  1.00 193.89 ? 236 ARG E NH2 1 
ATOM   9637  N N   . ILE E 3 246 ? 203.772 -83.354  48.788  1.00 216.29 ? 237 ILE E N   1 
ATOM   9638  C CA  . ILE E 3 246 ? 202.778 -82.495  48.114  1.00 203.11 ? 237 ILE E CA  1 
ATOM   9639  C C   . ILE E 3 246 ? 203.487 -81.389  47.313  1.00 192.30 ? 237 ILE E C   1 
ATOM   9640  O O   . ILE E 3 246 ? 202.996 -80.958  46.263  1.00 189.88 ? 237 ILE E O   1 
ATOM   9641  C CB  . ILE E 3 246 ? 201.726 -81.902  49.096  1.00 202.54 ? 237 ILE E CB  1 
ATOM   9642  C CG1 . ILE E 3 246 ? 201.084 -83.006  49.951  1.00 201.40 ? 237 ILE E CG1 1 
ATOM   9643  C CG2 . ILE E 3 246 ? 200.641 -81.141  48.337  1.00 200.05 ? 237 ILE E CG2 1 
ATOM   9644  C CD1 . ILE E 3 246 ? 200.300 -82.502  51.150  1.00 197.95 ? 237 ILE E CD1 1 
ATOM   9645  N N   . GLN E 3 247 ? 204.647 -80.949  47.814  1.00 178.18 ? 238 GLN E N   1 
ATOM   9646  C CA  . GLN E 3 247 ? 205.561 -80.066  47.075  1.00 162.57 ? 238 GLN E CA  1 
ATOM   9647  C C   . GLN E 3 247 ? 206.029 -80.758  45.810  1.00 149.47 ? 238 GLN E C   1 
ATOM   9648  O O   . GLN E 3 247 ? 206.246 -80.118  44.786  1.00 144.14 ? 238 GLN E O   1 
ATOM   9649  C CB  . GLN E 3 247 ? 206.798 -79.719  47.913  1.00 165.13 ? 238 GLN E CB  1 
ATOM   9650  C CG  . GLN E 3 247 ? 206.573 -78.728  49.045  1.00 171.53 ? 238 GLN E CG  1 
ATOM   9651  C CD  . GLN E 3 247 ? 206.314 -77.312  48.563  1.00 174.78 ? 238 GLN E CD  1 
ATOM   9652  O OE1 . GLN E 3 247 ? 205.226 -76.997  48.086  1.00 181.56 ? 238 GLN E OE1 1 
ATOM   9653  N NE2 . GLN E 3 247 ? 207.310 -76.445  48.707  1.00 174.09 ? 238 GLN E NE2 1 
ATOM   9654  N N   . HIS E 3 248 ? 206.189 -82.076  45.919  1.00 139.04 ? 239 HIS E N   1 
ATOM   9655  C CA  . HIS E 3 248 ? 206.608 -82.934  44.827  1.00 130.67 ? 239 HIS E CA  1 
ATOM   9656  C C   . HIS E 3 248 ? 205.439 -83.323  43.899  1.00 129.06 ? 239 HIS E C   1 
ATOM   9657  O O   . HIS E 3 248 ? 205.584 -83.268  42.679  1.00 129.46 ? 239 HIS E O   1 
ATOM   9658  C CB  . HIS E 3 248 ? 207.274 -84.175  45.422  1.00 125.99 ? 239 HIS E CB  1 
ATOM   9659  C CG  . HIS E 3 248 ? 208.005 -85.013  44.429  1.00 121.23 ? 239 HIS E CG  1 
ATOM   9660  N ND1 . HIS E 3 248 ? 209.337 -84.821  44.135  1.00 119.27 ? 239 HIS E ND1 1 
ATOM   9661  C CD2 . HIS E 3 248 ? 207.598 -86.061  43.675  1.00 119.75 ? 239 HIS E CD2 1 
ATOM   9662  C CE1 . HIS E 3 248 ? 209.716 -85.709  43.235  1.00 118.52 ? 239 HIS E CE1 1 
ATOM   9663  N NE2 . HIS E 3 248 ? 208.680 -86.473  42.938  1.00 118.43 ? 239 HIS E NE2 1 
ATOM   9664  N N   . GLU E 3 249 ? 204.291 -83.700  44.479  1.00 124.87 ? 240 GLU E N   1 
ATOM   9665  C CA  . GLU E 3 249 ? 203.105 -84.174  43.723  1.00 117.91 ? 240 GLU E CA  1 
ATOM   9666  C C   . GLU E 3 249 ? 202.432 -83.100  42.867  1.00 113.36 ? 240 GLU E C   1 
ATOM   9667  O O   . GLU E 3 249 ? 202.202 -83.306  41.672  1.00 113.21 ? 240 GLU E O   1 
ATOM   9668  C CB  . GLU E 3 249 ? 202.056 -84.819  44.650  1.00 114.97 ? 240 GLU E CB  1 
ATOM   9669  C CG  . GLU E 3 249 ? 202.015 -86.344  44.622  1.00 109.43 ? 240 GLU E CG  1 
ATOM   9670  C CD  . GLU E 3 249 ? 200.722 -86.927  45.182  1.00 104.72 ? 240 GLU E CD  1 
ATOM   9671  O OE1 . GLU E 3 249 ? 199.671 -86.249  45.132  1.00 101.88 ? 240 GLU E OE1 1 
ATOM   9672  O OE2 . GLU E 3 249 ? 200.751 -88.078  45.665  1.00 102.50 ? 240 GLU E OE2 1 
ATOM   9673  N N   . ALA E 3 250 ? 202.097 -81.970  43.487  1.00 107.22 ? 241 ALA E N   1 
ATOM   9674  C CA  . ALA E 3 250 ? 201.560 -80.823  42.762  1.00 102.18 ? 241 ALA E CA  1 
ATOM   9675  C C   . ALA E 3 250 ? 202.636 -80.238  41.848  1.00 100.19 ? 241 ALA E C   1 
ATOM   9676  O O   . ALA E 3 250 ? 202.327 -79.618  40.831  1.00 100.45 ? 241 ALA E O   1 
ATOM   9677  C CB  . ALA E 3 250 ? 201.041 -79.774  43.731  1.00 100.68 ? 241 ALA E CB  1 
ATOM   9678  N N   . LEU E 3 251 ? 203.898 -80.455  42.221  1.00 98.06  ? 242 LEU E N   1 
ATOM   9679  C CA  . LEU E 3 251 ? 205.054 -80.088  41.401  1.00 96.67  ? 242 LEU E CA  1 
ATOM   9680  C C   . LEU E 3 251 ? 205.260 -81.079  40.251  1.00 97.05  ? 242 LEU E C   1 
ATOM   9681  O O   . LEU E 3 251 ? 205.964 -80.779  39.289  1.00 95.87  ? 242 LEU E O   1 
ATOM   9682  C CB  . LEU E 3 251 ? 206.313 -80.018  42.275  1.00 95.40  ? 242 LEU E CB  1 
ATOM   9683  C CG  . LEU E 3 251 ? 207.647 -79.428  41.796  1.00 94.53  ? 242 LEU E CG  1 
ATOM   9684  C CD1 . LEU E 3 251 ? 207.488 -77.989  41.331  1.00 94.58  ? 242 LEU E CD1 1 
ATOM   9685  C CD2 . LEU E 3 251 ? 208.699 -79.524  42.896  1.00 93.54  ? 242 LEU E CD2 1 
ATOM   9686  N N   . ARG E 3 252 ? 204.649 -82.257  40.362  1.00 99.23  ? 243 ARG E N   1 
ATOM   9687  C CA  . ARG E 3 252 ? 204.717 -83.285  39.320  1.00 101.93 ? 243 ARG E CA  1 
ATOM   9688  C C   . ARG E 3 252 ? 203.546 -83.154  38.340  1.00 105.02 ? 243 ARG E C   1 
ATOM   9689  O O   . ARG E 3 252 ? 203.690 -83.457  37.154  1.00 104.46 ? 243 ARG E O   1 
ATOM   9690  C CB  . ARG E 3 252 ? 204.752 -84.684  39.953  1.00 101.68 ? 243 ARG E CB  1 
ATOM   9691  C CG  . ARG E 3 252 ? 204.935 -85.850  38.985  1.00 101.26 ? 243 ARG E CG  1 
ATOM   9692  C CD  . ARG E 3 252 ? 205.420 -87.118  39.687  1.00 101.46 ? 243 ARG E CD  1 
ATOM   9693  N NE  . ARG E 3 252 ? 204.640 -87.454  40.883  1.00 101.14 ? 243 ARG E NE  1 
ATOM   9694  C CZ  . ARG E 3 252 ? 204.739 -88.594  41.569  1.00 100.02 ? 243 ARG E CZ  1 
ATOM   9695  N NH1 . ARG E 3 252 ? 205.579 -89.548  41.190  1.00 99.19  ? 243 ARG E NH1 1 
ATOM   9696  N NH2 . ARG E 3 252 ? 203.984 -88.786  42.641  1.00 99.58  ? 243 ARG E NH2 1 
ATOM   9697  N N   . ASP E 3 253 ? 202.397 -82.702  38.845  1.00 110.24 ? 244 ASP E N   1 
ATOM   9698  C CA  . ASP E 3 253 ? 201.198 -82.492  38.022  1.00 116.00 ? 244 ASP E CA  1 
ATOM   9699  C C   . ASP E 3 253 ? 201.242 -81.205  37.191  1.00 123.24 ? 244 ASP E C   1 
ATOM   9700  O O   . ASP E 3 253 ? 200.787 -81.196  36.043  1.00 124.03 ? 244 ASP E O   1 
ATOM   9701  C CB  . ASP E 3 253 ? 199.925 -82.526  38.882  1.00 113.24 ? 244 ASP E CB  1 
ATOM   9702  C CG  . ASP E 3 253 ? 199.260 -83.897  38.903  1.00 110.78 ? 244 ASP E CG  1 
ATOM   9703  O OD1 . ASP E 3 253 ? 199.179 -84.549  37.839  1.00 109.26 ? 244 ASP E OD1 1 
ATOM   9704  O OD2 . ASP E 3 253 ? 198.799 -84.315  39.987  1.00 109.57 ? 244 ASP E OD2 1 
ATOM   9705  N N   . HIS E 3 254 ? 201.773 -80.126  37.776  1.00 131.70 ? 245 HIS E N   1 
ATOM   9706  C CA  . HIS E 3 254 ? 201.942 -78.845  37.069  1.00 138.13 ? 245 HIS E CA  1 
ATOM   9707  C C   . HIS E 3 254 ? 202.985 -78.951  35.951  1.00 143.28 ? 245 HIS E C   1 
ATOM   9708  O O   . HIS E 3 254 ? 202.794 -78.398  34.867  1.00 146.70 ? 245 HIS E O   1 
ATOM   9709  C CB  . HIS E 3 254 ? 202.314 -77.705  38.036  1.00 135.99 ? 245 HIS E CB  1 
ATOM   9710  C CG  . HIS E 3 254 ? 201.134 -76.998  38.639  1.00 132.92 ? 245 HIS E CG  1 
ATOM   9711  N ND1 . HIS E 3 254 ? 200.377 -76.078  37.944  1.00 130.40 ? 245 HIS E ND1 1 
ATOM   9712  C CD2 . HIS E 3 254 ? 200.598 -77.061  39.882  1.00 131.82 ? 245 HIS E CD2 1 
ATOM   9713  C CE1 . HIS E 3 254 ? 199.418 -75.615  38.728  1.00 128.28 ? 245 HIS E CE1 1 
ATOM   9714  N NE2 . HIS E 3 254 ? 199.530 -76.196  39.909  1.00 129.54 ? 245 HIS E NE2 1 
ATOM   9715  N N   . VAL E 3 255 ? 204.076 -79.669  36.225  1.00 145.97 ? 246 VAL E N   1 
ATOM   9716  C CA  . VAL E 3 255 ? 205.147 -79.903  35.247  1.00 146.12 ? 246 VAL E CA  1 
ATOM   9717  C C   . VAL E 3 255 ? 204.683 -80.818  34.104  1.00 146.24 ? 246 VAL E C   1 
ATOM   9718  O O   . VAL E 3 255 ? 205.143 -80.682  32.967  1.00 147.37 ? 246 VAL E O   1 
ATOM   9719  C CB  . VAL E 3 255 ? 206.413 -80.481  35.926  1.00 145.35 ? 246 VAL E CB  1 
ATOM   9720  C CG1 . VAL E 3 255 ? 207.477 -80.845  34.902  1.00 145.94 ? 246 VAL E CG1 1 
ATOM   9721  C CG2 . VAL E 3 255 ? 206.982 -79.484  36.922  1.00 143.68 ? 246 VAL E CG2 1 
ATOM   9722  N N   . ALA E 3 256 ? 203.764 -81.733  34.416  1.00 144.10 ? 247 ALA E N   1 
ATOM   9723  C CA  . ALA E 3 256 ? 203.223 -82.695  33.447  1.00 140.33 ? 247 ALA E CA  1 
ATOM   9724  C C   . ALA E 3 256 ? 202.622 -82.036  32.205  1.00 138.13 ? 247 ALA E C   1 
ATOM   9725  O O   . ALA E 3 256 ? 202.816 -82.519  31.087  1.00 136.09 ? 247 ALA E O   1 
ATOM   9726  C CB  . ALA E 3 256 ? 202.194 -83.595  34.114  1.00 139.48 ? 247 ALA E CB  1 
ATOM   9727  N N   . GLY E 3 257 ? 201.890 -80.943  32.410  1.00 137.29 ? 248 GLY E N   1 
ATOM   9728  C CA  . GLY E 3 257 ? 201.309 -80.181  31.309  1.00 137.85 ? 248 GLY E CA  1 
ATOM   9729  C C   . GLY E 3 257 ? 202.185 -79.019  30.874  1.00 138.88 ? 248 GLY E C   1 
ATOM   9730  O O   . GLY E 3 257 ? 201.721 -77.877  30.807  1.00 140.47 ? 248 GLY E O   1 
ATOM   9731  N N   . MET E 3 258 ? 203.455 -79.311  30.586  1.00 138.07 ? 249 MET E N   1 
ATOM   9732  C CA  . MET E 3 258 ? 204.417 -78.303  30.122  1.00 136.76 ? 249 MET E CA  1 
ATOM   9733  C C   . MET E 3 258 ? 205.197 -78.791  28.899  1.00 136.85 ? 249 MET E C   1 
ATOM   9734  O O   . MET E 3 258 ? 205.532 -79.974  28.800  1.00 138.32 ? 249 MET E O   1 
ATOM   9735  C CB  . MET E 3 258 ? 205.398 -77.919  31.238  1.00 134.88 ? 249 MET E CB  1 
ATOM   9736  C CG  . MET E 3 258 ? 204.764 -77.284  32.468  1.00 133.84 ? 249 MET E CG  1 
ATOM   9737  S SD  . MET E 3 258 ? 204.195 -75.595  32.197  1.00 132.98 ? 249 MET E SD  1 
ATOM   9738  C CE  . MET E 3 258 ? 202.902 -75.465  33.431  1.00 132.50 ? 249 MET E CE  1 
ATOM   9739  N N   . ASP E 3 259 ? 205.482 -77.869  27.978  1.00 135.33 ? 250 ASP E N   1 
ATOM   9740  C CA  . ASP E 3 259 ? 206.235 -78.171  26.753  1.00 131.87 ? 250 ASP E CA  1 
ATOM   9741  C C   . ASP E 3 259 ? 207.731 -77.901  26.893  1.00 128.23 ? 250 ASP E C   1 
ATOM   9742  O O   . ASP E 3 259 ? 208.545 -78.567  26.256  1.00 128.56 ? 250 ASP E O   1 
ATOM   9743  C CB  . ASP E 3 259 ? 205.691 -77.370  25.564  1.00 131.98 ? 250 ASP E CB  1 
ATOM   9744  C CG  . ASP E 3 259 ? 204.381 -77.920  25.029  1.00 131.21 ? 250 ASP E CG  1 
ATOM   9745  O OD1 . ASP E 3 259 ? 204.265 -79.155  24.848  1.00 130.58 ? 250 ASP E OD1 1 
ATOM   9746  O OD2 . ASP E 3 259 ? 203.472 -77.104  24.760  1.00 130.55 ? 250 ASP E OD2 1 
ATOM   9747  N N   . VAL E 3 260 ? 208.084 -76.897  27.695  1.00 122.34 ? 251 VAL E N   1 
ATOM   9748  C CA  . VAL E 3 260 ? 209.485 -76.553  27.952  1.00 115.15 ? 251 VAL E CA  1 
ATOM   9749  C C   . VAL E 3 260 ? 209.694 -76.287  29.441  1.00 109.06 ? 251 VAL E C   1 
ATOM   9750  O O   . VAL E 3 260 ? 208.984 -75.487  30.049  1.00 107.55 ? 251 VAL E O   1 
ATOM   9751  C CB  . VAL E 3 260 ? 209.968 -75.333  27.123  1.00 115.99 ? 251 VAL E CB  1 
ATOM   9752  C CG1 . VAL E 3 260 ? 211.442 -75.052  27.381  1.00 114.74 ? 251 VAL E CG1 1 
ATOM   9753  C CG2 . VAL E 3 260 ? 209.736 -75.544  25.632  1.00 116.93 ? 251 VAL E CG2 1 
ATOM   9754  N N   . LEU E 3 261 ? 210.664 -76.977  30.024  1.00 103.36 ? 252 LEU E N   1 
ATOM   9755  C CA  . LEU E 3 261 ? 211.026 -76.751  31.408  1.00 100.31 ? 252 LEU E CA  1 
ATOM   9756  C C   . LEU E 3 261 ? 212.452 -76.245  31.459  1.00 101.65 ? 252 LEU E C   1 
ATOM   9757  O O   . LEU E 3 261 ? 213.398 -77.001  31.244  1.00 100.43 ? 252 LEU E O   1 
ATOM   9758  C CB  . LEU E 3 261 ? 210.880 -78.032  32.237  1.00 97.70  ? 252 LEU E CB  1 
ATOM   9759  C CG  . LEU E 3 261 ? 209.497 -78.620  32.553  1.00 95.88  ? 252 LEU E CG  1 
ATOM   9760  C CD1 . LEU E 3 261 ? 208.564 -77.591  33.166  1.00 94.12  ? 252 LEU E CD1 1 
ATOM   9761  C CD2 . LEU E 3 261 ? 208.849 -79.253  31.333  1.00 95.31  ? 252 LEU E CD2 1 
ATOM   9762  N N   . ILE E 3 262 ? 212.597 -74.954  31.720  1.00 105.89 ? 253 ILE E N   1 
ATOM   9763  C CA  . ILE E 3 262 ? 213.911 -74.353  31.864  1.00 113.63 ? 253 ILE E CA  1 
ATOM   9764  C C   . ILE E 3 262 ? 214.232 -74.275  33.355  1.00 122.79 ? 253 ILE E C   1 
ATOM   9765  O O   . ILE E 3 262 ? 213.448 -73.735  34.134  1.00 122.20 ? 253 ILE E O   1 
ATOM   9766  C CB  . ILE E 3 262 ? 213.978 -72.970  31.185  1.00 111.96 ? 253 ILE E CB  1 
ATOM   9767  C CG1 . ILE E 3 262 ? 213.457 -73.066  29.744  1.00 110.61 ? 253 ILE E CG1 1 
ATOM   9768  C CG2 . ILE E 3 262 ? 215.403 -72.432  31.213  1.00 113.16 ? 253 ILE E CG2 1 
ATOM   9769  C CD1 . ILE E 3 262 ? 213.288 -71.739  29.034  1.00 110.57 ? 253 ILE E CD1 1 
ATOM   9770  N N   . THR E 3 263 ? 215.376 -74.838  33.743  1.00 137.39 ? 254 THR E N   1 
ATOM   9771  C CA  . THR E 3 263 ? 215.730 -75.008  35.158  1.00 153.13 ? 254 THR E CA  1 
ATOM   9772  C C   . THR E 3 263 ? 217.083 -74.375  35.510  1.00 165.18 ? 254 THR E C   1 
ATOM   9773  O O   . THR E 3 263 ? 218.094 -74.657  34.858  1.00 165.71 ? 254 THR E O   1 
ATOM   9774  C CB  . THR E 3 263 ? 215.750 -76.500  35.548  1.00 153.97 ? 254 THR E CB  1 
ATOM   9775  O OG1 . THR E 3 263 ? 216.672 -77.206  34.706  1.00 154.97 ? 254 THR E OG1 1 
ATOM   9776  C CG2 . THR E 3 263 ? 214.364 -77.123  35.416  1.00 154.83 ? 254 THR E CG2 1 
ATOM   9777  N N   . THR E 3 264 ? 217.096 -73.536  36.550  1.00 181.47 ? 255 THR E N   1 
ATOM   9778  C CA  . THR E 3 264 ? 218.275 -72.712  36.883  1.00 194.91 ? 255 THR E CA  1 
ATOM   9779  C C   . THR E 3 264 ? 218.714 -72.719  38.362  1.00 198.79 ? 255 THR E C   1 
ATOM   9780  O O   . THR E 3 264 ? 219.448 -71.826  38.791  1.00 201.79 ? 255 THR E O   1 
ATOM   9781  C CB  . THR E 3 264 ? 218.075 -71.233  36.461  1.00 199.81 ? 255 THR E CB  1 
ATOM   9782  O OG1 . THR E 3 264 ? 216.953 -70.675  37.161  1.00 203.30 ? 255 THR E OG1 1 
ATOM   9783  C CG2 . THR E 3 264 ? 217.860 -71.100  34.953  1.00 203.19 ? 255 THR E CG2 1 
ATOM   9784  N N   . ALA E 3 265 ? 218.288 -73.721  39.128  1.00 199.85 ? 256 ALA E N   1 
ATOM   9785  C CA  . ALA E 3 265 ? 218.561 -73.766  40.573  1.00 199.46 ? 256 ALA E CA  1 
ATOM   9786  C C   . ALA E 3 265 ? 220.005 -74.166  40.934  1.00 201.21 ? 256 ALA E C   1 
ATOM   9787  O O   . ALA E 3 265 ? 220.416 -75.304  40.695  1.00 203.91 ? 256 ALA E O   1 
ATOM   9788  C CB  . ALA E 3 265 ? 217.561 -74.683  41.263  1.00 195.94 ? 256 ALA E CB  1 
ATOM   9789  N N   . GLN E 3 266 ? 220.758 -73.228  41.518  1.00 202.09 ? 257 GLN E N   1 
ATOM   9790  C CA  . GLN E 3 266 ? 222.161 -73.458  41.922  1.00 201.85 ? 257 GLN E CA  1 
