data_4OE4
# 
_entry.id   4OE4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OE4         
RCSB  RCSB084377   
WWPDB D_1000084377 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OE5 . unspecified 
PDB 4OE6 . unspecified 
# 
_pdbx_database_status.entry_id                        4OE4 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-11 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Tanner, J.J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
;Structural Studies of Yeast Delta (1)-Pyrroline-5-carboxylate Dehydrogenase (ALDH4A1): Active Site Flexibility and Oligomeric State.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            53 
_citation.page_first                1350 
_citation.page_last                 1359 
_citation.year                      2014 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24502590 
_citation.pdbx_database_id_DOI      10.1021/bi500048b 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pemberton, T.A.' 1 
primary 'Srivastava, D.'  2 
primary 'Sanyal, N.'      3 
primary 'Henzl, M.T.'     4 
primary 'Becker, D.F.'    5 
primary 'Tanner, J.J.'    6 
# 
_cell.length_a           108.037 
_cell.length_b           108.037 
_cell.length_c           181.027 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4OE4 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.entry_id                         4OE4 
_symmetry.Int_Tables_number                173 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial' 65111.254 2   1.2.1.88 ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                              663.425   2   ?        ? ? ? 
3 water       nat water                                                          18.015    173 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'P5C dehydrogenase, L-glutamate gamma-semialdehyde dehydrogenase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDHHHHHHHHASENLYFQGHMKPPKHIRNEPVKPFRNIDLKDWDLLRASLMKFKSSSLEVPLVINGERIYDNNERALFPQ
TNPANHQQVLANVTQATEKDVMNAVKAAKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEID
CITELSDFFRYYVKYASDLYAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAAL
SNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIGETGGK
NFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMNTSASPISGGNLRGFMGP
VIHEQSFDKLVKVIEDAKKDPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDII
DNTSQYALTGAIFAKDRKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTKEN
FYELTDFKYPSNYEELGSGC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDHHHHHHHHASENLYFQGHMKPPKHIRNEPVKPFRNIDLKDWDLLRASLMKFKSSSLEVPLVINGERIYDNNERALFPQ
TNPANHQQVLANVTQATEKDVMNAVKAAKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEID
CITELSDFFRYYVKYASDLYAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAAL
SNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIGETGGK
NFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMNTSASPISGGNLRGFMGP
VIHEQSFDKLVKVIEDAKKDPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDII
DNTSQYALTGAIFAKDRKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTKEN
FYELTDFKYPSNYEELGSGC
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  ALA n 
1 12  SER n 
1 13  GLU n 
1 14  ASN n 
1 15  LEU n 
1 16  TYR n 
1 17  PHE n 
1 18  GLN n 
1 19  GLY n 
1 20  HIS n 
1 21  MET n 
1 22  LYS n 
1 23  PRO n 
1 24  PRO n 
1 25  LYS n 
1 26  HIS n 
1 27  ILE n 
1 28  ARG n 
1 29  ASN n 
1 30  GLU n 
1 31  PRO n 
1 32  VAL n 
1 33  LYS n 
1 34  PRO n 
1 35  PHE n 
1 36  ARG n 
1 37  ASN n 
1 38  ILE n 
1 39  ASP n 
1 40  LEU n 
1 41  LYS n 
1 42  ASP n 
1 43  TRP n 
1 44  ASP n 
1 45  LEU n 
1 46  LEU n 
1 47  ARG n 
1 48  ALA n 
1 49  SER n 
1 50  LEU n 
1 51  MET n 
1 52  LYS n 
1 53  PHE n 
1 54  LYS n 
1 55  SER n 
1 56  SER n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  VAL n 
1 61  PRO n 
1 62  LEU n 
1 63  VAL n 
1 64  ILE n 
1 65  ASN n 
1 66  GLY n 
1 67  GLU n 
1 68  ARG n 
1 69  ILE n 
1 70  TYR n 
1 71  ASP n 
1 72  ASN n 
1 73  ASN n 
1 74  GLU n 
1 75  ARG n 
1 76  ALA n 
1 77  LEU n 
1 78  PHE n 
1 79  PRO n 
1 80  GLN n 
1 81  THR n 
1 82  ASN n 
1 83  PRO n 
1 84  ALA n 
1 85  ASN n 
1 86  HIS n 
1 87  GLN n 
1 88  GLN n 
1 89  VAL n 
1 90  LEU n 
1 91  ALA n 
1 92  ASN n 
1 93  VAL n 
1 94  THR n 
1 95  GLN n 
1 96  ALA n 
1 97  THR n 
1 98  GLU n 
1 99  LYS n 
1 100 ASP n 
1 101 VAL n 
1 102 MET n 
1 103 ASN n 
1 104 ALA n 
1 105 VAL n 
1 106 LYS n 
1 107 ALA n 
1 108 ALA n 
1 109 LYS n 
1 110 ASP n 
1 111 ALA n 
1 112 LYS n 
1 113 LYS n 
1 114 ASP n 
1 115 TRP n 
1 116 TYR n 
1 117 ASN n 
1 118 LEU n 
1 119 PRO n 
1 120 PHE n 
1 121 TYR n 
1 122 ASP n 
1 123 ARG n 
1 124 SER n 
1 125 ALA n 
1 126 ILE n 
1 127 PHE n 
1 128 LEU n 
1 129 LYS n 
1 130 ALA n 
1 131 ALA n 
1 132 ASP n 
1 133 LEU n 
1 134 ILE n 
1 135 SER n 
1 136 THR n 
1 137 LYS n 
1 138 TYR n 
1 139 ARG n 
1 140 TYR n 
1 141 ASP n 
1 142 MET n 
1 143 LEU n 
1 144 ALA n 
1 145 ALA n 
1 146 THR n 
1 147 MET n 
1 148 LEU n 
1 149 GLY n 
1 150 GLN n 
1 151 GLY n 
1 152 LYS n 
1 153 ASN n 
1 154 VAL n 
1 155 TYR n 
1 156 GLN n 
1 157 ALA n 
1 158 GLU n 
1 159 ILE n 
1 160 ASP n 
1 161 CYS n 
1 162 ILE n 
1 163 THR n 
1 164 GLU n 
1 165 LEU n 
1 166 SER n 
1 167 ASP n 
1 168 PHE n 
1 169 PHE n 
1 170 ARG n 
1 171 TYR n 
1 172 TYR n 
1 173 VAL n 
1 174 LYS n 
1 175 TYR n 
1 176 ALA n 
1 177 SER n 
1 178 ASP n 
1 179 LEU n 
1 180 TYR n 
1 181 ALA n 
1 182 GLN n 
1 183 GLN n 
1 184 PRO n 
1 185 VAL n 
1 186 GLU n 
1 187 SER n 
1 188 ALA n 
1 189 ASP n 
1 190 GLY n 
1 191 THR n 
1 192 TRP n 
1 193 ASN n 
1 194 LYS n 
1 195 ALA n 
1 196 GLU n 
1 197 TYR n 
1 198 ARG n 
1 199 PRO n 
1 200 LEU n 
1 201 GLU n 
1 202 GLY n 
1 203 PHE n 
1 204 VAL n 
1 205 TYR n 
1 206 ALA n 
1 207 VAL n 
1 208 SER n 
1 209 PRO n 
1 210 PHE n 
1 211 ASN n 
1 212 PHE n 
1 213 THR n 
1 214 ALA n 
1 215 ILE n 
1 216 ALA n 
1 217 ALA n 
1 218 ASN n 
1 219 LEU n 
1 220 ILE n 
1 221 GLY n 
1 222 ALA n 
1 223 PRO n 
1 224 ALA n 
1 225 LEU n 
1 226 MET n 
1 227 GLY n 
1 228 ASN n 
1 229 THR n 
1 230 VAL n 
1 231 VAL n 
1 232 TRP n 
1 233 LYS n 
1 234 PRO n 
1 235 SER n 
1 236 GLN n 
1 237 THR n 
1 238 ALA n 
1 239 ALA n 
1 240 LEU n 
1 241 SER n 
1 242 ASN n 
1 243 TYR n 
1 244 LEU n 
1 245 LEU n 
1 246 MET n 
1 247 THR n 
1 248 VAL n 
1 249 LEU n 
1 250 GLU n 
1 251 GLU n 
1 252 ALA n 
1 253 GLY n 
1 254 LEU n 
1 255 PRO n 
1 256 LYS n 
1 257 GLY n 
1 258 VAL n 
1 259 ILE n 
1 260 ASN n 
1 261 PHE n 
1 262 ILE n 
1 263 PRO n 
1 264 GLY n 
1 265 ASP n 
1 266 PRO n 
1 267 VAL n 
1 268 GLN n 
1 269 VAL n 
1 270 THR n 
1 271 ASP n 
1 272 GLN n 
1 273 VAL n 
1 274 LEU n 
1 275 ALA n 
1 276 ASP n 
1 277 LYS n 
1 278 ASP n 
1 279 PHE n 
1 280 GLY n 
1 281 ALA n 
1 282 LEU n 
1 283 HIS n 
1 284 PHE n 
1 285 THR n 
1 286 GLY n 
1 287 SER n 
1 288 THR n 
1 289 ASN n 
1 290 VAL n 
1 291 PHE n 
1 292 LYS n 
1 293 SER n 
1 294 LEU n 
1 295 TYR n 
1 296 GLY n 
1 297 LYS n 
1 298 ILE n 
1 299 GLN n 
1 300 SER n 
1 301 GLY n 
1 302 VAL n 
1 303 VAL n 
1 304 GLU n 
1 305 GLY n 
1 306 LYS n 
1 307 TYR n 
1 308 ARG n 
1 309 ASP n 
1 310 TYR n 
1 311 PRO n 
1 312 ARG n 
1 313 ILE n 
1 314 ILE n 
1 315 GLY n 
1 316 GLU n 
1 317 THR n 
1 318 GLY n 
1 319 GLY n 
1 320 LYS n 
1 321 ASN n 
1 322 PHE n 
1 323 HIS n 
1 324 LEU n 
1 325 VAL n 
1 326 HIS n 
1 327 PRO n 
1 328 SER n 
1 329 ALA n 
1 330 ASN n 
1 331 ILE n 
1 332 SER n 
1 333 HIS n 
1 334 ALA n 
1 335 VAL n 
1 336 LEU n 
1 337 SER n 
1 338 THR n 
1 339 ILE n 
1 340 ARG n 
1 341 GLY n 
1 342 THR n 
1 343 PHE n 
1 344 GLU n 
1 345 PHE n 
1 346 GLN n 
1 347 GLY n 
1 348 GLN n 
1 349 LYS n 
1 350 CYS n 
1 351 SER n 
1 352 ALA n 
1 353 ALA n 
1 354 SER n 
1 355 ARG n 
1 356 LEU n 
1 357 TYR n 
1 358 LEU n 
1 359 PRO n 
1 360 GLU n 
1 361 SER n 
1 362 LYS n 
1 363 SER n 
1 364 GLU n 
1 365 GLU n 
1 366 PHE n 
1 367 LEU n 
1 368 SER n 
1 369 ASP n 
1 370 MET n 
1 371 PHE n 
1 372 GLY n 
1 373 ILE n 
1 374 LEU n 
1 375 GLN n 
1 376 SER n 
1 377 GLN n 
1 378 ASN n 
1 379 VAL n 
1 380 VAL n 
1 381 PRO n 
1 382 MET n 
1 383 ASN n 
1 384 THR n 
1 385 SER n 
1 386 ALA n 
1 387 SER n 
1 388 PRO n 
1 389 ILE n 
1 390 SER n 
1 391 GLY n 
1 392 GLY n 
1 393 ASN n 
1 394 LEU n 
1 395 ARG n 
1 396 GLY n 
1 397 PHE n 
1 398 MET n 
1 399 GLY n 
1 400 PRO n 
1 401 VAL n 
1 402 ILE n 
1 403 HIS n 
1 404 GLU n 
1 405 GLN n 
1 406 SER n 
1 407 PHE n 
1 408 ASP n 
1 409 LYS n 
1 410 LEU n 
1 411 VAL n 
1 412 LYS n 
1 413 VAL n 
1 414 ILE n 
1 415 GLU n 
1 416 ASP n 
1 417 ALA n 
1 418 LYS n 
1 419 LYS n 
1 420 ASP n 
1 421 PRO n 
1 422 GLU n 
1 423 LEU n 
1 424 GLU n 
1 425 ILE n 
1 426 LEU n 
1 427 TYR n 
1 428 GLY n 
1 429 GLY n 
1 430 GLN n 
1 431 TYR n 
1 432 ASP n 
1 433 LYS n 
1 434 SER n 
1 435 GLN n 
1 436 GLY n 
1 437 TRP n 
1 438 PHE n 
1 439 VAL n 
1 440 GLY n 
1 441 PRO n 
1 442 THR n 
1 443 VAL n 
1 444 ILE n 
1 445 LYS n 
1 446 ALA n 
1 447 LYS n 
1 448 ARG n 
1 449 PRO n 
1 450 ASP n 
1 451 HIS n 
1 452 PRO n 
1 453 TYR n 
1 454 MET n 
1 455 SER n 
1 456 THR n 
1 457 GLU n 
1 458 PHE n 
1 459 PHE n 
1 460 GLY n 
1 461 PRO n 
1 462 ILE n 
1 463 LEU n 
1 464 THR n 
1 465 VAL n 
1 466 TYR n 
1 467 GLU n 
1 468 TYR n 
1 469 PRO n 
1 470 ASP n 
1 471 THR n 
1 472 GLU n 
1 473 PHE n 
1 474 ASN n 
1 475 GLU n 
1 476 ILE n 
1 477 CYS n 
1 478 ASP n 
1 479 ILE n 
1 480 ILE n 
1 481 ASP n 
1 482 ASN n 
1 483 THR n 
1 484 SER n 
1 485 GLN n 
1 486 TYR n 
1 487 ALA n 
1 488 LEU n 
1 489 THR n 
1 490 GLY n 
1 491 ALA n 
1 492 ILE n 
1 493 PHE n 
1 494 ALA n 
1 495 LYS n 
1 496 ASP n 
1 497 ARG n 
1 498 LYS n 
1 499 ALA n 
1 500 ILE n 
1 501 GLU n 
1 502 TYR n 
1 503 ALA n 
1 504 ASP n 
1 505 GLU n 
1 506 LYS n 
1 507 LEU n 
1 508 LYS n 
1 509 PHE n 
1 510 SER n 
1 511 ALA n 
1 512 GLY n 
1 513 ASN n 
1 514 PHE n 
1 515 TYR n 
1 516 ILE n 
1 517 ASN n 
1 518 ASP n 
1 519 LYS n 
1 520 CYS n 
1 521 THR n 
1 522 GLY n 
1 523 ALA n 
1 524 VAL n 
1 525 VAL n 
1 526 SER n 
1 527 GLN n 
1 528 GLN n 
1 529 TRP n 
1 530 PHE n 
1 531 GLY n 
1 532 GLY n 
1 533 ALA n 
1 534 ARG n 
1 535 MET n 
1 536 SER n 
1 537 GLY n 
1 538 THR n 
1 539 ASP n 
1 540 ASP n 
1 541 LYS n 
1 542 ALA n 
1 543 GLY n 
1 544 GLY n 
1 545 PRO n 
1 546 ASN n 
1 547 ILE n 
1 548 LEU n 
1 549 SER n 
1 550 ARG n 
1 551 PHE n 
1 552 VAL n 
1 553 SER n 
1 554 ILE n 
1 555 ARG n 
1 556 ASN n 
1 557 THR n 
1 558 LYS n 
1 559 GLU n 
1 560 ASN n 
1 561 PHE n 
1 562 TYR n 
1 563 GLU n 
1 564 LEU n 
1 565 THR n 
1 566 ASP n 
1 567 PHE n 
1 568 LYS n 
1 569 TYR n 
1 570 PRO n 
1 571 SER n 
1 572 ASN n 
1 573 TYR n 
1 574 GLU n 
1 575 GLU n 
1 576 LEU n 
1 577 GLY n 
1 578 SER n 
1 579 GLY n 
1 580 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;Baker's yeast
;
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PUT2, YHR037W' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    s288c 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     559292 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmd 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pkA8H 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PUT2_YEAST 
_struct_ref.pdbx_db_accession          P07275 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KPPKHIRNEPVKPFRNIDLKDWDLLRASLMKFKSSSLEVPLVINGERIYDNNERALFPQTNPANHQQVLANVTQATEKDV
MNAVKAAKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYA
QQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVINF
IPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRG
TFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMNTSASPISGGNLRGFMGPVIHEQSFDKLVKVIEDAKKDP
ELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDIIDNTSQYALTGAIFAKDRKAIE
YADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTKENFYELTDFKYPSNYE
;
_struct_ref.pdbx_align_begin           23 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4OE4 A 22 ? 574 ? P07275 23 ? 575 ? 23 575 
2 1 4OE4 B 22 ? 574 ? P07275 23 ? 575 ? 23 575 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4OE4 MET A 1   ? UNP P07275 ? ? 'EXPRESSION TAG' 2   1  
1 4OE4 ASP A 2   ? UNP P07275 ? ? 'EXPRESSION TAG' 3   2  
1 4OE4 HIS A 3   ? UNP P07275 ? ? 'EXPRESSION TAG' 4   3  
1 4OE4 HIS A 4   ? UNP P07275 ? ? 'EXPRESSION TAG' 5   4  
1 4OE4 HIS A 5   ? UNP P07275 ? ? 'EXPRESSION TAG' 6   5  
1 4OE4 HIS A 6   ? UNP P07275 ? ? 'EXPRESSION TAG' 7   6  
1 4OE4 HIS A 7   ? UNP P07275 ? ? 'EXPRESSION TAG' 8   7  
1 4OE4 HIS A 8   ? UNP P07275 ? ? 'EXPRESSION TAG' 9   8  
1 4OE4 HIS A 9   ? UNP P07275 ? ? 'EXPRESSION TAG' 10  9  
1 4OE4 HIS A 10  ? UNP P07275 ? ? 'EXPRESSION TAG' 11  10 
1 4OE4 ALA A 11  ? UNP P07275 ? ? 'EXPRESSION TAG' 12  11 
1 4OE4 SER A 12  ? UNP P07275 ? ? 'EXPRESSION TAG' 13  12 
1 4OE4 GLU A 13  ? UNP P07275 ? ? 'EXPRESSION TAG' 14  13 
1 4OE4 ASN A 14  ? UNP P07275 ? ? 'EXPRESSION TAG' 15  14 
1 4OE4 LEU A 15  ? UNP P07275 ? ? 'EXPRESSION TAG' 16  15 
1 4OE4 TYR A 16  ? UNP P07275 ? ? 'EXPRESSION TAG' 17  16 
1 4OE4 PHE A 17  ? UNP P07275 ? ? 'EXPRESSION TAG' 18  17 
1 4OE4 GLN A 18  ? UNP P07275 ? ? 'EXPRESSION TAG' 19  18 
1 4OE4 GLY A 19  ? UNP P07275 ? ? 'EXPRESSION TAG' 20  19 
1 4OE4 HIS A 20  ? UNP P07275 ? ? 'EXPRESSION TAG' 21  20 
1 4OE4 MET A 21  ? UNP P07275 ? ? 'EXPRESSION TAG' 22  21 
1 4OE4 GLU A 575 ? UNP P07275 ? ? 'EXPRESSION TAG' 576 22 
1 4OE4 LEU A 576 ? UNP P07275 ? ? 'EXPRESSION TAG' 577 23 
1 4OE4 GLY A 577 ? UNP P07275 ? ? 'EXPRESSION TAG' 578 24 
1 4OE4 SER A 578 ? UNP P07275 ? ? 'EXPRESSION TAG' 579 25 
1 4OE4 GLY A 579 ? UNP P07275 ? ? 'EXPRESSION TAG' 580 26 
1 4OE4 CYS A 580 ? UNP P07275 ? ? 'EXPRESSION TAG' 581 27 
2 4OE4 MET B 1   ? UNP P07275 ? ? 'EXPRESSION TAG' 2   28 
2 4OE4 ASP B 2   ? UNP P07275 ? ? 'EXPRESSION TAG' 3   29 
2 4OE4 HIS B 3   ? UNP P07275 ? ? 'EXPRESSION TAG' 4   30 
2 4OE4 HIS B 4   ? UNP P07275 ? ? 'EXPRESSION TAG' 5   31 
2 4OE4 HIS B 5   ? UNP P07275 ? ? 'EXPRESSION TAG' 6   32 
2 4OE4 HIS B 6   ? UNP P07275 ? ? 'EXPRESSION TAG' 7   33 
2 4OE4 HIS B 7   ? UNP P07275 ? ? 'EXPRESSION TAG' 8   34 
2 4OE4 HIS B 8   ? UNP P07275 ? ? 'EXPRESSION TAG' 9   35 
2 4OE4 HIS B 9   ? UNP P07275 ? ? 'EXPRESSION TAG' 10  36 
2 4OE4 HIS B 10  ? UNP P07275 ? ? 'EXPRESSION TAG' 11  37 
2 4OE4 ALA B 11  ? UNP P07275 ? ? 'EXPRESSION TAG' 12  38 
2 4OE4 SER B 12  ? UNP P07275 ? ? 'EXPRESSION TAG' 13  39 
2 4OE4 GLU B 13  ? UNP P07275 ? ? 'EXPRESSION TAG' 14  40 
2 4OE4 ASN B 14  ? UNP P07275 ? ? 'EXPRESSION TAG' 15  41 
2 4OE4 LEU B 15  ? UNP P07275 ? ? 'EXPRESSION TAG' 16  42 
2 4OE4 TYR B 16  ? UNP P07275 ? ? 'EXPRESSION TAG' 17  43 
2 4OE4 PHE B 17  ? UNP P07275 ? ? 'EXPRESSION TAG' 18  44 
2 4OE4 GLN B 18  ? UNP P07275 ? ? 'EXPRESSION TAG' 19  45 
2 4OE4 GLY B 19  ? UNP P07275 ? ? 'EXPRESSION TAG' 20  46 