ATOM   9791  C C   . GLN E 3 266 ? 222.486 -72.967  43.342  1.00 195.08 ? 257 GLN E C   1 
ATOM   9792  O O   . GLN E 3 266 ? 221.731 -72.186  43.927  1.00 192.08 ? 257 GLN E O   1 
ATOM   9793  C CB  . GLN E 3 266 ? 223.136 -72.813  40.924  1.00 213.00 ? 257 GLN E CB  1 
ATOM   9794  C CG  . GLN E 3 266 ? 223.554 -73.700  39.757  1.00 224.33 ? 257 GLN E CG  1 
ATOM   9795  C CD  . GLN E 3 266 ? 224.766 -73.161  39.006  1.00 229.77 ? 257 GLN E CD  1 
ATOM   9796  O OE1 . GLN E 3 266 ? 225.860 -73.043  39.566  1.00 228.65 ? 257 GLN E OE1 1 
ATOM   9797  N NE2 . GLN E 3 266 ? 224.579 -72.842  37.729  1.00 233.83 ? 257 GLN E NE2 1 
ATOM   9798  N N   . VAL E 3 267 ? 223.618 -73.432  43.878  1.00 190.61 ? 258 VAL E N   1 
ATOM   9799  C CA  . VAL E 3 267 ? 224.102 -73.067  45.223  1.00 189.90 ? 258 VAL E CA  1 
ATOM   9800  C C   . VAL E 3 267 ? 225.636 -72.870  45.192  1.00 188.46 ? 258 VAL E C   1 
ATOM   9801  O O   . VAL E 3 267 ? 226.331 -73.647  44.533  1.00 189.67 ? 258 VAL E O   1 
ATOM   9802  C CB  . VAL E 3 267 ? 223.742 -74.150  46.277  1.00 190.59 ? 258 VAL E CB  1 
ATOM   9803  C CG1 . VAL E 3 267 ? 223.663 -73.543  47.669  1.00 193.06 ? 258 VAL E CG1 1 
ATOM   9804  C CG2 . VAL E 3 267 ? 222.421 -74.837  45.952  1.00 189.73 ? 258 VAL E CG2 1 
ATOM   9805  N N   . PRO E 3 268 ? 226.173 -71.839  45.898  1.00 185.86 ? 259 PRO E N   1 
ATOM   9806  C CA  . PRO E 3 268 ? 227.626 -71.573  45.851  1.00 182.45 ? 259 PRO E CA  1 
ATOM   9807  C C   . PRO E 3 268 ? 228.483 -72.399  46.824  1.00 180.47 ? 259 PRO E C   1 
ATOM   9808  O O   . PRO E 3 268 ? 229.062 -71.848  47.770  1.00 172.46 ? 259 PRO E O   1 
ATOM   9809  C CB  . PRO E 3 268 ? 227.732 -70.072  46.181  1.00 181.39 ? 259 PRO E CB  1 
ATOM   9810  C CG  . PRO E 3 268 ? 226.376 -69.636  46.639  1.00 183.23 ? 259 PRO E CG  1 
ATOM   9811  C CD  . PRO E 3 268 ? 225.471 -70.832  46.712  1.00 185.24 ? 259 PRO E CD  1 
ATOM   9812  N N   . GLY E 3 269 ? 228.575 -73.704  46.566  1.00 185.24 ? 260 GLY E N   1 
ATOM   9813  C CA  . GLY E 3 269 ? 229.378 -74.624  47.380  1.00 191.15 ? 260 GLY E CA  1 
ATOM   9814  C C   . GLY E 3 269 ? 228.922 -76.078  47.340  1.00 196.70 ? 260 GLY E C   1 
ATOM   9815  O O   . GLY E 3 269 ? 229.604 -76.964  47.867  1.00 192.31 ? 260 GLY E O   1 
ATOM   9816  N N   . ARG E 3 270 ? 227.772 -76.317  46.709  1.00 205.34 ? 261 ARG E N   1 
ATOM   9817  C CA  . ARG E 3 270 ? 227.148 -77.645  46.635  1.00 212.97 ? 261 ARG E CA  1 
ATOM   9818  C C   . ARG E 3 270 ? 226.703 -78.008  45.217  1.00 225.12 ? 261 ARG E C   1 
ATOM   9819  O O   . ARG E 3 270 ? 226.468 -77.124  44.388  1.00 231.83 ? 261 ARG E O   1 
ATOM   9820  C CB  . ARG E 3 270 ? 225.935 -77.706  47.565  1.00 204.73 ? 261 ARG E CB  1 
ATOM   9821  C CG  . ARG E 3 270 ? 226.176 -78.405  48.891  1.00 196.12 ? 261 ARG E CG  1 
ATOM   9822  C CD  . ARG E 3 270 ? 225.552 -79.790  48.917  1.00 189.56 ? 261 ARG E CD  1 
ATOM   9823  N NE  . ARG E 3 270 ? 226.544 -80.847  48.741  1.00 183.75 ? 261 ARG E NE  1 
ATOM   9824  C CZ  . ARG E 3 270 ? 226.253 -82.133  48.566  1.00 180.81 ? 261 ARG E CZ  1 
ATOM   9825  N NH1 . ARG E 3 270 ? 227.234 -83.016  48.421  1.00 177.46 ? 261 ARG E NH1 1 
ATOM   9826  N NH2 . ARG E 3 270 ? 224.989 -82.542  48.528  1.00 180.79 ? 261 ARG E NH2 1 
ATOM   9827  N N   . ARG E 3 271 ? 226.578 -79.310  44.954  1.00 233.19 ? 262 ARG E N   1 
ATOM   9828  C CA  . ARG E 3 271 ? 226.075 -79.800  43.665  1.00 232.55 ? 262 ARG E CA  1 
ATOM   9829  C C   . ARG E 3 271 ? 224.577 -79.530  43.547  1.00 225.77 ? 262 ARG E C   1 
ATOM   9830  O O   . ARG E 3 271 ? 223.828 -79.691  44.517  1.00 221.43 ? 262 ARG E O   1 
ATOM   9831  C CB  . ARG E 3 271 ? 226.379 -81.294  43.461  1.00 237.76 ? 262 ARG E CB  1 
ATOM   9832  C CG  . ARG E 3 271 ? 227.860 -81.655  43.529  1.00 240.33 ? 262 ARG E CG  1 
ATOM   9833  C CD  . ARG E 3 271 ? 228.200 -82.923  42.751  1.00 235.85 ? 262 ARG E CD  1 
ATOM   9834  N NE  . ARG E 3 271 ? 228.768 -82.631  41.432  1.00 228.15 ? 262 ARG E NE  1 
ATOM   9835  C CZ  . ARG E 3 271 ? 229.467 -83.494  40.695  1.00 222.43 ? 262 ARG E CZ  1 
ATOM   9836  N NH1 . ARG E 3 271 ? 229.704 -84.725  41.135  1.00 220.76 ? 262 ARG E NH1 1 
ATOM   9837  N NH2 . ARG E 3 271 ? 229.940 -83.120  39.512  1.00 217.18 ? 262 ARG E NH2 1 
ATOM   9838  N N   . ALA E 3 272 ? 224.162 -79.117  42.352  1.00 220.24 ? 263 ALA E N   1 
ATOM   9839  C CA  . ALA E 3 272 ? 222.794 -78.678  42.089  1.00 217.75 ? 263 ALA E CA  1 
ATOM   9840  C C   . ALA E 3 272 ? 221.731 -79.599  42.692  1.00 217.16 ? 263 ALA E C   1 
ATOM   9841  O O   . ALA E 3 272 ? 221.773 -80.815  42.486  1.00 215.06 ? 263 ALA E O   1 
ATOM   9842  C CB  . ALA E 3 272 ? 222.572 -78.513  40.593  1.00 218.11 ? 263 ALA E CB  1 
ATOM   9843  N N   . PRO E 3 273 ? 220.796 -79.018  43.467  1.00 218.33 ? 264 PRO E N   1 
ATOM   9844  C CA  . PRO E 3 273 ? 219.630 -79.738  43.986  1.00 220.02 ? 264 PRO E CA  1 
ATOM   9845  C C   . PRO E 3 273 ? 218.617 -80.072  42.881  1.00 220.07 ? 264 PRO E C   1 
ATOM   9846  O O   . PRO E 3 273 ? 218.412 -79.271  41.964  1.00 225.53 ? 264 PRO E O   1 
ATOM   9847  C CB  . PRO E 3 273 ? 219.030 -78.757  45.000  1.00 221.70 ? 264 PRO E CB  1 
ATOM   9848  C CG  . PRO E 3 273 ? 219.533 -77.415  44.590  1.00 221.40 ? 264 PRO E CG  1 
ATOM   9849  C CD  . PRO E 3 273 ? 220.898 -77.656  44.024  1.00 218.52 ? 264 PRO E CD  1 
ATOM   9850  N N   . ILE E 3 274 ? 217.990 -81.243  42.990  1.00 213.14 ? 265 ILE E N   1 
ATOM   9851  C CA  . ILE E 3 274 ? 217.134 -81.796  41.930  1.00 202.05 ? 265 ILE E CA  1 
ATOM   9852  C C   . ILE E 3 274 ? 215.689 -81.291  41.992  1.00 185.04 ? 265 ILE E C   1 
ATOM   9853  O O   . ILE E 3 274 ? 214.997 -81.470  42.999  1.00 184.06 ? 265 ILE E O   1 
ATOM   9854  C CB  . ILE E 3 274 ? 217.138 -83.350  41.948  1.00 209.66 ? 265 ILE E CB  1 
ATOM   9855  C CG1 . ILE E 3 274 ? 218.567 -83.916  42.097  1.00 215.91 ? 265 ILE E CG1 1 
ATOM   9856  C CG2 . ILE E 3 274 ? 216.403 -83.922  40.736  1.00 210.25 ? 265 ILE E CG2 1 
ATOM   9857  C CD1 . ILE E 3 274 ? 219.537 -83.575  40.978  1.00 220.86 ? 265 ILE E CD1 1 
ATOM   9858  N N   . LEU E 3 275 ? 215.239 -80.669  40.906  1.00 165.71 ? 266 LEU E N   1 
ATOM   9859  C CA  . LEU E 3 275 ? 213.851 -80.231  40.797  1.00 151.48 ? 266 LEU E CA  1 
ATOM   9860  C C   . LEU E 3 275 ? 213.012 -81.202  39.967  1.00 147.78 ? 266 LEU E C   1 
ATOM   9861  O O   . LEU E 3 275 ? 211.827 -81.387  40.242  1.00 147.88 ? 266 LEU E O   1 
ATOM   9862  C CB  . LEU E 3 275 ? 213.763 -78.805  40.236  1.00 144.58 ? 266 LEU E CB  1 
ATOM   9863  C CG  . LEU E 3 275 ? 214.165 -77.654  41.169  1.00 139.04 ? 266 LEU E CG  1 
ATOM   9864  C CD1 . LEU E 3 275 ? 214.209 -76.331  40.420  1.00 135.32 ? 266 LEU E CD1 1 
ATOM   9865  C CD2 . LEU E 3 275 ? 213.230 -77.554  42.366  1.00 137.58 ? 266 LEU E CD2 1 
ATOM   9866  N N   . LEU E 3 276 ? 213.636 -81.823  38.965  1.00 143.13 ? 267 LEU E N   1 
ATOM   9867  C CA  . LEU E 3 276 ? 212.956 -82.780  38.088  1.00 139.50 ? 267 LEU E CA  1 
ATOM   9868  C C   . LEU E 3 276 ? 213.399 -84.214  38.335  1.00 134.78 ? 267 LEU E C   1 
ATOM   9869  O O   . LEU E 3 276 ? 214.448 -84.645  37.851  1.00 132.36 ? 267 LEU E O   1 
ATOM   9870  C CB  . LEU E 3 276 ? 213.171 -82.421  36.616  1.00 142.66 ? 267 LEU E CB  1 
ATOM   9871  C CG  . LEU E 3 276 ? 212.299 -81.312  36.020  1.00 146.67 ? 267 LEU E CG  1 
ATOM   9872  C CD1 . LEU E 3 276 ? 212.765 -80.995  34.608  1.00 148.54 ? 267 LEU E CD1 1 
ATOM   9873  C CD2 . LEU E 3 276 ? 210.826 -81.718  36.020  1.00 148.11 ? 267 LEU E CD2 1 
ATOM   9874  N N   . THR E 3 277 ? 212.583 -84.949  39.081  1.00 132.11 ? 268 THR E N   1 
ATOM   9875  C CA  . THR E 3 277 ? 212.889 -86.332  39.429  1.00 131.07 ? 268 THR E CA  1 
ATOM   9876  C C   . THR E 3 277 ? 212.509 -87.297  38.310  1.00 130.44 ? 268 THR E C   1 
ATOM   9877  O O   . THR E 3 277 ? 211.812 -86.920  37.365  1.00 128.50 ? 268 THR E O   1 
ATOM   9878  C CB  . THR E 3 277 ? 212.186 -86.753  40.734  1.00 131.16 ? 268 THR E CB  1 
ATOM   9879  O OG1 . THR E 3 277 ? 210.775 -86.538  40.610  1.00 131.54 ? 268 THR E OG1 1 
ATOM   9880  C CG2 . THR E 3 277 ? 212.725 -85.955  41.915  1.00 130.73 ? 268 THR E CG2 1 
ATOM   9881  N N   . GLU E 3 278 ? 212.985 -88.536  38.432  1.00 131.35 ? 269 GLU E N   1 
ATOM   9882  C CA  . GLU E 3 278 ? 212.651 -89.635  37.522  1.00 131.82 ? 269 GLU E CA  1 
ATOM   9883  C C   . GLU E 3 278 ? 211.150 -89.712  37.228  1.00 131.98 ? 269 GLU E C   1 
ATOM   9884  O O   . GLU E 3 278 ? 210.745 -89.781  36.067  1.00 130.86 ? 269 GLU E O   1 
ATOM   9885  C CB  . GLU E 3 278 ? 213.167 -90.974  38.087  1.00 133.60 ? 269 GLU E CB  1 
ATOM   9886  C CG  . GLU E 3 278 ? 212.904 -91.184  39.582  1.00 135.68 ? 269 GLU E CG  1 
ATOM   9887  C CD  . GLU E 3 278 ? 213.413 -92.515  40.127  1.00 136.59 ? 269 GLU E CD  1 
ATOM   9888  O OE1 . GLU E 3 278 ? 214.019 -93.308  39.357  1.00 139.27 ? 269 GLU E OE1 1 
ATOM   9889  O OE2 . GLU E 3 278 ? 213.204 -92.772  41.341  1.00 134.65 ? 269 GLU E OE2 1 
ATOM   9890  N N   . ASP E 3 279 ? 210.341 -89.674  38.289  1.00 132.66 ? 270 ASP E N   1 
ATOM   9891  C CA  . ASP E 3 279 ? 208.880 -89.784  38.191  1.00 131.53 ? 270 ASP E CA  1 
ATOM   9892  C C   . ASP E 3 279 ? 208.211 -88.537  37.605  1.00 129.33 ? 270 ASP E C   1 
ATOM   9893  O O   . ASP E 3 279 ? 207.193 -88.643  36.915  1.00 130.02 ? 270 ASP E O   1 
ATOM   9894  C CB  . ASP E 3 279 ? 208.256 -90.166  39.547  1.00 131.61 ? 270 ASP E CB  1 
ATOM   9895  C CG  . ASP E 3 279 ? 208.804 -89.346  40.714  1.00 130.96 ? 270 ASP E CG  1 
ATOM   9896  O OD1 . ASP E 3 279 ? 210.012 -89.454  41.015  1.00 131.29 ? 270 ASP E OD1 1 
ATOM   9897  O OD2 . ASP E 3 279 ? 208.018 -88.614  41.351  1.00 129.35 ? 270 ASP E OD2 1 
ATOM   9898  N N   . MET E 3 280 ? 208.783 -87.367  37.887  1.00 125.15 ? 271 MET E N   1 
ATOM   9899  C CA  . MET E 3 280 ? 208.362 -86.116  37.253  1.00 120.81 ? 271 MET E CA  1 
ATOM   9900  C C   . MET E 3 280 ? 208.741 -86.137  35.779  1.00 120.08 ? 271 MET E C   1 
ATOM   9901  O O   . MET E 3 280 ? 208.020 -85.605  34.934  1.00 118.38 ? 271 MET E O   1 
ATOM   9902  C CB  . MET E 3 280 ? 209.023 -84.918  37.929  1.00 118.70 ? 271 MET E CB  1 
ATOM   9903  C CG  . MET E 3 280 ? 208.439 -84.551  39.279  1.00 117.41 ? 271 MET E CG  1 
ATOM   9904  S SD  . MET E 3 280 ? 209.513 -83.397  40.145  1.00 116.50 ? 271 MET E SD  1 
ATOM   9905  C CE  . MET E 3 280 ? 208.478 -82.940  41.525  1.00 115.75 ? 271 MET E CE  1 
ATOM   9906  N N   . VAL E 3 281 ? 209.887 -86.754  35.495  1.00 121.04 ? 272 VAL E N   1 
ATOM   9907  C CA  . VAL E 3 281 ? 210.386 -86.960  34.139  1.00 123.71 ? 272 VAL E CA  1 
ATOM   9908  C C   . VAL E 3 281 ? 209.470 -87.885  33.336  1.00 129.07 ? 272 VAL E C   1 
ATOM   9909  O O   . VAL E 3 281 ? 209.155 -87.603  32.179  1.00 130.77 ? 272 VAL E O   1 
ATOM   9910  C CB  . VAL E 3 281 ? 211.834 -87.509  34.167  1.00 120.91 ? 272 VAL E CB  1 
ATOM   9911  C CG1 . VAL E 3 281 ? 212.127 -88.408  32.973  1.00 119.80 ? 272 VAL E CG1 1 
ATOM   9912  C CG2 . VAL E 3 281 ? 212.829 -86.365  34.249  1.00 119.68 ? 272 VAL E CG2 1 
ATOM   9913  N N   . GLU E 3 282 ? 209.041 -88.980  33.961  1.00 135.32 ? 273 GLU E N   1 
ATOM   9914  C CA  . GLU E 3 282 ? 208.214 -89.989  33.296  1.00 141.14 ? 273 GLU E CA  1 
ATOM   9915  C C   . GLU E 3 282 ? 206.815 -89.485  32.960  1.00 143.17 ? 273 GLU E C   1 
ATOM   9916  O O   . GLU E 3 282 ? 206.230 -89.896  31.955  1.00 143.04 ? 273 GLU E O   1 
ATOM   9917  C CB  . GLU E 3 282 ? 208.122 -91.247  34.154  1.00 144.45 ? 273 GLU E CB  1 
ATOM   9918  C CG  . GLU E 3 282 ? 209.397 -92.070  34.156  1.00 148.58 ? 273 GLU E CG  1 
ATOM   9919  C CD  . GLU E 3 282 ? 209.702 -92.677  35.509  1.00 152.60 ? 273 GLU E CD  1 
ATOM   9920  O OE1 . GLU E 3 282 ? 210.895 -92.695  35.882  1.00 155.48 ? 273 GLU E OE1 1 
ATOM   9921  O OE2 . GLU E 3 282 ? 208.757 -93.125  36.198  1.00 153.52 ? 273 GLU E OE2 1 
ATOM   9922  N N   . ARG E 3 283 ? 206.289 -88.596  33.801  1.00 145.75 ? 274 ARG E N   1 
ATOM   9923  C CA  . ARG E 3 283 ? 204.958 -88.029  33.589  1.00 147.97 ? 274 ARG E CA  1 
ATOM   9924  C C   . ARG E 3 283 ? 204.973 -86.873  32.584  1.00 149.69 ? 274 ARG E C   1 
ATOM   9925  O O   . ARG E 3 283 ? 203.930 -86.281  32.289  1.00 150.52 ? 274 ARG E O   1 
ATOM   9926  C CB  . ARG E 3 283 ? 204.332 -87.582  34.913  1.00 146.79 ? 274 ARG E CB  1 
ATOM   9927  C CG  . ARG E 3 283 ? 202.817 -87.729  34.935  1.00 145.40 ? 274 ARG E CG  1 
ATOM   9928  C CD  . ARG E 3 283 ? 202.157 -86.754  35.900  1.00 143.76 ? 274 ARG E CD  1 
ATOM   9929  N NE  . ARG E 3 283 ? 202.150 -87.152  37.315  1.00 142.45 ? 274 ARG E NE  1 
ATOM   9930  C CZ  . ARG E 3 283 ? 202.372 -88.381  37.794  1.00 141.95 ? 274 ARG E CZ  1 
ATOM   9931  N NH1 . ARG E 3 283 ? 202.629 -89.425  36.992  1.00 140.12 ? 274 ARG E NH1 1 
ATOM   9932  N NH2 . ARG E 3 283 ? 202.328 -88.570  39.108  1.00 142.97 ? 274 ARG E NH2 1 
ATOM   9933  N N   . LEU E 3 284 ? 206.154 -86.556  32.062  1.00 151.27 ? 275 LEU E N   1 
ATOM   9934  C CA  . LEU E 3 284 ? 206.271 -85.571  30.997  1.00 153.43 ? 275 LEU E CA  1 
ATOM   9935  C C   . LEU E 3 284 ? 205.807 -86.168  29.679  1.00 156.74 ? 275 LEU E C   1 
ATOM   9936  O O   . LEU E 3 284 ? 206.095 -87.330  29.374  1.00 153.36 ? 275 LEU E O   1 
ATOM   9937  C CB  . LEU E 3 284 ? 207.710 -85.065  30.871  1.00 153.09 ? 275 LEU E CB  1 
ATOM   9938  C CG  . LEU E 3 284 ? 208.204 -84.079  31.932  1.00 153.00 ? 275 LEU E CG  1 
ATOM   9939  C CD1 . LEU E 3 284 ? 209.719 -83.947  31.885  1.00 153.69 ? 275 LEU E CD1 1 
ATOM   9940  C CD2 . LEU E 3 284 ? 207.541 -82.722  31.756  1.00 153.14 ? 275 LEU E CD2 1 
ATOM   9941  N N   . LYS E 3 285 ? 205.073 -85.369  28.911  1.00 164.99 ? 276 LYS E N   1 
ATOM   9942  C CA  . LYS E 3 285 ? 204.657 -85.762  27.572  1.00 176.05 ? 276 LYS E CA  1 
ATOM   9943  C C   . LYS E 3 285 ? 205.866 -85.730  26.642  1.00 187.72 ? 276 LYS E C   1 
ATOM   9944  O O   . LYS E 3 285 ? 206.810 -84.976  26.881  1.00 191.24 ? 276 LYS E O   1 
ATOM   9945  C CB  . LYS E 3 285 ? 203.597 -84.805  27.023  1.00 174.41 ? 276 LYS E CB  1 
ATOM   9946  C CG  . LYS E 3 285 ? 202.423 -84.512  27.943  1.00 172.47 ? 276 LYS E CG  1 
ATOM   9947  C CD  . LYS E 3 285 ? 201.237 -83.945  27.168  1.00 173.39 ? 276 LYS E CD  1 
ATOM   9948  C CE  . LYS E 3 285 ? 201.632 -82.871  26.150  1.00 174.16 ? 276 LYS E CE  1 
ATOM   9949  N NZ  . LYS E 3 285 ? 202.197 -81.639  26.778  1.00 174.68 ? 276 LYS E NZ  1 
ATOM   9950  N N   . PRO E 3 286 ? 205.852 -86.567  25.589  1.00 197.42 ? 277 PRO E N   1 
ATOM   9951  C CA  . PRO E 3 286 ? 206.834 -86.452  24.505  1.00 200.43 ? 277 PRO E CA  1 
ATOM   9952  C C   . PRO E 3 286 ? 206.645 -85.161  23.690  1.00 195.78 ? 277 PRO E C   1 
ATOM   9953  O O   . PRO E 3 286 ? 205.508 -84.738  23.455  1.00 202.33 ? 277 PRO E O   1 
ATOM   9954  C CB  . PRO E 3 286 ? 206.549 -87.687  23.644  1.00 205.03 ? 277 PRO E CB  1 
ATOM   9955  C CG  . PRO E 3 286 ? 205.899 -88.658  24.576  1.00 204.15 ? 277 PRO E CG  1 
ATOM   9956  C CD  . PRO E 3 286 ? 205.067 -87.812  25.490  1.00 200.32 ? 277 PRO E CD  1 
ATOM   9957  N N   . GLY E 3 287 ? 207.753 -84.550  23.268  1.00 183.11 ? 278 GLY E N   1 
ATOM   9958  C CA  . GLY E 3 287 ? 207.727 -83.245  22.597  1.00 165.00 ? 278 GLY E CA  1 
ATOM   9959  C C   . GLY E 3 287 ? 208.094 -82.132  23.561  1.00 154.03 ? 278 GLY E C   1 
ATOM   9960  O O   . GLY E 3 287 ? 208.275 -80.975  23.163  1.00 147.45 ? 278 GLY E O   1 
ATOM   9961  N N   . THR E 3 288 ? 208.197 -82.502  24.837  1.00 149.44 ? 279 THR E N   1 
ATOM   9962  C CA  . THR E 3 288 ? 208.593 -81.598  25.905  1.00 146.15 ? 279 THR E CA  1 
ATOM   9963  C C   . THR E 3 288 ? 210.098 -81.354  25.863  1.00 143.96 ? 279 THR E C   1 
ATOM   9964  O O   . THR E 3 288 ? 210.882 -82.269  25.602  1.00 141.58 ? 279 THR E O   1 
ATOM   9965  C CB  . THR E 3 288 ? 208.185 -82.153  27.288  1.00 147.05 ? 279 THR E CB  1 
ATOM   9966  O OG1 . THR E 3 288 ? 206.761 -82.301  27.344  1.00 148.61 ? 279 THR E OG1 1 
ATOM   9967  C CG2 . THR E 3 288 ? 208.629 -81.230  28.412  1.00 146.59 ? 279 THR E CG2 1 
ATOM   9968  N N   . VAL E 3 289 ? 210.480 -80.109  26.127  1.00 144.04 ? 280 VAL E N   1 
ATOM   9969  C CA  . VAL E 3 289 ? 211.871 -79.679  26.107  1.00 145.48 ? 280 VAL E CA  1 
ATOM   9970  C C   . VAL E 3 289 ? 212.345 -79.387  27.532  1.00 146.54 ? 280 VAL E C   1 
ATOM   9971  O O   . VAL E 3 289 ? 211.761 -78.560  28.232  1.00 145.74 ? 280 VAL E O   1 
ATOM   9972  C CB  . VAL E 3 289 ? 212.048 -78.419  25.229  1.00 145.27 ? 280 VAL E CB  1 
ATOM   9973  C CG1 . VAL E 3 289 ? 213.522 -78.077  25.054  1.00 146.33 ? 280 VAL E CG1 1 
ATOM   9974  C CG2 . VAL E 3 289 ? 211.372 -78.599  23.875  1.00 144.11 ? 280 VAL E CG2 1 
ATOM   9975  N N   . VAL E 3 290 ? 213.401 -80.076  27.956  1.00 148.02 ? 281 VAL E N   1 
ATOM   9976  C CA  . VAL E 3 290 ? 213.993 -79.845  29.273  1.00 148.92 ? 281 VAL E CA  1 
ATOM   9977  C C   . VAL E 3 290 ? 215.325 -79.108  29.124  1.00 150.90 ? 281 VAL E C   1 
ATOM   9978  O O   . VAL E 3 290 ? 216.293 -79.651  28.583  1.00 151.92 ? 281 VAL E O   1 
ATOM   9979  C CB  . VAL E 3 290 ? 214.179 -81.160  30.067  1.00 147.56 ? 281 VAL E CB  1 
ATOM   9980  C CG1 . VAL E 3 290 ? 214.836 -80.894  31.414  1.00 147.43 ? 281 VAL E CG1 1 
ATOM   9981  C CG2 . VAL E 3 290 ? 212.843 -81.862  30.266  1.00 146.70 ? 281 VAL E CG2 1 
ATOM   9982  N N   . VAL E 3 291 ? 215.352 -77.865  29.599  1.00 151.92 ? 282 VAL E N   1 
ATOM   9983  C CA  . VAL E 3 291 ? 216.544 -77.019  29.535  1.00 153.11 ? 282 VAL E CA  1 
ATOM   9984  C C   . VAL E 3 291 ? 217.185 -76.940  30.927  1.00 153.01 ? 282 VAL E C   1 
ATOM   9985  O O   . VAL E 3 291 ? 216.499 -76.651  31.913  1.00 153.84 ? 282 VAL E O   1 
ATOM   9986  C CB  . VAL E 3 291 ? 216.205 -75.605  29.002  1.00 153.29 ? 282 VAL E CB  1 
ATOM   9987  C CG1 . VAL E 3 291 ? 217.472 -74.858  28.615  1.00 155.67 ? 282 VAL E CG1 1 
ATOM   9988  C CG2 . VAL E 3 291 ? 215.263 -75.687  27.806  1.00 151.82 ? 282 VAL E CG2 1 
ATOM   9989  N N   . ASP E 3 292 ? 218.493 -77.198  30.997  1.00 151.26 ? 283 ASP E N   1 
ATOM   9990  C CA  . ASP E 3 292 ? 219.194 -77.348  32.278  1.00 147.34 ? 283 ASP E CA  1 
ATOM   9991  C C   . ASP E 3 292 ? 220.532 -76.601  32.338  1.00 145.51 ? 283 ASP E C   1 
ATOM   9992  O O   . ASP E 3 292 ? 221.583 -77.155  32.003  1.00 143.45 ? 283 ASP E O   1 
ATOM   9993  C CB  . ASP E 3 292 ? 219.406 -78.838  32.579  1.00 146.39 ? 283 ASP E CB  1 
ATOM   9994  C CG  . ASP E 3 292 ? 219.761 -79.108  34.032  1.00 144.72 ? 283 ASP E CG  1 
ATOM   9995  O OD1 . ASP E 3 292 ? 220.252 -78.195  34.733  1.00 142.06 ? 283 ASP E OD1 1 
ATOM   9996  O OD2 . ASP E 3 292 ? 219.548 -80.257  34.474  1.00 145.17 ? 283 ASP E OD2 1 
ATOM   9997  N N   . LEU E 3 293 ? 220.481 -75.353  32.796  1.00 145.49 ? 284 LEU E N   1 
ATOM   9998  C CA  . LEU E 3 293 ? 221.669 -74.510  32.913  1.00 147.99 ? 284 LEU E CA  1 
ATOM   9999  C C   . LEU E 3 293 ? 222.507 -74.892  34.127  1.00 153.71 ? 284 LEU E C   1 
ATOM   10000 O O   . LEU E 3 293 ? 223.691 -74.553  34.203  1.00 153.67 ? 284 LEU E O   1 
ATOM   10001 C CB  . LEU E 3 293 ? 221.264 -73.042  33.021  1.00 145.57 ? 284 LEU E CB  1 
ATOM   10002 C CG  . LEU E 3 293 ? 222.130 -72.032  32.258  1.00 144.14 ? 284 LEU E CG  1 
ATOM   10003 C CD1 . LEU E 3 293 ? 221.490 -71.712  30.900  1.00 144.95 ? 284 LEU E CD1 1 
ATOM   10004 C CD2 . LEU E 3 293 ? 222.307 -70.752  33.084  1.00 143.72 ? 284 LEU E CD2 1 
ATOM   10005 N N   . ALA E 3 294 ? 221.882 -75.597  35.071  1.00 163.07 ? 285 ALA E N   1 
ATOM   10006 C CA  . ALA E 3 294 ? 222.537 -76.038  36.303  1.00 175.96 ? 285 ALA E CA  1 
ATOM   10007 C C   . ALA E 3 294 ? 223.504 -77.203  36.075  1.00 184.74 ? 285 ALA E C   1 
ATOM   10008 O O   . ALA E 3 294 ? 224.028 -77.784  37.029  1.00 186.72 ? 285 ALA E O   1 
ATOM   10009 C CB  . ALA E 3 294 ? 221.492 -76.407  37.347  1.00 176.50 ? 285 ALA E CB  1 
ATOM   10010 N N   . ALA E 3 295 ? 223.742 -77.525  34.805  1.00 195.39 ? 286 ALA E N   1 
ATOM   10011 C CA  . ALA E 3 295 ? 224.614 -78.632  34.416  1.00 206.84 ? 286 ALA E CA  1 
ATOM   10012 C C   . ALA E 3 295 ? 226.108 -78.379  34.674  1.00 213.90 ? 286 ALA E C   1 
ATOM   10013 O O   . ALA E 3 295 ? 226.886 -79.333  34.784  1.00 222.20 ? 286 ALA E O   1 
ATOM   10014 C CB  . ALA E 3 295 ? 224.378 -78.998  32.956  1.00 207.21 ? 286 ALA E CB  1 
ATOM   10015 N N   . GLU E 3 296 ? 226.505 -77.107  34.772  1.00 214.08 ? 287 GLU E N   1 
ATOM   10016 C CA  . GLU E 3 296 ? 227.911 -76.741  35.023  1.00 207.28 ? 287 GLU E CA  1 
ATOM   10017 C C   . GLU E 3 296 ? 228.384 -77.099  36.439  1.00 203.73 ? 287 GLU E C   1 
ATOM   10018 O O   . GLU E 3 296 ? 229.580 -77.020  36.743  1.00 202.09 ? 287 GLU E O   1 
ATOM   10019 C CB  . GLU E 3 296 ? 228.173 -75.253  34.711  1.00 202.70 ? 287 GLU E CB  1 
ATOM   10020 C CG  . GLU E 3 296 ? 227.500 -74.249  35.645  1.00 195.05 ? 287 GLU E CG  1 
ATOM   10021 C CD  . GLU E 3 296 ? 227.904 -72.807  35.371  1.00 188.22 ? 287 GLU E CD  1 
ATOM   10022 O OE1 . GLU E 3 296 ? 229.020 -72.576  34.859  1.00 186.38 ? 287 GLU E OE1 1 
ATOM   10023 O OE2 . GLU E 3 296 ? 227.106 -71.896  35.680  1.00 182.71 ? 287 GLU E OE2 1 
ATOM   10024 N N   . SER E 3 297 ? 227.436 -77.498  37.288  1.00 198.72 ? 288 SER E N   1 
ATOM   10025 C CA  . SER E 3 297 ? 227.719 -77.894  38.666  1.00 191.49 ? 288 SER E CA  1 
ATOM   10026 C C   . SER E 3 297 ? 226.828 -79.043  39.164  1.00 185.47 ? 288 SER E C   1 
ATOM   10027 O O   . SER E 3 297 ? 226.934 -79.453  40.322  1.00 184.30 ? 288 SER E O   1 
ATOM   10028 C CB  . SER E 3 297 ? 227.609 -76.683  39.602  1.00 192.31 ? 288 SER E CB  1 
ATOM   10029 O OG  . SER E 3 297 ? 226.314 -76.108  39.553  1.00 193.74 ? 288 SER E OG  1 
ATOM   10030 N N   . GLY E 3 298 ? 225.963 -79.563  38.291  1.00 179.78 ? 289 GLY E N   1 
ATOM   10031 C CA  . GLY E 3 298 ? 225.088 -80.682  38.650  1.00 174.26 ? 289 GLY E CA  1 
ATOM   10032 C C   . GLY E 3 298 ? 223.987 -80.983  37.647  1.00 172.00 ? 289 GLY E C   1 
ATOM   10033 O O   . GLY E 3 298 ? 224.062 -81.966  36.908  1.00 171.71 ? 289 GLY E O   1 
ATOM   10034 N N   . GLY E 3 299 ? 222.960 -80.137  37.632  1.00 171.30 ? 290 GLY E N   1 
ATOM   10035 C CA  . GLY E 3 299 ? 221.817 -80.317  36.741  1.00 172.80 ? 290 GLY E CA  1 
ATOM   10036 C C   . GLY E 3 299 ? 220.537 -80.618  37.498  1.00 175.61 ? 290 GLY E C   1 
ATOM   10037 O O   . GLY E 3 299 ? 220.499 -81.536  38.317  1.00 177.94 ? 290 GLY E O   1 
ATOM   10038 N N   . ASN E 3 300 ? 219.489 -79.844  37.214  1.00 176.59 ? 291 ASN E N   1 
ATOM   10039 C CA  . ASN E 3 300 ? 218.192 -79.978  37.891  1.00 176.56 ? 291 ASN E CA  1 
ATOM   10040 C C   . ASN E 3 300 ? 217.392 -81.219  37.496  1.00 174.61 ? 291 ASN E C   1 
ATOM   10041 O O   . ASN E 3 300 ? 216.559 -81.699  38.269  1.00 174.15 ? 291 ASN E O   1 
ATOM   10042 C CB  . ASN E 3 300 ? 217.328 -78.735  37.659  1.00 176.91 ? 291 ASN E CB  1 
ATOM   10043 C CG  . ASN E 3 300 ? 217.861 -77.503  38.369  1.00 177.23 ? 291 ASN E CG  1 
ATOM   10044 O OD1 . ASN E 3 300 ? 218.213 -76.512  37.730  1.00 177.03 ? 291 ASN E OD1 1 
ATOM   10045 N ND2 . ASN E 3 300 ? 217.911 -77.556  39.695  1.00 177.82 ? 291 ASN E ND2 1 
ATOM   10046 N N   . CYS E 3 301 ? 217.631 -81.720  36.287  1.00 171.88 ? 292 CYS E N   1 
ATOM   10047 C CA  . CYS E 3 301 ? 216.929 -82.899  35.793  1.00 168.90 ? 292 CYS E CA  1 
ATOM   10048 C C   . CYS E 3 301 ? 217.795 -84.145  35.946  1.00 172.06 ? 292 CYS E C   1 
ATOM   10049 O O   . CYS E 3 301 ? 219.005 -84.107  35.704  1.00 170.00 ? 292 CYS E O   1 
ATOM   10050 C CB  . CYS E 3 301 ? 216.509 -82.708  34.335  1.00 164.55 ? 292 CYS E CB  1 
ATOM   10051 S SG  . CYS E 3 301 ? 215.176 -83.803  33.797  1.00 156.88 ? 292 CYS E SG  1 
ATOM   10052 N N   . VAL E 3 302 ? 217.155 -85.243  36.346  1.00 177.86 ? 293 VAL E N   1 
ATOM   10053 C CA  . VAL E 3 302 ? 217.839 -86.508  36.647  1.00 183.52 ? 293 VAL E CA  1 
ATOM   10054 C C   . VAL E 3 302 ? 218.627 -87.088  35.472  1.00 183.40 ? 293 VAL E C   1 
ATOM   10055 O O   . VAL E 3 302 ? 219.687 -87.689  35.663  1.00 182.87 ? 293 VAL E O   1 
ATOM   10056 C CB  . VAL E 3 302 ? 216.861 -87.588  37.182  1.00 186.96 ? 293 VAL E CB  1 
ATOM   10057 C CG1 . VAL E 3 302 ? 216.459 -87.285  38.617  1.00 190.54 ? 293 VAL E CG1 1 
ATOM   10058 C CG2 . VAL E 3 302 ? 215.629 -87.720  36.293  1.00 186.22 ? 293 VAL E CG2 1 
ATOM   10059 N N   . LEU E 3 303 ? 218.107 -86.892  34.265  1.00 183.61 ? 294 LEU E N   1 
ATOM   10060 C CA  . LEU E 3 303 ? 218.647 -87.540  33.074  1.00 180.73 ? 294 LEU E CA  1 
ATOM   10061 C C   . LEU E 3 303 ? 219.685 -86.679  32.331  1.00 173.25 ? 294 LEU E C   1 
ATOM   10062 O O   . LEU E 3 303 ? 220.211 -87.090  31.291  1.00 175.79 ? 294 LEU E O   1 
ATOM   10063 C CB  . LEU E 3 303 ? 217.500 -87.980  32.142  1.00 184.17 ? 294 LEU E CB  1 
ATOM   10064 C CG  . LEU E 3 303 ? 216.238 -88.652  32.723  1.00 182.03 ? 294 LEU E CG  1 
ATOM   10065 C CD1 . LEU E 3 303 ? 215.166 -88.771  31.652  1.00 181.44 ? 294 LEU E CD1 1 
ATOM   10066 C CD2 . LEU E 3 303 ? 216.506 -90.015  33.354  1.00 177.80 ? 294 LEU E CD2 1 
ATOM   10067 N N   . THR E 3 304 ? 219.989 -85.502  32.878  1.00 160.70 ? 295 THR E N   1 
ATOM   10068 C CA  . THR E 3 304 ? 220.951 -84.584  32.265  1.00 149.22 ? 295 THR E CA  1 
ATOM   10069 C C   . THR E 3 304 ? 222.372 -85.147  32.308  1.00 143.83 ? 295 THR E C   1 
ATOM   10070 O O   . THR E 3 304 ? 222.890 -85.472  33.379  1.00 140.48 ? 295 THR E O   1 
ATOM   10071 C CB  . THR E 3 304 ? 220.930 -83.194  32.941  1.00 147.86 ? 295 THR E CB  1 
ATOM   10072 O OG1 . THR E 3 304 ? 219.576 -82.750  33.092  1.00 147.29 ? 295 THR E OG1 1 
ATOM   10073 C CG2 . THR E 3 304 ? 221.700 -82.173  32.107  1.00 146.89 ? 295 THR E CG2 1 
ATOM   10074 N N   . LYS E 3 305 ? 222.979 -85.280  31.131  1.00 139.54 ? 296 LYS E N   1 
ATOM   10075 C CA  . LYS E 3 305 ? 224.401 -85.591  31.009  1.00 139.00 ? 296 LYS E CA  1 
ATOM   10076 C C   . LYS E 3 305 ? 225.126 -84.364  30.442  1.00 148.38 ? 296 LYS E C   1 
ATOM   10077 O O   . LYS E 3 305 ? 224.639 -83.748  29.490  1.00 149.88 ? 296 LYS E O   1 
ATOM   10078 C CB  . LYS E 3 305 ? 224.625 -86.831  30.135  1.00 127.27 ? 296 LYS E CB  1 
ATOM   10079 C CG  . LYS E 3 305 ? 224.321 -88.150  30.835  1.00 117.12 ? 296 LYS E CG  1 
ATOM   10080 C CD  . LYS E 3 305 ? 224.628 -89.349  29.951  1.00 109.16 ? 296 LYS E CD  1 
ATOM   10081 C CE  . LYS E 3 305 ? 226.114 -89.673  29.937  1.00 105.29 ? 296 LYS E CE  1 
ATOM   10082 N NZ  . LYS E 3 305 ? 226.420 -90.779  28.990  1.00 102.11 ? 296 LYS E NZ  1 
ATOM   10083 N N   . PRO E 3 306 ? 226.287 -84.000  31.032  1.00 157.23 ? 297 PRO E N   1 
ATOM   10084 C CA  . PRO E 3 306 ? 226.976 -82.726  30.752  1.00 162.83 ? 297 PRO E CA  1 
ATOM   10085 C C   . PRO E 3 306 ? 227.485 -82.550  29.316  1.00 168.39 ? 297 PRO E C   1 
ATOM   10086 O O   . PRO E 3 306 ? 228.312 -83.335  28.844  1.00 170.43 ? 297 PRO E O   1 
ATOM   10087 C CB  . PRO E 3 306 ? 228.155 -82.737  31.738  1.00 162.17 ? 297 PRO E CB  1 
ATOM   10088 C CG  . PRO E 3 306 ? 228.383 -84.176  32.048  1.00 160.94 ? 297 PRO E CG  1 
ATOM   10089 C CD  . PRO E 3 306 ? 227.022 -84.809  32.024  1.00 159.44 ? 297 PRO E CD  1 
ATOM   10090 N N   . GLY E 3 307 ? 226.983 -81.517  28.640  1.00 173.83 ? 298 GLY E N   1 
ATOM   10091 C CA  . GLY E 3 307 ? 227.451 -81.142  27.305  1.00 182.11 ? 298 GLY E CA  1 
ATOM   10092 C C   . GLY E 3 307 ? 226.928 -81.971  26.142  1.00 190.56 ? 298 GLY E C   1 
ATOM   10093 O O   . GLY E 3 307 ? 227.405 -81.820  25.015  1.00 190.93 ? 298 GLY E O   1 
ATOM   10094 N N   . GLU E 3 308 ? 225.951 -82.840  26.411  1.00 198.97 ? 299 GLU E N   1 
ATOM   10095 C CA  . GLU E 3 308 ? 225.359 -83.720  25.386  1.00 205.53 ? 299 GLU E CA  1 
ATOM   10096 C C   . GLU E 3 308 ? 223.818 -83.650  25.359  1.00 211.19 ? 299 GLU E C   1 
ATOM   10097 O O   . GLU E 3 308 ? 223.175 -83.520  26.407  1.00 214.72 ? 299 GLU E O   1 
ATOM   10098 C CB  . GLU E 3 308 ? 225.831 -85.179  25.567  1.00 199.15 ? 299 GLU E CB  1 
ATOM   10099 C CG  . GLU E 3 308 ? 227.302 -85.441  25.229  1.00 187.71 ? 299 GLU E CG  1 
ATOM   10100 C CD  . GLU E 3 308 ? 227.684 -86.920  25.242  1.00 177.70 ? 299 GLU E CD  1 