2 4OE4 HIS B 20  ? UNP P07275 ? ? 'EXPRESSION TAG' 21  47 
2 4OE4 MET B 21  ? UNP P07275 ? ? 'EXPRESSION TAG' 22  48 
2 4OE4 GLU B 575 ? UNP P07275 ? ? 'EXPRESSION TAG' 576 49 
2 4OE4 LEU B 576 ? UNP P07275 ? ? 'EXPRESSION TAG' 577 50 
2 4OE4 GLY B 577 ? UNP P07275 ? ? 'EXPRESSION TAG' 578 51 
2 4OE4 SER B 578 ? UNP P07275 ? ? 'EXPRESSION TAG' 579 52 
2 4OE4 GLY B 579 ? UNP P07275 ? ? 'EXPRESSION TAG' 580 53 
2 4OE4 CYS B 580 ? UNP P07275 ? ? 'EXPRESSION TAG' 581 54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4OE4 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   47.48 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;8 - 14 % (w/v) polyethylene glycol (PEG) 3350, 0.1 M (NH4)2SO4, and 0.1 M Bis-Tris at pH 5.5 - 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-07-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
# 
_reflns.entry_id                     4OE4 
_reflns.d_resolution_high            2.168 
_reflns.d_resolution_low             93.563 
_reflns.number_all                   63148 
_reflns.number_obs                   63148 
_reflns.pdbx_netI_over_sigmaI        16.500 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_redundancy              4.400 
_reflns.percent_possible_obs         99.800 
_reflns.B_iso_Wilson_estimate        38.040 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.170 2.290  ? 39868 ? 0.583 1.300  0.583 ? 4.400 ? 9112 98.900  1  1 
2.290 2.420  ? 38522 ? 0.389 1.900  0.389 ? 4.400 ? 8717 100.000 2  1 
2.420 2.590  ? 36155 ? 0.256 3.000  0.256 ? 4.400 ? 8183 100.000 3  1 
2.590 2.800  ? 33708 ? 0.163 4.600  0.163 ? 4.400 ? 7646 100.000 4  1 
2.800 3.070  ? 30978 ? 0.100 7.500  0.100 ? 4.400 ? 7038 100.000 5  1 
3.070 3.430  ? 27723 ? 0.058 12.600 0.058 ? 4.400 ? 6346 100.000 6  1 
3.430 3.960  ? 23929 ? 0.034 20.400 0.034 ? 4.300 ? 5627 99.900  7  1 
3.960 4.850  ? 21177 ? 0.024 26.300 0.024 ? 4.500 ? 4751 99.900  8  1 
4.850 6.860  ? 16312 ? 0.023 26.800 0.023 ? 4.400 ? 3682 99.900  9  1 
6.860 93.563 ? 8730  ? 0.021 26.900 0.021 ? 4.300 ? 2046 99.400  10 1 
# 
_refine.entry_id                                 4OE4 
_refine.ls_d_res_high                            2.1680 
_refine.ls_d_res_low                             40.7410 
_refine.pdbx_ls_sigma_F                          1.610 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.7600 
_refine.ls_number_reflns_obs                     63090 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1745 
_refine.ls_R_factor_R_work                       0.1726 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2122 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.9200 
_refine.ls_number_reflns_R_free                  3107 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               39.5014 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2600 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'same structure without NAD' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8599 
_refine.B_iso_max                                99.580 
_refine.B_iso_min                                13.920 
_refine.pdbx_overall_phase_error                 21.8800 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.420 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7340 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             173 
_refine_hist.number_atoms_total               7575 
_refine_hist.d_res_high                       2.1680 
_refine_hist.d_res_low                        40.7410 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           7584  0.008  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          10327 1.087  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     1157  0.070  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      1326  0.005  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 2715  17.746 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.1681 2.2020  22 96.0000  2629 . 0.2349 0.2751 . 132 . 2761 . . 'X-RAY DIFFRACTION' 
2.2020 2.2381  22 100.0000 2708 . 0.2349 0.3085 . 142 . 2850 . . 'X-RAY DIFFRACTION' 
2.2381 2.2767  22 100.0000 2701 . 0.2251 0.3122 . 141 . 2842 . . 'X-RAY DIFFRACTION' 
2.2767 2.3181  22 100.0000 2755 . 0.2202 0.2700 . 151 . 2906 . . 'X-RAY DIFFRACTION' 
2.3181 2.3626  22 100.0000 2706 . 0.2185 0.2698 . 150 . 2856 . . 'X-RAY DIFFRACTION' 
2.3626 2.4109  22 100.0000 2705 . 0.2108 0.2716 . 144 . 2849 . . 'X-RAY DIFFRACTION' 
2.4109 2.4633  22 100.0000 2744 . 0.2008 0.2852 . 157 . 2901 . . 'X-RAY DIFFRACTION' 
2.4633 2.5206  22 100.0000 2712 . 0.1972 0.2424 . 139 . 2851 . . 'X-RAY DIFFRACTION' 
2.5206 2.5836  22 100.0000 2725 . 0.1897 0.2512 . 138 . 2863 . . 'X-RAY DIFFRACTION' 
2.5836 2.6534  22 100.0000 2726 . 0.1877 0.2431 . 139 . 2865 . . 'X-RAY DIFFRACTION' 
2.6534 2.7315  22 100.0000 2745 . 0.1861 0.2246 . 138 . 2883 . . 'X-RAY DIFFRACTION' 
2.7315 2.8196  22 100.0000 2746 . 0.1872 0.2569 . 127 . 2873 . . 'X-RAY DIFFRACTION' 
2.8196 2.9204  22 100.0000 2745 . 0.1812 0.2319 . 138 . 2883 . . 'X-RAY DIFFRACTION' 
2.9204 3.0373  22 100.0000 2714 . 0.1901 0.2295 . 131 . 2845 . . 'X-RAY DIFFRACTION' 
3.0373 3.1755  22 100.0000 2768 . 0.1998 0.2595 . 144 . 2912 . . 'X-RAY DIFFRACTION' 
3.1755 3.3428  22 100.0000 2721 . 0.2002 0.2322 . 142 . 2863 . . 'X-RAY DIFFRACTION' 
3.3428 3.5521  22 100.0000 2694 . 0.1815 0.2303 . 150 . 2844 . . 'X-RAY DIFFRACTION' 
3.5521 3.8262  22 100.0000 2752 . 0.1576 0.1745 . 136 . 2888 . . 'X-RAY DIFFRACTION' 
3.8262 4.2109  22 100.0000 2714 . 0.1390 0.1585 . 163 . 2877 . . 'X-RAY DIFFRACTION' 
4.2109 4.8194  22 100.0000 2756 . 0.1256 0.1476 . 120 . 2876 . . 'X-RAY DIFFRACTION' 
4.8194 6.0687  22 100.0000 2767 . 0.1470 0.1709 . 131 . 2898 . . 'X-RAY DIFFRACTION' 
6.0687 40.7481 22 99.0000  2750 . 0.1640 0.1950 . 154 . 2904 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OE4 
_struct.title                     'Crystal Structure of Yeast ALDH4A1 Complexed with NAD+' 
_struct.pdbx_descriptor           'Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial (E.C.1.2.1.88)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OE4 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'PUT2P, ALDEHYDE DEHYDROGENASE, ALDH4A1, ROSSMANN FOLD, OXIDOREDUCTASE, NAD, MITOCHONDRIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 42  ? SER A 56  ? ASP A 43  SER A 57  1 ? 15 
HELX_P HELX_P2  2  THR A 97  ? ASN A 117 ? THR A 98  ASN A 118 1 ? 21 
HELX_P HELX_P3  3  PRO A 119 ? THR A 136 ? PRO A 120 THR A 137 1 ? 18 
HELX_P HELX_P4  4  TYR A 138 ? GLY A 151 ? TYR A 139 GLY A 152 1 ? 14 
HELX_P HELX_P5  5  ASN A 153 ? ILE A 162 ? ASN A 154 ILE A 163 1 ? 10 
HELX_P HELX_P6  6  ILE A 162 ? ALA A 181 ? ILE A 163 ALA A 182 1 ? 20 
HELX_P HELX_P7  7  PHE A 212 ? MET A 226 ? PHE A 213 MET A 227 1 ? 15 
HELX_P HELX_P8  8  SER A 235 ? THR A 237 ? SER A 236 THR A 238 5 ? 3  
HELX_P HELX_P9  9  ALA A 238 ? ALA A 252 ? ALA A 239 ALA A 253 1 ? 15 
HELX_P HELX_P10 10 ASP A 265 ? ALA A 275 ? ASP A 266 ALA A 276 1 ? 11 
HELX_P HELX_P11 11 SER A 287 ? GLU A 304 ? SER A 288 GLU A 305 1 ? 18 
HELX_P HELX_P12 12 ASN A 330 ? GLU A 344 ? ASN A 331 GLU A 345 1 ? 15 
HELX_P HELX_P13 13 PHE A 345 ? GLN A 348 ? PHE A 346 GLN A 349 5 ? 4  
HELX_P HELX_P14 14 GLU A 360 ? GLN A 377 ? GLU A 361 GLN A 378 1 ? 18 
HELX_P HELX_P15 15 HIS A 403 ? ASP A 420 ? HIS A 404 ASP A 421 1 ? 18 
HELX_P HELX_P16 16 HIS A 451 ? SER A 455 ? HIS A 452 SER A 456 5 ? 5  
HELX_P HELX_P17 17 PRO A 469 ? THR A 471 ? PRO A 470 THR A 472 5 ? 3  
HELX_P HELX_P18 18 GLU A 472 ? ASN A 482 ? GLU A 473 ASN A 483 1 ? 11 
HELX_P HELX_P19 19 ASP A 496 ? LEU A 507 ? ASP A 497 LEU A 508 1 ? 12 
HELX_P HELX_P20 20 ILE A 547 ? ARG A 550 ? ILE A 548 ARG A 551 5 ? 4  
HELX_P HELX_P21 21 TRP B 43  ? SER B 56  ? TRP B 44  SER B 57  1 ? 14 
HELX_P HELX_P22 22 THR B 97  ? ASN B 117 ? THR B 98  ASN B 118 1 ? 21 
HELX_P HELX_P23 23 PRO B 119 ? THR B 136 ? PRO B 120 THR B 137 1 ? 18 
HELX_P HELX_P24 24 TYR B 138 ? GLY B 151 ? TYR B 139 GLY B 152 1 ? 14 
HELX_P HELX_P25 25 ASN B 153 ? ILE B 162 ? ASN B 154 ILE B 163 1 ? 10 
HELX_P HELX_P26 26 ILE B 162 ? TYR B 180 ? ILE B 163 TYR B 181 1 ? 19 
HELX_P HELX_P27 27 PHE B 212 ? MET B 226 ? PHE B 213 MET B 227 1 ? 15 
HELX_P HELX_P28 28 SER B 235 ? THR B 237 ? SER B 236 THR B 238 5 ? 3  
HELX_P HELX_P29 29 ALA B 238 ? ALA B 252 ? ALA B 239 ALA B 253 1 ? 15 
HELX_P HELX_P30 30 ASP B 265 ? LEU B 274 ? ASP B 266 LEU B 275 1 ? 10 
HELX_P HELX_P31 31 SER B 287 ? GLY B 305 ? SER B 288 GLY B 306 1 ? 19 
HELX_P HELX_P32 32 ASN B 330 ? GLU B 344 ? ASN B 331 GLU B 345 1 ? 15 
HELX_P HELX_P33 33 PHE B 345 ? GLN B 348 ? PHE B 346 GLN B 349 5 ? 4  
HELX_P HELX_P34 34 GLU B 360 ? GLN B 377 ? GLU B 361 GLN B 378 1 ? 18 
HELX_P HELX_P35 35 HIS B 403 ? ASP B 420 ? HIS B 404 ASP B 421 1 ? 18 
HELX_P HELX_P36 36 HIS B 451 ? SER B 455 ? HIS B 452 SER B 456 5 ? 5  
HELX_P HELX_P37 37 PRO B 469 ? THR B 471 ? PRO B 470 THR B 472 5 ? 3  
HELX_P HELX_P38 38 GLU B 472 ? THR B 483 ? GLU B 473 THR B 484 1 ? 12 
HELX_P HELX_P39 39 ASP B 496 ? LEU B 507 ? ASP B 497 LEU B 508 1 ? 12 
HELX_P HELX_P40 40 ILE B 547 ? ARG B 550 ? ILE B 548 ARG B 551 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 2  ? 
C ? 10 ? 
D ? 5  ? 
E ? 10 ? 
F ? 2  ? 
G ? 3  ? 
H ? 2  ? 
I ? 5  ? 
J ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? parallel      
A 2 3  ? anti-parallel 
B 1 2  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
C 3 4  ? parallel      
C 4 5  ? parallel      
C 5 6  ? parallel      
C 6 7  ? parallel      
C 7 8  ? parallel      
C 8 9  ? parallel      
C 9 10 ? anti-parallel 
D 1 2  ? parallel      
D 2 3  ? parallel      
D 3 4  ? parallel      
D 4 5  ? parallel      
E 1 2  ? anti-parallel 
E 2 3  ? parallel      
E 3 4  ? parallel      
E 4 5  ? parallel      
E 5 6  ? parallel      
E 6 7  ? parallel      
E 7 8  ? parallel      
E 8 9  ? anti-parallel 
E 9 10 ? anti-parallel 
F 1 2  ? anti-parallel 
G 1 2  ? parallel      
G 2 3  ? anti-parallel 
H 1 2  ? anti-parallel 
I 1 2  ? parallel      
I 2 3  ? parallel      
I 3 4  ? parallel      
I 4 5  ? parallel      
J 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 58  ? VAL A 60  ? LEU A 59  VAL A 61  
A 2  ASN A 85  ? THR A 94  ? ASN A 86  THR A 95  
A 3  LEU A 77  ? ASN A 82  ? LEU A 78  ASN A 83  
B 1  LEU A 62  ? ILE A 64  ? LEU A 63  ILE A 65  
B 2  GLU A 67  ? ILE A 69  ? GLU A 68  ILE A 70  
C 1  VAL A 185 ? GLU A 186 ? VAL A 186 GLU A 187 
C 2  TRP A 192 ? PRO A 199 ? TRP A 193 PRO A 200 
C 3  VAL A 552 ? GLU A 559 ? VAL A 553 GLU A 560 
C 4  ASN B 513 ? ILE B 516 ? ASN B 514 ILE B 517 
C 5  THR B 489 ? PHE B 493 ? THR B 490 PHE B 494 
C 6  ASN B 321 ? VAL B 325 ? ASN B 322 VAL B 326 
C 7  ALA B 353 ? PRO B 359 ? ALA B 354 PRO B 360 
C 8  ILE B 462 ? TYR B 468 ? ILE B 463 TYR B 469 
C 9  THR B 442 ? ALA B 446 ? THR B 443 ALA B 447 
C 10 LEU B 423 ? GLY B 428 ? LEU B 424 GLY B 429 
D 1  ILE A 259 ? PHE A 261 ? ILE A 260 PHE A 262 
D 2  VAL A 230 ? LYS A 233 ? VAL A 231 LYS A 234 
D 3  PHE A 203 ? VAL A 207 ? PHE A 204 VAL A 208 
D 4  PHE A 279 ? THR A 285 ? PHE A 280 THR A 286 
D 5  ARG A 312 ? GLU A 316 ? ARG A 313 GLU A 317 
E 1  LEU A 423 ? GLY A 428 ? LEU A 424 GLY A 429 
E 2  THR A 442 ? ALA A 446 ? THR A 443 ALA A 447 
E 3  ILE A 462 ? TYR A 468 ? ILE A 463 TYR A 469 
E 4  ALA A 353 ? PRO A 359 ? ALA A 354 PRO A 360 
E 5  ASN A 321 ? VAL A 325 ? ASN A 322 VAL A 326 
E 6  THR A 489 ? PHE A 493 ? THR A 490 PHE A 494 
E 7  ASN A 513 ? ILE A 516 ? ASN A 514 ILE A 517 
E 8  VAL B 552 ? GLU B 559 ? VAL B 553 GLU B 560 
E 9  TRP B 192 ? PRO B 199 ? TRP B 193 PRO B 200 
E 10 VAL B 185 ? GLU B 186 ? VAL B 186 GLU B 187 
F 1  TYR A 431 ? ASP A 432 ? TYR A 432 ASP A 433 
F 2  PHE A 438 ? VAL A 439 ? PHE A 439 VAL A 440 
G 1  LEU B 58  ? VAL B 60  ? LEU B 59  VAL B 61  
G 2  ASN B 85  ? THR B 94  ? ASN B 86  THR B 95  
G 3  LEU B 77  ? ASN B 82  ? LEU B 78  ASN B 83  
H 1  LEU B 62  ? ILE B 64  ? LEU B 63  ILE B 65  
H 2  GLU B 67  ? ILE B 69  ? GLU B 68  ILE B 70  
I 1  ILE B 259 ? PHE B 261 ? ILE B 260 PHE B 262 
I 2  VAL B 230 ? LYS B 233 ? VAL B 231 LYS B 234 
I 3  PHE B 203 ? VAL B 207 ? PHE B 204 VAL B 208 
I 4  PHE B 279 ? THR B 285 ? PHE B 280 THR B 286 
I 5  ARG B 312 ? GLU B 316 ? ARG B 313 GLU B 317 
J 1  TYR B 431 ? ASP B 432 ? TYR B 432 ASP B 433 
J 2  PHE B 438 ? VAL B 439 ? PHE B 439 VAL B 440 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  N VAL A 60  ? N VAL A 61  O THR A 94  ? O THR A 95  
A 2 3  O VAL A 93  ? O VAL A 94  N PHE A 78  ? N PHE A 79  
B 1 2  N LEU A 62  ? N LEU A 63  O ILE A 69  ? O ILE A 70  
C 1 2  N VAL A 185 ? N VAL A 186 O ASN A 193 ? O ASN A 194 
C 2 3  N ARG A 198 ? N ARG A 199 O SER A 553 ? O SER A 554 
C 3 4  N ASN A 556 ? N ASN A 557 O PHE B 514 ? O PHE B 515 
C 4 5  O TYR B 515 ? O TYR B 516 N ILE B 492 ? N ILE B 493 
C 5 6  O ALA B 491 ? O ALA B 492 N LEU B 324 ? N LEU B 325 
C 6 7  N ASN B 321 ? N ASN B 322 O SER B 354 ? O SER B 355 
C 7 8  N LEU B 358 ? N LEU B 359 O TYR B 468 ? O TYR B 469 
C 8 9  O VAL B 465 ? O VAL B 466 N ILE B 444 ? N ILE B 445 
C 9 10 O LYS B 445 ? O LYS B 446 N GLU B 424 ? N GLU B 425 
D 1 2  O ASN A 260 ? O ASN A 261 N TRP A 232 ? N TRP A 233 
D 2 3  O VAL A 231 ? O VAL A 232 N VAL A 204 ? N VAL A 205 
D 3 4  N TYR A 205 ? N TYR A 206 O ALA A 281 ? O ALA A 282 
D 4 5  N LEU A 282 ? N LEU A 283 O ILE A 314 ? O ILE A 315 
E 1 2  N GLU A 424 ? N GLU A 425 O LYS A 445 ? O LYS A 446 
E 2 3  N ILE A 444 ? N ILE A 445 O VAL A 465 ? O VAL A 466 
E 3 4  O TYR A 466 ? O TYR A 467 N LEU A 356 ? N LEU A 357 
E 4 5  O TYR A 357 ? O TYR A 358 N VAL A 325 ? N VAL A 326 
E 5 6  N LEU A 324 ? N LEU A 325 O ALA A 491 ? O ALA A 492 
E 6 7  N ILE A 492 ? N ILE A 493 O TYR A 515 ? O TYR A 516 
E 7 8  N PHE A 514 ? N PHE A 515 O ASN B 556 ? O ASN B 557 
E 8 9  O THR B 557 ? O THR B 558 N LYS B 194 ? N LYS B 195 
E 9 10 O ASN B 193 ? O ASN B 194 N VAL B 185 ? N VAL B 186 
F 1 2  N ASP A 432 ? N ASP A 433 O PHE A 438 ? O PHE A 439 
G 1 2  N VAL B 60  ? N VAL B 61  O THR B 94  ? O THR B 95  
G 2 3  O VAL B 93  ? O VAL B 94  N PHE B 78  ? N PHE B 79  
H 1 2  N LEU B 62  ? N LEU B 63  O ILE B 69  ? O ILE B 70  
I 1 2  O ASN B 260 ? O ASN B 261 N TRP B 232 ? N TRP B 233 
I 2 3  O VAL B 231 ? O VAL B 232 N ALA B 206 ? N ALA B 207 
I 3 4  N TYR B 205 ? N TYR B 206 O ALA B 281 ? O ALA B 282 
I 4 5  N LEU B 282 ? N LEU B 283 O ILE B 314 ? O ILE B 315 
J 1 2  N ASP B 432 ? N ASP B 433 O PHE B 438 ? O PHE B 439 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE NAD A 1000' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE NAD B 1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 VAL A 207 ? VAL A 208  . ? 1_555 ? 