ATOM   10101 O OE1 . GLU E 3 308 ? 228.608 -87.296  25.995  1.00 171.26 ? 299 GLU E OE1 1 
ATOM   10102 O OE2 . GLU E 3 308 ? 227.074 -87.715  24.494  1.00 172.74 ? 299 GLU E OE2 1 
ATOM   10103 N N   . VAL E 3 309 ? 223.244 -83.738  24.155  1.00 212.41 ? 300 VAL E N   1 
ATOM   10104 C CA  . VAL E 3 309 ? 221.785 -83.717  23.951  1.00 206.81 ? 300 VAL E CA  1 
ATOM   10105 C C   . VAL E 3 309 ? 221.239 -85.144  23.901  1.00 198.51 ? 300 VAL E C   1 
ATOM   10106 O O   . VAL E 3 309 ? 221.674 -85.957  23.078  1.00 195.94 ? 300 VAL E O   1 
ATOM   10107 C CB  . VAL E 3 309 ? 221.385 -82.972  22.651  1.00 210.72 ? 300 VAL E CB  1 
ATOM   10108 C CG1 . VAL E 3 309 ? 219.872 -82.957  22.472  1.00 210.81 ? 300 VAL E CG1 1 
ATOM   10109 C CG2 . VAL E 3 309 ? 221.931 -81.550  22.641  1.00 214.31 ? 300 VAL E CG2 1 
ATOM   10110 N N   . VAL E 3 310 ? 220.280 -85.440  24.776  1.00 190.14 ? 301 VAL E N   1 
ATOM   10111 C CA  . VAL E 3 310 ? 219.729 -86.793  24.894  1.00 184.54 ? 301 VAL E CA  1 
ATOM   10112 C C   . VAL E 3 310 ? 218.203 -86.843  24.743  1.00 180.03 ? 301 VAL E C   1 
ATOM   10113 O O   . VAL E 3 310 ? 217.512 -85.850  24.987  1.00 178.00 ? 301 VAL E O   1 
ATOM   10114 C CB  . VAL E 3 310 ? 220.158 -87.477  26.218  1.00 185.57 ? 301 VAL E CB  1 
ATOM   10115 C CG1 . VAL E 3 310 ? 221.604 -87.956  26.134  1.00 185.58 ? 301 VAL E CG1 1 
ATOM   10116 C CG2 . VAL E 3 310 ? 219.963 -86.547  27.411  1.00 186.23 ? 301 VAL E CG2 1 
ATOM   10117 N N   . GLU E 3 311 ? 217.697 -88.010  24.334  1.00 176.06 ? 302 GLU E N   1 
ATOM   10118 C CA  . GLU E 3 311 ? 216.258 -88.250  24.164  1.00 171.84 ? 302 GLU E CA  1 
ATOM   10119 C C   . GLU E 3 311 ? 215.849 -89.633  24.694  1.00 169.37 ? 302 GLU E C   1 
ATOM   10120 O O   . GLU E 3 311 ? 216.433 -90.650  24.306  1.00 171.30 ? 302 GLU E O   1 
ATOM   10121 C CB  . GLU E 3 311 ? 215.862 -88.113  22.686  1.00 170.31 ? 302 GLU E CB  1 
ATOM   10122 C CG  . GLU E 3 311 ? 214.374 -88.301  22.402  1.00 168.33 ? 302 GLU E CG  1 
ATOM   10123 C CD  . GLU E 3 311 ? 214.069 -88.595  20.940  1.00 166.76 ? 302 GLU E CD  1 
ATOM   10124 O OE1 . GLU E 3 311 ? 213.162 -89.415  20.676  1.00 164.45 ? 302 GLU E OE1 1 
ATOM   10125 O OE2 . GLU E 3 311 ? 214.730 -88.013  20.053  1.00 166.82 ? 302 GLU E OE2 1 
ATOM   10126 N N   . VAL E 3 312 ? 214.850 -89.658  25.579  1.00 163.64 ? 303 VAL E N   1 
ATOM   10127 C CA  . VAL E 3 312 ? 214.263 -90.909  26.098  1.00 156.02 ? 303 VAL E CA  1 
ATOM   10128 C C   . VAL E 3 312 ? 212.766 -90.730  26.401  1.00 148.84 ? 303 VAL E C   1 
ATOM   10129 O O   . VAL E 3 312 ? 212.364 -89.746  27.029  1.00 149.34 ? 303 VAL E O   1 
ATOM   10130 C CB  . VAL E 3 312 ? 215.040 -91.472  27.322  1.00 156.98 ? 303 VAL E CB  1 
ATOM   10131 C CG1 . VAL E 3 312 ? 214.995 -90.512  28.505  1.00 157.63 ? 303 VAL E CG1 1 
ATOM   10132 C CG2 . VAL E 3 312 ? 214.512 -92.846  27.722  1.00 156.35 ? 303 VAL E CG2 1 
ATOM   10133 N N   . ARG E 3 313 ? 211.955 -91.689  25.946  1.00 139.02 ? 304 ARG E N   1 
ATOM   10134 C CA  . ARG E 3 313 ? 210.488 -91.563  25.912  1.00 131.07 ? 304 ARG E CA  1 
ATOM   10135 C C   . ARG E 3 313 ? 210.026 -90.312  25.158  1.00 132.77 ? 304 ARG E C   1 
ATOM   10136 O O   . ARG E 3 313 ? 208.905 -89.841  25.355  1.00 131.25 ? 304 ARG E O   1 
ATOM   10137 C CB  . ARG E 3 313 ? 209.869 -91.597  27.318  1.00 123.74 ? 304 ARG E CB  1 
ATOM   10138 C CG  . ARG E 3 313 ? 209.484 -92.982  27.816  1.00 117.89 ? 304 ARG E CG  1 
ATOM   10139 C CD  . ARG E 3 313 ? 210.651 -93.708  28.471  1.00 114.79 ? 304 ARG E CD  1 
ATOM   10140 N NE  . ARG E 3 313 ? 211.419 -92.850  29.379  1.00 112.28 ? 304 ARG E NE  1 
ATOM   10141 C CZ  . ARG E 3 313 ? 211.012 -92.458  30.585  1.00 110.74 ? 304 ARG E CZ  1 
ATOM   10142 N NH1 . ARG E 3 313 ? 211.793 -91.681  31.326  1.00 108.70 ? 304 ARG E NH1 1 
ATOM   10143 N NH2 . ARG E 3 313 ? 209.826 -92.831  31.049  1.00 110.39 ? 304 ARG E NH2 1 
ATOM   10144 N N   . GLY E 3 314 ? 210.901 -89.784  24.302  1.00 136.12 ? 305 GLY E N   1 
ATOM   10145 C CA  . GLY E 3 314 ? 210.598 -88.608  23.487  1.00 140.72 ? 305 GLY E CA  1 
ATOM   10146 C C   . GLY E 3 314 ? 211.064 -87.278  24.058  1.00 144.31 ? 305 GLY E C   1 
ATOM   10147 O O   . GLY E 3 314 ? 211.221 -86.304  23.318  1.00 144.77 ? 305 GLY E O   1 
ATOM   10148 N N   . VAL E 3 315 ? 211.286 -87.235  25.371  1.00 147.92 ? 306 VAL E N   1 
ATOM   10149 C CA  . VAL E 3 315 ? 211.651 -85.994  26.060  1.00 151.40 ? 306 VAL E CA  1 
ATOM   10150 C C   . VAL E 3 315 ? 213.119 -85.636  25.825  1.00 153.11 ? 306 VAL E C   1 
ATOM   10151 O O   . VAL E 3 315 ? 214.018 -86.427  26.120  1.00 153.08 ? 306 VAL E O   1 
ATOM   10152 C CB  . VAL E 3 315 ? 211.365 -86.067  27.579  1.00 152.72 ? 306 VAL E CB  1 
ATOM   10153 C CG1 . VAL E 3 315 ? 211.416 -84.678  28.201  1.00 152.65 ? 306 VAL E CG1 1 
ATOM   10154 C CG2 . VAL E 3 315 ? 210.013 -86.715  27.849  1.00 154.07 ? 306 VAL E CG2 1 
ATOM   10155 N N   . ARG E 3 316 ? 213.347 -84.439  25.289  1.00 156.95 ? 307 ARG E N   1 
ATOM   10156 C CA  . ARG E 3 316 ? 214.697 -83.961  24.996  1.00 160.09 ? 307 ARG E CA  1 
ATOM   10157 C C   . ARG E 3 316 ? 215.261 -83.149  26.163  1.00 154.81 ? 307 ARG E C   1 
ATOM   10158 O O   . ARG E 3 316 ? 214.627 -82.203  26.637  1.00 155.12 ? 307 ARG E O   1 
ATOM   10159 C CB  . ARG E 3 316 ? 214.711 -83.152  23.690  1.00 170.93 ? 307 ARG E CB  1 
ATOM   10160 C CG  . ARG E 3 316 ? 214.625 -84.008  22.429  1.00 179.54 ? 307 ARG E CG  1 
ATOM   10161 C CD  . ARG E 3 316 ? 214.468 -83.180  21.158  1.00 187.38 ? 307 ARG E CD  1 
ATOM   10162 N NE  . ARG E 3 316 ? 213.068 -82.875  20.851  1.00 191.19 ? 307 ARG E NE  1 
ATOM   10163 C CZ  . ARG E 3 316 ? 212.630 -82.392  19.688  1.00 191.71 ? 307 ARG E CZ  1 
ATOM   10164 N NH1 . ARG E 3 316 ? 213.474 -82.150  18.691  1.00 189.77 ? 307 ARG E NH1 1 
ATOM   10165 N NH2 . ARG E 3 316 ? 211.336 -82.152  19.519  1.00 192.16 ? 307 ARG E NH2 1 
ATOM   10166 N N   . VAL E 3 317 ? 216.445 -83.541  26.632  1.00 147.85 ? 308 VAL E N   1 
ATOM   10167 C CA  . VAL E 3 317 ? 217.102 -82.880  27.763  1.00 142.65 ? 308 VAL E CA  1 
ATOM   10168 C C   . VAL E 3 317 ? 218.489 -82.374  27.360  1.00 140.70 ? 308 VAL E C   1 
ATOM   10169 O O   . VAL E 3 317 ? 219.325 -83.138  26.872  1.00 137.84 ? 308 VAL E O   1 
ATOM   10170 C CB  . VAL E 3 317 ? 217.212 -83.808  28.997  1.00 141.65 ? 308 VAL E CB  1 
ATOM   10171 C CG1 . VAL E 3 317 ? 217.796 -83.060  30.188  1.00 140.88 ? 308 VAL E CG1 1 
ATOM   10172 C CG2 . VAL E 3 317 ? 215.853 -84.392  29.364  1.00 141.50 ? 308 VAL E CG2 1 
ATOM   10173 N N   . TYR E 3 318 ? 218.716 -81.080  27.576  1.00 141.30 ? 309 TYR E N   1 
ATOM   10174 C CA  . TYR E 3 318 ? 219.954 -80.411  27.184  1.00 143.25 ? 309 TYR E CA  1 
ATOM   10175 C C   . TYR E 3 318 ? 220.635 -79.786  28.402  1.00 139.02 ? 309 TYR E C   1 
ATOM   10176 O O   . TYR E 3 318 ? 219.977 -79.157  29.233  1.00 139.84 ? 309 TYR E O   1 
ATOM   10177 C CB  . TYR E 3 318 ? 219.646 -79.353  26.109  1.00 150.57 ? 309 TYR E CB  1 
ATOM   10178 C CG  . TYR E 3 318 ? 220.830 -78.568  25.561  1.00 158.71 ? 309 TYR E CG  1 
ATOM   10179 C CD1 . TYR E 3 318 ? 222.065 -79.179  25.327  1.00 162.35 ? 309 TYR E CD1 1 
ATOM   10180 C CD2 . TYR E 3 318 ? 220.697 -77.216  25.237  1.00 162.15 ? 309 TYR E CD2 1 
ATOM   10181 C CE1 . TYR E 3 318 ? 223.138 -78.460  24.817  1.00 166.56 ? 309 TYR E CE1 1 
ATOM   10182 C CE2 . TYR E 3 318 ? 221.764 -76.490  24.723  1.00 166.02 ? 309 TYR E CE2 1 
ATOM   10183 C CZ  . TYR E 3 318 ? 222.982 -77.115  24.514  1.00 167.24 ? 309 TYR E CZ  1 
ATOM   10184 O OH  . TYR E 3 318 ? 224.046 -76.402  24.004  1.00 168.23 ? 309 TYR E OH  1 
ATOM   10185 N N   . GLY E 3 319 ? 221.949 -79.976  28.507  1.00 133.82 ? 310 GLY E N   1 
ATOM   10186 C CA  . GLY E 3 319 ? 222.733 -79.426  29.614  1.00 128.55 ? 310 GLY E CA  1 
ATOM   10187 C C   . GLY E 3 319 ? 224.019 -78.749  29.164  1.00 125.29 ? 310 GLY E C   1 
ATOM   10188 O O   . GLY E 3 319 ? 225.016 -79.428  28.911  1.00 124.22 ? 310 GLY E O   1 
ATOM   10189 N N   . PRO E 3 320 ? 224.005 -77.403  29.057  1.00 123.42 ? 311 PRO E N   1 
ATOM   10190 C CA  . PRO E 3 320 ? 225.166 -76.622  28.619  1.00 121.00 ? 311 PRO E CA  1 
ATOM   10191 C C   . PRO E 3 320 ? 226.030 -76.040  29.754  1.00 117.14 ? 311 PRO E C   1 
ATOM   10192 O O   . PRO E 3 320 ? 225.514 -75.363  30.650  1.00 117.69 ? 311 PRO E O   1 
ATOM   10193 C CB  . PRO E 3 320 ? 224.529 -75.497  27.797  1.00 122.52 ? 311 PRO E CB  1 
ATOM   10194 C CG  . PRO E 3 320 ? 223.142 -75.348  28.344  1.00 123.63 ? 311 PRO E CG  1 
ATOM   10195 C CD  . PRO E 3 320 ? 222.799 -76.562  29.166  1.00 123.74 ? 311 PRO E CD  1 
ATOM   10196 N N   . LEU E 3 321 ? 227.338 -76.304  29.690  1.00 111.02 ? 312 LEU E N   1 
ATOM   10197 C CA  . LEU E 3 321 ? 228.318 -75.807  30.673  1.00 104.11 ? 312 LEU E CA  1 
ATOM   10198 C C   . LEU E 3 321 ? 228.599 -74.312  30.531  1.00 99.56  ? 312 LEU E C   1 
ATOM   10199 O O   . LEU E 3 321 ? 228.518 -73.561  31.508  1.00 98.77  ? 312 LEU E O   1 
ATOM   10200 C CB  . LEU E 3 321 ? 229.642 -76.590  30.575  1.00 102.93 ? 312 LEU E CB  1 
ATOM   10201 C CG  . LEU E 3 321 ? 230.053 -77.603  31.659  1.00 101.40 ? 312 LEU E CG  1 
ATOM   10202 C CD1 . LEU E 3 321 ? 230.793 -78.784  31.043  1.00 100.91 ? 312 LEU E CD1 1 
ATOM   10203 C CD2 . LEU E 3 321 ? 230.923 -76.947  32.727  1.00 99.21  ? 312 LEU E CD2 1 
ATOM   10204 N N   . ASN E 3 322 ? 228.935 -73.888  29.314  1.00 94.22  ? 313 ASN E N   1 
ATOM   10205 C CA  . ASN E 3 322 ? 229.340 -72.511  29.074  1.00 89.26  ? 313 ASN E CA  1 
ATOM   10206 C C   . ASN E 3 322 ? 228.529 -71.826  27.979  1.00 88.53  ? 313 ASN E C   1 
ATOM   10207 O O   . ASN E 3 322 ? 228.848 -71.920  26.789  1.00 88.25  ? 313 ASN E O   1 
ATOM   10208 C CB  . ASN E 3 322 ? 230.836 -72.444  28.771  1.00 86.39  ? 313 ASN E CB  1 
ATOM   10209 C CG  . ASN E 3 322 ? 231.495 -71.221  29.370  1.00 84.30  ? 313 ASN E CG  1 
ATOM   10210 O OD1 . ASN E 3 322 ? 231.120 -70.085  29.076  1.00 82.96  ? 313 ASN E OD1 1 
ATOM   10211 N ND2 . ASN E 3 322 ? 232.493 -71.449  30.212  1.00 83.65  ? 313 ASN E ND2 1 
ATOM   10212 N N   . LEU E 3 323 ? 227.470 -71.144  28.410  1.00 87.75  ? 314 LEU E N   1 
ATOM   10213 C CA  . LEU E 3 323 ? 226.617 -70.348  27.531  1.00 87.26  ? 314 LEU E CA  1 
ATOM   10214 C C   . LEU E 3 323 ? 227.277 -69.029  27.122  1.00 87.14  ? 314 LEU E C   1 
ATOM   10215 O O   . LEU E 3 323 ? 227.152 -68.619  25.964  1.00 87.76  ? 314 LEU E O   1 
ATOM   10216 C CB  . LEU E 3 323 ? 225.266 -70.057  28.199  1.00 86.49  ? 314 LEU E CB  1 
ATOM   10217 C CG  . LEU E 3 323 ? 224.266 -71.167  28.548  1.00 85.83  ? 314 LEU E CG  1 
ATOM   10218 C CD1 . LEU E 3 323 ? 223.770 -71.869  27.292  1.00 85.96  ? 314 LEU E CD1 1 
ATOM   10219 C CD2 . LEU E 3 323 ? 224.824 -72.161  29.561  1.00 85.39  ? 314 LEU E CD2 1 
ATOM   10220 N N   . PRO E 3 324 ? 227.976 -68.353  28.066  1.00 86.47  ? 315 PRO E N   1 
ATOM   10221 C CA  . PRO E 3 324 ? 228.647 -67.098  27.710  1.00 85.58  ? 315 PRO E CA  1 
ATOM   10222 C C   . PRO E 3 324 ? 229.675 -67.279  26.597  1.00 84.83  ? 315 PRO E C   1 
ATOM   10223 O O   . PRO E 3 324 ? 230.030 -66.312  25.925  1.00 83.46  ? 315 PRO E O   1 
ATOM   10224 C CB  . PRO E 3 324 ? 229.349 -66.694  29.007  1.00 86.03  ? 315 PRO E CB  1 
ATOM   10225 C CG  . PRO E 3 324 ? 228.575 -67.361  30.087  1.00 86.42  ? 315 PRO E CG  1 
ATOM   10226 C CD  . PRO E 3 324 ? 228.143 -68.667  29.499  1.00 86.44  ? 315 PRO E CD  1 
ATOM   10227 N N   . SER E 3 325 ? 230.136 -68.515  26.416  1.00 85.27  ? 316 SER E N   1 
ATOM   10228 C CA  . SER E 3 325 ? 231.062 -68.870  25.345  1.00 86.16  ? 316 SER E CA  1 
ATOM   10229 C C   . SER E 3 325 ? 230.417 -68.798  23.959  1.00 86.73  ? 316 SER E C   1 
ATOM   10230 O O   . SER E 3 325 ? 231.072 -68.425  22.986  1.00 88.00  ? 316 SER E O   1 
ATOM   10231 C CB  . SER E 3 325 ? 231.627 -70.271  25.584  1.00 86.20  ? 316 SER E CB  1 
ATOM   10232 O OG  . SER E 3 325 ? 232.434 -70.295  26.745  1.00 85.67  ? 316 SER E OG  1 
ATOM   10233 N N   . GLU E 3 326 ? 229.139 -69.161  23.875  1.00 86.24  ? 317 GLU E N   1 
ATOM   10234 C CA  . GLU E 3 326 ? 228.407 -69.157  22.603  1.00 85.01  ? 317 GLU E CA  1 
ATOM   10235 C C   . GLU E 3 326 ? 227.996 -67.749  22.186  1.00 84.68  ? 317 GLU E C   1 
ATOM   10236 O O   . GLU E 3 326 ? 227.902 -67.445  20.994  1.00 84.62  ? 317 GLU E O   1 
ATOM   10237 C CB  . GLU E 3 326 ? 227.178 -70.062  22.685  1.00 83.69  ? 317 GLU E CB  1 
ATOM   10238 C CG  . GLU E 3 326 ? 227.511 -71.541  22.820  1.00 81.88  ? 317 GLU E CG  1 
ATOM   10239 C CD  . GLU E 3 326 ? 226.322 -72.381  23.248  1.00 80.46  ? 317 GLU E CD  1 
ATOM   10240 O OE1 . GLU E 3 326 ? 225.167 -71.936  23.062  1.00 79.91  ? 317 GLU E OE1 1 
ATOM   10241 O OE2 . GLU E 3 326 ? 226.548 -73.495  23.767  1.00 79.24  ? 317 GLU E OE2 1 
ATOM   10242 N N   . LEU E 3 327 ? 227.738 -66.904  23.181  1.00 84.16  ? 318 LEU E N   1 
ATOM   10243 C CA  . LEU E 3 327 ? 227.480 -65.494  22.954  1.00 84.31  ? 318 LEU E CA  1 
ATOM   10244 C C   . LEU E 3 327 ? 228.695 -64.722  23.457  1.00 86.38  ? 318 LEU E C   1 
ATOM   10245 O O   . LEU E 3 327 ? 228.576 -63.791  24.254  1.00 85.11  ? 318 LEU E O   1 
ATOM   10246 C CB  . LEU E 3 327 ? 226.214 -65.071  23.695  1.00 82.68  ? 318 LEU E CB  1 
ATOM   10247 C CG  . LEU E 3 327 ? 225.230 -64.175  22.948  1.00 82.13  ? 318 LEU E CG  1 
ATOM   10248 C CD1 . LEU E 3 327 ? 224.377 -64.998  21.998  1.00 81.80  ? 318 LEU E CD1 1 
ATOM   10249 C CD2 . LEU E 3 327 ? 224.346 -63.435  23.934  1.00 81.98  ? 318 LEU E CD2 1 
ATOM   10250 N N   . SER E 3 328 ? 229.864 -65.127  22.966  1.00 91.05  ? 319 SER E N   1 
ATOM   10251 C CA  . SER E 3 328 ? 231.157 -64.679  23.484  1.00 97.10  ? 319 SER E CA  1 
ATOM   10252 C C   . SER E 3 328 ? 231.461 -63.200  23.293  1.00 103.65 ? 319 SER E C   1 
ATOM   10253 O O   . SER E 3 328 ? 232.222 -62.624  24.068  1.00 104.09 ? 319 SER E O   1 
ATOM   10254 C CB  . SER E 3 328 ? 232.282 -65.509  22.867  1.00 96.26  ? 319 SER E CB  1 
ATOM   10255 O OG  . SER E 3 328 ? 232.266 -65.421  21.454  1.00 95.82  ? 319 SER E OG  1 