2  AC1 19 SER A 208 ? SER A 209  . ? 1_555 ? 
3  AC1 19 PRO A 209 ? PRO A 210  . ? 1_555 ? 
4  AC1 19 PHE A 210 ? PHE A 211  . ? 1_555 ? 
5  AC1 19 LYS A 233 ? LYS A 234  . ? 1_555 ? 
6  AC1 19 SER A 235 ? SER A 236  . ? 1_555 ? 
7  AC1 19 PRO A 266 ? PRO A 267  . ? 1_555 ? 
8  AC1 19 THR A 270 ? THR A 271  . ? 1_555 ? 
9  AC1 19 PHE A 284 ? PHE A 285  . ? 1_555 ? 
10 AC1 19 GLY A 286 ? GLY A 287  . ? 1_555 ? 
11 AC1 19 SER A 287 ? SER A 288  . ? 1_555 ? 
12 AC1 19 VAL A 290 ? VAL A 291  . ? 1_555 ? 
13 AC1 19 GLY A 318 ? GLY A 319  . ? 1_555 ? 
14 AC1 19 GLU A 457 ? GLU A 458  . ? 1_555 ? 
15 AC1 19 PHE A 459 ? PHE A 460  . ? 1_555 ? 
16 AC1 19 HOH E .   ? HOH A 1102 . ? 1_555 ? 
17 AC1 19 HOH E .   ? HOH A 1110 . ? 1_555 ? 
18 AC1 19 HOH E .   ? HOH A 1116 . ? 1_555 ? 
19 AC1 19 HOH E .   ? HOH A 1173 . ? 1_555 ? 
20 AC2 15 VAL B 207 ? VAL B 208  . ? 1_555 ? 
21 AC2 15 SER B 208 ? SER B 209  . ? 1_555 ? 
22 AC2 15 PRO B 209 ? PRO B 210  . ? 1_555 ? 
23 AC2 15 PHE B 210 ? PHE B 211  . ? 1_555 ? 
24 AC2 15 LYS B 233 ? LYS B 234  . ? 1_555 ? 
25 AC2 15 SER B 235 ? SER B 236  . ? 1_555 ? 
26 AC2 15 PRO B 266 ? PRO B 267  . ? 1_555 ? 
27 AC2 15 VAL B 267 ? VAL B 268  . ? 1_555 ? 
28 AC2 15 THR B 270 ? THR B 271  . ? 1_555 ? 
29 AC2 15 PHE B 284 ? PHE B 285  . ? 1_555 ? 
30 AC2 15 GLY B 286 ? GLY B 287  . ? 1_555 ? 
31 AC2 15 SER B 287 ? SER B 288  . ? 1_555 ? 
32 AC2 15 VAL B 290 ? VAL B 291  . ? 1_555 ? 
33 AC2 15 LEU B 294 ? LEU B 295  . ? 1_555 ? 
34 AC2 15 HOH F .   ? HOH B 1109 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4OE4 
_atom_sites.fract_transf_matrix[1][1]   0.009256 
_atom_sites.fract_transf_matrix[1][2]   0.005344 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010688 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005524 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 42  ? 11.348  49.612 68.888  1.00 67.00 ? 43   ASP A N   1 
ATOM   2    C CA  . ASP A 1 42  ? 10.867  48.801 70.011  1.00 66.20 ? 43   ASP A CA  1 
ATOM   3    C C   . ASP A 1 42  ? 10.657  47.356 69.575  1.00 66.47 ? 43   ASP A C   1 
ATOM   4    O O   . ASP A 1 42  ? 11.260  46.432 70.128  1.00 63.70 ? 43   ASP A O   1 
ATOM   5    C CB  . ASP A 1 42  ? 9.566   49.364 70.593  1.00 61.59 ? 43   ASP A CB  1 
ATOM   6    N N   . TRP A 1 43  ? 9.800   47.173 68.576  1.00 65.83 ? 44   TRP A N   1 
ATOM   7    C CA  . TRP A 1 43  ? 9.543   45.853 68.019  1.00 64.62 ? 44   TRP A CA  1 
ATOM   8    C C   . TRP A 1 43  ? 10.788  45.275 67.357  1.00 60.11 ? 44   TRP A C   1 
ATOM   9    O O   . TRP A 1 43  ? 11.007  44.066 67.372  1.00 61.77 ? 44   TRP A O   1 
ATOM   10   C CB  . TRP A 1 43  ? 8.392   45.915 67.019  1.00 69.88 ? 44   TRP A CB  1 
ATOM   11   C CG  . TRP A 1 43  ? 7.094   46.281 67.659  1.00 74.23 ? 44   TRP A CG  1 
ATOM   12   C CD1 . TRP A 1 43  ? 6.457   47.491 67.604  1.00 76.61 ? 44   TRP A CD1 1 
ATOM   13   C CD2 . TRP A 1 43  ? 6.276   45.434 68.469  1.00 73.89 ? 44   TRP A CD2 1 
ATOM   14   N NE1 . TRP A 1 43  ? 5.286   47.443 68.323  1.00 75.90 ? 44   TRP A NE1 1 
ATOM   15   C CE2 . TRP A 1 43  ? 5.151   46.192 68.865  1.00 75.41 ? 44   TRP A CE2 1 
ATOM   16   C CE3 . TRP A 1 43  ? 6.381   44.107 68.897  1.00 71.23 ? 44   TRP A CE3 1 
ATOM   17   C CZ2 . TRP A 1 43  ? 4.141   45.665 69.666  1.00 75.39 ? 44   TRP A CZ2 1 
ATOM   18   C CZ3 . TRP A 1 43  ? 5.379   43.586 69.690  1.00 71.26 ? 44   TRP A CZ3 1 
ATOM   19   C CH2 . TRP A 1 43  ? 4.272   44.364 70.068  1.00 73.76 ? 44   TRP A CH2 1 
ATOM   20   N N   . ASP A 1 44  ? 11.609  46.142 66.784  1.00 51.17 ? 45   ASP A N   1 
ATOM   21   C CA  . ASP A 1 44  ? 12.836  45.696 66.147  1.00 52.51 ? 45   ASP A CA  1 
ATOM   22   C C   . ASP A 1 44  ? 13.863  45.276 67.187  1.00 50.87 ? 45   ASP A C   1 
ATOM   23   O O   . ASP A 1 44  ? 14.580  44.304 66.983  1.00 52.87 ? 45   ASP A O   1 
ATOM   24   C CB  . ASP A 1 44  ? 13.400  46.782 65.230  1.00 57.21 ? 45   ASP A CB  1 
ATOM   25   C CG  . ASP A 1 44  ? 12.473  47.094 64.064  1.00 70.21 ? 45   ASP A CG  1 
ATOM   26   O OD1 . ASP A 1 44  ? 12.341  48.282 63.704  1.00 77.73 ? 45   ASP A OD1 1 
ATOM   27   O OD2 . ASP A 1 44  ? 11.868  46.151 63.509  1.00 73.10 ? 45   ASP A OD2 1 
ATOM   28   N N   . LEU A 1 45  ? 13.931  46.002 68.300  1.00 47.09 ? 46   LEU A N   1 
ATOM   29   C CA  . LEU A 1 45  ? 14.837  45.626 69.383  1.00 47.36 ? 46   LEU A CA  1 
ATOM   30   C C   . LEU A 1 45  ? 14.426  44.278 69.976  1.00 42.83 ? 46   LEU A C   1 
ATOM   31   O O   . LEU A 1 45  ? 15.273  43.474 70.375  1.00 43.81 ? 46   LEU A O   1 
ATOM   32   C CB  . LEU A 1 45  ? 14.863  46.685 70.494  1.00 48.05 ? 46   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 45  ? 15.701  47.954 70.332  1.00 54.04 ? 46   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 45  ? 17.056  47.618 69.744  1.00 52.82 ? 46   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 45  ? 14.970  48.980 69.480  1.00 62.18 ? 46   LEU A CD2 1 
ATOM   36   N N   . LEU A 1 46  ? 13.121  44.043 70.037  1.00 37.65 ? 47   LEU A N   1 
ATOM   37   C CA  . LEU A 1 46  ? 12.603  42.812 70.618  1.00 38.10 ? 47   LEU A CA  1 
ATOM   38   C C   . LEU A 1 46  ? 12.894  41.651 69.689  1.00 41.01 ? 47   LEU A C   1 
ATOM   39   O O   . LEU A 1 46  ? 13.326  40.591 70.132  1.00 36.91 ? 47   LEU A O   1 
ATOM   40   C CB  . LEU A 1 46  ? 11.104  42.922 70.861  1.00 33.41 ? 47   LEU A CB  1 
ATOM   41   C CG  . LEU A 1 46  ? 10.377  41.677 71.397  1.00 37.62 ? 47   LEU A CG  1 
ATOM   42   C CD1 . LEU A 1 46  ? 10.917  41.249 72.756  1.00 35.55 ? 47   LEU A CD1 1 
ATOM   43   C CD2 . LEU A 1 46  ? 8.903   41.950 71.504  1.00 37.19 ? 47   LEU A CD2 1 
ATOM   44   N N   . ARG A 1 47  ? 12.658  41.865 68.396  1.00 47.15 ? 48   ARG A N   1 
ATOM   45   C CA  . ARG A 1 47  ? 12.898  40.835 67.395  1.00 50.43 ? 48   ARG A CA  1 
ATOM   46   C C   . ARG A 1 47  ? 14.355  40.394 67.463  1.00 48.83 ? 48   ARG A C   1 
ATOM   47   O O   . ARG A 1 47  ? 14.653  39.204 67.429  1.00 54.51 ? 48   ARG A O   1 
ATOM   48   C CB  . ARG A 1 47  ? 12.547  41.340 65.992  1.00 53.83 ? 48   ARG A CB  1 
ATOM   49   N N   . ALA A 1 48  ? 15.256  41.359 67.592  1.00 39.78 ? 49   ALA A N   1 
ATOM   50   C CA  . ALA A 1 48  ? 16.672  41.055 67.703  1.00 42.58 ? 49   ALA A CA  1 
ATOM   51   C C   . ALA A 1 48  ? 16.949  40.202 68.931  1.00 39.69 ? 49   ALA A C   1 
ATOM   52   O O   . ALA A 1 48  ? 17.731  39.259 68.875  1.00 41.53 ? 49   ALA A O   1 
ATOM   53   C CB  . ALA A 1 48  ? 17.496  42.339 67.757  1.00 48.29 ? 49   ALA A CB  1 
ATOM   54   N N   . SER A 1 49  ? 16.323  40.540 70.051  1.00 36.47 ? 50   SER A N   1 
ATOM   55   C CA  . SER A 1 49  ? 16.505  39.738 71.250  1.00 33.62 ? 50   SER A CA  1 
ATOM   56   C C   . SER A 1 49  ? 15.951  38.334 71.006  1.00 32.48 ? 50   SER A C   1 
ATOM   57   O O   . SER A 1 49  ? 16.591  37.343 71.337  1.00 30.74 ? 50   SER A O   1 
ATOM   58   C CB  . SER A 1 49  ? 15.835  40.394 72.454  1.00 38.77 ? 50   SER A CB  1 
ATOM   59   O OG  . SER A 1 49  ? 16.668  41.404 72.987  1.00 41.52 ? 50   SER A OG  1 
ATOM   60   N N   . LEU A 1 50  ? 14.771  38.260 70.398  1.00 29.97 ? 51   LEU A N   1 
ATOM   61   C CA  . LEU A 1 50  ? 14.172  36.973 70.081  1.00 36.81 ? 51   LEU A CA  1 
ATOM   62   C C   . LEU A 1 50  ? 15.096  36.127 69.195  1.00 42.84 ? 51   LEU A C   1 
ATOM   63   O O   . LEU A 1 50  ? 15.290  34.945 69.465  1.00 38.01 ? 51   LEU A O   1 
ATOM   64   C CB  . LEU A 1 50  ? 12.808  37.154 69.413  1.00 36.40 ? 51   LEU A CB  1 
ATOM   65   C CG  . LEU A 1 50  ? 11.668  37.690 70.290  1.00 36.34 ? 51   LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 50  ? 10.426  37.958 69.449  1.00 28.65 ? 51   LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 50  ? 11.337  36.725 71.422  1.00 29.38 ? 51   LEU A CD2 1 
ATOM   68   N N   . MET A 1 51  ? 15.673  36.742 68.161  1.00 40.38 ? 52   MET A N   1 
ATOM   69   C CA  . MET A 1 51  ? 16.489  36.020 67.179  1.00 46.45 ? 52   MET A CA  1 
ATOM   70   C C   . MET A 1 51  ? 17.814  35.585 67.767  1.00 48.05 ? 52   MET A C   1 
ATOM   71   O O   . MET A 1 51  ? 18.400  34.589 67.349  1.00 50.86 ? 52   MET A O   1 
ATOM   72   C CB  . MET A 1 51  ? 16.754  36.880 65.939  1.00 52.39 ? 52   MET A CB  1 
ATOM   73   C CG  . MET A 1 51  ? 15.537  37.082 65.044  1.00 58.00 ? 52   MET A CG  1 
ATOM   74   S SD  . MET A 1 51  ? 14.792  35.518 64.549  1.00 99.58 ? 52   MET A SD  1 
ATOM   75   C CE  . MET A 1 51  ? 16.191  34.750 63.730  1.00 84.33 ? 52   MET A CE  1 
ATOM   76   N N   . LYS A 1 52  ? 18.290  36.362 68.728  1.00 44.45 ? 53   LYS A N   1 
ATOM   77   C CA  . LYS A 1 52  ? 19.490  36.030 69.465  1.00 49.92 ? 53   LYS A CA  1 
ATOM   78   C C   . LYS A 1 52  ? 19.279  34.707 70.193  1.00 50.78 ? 53   LYS A C   1 
ATOM   79   O O   . LYS A 1 52  ? 19.929  33.711 69.884  1.00 46.29 ? 53   LYS A O   1 
ATOM   80   C CB  . LYS A 1 52  ? 19.802  37.154 70.452  1.00 57.85 ? 53   LYS A CB  1 
ATOM   81   C CG  . LYS A 1 52  ? 21.096  36.995 71.216  1.00 64.16 ? 53   LYS A CG  1 
ATOM   82   C CD  . LYS A 1 52  ? 21.600  38.350 71.694  1.00 66.59 ? 53   LYS A CD  1 
ATOM   83   C CE  . LYS A 1 52  ? 20.560  39.076 72.538  1.00 64.26 ? 53   LYS A CE  1 
ATOM   84   N NZ  . LYS A 1 52  ? 20.924  40.513 72.743  1.00 63.68 ? 53   LYS A NZ  1 
ATOM   85   N N   . PHE A 1 53  ? 18.342  34.697 71.139  1.00 53.46 ? 54   PHE A N   1 
ATOM   86   C CA  . PHE A 1 53  ? 18.049  33.494 71.923  1.00 48.28 ? 54   PHE A CA  1 
ATOM   87   C C   . PHE A 1 53  ? 17.624  32.336 71.045  1.00 50.10 ? 54   PHE A C   1 
ATOM   88   O O   . PHE A 1 53  ? 17.811  31.188 71.417  1.00 49.95 ? 54   PHE A O   1 
ATOM   89   C CB  . PHE A 1 53  ? 16.956  33.741 72.962  1.00 32.04 ? 54   PHE A CB  1 
ATOM   90   C CG  . PHE A 1 53  ? 17.374  34.626 74.090  1.00 38.42 ? 54   PHE A CG  1 
ATOM   91   C CD1 . PHE A 1 53  ? 18.385  34.243 74.952  1.00 45.15 ? 54   PHE A CD1 1 
ATOM   92   C CD2 . PHE A 1 53  ? 16.741  35.843 74.303  1.00 48.13 ? 54   PHE A CD2 1 
ATOM   93   C CE1 . PHE A 1 53  ? 18.774  35.066 76.009  1.00 56.08 ? 54   PHE A CE1 1 
ATOM   94   C CE2 . PHE A 1 53  ? 17.116  36.675 75.363  1.00 54.11 ? 54   PHE A CE2 1 
ATOM   95   C CZ  . PHE A 1 53  ? 18.133  36.285 76.217  1.00 56.03 ? 54   PHE A CZ  1 
ATOM   96   N N   . LYS A 1 54  ? 17.046  32.644 69.888  1.00 58.20 ? 55   LYS A N   1 
ATOM   97   C CA  . LYS A 1 54  ? 16.545  31.614 68.979  1.00 62.49 ? 55   LYS A CA  1 
ATOM   98   C C   . LYS A 1 54  ? 17.669  30.971 68.186  1.00 64.84 ? 55   LYS A C   1 
ATOM   99   O O   . LYS A 1 54  ? 17.684  29.758 68.003  1.00 68.79 ? 55   LYS A O   1 
ATOM   100  C CB  . LYS A 1 54  ? 15.495  32.180 68.009  1.00 60.34 ? 55   LYS A CB  1 
ATOM   101  C CG  . LYS A 1 54  ? 14.071  32.271 68.548  1.00 54.28 ? 55   LYS A CG  1 
ATOM   102  C CD  . LYS A 1 54  ? 13.147  32.927 67.526  1.00 59.93 ? 55   LYS A CD  1 
ATOM   103  C CE  . LYS A 1 54  ? 11.682  32.631 67.813  1.00 63.03 ? 55   LYS A CE  1 
ATOM   104  N NZ  . LYS A 1 54  ? 10.758  33.525 67.049  1.00 65.29 ? 55   LYS A NZ  1 
ATOM   105  N N   . SER A 1 55  ? 18.601  31.795 67.711  1.00 69.70 ? 56   SER A N   1 
ATOM   106  C CA  . SER A 1 55  ? 19.693  31.343 66.837  1.00 69.48 ? 56   SER A CA  1 
ATOM   107  C C   . SER A 1 55  ? 20.442  30.118 67.369  1.00 70.36 ? 56   SER A C   1 
ATOM   108  O O   . SER A 1 55  ? 20.734  29.180 66.620  1.00 73.96 ? 56   SER A O   1 
ATOM   109  C CB  . SER A 1 55  ? 20.686  32.484 66.592  1.00 64.86 ? 56   SER A CB  1 
ATOM   110  N N   . SER A 1 56  ? 20.744  30.135 68.663  1.00 65.48 ? 57   SER A N   1 
ATOM   111  C CA  . SER A 1 56  ? 21.466  29.043 69.300  1.00 59.76 ? 57   SER A CA  1 
ATOM   112  C C   . SER A 1 56  ? 21.011  28.840 70.747  1.00 55.41 ? 57   SER A C   1 
ATOM   113  O O   . SER A 1 56  ? 20.011  29.414 71.187  1.00 52.65 ? 57   SER A O   1 
ATOM   114  C CB  . SER A 1 56  ? 22.960  29.325 69.264  1.00 56.12 ? 57   SER A CB  1 
ATOM   115  O OG  . SER A 1 56  ? 23.221  30.588 69.835  1.00 54.77 ? 57   SER A OG  1 
ATOM   116  N N   . SER A 1 57  ? 21.752  28.022 71.486  1.00 50.74 ? 58   SER A N   1 
ATOM   117  C CA  . SER A 1 57  ? 21.376  27.682 72.852  1.00 44.12 ? 58   SER A CA  1 
ATOM   118  C C   . SER A 1 57  ? 22.351  28.298 73.841  1.00 45.40 ? 58   SER A C   1 
ATOM   119  O O   . SER A 1 57  ? 23.566  28.248 73.648  1.00 47.83 ? 58   SER A O   1 
ATOM   120  C CB  . SER A 1 57  ? 21.346  26.165 73.030  1.00 46.21 ? 58   SER A CB  1 
ATOM   121  O OG  . SER A 1 57  ? 20.566  25.550 72.014  1.00 49.18 ? 58   SER A OG  1 
ATOM   122  N N   . LEU A 1 58  ? 21.813  28.889 74.901  1.00 40.19 ? 59   LEU A N   1 
ATOM   123  C CA  . LEU A 1 58  ? 22.646  29.482 75.928  1.00 39.08 ? 59   LEU A CA  1 
ATOM   124  C C   . LEU A 1 58  ? 23.039  28.423 76.950  1.00 40.28 ? 59   LEU A C   1 
ATOM   125  O O   . LEU A 1 58  ? 22.197  27.644 77.411  1.00 40.31 ? 59   LEU A O   1 
ATOM   126  C CB  . LEU A 1 58  ? 21.899  30.617 76.633  1.00 34.71 ? 59   LEU A CB  1 
ATOM   127  C CG  . LEU A 1 58  ? 22.762  31.369 77.643  1.00 37.50 ? 59   LEU A CG  1 
ATOM   128  C CD1 . LEU A 1 58  ? 23.857  32.147 76.901  1.00 34.22 ? 59   LEU A CD1 1 
ATOM   129  C CD2 . LEU A 1 58  ? 21.940  32.291 78.540  1.00 34.09 ? 59   LEU A CD2 1 
ATOM   130  N N   . GLU A 1 59  ? 24.313  28.389 77.313  1.00 35.61 ? 60   GLU A N   1 
ATOM   131  C CA  . GLU A 1 59  ? 24.726  27.556 78.430  1.00 36.47 ? 60   GLU A CA  1 
ATOM   132  C C   . GLU A 1 59  ? 24.425  28.341 79.694  1.00 30.19 ? 60   GLU A C   1 
ATOM   133  O O   . GLU A 1 59  ? 24.935  29.437 79.870  1.00 32.76 ? 60   GLU A O   1 
ATOM   134  C CB  . GLU A 1 59  ? 26.213  27.219 78.331  1.00 45.40 ? 60   GLU A CB  1 
ATOM   135  C CG  . GLU A 1 59  ? 26.597  26.546 77.017  1.00 60.20 ? 60   GLU A CG  1 
ATOM   136  C CD  . GLU A 1 59  ? 25.838  25.242 76.777  1.00 71.58 ? 60   GLU A CD  1 
ATOM   137  O OE1 . GLU A 1 59  ? 25.835  24.377 77.684  1.00 71.37 ? 60   GLU A OE1 1 
ATOM   138  O OE2 . GLU A 1 59  ? 25.240  25.083 75.684  1.00 76.34 ? 60   GLU A OE2 1 
ATOM   139  N N   . VAL A 1 60  ? 23.555  27.813 80.549  1.00 28.63 ? 61   VAL A N   1 
ATOM   140  C CA  . VAL A 1 60  ? 23.218  28.491 81.795  1.00 27.85 ? 61   VAL A CA  1 
ATOM   141  C C   . VAL A 1 60  ? 23.949  27.814 82.933  1.00 28.78 ? 61   VAL A C   1 
ATOM   142  O O   . VAL A 1 60  ? 23.762  26.625 83.163  1.00 34.45 ? 61   VAL A O   1 
ATOM   143  C CB  . VAL A 1 60  ? 21.693  28.473 82.055  1.00 29.40 ? 61   VAL A CB  1 
ATOM   144  C CG1 . VAL A 1 60  ? 21.357  28.864 83.507  1.00 22.97 ? 61   VAL A CG1 1 
ATOM   145  C CG2 . VAL A 1 60  ? 20.988  29.373 81.055  1.00 28.80 ? 61   VAL A CG2 1 
ATOM   146  N N   . PRO A 1 61  ? 24.814  28.560 83.632  1.00 27.91 ? 62   PRO A N   1 
ATOM   147  C CA  . PRO A 1 61  ? 25.644  27.963 84.683  1.00 27.16 ? 62   PRO A CA  1 
ATOM   148  C C   . PRO A 1 61  ? 24.992  28.120 86.062  1.00 28.54 ? 62   PRO A C   1 
ATOM   149  O O   . PRO A 1 61  ? 24.025  28.867 86.227  1.00 23.19 ? 62   PRO A O   1 
ATOM   150  C CB  . PRO A 1 61  ? 26.899  28.836 84.643  1.00 26.93 ? 62   PRO A CB  1 
ATOM   151  C CG  . PRO A 1 61  ? 26.328  30.240 84.350  1.00 25.16 ? 62   PRO A CG  1 
ATOM   152  C CD  . PRO A 1 61  ? 25.119  29.994 83.432  1.00 24.98 ? 62   PRO A CD  1 
ATOM   153  N N   . LEU A 1 62  ? 25.530  27.422 87.050  1.00 26.43 ? 63   LEU A N   1 
ATOM   154  C CA  . LEU A 1 62  ? 25.254  27.785 88.425  1.00 25.21 ? 63   LEU A CA  1 
ATOM   155  C C   . LEU A 1 62  ? 25.963  29.112 88.708  1.00 28.32 ? 63   LEU A C   1 
ATOM   156  O O   . LEU A 1 62  ? 26.988  29.444 88.092  1.00 24.26 ? 63   LEU A O   1 
ATOM   157  C CB  . LEU A 1 62  ? 25.814  26.722 89.367  1.00 24.68 ? 63   LEU A CB  1 
ATOM   158  C CG  . LEU A 1 62  ? 25.569  25.261 89.007  1.00 25.11 ? 63   LEU A CG  1 
ATOM   159  C CD1 . LEU A 1 62  ? 26.247  24.365 90.047  1.00 25.85 ? 63   LEU A CD1 1 
ATOM   160  C CD2 . LEU A 1 62  ? 24.075  24.961 88.921  1.00 24.28 ? 63   LEU A CD2 1 
ATOM   161  N N   . VAL A 1 63  ? 25.425  29.874 89.642  1.00 24.11 ? 64   VAL A N   1 
ATOM   162  C CA  . VAL A 1 63  ? 26.173  30.999 90.166  1.00 26.42 ? 64   VAL A CA  1 
ATOM   163  C C   . VAL A 1 63  ? 26.298  30.819 91.665  1.00 24.41 ? 64   VAL A C   1 
ATOM   164  O O   . VAL A 1 63  ? 25.322  30.977 92.401  1.00 23.77 ? 64   VAL A O   1 
ATOM   165  C CB  . VAL A 1 63  ? 25.497  32.338 89.855  1.00 24.40 ? 64   VAL A CB  1 
ATOM   166  C CG1 . VAL A 1 63  ? 26.382  33.474 90.335  1.00 24.40 ? 64   VAL A CG1 1 
ATOM   167  C CG2 . VAL A 1 63  ? 25.242  32.453 88.363  1.00 21.54 ? 64   VAL A CG2 1 
ATOM   168  N N   . ILE A 1 64  ? 27.501  30.469 92.108  1.00 27.06 ? 65   ILE A N   1 
ATOM   169  C CA  . ILE A 1 64  ? 27.752  30.209 93.515  1.00 27.50 ? 65   ILE A CA  1 
ATOM   170  C C   . ILE A 1 64  ? 28.884  31.111 93.985  1.00 29.29 ? 65   ILE A C   1 
ATOM   171  O O   . ILE A 1 64  ? 29.969  31.107 93.408  1.00 30.96 ? 65   ILE A O   1 
ATOM   172  C CB  . ILE A 1 64  ? 28.124  28.725 93.738  1.00 31.07 ? 65   ILE A CB  1 
ATOM   173  C CG1 . ILE A 1 64  ? 26.923  27.825 93.403  1.00 26.22 ? 65   ILE A CG1 1 
ATOM   174  C CG2 . ILE A 1 64  ? 28.665  28.497 95.167  1.00 24.01 ? 65   ILE A CG2 1 
ATOM   175  C CD1 . ILE A 1 64  ? 27.229  26.330 93.504  1.00 24.46 ? 65   ILE A CD1 1 
ATOM   176  N N   . ASN A 1 65  ? 28.614  31.890 95.027  1.00 25.47 ? 66   ASN A N   1 
ATOM   177  C CA  . ASN A 1 65  ? 29.572  32.856 95.533  1.00 29.66 ? 66   ASN A CA  1 
ATOM   178  C C   . ASN A 1 65  ? 30.090  33.780 94.429  1.00 34.24 ? 66   ASN A C   1 
ATOM   179  O O   . ASN A 1 65  ? 31.270  34.096 94.385  1.00 36.14 ? 66   ASN A O   1 
ATOM   180  C CB  . ASN A 1 65  ? 30.736  32.130 96.210  1.00 26.83 ? 66   ASN A CB  1 
ATOM   181  C CG  . ASN A 1 65  ? 31.359  32.937 97.313  1.00 31.91 ? 66   ASN A CG  1 
ATOM   182  O OD1 . ASN A 1 65  ? 30.700  33.761 97.953  1.00 29.10 ? 66   ASN A OD1 1 
ATOM   183  N ND2 . ASN A 1 65  ? 32.640  32.699 97.557  1.00 36.13 ? 66   ASN A ND2 1 
ATOM   184  N N   . GLY A 1 66  ? 29.206  34.187 93.521  1.00 36.68 ? 67   GLY A N   1 
ATOM   185  C CA  . GLY A 1 66  ? 29.564  35.136 92.470  1.00 29.10 ? 67   GLY A CA  1 
ATOM   186  C C   . GLY A 1 66  ? 30.282  34.554 91.264  1.00 29.34 ? 67   GLY A C   1 
ATOM   187  O O   . GLY A 1 66  ? 30.576  35.268 90.308  1.00 35.91 ? 67   GLY A O   1 
ATOM   188  N N   . GLU A 1 67  ? 30.562  33.255 91.297  1.00 32.52 ? 68   GLU A N   1 
ATOM   189  C CA  . GLU A 1 67  ? 31.212  32.595 90.171  1.00 34.19 ? 68   GLU A CA  1 
ATOM   190  C C   . GLU A 1 67  ? 30.240  31.708 89.381  1.00 34.24 ? 68   GLU A C   1 
ATOM   191  O O   . GLU A 1 67  ? 29.464  30.948 89.962  1.00 33.02 ? 68   GLU A O   1 
ATOM   192  C CB  . GLU A 1 67  ? 32.405  31.764 90.647  1.00 26.17 ? 68   GLU A CB  1 
ATOM   193  N N   . ARG A 1 68  ? 30.301  31.818 88.058  1.00 30.68 ? 69   ARG A N   1 
ATOM   194  C CA  . ARG A 1 68  ? 29.551  30.968 87.154  1.00 26.15 ? 69   ARG A CA  1 
ATOM   195  C C   . ARG A 1 68  ? 30.164  29.584 87.139  1.00 32.19 ? 69   ARG A C   1 
ATOM   196  O O   . ARG A 1 68  ? 31.360  29.445 86.933  1.00 33.27 ? 69   ARG A O   1 
ATOM   197  C CB  . ARG A 1 68  ? 29.593  31.553 85.746  1.00 33.19 ? 69   ARG A CB  1 
ATOM   198  C CG  . ARG A 1 68  ? 28.681  32.751 85.535  1.00 39.27 ? 69   ARG A CG  1 
ATOM   199  C CD  . ARG A 1 68  ? 29.456  33.971 85.117  1.00 56.39 ? 69   ARG A CD  1 
ATOM   200  N NE  . ARG A 1 68  ? 29.088  34.459 83.791  1.00 67.38 ? 69   ARG A NE  1 
ATOM   201  C CZ  . ARG A 1 68  ? 29.880  34.393 82.722  1.00 71.73 ? 69   ARG A CZ  1 
ATOM   202  N NH1 . ARG A 1 68  ? 29.462  34.873 81.559  1.00 70.75 ? 69   ARG A NH1 1 
ATOM   203  N NH2 . ARG A 1 68  ? 31.091  33.852 82.814  1.00 73.82 ? 69   ARG A NH2 1 
ATOM   204  N N   . ILE A 1 69  ? 29.349  28.560 87.370  1.00 36.55 ? 70   ILE A N   1 
ATOM   205  C CA  . ILE A 1 69  ? 29.819  27.179 87.315  1.00 34.35 ? 70   ILE A CA  1 
ATOM   206  C C   . ILE A 1 69  ? 29.127  26.389 86.219  1.00 33.86 ? 70   ILE A C   1 
ATOM   207  O O   . ILE A 1 69  ? 27.912  26.179 86.250  1.00 30.19 ? 70   ILE A O   1 
ATOM   208  C CB  . ILE A 1 69  ? 29.638  26.454 88.664  1.00 35.36 ? 70   ILE A CB  1 
ATOM   209  C CG1 . ILE A 1 69  ? 30.400  27.214 89.758  1.00 47.41 ? 70   ILE A CG1 1 
ATOM   210  C CG2 . ILE A 1 69  ? 30.152  25.027 88.562  1.00 32.77 ? 70   ILE A CG2 1 
ATOM   211  C CD1 . ILE A 1 69  ? 30.576  26.450 91.056  1.00 52.74 ? 70   ILE A CD1 1 
ATOM   212  N N   . TYR A 1 70  ? 29.916  25.938 85.254  1.00 36.16 ? 71   TYR A N   1 
ATOM   213  C CA  . TYR A 1 70  ? 29.389  25.257 84.077  1.00 37.91 ? 71   TYR A CA  1 
ATOM   214  C C   . TYR A 1 70  ? 29.426  23.741 84.257  1.00 38.52 ? 71   TYR A C   1 
ATOM   215  O O   . TYR A 1 70  ? 29.954  23.258 85.261  1.00 36.60 ? 71   TYR A O   1 
ATOM   216  C CB  . TYR A 1 70  ? 30.142  25.720 82.816  1.00 39.01 ? 71   TYR A CB  1 
ATOM   217  C CG  . TYR A 1 70  ? 29.781  27.141 82.425  1.00 35.53 ? 71   TYR A CG  1 
ATOM   218  C CD1 . TYR A 1 70  ? 28.638  27.401 81.661  1.00 34.33 ? 71   TYR A CD1 1 
ATOM   219  C CD2 . TYR A 1 70  ? 30.553  28.224 82.846  1.00 30.53 ? 71   TYR A CD2 1 
ATOM   220  C CE1 . TYR A 1 70  ? 28.284  28.704 81.304  1.00 32.87 ? 71   TYR A CE1 1 
ATOM   221  C CE2 . TYR A 1 70  ? 30.203  29.547 82.499  1.00 34.11 ? 71   TYR A CE2 1 
ATOM   222  C CZ  . TYR A 1 70  ? 29.072  29.772 81.726  1.00 34.41 ? 71   TYR A CZ  1 
ATOM   223  O OH  . TYR A 1 70  ? 28.708  31.052 81.371  1.00 32.60 ? 71   TYR A OH  1 
ATOM   224  N N   . ASP A 1 71  ? 28.865  22.995 83.306  1.00 35.91 ? 72   ASP A N   1 
ATOM   225  C CA  . ASP A 1 71  ? 28.725  21.553 83.485  1.00 38.71 ? 72   ASP A CA  1 
ATOM   226  C C   . ASP A 1 71  ? 30.101  20.873 83.541  1.00 44.67 ? 72   ASP A C   1 
ATOM   227  O O   . ASP A 1 71  ? 30.251  19.803 84.174  1.00 37.24 ? 72   ASP A O   1 
ATOM   228  C CB  . ASP A 1 71  ? 27.840  20.934 82.394  1.00 42.29 ? 72   ASP A CB  1 
ATOM   229  C CG  . ASP A 1 71  ? 28.586  20.702 81.088  1.00 51.85 ? 72   ASP A CG  1 
ATOM   230  O OD1 . ASP A 1 71  ? 29.290  19.682 80.985  1.00 58.29 ? 72   ASP A OD1 1 
ATOM   231  O OD2 . ASP A 1 71  ? 28.458  21.527 80.166  1.00 53.41 ? 72   ASP A OD2 1 
ATOM   232  N N   . ASN A 1 72  ? 31.087  21.487 82.873  1.00 46.44 ? 73   ASN A N   1 
ATOM   233  C CA  . ASN A 1 72  ? 32.478  21.062 82.986  1.00 50.99 ? 73   ASN A CA  1 
ATOM   234  C C   . ASN A 1 72  ? 32.651  19.537 82.804  1.00 55.94 ? 73   ASN A C   1 
ATOM   235  O O   . ASN A 1 72  ? 33.599  18.933 83.314  1.00 60.83 ? 73   ASN A O   1 
ATOM   236  C CB  . ASN A 1 72  ? 33.033  21.575 84.329  1.00 53.55 ? 73   ASN A CB  1 
ATOM   237  C CG  . ASN A 1 72  ? 34.481  21.204 84.560  1.00 61.26 ? 73   ASN A CG  1 
ATOM   238  O OD1 . ASN A 1 72  ? 35.423  21.880 84.069  1.00 62.05 ? 73   ASN A OD1 1 
ATOM   239  N ND2 . ASN A 1 72  ? 34.688  20.109 85.322  1.00 65.53 ? 73   ASN A ND2 1 
ATOM   240  N N   . ASN A 1 73  ? 31.706  18.933 82.078  1.00 56.66 ? 74   ASN A N   1 
ATOM   241  C CA  . ASN A 1 73  ? 31.693  17.496 81.763  1.00 63.71 ? 74   ASN A CA  1 
ATOM   242  C C   . ASN A 1 73  ? 31.519  16.593 82.989  1.00 60.71 ? 74   ASN A C   1 
ATOM   243  O O   . ASN A 1 73  ? 31.953  15.437 82.994  1.00 63.28 ? 74   ASN A O   1 
ATOM   244  C CB  . ASN A 1 73  ? 32.934  17.088 80.949  1.00 73.59 ? 74   ASN A CB  1 
ATOM   245  C CG  . ASN A 1 73  ? 32.575  16.443 79.621  1.00 80.81 ? 74   ASN A CG  1 
ATOM   246  O OD1 . ASN A 1 73  ? 32.320  15.238 79.543  1.00 84.55 ? 74   ASN A OD1 1 
ATOM   247  N ND2 . ASN A 1 73  ? 32.552  17.247 78.568  1.00 83.64 ? 74   ASN A ND2 1 
ATOM   248  N N   . GLU A 1 74  ? 30.875  17.137 84.017  1.00 57.35 ? 75   GLU A N   1 
ATOM   249  C CA  . GLU A 1 74  ? 30.705  16.456 85.291  1.00 52.41 ? 75   GLU A CA  1 
ATOM   250  C C   . GLU A 1 74  ? 29.234  16.493 85.692  1.00 48.46 ? 75   GLU A C   1 
ATOM   251  O O   . GLU A 1 74  ? 28.666  15.499 86.167  1.00 52.21 ? 75   GLU A O   1 
ATOM   252  C CB  . GLU A 1 74  ? 31.570  17.126 86.361  1.00 52.35 ? 75   GLU A CB  1 
ATOM   253  C CG  . GLU A 1 74  ? 33.064  16.904 86.144  1.00 59.73 ? 75   GLU A CG  1 
ATOM   254  C CD  . GLU A 1 74  ? 33.920  17.706 87.093  1.00 58.02 ? 75   GLU A CD  1 
ATOM   255  O OE1 . GLU A 1 74  ? 33.452  18.761 87.558  1.00 56.00 ? 75   GLU A OE1 1 
ATOM   256  O OE2 . GLU A 1 74  ? 35.059  17.272 87.355  1.00 59.76 ? 75   GLU A OE2 1 
ATOM   257  N N   . ARG A 1 75  ? 28.614  17.641 85.471  1.00 38.18 ? 76   ARG A N   1 
ATOM   258  C CA  . ARG A 1 75  ? 27.245  17.855 85.908  1.00 33.82 ? 76   ARG A CA  1 
ATOM   259  C C   . ARG A 1 75  ? 26.230  17.492 84.828  1.00 36.14 ? 76   ARG A C   1 
ATOM   260  O O   . ARG A 1 75  ? 26.547  17.497 83.638  1.00 34.87 ? 76   ARG A O   1 
ATOM   261  C CB  . ARG A 1 75  ? 27.093  19.299 86.345  1.00 32.10 ? 76   ARG A CB  1 
ATOM   262  C CG  . ARG A 1 75  ? 28.206  19.713 87.321  1.00 32.21 ? 76   ARG A CG  1 
ATOM   263  C CD  . ARG A 1 75  ? 28.097  21.168 87.766  1.00 32.23 ? 76   ARG A CD  1 
ATOM   264  N NE  . ARG A 1 75  ? 28.963  21.448 88.910  1.00 30.66 ? 76   ARG A NE  1 
ATOM   265  C CZ  . ARG A 1 75  ? 30.282  21.622 88.835  1.00 34.16 ? 76   ARG A CZ  1 
ATOM   266  N NH1 . ARG A 1 75  ? 30.914  21.538 87.666  1.00 32.84 ? 76   ARG A NH1 1 
ATOM   267  N NH2 . ARG A 1 75  ? 30.977  21.867 89.939  1.00 31.68 ? 76   ARG A NH2 1 
ATOM   268  N N   . ALA A 1 76  ? 25.016  17.145 85.248  1.00 32.96 ? 77   ALA A N   1 
ATOM   269  C CA  . ALA A 1 76  ? 23.933  16.936 84.301  1.00 32.81 ? 77   ALA A CA  1 
ATOM   270  C C   . ALA A 1 76  ? 23.485  18.265 83.727  1.00 33.61 ? 77   ALA A C   1 
ATOM   271  O O   . ALA A 1 76  ? 23.806  19.329 84.270  1.00 30.53 ? 77   ALA A O   1 
ATOM   272  C CB  . ALA A 1 76  ? 22.755  16.235 84.962  1.00 32.19 ? 77   ALA A CB  1 
ATOM   273  N N   . LEU A 1 77  ? 22.719  18.177 82.642  1.00 33.06 ? 78   LEU A N   1 
ATOM   274  C CA  . LEU A 1 77  ? 22.138  19.333 81.982  1.00 34.08 ? 78   LEU A CA  1 
ATOM   275  C C   . LEU A 1 77  ? 20.646  19.142 81.767  1.00 35.44 ? 78   LEU A C   1 
ATOM   276  O O   . LEU A 1 77  ? 20.184  18.044 81.486  1.00 37.13 ? 78   LEU A O   1 
ATOM   277  C CB  . LEU A 1 77  ? 22.802  19.560 80.628  1.00 35.44 ? 78   LEU A CB  1 
ATOM   278  C CG  . LEU A 1 77  ? 24.222  20.094 80.650  1.00 39.48 ? 78   LEU A CG  1 
ATOM   279  C CD1 . LEU A 1 77  ? 24.773  20.049 79.247  1.00 47.62 ? 78   LEU A CD1 1 
ATOM   280  C CD2 . LEU A 1 77  ? 24.254  21.503 81.186  1.00 37.23 ? 78   LEU A CD2 1 
ATOM   281  N N   . PHE A 1 78  ? 19.897  20.225 81.911  1.00 34.60 ? 79   PHE A N   1 
ATOM   282  C CA  . PHE A 1 78  ? 18.493  20.229 81.567  1.00 30.31 ? 79   PHE A CA  1 
ATOM   283  C C   . PHE A 1 78  ? 18.313  21.078 80.317  1.00 33.48 ? 79   PHE A C   1 
ATOM   284  O O   . PHE A 1 78  ? 18.675  22.255 80.308  1.00 34.87 ? 79   PHE A O   1 
ATOM   285  C CB  . PHE A 1 78  ? 17.650  20.813 82.707  1.00 25.97 ? 79   PHE A CB  1 
ATOM   286  C CG  . PHE A 1 78  ? 16.186  20.912 82.373  1.00 35.58 ? 79   PHE A CG  1 
ATOM   287  C CD1 . PHE A 1 78  ? 15.663  22.065 81.804  1.00 24.48 ? 79   PHE A CD1 1 
ATOM   288  C CD2 . PHE A 1 78  ? 15.334  19.827 82.586  1.00 34.62 ? 79   PHE A CD2 1 
ATOM   289  C CE1 . PHE A 1 78  ? 14.309  22.140 81.468  1.00 28.15 ? 79   PHE A CE1 1 
ATOM   290  C CE2 . PHE A 1 78  ? 13.969  19.904 82.258  1.00 31.58 ? 79   PHE A CE2 1 
ATOM   291  C CZ  . PHE A 1 78  ? 13.462  21.052 81.702  1.00 27.74 ? 79   PHE A CZ  1 
ATOM   292  N N   . PRO A 1 79  ? 17.749  20.495 79.254  1.00 35.23 ? 80   PRO A N   1 
ATOM   293  C CA  . PRO A 1 79  ? 17.499  21.338 78.083  1.00 33.37 ? 80   PRO A CA  1 
ATOM   294  C C   . PRO A 1 79  ? 16.175  22.094 78.242  1.00 32.80 ? 80   PRO A C   1 
ATOM   295  O O   . PRO A 1 79  ? 15.087  21.500 78.214  1.00 30.50 ? 80   PRO A O   1 
ATOM   296  C CB  . PRO A 1 79  ? 17.429  20.319 76.930  1.00 30.53 ? 80   PRO A CB  1 
ATOM   297  C CG  . PRO A 1 79  ? 16.918  19.080 77.577  1.00 38.06 ? 80   PRO A CG  1 
ATOM   298  C CD  . PRO A 1 79  ? 17.444  19.075 78.996  1.00 40.06 ? 80   PRO A CD  1 
ATOM   299  N N   . GLN A 1 80  ? 16.255  23.403 78.430  1.00 30.53 ? 81   GLN A N   1 