ATOM   10256 N N   . VAL E 3 329 ? 230.875 -62.593  22.264  1.00 114.13 ? 320 VAL E N   1 
ATOM   10257 C CA  . VAL E 3 329 ? 231.159 -61.196  21.924  1.00 126.02 ? 320 VAL E CA  1 
ATOM   10258 C C   . VAL E 3 329 ? 230.678 -60.233  23.012  1.00 134.33 ? 320 VAL E C   1 
ATOM   10259 O O   . VAL E 3 329 ? 231.473 -59.463  23.558  1.00 135.45 ? 320 VAL E O   1 
ATOM   10260 C CB  . VAL E 3 329 ? 230.558 -60.798  20.554  1.00 127.40 ? 320 VAL E CB  1 
ATOM   10261 C CG1 . VAL E 3 329 ? 230.905 -59.356  20.204  1.00 128.47 ? 320 VAL E CG1 1 
ATOM   10262 C CG2 . VAL E 3 329 ? 231.044 -61.736  19.459  1.00 128.54 ? 320 VAL E CG2 1 
ATOM   10263 N N   . HIS E 3 330 ? 229.384 -60.288  23.322  1.00 146.04 ? 321 HIS E N   1 
ATOM   10264 C CA  . HIS E 3 330 ? 228.786 -59.390  24.311  1.00 156.59 ? 321 HIS E CA  1 
ATOM   10265 C C   . HIS E 3 330 ? 229.119 -59.775  25.753  1.00 159.43 ? 321 HIS E C   1 
ATOM   10266 O O   . HIS E 3 330 ? 229.274 -58.901  26.610  1.00 159.81 ? 321 HIS E O   1 
ATOM   10267 C CB  . HIS E 3 330 ? 227.266 -59.287  24.117  1.00 163.28 ? 321 HIS E CB  1 
ATOM   10268 C CG  . HIS E 3 330 ? 226.854 -58.331  23.039  1.00 168.61 ? 321 HIS E CG  1 
ATOM   10269 N ND1 . HIS E 3 330 ? 225.910 -58.645  22.084  1.00 170.78 ? 321 HIS E ND1 1 
ATOM   10270 C CD2 . HIS E 3 330 ? 227.259 -57.068  22.763  1.00 171.95 ? 321 HIS E CD2 1 
ATOM   10271 C CE1 . HIS E 3 330 ? 225.749 -57.617  21.270  1.00 172.57 ? 321 HIS E CE1 1 
ATOM   10272 N NE2 . HIS E 3 330 ? 226.558 -56.648  21.659  1.00 173.97 ? 321 HIS E NE2 1 
ATOM   10273 N N   . ALA E 3 331 ? 229.231 -61.079  26.008  1.00 162.16 ? 322 ALA E N   1 
ATOM   10274 C CA  . ALA E 3 331 ? 229.537 -61.600  27.343  1.00 163.92 ? 322 ALA E CA  1 
ATOM   10275 C C   . ALA E 3 331 ? 230.891 -61.109  27.856  1.00 164.49 ? 322 ALA E C   1 
ATOM   10276 O O   . ALA E 3 331 ? 231.007 -60.686  29.009  1.00 162.53 ? 322 ALA E O   1 
ATOM   10277 C CB  . ALA E 3 331 ? 229.482 -63.122  27.347  1.00 163.77 ? 322 ALA E CB  1 
ATOM   10278 N N   . SER E 3 332 ? 231.901 -61.166  26.986  1.00 166.50 ? 323 SER E N   1 
ATOM   10279 C CA  . SER E 3 332 ? 233.243 -60.672  27.295  1.00 167.05 ? 323 SER E CA  1 
ATOM   10280 C C   . SER E 3 332 ? 233.220 -59.165  27.531  1.00 163.64 ? 323 SER E C   1 
ATOM   10281 O O   . SER E 3 332 ? 233.848 -58.665  28.468  1.00 162.99 ? 323 SER E O   1 
ATOM   10282 C CB  . SER E 3 332 ? 234.217 -61.004  26.157  1.00 170.26 ? 323 SER E CB  1 
ATOM   10283 O OG  . SER E 3 332 ? 234.196 -62.385  25.836  1.00 173.81 ? 323 SER E OG  1 
ATOM   10284 N N   . GLU E 3 333 ? 232.484 -58.458  26.674  1.00 159.85 ? 324 GLU E N   1 
ATOM   10285 C CA  . GLU E 3 333 ? 232.317 -57.009  26.764  1.00 156.29 ? 324 GLU E CA  1 
ATOM   10286 C C   . GLU E 3 333 ? 231.676 -56.608  28.094  1.00 153.44 ? 324 GLU E C   1 
ATOM   10287 O O   . GLU E 3 333 ? 232.081 -55.620  28.712  1.00 153.98 ? 324 GLU E O   1 
ATOM   10288 C CB  . GLU E 3 333 ? 231.485 -56.499  25.581  1.00 156.22 ? 324 GLU E CB  1 
ATOM   10289 C CG  . GLU E 3 333 ? 231.431 -54.985  25.442  1.00 156.29 ? 324 GLU E CG  1 
ATOM   10290 C CD  . GLU E 3 333 ? 230.737 -54.536  24.169  1.00 156.13 ? 324 GLU E CD  1 
ATOM   10291 O OE1 . GLU E 3 333 ? 229.633 -53.957  24.266  1.00 157.09 ? 324 GLU E OE1 1 
ATOM   10292 O OE2 . GLU E 3 333 ? 231.293 -54.762  23.071  1.00 154.71 ? 324 GLU E OE2 1 
ATOM   10293 N N   . MET E 3 334 ? 230.685 -57.386  28.527  1.00 149.99 ? 325 MET E N   1 
ATOM   10294 C CA  . MET E 3 334 ? 230.024 -57.171  29.814  1.00 147.94 ? 325 MET E CA  1 
ATOM   10295 C C   . MET E 3 334 ? 230.924 -57.563  30.983  1.00 144.57 ? 325 MET E C   1 
ATOM   10296 O O   . MET E 3 334 ? 230.785 -57.035  32.086  1.00 144.61 ? 325 MET E O   1 
ATOM   10297 C CB  . MET E 3 334 ? 228.710 -57.952  29.884  1.00 150.64 ? 325 MET E CB  1 
ATOM   10298 C CG  . MET E 3 334 ? 227.587 -57.359  29.046  1.00 153.71 ? 325 MET E CG  1 
ATOM   10299 S SD  . MET E 3 334 ? 226.054 -58.306  29.135  1.00 157.49 ? 325 MET E SD  1 
ATOM   10300 C CE  . MET E 3 334 ? 225.427 -57.822  30.743  1.00 156.67 ? 325 MET E CE  1 
ATOM   10301 N N   . TYR E 3 335 ? 231.844 -58.488  30.730  1.00 140.95 ? 326 TYR E N   1 
ATOM   10302 C CA  . TYR E 3 335 ? 232.768 -58.964  31.751  1.00 139.97 ? 326 TYR E CA  1 
ATOM   10303 C C   . TYR E 3 335 ? 233.944 -58.011  31.970  1.00 136.20 ? 326 TYR E C   1 
ATOM   10304 O O   . TYR E 3 335 ? 234.465 -57.907  33.083  1.00 135.99 ? 326 TYR E O   1 
ATOM   10305 C CB  . TYR E 3 335 ? 233.276 -60.361  31.389  1.00 144.44 ? 326 TYR E CB  1 
ATOM   10306 C CG  . TYR E 3 335 ? 234.170 -60.980  32.434  1.00 150.34 ? 326 TYR E CG  1 
ATOM   10307 C CD1 . TYR E 3 335 ? 233.637 -61.521  33.602  1.00 153.71 ? 326 TYR E CD1 1 
ATOM   10308 C CD2 . TYR E 3 335 ? 235.552 -61.025  32.257  1.00 152.46 ? 326 TYR E CD2 1 
ATOM   10309 C CE1 . TYR E 3 335 ? 234.455 -62.089  34.566  1.00 158.32 ? 326 TYR E CE1 1 
ATOM   10310 C CE2 . TYR E 3 335 ? 236.379 -61.592  33.213  1.00 156.29 ? 326 TYR E CE2 1 
ATOM   10311 C CZ  . TYR E 3 335 ? 235.826 -62.122  34.365  1.00 158.99 ? 326 TYR E CZ  1 
ATOM   10312 O OH  . TYR E 3 335 ? 236.640 -62.685  35.319  1.00 162.56 ? 326 TYR E OH  1 
ATOM   10313 N N   . ALA E 3 336 ? 234.356 -57.322  30.907  1.00 132.06 ? 327 ALA E N   1 
ATOM   10314 C CA  . ALA E 3 336 ? 235.512 -56.424  30.955  1.00 127.84 ? 327 ALA E CA  1 
ATOM   10315 C C   . ALA E 3 336 ? 235.248 -55.138  31.740  1.00 123.63 ? 327 ALA E C   1 
ATOM   10316 O O   . ALA E 3 336 ? 236.129 -54.648  32.451  1.00 122.82 ? 327 ALA E O   1 
ATOM   10317 C CB  . ALA E 3 336 ? 235.993 -56.104  29.549  1.00 129.57 ? 327 ALA E CB  1 
ATOM   10318 N N   . LYS E 3 337 ? 234.040 -54.594  31.602  1.00 118.57 ? 328 LYS E N   1 
ATOM   10319 C CA  . LYS E 3 337 ? 233.633 -53.408  32.356  1.00 114.55 ? 328 LYS E CA  1 
ATOM   10320 C C   . LYS E 3 337 ? 233.373 -53.726  33.828  1.00 113.79 ? 328 LYS E C   1 
ATOM   10321 O O   . LYS E 3 337 ? 233.546 -52.861  34.690  1.00 113.41 ? 328 LYS E O   1 
ATOM   10322 C CB  . LYS E 3 337 ? 232.408 -52.746  31.725  1.00 112.78 ? 328 LYS E CB  1 
ATOM   10323 C CG  . LYS E 3 337 ? 232.730 -51.843  30.546  1.00 110.47 ? 328 LYS E CG  1 
ATOM   10324 C CD  . LYS E 3 337 ? 231.461 -51.372  29.855  1.00 109.74 ? 328 LYS E CD  1 
ATOM   10325 C CE  . LYS E 3 337 ? 231.771 -50.475  28.667  1.00 108.87 ? 328 LYS E CE  1 
ATOM   10326 N NZ  . LYS E 3 337 ? 232.255 -49.133  29.096  1.00 108.25 ? 328 LYS E NZ  1 
ATOM   10327 N N   . ASN E 3 338 ? 232.951 -54.963  34.105  1.00 113.04 ? 329 ASN E N   1 
ATOM   10328 C CA  . ASN E 3 338 ? 232.841 -55.470  35.476  1.00 111.75 ? 329 ASN E CA  1 
ATOM   10329 C C   . ASN E 3 338 ? 234.190 -55.390  36.176  1.00 110.41 ? 329 ASN E C   1 
ATOM   10330 O O   . ASN E 3 338 ? 234.270 -55.062  37.360  1.00 108.39 ? 329 ASN E O   1 
ATOM   10331 C CB  . ASN E 3 338 ? 232.342 -56.920  35.494  1.00 112.46 ? 329 ASN E CB  1 
ATOM   10332 C CG  . ASN E 3 338 ? 230.834 -57.034  35.334  1.00 113.06 ? 329 ASN E CG  1 
ATOM   10333 O OD1 . ASN E 3 338 ? 230.334 -58.029  34.809  1.00 113.28 ? 329 ASN E OD1 1 
ATOM   10334 N ND2 . ASN E 3 338 ? 230.102 -56.023  35.794  1.00 113.34 ? 329 ASN E ND2 1 
ATOM   10335 N N   . LEU E 3 339 ? 235.241 -55.699  35.421  1.00 110.59 ? 330 LEU E N   1 
ATOM   10336 C CA  . LEU E 3 339 ? 236.611 -55.562  35.886  1.00 111.71 ? 330 LEU E CA  1 
ATOM   10337 C C   . LEU E 3 339 ? 237.039 -54.102  35.901  1.00 114.53 ? 330 LEU E C   1 
ATOM   10338 O O   . LEU E 3 339 ? 237.827 -53.703  36.756  1.00 112.90 ? 330 LEU E O   1 
ATOM   10339 C CB  . LEU E 3 339 ? 237.563 -56.370  35.000  1.00 110.71 ? 330 LEU E CB  1 
ATOM   10340 C CG  . LEU E 3 339 ? 237.472 -57.897  35.045  1.00 110.33 ? 330 LEU E CG  1 
ATOM   10341 C CD1 . LEU E 3 339 ? 238.218 -58.512  33.872  1.00 109.61 ? 330 LEU E CD1 1 
ATOM   10342 C CD2 . LEU E 3 339 ? 238.007 -58.439  36.362  1.00 110.86 ? 330 LEU E CD2 1 
ATOM   10343 N N   . TYR E 3 340 ? 236.523 -53.313  34.954  1.00 120.37 ? 331 TYR E N   1 
ATOM   10344 C CA  . TYR E 3 340 ? 236.880 -51.892  34.843  1.00 127.23 ? 331 TYR E CA  1 
ATOM   10345 C C   . TYR E 3 340 ? 236.330 -51.055  35.993  1.00 126.58 ? 331 TYR E C   1 
ATOM   10346 O O   . TYR E 3 340 ? 237.032 -50.201  36.539  1.00 127.03 ? 331 TYR E O   1 
ATOM   10347 C CB  . TYR E 3 340 ? 236.436 -51.287  33.503  1.00 133.40 ? 331 TYR E CB  1 
ATOM   10348 C CG  . TYR E 3 340 ? 236.834 -49.829  33.358  1.00 140.23 ? 331 TYR E CG  1 
ATOM   10349 C CD1 . TYR E 3 340 ? 238.126 -49.476  32.970  1.00 142.88 ? 331 TYR E CD1 1 
ATOM   10350 C CD2 . TYR E 3 340 ? 235.928 -48.802  33.633  1.00 142.76 ? 331 TYR E CD2 1 
ATOM   10351 C CE1 . TYR E 3 340 ? 238.504 -48.146  32.849  1.00 145.07 ? 331 TYR E CE1 1 
ATOM   10352 C CE2 . TYR E 3 340 ? 236.298 -47.468  33.516  1.00 145.24 ? 331 TYR E CE2 1 
ATOM   10353 C CZ  . TYR E 3 340 ? 237.587 -47.146  33.123  1.00 145.69 ? 331 TYR E CZ  1 
ATOM   10354 O OH  . TYR E 3 340 ? 237.967 -45.828  33.000  1.00 145.83 ? 331 TYR E OH  1 
ATOM   10355 N N   . ASN E 3 341 ? 235.067 -51.282  36.342  1.00 125.28 ? 332 ASN E N   1 
ATOM   10356 C CA  . ASN E 3 341 ? 234.485 -50.641  37.514  1.00 123.82 ? 332 ASN E CA  1 
ATOM   10357 C C   . ASN E 3 341 ? 235.071 -51.228  38.798  1.00 123.83 ? 332 ASN E C   1 
ATOM   10358 O O   . ASN E 3 341 ? 235.002 -50.603  39.857  1.00 126.15 ? 332 ASN E O   1 
ATOM   10359 C CB  . ASN E 3 341 ? 232.956 -50.736  37.496  1.00 121.95 ? 332 ASN E CB  1 
ATOM   10360 C CG  . ASN E 3 341 ? 232.318 -49.722  36.560  1.00 119.94 ? 332 ASN E CG  1 
ATOM   10361 O OD1 . ASN E 3 341 ? 232.599 -48.522  36.634  1.00 117.61 ? 332 ASN E OD1 1 
ATOM   10362 N ND2 . ASN E 3 341 ? 231.442 -50.199  35.684  1.00 119.72 ? 332 ASN E ND2 1 
ATOM   10363 N N   . LEU E 3 342 ? 235.657 -52.422  38.686  1.00 121.05 ? 333 LEU E N   1 
ATOM   10364 C CA  . LEU E 3 342 ? 236.395 -53.047  39.783  1.00 117.89 ? 333 LEU E CA  1 
ATOM   10365 C C   . LEU E 3 342 ? 237.862 -52.615  39.765  1.00 118.76 ? 333 LEU E C   1 
ATOM   10366 O O   . LEU E 3 342 ? 238.585 -52.805  40.746  1.00 116.53 ? 333 LEU E O   1 
ATOM   10367 C CB  . LEU E 3 342 ? 236.307 -54.571  39.700  1.00 114.56 ? 333 LEU E CB  1 
ATOM   10368 C CG  . LEU E 3 342 ? 236.115 -55.413  40.968  1.00 113.17 ? 333 LEU E CG  1 
ATOM   10369 C CD1 . LEU E 3 342 ? 236.866 -56.720  40.795  1.00 113.50 ? 333 LEU E CD1 1 
ATOM   10370 C CD2 . LEU E 3 342 ? 236.555 -54.732  42.258  1.00 112.60 ? 333 LEU E CD2 1 
ATOM   10371 N N   . SER E 3 343 ? 238.298 -52.045  38.641  1.00 122.32 ? 334 SER E N   1 
ATOM   10372 C CA  . SER E 3 343 ? 239.625 -51.438  38.541  1.00 127.19 ? 334 SER E CA  1 
ATOM   10373 C C   . SER E 3 343 ? 239.623 -50.105  39.282  1.00 131.93 ? 334 SER E C   1 
ATOM   10374 O O   . SER E 3 343 ? 240.674 -49.512  39.523  1.00 133.52 ? 334 SER E O   1 
ATOM   10375 C CB  . SER E 3 343 ? 240.037 -51.234  37.080  1.00 126.51 ? 334 SER E CB  1 
ATOM   10376 O OG  . SER E 3 343 ? 239.566 -49.994  36.572  1.00 125.09 ? 334 SER E OG  1 
ATOM   10377 N N   . SER E 3 344 ? 238.421 -49.644  39.626  1.00 137.57 ? 335 SER E N   1 
ATOM   10378 C CA  . SER E 3 344 ? 238.221 -48.477  40.480  1.00 143.08 ? 335 SER E CA  1 
ATOM   10379 C C   . SER E 3 344 ? 238.533 -48.815  41.948  1.00 148.61 ? 335 SER E C   1 
ATOM   10380 O O   . SER E 3 344 ? 238.356 -47.976  42.837  1.00 150.83 ? 335 SER E O   1 
ATOM   10381 C CB  . SER E 3 344 ? 236.779 -47.968  40.327  1.00 140.81 ? 335 SER E CB  1 
ATOM   10382 O OG  . SER E 3 344 ? 236.489 -46.896  41.207  1.00 138.27 ? 335 SER E OG  1 
ATOM   10383 N N   . LEU E 3 345 ? 239.000 -50.044  42.185  1.00 152.98 ? 336 LEU E N   1 
ATOM   10384 C CA  . LEU E 3 345 ? 239.333 -50.538  43.527  1.00 155.39 ? 336 LEU E CA  1 
ATOM   10385 C C   . LEU E 3 345 ? 240.743 -51.136  43.608  1.00 156.98 ? 336 LEU E C   1 
ATOM   10386 O O   . LEU E 3 345 ? 241.141 -51.675  44.646  1.00 154.04 ? 336 LEU E O   1 
ATOM   10387 C CB  . LEU E 3 345 ? 238.303 -51.582  43.976  1.00 155.94 ? 336 LEU E CB  1 
ATOM   10388 C CG  . LEU E 3 345 ? 237.074 -51.159  44.790  1.00 157.13 ? 336 LEU E CG  1 
ATOM   10389 C CD1 . LEU E 3 345 ? 236.134 -50.229  44.029  1.00 158.52 ? 336 LEU E CD1 1 
ATOM   10390 C CD2 . LEU E 3 345 ? 236.322 -52.401  45.241  1.00 156.94 ? 336 LEU E CD2 1 
ATOM   10391 N N   . LEU E 3 346 ? 241.487 -51.043  42.508  1.00 162.20 ? 337 LEU E N   1 
ATOM   10392 C CA  . LEU E 3 346 ? 242.832 -51.613  42.419  1.00 168.89 ? 337 LEU E CA  1 
ATOM   10393 C C   . LEU E 3 346 ? 243.805 -50.661  41.712  1.00 180.91 ? 337 LEU E C   1 
ATOM   10394 O O   . LEU E 3 346 ? 244.984 -50.593  42.068  1.00 180.04 ? 337 LEU E O   1 
ATOM   10395 C CB  . LEU E 3 346 ? 242.792 -52.974  41.707  1.00 162.82 ? 337 LEU E CB  1 
ATOM   10396 C CG  . LEU E 3 346 ? 241.801 -54.043  42.197  1.00 157.72 ? 337 LEU E CG  1 
ATOM   10397 C CD1 . LEU E 3 346 ? 241.503 -55.056  41.101  1.00 156.19 ? 337 LEU E CD1 1 
ATOM   10398 C CD2 . LEU E 3 346 ? 242.289 -54.739  43.463  1.00 155.45 ? 337 LEU E CD2 1 
ATOM   10399 N N   . ILE E 3 347 ? 243.299 -49.933  40.714  1.00 198.19 ? 338 ILE E N   1 
ATOM   10400 C CA  . ILE E 3 347 ? 244.087 -48.958  39.945  1.00 215.06 ? 338 ILE E CA  1 
ATOM   10401 C C   . ILE E 3 347 ? 243.775 -47.528  40.392  1.00 224.79 ? 338 ILE E C   1 
ATOM   10402 O O   . ILE E 3 347 ? 242.606 -47.153  40.527  1.00 227.83 ? 338 ILE E O   1 
ATOM   10403 C CB  . ILE E 3 347 ? 243.838 -49.089  38.419  1.00 216.10 ? 338 ILE E CB  1 
ATOM   10404 C CG1 . ILE E 3 347 ? 244.258 -50.477  37.925  1.00 218.82 ? 338 ILE E CG1 1 
ATOM   10405 C CG2 . ILE E 3 347 ? 244.584 -48.007  37.640  1.00 215.42 ? 338 ILE E CG2 1 
ATOM   10406 C CD1 . ILE E 3 347 ? 243.789 -50.816  36.525  1.00 219.98 ? 338 ILE E CD1 1 
ATOM   10407 N N   . GLU E 3 348 ? 244.827 -46.740  40.609  1.00 235.51 ? 339 GLU E N   1 
ATOM   10408 C CA  . GLU E 3 348 ? 244.694 -45.348  41.035  1.00 242.84 ? 339 GLU E CA  1 
ATOM   10409 C C   . GLU E 3 348 ? 245.513 -44.425  40.128  1.00 247.17 ? 339 GLU E C   1 
ATOM   10410 O O   . GLU E 3 348 ? 246.738 -44.338  40.263  1.00 248.47 ? 339 GLU E O   1 