ATOM   300  C CA  . GLN A 1 80  ? 15.026  24.181 78.491  1.00 25.21 ? 81   GLN A CA  1 
ATOM   301  C C   . GLN A 1 80  ? 14.606  24.527 77.071  1.00 25.96 ? 81   GLN A C   1 
ATOM   302  O O   . GLN A 1 80  ? 15.340  25.194 76.340  1.00 26.65 ? 81   GLN A O   1 
ATOM   303  C CB  . GLN A 1 80  ? 15.206  25.454 79.312  1.00 28.27 ? 81   GLN A CB  1 
ATOM   304  C CG  . GLN A 1 80  ? 13.919  26.258 79.379  1.00 27.95 ? 81   GLN A CG  1 
ATOM   305  C CD  . GLN A 1 80  ? 14.105  27.623 79.998  1.00 24.48 ? 81   GLN A CD  1 
ATOM   306  O OE1 . GLN A 1 80  ? 15.230  28.045 80.251  1.00 25.51 ? 81   GLN A OE1 1 
ATOM   307  N NE2 . GLN A 1 80  ? 13.001  28.319 80.246  1.00 20.94 ? 81   GLN A NE2 1 
ATOM   308  N N   . THR A 1 81  ? 13.428  24.070 76.676  1.00 29.29 ? 82   THR A N   1 
ATOM   309  C CA  . THR A 1 81  ? 12.965  24.260 75.312  1.00 28.36 ? 82   THR A CA  1 
ATOM   310  C C   . THR A 1 81  ? 11.826  25.272 75.235  1.00 29.93 ? 82   THR A C   1 
ATOM   311  O O   . THR A 1 81  ? 11.191  25.575 76.239  1.00 29.96 ? 82   THR A O   1 
ATOM   312  C CB  . THR A 1 81  ? 12.509  22.921 74.700  1.00 29.70 ? 82   THR A CB  1 
ATOM   313  O OG1 . THR A 1 81  ? 11.555  22.301 75.571  1.00 30.57 ? 82   THR A OG1 1 
ATOM   314  C CG2 . THR A 1 81  ? 13.706  21.983 74.506  1.00 29.36 ? 82   THR A CG2 1 
ATOM   315  N N   . ASN A 1 82  ? 11.593  25.796 74.035  1.00 29.17 ? 83   ASN A N   1 
ATOM   316  C CA  . ASN A 1 82  ? 10.474  26.686 73.766  1.00 28.21 ? 83   ASN A CA  1 
ATOM   317  C C   . ASN A 1 82  ? 9.162   25.896 73.841  1.00 27.45 ? 83   ASN A C   1 
ATOM   318  O O   . ASN A 1 82  ? 8.915   25.015 73.015  1.00 30.54 ? 83   ASN A O   1 
ATOM   319  C CB  . ASN A 1 82  ? 10.644  27.319 72.373  1.00 29.28 ? 83   ASN A CB  1 
ATOM   320  C CG  . ASN A 1 82  ? 9.609   28.414 72.076  1.00 34.06 ? 83   ASN A CG  1 
ATOM   321  O OD1 . ASN A 1 82  ? 8.536   28.467 72.685  1.00 25.64 ? 83   ASN A OD1 1 
ATOM   322  N ND2 . ASN A 1 82  ? 9.928   29.281 71.113  1.00 30.80 ? 83   ASN A ND2 1 
ATOM   323  N N   . PRO A 1 83  ? 8.304   26.215 74.826  1.00 24.27 ? 84   PRO A N   1 
ATOM   324  C CA  . PRO A 1 83  ? 7.044   25.466 74.904  1.00 24.07 ? 84   PRO A CA  1 
ATOM   325  C C   . PRO A 1 83  ? 6.117   25.668 73.691  1.00 27.61 ? 84   PRO A C   1 
ATOM   326  O O   . PRO A 1 83  ? 5.198   24.873 73.510  1.00 25.31 ? 84   PRO A O   1 
ATOM   327  C CB  . PRO A 1 83  ? 6.387   25.983 76.195  1.00 25.27 ? 84   PRO A CB  1 
ATOM   328  C CG  . PRO A 1 83  ? 7.054   27.303 76.493  1.00 26.17 ? 84   PRO A CG  1 
ATOM   329  C CD  . PRO A 1 83  ? 8.432   27.236 75.885  1.00 22.97 ? 84   PRO A CD  1 
ATOM   330  N N   . ALA A 1 84  ? 6.352   26.696 72.881  1.00 28.82 ? 85   ALA A N   1 
ATOM   331  C CA  . ALA A 1 84  ? 5.596   26.892 71.641  1.00 26.24 ? 85   ALA A CA  1 
ATOM   332  C C   . ALA A 1 84  ? 6.247   26.180 70.463  1.00 28.01 ? 85   ALA A C   1 
ATOM   333  O O   . ALA A 1 84  ? 5.655   26.059 69.391  1.00 30.05 ? 85   ALA A O   1 
ATOM   334  C CB  . ALA A 1 84  ? 5.469   28.389 71.329  1.00 26.22 ? 85   ALA A CB  1 
ATOM   335  N N   . ASN A 1 85  ? 7.479   25.728 70.657  1.00 28.44 ? 86   ASN A N   1 
ATOM   336  C CA  . ASN A 1 85  ? 8.249   25.073 69.589  1.00 36.40 ? 86   ASN A CA  1 
ATOM   337  C C   . ASN A 1 85  ? 9.316   24.204 70.250  1.00 30.39 ? 86   ASN A C   1 
ATOM   338  O O   . ASN A 1 85  ? 10.475  24.597 70.363  1.00 33.46 ? 86   ASN A O   1 
ATOM   339  C CB  . ASN A 1 85  ? 8.880   26.137 68.686  1.00 36.97 ? 86   ASN A CB  1 
ATOM   340  C CG  . ASN A 1 85  ? 9.749   25.548 67.582  1.00 43.98 ? 86   ASN A CG  1 
ATOM   341  O OD1 . ASN A 1 85  ? 9.645   24.372 67.245  1.00 45.47 ? 86   ASN A OD1 1 
ATOM   342  N ND2 . ASN A 1 85  ? 10.613  26.379 67.015  1.00 43.73 ? 86   ASN A ND2 1 
ATOM   343  N N   . HIS A 1 86  ? 8.905   23.032 70.720  1.00 38.21 ? 87   HIS A N   1 
ATOM   344  C CA  . HIS A 1 86  ? 9.681   22.303 71.721  1.00 42.56 ? 87   HIS A CA  1 
ATOM   345  C C   . HIS A 1 86  ? 10.885  21.531 71.194  1.00 41.43 ? 87   HIS A C   1 
ATOM   346  O O   . HIS A 1 86  ? 11.566  20.855 71.961  1.00 44.56 ? 87   HIS A O   1 
ATOM   347  C CB  . HIS A 1 86  ? 8.776   21.401 72.569  1.00 42.42 ? 87   HIS A CB  1 
ATOM   348  C CG  . HIS A 1 86  ? 7.904   20.492 71.764  1.00 40.29 ? 87   HIS A CG  1 
ATOM   349  N ND1 . HIS A 1 86  ? 8.404   19.625 70.816  1.00 43.21 ? 87   HIS A ND1 1 
ATOM   350  C CD2 . HIS A 1 86  ? 6.563   20.317 71.763  1.00 42.43 ? 87   HIS A CD2 1 
ATOM   351  C CE1 . HIS A 1 86  ? 7.408   18.955 70.264  1.00 43.21 ? 87   HIS A CE1 1 
ATOM   352  N NE2 . HIS A 1 86  ? 6.280   19.355 70.820  1.00 43.90 ? 87   HIS A NE2 1 
ATOM   353  N N   . GLN A 1 87  ? 11.156  21.635 69.897  1.00 40.17 ? 88   GLN A N   1 
ATOM   354  C CA  . GLN A 1 87  ? 12.401  21.095 69.367  1.00 46.81 ? 88   GLN A CA  1 
ATOM   355  C C   . GLN A 1 87  ? 13.482  22.153 69.539  1.00 45.58 ? 88   GLN A C   1 
ATOM   356  O O   . GLN A 1 87  ? 14.683  21.872 69.476  1.00 49.53 ? 88   GLN A O   1 
ATOM   357  C CB  . GLN A 1 87  ? 12.258  20.688 67.892  1.00 51.13 ? 88   GLN A CB  1 
ATOM   358  C CG  . GLN A 1 87  ? 11.918  21.832 66.944  1.00 56.84 ? 88   GLN A CG  1 
ATOM   359  C CD  . GLN A 1 87  ? 12.110  21.465 65.478  1.00 67.55 ? 88   GLN A CD  1 
ATOM   360  O OE1 . GLN A 1 87  ? 12.929  20.601 65.139  1.00 71.83 ? 88   GLN A OE1 1 
ATOM   361  N NE2 . GLN A 1 87  ? 11.354  22.123 64.599  1.00 68.02 ? 88   GLN A NE2 1 
ATOM   362  N N   . GLN A 1 88  ? 13.041  23.382 69.770  1.00 40.83 ? 89   GLN A N   1 
ATOM   363  C CA  . GLN A 1 88  ? 13.966  24.481 69.907  1.00 33.07 ? 89   GLN A CA  1 
ATOM   364  C C   . GLN A 1 88  ? 14.471  24.603 71.346  1.00 37.76 ? 89   GLN A C   1 
ATOM   365  O O   . GLN A 1 88  ? 13.725  25.004 72.259  1.00 35.91 ? 89   GLN A O   1 
ATOM   366  C CB  . GLN A 1 88  ? 13.317  25.782 69.454  1.00 35.12 ? 89   GLN A CB  1 
ATOM   367  C CG  . GLN A 1 88  ? 14.228  26.962 69.572  1.00 36.40 ? 89   GLN A CG  1 
ATOM   368  C CD  . GLN A 1 88  ? 13.488  28.276 69.581  1.00 48.58 ? 89   GLN A CD  1 
ATOM   369  O OE1 . GLN A 1 88  ? 12.265  28.323 69.491  1.00 48.67 ? 89   GLN A OE1 1 
ATOM   370  N NE2 . GLN A 1 88  ? 14.237  29.362 69.695  1.00 57.23 ? 89   GLN A NE2 1 
ATOM   371  N N   . VAL A 1 89  ? 15.744  24.253 71.526  1.00 34.23 ? 90   VAL A N   1 
ATOM   372  C CA  . VAL A 1 89  ? 16.430  24.326 72.809  1.00 31.30 ? 90   VAL A CA  1 
ATOM   373  C C   . VAL A 1 89  ? 16.967  25.734 73.026  1.00 30.62 ? 90   VAL A C   1 
ATOM   374  O O   . VAL A 1 89  ? 17.862  26.187 72.310  1.00 34.31 ? 90   VAL A O   1 
ATOM   375  C CB  . VAL A 1 89  ? 17.619  23.324 72.880  1.00 32.59 ? 90   VAL A CB  1 
ATOM   376  C CG1 . VAL A 1 89  ? 18.245  23.336 74.273  1.00 31.52 ? 90   VAL A CG1 1 
ATOM   377  C CG2 . VAL A 1 89  ? 17.157  21.910 72.497  1.00 33.94 ? 90   VAL A CG2 1 
ATOM   378  N N   . LEU A 1 90  ? 16.428  26.414 74.029  1.00 28.89 ? 91   LEU A N   1 
ATOM   379  C CA  . LEU A 1 90  ? 16.830  27.779 74.350  1.00 32.81 ? 91   LEU A CA  1 
ATOM   380  C C   . LEU A 1 90  ? 18.056  27.825 75.246  1.00 34.60 ? 91   LEU A C   1 
ATOM   381  O O   . LEU A 1 90  ? 18.840  28.774 75.206  1.00 35.29 ? 91   LEU A O   1 
ATOM   382  C CB  . LEU A 1 90  ? 15.682  28.486 75.059  1.00 30.12 ? 91   LEU A CB  1 
ATOM   383  C CG  . LEU A 1 90  ? 14.383  28.504 74.246  1.00 32.47 ? 91   LEU A CG  1 
ATOM   384  C CD1 . LEU A 1 90  ? 13.194  28.896 75.118  1.00 29.18 ? 91   LEU A CD1 1 
ATOM   385  C CD2 . LEU A 1 90  ? 14.533  29.469 73.058  1.00 30.91 ? 91   LEU A CD2 1 
ATOM   386  N N   . ALA A 1 91  ? 18.203  26.810 76.086  1.00 34.74 ? 92   ALA A N   1 
ATOM   387  C CA  . ALA A 1 91  ? 19.284  26.794 77.064  1.00 32.61 ? 92   ALA A CA  1 
ATOM   388  C C   . ALA A 1 91  ? 19.596  25.390 77.533  1.00 31.55 ? 92   ALA A C   1 
ATOM   389  O O   . ALA A 1 91  ? 18.713  24.546 77.663  1.00 28.08 ? 92   ALA A O   1 
ATOM   390  C CB  . ALA A 1 91  ? 18.955  27.662 78.249  1.00 25.85 ? 92   ALA A CB  1 
ATOM   391  N N   . ASN A 1 92  ? 20.871  25.150 77.764  1.00 30.50 ? 93   ASN A N   1 
ATOM   392  C CA  . ASN A 1 92  ? 21.298  23.949 78.430  1.00 32.18 ? 93   ASN A CA  1 
ATOM   393  C C   . ASN A 1 92  ? 21.655  24.356 79.835  1.00 29.57 ? 93   ASN A C   1 
ATOM   394  O O   . ASN A 1 92  ? 22.575  25.144 80.048  1.00 29.15 ? 93   ASN A O   1 
ATOM   395  C CB  . ASN A 1 92  ? 22.483  23.331 77.696  1.00 33.20 ? 93   ASN A CB  1 
ATOM   396  C CG  . ASN A 1 92  ? 22.089  22.806 76.337  1.00 38.75 ? 93   ASN A CG  1 
ATOM   397  O OD1 . ASN A 1 92  ? 22.665  23.193 75.316  1.00 49.41 ? 93   ASN A OD1 1 
ATOM   398  N ND2 . ASN A 1 92  ? 21.084  21.941 76.311  1.00 35.28 ? 93   ASN A ND2 1 
ATOM   399  N N   . VAL A 1 93  ? 20.910  23.830 80.795  1.00 30.89 ? 94   VAL A N   1 
ATOM   400  C CA  . VAL A 1 93  ? 20.995  24.323 82.158  1.00 31.15 ? 94   VAL A CA  1 
ATOM   401  C C   . VAL A 1 93  ? 21.767  23.397 83.065  1.00 32.81 ? 94   VAL A C   1 
ATOM   402  O O   . VAL A 1 93  ? 21.321  22.275 83.357  1.00 28.24 ? 94   VAL A O   1 
ATOM   403  C CB  . VAL A 1 93  ? 19.604  24.547 82.738  1.00 28.96 ? 94   VAL A CB  1 
ATOM   404  C CG1 . VAL A 1 93  ? 19.691  25.231 84.127  1.00 23.47 ? 94   VAL A CG1 1 
ATOM   405  C CG2 . VAL A 1 93  ? 18.767  25.361 81.742  1.00 24.30 ? 94   VAL A CG2 1 
ATOM   406  N N   . THR A 1 94  ? 22.932  23.886 83.496  1.00 33.05 ? 95   THR A N   1 
ATOM   407  C CA  . THR A 1 94  ? 23.785  23.190 84.456  1.00 30.40 ? 95   THR A CA  1 
ATOM   408  C C   . THR A 1 94  ? 22.976  22.801 85.684  1.00 28.93 ? 95   THR A C   1 
ATOM   409  O O   . THR A 1 94  ? 22.129  23.573 86.165  1.00 25.95 ? 95   THR A O   1 
ATOM   410  C CB  . THR A 1 94  ? 25.012  24.044 84.861  1.00 30.30 ? 95   THR A CB  1 
ATOM   411  O OG1 . THR A 1 94  ? 25.750  24.391 83.688  1.00 32.33 ? 95   THR A OG1 1 
ATOM   412  C CG2 . THR A 1 94  ? 25.936  23.276 85.789  1.00 29.56 ? 95   THR A CG2 1 
ATOM   413  N N   . GLN A 1 95  ? 23.212  21.580 86.155  1.00 28.39 ? 96   GLN A N   1 
ATOM   414  C CA  . GLN A 1 95  ? 22.462  21.005 87.263  1.00 30.94 ? 96   GLN A CA  1 
ATOM   415  C C   . GLN A 1 95  ? 23.376  20.787 88.463  1.00 32.59 ? 96   GLN A C   1 
ATOM   416  O O   . GLN A 1 95  ? 24.394  20.084 88.369  1.00 28.35 ? 96   GLN A O   1 
ATOM   417  C CB  . GLN A 1 95  ? 21.826  19.692 86.824  1.00 27.44 ? 96   GLN A CB  1 
ATOM   418  C CG  . GLN A 1 95  ? 20.933  19.871 85.620  1.00 28.72 ? 96   GLN A CG  1 
ATOM   419  C CD  . GLN A 1 95  ? 19.608  20.494 85.990  1.00 30.90 ? 96   GLN A CD  1 
ATOM   420  O OE1 . GLN A 1 95  ? 18.741  19.831 86.549  1.00 34.91 ? 96   GLN A OE1 1 
ATOM   421  N NE2 . GLN A 1 95  ? 19.456  21.785 85.715  1.00 32.79 ? 96   GLN A NE2 1 
ATOM   422  N N   . ALA A 1 96  ? 23.001  21.398 89.581  1.00 25.85 ? 97   ALA A N   1 
ATOM   423  C CA  . ALA A 1 96  ? 23.816  21.383 90.788  1.00 27.66 ? 97   ALA A CA  1 
ATOM   424  C C   . ALA A 1 96  ? 24.056  19.984 91.375  1.00 27.26 ? 97   ALA A C   1 
ATOM   425  O O   . ALA A 1 96  ? 23.119  19.201 91.527  1.00 33.38 ? 97   ALA A O   1 
ATOM   426  C CB  . ALA A 1 96  ? 23.193  22.282 91.838  1.00 24.72 ? 97   ALA A CB  1 
ATOM   427  N N   . THR A 1 97  ? 25.308  19.695 91.721  1.00 33.80 ? 98   THR A N   1 
ATOM   428  C CA  . THR A 1 97  ? 25.640  18.470 92.448  1.00 35.31 ? 98   THR A CA  1 
ATOM   429  C C   . THR A 1 97  ? 25.417  18.678 93.937  1.00 33.91 ? 98   THR A C   1 
ATOM   430  O O   . THR A 1 97  ? 25.176  19.795 94.392  1.00 30.39 ? 98   THR A O   1 
ATOM   431  C CB  . THR A 1 97  ? 27.119  18.080 92.301  1.00 32.17 ? 98   THR A CB  1 
ATOM   432  O OG1 . THR A 1 97  ? 27.932  19.109 92.880  1.00 32.12 ? 98   THR A OG1 1 
ATOM   433  C CG2 . THR A 1 97  ? 27.490  17.881 90.849  1.00 31.99 ? 98   THR A CG2 1 
ATOM   434  N N   . GLU A 1 98  ? 25.538  17.594 94.694  1.00 34.89 ? 99   GLU A N   1 
ATOM   435  C CA  . GLU A 1 98  ? 25.441  17.658 96.136  1.00 36.77 ? 99   GLU A CA  1 
ATOM   436  C C   . GLU A 1 98  ? 26.529  18.579 96.676  1.00 35.67 ? 99   GLU A C   1 
ATOM   437  O O   . GLU A 1 98  ? 26.283  19.404 97.564  1.00 35.81 ? 99   GLU A O   1 
ATOM   438  C CB  . GLU A 1 98  ? 25.551  16.254 96.731  1.00 43.55 ? 99   GLU A CB  1 
ATOM   439  C CG  . GLU A 1 98  ? 26.034  16.226 98.170  1.00 55.16 ? 99   GLU A CG  1 
ATOM   440  C CD  . GLU A 1 98  ? 26.187  14.813 98.734  1.00 60.66 ? 99   GLU A CD  1 
ATOM   441  O OE1 . GLU A 1 98  ? 26.978  14.650 99.684  1.00 67.82 ? 99   GLU A OE1 1 
ATOM   442  O OE2 . GLU A 1 98  ? 25.519  13.875 98.241  1.00 56.49 ? 99   GLU A OE2 1 
ATOM   443  N N   . LYS A 1 99  ? 27.724  18.462 96.109  1.00 33.20 ? 100  LYS A N   1 
ATOM   444  C CA  . LYS A 1 99  ? 28.833  19.313 96.509  1.00 33.57 ? 100  LYS A CA  1 
ATOM   445  C C   . LYS A 1 99  ? 28.565  20.793 96.194  1.00 31.64 ? 100  LYS A C   1 
ATOM   446  O O   . LYS A 1 99  ? 28.806  21.651 97.040  1.00 31.17 ? 100  LYS A O   1 
ATOM   447  C CB  . LYS A 1 99  ? 30.143  18.847 95.870  1.00 39.77 ? 100  LYS A CB  1 
ATOM   448  C CG  . LYS A 1 99  ? 31.377  19.428 96.531  1.00 54.41 ? 100  LYS A CG  1 
ATOM   449  C CD  . LYS A 1 99  ? 31.444  19.053 98.008  1.00 61.39 ? 100  LYS A CD  1 
ATOM   450  C CE  . LYS A 1 99  ? 32.713  19.585 98.660  1.00 64.80 ? 100  LYS A CE  1 
ATOM   451  N NZ  . LYS A 1 99  ? 32.439  20.651 99.664  1.00 65.02 ? 100  LYS A NZ  1 
ATOM   452  N N   . ASP A 1 100 ? 28.082  21.080 94.984  1.00 30.04 ? 101  ASP A N   1 
ATOM   453  C CA  . ASP A 1 100 ? 27.674  22.444 94.607  1.00 29.76 ? 101  ASP A CA  1 
ATOM   454  C C   . ASP A 1 100 ? 26.691  23.021 95.611  1.00 26.14 ? 101  ASP A C   1 
ATOM   455  O O   . ASP A 1 100 ? 26.854  24.143 96.072  1.00 34.61 ? 101  ASP A O   1 
ATOM   456  C CB  . ASP A 1 100 ? 27.030  22.468 93.208  1.00 27.07 ? 101  ASP A CB  1 
ATOM   457  C CG  . ASP A 1 100 ? 27.995  22.031 92.108  1.00 35.63 ? 101  ASP A CG  1 
ATOM   458  O OD1 . ASP A 1 100 ? 29.198  22.359 92.209  1.00 36.54 ? 101  ASP A OD1 1 