ATOM   10411 C CB  . GLU E 3 348 ? 245.137 -45.206  42.493  1.00 241.70 ? 339 GLU E CB  1 
ATOM   10412 C CG  . GLU E 3 348 ? 244.656 -43.949  43.199  1.00 241.69 ? 339 GLU E CG  1 
ATOM   10413 C CD  . GLU E 3 348 ? 245.048 -43.924  44.665  1.00 240.72 ? 339 GLU E CD  1 
ATOM   10414 O OE1 . GLU E 3 348 ? 244.142 -43.838  45.522  1.00 241.41 ? 339 GLU E OE1 1 
ATOM   10415 O OE2 . GLU E 3 348 ? 246.261 -44.003  44.964  1.00 238.96 ? 339 GLU E OE2 1 
ATOM   10416 N N   . LYS E 3 349 ? 244.823 -43.750  39.205  1.00 249.53 ? 340 LYS E N   1 
ATOM   10417 C CA  . LYS E 3 349 ? 245.437 -42.835  38.223  1.00 247.67 ? 340 LYS E CA  1 
ATOM   10418 C C   . LYS E 3 349 ? 246.558 -43.498  37.410  1.00 240.56 ? 340 LYS E C   1 
ATOM   10419 O O   . LYS E 3 349 ? 247.530 -42.846  37.015  1.00 239.99 ? 340 LYS E O   1 
ATOM   10420 C CB  . LYS E 3 349 ? 245.954 -41.553  38.896  1.00 250.43 ? 340 LYS E CB  1 
ATOM   10421 C CG  . LYS E 3 349 ? 244.962 -40.865  39.820  1.00 251.21 ? 340 LYS E CG  1 
ATOM   10422 C CD  . LYS E 3 349 ? 245.605 -39.677  40.519  1.00 253.15 ? 340 LYS E CD  1 
ATOM   10423 C CE  . LYS E 3 349 ? 244.928 -39.369  41.847  1.00 254.46 ? 340 LYS E CE  1 
ATOM   10424 N NZ  . LYS E 3 349 ? 243.492 -39.000  41.700  1.00 255.30 ? 340 LYS E NZ  1 
ATOM   10425 N N   . GLY E 3 350 ? 246.407 -44.797  37.162  1.00 230.91 ? 341 GLY E N   1 
ATOM   10426 C CA  . GLY E 3 350 ? 247.437 -45.583  36.492  1.00 215.41 ? 341 GLY E CA  1 
ATOM   10427 C C   . GLY E 3 350 ? 248.602 -45.927  37.403  1.00 204.12 ? 341 GLY E C   1 
ATOM   10428 O O   . GLY E 3 350 ? 249.753 -45.973  36.961  1.00 199.33 ? 341 GLY E O   1 
ATOM   10429 N N   . ALA E 3 351 ? 248.298 -46.156  38.680  1.00 195.77 ? 342 ALA E N   1 
ATOM   10430 C CA  . ALA E 3 351 ? 249.294 -46.584  39.661  1.00 188.69 ? 342 ALA E CA  1 
ATOM   10431 C C   . ALA E 3 351 ? 248.720 -47.645  40.601  1.00 185.76 ? 342 ALA E C   1 
ATOM   10432 O O   . ALA E 3 351 ? 247.585 -47.529  41.071  1.00 184.05 ? 342 ALA E O   1 
ATOM   10433 C CB  . ALA E 3 351 ? 249.829 -45.394  40.446  1.00 186.16 ? 342 ALA E CB  1 
ATOM   10434 N N   . PHE E 3 352 ? 249.528 -48.672  40.860  1.00 183.70 ? 343 PHE E N   1 
ATOM   10435 C CA  . PHE E 3 352 ? 249.157 -49.842  41.665  1.00 180.91 ? 343 PHE E CA  1 
ATOM   10436 C C   . PHE E 3 352 ? 248.770 -49.475  43.101  1.00 175.82 ? 343 PHE E C   1 
ATOM   10437 O O   . PHE E 3 352 ? 249.611 -49.484  44.004  1.00 177.63 ? 343 PHE E O   1 
ATOM   10438 C CB  . PHE E 3 352 ? 250.321 -50.853  41.640  1.00 182.77 ? 343 PHE E CB  1 
ATOM   10439 C CG  . PHE E 3 352 ? 250.021 -52.179  42.299  1.00 181.26 ? 343 PHE E CG  1 
ATOM   10440 C CD1 . PHE E 3 352 ? 248.845 -52.875  42.023  1.00 181.67 ? 343 PHE E CD1 1 
ATOM   10441 C CD2 . PHE E 3 352 ? 250.948 -52.755  43.167  1.00 178.29 ? 343 PHE E CD2 1 
ATOM   10442 C CE1 . PHE E 3 352 ? 248.588 -54.100  42.624  1.00 180.88 ? 343 PHE E CE1 1 
ATOM   10443 C CE2 . PHE E 3 352 ? 250.697 -53.980  43.767  1.00 176.20 ? 343 PHE E CE2 1 
ATOM   10444 C CZ  . PHE E 3 352 ? 249.516 -54.652  43.494  1.00 178.38 ? 343 PHE E CZ  1 
ATOM   10445 N N   . ALA E 3 353 ? 247.496 -49.147  43.301  1.00 167.70 ? 344 ALA E N   1 
ATOM   10446 C CA  . ALA E 3 353 ? 246.990 -48.822  44.631  1.00 161.84 ? 344 ALA E CA  1 
ATOM   10447 C C   . ALA E 3 353 ? 245.824 -49.724  45.031  1.00 160.26 ? 344 ALA E C   1 
ATOM   10448 O O   . ALA E 3 353 ? 244.660 -49.388  44.796  1.00 157.19 ? 344 ALA E O   1 
ATOM   10449 C CB  . ALA E 3 353 ? 246.607 -47.354  44.724  1.00 160.37 ? 344 ALA E CB  1 
ATOM   10450 N N   . PRO E 3 354 ? 246.142 -50.885  45.631  1.00 161.97 ? 345 PRO E N   1 
ATOM   10451 C CA  . PRO E 3 354 ? 245.131 -51.821  46.112  1.00 165.47 ? 345 PRO E CA  1 
ATOM   10452 C C   . PRO E 3 354 ? 244.454 -51.288  47.368  1.00 169.48 ? 345 PRO E C   1 
ATOM   10453 O O   . PRO E 3 354 ? 245.055 -50.502  48.108  1.00 169.52 ? 345 PRO E O   1 
ATOM   10454 C CB  . PRO E 3 354 ? 245.944 -53.073  46.443  1.00 165.50 ? 345 PRO E CB  1 
ATOM   10455 C CG  . PRO E 3 354 ? 247.304 -52.565  46.777  1.00 163.89 ? 345 PRO E CG  1 
ATOM   10456 C CD  . PRO E 3 354 ? 247.513 -51.359  45.909  1.00 162.40 ? 345 PRO E CD  1 
ATOM   10457 N N   . LYS E 3 355 ? 243.215 -51.713  47.599  1.00 174.39 ? 346 LYS E N   1 
ATOM   10458 C CA  . LYS E 3 355 ? 242.434 -51.219  48.734  1.00 178.23 ? 346 LYS E CA  1 
ATOM   10459 C C   . LYS E 3 355 ? 241.933 -52.366  49.623  1.00 180.46 ? 346 LYS E C   1 
ATOM   10460 O O   . LYS E 3 355 ? 240.845 -52.912  49.411  1.00 182.50 ? 346 LYS E O   1 
ATOM   10461 C CB  . LYS E 3 355 ? 241.290 -50.310  48.253  1.00 177.29 ? 346 LYS E CB  1 
ATOM   10462 C CG  . LYS E 3 355 ? 241.678 -49.395  47.095  1.00 175.77 ? 346 LYS E CG  1 
ATOM   10463 C CD  . LYS E 3 355 ? 241.053 -48.013  47.192  1.00 174.97 ? 346 LYS E CD  1 
ATOM   10464 C CE  . LYS E 3 355 ? 241.616 -47.087  46.122  1.00 174.65 ? 346 LYS E CE  1 
ATOM   10465 N NZ  . LYS E 3 355 ? 243.096 -46.897  46.235  1.00 174.40 ? 346 LYS E NZ  1 
ATOM   10466 N N   . TRP E 3 356 ? 242.753 -52.721  50.616  1.00 180.72 ? 347 TRP E N   1 
ATOM   10467 C CA  . TRP E 3 356 ? 242.492 -53.838  51.539  1.00 176.80 ? 347 TRP E CA  1 
ATOM   10468 C C   . TRP E 3 356 ? 241.416 -53.492  52.567  1.00 167.92 ? 347 TRP E C   1 
ATOM   10469 O O   . TRP E 3 356 ? 240.848 -54.375  53.220  1.00 161.02 ? 347 TRP E O   1 
ATOM   10470 C CB  . TRP E 3 356 ? 243.781 -54.232  52.270  1.00 185.29 ? 347 TRP E CB  1 
ATOM   10471 C CG  . TRP E 3 356 ? 245.014 -54.230  51.401  1.00 194.38 ? 347 TRP E CG  1 
ATOM   10472 C CD1 . TRP E 3 356 ? 245.945 -53.233  51.298  1.00 195.30 ? 347 TRP E CD1 1 
ATOM   10473 C CD2 . TRP E 3 356 ? 245.444 -55.273  50.517  1.00 200.01 ? 347 TRP E CD2 1 
ATOM   10474 N NE1 . TRP E 3 356 ? 246.928 -53.592  50.405  1.00 198.37 ? 347 TRP E NE1 1 
ATOM   10475 C CE2 . TRP E 3 356 ? 246.646 -54.839  49.911  1.00 201.10 ? 347 TRP E CE2 1 
ATOM   10476 C CE3 . TRP E 3 356 ? 244.932 -56.535  50.179  1.00 203.41 ? 347 TRP E CE3 1 
ATOM   10477 C CZ2 . TRP E 3 356 ? 247.345 -55.622  48.983  1.00 203.24 ? 347 TRP E CZ2 1 
ATOM   10478 C CZ3 . TRP E 3 356 ? 245.627 -57.313  49.255  1.00 204.69 ? 347 TRP E CZ3 1 
ATOM   10479 C CH2 . TRP E 3 356 ? 246.821 -56.852  48.669  1.00 204.46 ? 347 TRP E CH2 1 
ATOM   10480 N N   . GLU E 3 357 ? 241.164 -52.195  52.706  1.00 163.47 ? 348 GLU E N   1 
ATOM   10481 C CA  . GLU E 3 357 ? 240.157 -51.656  53.611  1.00 160.00 ? 348 GLU E CA  1 
ATOM   10482 C C   . GLU E 3 357 ? 238.725 -51.847  53.090  1.00 154.19 ? 348 GLU E C   1 
ATOM   10483 O O   . GLU E 3 357 ? 237.787 -51.959  53.884  1.00 154.14 ? 348 GLU E O   1 
ATOM   10484 C CB  . GLU E 3 357 ? 240.446 -50.168  53.873  1.00 166.02 ? 348 GLU E CB  1 
ATOM   10485 C CG  . GLU E 3 357 ? 240.803 -49.360  52.622  1.00 171.58 ? 348 GLU E CG  1 
ATOM   10486 C CD  . GLU E 3 357 ? 241.597 -48.089  52.911  1.00 174.78 ? 348 GLU E CD  1 
ATOM   10487 O OE1 . GLU E 3 357 ? 241.685 -47.224  52.011  1.00 174.63 ? 348 GLU E OE1 1 
ATOM   10488 O OE2 . GLU E 3 357 ? 242.141 -47.951  54.029  1.00 177.76 ? 348 GLU E OE2 1 
ATOM   10489 N N   . ASP E 3 358 ? 238.580 -51.903  51.763  1.00 146.55 ? 349 ASP E N   1 
ATOM   10490 C CA  . ASP E 3 358 ? 237.277 -51.904  51.066  1.00 138.26 ? 349 ASP E CA  1 
ATOM   10491 C C   . ASP E 3 358 ? 236.340 -53.045  51.478  1.00 129.90 ? 349 ASP E C   1 
ATOM   10492 O O   . ASP E 3 358 ? 236.796 -54.135  51.822  1.00 132.09 ? 349 ASP E O   1 
ATOM   10493 C CB  . ASP E 3 358 ? 237.504 -51.933  49.544  1.00 140.37 ? 349 ASP E CB  1 
ATOM   10494 C CG  . ASP E 3 358 ? 236.281 -51.487  48.749  1.00 141.24 ? 349 ASP E CG  1 
ATOM   10495 O OD1 . ASP E 3 358 ? 235.238 -52.172  48.795  1.00 140.36 ? 349 ASP E OD1 1 
ATOM   10496 O OD2 . ASP E 3 358 ? 236.373 -50.454  48.053  1.00 142.80 ? 349 ASP E OD2 1 
ATOM   10497 N N   . GLU E 3 359 ? 235.031 -52.780  51.427  1.00 116.67 ? 350 GLU E N   1 
ATOM   10498 C CA  . GLU E 3 359 ? 234.005 -53.766  51.797  1.00 105.82 ? 350 GLU E CA  1 
ATOM   10499 C C   . GLU E 3 359 ? 233.605 -54.707  50.653  1.00 101.65 ? 350 GLU E C   1 
ATOM   10500 O O   . GLU E 3 359 ? 233.028 -55.766  50.894  1.00 100.95 ? 350 GLU E O   1 
ATOM   10501 C CB  . GLU E 3 359 ? 232.766 -53.082  52.395  1.00 100.62 ? 350 GLU E CB  1 
ATOM   10502 C CG  . GLU E 3 359 ? 231.946 -52.255  51.415  1.00 96.09  ? 350 GLU E CG  1 
ATOM   10503 C CD  . GLU E 3 359 ? 230.579 -51.879  51.960  1.00 93.03  ? 350 GLU E CD  1 
ATOM   10504 O OE1 . GLU E 3 359 ? 229.988 -50.905  51.451  1.00 91.58  ? 350 GLU E OE1 1 
ATOM   10505 O OE2 . GLU E 3 359 ? 230.090 -52.554  52.892  1.00 91.67  ? 350 GLU E OE2 1 
ATOM   10506 N N   . ILE E 3 360 ? 233.895 -54.309  49.417  1.00 97.29  ? 351 ILE E N   1 
ATOM   10507 C CA  . ILE E 3 360 ? 233.742 -55.200  48.270  1.00 93.91  ? 351 ILE E CA  1 
ATOM   10508 C C   . ILE E 3 360 ? 234.946 -56.132  48.225  1.00 94.77  ? 351 ILE E C   1 
ATOM   10509 O O   . ILE E 3 360 ? 234.793 -57.336  48.021  1.00 93.01  ? 351 ILE E O   1 
ATOM   10510 C CB  . ILE E 3 360 ? 233.642 -54.427  46.940  1.00 91.93  ? 351 ILE E CB  1 
ATOM   10511 C CG1 . ILE E 3 360 ? 232.502 -53.409  46.995  1.00 91.67  ? 351 ILE E CG1 1 
ATOM   10512 C CG2 . ILE E 3 360 ? 233.444 -55.386  45.774  1.00 90.15  ? 351 ILE E CG2 1 
ATOM   10513 C CD1 . ILE E 3 360 ? 232.632 -52.289  45.985  1.00 92.48  ? 351 ILE E CD1 1 
ATOM   10514 N N   . VAL E 3 361 ? 236.135 -55.562  48.428  1.00 97.82  ? 352 VAL E N   1 
ATOM   10515 C CA  . VAL E 3 361 ? 237.391 -56.319  48.440  1.00 101.12 ? 352 VAL E CA  1 
ATOM   10516 C C   . VAL E 3 361 ? 237.455 -57.289  49.629  1.00 102.00 ? 352 VAL E C   1 
ATOM   10517 O O   . VAL E 3 361 ? 237.617 -58.490  49.429  1.00 102.17 ? 352 VAL E O   1 
ATOM   10518 C CB  . VAL E 3 361 ? 238.633 -55.391  48.403  1.00 102.39 ? 352 VAL E CB  1 
ATOM   10519 C CG1 . VAL E 3 361 ? 239.921 -56.189  48.577  1.00 103.00 ? 352 VAL E CG1 1 
ATOM   10520 C CG2 . VAL E 3 361 ? 238.677 -54.605  47.099  1.00 102.42 ? 352 VAL E CG2 1 
ATOM   10521 N N   . ARG E 3 362 ? 237.312 -56.770  50.851  1.00 102.84 ? 353 ARG E N   1 
ATOM   10522 C CA  . ARG E 3 362 ? 237.300 -57.602  52.068  1.00 102.09 ? 353 ARG E CA  1 
ATOM   10523 C C   . ARG E 3 362 ? 236.141 -58.609  52.075  1.00 99.81  ? 353 ARG E C   1 
ATOM   10524 O O   . ARG E 3 362 ? 236.240 -59.674  52.694  1.00 98.86  ? 353 ARG E O   1 
ATOM   10525 C CB  . ARG E 3 362 ? 237.297 -56.717  53.327  1.00 104.39 ? 353 ARG E CB  1 
ATOM   10526 C CG  . ARG E 3 362 ? 236.958 -57.392  54.655  1.00 106.21 ? 353 ARG E CG  1 
ATOM   10527 C CD  . ARG E 3 362 ? 235.493 -57.216  55.068  1.00 108.97 ? 353 ARG E CD  1 
ATOM   10528 N NE  . ARG E 3 362 ? 234.955 -55.866  54.837  1.00 112.47 ? 353 ARG E NE  1 
ATOM   10529 C CZ  . ARG E 3 362 ? 235.345 -54.760  55.478  1.00 114.04 ? 353 ARG E CZ  1 
ATOM   10530 N NH1 . ARG E 3 362 ? 234.778 -53.595  55.184  1.00 114.66 ? 353 ARG E NH1 1 
ATOM   10531 N NH2 . ARG E 3 362 ? 236.307 -54.805  56.403  1.00 115.01 ? 353 ARG E NH2 1 
ATOM   10532 N N   . ALA E 3 363 ? 235.053 -58.268  51.385  1.00 97.18  ? 354 ALA E N   1 
ATOM   10533 C CA  . ALA E 3 363 ? 233.929 -59.186  51.224  1.00 93.88  ? 354 ALA E CA  1 
ATOM   10534 C C   . ALA E 3 363 ? 233.914 -59.881  49.856  1.00 91.10  ? 354 ALA E C   1 
ATOM   10535 O O   . ALA E 3 363 ? 232.846 -60.194  49.331  1.00 91.05  ? 354 ALA E O   1 
ATOM   10536 C CB  . ALA E 3 363 ? 232.602 -58.488  51.502  1.00 94.21  ? 354 ALA E CB  1 
ATOM   10537 N N   . ALA E 3 364 ? 235.100 -60.129  49.300  1.00 87.98  ? 355 ALA E N   1 
ATOM   10538 C CA  . ALA E 3 364 ? 235.254 -60.929  48.076  1.00 85.48  ? 355 ALA E CA  1 
ATOM   10539 C C   . ALA E 3 364 ? 236.652 -61.544  47.952  1.00 84.44  ? 355 ALA E C   1 
ATOM   10540 O O   . ALA E 3 364 ? 236.854 -62.488  47.183  1.00 83.83  ? 355 ALA E O   1 
ATOM   10541 C CB  . ALA E 3 364 ? 234.921 -60.106  46.838  1.00 85.22  ? 355 ALA E CB  1 
ATOM   10542 N N   . LEU E 3 365 ? 237.603 -61.001  48.714  1.00 83.77  ? 356 LEU E N   1 
ATOM   10543 C CA  . LEU E 3 365 ? 238.999 -61.450  48.713  1.00 83.27  ? 356 LEU E CA  1 
ATOM   10544 C C   . LEU E 3 365 ? 239.106 -62.903  49.168  1.00 83.07  ? 356 LEU E C   1 
ATOM   10545 O O   . LEU E 3 365 ? 238.799 -63.224  50.318  1.00 84.50  ? 356 LEU E O   1 
ATOM   10546 C CB  . LEU E 3 365 ? 239.842 -60.543  49.622  1.00 82.58  ? 356 LEU E CB  1 
ATOM   10547 C CG  . LEU E 3 365 ? 241.372 -60.602  49.622  1.00 81.92  ? 356 LEU E CG  1 
ATOM   10548 C CD1 . LEU E 3 365 ? 241.955 -59.989  48.355  1.00 81.71  ? 356 LEU E CD1 1 
ATOM   10549 C CD2 . LEU E 3 365 ? 241.915 -59.892  50.853  1.00 81.30  ? 356 LEU E CD2 1 
ATOM   10550 N N   . LEU E 3 366 ? 239.531 -63.776  48.257  1.00 81.70  ? 357 LEU E N   1 
ATOM   10551 C CA  . LEU E 3 366 ? 239.658 -65.198  48.557  1.00 80.39  ? 357 LEU E CA  1 
ATOM   10552 C C   . LEU E 3 366 ? 240.888 -65.476  49.409  1.00 80.96  ? 357 LEU E C   1 
ATOM   10553 O O   . LEU E 3 366 ? 240.842 -66.303  50.319  1.00 79.70  ? 357 LEU E O   1 
ATOM   10554 C CB  . LEU E 3 366 ? 239.718 -66.022  47.270  1.00 78.79  ? 357 LEU E CB  1 
ATOM   10555 C CG  . LEU E 3 366 ? 239.404 -67.510  47.417  1.00 77.97  ? 357 LEU E CG  1 
ATOM   10556 C CD1 . LEU E 3 366 ? 237.901 -67.727  47.419  1.00 78.64  ? 357 LEU E CD1 1 
ATOM   10557 C CD2 . LEU E 3 366 ? 240.044 -68.304  46.294  1.00 77.41  ? 357 LEU E CD2 1 
ATOM   10558 N N   . MET E 3 367 ? 241.985 -64.785  49.102  1.00 83.65  ? 358 MET E N   1 
ATOM   10559 C CA  . MET E 3 367 ? 243.239 -64.946  49.833  1.00 88.15  ? 358 MET E CA  1 
ATOM   10560 C C   . MET E 3 367 ? 244.046 -63.662  49.934  1.00 92.91  ? 358 MET E C   1 
ATOM   10561 O O   . MET E 3 367 ? 243.831 -62.720  49.172  1.00 93.15  ? 358 MET E O   1 
ATOM   10562 C CB  . MET E 3 367 ? 244.118 -65.999  49.170  1.00 87.81  ? 358 MET E CB  1 
ATOM   10563 C CG  . MET E 3 367 ? 243.578 -67.406  49.238  1.00 88.80  ? 358 MET E CG  1 
ATOM   10564 S SD  . MET E 3 367 ? 244.469 -68.437  48.075  1.00 91.62  ? 358 MET E SD  1 