ATOM   459  O OD2 . ASP A 1 100 ? 27.553  21.353 91.156  1.00 28.83 ? 101  ASP A OD2 1 
ATOM   460  N N   . VAL A 1 101 ? 25.662  22.247 95.945  1.00 28.91 ? 102  VAL A N   1 
ATOM   461  C CA  . VAL A 1 101 ? 24.667  22.708 96.902  1.00 29.36 ? 102  VAL A CA  1 
ATOM   462  C C   . VAL A 1 101 ? 25.312  23.064 98.248  1.00 28.73 ? 102  VAL A C   1 
ATOM   463  O O   . VAL A 1 101 ? 25.041  24.126 98.813  1.00 26.22 ? 102  VAL A O   1 
ATOM   464  C CB  . VAL A 1 101 ? 23.553  21.674 97.110  1.00 31.47 ? 102  VAL A CB  1 
ATOM   465  C CG1 . VAL A 1 101 ? 22.568  22.170 98.168  1.00 24.10 ? 102  VAL A CG1 1 
ATOM   466  C CG2 . VAL A 1 101 ? 22.851  21.367 95.777  1.00 26.71 ? 102  VAL A CG2 1 
ATOM   467  N N   . MET A 1 102 ? 26.148  22.162 98.755  1.00 26.51 ? 103  MET A N   1 
ATOM   468  C CA  . MET A 1 102 ? 26.931  22.426 99.958  1.00 36.74 ? 103  MET A CA  1 
ATOM   469  C C   . MET A 1 102 ? 27.767  23.706 99.844  1.00 34.99 ? 103  MET A C   1 
ATOM   470  O O   . MET A 1 102 ? 27.836  24.488 100.795 1.00 34.36 ? 103  MET A O   1 
ATOM   471  C CB  . MET A 1 102 ? 27.830  21.235 100.287 1.00 32.78 ? 103  MET A CB  1 
ATOM   472  C CG  . MET A 1 102 ? 27.057  20.000 100.718 1.00 42.88 ? 103  MET A CG  1 
ATOM   473  S SD  . MET A 1 102 ? 28.109  18.595 101.156 1.00 50.92 ? 103  MET A SD  1 
ATOM   474  C CE  . MET A 1 102 ? 29.248  19.396 102.300 1.00 42.64 ? 103  MET A CE  1 
ATOM   475  N N   . ASN A 1 103 ? 28.396  23.914 98.689  1.00 26.78 ? 104  ASN A N   1 
ATOM   476  C CA  . ASN A 1 103 ? 29.134  25.160 98.431  1.00 29.23 ? 104  ASN A CA  1 
ATOM   477  C C   . ASN A 1 103 ? 28.209  26.378 98.361  1.00 31.35 ? 104  ASN A C   1 
ATOM   478  O O   . ASN A 1 103 ? 28.584  27.480 98.781  1.00 27.05 ? 104  ASN A O   1 
ATOM   479  C CB  . ASN A 1 103 ? 29.968  25.058 97.149  1.00 27.07 ? 104  ASN A CB  1 
ATOM   480  C CG  . ASN A 1 103 ? 31.104  24.049 97.269  1.00 38.37 ? 104  ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 103 ? 31.501  23.675 98.368  1.00 38.21 ? 104  ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 103 ? 31.628  23.608 96.133  1.00 41.04 ? 104  ASN A ND2 1 
ATOM   483  N N   . ALA A 1 104 ? 26.994  26.182 97.845  1.00 27.94 ? 105  ALA A N   1 
ATOM   484  C CA  . ALA A 1 104 ? 26.023  27.274 97.818  1.00 26.04 ? 105  ALA A CA  1 
ATOM   485  C C   . ALA A 1 104 ? 25.642  27.646 99.240  1.00 22.57 ? 105  ALA A C   1 
ATOM   486  O O   . ALA A 1 104 ? 25.618  28.820 99.602  1.00 30.45 ? 105  ALA A O   1 
ATOM   487  C CB  . ALA A 1 104 ? 24.781  26.887 97.012  1.00 22.27 ? 105  ALA A CB  1 
ATOM   488  N N   . VAL A 1 105 ? 25.346  26.636 100.048 1.00 25.92 ? 106  VAL A N   1 
ATOM   489  C CA  . VAL A 1 105 ? 24.979  26.855 101.443 1.00 23.04 ? 106  VAL A CA  1 
ATOM   490  C C   . VAL A 1 105 ? 26.140  27.529 102.190 1.00 30.97 ? 106  VAL A C   1 
ATOM   491  O O   . VAL A 1 105 ? 25.937  28.451 102.992 1.00 26.75 ? 106  VAL A O   1 
ATOM   492  C CB  . VAL A 1 105 ? 24.565  25.527 102.134 1.00 25.70 ? 106  VAL A CB  1 
ATOM   493  C CG1 . VAL A 1 105 ? 24.507  25.699 103.646 1.00 24.13 ? 106  VAL A CG1 1 
ATOM   494  C CG2 . VAL A 1 105 ? 23.232  25.037 101.588 1.00 26.59 ? 106  VAL A CG2 1 
ATOM   495  N N   . LYS A 1 106 ? 27.360  27.098 101.893 1.00 28.10 ? 107  LYS A N   1 
ATOM   496  C CA  . LYS A 1 106 ? 28.528  27.712 102.512 1.00 32.08 ? 107  LYS A CA  1 
ATOM   497  C C   . LYS A 1 106 ? 28.683  29.173 102.100 1.00 32.06 ? 107  LYS A C   1 
ATOM   498  O O   . LYS A 1 106 ? 28.953  30.047 102.941 1.00 30.72 ? 107  LYS A O   1 
ATOM   499  C CB  . LYS A 1 106 ? 29.803  26.942 102.163 1.00 36.66 ? 107  LYS A CB  1 
ATOM   500  C CG  . LYS A 1 106 ? 31.044  27.463 102.886 1.00 37.49 ? 107  LYS A CG  1 
ATOM   501  C CD  . LYS A 1 106 ? 32.282  26.656 102.511 1.00 41.33 ? 107  LYS A CD  1 
ATOM   502  C CE  . LYS A 1 106 ? 33.446  26.911 103.470 1.00 40.45 ? 107  LYS A CE  1 
ATOM   503  N NZ  . LYS A 1 106 ? 33.731  28.363 103.687 1.00 37.41 ? 107  LYS A NZ  1 
ATOM   504  N N   . ALA A 1 107 ? 28.516  29.439 100.808 1.00 26.38 ? 108  ALA A N   1 
ATOM   505  C CA  . ALA A 1 107 ? 28.659  30.800 100.311 1.00 24.71 ? 108  ALA A CA  1 
ATOM   506  C C   . ALA A 1 107 ? 27.677  31.734 101.016 1.00 24.46 ? 108  ALA A C   1 
ATOM   507  O O   . ALA A 1 107 ? 28.039  32.849 101.384 1.00 28.61 ? 108  ALA A O   1 
ATOM   508  C CB  . ALA A 1 107 ? 28.468  30.856 98.796  1.00 22.70 ? 108  ALA A CB  1 
ATOM   509  N N   . ALA A 1 108 ? 26.448  31.263 101.217 1.00 23.15 ? 109  ALA A N   1 
ATOM   510  C CA  . ALA A 1 108 ? 25.400  32.065 101.840 1.00 22.91 ? 109  ALA A CA  1 
ATOM   511  C C   . ALA A 1 108 ? 25.768  32.385 103.281 1.00 27.37 ? 109  ALA A C   1 
ATOM   512  O O   . ALA A 1 108 ? 25.556  33.502 103.741 1.00 28.41 ? 109  ALA A O   1 
ATOM   513  C CB  . ALA A 1 108 ? 24.017  31.335 101.784 1.00 20.43 ? 109  ALA A CB  1 
ATOM   514  N N   . LYS A 1 109 ? 26.277  31.385 103.998 1.00 30.84 ? 110  LYS A N   1 
ATOM   515  C CA  . LYS A 1 109 ? 26.677  31.581 105.381 1.00 31.56 ? 110  LYS A CA  1 
ATOM   516  C C   . LYS A 1 109 ? 27.871  32.531 105.477 1.00 28.64 ? 110  LYS A C   1 
ATOM   517  O O   . LYS A 1 109 ? 27.920  33.363 106.379 1.00 29.36 ? 110  LYS A O   1 
ATOM   518  C CB  . LYS A 1 109 ? 26.997  30.250 106.062 1.00 33.46 ? 110  LYS A CB  1 
ATOM   519  N N   . ASP A 1 110 ? 28.807  32.427 104.535 1.00 25.24 ? 111  ASP A N   1 
ATOM   520  C CA  . ASP A 1 110 ? 30.018  33.254 104.560 1.00 29.68 ? 111  ASP A CA  1 
ATOM   521  C C   . ASP A 1 110 ? 29.753  34.712 104.229 1.00 35.81 ? 111  ASP A C   1 
ATOM   522  O O   . ASP A 1 110 ? 30.504  35.589 104.652 1.00 33.63 ? 111  ASP A O   1 
ATOM   523  C CB  . ASP A 1 110 ? 31.092  32.711 103.614 1.00 32.26 ? 111  ASP A CB  1 
ATOM   524  C CG  . ASP A 1 110 ? 31.703  31.414 104.110 1.00 41.25 ? 111  ASP A CG  1 
ATOM   525  O OD1 . ASP A 1 110 ? 31.478  31.077 105.292 1.00 44.29 ? 111  ASP A OD1 1 
ATOM   526  O OD2 . ASP A 1 110 ? 32.396  30.725 103.320 1.00 39.29 ? 111  ASP A OD2 1 
ATOM   527  N N   . ALA A 1 111 ? 28.692  34.973 103.469 1.00 36.38 ? 112  ALA A N   1 
ATOM   528  C CA  . ALA A 1 111 ? 28.384  36.340 103.048 1.00 32.33 ? 112  ALA A CA  1 
ATOM   529  C C   . ALA A 1 111 ? 27.482  37.033 104.052 1.00 25.25 ? 112  ALA A C   1 
ATOM   530  O O   . ALA A 1 111 ? 27.305  38.252 103.994 1.00 25.97 ? 112  ALA A O   1 
ATOM   531  C CB  . ALA A 1 111 ? 27.724  36.347 101.643 1.00 25.57 ? 112  ALA A CB  1 
ATOM   532  N N   . LYS A 1 112 ? 26.910  36.245 104.961 1.00 23.82 ? 113  LYS A N   1 
ATOM   533  C CA  . LYS A 1 112 ? 25.843  36.718 105.838 1.00 25.00 ? 113  LYS A CA  1 
ATOM   534  C C   . LYS A 1 112 ? 26.175  38.022 106.604 1.00 25.49 ? 113  LYS A C   1 
ATOM   535  O O   . LYS A 1 112 ? 25.487  39.037 106.442 1.00 28.09 ? 113  LYS A O   1 
ATOM   536  C CB  . LYS A 1 112 ? 25.419  35.594 106.797 1.00 26.07 ? 113  LYS A CB  1 
ATOM   537  C CG  . LYS A 1 112 ? 24.281  35.965 107.741 1.00 21.68 ? 113  LYS A CG  1 
ATOM   538  C CD  . LYS A 1 112 ? 23.022  36.444 107.000 1.00 22.30 ? 113  LYS A CD  1 
ATOM   539  C CE  . LYS A 1 112 ? 21.812  36.316 107.910 1.00 22.43 ? 113  LYS A CE  1 
ATOM   540  N NZ  . LYS A 1 112 ? 21.592  34.862 108.259 1.00 28.88 ? 113  LYS A NZ  1 
ATOM   541  N N   . LYS A 1 113 ? 27.227  37.997 107.416 1.00 26.72 ? 114  LYS A N   1 
ATOM   542  C CA  . LYS A 1 113 ? 27.630  39.170 108.205 1.00 29.59 ? 114  LYS A CA  1 
ATOM   543  C C   . LYS A 1 113 ? 27.921  40.433 107.362 1.00 23.91 ? 114  LYS A C   1 
ATOM   544  O O   . LYS A 1 113 ? 27.428  41.516 107.674 1.00 23.70 ? 114  LYS A O   1 
ATOM   545  C CB  . LYS A 1 113 ? 28.838  38.834 109.097 1.00 35.42 ? 114  LYS A CB  1 
ATOM   546  N N   . ASP A 1 114 ? 28.724  40.314 106.310 1.00 24.36 ? 115  ASP A N   1 
ATOM   547  C CA  . ASP A 1 114 ? 28.994  41.493 105.470 1.00 28.24 ? 115  ASP A CA  1 
ATOM   548  C C   . ASP A 1 114 ? 27.742  41.999 104.774 1.00 30.61 ? 115  ASP A C   1 
ATOM   549  O O   . ASP A 1 114 ? 27.678  43.166 104.368 1.00 28.68 ? 115  ASP A O   1 
ATOM   550  C CB  . ASP A 1 114 ? 30.077  41.210 104.428 1.00 28.74 ? 115  ASP A CB  1 
ATOM   551  C CG  . ASP A 1 114 ? 31.451  41.083 105.055 1.00 38.88 ? 115  ASP A CG  1 
ATOM   552  O OD1 . ASP A 1 114 ? 31.522  41.169 106.300 1.00 35.97 ? 115  ASP A OD1 1 
ATOM   553  O OD2 . ASP A 1 114 ? 32.447  40.897 104.315 1.00 40.71 ? 115  ASP A OD2 1 
ATOM   554  N N   . TRP A 1 115 ? 26.757  41.113 104.621 1.00 26.81 ? 116  TRP A N   1 
ATOM   555  C CA  . TRP A 1 115 ? 25.520  41.494 103.964 1.00 21.88 ? 116  TRP A CA  1 
ATOM   556  C C   . TRP A 1 115 ? 24.596  42.209 104.937 1.00 20.60 ? 116  TRP A C   1 
ATOM   557  O O   . TRP A 1 115 ? 24.094  43.284 104.626 1.00 23.15 ? 116  TRP A O   1 
ATOM   558  C CB  . TRP A 1 115 ? 24.831  40.281 103.333 1.00 20.59 ? 116  TRP A CB  1 
ATOM   559  C CG  . TRP A 1 115 ? 23.509  40.579 102.685 1.00 23.12 ? 116  TRP A CG  1 
ATOM   560  C CD1 . TRP A 1 115 ? 22.303  40.037 103.015 1.00 18.82 ? 116  TRP A CD1 1 
ATOM   561  C CD2 . TRP A 1 115 ? 23.256  41.487 101.593 1.00 24.06 ? 116  TRP A CD2 1 
ATOM   562  N NE1 . TRP A 1 115 ? 21.312  40.548 102.198 1.00 20.35 ? 116  TRP A NE1 1 
ATOM   563  C CE2 . TRP A 1 115 ? 21.873  41.432 101.316 1.00 20.94 ? 116  TRP A CE2 1 
ATOM   564  C CE3 . TRP A 1 115 ? 24.064  42.335 100.827 1.00 19.34 ? 116  TRP A CE3 1 
ATOM   565  C CZ2 . TRP A 1 115 ? 21.286  42.177 100.301 1.00 18.31 ? 116  TRP A CZ2 1 
ATOM   566  C CZ3 . TRP A 1 115 ? 23.476  43.093 99.818  1.00 18.96 ? 116  TRP A CZ3 1 
ATOM   567  C CH2 . TRP A 1 115 ? 22.101  43.003 99.561  1.00 20.80 ? 116  TRP A CH2 1 
ATOM   568  N N   . TYR A 1 116 ? 24.367  41.646 106.120 1.00 21.46 ? 117  TYR A N   1 
ATOM   569  C CA  . TYR A 1 116 ? 23.408  42.309 106.984 1.00 24.06 ? 117  TYR A CA  1 
ATOM   570  C C   . TYR A 1 116 ? 24.035  43.555 107.594 1.00 26.86 ? 117  TYR A C   1 
ATOM   571  O O   . TYR A 1 116 ? 23.325  44.459 108.019 1.00 30.78 ? 117  TYR A O   1 
ATOM   572  C CB  . TYR A 1 116 ? 22.750  41.380 108.016 1.00 21.97 ? 117  TYR A CB  1 
ATOM   573  C CG  . TYR A 1 116 ? 23.617  40.817 109.130 1.00 27.67 ? 117  TYR A CG  1 
ATOM   574  C CD1 . TYR A 1 116 ? 24.201  41.646 110.090 1.00 32.99 ? 117  TYR A CD1 1 
ATOM   575  C CD2 . TYR A 1 116 ? 23.790  39.436 109.264 1.00 32.47 ? 117  TYR A CD2 1 
ATOM   576  C CE1 . TYR A 1 116 ? 24.969  41.110 111.135 1.00 32.00 ? 117  TYR A CE1 1 
ATOM   577  C CE2 . TYR A 1 116 ? 24.545  38.891 110.293 1.00 34.13 ? 117  TYR A CE2 1 
ATOM   578  C CZ  . TYR A 1 116 ? 25.130  39.731 111.227 1.00 36.63 ? 117  TYR A CZ  1 
ATOM   579  O OH  . TYR A 1 116 ? 25.884  39.184 112.245 1.00 35.84 ? 117  TYR A OH  1 
ATOM   580  N N   . ASN A 1 117 ? 25.367  43.605 107.597 1.00 27.70 ? 118  ASN A N   1 
ATOM   581  C CA  . ASN A 1 117 ? 26.088  44.828 107.979 1.00 32.86 ? 118  ASN A CA  1 
ATOM   582  C C   . ASN A 1 117 ? 26.185  45.872 106.876 1.00 30.87 ? 118  ASN A C   1 
ATOM   583  O O   . ASN A 1 117 ? 26.590  46.998 107.132 1.00 28.79 ? 118  ASN A O   1 
ATOM   584  C CB  . ASN A 1 117 ? 27.505  44.523 108.474 1.00 29.83 ? 118  ASN A CB  1 
ATOM   585  C CG  . ASN A 1 117 ? 27.527  44.019 109.890 1.00 32.30 ? 118  ASN A CG  1 
ATOM   586  O OD1 . ASN A 1 117 ? 26.626  44.300 110.680 1.00 36.36 ? 118  ASN A OD1 1 
ATOM   587  N ND2 . ASN A 1 117 ? 28.566  43.272 110.229 1.00 32.07 ? 118  ASN A ND2 1 
ATOM   588  N N   . LEU A 1 118 ? 25.861  45.495 105.645 1.00 29.82 ? 119  LEU A N   1 
ATOM   589  C CA  . LEU A 1 118 ? 25.804  46.484 104.573 1.00 26.50 ? 119  LEU A CA  1 
ATOM   590  C C   . LEU A 1 118 ? 24.556  47.323 104.807 1.00 27.50 ? 119  LEU A C   1 
ATOM   591  O O   . LEU A 1 118 ? 23.474  46.769 104.995 1.00 27.80 ? 119  LEU A O   1 
ATOM   592  C CB  . LEU A 1 118 ? 25.737  45.795 103.215 1.00 23.87 ? 119  LEU A CB  1 
ATOM   593  C CG  . LEU A 1 118 ? 25.781  46.720 102.003 1.00 26.12 ? 119  LEU A CG  1 
ATOM   594  C CD1 . LEU A 1 118 ? 27.139  47.453 101.931 1.00 28.71 ? 119  LEU A CD1 1 
ATOM   595  C CD2 . LEU A 1 118 ? 25.543  45.912 100.749 1.00 23.35 ? 119  LEU A CD2 1 
ATOM   596  N N   . PRO A 1 119 ? 24.702  48.661 104.825 1.00 22.17 ? 120  PRO A N   1 
ATOM   597  C CA  . PRO A 1 119 ? 23.571  49.499 105.210 1.00 22.39 ? 120  PRO A CA  1 
ATOM   598  C C   . PRO A 1 119 ? 22.367  49.261 104.311 1.00 25.04 ? 120  PRO A C   1 
ATOM   599  O O   . PRO A 1 119 ? 22.528  48.970 103.130 1.00 24.49 ? 120  PRO A O   1 
ATOM   600  C CB  . PRO A 1 119 ? 24.101  50.919 105.001 1.00 24.60 ? 120  PRO A CB  1 
ATOM   601  C CG  . PRO A 1 119 ? 25.585  50.787 105.124 1.00 24.58 ? 120  PRO A CG  1 
ATOM   602  C CD  . PRO A 1 119 ? 25.907  49.455 104.535 1.00 22.53 ? 120  PRO A CD  1 
ATOM   603  N N   . PHE A 1 120 ? 21.179  49.389 104.888 1.00 23.36 ? 121  PHE A N   1 
ATOM   604  C CA  . PHE A 1 120 ? 19.932  49.204 104.170 1.00 22.75 ? 121  PHE A CA  1 
ATOM   605  C C   . PHE A 1 120 ? 19.873  50.036 102.884 1.00 26.24 ? 121  PHE A C   1 
ATOM   606  O O   . PHE A 1 120 ? 19.377  49.570 101.854 1.00 26.66 ? 121  PHE A O   1 
ATOM   607  C CB  . PHE A 1 120 ? 18.750  49.555 105.075 1.00 23.17 ? 121  PHE A CB  1 
ATOM   608  C CG  . PHE A 1 120 ? 17.455  49.688 104.335 1.00 25.40 ? 121  PHE A CG  1 
ATOM   609  C CD1 . PHE A 1 120 ? 16.833  48.570 103.804 1.00 26.00 ? 121  PHE A CD1 1 
ATOM   610  C CD2 . PHE A 1 120 ? 16.876  50.935 104.143 1.00 27.15 ? 121  PHE A CD2 1 
ATOM   611  C CE1 . PHE A 1 120 ? 15.629  48.683 103.112 1.00 27.72 ? 121  PHE A CE1 1 
ATOM   612  C CE2 . PHE A 1 120 ? 15.670  51.065 103.452 1.00 25.40 ? 121  PHE A CE2 1 
ATOM   613  C CZ  . PHE A 1 120 ? 15.045  49.942 102.929 1.00 21.76 ? 121  PHE A CZ  1 
ATOM   614  N N   . TYR A 1 121 ? 20.376  51.265 102.961 1.00 24.71 ? 122  TYR A N   1 
ATOM   615  C CA  . TYR A 1 121 ? 20.439  52.142 101.806 1.00 26.89 ? 122  TYR A CA  1 
ATOM   616  C C   . TYR A 1 121 ? 21.086  51.415 100.632 1.00 24.78 ? 122  TYR A C   1 
ATOM   617  O O   . TYR A 1 121 ? 20.571  51.451 99.517  1.00 20.84 ? 122  TYR A O   1 
ATOM   618  C CB  . TYR A 1 121 ? 21.214  53.431 102.131 1.00 23.93 ? 122  TYR A CB  1 