ATOM   10565 C CE  . MET E 3 367 ? 243.229 -69.690  47.766  1.00 93.62  ? 358 MET E CE  1 
ATOM   10566 N N   . LYS E 3 368 ? 244.988 -63.652  50.876  1.00 99.83  ? 359 LYS E N   1 
ATOM   10567 C CA  . LYS E 3 368 ? 245.962 -62.571  51.016  1.00 107.11 ? 359 LYS E CA  1 
ATOM   10568 C C   . LYS E 3 368 ? 247.382 -63.150  51.100  1.00 111.11 ? 359 LYS E C   1 
ATOM   10569 O O   . LYS E 3 368 ? 247.957 -63.266  52.189  1.00 112.68 ? 359 LYS E O   1 
ATOM   10570 C CB  . LYS E 3 368 ? 245.640 -61.710  52.244  1.00 108.24 ? 359 LYS E CB  1 
ATOM   10571 C CG  . LYS E 3 368 ? 246.360 -60.371  52.286  1.00 109.85 ? 359 LYS E CG  1 
ATOM   10572 C CD  . LYS E 3 368 ? 245.771 -59.467  53.357  1.00 111.06 ? 359 LYS E CD  1 
ATOM   10573 C CE  . LYS E 3 368 ? 246.369 -58.071  53.288  1.00 112.02 ? 359 LYS E CE  1 
ATOM   10574 N NZ  . LYS E 3 368 ? 245.593 -57.096  54.104  1.00 112.97 ? 359 LYS E NZ  1 
ATOM   10575 N N   . GLU E 3 369 ? 247.928 -63.510  49.935  1.00 114.37 ? 360 GLU E N   1 
ATOM   10576 C CA  . GLU E 3 369 ? 249.264 -64.120  49.805  1.00 115.47 ? 360 GLU E CA  1 
ATOM   10577 C C   . GLU E 3 369 ? 249.395 -65.450  50.561  1.00 116.05 ? 360 GLU E C   1 
ATOM   10578 O O   . GLU E 3 369 ? 250.074 -65.535  51.591  1.00 115.99 ? 360 GLU E O   1 
ATOM   10579 C CB  . GLU E 3 369 ? 250.374 -63.137  50.210  1.00 114.98 ? 360 GLU E CB  1 
ATOM   10580 C CG  . GLU E 3 369 ? 250.523 -61.945  49.277  1.00 114.25 ? 360 GLU E CG  1 
ATOM   10581 C CD  . GLU E 3 369 ? 251.401 -60.849  49.852  1.00 113.96 ? 360 GLU E CD  1 
ATOM   10582 O OE1 . GLU E 3 369 ? 252.069 -60.155  49.058  1.00 114.54 ? 360 GLU E OE1 1 
ATOM   10583 O OE2 . GLU E 3 369 ? 251.421 -60.675  51.091  1.00 113.06 ? 360 GLU E OE2 1 
ATOM   10584 N N   . GLY E 3 370 ? 248.737 -66.480  50.030  1.00 116.15 ? 361 GLY E N   1 
ATOM   10585 C CA  . GLY E 3 370 ? 248.724 -67.809  50.645  1.00 115.33 ? 361 GLY E CA  1 
ATOM   10586 C C   . GLY E 3 370 ? 247.998 -67.803  51.973  1.00 115.93 ? 361 GLY E C   1 
ATOM   10587 O O   . GLY E 3 370 ? 248.483 -68.363  52.960  1.00 112.99 ? 361 GLY E O   1 
ATOM   10588 N N   . GLU E 3 371 ? 246.831 -67.160  51.989  1.00 119.55 ? 362 GLU E N   1 
ATOM   10589 C CA  . GLU E 3 371 ? 246.069 -66.952  53.212  1.00 124.38 ? 362 GLU E CA  1 
ATOM   10590 C C   . GLU E 3 371 ? 244.578 -66.851  52.886  1.00 126.09 ? 362 GLU E C   1 
ATOM   10591 O O   . GLU E 3 371 ? 244.076 -65.772  52.568  1.00 124.79 ? 362 GLU E O   1 
ATOM   10592 C CB  . GLU E 3 371 ? 246.562 -65.683  53.918  1.00 126.77 ? 362 GLU E CB  1 
ATOM   10593 C CG  . GLU E 3 371 ? 246.899 -65.857  55.391  1.00 129.78 ? 362 GLU E CG  1 
ATOM   10594 C CD  . GLU E 3 371 ? 245.700 -65.683  56.305  1.00 131.70 ? 362 GLU E CD  1 
ATOM   10595 O OE1 . GLU E 3 371 ? 244.745 -66.484  56.205  1.00 134.91 ? 362 GLU E OE1 1 
ATOM   10596 O OE2 . GLU E 3 371 ? 245.719 -64.747  57.134  1.00 131.48 ? 362 GLU E OE2 1 
ATOM   10597 N N   . VAL E 3 372 ? 243.880 -67.983  52.969  1.00 129.78 ? 363 VAL E N   1 
ATOM   10598 C CA  . VAL E 3 372 ? 242.462 -68.061  52.604  1.00 133.82 ? 363 VAL E CA  1 
ATOM   10599 C C   . VAL E 3 372 ? 241.558 -67.365  53.622  1.00 140.15 ? 363 VAL E C   1 
ATOM   10600 O O   . VAL E 3 372 ? 241.302 -67.896  54.709  1.00 140.55 ? 363 VAL E O   1 
ATOM   10601 C CB  . VAL E 3 372 ? 241.986 -69.519  52.415  1.00 132.24 ? 363 VAL E CB  1 
ATOM   10602 C CG1 . VAL E 3 372 ? 240.573 -69.542  51.854  1.00 130.67 ? 363 VAL E CG1 1 
ATOM   10603 C CG2 . VAL E 3 372 ? 242.926 -70.285  51.496  1.00 132.48 ? 363 VAL E CG2 1 
ATOM   10604 N N   . LEU E 3 373 ? 241.077 -66.178  53.258  1.00 148.84 ? 364 LEU E N   1 
ATOM   10605 C CA  . LEU E 3 373 ? 240.155 -65.420  54.106  1.00 156.46 ? 364 LEU E CA  1 
ATOM   10606 C C   . LEU E 3 373 ? 238.753 -66.023  54.080  1.00 157.97 ? 364 LEU E C   1 
ATOM   10607 O O   . LEU E 3 373 ? 238.136 -66.222  55.134  1.00 156.17 ? 364 LEU E O   1 
ATOM   10608 C CB  . LEU E 3 373 ? 240.103 -63.940  53.692  1.00 160.68 ? 364 LEU E CB  1 
ATOM   10609 C CG  . LEU E 3 373 ? 241.199 -62.977  54.165  1.00 161.43 ? 364 LEU E CG  1 
ATOM   10610 C CD1 . LEU E 3 373 ? 242.377 -62.973  53.204  1.00 161.16 ? 364 LEU E CD1 1 
ATOM   10611 C CD2 . LEU E 3 373 ? 240.646 -61.567  54.316  1.00 161.23 ? 364 LEU E CD2 1 
ATOM   10612 N N   . HIS E 3 374 ? 238.262 -66.308  52.873  1.00 160.38 ? 365 HIS E N   1 
ATOM   10613 C CA  . HIS E 3 374 ? 236.937 -66.889  52.677  1.00 161.60 ? 365 HIS E CA  1 
ATOM   10614 C C   . HIS E 3 374 ? 236.814 -68.148  53.523  1.00 163.93 ? 365 HIS E C   1 
ATOM   10615 O O   . HIS E 3 374 ? 237.458 -69.163  53.247  1.00 162.42 ? 365 HIS E O   1 
ATOM   10616 C CB  . HIS E 3 374 ? 236.685 -67.189  51.191  1.00 159.86 ? 365 HIS E CB  1 
ATOM   10617 C CG  . HIS E 3 374 ? 235.235 -67.334  50.830  1.00 157.71 ? 365 HIS E CG  1 
ATOM   10618 N ND1 . HIS E 3 374 ? 234.747 -68.413  50.122  1.00 156.84 ? 365 HIS E ND1 1 
ATOM   10619 C CD2 . HIS E 3 374 ? 234.171 -66.530  51.066  1.00 156.32 ? 365 HIS E CD2 1 
ATOM   10620 C CE1 . HIS E 3 374 ? 233.446 -68.269  49.942  1.00 155.12 ? 365 HIS E CE1 1 
ATOM   10621 N NE2 . HIS E 3 374 ? 233.071 -67.135  50.507  1.00 155.16 ? 365 HIS E NE2 1 
ATOM   10622 N N   . GLY E 3 375 ? 236.010 -68.045  54.578  1.00 167.88 ? 366 GLY E N   1 
ATOM   10623 C CA  . GLY E 3 375 ? 235.726 -69.159  55.475  1.00 173.89 ? 366 GLY E CA  1 
ATOM   10624 C C   . GLY E 3 375 ? 235.287 -70.444  54.789  1.00 179.84 ? 366 GLY E C   1 
ATOM   10625 O O   . GLY E 3 375 ? 235.746 -71.519  55.166  1.00 178.34 ? 366 GLY E O   1 
ATOM   10626 N N   . PRO E 3 376 ? 234.384 -70.344  53.788  1.00 185.23 ? 367 PRO E N   1 
ATOM   10627 C CA  . PRO E 3 376 ? 233.984 -71.496  52.980  1.00 184.59 ? 367 PRO E CA  1 
ATOM   10628 C C   . PRO E 3 376 ? 235.110 -72.075  52.117  1.00 179.88 ? 367 PRO E C   1 
ATOM   10629 O O   . PRO E 3 376 ? 235.152 -73.287  51.903  1.00 180.16 ? 367 PRO E O   1 
ATOM   10630 C CB  . PRO E 3 376 ? 232.872 -70.927  52.093  1.00 188.36 ? 367 PRO E CB  1 
ATOM   10631 C CG  . PRO E 3 376 ? 232.310 -69.805  52.885  1.00 191.05 ? 367 PRO E CG  1 
ATOM   10632 C CD  . PRO E 3 376 ? 233.527 -69.181  53.498  1.00 189.95 ? 367 PRO E CD  1 
ATOM   10633 N N   . THR E 3 377 ? 235.999 -71.217  51.617  1.00 172.56 ? 368 THR E N   1 
ATOM   10634 C CA  . THR E 3 377 ? 237.170 -71.675  50.865  1.00 163.84 ? 368 THR E CA  1 
ATOM   10635 C C   . THR E 3 377 ? 238.230 -72.198  51.838  1.00 162.03 ? 368 THR E C   1 
ATOM   10636 O O   . THR E 3 377 ? 239.052 -73.046  51.481  1.00 160.59 ? 368 THR E O   1 
ATOM   10637 C CB  . THR E 3 377 ? 237.741 -70.569  49.954  1.00 160.16 ? 368 THR E CB  1 
ATOM   10638 O OG1 . THR E 3 377 ? 236.673 -69.973  49.209  1.00 158.80 ? 368 THR E OG1 1 
ATOM   10639 C CG2 . THR E 3 377 ? 238.765 -71.136  48.975  1.00 156.92 ? 368 THR E CG2 1 
ATOM   10640 N N   . LYS E 3 378 ? 238.198 -71.682  53.067  1.00 160.56 ? 369 LYS E N   1 
ATOM   10641 C CA  . LYS E 3 378 ? 238.951 -72.257  54.177  1.00 160.04 ? 369 LYS E CA  1 
ATOM   10642 C C   . LYS E 3 378 ? 238.296 -73.589  54.570  1.00 165.30 ? 369 LYS E C   1 
ATOM   10643 O O   . LYS E 3 378 ? 238.979 -74.513  55.022  1.00 171.21 ? 369 LYS E O   1 
ATOM   10644 C CB  . LYS E 3 378 ? 238.984 -71.290  55.372  1.00 151.47 ? 369 LYS E CB  1 
ATOM   10645 C CG  . LYS E 3 378 ? 240.028 -71.615  56.438  1.00 143.33 ? 369 LYS E CG  1 
ATOM   10646 C CD  . LYS E 3 378 ? 239.548 -71.238  57.835  1.00 136.32 ? 369 LYS E CD  1 
ATOM   10647 C CE  . LYS E 3 378 ? 240.011 -69.856  58.272  1.00 131.02 ? 369 LYS E CE  1 
ATOM   10648 N NZ  . LYS E 3 378 ? 241.318 -69.923  58.985  1.00 127.29 ? 369 LYS E NZ  1 
ATOM   10649 N N   . ALA E 3 379 ? 236.977 -73.679  54.371  1.00 165.85 ? 370 ALA E N   1 
ATOM   10650 C CA  . ALA E 3 379 ? 236.192 -74.864  54.732  1.00 164.57 ? 370 ALA E CA  1 
ATOM   10651 C C   . ALA E 3 379 ? 236.462 -76.079  53.845  1.00 166.58 ? 370 ALA E C   1 
ATOM   10652 O O   . ALA E 3 379 ? 236.644 -77.182  54.356  1.00 165.69 ? 370 ALA E O   1 
ATOM   10653 C CB  . ALA E 3 379 ? 234.701 -74.545  54.761  1.00 159.07 ? 370 ALA E CB  1 
ATOM   10654 N N   . LEU E 3 380 ? 236.497 -75.877  52.529  1.00 171.28 ? 371 LEU E N   1 
ATOM   10655 C CA  . LEU E 3 380 ? 236.682 -76.992  51.589  1.00 173.53 ? 371 LEU E CA  1 
ATOM   10656 C C   . LEU E 3 380 ? 238.088 -77.629  51.597  1.00 165.90 ? 371 LEU E C   1 
ATOM   10657 O O   . LEU E 3 380 ? 238.284 -78.715  51.043  1.00 168.70 ? 371 LEU E O   1 
ATOM   10658 C CB  . LEU E 3 380 ? 236.239 -76.612  50.163  1.00 182.86 ? 371 LEU E CB  1 
ATOM   10659 C CG  . LEU E 3 380 ? 234.741 -76.675  49.805  1.00 187.30 ? 371 LEU E CG  1 
ATOM   10660 C CD1 . LEU E 3 380 ? 234.517 -76.224  48.368  1.00 189.06 ? 371 LEU E CD1 1 
ATOM   10661 C CD2 . LEU E 3 380 ? 234.145 -78.066  50.014  1.00 189.62 ? 371 LEU E CD2 1 
ATOM   10662 N N   . LEU E 3 381 ? 239.052 -76.964  52.235  1.00 152.45 ? 372 LEU E N   1 
ATOM   10663 C CA  . LEU E 3 381 ? 240.404 -77.510  52.371  1.00 139.87 ? 372 LEU E CA  1 
ATOM   10664 C C   . LEU E 3 381 ? 240.710 -77.912  53.815  1.00 134.39 ? 372 LEU E C   1 
ATOM   10665 O O   . LEU E 3 381 ? 241.676 -78.628  54.084  1.00 128.15 ? 372 LEU E O   1 
ATOM   10666 C CB  . LEU E 3 381 ? 241.454 -76.529  51.823  1.00 134.80 ? 372 LEU E CB  1 
ATOM   10667 C CG  . LEU E 3 381 ? 241.763 -75.204  52.525  1.00 132.30 ? 372 LEU E CG  1 
ATOM   10668 C CD1 . LEU E 3 381 ? 242.821 -75.381  53.604  1.00 129.78 ? 372 LEU E CD1 1 
ATOM   10669 C CD2 . LEU E 3 381 ? 242.226 -74.179  51.503  1.00 130.85 ? 372 LEU E CD2 1 
ATOM   10670 N N   . MET F 3 10  ? 180.340 -93.747  0.802   1.00 91.76  ? 1   MET F N   1 
ATOM   10671 C CA  . MET F 3 10  ? 181.200 -94.070  1.980   1.00 93.73  ? 1   MET F CA  1 
ATOM   10672 C C   . MET F 3 10  ? 182.676 -94.186  1.568   1.00 98.72  ? 1   MET F C   1 
ATOM   10673 O O   . MET F 3 10  ? 183.091 -95.182  0.971   1.00 99.04  ? 1   MET F O   1 
ATOM   10674 C CB  . MET F 3 10  ? 180.672 -95.319  2.709   1.00 89.30  ? 1   MET F CB  1 
ATOM   10675 C CG  . MET F 3 10  ? 179.319 -95.095  3.391   1.00 84.85  ? 1   MET F CG  1 
ATOM   10676 S SD  . MET F 3 10  ? 178.416 -96.578  3.899   1.00 80.45  ? 1   MET F SD  1 
ATOM   10677 C CE  . MET F 3 10  ? 176.972 -95.859  4.708   1.00 78.38  ? 1   MET F CE  1 
ATOM   10678 N N   . VAL F 3 11  ? 183.450 -93.149  1.896   1.00 106.07 ? 2   VAL F N   1 
ATOM   10679 C CA  . VAL F 3 11  ? 184.813 -92.950  1.369   1.00 114.65 ? 2   VAL F CA  1 
ATOM   10680 C C   . VAL F 3 11  ? 185.931 -93.364  2.348   1.00 121.54 ? 2   VAL F C   1 
ATOM   10681 O O   . VAL F 3 11  ? 185.736 -93.351  3.567   1.00 121.67 ? 2   VAL F O   1 
ATOM   10682 C CB  . VAL F 3 11  ? 184.999 -91.486  0.866   1.00 114.38 ? 2   VAL F CB  1 
ATOM   10683 C CG1 . VAL F 3 11  ? 184.823 -90.480  1.998   1.00 114.06 ? 2   VAL F CG1 1 
ATOM   10684 C CG2 . VAL F 3 11  ? 186.335 -91.290  0.157   1.00 114.92 ? 2   VAL F CG2 1 
ATOM   10685 N N   . THR F 3 12  ? 187.091 -93.732  1.796   1.00 131.04 ? 3   THR F N   1 
ATOM   10686 C CA  . THR F 3 12  ? 188.253 -94.170  2.580   1.00 139.76 ? 3   THR F CA  1 
ATOM   10687 C C   . THR F 3 12  ? 189.511 -93.333  2.294   1.00 146.22 ? 3   THR F C   1 
ATOM   10688 O O   . THR F 3 12  ? 189.964 -93.242  1.150   1.00 147.92 ? 3   THR F O   1 
ATOM   10689 C CB  . THR F 3 12  ? 188.555 -95.669  2.349   1.00 139.45 ? 3   THR F CB  1 
ATOM   10690 O OG1 . THR F 3 12  ? 187.385 -96.446  2.641   1.00 139.77 ? 3   THR F OG1 1 
ATOM   10691 C CG2 . THR F 3 12  ? 189.700 -96.141  3.237   1.00 138.71 ? 3   THR F CG2 1 
ATOM   10692 N N   . VAL F 3 13  ? 190.062 -92.734  3.349   1.00 153.52 ? 4   VAL F N   1 
ATOM   10693 C CA  . VAL F 3 13  ? 191.283 -91.926  3.265   1.00 159.71 ? 4   VAL F CA  1 
ATOM   10694 C C   . VAL F 3 13  ? 192.462 -92.705  3.853   1.00 165.23 ? 4   VAL F C   1 
ATOM   10695 O O   . VAL F 3 13  ? 192.334 -93.342  4.898   1.00 163.86 ? 4   VAL F O   1 
ATOM   10696 C CB  . VAL F 3 13  ? 191.111 -90.564  3.987   1.00 159.12 ? 4   VAL F CB  1 
ATOM   10697 C CG1 . VAL F 3 13  ? 192.425 -89.795  4.058   1.00 158.73 ? 4   VAL F CG1 1 
ATOM   10698 C CG2 . VAL F 3 13  ? 190.047 -89.722  3.296   1.00 158.63 ? 4   VAL F CG2 1 
ATOM   10699 N N   . ALA F 3 14  ? 193.603 -92.659  3.169   1.00 174.04 ? 5   ALA F N   1 
ATOM   10700 C CA  . ALA F 3 14  ? 194.813 -93.337  3.634   1.00 181.73 ? 5   ALA F CA  1 
ATOM   10701 C C   . ALA F 3 14  ? 195.946 -92.355  3.944   1.00 185.60 ? 5   ALA F C   1 
ATOM   10702 O O   . ALA F 3 14  ? 196.161 -91.387  3.209   1.00 191.37 ? 5   ALA F O   1 
ATOM   10703 C CB  . ALA F 3 14  ? 195.264 -94.376  2.618   1.00 183.33 ? 5   ALA F CB  1 
ATOM   10704 N N   . VAL F 3 15  ? 196.657 -92.610  5.043   1.00 184.16 ? 6   VAL F N   1 
ATOM   10705 C CA  . VAL F 3 15  ? 197.794 -91.783  5.459   1.00 179.91 ? 6   VAL F CA  1 
ATOM   10706 C C   . VAL F 3 15  ? 199.068 -92.637  5.505   1.00 179.33 ? 6   VAL F C   1 
ATOM   10707 O O   . VAL F 3 15  ? 199.153 -93.582  6.296   1.00 179.97 ? 6   VAL F O   1 
ATOM   10708 C CB  . VAL F 3 15  ? 197.559 -91.119  6.840   1.00 177.41 ? 6   VAL F CB  1 
ATOM   10709 C CG1 . VAL F 3 15  ? 198.585 -90.024  7.091   1.00 176.17 ? 6   VAL F CG1 1 
ATOM   10710 C CG2 . VAL F 3 15  ? 196.150 -90.550  6.947   1.00 175.03 ? 6   VAL F CG2 1 
ATOM   10711 N N   . PRO F 3 16  ? 200.059 -92.317  4.649   1.00 178.06 ? 7   PRO F N   1 
ATOM   10712 C CA  . PRO F 3 16  ? 201.309 -93.069  4.621   1.00 181.12 ? 7   PRO F CA  1 
ATOM   10713 C C   . PRO F 3 16  ? 202.396 -92.453  5.499   1.00 189.09 ? 7   PRO F C   1 
ATOM   10714 O O   . PRO F 3 16  ? 202.330 -91.265  5.828   1.00 191.41 ? 7   PRO F O   1 
ATOM   10715 C CB  . PRO F 3 16  ? 201.721 -92.971  3.155   1.00 176.83 ? 7   PRO F CB  1 
ATOM   10716 C CG  . PRO F 3 16  ? 201.229 -91.628  2.733   1.00 173.72 ? 7   PRO F CG  1 
ATOM   10717 C CD  . PRO F 3 16  ? 200.004 -91.323  3.559   1.00 174.93 ? 7   PRO F CD  1 
ATOM   10718 N N   . LYS F 3 17  ? 203.384 -93.263  5.872   1.00 198.45 ? 8   LYS F N   1 
ATOM   10719 C CA  . LYS F 3 17  ? 204.576 -92.759  6.548   1.00 207.98 ? 8   LYS F CA  1 