ATOM   619  C CG  . TYR A 1 121 ? 21.305  54.390 100.962 1.00 24.19 ? 122  TYR A CG  1 
ATOM   620  C CD1 . TYR A 1 121 ? 20.223  55.184 100.596 1.00 24.35 ? 122  TYR A CD1 1 
ATOM   621  C CD2 . TYR A 1 121 ? 22.468  54.484 100.210 1.00 21.73 ? 122  TYR A CD2 1 
ATOM   622  C CE1 . TYR A 1 121 ? 20.303  56.069 99.508  1.00 25.80 ? 122  TYR A CE1 1 
ATOM   623  C CE2 . TYR A 1 121 ? 22.570  55.355 99.133  1.00 26.15 ? 122  TYR A CE2 1 
ATOM   624  C CZ  . TYR A 1 121 ? 21.492  56.147 98.781  1.00 26.67 ? 122  TYR A CZ  1 
ATOM   625  O OH  . TYR A 1 121 ? 21.617  57.017 97.712  1.00 24.56 ? 122  TYR A OH  1 
ATOM   626  N N   . ASP A 1 122 ? 22.192  50.729 100.901 1.00 25.01 ? 123  ASP A N   1 
ATOM   627  C CA  . ASP A 1 122 ? 22.959  50.072 99.852  1.00 24.63 ? 123  ASP A CA  1 
ATOM   628  C C   . ASP A 1 122 ? 22.330  48.764 99.409  1.00 23.71 ? 123  ASP A C   1 
ATOM   629  O O   . ASP A 1 122 ? 22.291  48.470 98.217  1.00 25.22 ? 123  ASP A O   1 
ATOM   630  C CB  . ASP A 1 122 ? 24.405  49.843 100.308 1.00 23.69 ? 123  ASP A CB  1 
ATOM   631  C CG  . ASP A 1 122 ? 25.129  51.149 100.603 1.00 28.60 ? 123  ASP A CG  1 
ATOM   632  O OD1 . ASP A 1 122 ? 25.326  51.466 101.790 1.00 28.55 ? 123  ASP A OD1 1 
ATOM   633  O OD2 . ASP A 1 122 ? 25.464  51.876 99.648  1.00 33.96 ? 123  ASP A OD2 1 
ATOM   634  N N   . ARG A 1 123 ? 21.844  47.974 100.359 1.00 19.74 ? 124  ARG A N   1 
ATOM   635  C CA  . ARG A 1 123 ? 21.101  46.756 99.996  1.00 25.04 ? 124  ARG A CA  1 
ATOM   636  C C   . ARG A 1 123 ? 19.940  47.090 99.063  1.00 25.99 ? 124  ARG A C   1 
ATOM   637  O O   . ARG A 1 123 ? 19.794  46.474 98.010  1.00 29.19 ? 124  ARG A O   1 
ATOM   638  C CB  . ARG A 1 123 ? 20.584  46.020 101.232 1.00 22.94 ? 124  ARG A CB  1 
ATOM   639  C CG  . ARG A 1 123 ? 21.671  45.687 102.244 1.00 25.74 ? 124  ARG A CG  1 
ATOM   640  C CD  . ARG A 1 123 ? 21.271  44.512 103.125 1.00 23.89 ? 124  ARG A CD  1 
ATOM   641  N NE  . ARG A 1 123 ? 20.014  44.738 103.826 1.00 26.17 ? 124  ARG A NE  1 
ATOM   642  C CZ  . ARG A 1 123 ? 19.917  45.256 105.048 1.00 27.45 ? 124  ARG A CZ  1 
ATOM   643  N NH1 . ARG A 1 123 ? 21.006  45.632 105.708 1.00 25.07 ? 124  ARG A NH1 1 
ATOM   644  N NH2 . ARG A 1 123 ? 18.722  45.402 105.609 1.00 25.04 ? 124  ARG A NH2 1 
ATOM   645  N N   . SER A 1 124 ? 19.126  48.071 99.452  1.00 26.43 ? 125  SER A N   1 
ATOM   646  C CA  . SER A 1 124 ? 18.038  48.565 98.601  1.00 24.20 ? 125  SER A CA  1 
ATOM   647  C C   . SER A 1 124 ? 18.519  48.965 97.219  1.00 25.40 ? 125  SER A C   1 
ATOM   648  O O   . SER A 1 124 ? 17.916  48.581 96.223  1.00 22.47 ? 125  SER A O   1 
ATOM   649  C CB  . SER A 1 124 ? 17.377  49.785 99.230  1.00 27.10 ? 125  SER A CB  1 
ATOM   650  O OG  . SER A 1 124 ? 16.789  49.446 100.459 1.00 28.46 ? 125  SER A OG  1 
ATOM   651  N N   . ALA A 1 125 ? 19.595  49.757 97.177  1.00 24.58 ? 126  ALA A N   1 
ATOM   652  C CA  . ALA A 1 125 ? 20.116  50.307 95.923  1.00 23.90 ? 126  ALA A CA  1 
ATOM   653  C C   . ALA A 1 125 ? 20.343  49.223 94.853  1.00 20.21 ? 126  ALA A C   1 
ATOM   654  O O   . ALA A 1 125 ? 20.052  49.417 93.674  1.00 23.65 ? 126  ALA A O   1 
ATOM   655  C CB  . ALA A 1 125 ? 21.426  51.098 96.179  1.00 19.29 ? 126  ALA A CB  1 
ATOM   656  N N   . ILE A 1 126 ? 20.863  48.089 95.289  1.00 19.84 ? 127  ILE A N   1 
ATOM   657  C CA  . ILE A 1 126 ? 21.130  46.961 94.415  1.00 19.27 ? 127  ILE A CA  1 
ATOM   658  C C   . ILE A 1 126 ? 19.844  46.476 93.751  1.00 21.40 ? 127  ILE A C   1 
ATOM   659  O O   . ILE A 1 126 ? 19.814  46.235 92.546  1.00 24.56 ? 127  ILE A O   1 
ATOM   660  C CB  . ILE A 1 126 ? 21.743  45.814 95.219  1.00 17.58 ? 127  ILE A CB  1 
ATOM   661  C CG1 . ILE A 1 126 ? 23.188  46.161 95.576  1.00 19.64 ? 127  ILE A CG1 1 
ATOM   662  C CG2 . ILE A 1 126 ? 21.619  44.469 94.439  1.00 21.26 ? 127  ILE A CG2 1 
ATOM   663  C CD1 . ILE A 1 126 ? 23.731  45.339 96.725  1.00 19.62 ? 127  ILE A CD1 1 
ATOM   664  N N   . PHE A 1 127 ? 18.779  46.361 94.541  1.00 24.51 ? 128  PHE A N   1 
ATOM   665  C CA  . PHE A 1 127 ? 17.489  45.917 94.017  1.00 25.91 ? 128  PHE A CA  1 
ATOM   666  C C   . PHE A 1 127 ? 16.774  46.950 93.165  1.00 25.73 ? 128  PHE A C   1 
ATOM   667  O O   . PHE A 1 127 ? 16.116  46.598 92.194  1.00 26.20 ? 128  PHE A O   1 
ATOM   668  C CB  . PHE A 1 127 ? 16.605  45.371 95.138  1.00 22.65 ? 128  PHE A CB  1 
ATOM   669  C CG  . PHE A 1 127 ? 17.135  44.098 95.712  1.00 24.58 ? 128  PHE A CG  1 
ATOM   670  C CD1 . PHE A 1 127 ? 16.829  42.887 95.129  1.00 22.14 ? 128  PHE A CD1 1 
ATOM   671  C CD2 . PHE A 1 127 ? 17.996  44.116 96.791  1.00 26.37 ? 128  PHE A CD2 1 
ATOM   672  C CE1 . PHE A 1 127 ? 17.351  41.711 95.629  1.00 25.53 ? 128  PHE A CE1 1 
ATOM   673  C CE2 . PHE A 1 127 ? 18.511  42.941 97.300  1.00 22.19 ? 128  PHE A CE2 1 
ATOM   674  C CZ  . PHE A 1 127 ? 18.194  41.738 96.705  1.00 28.53 ? 128  PHE A CZ  1 
ATOM   675  N N   . LEU A 1 128 ? 16.915  48.224 93.515  1.00 24.58 ? 129  LEU A N   1 
ATOM   676  C CA  . LEU A 1 128 ? 16.367  49.287 92.690  1.00 17.52 ? 129  LEU A CA  1 
ATOM   677  C C   . LEU A 1 128 ? 17.109  49.334 91.347  1.00 26.50 ? 129  LEU A C   1 
ATOM   678  O O   . LEU A 1 128 ? 16.487  49.421 90.284  1.00 26.53 ? 129  LEU A O   1 
ATOM   679  C CB  . LEU A 1 128 ? 16.449  50.654 93.409  1.00 21.05 ? 129  LEU A CB  1 
ATOM   680  C CG  . LEU A 1 128 ? 15.592  50.767 94.694  1.00 26.00 ? 129  LEU A CG  1 
ATOM   681  C CD1 . LEU A 1 128 ? 15.769  52.111 95.407  1.00 21.24 ? 129  LEU A CD1 1 
ATOM   682  C CD2 . LEU A 1 128 ? 14.124  50.526 94.396  1.00 24.37 ? 129  LEU A CD2 1 
ATOM   683  N N   . LYS A 1 129 ? 18.438  49.276 91.403  1.00 24.68 ? 130  LYS A N   1 
ATOM   684  C CA  . LYS A 1 129 ? 19.242  49.239 90.190  1.00 25.31 ? 130  LYS A CA  1 
ATOM   685  C C   . LYS A 1 129 ? 18.836  48.064 89.284  1.00 21.94 ? 130  LYS A C   1 
ATOM   686  O O   . LYS A 1 129 ? 18.657  48.236 88.078  1.00 23.90 ? 130  LYS A O   1 
ATOM   687  C CB  . LYS A 1 129 ? 20.731  49.152 90.524  1.00 25.51 ? 130  LYS A CB  1 
ATOM   688  C CG  . LYS A 1 129 ? 21.630  49.375 89.294  1.00 33.84 ? 130  LYS A CG  1 
ATOM   689  C CD  . LYS A 1 129 ? 22.840  50.249 89.615  1.00 44.81 ? 130  LYS A CD  1 
ATOM   690  C CE  . LYS A 1 129 ? 23.657  50.558 88.356  1.00 50.02 ? 130  LYS A CE  1 
ATOM   691  N NZ  . LYS A 1 129 ? 22.787  50.702 87.132  1.00 44.53 ? 130  LYS A NZ  1 
ATOM   692  N N   . ALA A 1 130 ? 18.695  46.874 89.867  1.00 19.28 ? 131  ALA A N   1 
ATOM   693  C CA  . ALA A 1 130 ? 18.323  45.693 89.075  1.00 22.66 ? 131  ALA A CA  1 
ATOM   694  C C   . ALA A 1 130 ? 16.967  45.897 88.397  1.00 22.65 ? 131  ALA A C   1 
ATOM   695  O O   . ALA A 1 130 ? 16.786  45.587 87.215  1.00 23.86 ? 131  ALA A O   1 
ATOM   696  C CB  . ALA A 1 130 ? 18.337  44.425 89.939  1.00 16.95 ? 131  ALA A CB  1 
ATOM   697  N N   . ALA A 1 131 ? 16.020  46.457 89.129  1.00 23.84 ? 132  ALA A N   1 
ATOM   698  C CA  . ALA A 1 131 ? 14.725  46.775 88.528  1.00 29.99 ? 132  ALA A CA  1 
ATOM   699  C C   . ALA A 1 131 ? 14.873  47.766 87.374  1.00 29.13 ? 132  ALA A C   1 
ATOM   700  O O   . ALA A 1 131 ? 14.266  47.602 86.314  1.00 27.89 ? 132  ALA A O   1 
ATOM   701  C CB  . ALA A 1 131 ? 13.752  47.307 89.572  1.00 26.24 ? 132  ALA A CB  1 
ATOM   702  N N   . ASP A 1 132 ? 15.695  48.786 87.560  1.00 25.23 ? 133  ASP A N   1 
ATOM   703  C CA  . ASP A 1 132 ? 15.851  49.752 86.493  1.00 27.30 ? 133  ASP A CA  1 
ATOM   704  C C   . ASP A 1 132 ? 16.606  49.180 85.285  1.00 29.05 ? 133  ASP A C   1 
ATOM   705  O O   . ASP A 1 132 ? 16.274  49.487 84.138  1.00 31.22 ? 133  ASP A O   1 
ATOM   706  C CB  . ASP A 1 132 ? 16.488  51.049 86.998  1.00 38.74 ? 133  ASP A CB  1 
ATOM   707  C CG  . ASP A 1 132 ? 16.276  52.213 86.031  1.00 54.20 ? 133  ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 132 ? 15.154  52.788 85.990  1.00 59.07 ? 133  ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 132 ? 17.234  52.545 85.298  1.00 56.95 ? 133  ASP A OD2 1 
ATOM   710  N N   . LEU A 1 133 ? 17.615  48.354 85.540  1.00 19.57 ? 134  LEU A N   1 
ATOM   711  C CA  . LEU A 1 133 ? 18.365  47.721 84.461  1.00 22.99 ? 134  LEU A CA  1 
ATOM   712  C C   . LEU A 1 133 ? 17.430  46.823 83.651  1.00 24.30 ? 134  LEU A C   1 
ATOM   713  O O   . LEU A 1 133 ? 17.491  46.793 82.422  1.00 25.87 ? 134  LEU A O   1 
ATOM   714  C CB  . LEU A 1 133 ? 19.539  46.893 85.022  1.00 22.76 ? 134  LEU A CB  1 
ATOM   715  C CG  . LEU A 1 133 ? 20.766  47.660 85.522  1.00 25.26 ? 134  LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 133 ? 21.753  46.766 86.264  1.00 24.57 ? 134  LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 133 ? 21.468  48.328 84.342  1.00 31.26 ? 134  LEU A CD2 1 
ATOM   718  N N   . ILE A 1 134 ? 16.568  46.087 84.350  1.00 23.34 ? 135  ILE A N   1 
ATOM   719  C CA  . ILE A 1 134 ? 15.605  45.216 83.686  1.00 20.57 ? 135  ILE A CA  1 
ATOM   720  C C   . ILE A 1 134 ? 14.579  46.037 82.903  1.00 30.88 ? 135  ILE A C   1 
ATOM   721  O O   . ILE A 1 134 ? 14.189  45.643 81.801  1.00 32.31 ? 135  ILE A O   1 
ATOM   722  C CB  . ILE A 1 134 ? 14.917  44.233 84.670  1.00 26.64 ? 135  ILE A CB  1 
ATOM   723  C CG1 . ILE A 1 134 ? 15.904  43.124 85.071  1.00 24.27 ? 135  ILE A CG1 1 
ATOM   724  C CG2 . ILE A 1 134 ? 13.632  43.614 84.034  1.00 19.91 ? 135  ILE A CG2 1 
ATOM   725  C CD1 . ILE A 1 134 ? 15.529  42.363 86.352  1.00 20.28 ? 135  ILE A CD1 1 
ATOM   726  N N   . SER A 1 135 ? 14.176  47.192 83.443  1.00 23.74 ? 136  SER A N   1 
ATOM   727  C CA  . SER A 1 135 ? 13.164  48.026 82.776  1.00 25.52 ? 136  SER A CA  1 
ATOM   728  C C   . SER A 1 135 ? 13.684  48.711 81.525  1.00 30.34 ? 136  SER A C   1 
ATOM   729  O O   . SER A 1 135 ? 12.902  49.103 80.650  1.00 33.26 ? 136  SER A O   1 
ATOM   730  C CB  . SER A 1 135 ? 12.618  49.079 83.728  1.00 28.73 ? 136  SER A CB  1 
ATOM   731  O OG  . SER A 1 135 ? 12.022  48.464 84.851  1.00 32.95 ? 136  SER A OG  1 
ATOM   732  N N   . THR A 1 136 ? 15.004  48.854 81.437  1.00 24.86 ? 137  THR A N   1 
ATOM   733  C CA  . THR A 1 136 ? 15.601  49.634 80.365  1.00 26.48 ? 137  THR A CA  1 
ATOM   734  C C   . THR A 1 136 ? 16.649  48.852 79.578  1.00 26.56 ? 137  THR A C   1 
ATOM   735  O O   . THR A 1 136 ? 16.351  48.281 78.539  1.00 28.90 ? 137  THR A O   1 
ATOM   736  C CB  . THR A 1 136 ? 16.218  50.942 80.915  1.00 27.76 ? 137  THR A CB  1 
ATOM   737  O OG1 . THR A 1 136 ? 17.206  50.626 81.914  1.00 29.36 ? 137  THR A OG1 1 
ATOM   738  C CG2 . THR A 1 136 ? 15.131  51.792 81.540  1.00 24.70 ? 137  THR A CG2 1 
ATOM   739  N N   . LYS A 1 137 ? 17.871  48.835 80.095  1.00 30.14 ? 138  LYS A N   1 
ATOM   740  C CA  . LYS A 1 137 ? 19.011  48.206 79.435  1.00 30.98 ? 138  LYS A CA  1 
ATOM   741  C C   . LYS A 1 137 ? 18.756  46.769 78.971  1.00 32.80 ? 138  LYS A C   1 
ATOM   742  O O   . LYS A 1 137 ? 19.144  46.387 77.869  1.00 33.51 ? 138  LYS A O   1 
ATOM   743  C CB  . LYS A 1 137 ? 20.209  48.223 80.382  1.00 31.31 ? 138  LYS A CB  1 
ATOM   744  C CG  . LYS A 1 137 ? 21.500  47.701 79.787  1.00 35.21 ? 138  LYS A CG  1 
ATOM   745  C CD  . LYS A 1 137 ? 22.651  48.072 80.709  1.00 37.70 ? 138  LYS A CD  1 
ATOM   746  C CE  . LYS A 1 137 ? 23.968  47.449 80.277  1.00 40.62 ? 138  LYS A CE  1 
ATOM   747  N NZ  . LYS A 1 137 ? 25.093  47.981 81.101  1.00 42.20 ? 138  LYS A NZ  1 
ATOM   748  N N   . TYR A 1 138 ? 18.115  45.971 79.814  1.00 27.87 ? 139  TYR A N   1 
ATOM   749  C CA  . TYR A 1 138 ? 17.946  44.561 79.516  1.00 27.41 ? 139  TYR A CA  1 
ATOM   750  C C   . TYR A 1 138 ? 16.491  44.245 79.258  1.00 26.40 ? 139  TYR A C   1 
ATOM   751  O O   . TYR A 1 138 ? 16.080  43.094 79.333  1.00 29.51 ? 139  TYR A O   1 
ATOM   752  C CB  . TYR A 1 138 ? 18.482  43.699 80.662  1.00 27.22 ? 139  TYR A CB  1 
ATOM   753  C CG  . TYR A 1 138 ? 19.965  43.836 80.837  1.00 35.10 ? 139  TYR A CG  1 
ATOM   754  C CD1 . TYR A 1 138 ? 20.828  43.582 79.781  1.00 46.97 ? 139  TYR A CD1 1 
ATOM   755  C CD2 . TYR A 1 138 ? 20.512  44.233 82.053  1.00 34.54 ? 139  TYR A CD2 1 
ATOM   756  C CE1 . TYR A 1 138 ? 22.201  43.725 79.930  1.00 47.80 ? 139  TYR A CE1 1 
ATOM   757  C CE2 . TYR A 1 138 ? 21.875  44.370 82.215  1.00 36.01 ? 139  TYR A CE2 1 
ATOM   758  C CZ  . TYR A 1 138 ? 22.714  44.122 81.152  1.00 44.29 ? 139  TYR A CZ  1 
ATOM   759  O OH  . TYR A 1 138 ? 24.070  44.260 81.311  1.00 50.10 ? 139  TYR A OH  1 
ATOM   760  N N   . ARG A 1 139 ? 15.712  45.275 78.942  1.00 32.04 ? 140  ARG A N   1 
ATOM   761  C CA  . ARG A 1 139 ? 14.278  45.099 78.748  1.00 33.50 ? 140  ARG A CA  1 
ATOM   762  C C   . ARG A 1 139 ? 14.000  44.065 77.656  1.00 31.77 ? 140  ARG A C   1 
ATOM   763  O O   . ARG A 1 139 ? 13.214  43.147 77.843  1.00 24.20 ? 140  ARG A O   1 
ATOM   764  C CB  . ARG A 1 139 ? 13.615  46.427 78.384  1.00 36.44 ? 140  ARG A CB  1 
ATOM   765  C CG  . ARG A 1 139 ? 12.092  46.370 78.394  1.00 36.05 ? 140  ARG A CG  1 
ATOM   766  C CD  . ARG A 1 139 ? 11.476  47.581 77.700  1.00 38.12 ? 140  ARG A CD  1 
ATOM   767  N NE  . ARG A 1 139 ? 10.053  47.645 77.981  1.00 42.22 ? 140  ARG A NE  1 
ATOM   768  C CZ  . ARG A 1 139 ? 9.531   48.302 79.016  1.00 47.83 ? 140  ARG A CZ  1 
ATOM   769  N NH1 . ARG A 1 139 ? 8.216   48.296 79.218  1.00 52.07 ? 140  ARG A NH1 1 
ATOM   770  N NH2 . ARG A 1 139 ? 10.321  48.971 79.851  1.00 41.88 ? 140  ARG A NH2 1 
ATOM   771  N N   . TYR A 1 140 ? 14.664  44.204 76.516  1.00 30.52 ? 141  TYR A N   1 
ATOM   772  C CA  . TYR A 1 140 ? 14.326  43.338 75.396  1.00 33.60 ? 141  TYR A CA  1 
ATOM   773  C C   . TYR A 1 140 ? 14.817  41.908 75.603  1.00 28.99 ? 141  TYR A C   1 
ATOM   774  O O   . TYR A 1 140 ? 14.122  40.967 75.247  1.00 29.74 ? 141  TYR A O   1 
ATOM   775  C CB  . TYR A 1 140 ? 14.777  43.964 74.071  1.00 33.03 ? 141  TYR A CB  1 
ATOM   776  C CG  . TYR A 1 140 ? 14.067  45.276 73.866  1.00 40.03 ? 141  TYR A CG  1 
ATOM   777  C CD1 . TYR A 1 140 ? 12.715  45.306 73.532  1.00 44.90 ? 141  TYR A CD1 1 