ATOM   10720 C C   . LYS F 3 17  ? 205.534 -92.174  5.512   1.00 213.89 ? 8   LYS F C   1 
ATOM   10721 O O   . LYS F 3 17  ? 205.841 -92.820  4.506   1.00 218.09 ? 8   LYS F O   1 
ATOM   10722 C CB  . LYS F 3 17  ? 205.262 -93.866  7.357   1.00 208.14 ? 8   LYS F CB  1 
ATOM   10723 C CG  . LYS F 3 17  ? 206.544 -93.422  8.048   1.00 208.92 ? 8   LYS F CG  1 
ATOM   10724 C CD  . LYS F 3 17  ? 207.183 -94.541  8.856   1.00 209.30 ? 8   LYS F CD  1 
ATOM   10725 C CE  . LYS F 3 17  ? 208.613 -94.195  9.247   1.00 210.17 ? 8   LYS F CE  1 
ATOM   10726 N NZ  . LYS F 3 17  ? 208.721 -92.948  10.059  1.00 211.15 ? 8   LYS F NZ  1 
ATOM   10727 N N   . GLU F 3 18  ? 205.995 -90.949  5.756   1.00 218.11 ? 9   GLU F N   1 
ATOM   10728 C CA  . GLU F 3 18  ? 206.925 -90.278  4.849   1.00 220.57 ? 9   GLU F CA  1 
ATOM   10729 C C   . GLU F 3 18  ? 208.346 -90.791  5.065   1.00 224.32 ? 9   GLU F C   1 
ATOM   10730 O O   . GLU F 3 18  ? 208.850 -90.793  6.191   1.00 222.46 ? 9   GLU F O   1 
ATOM   10731 C CB  . GLU F 3 18  ? 206.852 -88.757  5.015   1.00 219.13 ? 9   GLU F CB  1 
ATOM   10732 C CG  . GLU F 3 18  ? 205.459 -88.172  4.808   1.00 218.69 ? 9   GLU F CG  1 
ATOM   10733 C CD  . GLU F 3 18  ? 204.892 -88.431  3.420   1.00 218.86 ? 9   GLU F CD  1 
ATOM   10734 O OE1 . GLU F 3 18  ? 203.691 -88.763  3.321   1.00 217.92 ? 9   GLU F OE1 1 
ATOM   10735 O OE2 . GLU F 3 18  ? 205.640 -88.305  2.425   1.00 219.14 ? 9   GLU F OE2 1 
ATOM   10736 N N   . ARG F 3 19  ? 208.982 -91.222  3.977   1.00 231.75 ? 10  ARG F N   1 
ATOM   10737 C CA  . ARG F 3 19  ? 210.245 -91.957  4.059   1.00 241.02 ? 10  ARG F CA  1 
ATOM   10738 C C   . ARG F 3 19  ? 211.412 -91.280  3.321   1.00 241.82 ? 10  ARG F C   1 
ATOM   10739 O O   . ARG F 3 19  ? 212.443 -91.911  3.069   1.00 245.53 ? 10  ARG F O   1 
ATOM   10740 C CB  . ARG F 3 19  ? 210.041 -93.396  3.561   1.00 248.72 ? 10  ARG F CB  1 
ATOM   10741 C CG  . ARG F 3 19  ? 210.589 -94.467  4.495   1.00 255.78 ? 10  ARG F CG  1 
ATOM   10742 C CD  . ARG F 3 19  ? 209.956 -95.826  4.222   1.00 258.35 ? 10  ARG F CD  1 
ATOM   10743 N NE  . ARG F 3 19  ? 209.855 -96.641  5.435   1.00 259.45 ? 10  ARG F NE  1 
ATOM   10744 C CZ  . ARG F 3 19  ? 209.257 -97.829  5.506   1.00 258.18 ? 10  ARG F CZ  1 
ATOM   10745 N NH1 . ARG F 3 19  ? 208.696 -98.371  4.431   1.00 256.82 ? 10  ARG F NH1 1 
ATOM   10746 N NH2 . ARG F 3 19  ? 209.219 -98.484  6.660   1.00 257.96 ? 10  ARG F NH2 1 
ATOM   10747 N N   . ALA F 3 20  ? 211.246 -90.000  2.985   1.00 240.55 ? 11  ALA F N   1 
ATOM   10748 C CA  . ALA F 3 20  ? 212.325 -89.195  2.401   1.00 242.02 ? 11  ALA F CA  1 
ATOM   10749 C C   . ALA F 3 20  ? 213.403 -88.894  3.458   1.00 245.28 ? 11  ALA F C   1 
ATOM   10750 O O   . ALA F 3 20  ? 213.094 -88.872  4.652   1.00 244.67 ? 11  ALA F O   1 
ATOM   10751 C CB  . ALA F 3 20  ? 211.761 -87.910  1.811   1.00 240.04 ? 11  ALA F CB  1 
ATOM   10752 N N   . PRO F 3 21  ? 214.668 -88.669  3.030   1.00 246.26 ? 12  PRO F N   1 
ATOM   10753 C CA  . PRO F 3 21  ? 215.797 -88.546  3.975   1.00 246.59 ? 12  PRO F CA  1 
ATOM   10754 C C   . PRO F 3 21  ? 215.734 -87.357  4.953   1.00 246.48 ? 12  PRO F C   1 
ATOM   10755 O O   . PRO F 3 21  ? 216.269 -86.281  4.662   1.00 246.93 ? 12  PRO F O   1 
ATOM   10756 C CB  . PRO F 3 21  ? 217.023 -88.419  3.052   1.00 245.60 ? 12  PRO F CB  1 
ATOM   10757 C CG  . PRO F 3 21  ? 216.578 -88.947  1.730   1.00 242.17 ? 12  PRO F CG  1 
ATOM   10758 C CD  . PRO F 3 21  ? 215.128 -88.580  1.631   1.00 243.22 ? 12  PRO F CD  1 
ATOM   10759 N N   . GLY F 3 22  ? 215.091 -87.567  6.103   1.00 247.00 ? 13  GLY F N   1 
ATOM   10760 C CA  . GLY F 3 22  ? 215.061 -86.578  7.188   1.00 248.04 ? 13  GLY F CA  1 
ATOM   10761 C C   . GLY F 3 22  ? 213.770 -85.787  7.346   1.00 249.84 ? 13  GLY F C   1 
ATOM   10762 O O   . GLY F 3 22  ? 213.808 -84.562  7.508   1.00 249.29 ? 13  GLY F O   1 
ATOM   10763 N N   . GLU F 3 23  ? 212.633 -86.487  7.310   1.00 249.16 ? 14  GLU F N   1 
ATOM   10764 C CA  . GLU F 3 23  ? 211.306 -85.864  7.444   1.00 247.54 ? 14  GLU F CA  1 
ATOM   10765 C C   . GLU F 3 23  ? 210.514 -86.476  8.605   1.00 246.40 ? 14  GLU F C   1 
ATOM   10766 O O   . GLU F 3 23  ? 210.592 -87.684  8.854   1.00 247.63 ? 14  GLU F O   1 
ATOM   10767 C CB  . GLU F 3 23  ? 210.516 -85.983  6.129   1.00 248.74 ? 14  GLU F CB  1 
ATOM   10768 C CG  . GLU F 3 23  ? 209.132 -85.332  6.125   1.00 248.74 ? 14  GLU F CG  1 
ATOM   10769 C CD  . GLU F 3 23  ? 209.173 -83.834  5.875   1.00 250.57 ? 14  GLU F CD  1 
ATOM   10770 O OE1 . GLU F 3 23  ? 209.072 -83.065  6.854   1.00 250.73 ? 14  GLU F OE1 1 
ATOM   10771 O OE2 . GLU F 3 23  ? 209.309 -83.421  4.703   1.00 247.66 ? 14  GLU F OE2 1 
ATOM   10772 N N   . ARG F 3 24  ? 209.758 -85.631  9.308   1.00 245.04 ? 15  ARG F N   1 
ATOM   10773 C CA  . ARG F 3 24  ? 208.927 -86.063  10.438  1.00 247.16 ? 15  ARG F CA  1 
ATOM   10774 C C   . ARG F 3 24  ? 207.491 -85.519  10.366  1.00 230.90 ? 15  ARG F C   1 
ATOM   10775 O O   . ARG F 3 24  ? 206.706 -85.693  11.303  1.00 230.49 ? 15  ARG F O   1 
ATOM   10776 C CB  . ARG F 3 24  ? 209.579 -85.680  11.776  1.00 252.86 ? 15  ARG F CB  1 
ATOM   10777 C CG  . ARG F 3 24  ? 210.963 -86.278  12.015  1.00 260.00 ? 15  ARG F CG  1 
ATOM   10778 C CD  . ARG F 3 24  ? 211.352 -86.274  13.489  1.00 266.89 ? 15  ARG F CD  1 
ATOM   10779 N NE  . ARG F 3 24  ? 211.231 -84.952  14.109  1.00 269.72 ? 15  ARG F NE  1 
ATOM   10780 C CZ  . ARG F 3 24  ? 212.206 -84.047  14.174  1.00 272.20 ? 15  ARG F CZ  1 
ATOM   10781 N NH1 . ARG F 3 24  ? 213.402 -84.301  13.657  1.00 274.23 ? 15  ARG F NH1 1 
ATOM   10782 N NH2 . ARG F 3 24  ? 211.982 -82.879  14.762  1.00 269.74 ? 15  ARG F NH2 1 
ATOM   10783 N N   . ARG F 3 25  ? 207.156 -84.866  9.254   1.00 205.27 ? 16  ARG F N   1 
ATOM   10784 C CA  . ARG F 3 25  ? 205.811 -84.336  9.037   1.00 186.43 ? 16  ARG F CA  1 
ATOM   10785 C C   . ARG F 3 25  ? 204.818 -85.452  8.730   1.00 180.71 ? 16  ARG F C   1 
ATOM   10786 O O   . ARG F 3 25  ? 205.029 -86.242  7.808   1.00 176.58 ? 16  ARG F O   1 
ATOM   10787 C CB  . ARG F 3 25  ? 205.806 -83.323  7.891   1.00 179.72 ? 16  ARG F CB  1 
ATOM   10788 C CG  . ARG F 3 25  ? 206.341 -81.945  8.243   1.00 175.88 ? 16  ARG F CG  1 
ATOM   10789 C CD  . ARG F 3 25  ? 206.192 -80.986  7.069   1.00 172.52 ? 16  ARG F CD  1 
ATOM   10790 N NE  . ARG F 3 25  ? 207.149 -81.255  5.992   1.00 169.57 ? 16  ARG F NE  1 
ATOM   10791 C CZ  . ARG F 3 25  ? 207.185 -80.609  4.825   1.00 166.83 ? 16  ARG F CZ  1 
ATOM   10792 N NH1 . ARG F 3 25  ? 206.316 -79.643  4.557   1.00 166.36 ? 16  ARG F NH1 1 
ATOM   10793 N NH2 . ARG F 3 25  ? 208.098 -80.930  3.918   1.00 164.00 ? 16  ARG F NH2 1 
ATOM   10794 N N   . VAL F 3 26  ? 203.744 -85.516  9.515   1.00 177.66 ? 17  VAL F N   1 
ATOM   10795 C CA  . VAL F 3 26  ? 202.638 -86.434  9.241   1.00 177.38 ? 17  VAL F CA  1 
ATOM   10796 C C   . VAL F 3 26  ? 201.544 -85.694  8.465   1.00 180.84 ? 17  VAL F C   1 
ATOM   10797 O O   . VAL F 3 26  ? 201.269 -84.521  8.733   1.00 180.02 ? 17  VAL F O   1 
ATOM   10798 C CB  . VAL F 3 26  ? 202.090 -87.105  10.531  1.00 174.34 ? 17  VAL F CB  1 
ATOM   10799 C CG1 . VAL F 3 26  ? 201.455 -86.087  11.473  1.00 171.69 ? 17  VAL F CG1 1 
ATOM   10800 C CG2 . VAL F 3 26  ? 201.097 -88.208  10.189  1.00 173.65 ? 17  VAL F CG2 1 
ATOM   10801 N N   . ALA F 3 27  ? 200.942 -86.382  7.496   1.00 186.61 ? 18  ALA F N   1 
ATOM   10802 C CA  . ALA F 3 27  ? 199.920 -85.788  6.633   1.00 191.43 ? 18  ALA F CA  1 
ATOM   10803 C C   . ALA F 3 27  ? 198.653 -85.418  7.400   1.00 193.24 ? 18  ALA F C   1 
ATOM   10804 O O   . ALA F 3 27  ? 198.186 -84.283  7.316   1.00 193.49 ? 18  ALA F O   1 
ATOM   10805 C CB  . ALA F 3 27  ? 199.597 -86.714  5.470   1.00 192.92 ? 18  ALA F CB  1 
ATOM   10806 N N   . LEU F 3 28  ? 198.108 -86.377  8.145   1.00 193.44 ? 19  LEU F N   1 
ATOM   10807 C CA  . LEU F 3 28  ? 196.944 -86.129  8.989   1.00 193.64 ? 19  LEU F CA  1 
ATOM   10808 C C   . LEU F 3 28  ? 197.268 -86.397  10.456  1.00 197.22 ? 19  LEU F C   1 
ATOM   10809 O O   . LEU F 3 28  ? 197.702 -87.496  10.811  1.00 195.90 ? 19  LEU F O   1 
ATOM   10810 C CB  . LEU F 3 28  ? 195.741 -86.977  8.544   1.00 188.43 ? 19  LEU F CB  1 
ATOM   10811 C CG  . LEU F 3 28  ? 195.069 -86.735  7.184   1.00 184.46 ? 19  LEU F CG  1 
ATOM   10812 C CD1 . LEU F 3 28  ? 193.920 -87.712  6.982   1.00 180.22 ? 19  LEU F CD1 1 
ATOM   10813 C CD2 . LEU F 3 28  ? 194.571 -85.304  7.030   1.00 183.69 ? 19  LEU F CD2 1 
ATOM   10814 N N   . VAL F 3 29  ? 197.077 -85.380  11.296  1.00 202.38 ? 20  VAL F N   1 
ATOM   10815 C CA  . VAL F 3 29  ? 197.133 -85.549  12.751  1.00 205.97 ? 20  VAL F CA  1 
ATOM   10816 C C   . VAL F 3 29  ? 195.816 -86.198  13.209  1.00 211.87 ? 20  VAL F C   1 
ATOM   10817 O O   . VAL F 3 29  ? 194.789 -86.027  12.545  1.00 215.91 ? 20  VAL F O   1 
ATOM   10818 C CB  . VAL F 3 29  ? 197.411 -84.214  13.500  1.00 202.58 ? 20  VAL F CB  1 
ATOM   10819 C CG1 . VAL F 3 29  ? 198.777 -83.654  13.121  1.00 199.46 ? 20  VAL F CG1 1 
ATOM   10820 C CG2 . VAL F 3 29  ? 196.318 -83.183  13.245  1.00 202.16 ? 20  VAL F CG2 1 
ATOM   10821 N N   . PRO F 3 30  ? 195.838 -86.953  14.330  1.00 214.44 ? 21  PRO F N   1 
ATOM   10822 C CA  . PRO F 3 30  ? 194.643 -87.686  14.779  1.00 213.22 ? 21  PRO F CA  1 
ATOM   10823 C C   . PRO F 3 30  ? 193.438 -86.778  15.016  1.00 209.33 ? 21  PRO F C   1 
ATOM   10824 O O   . PRO F 3 30  ? 192.294 -87.209  14.848  1.00 210.50 ? 21  PRO F O   1 
ATOM   10825 C CB  . PRO F 3 30  ? 195.087 -88.313  16.107  1.00 215.69 ? 21  PRO F CB  1 
ATOM   10826 C CG  . PRO F 3 30  ? 196.572 -88.353  16.039  1.00 217.63 ? 21  PRO F CG  1 
ATOM   10827 C CD  . PRO F 3 30  ? 196.966 -87.136  15.260  1.00 216.64 ? 21  PRO F CD  1 
ATOM   10828 N N   . GLU F 3 31  ? 193.712 -85.531  15.393  1.00 203.06 ? 22  GLU F N   1 
ATOM   10829 C CA  . GLU F 3 31  ? 192.688 -84.528  15.674  1.00 198.19 ? 22  GLU F CA  1 
ATOM   10830 C C   . GLU F 3 31  ? 191.885 -84.130  14.423  1.00 192.60 ? 22  GLU F C   1 
ATOM   10831 O O   . GLU F 3 31  ? 190.722 -83.727  14.527  1.00 191.97 ? 22  GLU F O   1 
ATOM   10832 C CB  . GLU F 3 31  ? 193.346 -83.310  16.335  1.00 200.48 ? 22  GLU F CB  1 
ATOM   10833 C CG  . GLU F 3 31  ? 192.388 -82.313  16.969  1.00 206.37 ? 22  GLU F CG  1 
ATOM   10834 C CD  . GLU F 3 31  ? 192.065 -81.150  16.050  1.00 210.82 ? 22  GLU F CD  1 
ATOM   10835 O OE1 . GLU F 3 31  ? 193.010 -80.548  15.490  1.00 215.59 ? 22  GLU F OE1 1 
ATOM   10836 O OE2 . GLU F 3 31  ? 190.867 -80.831  15.895  1.00 212.21 ? 22  GLU F OE2 1 
ATOM   10837 N N   . VAL F 3 32  ? 192.508 -84.254  13.251  1.00 186.16 ? 23  VAL F N   1 
ATOM   10838 C CA  . VAL F 3 32  ? 191.852 -83.964  11.970  1.00 179.81 ? 23  VAL F CA  1 
ATOM   10839 C C   . VAL F 3 32  ? 191.074 -85.177  11.449  1.00 173.67 ? 23  VAL F C   1 
ATOM   10840 O O   . VAL F 3 32  ? 189.947 -85.037  10.966  1.00 171.59 ? 23  VAL F O   1 
ATOM   10841 C CB  . VAL F 3 32  ? 192.866 -83.458  10.916  1.00 181.71 ? 23  VAL F CB  1 
ATOM   10842 C CG1 . VAL F 3 32  ? 192.301 -83.553  9.505   1.00 181.46 ? 23  VAL F CG1 1 
ATOM   10843 C CG2 . VAL F 3 32  ? 193.275 -82.025  11.226  1.00 183.20 ? 23  VAL F CG2 1 
ATOM   10844 N N   . VAL F 3 33  ? 191.684 -86.358  11.556  1.00 168.10 ? 24  VAL F N   1 
ATOM   10845 C CA  . VAL F 3 33  ? 191.047 -87.625  11.184  1.00 163.96 ? 24  VAL F CA  1 
ATOM   10846 C C   . VAL F 3 33  ? 189.667 -87.762  11.840  1.00 164.72 ? 24  VAL F C   1 
ATOM   10847 O O   . VAL F 3 33  ? 188.731 -88.278  11.228  1.00 164.10 ? 24  VAL F O   1 
ATOM   10848 C CB  . VAL F 3 33  ? 191.958 -88.831  11.531  1.00 161.50 ? 24  VAL F CB  1 
ATOM   10849 C CG1 . VAL F 3 33  ? 191.190 -90.145  11.510  1.00 160.46 ? 24  VAL F CG1 1 
ATOM   10850 C CG2 . VAL F 3 33  ? 193.142 -88.896  10.575  1.00 159.91 ? 24  VAL F CG2 1 
ATOM   10851 N N   . ALA F 3 34  ? 189.549 -87.269  13.073  1.00 167.09 ? 25  ALA F N   1 
ATOM   10852 C CA  . ALA F 3 34  ? 188.290 -87.286  13.823  1.00 169.99 ? 25  ALA F CA  1 
ATOM   10853 C C   . ALA F 3 34  ? 187.187 -86.445  13.174  1.00 170.79 ? 25  ALA F C   1 
ATOM   10854 O O   . ALA F 3 34  ? 186.012 -86.811  13.234  1.00 171.85 ? 25  ALA F O   1 
ATOM   10855 C CB  . ALA F 3 34  ? 188.523 -86.838  15.259  1.00 172.21 ? 25  ALA F CB  1 
ATOM   10856 N N   . ARG F 3 35  ? 187.570 -85.323  12.565  1.00 170.67 ? 26  ARG F N   1 
ATOM   10857 C CA  . ARG F 3 35  ? 186.636 -84.474  11.820  1.00 170.67 ? 26  ARG F CA  1 
ATOM   10858 C C   . ARG F 3 35  ? 186.175 -85.160  10.538  1.00 170.74 ? 26  ARG F C   1 
ATOM   10859 O O   . ARG F 3 35  ? 185.110 -84.846  10.002  1.00 166.12 ? 26  ARG F O   1 
ATOM   10860 C CB  . ARG F 3 35  ? 187.293 -83.146  11.452  1.00 171.84 ? 26  ARG F CB  1 
ATOM   10861 C CG  . ARG F 3 35  ? 187.533 -82.178  12.594  1.00 175.35 ? 26  ARG F CG  1 
ATOM   10862 C CD  . ARG F 3 35  ? 188.152 -80.909  12.034  1.00 179.97 ? 26  ARG F CD  1 
ATOM   10863 N NE  . ARG F 3 35  ? 188.357 -79.875  13.045  1.00 184.19 ? 26  ARG F NE  1 
ATOM   10864 C CZ  . ARG F 3 35  ? 188.771 -78.638  12.779  1.00 186.79 ? 26  ARG F CZ  1 
ATOM   10865 N NH1 . ARG F 3 35  ? 188.929 -77.768  13.767  1.00 188.07 ? 26  ARG F NH1 1 
ATOM   10866 N NH2 . ARG F 3 35  ? 189.026 -78.266  11.529  1.00 187.45 ? 26  ARG F NH2 1 
ATOM   10867 N N   . LEU F 3 36  ? 187.003 -86.081  10.048  1.00 175.55 ? 27  LEU F N   1 
ATOM   10868 C CA  . LEU F 3 36  ? 186.721 -86.846  8.837   1.00 180.90 ? 27  LEU F CA  1 
ATOM   10869 C C   . LEU F 3 36  ? 185.912 -88.105  9.140   1.00 181.35 ? 27  LEU F C   1 
ATOM   10870 O O   . LEU F 3 36  ? 185.062 -88.502  8.344   1.00 181.54 ? 27  LEU F O   1 
ATOM   10871 C CB  . LEU F 3 36  ? 188.027 -87.224  8.131   1.00 185.65 ? 27  LEU F CB  1 
ATOM   10872 C CG  . LEU F 3 36  ? 188.888 -86.102  7.544   1.00 188.95 ? 27  LEU F CG  1 
ATOM   10873 C CD1 . LEU F 3 36  ? 190.349 -86.525  7.475   1.00 189.20 ? 27  LEU F CD1 1 
ATOM   10874 C CD2 . LEU F 3 36  ? 188.378 -85.677  6.173   1.00 191.82 ? 27  LEU F CD2 1 
A