ATOM   778  C CD2 . TYR A 1 140 ? 14.725  46.485 74.071  1.00 48.19 ? 141  TYR A CD2 1 
ATOM   779  C CE1 . TYR A 1 140 ? 12.045  46.506 73.374  1.00 52.28 ? 141  TYR A CE1 1 
ATOM   780  C CE2 . TYR A 1 140 ? 14.066  47.691 73.914  1.00 53.01 ? 141  TYR A CE2 1 
ATOM   781  C CZ  . TYR A 1 140 ? 12.726  47.697 73.564  1.00 58.03 ? 141  TYR A CZ  1 
ATOM   782  O OH  . TYR A 1 140 ? 12.064  48.893 73.403  1.00 64.77 ? 141  TYR A OH  1 
ATOM   783  N N   . ASP A 1 141 ? 15.986  41.752 76.220  1.00 29.39 ? 142  ASP A N   1 
ATOM   784  C CA  . ASP A 1 141 ? 16.493  40.422 76.512  1.00 28.26 ? 142  ASP A CA  1 
ATOM   785  C C   . ASP A 1 141 ? 15.601  39.711 77.522  1.00 28.16 ? 142  ASP A C   1 
ATOM   786  O O   . ASP A 1 141 ? 15.325  38.523 77.381  1.00 26.49 ? 142  ASP A O   1 
ATOM   787  C CB  . ASP A 1 141 ? 17.908  40.478 77.059  1.00 28.35 ? 142  ASP A CB  1 
ATOM   788  C CG  . ASP A 1 141 ? 18.921  40.873 76.013  1.00 35.72 ? 142  ASP A CG  1 
ATOM   789  O OD1 . ASP A 1 141 ? 18.720  40.578 74.819  1.00 40.77 ? 142  ASP A OD1 1 
ATOM   790  O OD2 . ASP A 1 141 ? 19.931  41.477 76.397  1.00 42.14 ? 142  ASP A OD2 1 
ATOM   791  N N   . MET A 1 142 ? 15.176  40.425 78.554  1.00 21.34 ? 143  MET A N   1 
ATOM   792  C CA  . MET A 1 142 ? 14.337  39.814 79.559  1.00 21.19 ? 143  MET A CA  1 
ATOM   793  C C   . MET A 1 142 ? 12.974  39.432 78.980  1.00 23.70 ? 143  MET A C   1 
ATOM   794  O O   . MET A 1 142 ? 12.475  38.344 79.244  1.00 24.10 ? 143  MET A O   1 
ATOM   795  C CB  . MET A 1 142 ? 14.160  40.722 80.774  1.00 22.90 ? 143  MET A CB  1 
ATOM   796  C CG  . MET A 1 142 ? 13.247  40.129 81.804  1.00 18.96 ? 143  MET A CG  1 
ATOM   797  S SD  . MET A 1 142 ? 13.876  38.576 82.504  1.00 29.54 ? 143  MET A SD  1 
ATOM   798  C CE  . MET A 1 142 ? 14.898  39.177 83.859  1.00 23.58 ? 143  MET A CE  1 
ATOM   799  N N   . LEU A 1 143 ? 12.383  40.317 78.185  1.00 24.89 ? 144  LEU A N   1 
ATOM   800  C CA  . LEU A 1 143 ? 11.116  39.997 77.523  1.00 27.42 ? 144  LEU A CA  1 
ATOM   801  C C   . LEU A 1 143 ? 11.270  38.728 76.700  1.00 23.04 ? 144  LEU A C   1 
ATOM   802  O O   . LEU A 1 143 ? 10.439  37.831 76.792  1.00 27.09 ? 144  LEU A O   1 
ATOM   803  C CB  . LEU A 1 143 ? 10.652  41.136 76.617  1.00 30.32 ? 144  LEU A CB  1 
ATOM   804  C CG  . LEU A 1 143 ? 10.141  42.406 77.302  1.00 31.14 ? 144  LEU A CG  1 
ATOM   805  C CD1 . LEU A 1 143 ? 10.020  43.539 76.279  1.00 29.23 ? 144  LEU A CD1 1 
ATOM   806  C CD2 . LEU A 1 143 ? 8.798   42.146 77.979  1.00 23.62 ? 144  LEU A CD2 1 
ATOM   807  N N   . ALA A 1 144 ? 12.349  38.656 75.919  1.00 23.28 ? 145  ALA A N   1 
ATOM   808  C CA  . ALA A 1 144 ? 12.576  37.518 75.032  1.00 28.77 ? 145  ALA A CA  1 
ATOM   809  C C   . ALA A 1 144 ? 12.786  36.228 75.813  1.00 22.73 ? 145  ALA A C   1 
ATOM   810  O O   . ALA A 1 144 ? 12.202  35.207 75.476  1.00 28.54 ? 145  ALA A O   1 
ATOM   811  C CB  . ALA A 1 144 ? 13.745  37.772 74.087  1.00 24.72 ? 145  ALA A CB  1 
ATOM   812  N N   . ALA A 1 145 ? 13.603  36.281 76.858  1.00 22.10 ? 146  ALA A N   1 
ATOM   813  C CA  . ALA A 1 145 ? 13.839  35.103 77.683  1.00 24.46 ? 146  ALA A CA  1 
ATOM   814  C C   . ALA A 1 145 ? 12.543  34.588 78.305  1.00 22.69 ? 146  ALA A C   1 
ATOM   815  O O   . ALA A 1 145 ? 12.328  33.385 78.414  1.00 25.01 ? 146  ALA A O   1 
ATOM   816  C CB  . ALA A 1 145 ? 14.876  35.394 78.775  1.00 21.09 ? 146  ALA A CB  1 
ATOM   817  N N   . THR A 1 146 ? 11.679  35.506 78.716  1.00 26.63 ? 147  THR A N   1 
ATOM   818  C CA  . THR A 1 146 ? 10.445  35.116 79.393  1.00 22.37 ? 147  THR A CA  1 
ATOM   819  C C   . THR A 1 146 ? 9.430   34.603 78.363  1.00 26.96 ? 147  THR A C   1 
ATOM   820  O O   . THR A 1 146 ? 8.740   33.610 78.596  1.00 23.46 ? 147  THR A O   1 
ATOM   821  C CB  . THR A 1 146 ? 9.873   36.293 80.214  1.00 21.90 ? 147  THR A CB  1 
ATOM   822  O OG1 . THR A 1 146 ? 10.742  36.573 81.331  1.00 24.73 ? 147  THR A OG1 1 
ATOM   823  C CG2 . THR A 1 146 ? 8.478   35.970 80.735  1.00 21.19 ? 147  THR A CG2 1 
ATOM   824  N N   . MET A 1 147 ? 9.368   35.276 77.214  1.00 26.85 ? 148  MET A N   1 
ATOM   825  C CA  . MET A 1 147 ? 8.437   34.896 76.166  1.00 28.23 ? 148  MET A CA  1 
ATOM   826  C C   . MET A 1 147 ? 8.783   33.519 75.659  1.00 32.18 ? 148  MET A C   1 
ATOM   827  O O   . MET A 1 147 ? 7.926   32.641 75.599  1.00 24.72 ? 148  MET A O   1 
ATOM   828  C CB  . MET A 1 147 ? 8.495   35.878 74.992  1.00 24.53 ? 148  MET A CB  1 
ATOM   829  C CG  . MET A 1 147 ? 7.848   37.220 75.275  1.00 28.40 ? 148  MET A CG  1 
ATOM   830  S SD  . MET A 1 147 ? 8.185   38.445 73.996  1.00 29.46 ? 148  MET A SD  1 
ATOM   831  C CE  . MET A 1 147 ? 7.402   37.688 72.573  1.00 24.25 ? 148  MET A CE  1 
ATOM   832  N N   . LEU A 1 148 ? 10.047  33.343 75.281  1.00 22.52 ? 149  LEU A N   1 
ATOM   833  C CA  . LEU A 1 148 ? 10.481  32.094 74.685  1.00 25.07 ? 149  LEU A CA  1 
ATOM   834  C C   . LEU A 1 148 ? 10.504  30.965 75.718  1.00 27.85 ? 149  LEU A C   1 
ATOM   835  O O   . LEU A 1 148 ? 10.129  29.848 75.423  1.00 28.10 ? 149  LEU A O   1 
ATOM   836  C CB  . LEU A 1 148 ? 11.864  32.259 74.057  1.00 24.55 ? 149  LEU A CB  1 
ATOM   837  C CG  . LEU A 1 148 ? 11.977  33.142 72.812  1.00 25.71 ? 149  LEU A CG  1 
ATOM   838  C CD1 . LEU A 1 148 ? 13.451  33.378 72.489  1.00 29.83 ? 149  LEU A CD1 1 
ATOM   839  C CD2 . LEU A 1 148 ? 11.260  32.501 71.601  1.00 26.84 ? 149  LEU A CD2 1 
ATOM   840  N N   . GLY A 1 149 ? 10.970  31.257 76.925  1.00 26.08 ? 150  GLY A N   1 
ATOM   841  C CA  . GLY A 1 149 ? 11.214  30.207 77.890  1.00 22.20 ? 150  GLY A CA  1 
ATOM   842  C C   . GLY A 1 149 ? 9.950   29.764 78.604  1.00 24.55 ? 150  GLY A C   1 
ATOM   843  O O   . GLY A 1 149 ? 9.797   28.592 78.947  1.00 21.30 ? 150  GLY A O   1 
ATOM   844  N N   . GLN A 1 150 ? 9.033   30.696 78.828  1.00 25.03 ? 151  GLN A N   1 
ATOM   845  C CA  . GLN A 1 150 ? 7.853   30.366 79.604  1.00 23.23 ? 151  GLN A CA  1 
ATOM   846  C C   . GLN A 1 150 ? 6.564   30.390 78.775  1.00 26.14 ? 151  GLN A C   1 
ATOM   847  O O   . GLN A 1 150 ? 5.478   30.200 79.318  1.00 24.38 ? 151  GLN A O   1 
ATOM   848  C CB  . GLN A 1 150 ? 7.766   31.246 80.866  1.00 18.81 ? 151  GLN A CB  1 
ATOM   849  C CG  . GLN A 1 150 ? 8.894   30.976 81.872  1.00 17.62 ? 151  GLN A CG  1 
ATOM   850  C CD  . GLN A 1 150 ? 9.436   32.252 82.496  1.00 30.20 ? 151  GLN A CD  1 
ATOM   851  O OE1 . GLN A 1 150 ? 10.461  32.787 82.061  1.00 24.70 ? 151  GLN A OE1 1 
ATOM   852  N NE2 . GLN A 1 150 ? 8.745   32.754 83.525  1.00 22.05 ? 151  GLN A NE2 1 
ATOM   853  N N   . GLY A 1 151 ? 6.701   30.576 77.456  1.00 22.00 ? 152  GLY A N   1 
ATOM   854  C CA  . GLY A 1 151 ? 5.563   30.556 76.547  1.00 20.59 ? 152  GLY A CA  1 
ATOM   855  C C   . GLY A 1 151 ? 4.583   31.714 76.678  1.00 30.26 ? 152  GLY A C   1 
ATOM   856  O O   . GLY A 1 151 ? 3.365   31.530 76.575  1.00 26.03 ? 152  GLY A O   1 
ATOM   857  N N   . LYS A 1 152 ? 5.109   32.911 76.912  1.00 27.86 ? 153  LYS A N   1 
ATOM   858  C CA  . LYS A 1 152 ? 4.280   34.097 77.050  1.00 27.83 ? 153  LYS A CA  1 
ATOM   859  C C   . LYS A 1 152 ? 4.353   34.920 75.779  1.00 28.31 ? 153  LYS A C   1 
ATOM   860  O O   . LYS A 1 152 ? 5.373   34.912 75.102  1.00 28.99 ? 153  LYS A O   1 
ATOM   861  C CB  . LYS A 1 152 ? 4.773   34.948 78.222  1.00 26.84 ? 153  LYS A CB  1 
ATOM   862  C CG  . LYS A 1 152 ? 4.559   34.284 79.553  1.00 24.81 ? 153  LYS A CG  1 
ATOM   863  C CD  . LYS A 1 152 ? 4.738   35.223 80.742  1.00 23.19 ? 153  LYS A CD  1 
ATOM   864  C CE  . LYS A 1 152 ? 4.329   34.491 82.029  1.00 23.93 ? 153  LYS A CE  1 
ATOM   865  N NZ  . LYS A 1 152 ? 4.164   35.374 83.227  1.00 21.13 ? 153  LYS A NZ  1 
ATOM   866  N N   . ASN A 1 153 ? 3.269   35.617 75.454  1.00 25.63 ? 154  ASN A N   1 
ATOM   867  C CA  . ASN A 1 153 ? 3.317   36.658 74.429  1.00 30.83 ? 154  ASN A CA  1 
ATOM   868  C C   . ASN A 1 153 ? 3.936   37.942 75.036  1.00 28.21 ? 154  ASN A C   1 
ATOM   869  O O   . ASN A 1 153 ? 4.141   38.027 76.252  1.00 26.48 ? 154  ASN A O   1 
ATOM   870  C CB  . ASN A 1 153 ? 1.925   36.911 73.814  1.00 28.48 ? 154  ASN A CB  1 
ATOM   871  C CG  . ASN A 1 153 ? 0.928   37.498 74.823  1.00 32.88 ? 154  ASN A CG  1 
ATOM   872  O OD1 . ASN A 1 153 ? 1.227   38.468 75.521  1.00 33.36 ? 154  ASN A OD1 1 
ATOM   873  N ND2 . ASN A 1 153 ? -0.255  36.902 74.904  1.00 26.37 ? 154  ASN A ND2 1 
ATOM   874  N N   . VAL A 1 154 ? 4.231   38.927 74.198  1.00 28.21 ? 155  VAL A N   1 
ATOM   875  C CA  . VAL A 1 154 ? 4.973   40.109 74.648  1.00 26.77 ? 155  VAL A CA  1 
ATOM   876  C C   . VAL A 1 154 ? 4.249   40.867 75.775  1.00 28.00 ? 155  VAL A C   1 
ATOM   877  O O   . VAL A 1 154 ? 4.871   41.307 76.746  1.00 27.88 ? 155  VAL A O   1 
ATOM   878  C CB  . VAL A 1 154 ? 5.318   41.047 73.463  1.00 30.86 ? 155  VAL A CB  1 
ATOM   879  C CG1 . VAL A 1 154 ? 4.059   41.555 72.791  1.00 31.05 ? 155  VAL A CG1 1 
ATOM   880  C CG2 . VAL A 1 154 ? 6.202   42.194 73.930  1.00 32.71 ? 155  VAL A CG2 1 
ATOM   881  N N   . TYR A 1 155 ? 2.930   40.975 75.661  1.00 29.08 ? 156  TYR A N   1 
ATOM   882  C CA  . TYR A 1 155 ? 2.123   41.640 76.675  1.00 30.47 ? 156  TYR A CA  1 
ATOM   883  C C   . TYR A 1 155 ? 2.178   40.936 78.028  1.00 28.40 ? 156  TYR A C   1 
ATOM   884  O O   . TYR A 1 155 ? 2.300   41.590 79.062  1.00 25.16 ? 156  TYR A O   1 
ATOM   885  C CB  . TYR A 1 155 ? 0.679   41.784 76.192  1.00 33.66 ? 156  TYR A CB  1 
ATOM   886  C CG  . TYR A 1 155 ? 0.615   42.440 74.839  1.00 44.54 ? 156  TYR A CG  1 
ATOM   887  C CD1 . TYR A 1 155 ? 1.101   43.730 74.659  1.00 47.15 ? 156  TYR A CD1 1 
ATOM   888  C CD2 . TYR A 1 155 ? 0.096   41.770 73.735  1.00 47.76 ? 156  TYR A CD2 1 
ATOM   889  C CE1 . TYR A 1 155 ? 1.066   44.344 73.428  1.00 52.78 ? 156  TYR A CE1 1 
ATOM   890  C CE2 . TYR A 1 155 ? 0.055   42.379 72.485  1.00 52.37 ? 156  TYR A CE2 1 
ATOM   891  C CZ  . TYR A 1 155 ? 0.544   43.668 72.342  1.00 58.25 ? 156  TYR A CZ  1 
ATOM   892  O OH  . TYR A 1 155 ? 0.520   44.297 71.113  1.00 65.60 ? 156  TYR A OH  1 
ATOM   893  N N   . GLN A 1 156 ? 2.095   39.608 78.021  1.00 25.63 ? 157  GLN A N   1 
ATOM   894  C CA  . GLN A 1 156 ? 2.139   38.834 79.264  1.00 22.30 ? 157  GLN A CA  1 
ATOM   895  C C   . GLN A 1 156 ? 3.539   38.950 79.844  1.00 22.43 ? 157  GLN A C   1 
ATOM   896  O O   . GLN A 1 156 ? 3.719   39.061 81.052  1.00 24.20 ? 157  GLN A O   1 
ATOM   897  C CB  . GLN A 1 156 ? 1.804   37.351 79.011  1.00 27.06 ? 157  GLN A CB  1 
ATOM   898  C CG  . GLN A 1 156 ? 0.354   37.091 78.583  1.00 30.83 ? 157  GLN A CG  1 
ATOM   899  C CD  . GLN A 1 156 ? 0.148   35.754 77.846  1.00 31.61 ? 157  GLN A CD  1 
ATOM   900  O OE1 . GLN A 1 156 ? 1.093   35.146 77.321  1.00 29.77 ? 157  GLN A OE1 1 
ATOM   901  N NE2 . GLN A 1 156 ? -1.098  35.311 77.790  1.00 27.05 ? 157  GLN A NE2 1 
ATOM   902  N N   . ALA A 1 157 ? 4.536   38.939 78.969  1.00 19.24 ? 158  ALA A N   1 
ATOM   903  C CA  . ALA A 1 157 ? 5.902   38.991 79.447  1.00 23.25 ? 158  ALA A CA  1 
ATOM   904  C C   . ALA A 1 157 ? 6.149   40.371 80.071  1.00 27.71 ? 158  ALA A C   1 
ATOM   905  O O   . ALA A 1 157 ? 6.728   40.478 81.144  1.00 28.07 ? 158  ALA A O   1 
ATOM   906  C CB  . ALA A 1 157 ? 6.893   38.700 78.313  1.00 19.12 ? 158  ALA A CB  1 
ATOM   907  N N   . GLU A 1 158 ? 5.674   41.423 79.412  1.00 23.97 ? 159  GLU A N   1 
ATOM   908  C CA  . GLU A 1 158 ? 5.942   42.775 79.900  1.00 28.89 ? 159  GLU A CA  1 
ATOM   909  C C   . GLU A 1 158 ? 5.337   42.987 81.282  1.00 30.77 ? 159  GLU A C   1 
ATOM   910  O O   . GLU A 1 158 ? 5.983   43.515 82.173  1.00 25.17 ? 159  GLU A O   1 
ATOM   911  C CB  . GLU A 1 158 ? 5.421   43.818 78.922  1.00 33.01 ? 159  GLU A CB  1 
ATOM   912  C CG  . GLU A 1 158 ? 5.985   45.194 79.160  1.00 50.56 ? 159  GLU A CG  1 
ATOM   913  C CD  . GLU A 1 158 ? 5.870   46.060 77.927  1.00 69.88 ? 159  GLU A CD  1 
ATOM   914  O OE1 . GLU A 1 158 ? 6.812   46.837 77.656  1.00 77.26 ? 159  GLU A OE1 1 
ATOM   915  O OE2 . GLU A 1 158 ? 4.839   45.951 77.220  1.00 73.40 ? 159  GLU A OE2 1 
ATOM   916  N N   . ILE A 1 159 ? 4.100   42.537 81.451  1.00 29.01 ? 160  ILE A N   1 
ATOM   917  C CA  . ILE A 1 159 ? 3.396   42.677 82.713  1.00 29.05 ? 160  ILE A CA  1 
ATOM   918  C C   . ILE A 1 159 ? 4.122   41.942 83.846  1.00 28.42 ? 160  ILE A C   1 
ATOM   919  O O   . ILE A 1 159 ? 4.136   42.390 84.995  1.00 25.21 ? 160  ILE A O   1 
ATOM   920  C CB  . ILE A 1 159 ? 1.941   42.182 82.566  1.00 34.20 ? 160  ILE A CB  1 
ATOM   921  C CG1 . ILE A 1 159 ? 0.978   43.266 83.003  1.00 45.59 ? 160  ILE A CG1 1 
ATOM   922  C CG2 . ILE A 1 159 ? 1.680   40.906 83.324  1.00 35.13 ? 160  ILE A CG2 1 
ATOM   923  C CD1 . ILE A 1 159 ? 0.473   44.078 81.835  1.00 50.80 ? 160  ILE A CD1 1 
ATOM   924  N N   . ASP A 1 160 ? 4.745   40.823 83.503  1.00 24.15 ? 161  ASP A N   1 
ATOM   925  C CA  . ASP A 1 160 ? 5.389   39.972 84.486  1.00 22.86 ? 161  ASP A CA  1 
ATOM   926  C C   . ASP A 1 160 ? 6.819   40.466 84.745  1.00 27.88 ? 161  ASP A C   1 
ATOM   927  O O   . ASP A 1 160 ? 7.141   40.977 85.823  1.00 23.66 ? 161  ASP A O   1 
ATOM   928  C CB  . ASP A 1 160 ? 5.378   38.538 83.945  1.00 25.14 ? 161  ASP A CB  1 
ATOM   929  C CG  . ASP A 1 160 ? 6.308   37.588 84.693  1.00 22.41 ? 161  ASP A CG  1 
ATOM   930  O OD1 . ASP A 1 160 ? 6.806   37.934 85.779  1.00 20.63 ? 161  ASP A OD1 1 
ATOM   931  O OD2 . ASP A 1 160 ? 6.527   36.453 84.182  1.00 24.81 ? 161  ASP A OD2 1 
ATOM   932  N N   . CYS A 1 161 ? 7.672   40.318 83.743  1.00 28.39 ? 162  CYS A N   1 
ATOM   933  C CA  . CYS A 1 161 ? 9.096   40.403 83.981  1.00 28.12 ? 162  CYS A CA  1 
ATOM   934  C C   . CYS A 1 161 ? 9.615   41.831 83.945  1.00 25.12 ? 162  CYS A C   1 
ATOM   935  O O   . CYS A 1 161 ? 10.742  42.080 84.318  1.00 30.90 ? 162  CYS A O   1 
ATOM   936  C CB  . CYS A 1 161 ? 9.863   39.485 83.025  1.00 23.45 ? 162  CYS A CB  1 
ATOM   937  S SG  . CYS A 1 161 ? 9.775   39.996 81.367  1.00 32.33 ? 162  CYS A SG  1 
ATOM   938  N N   . ILE A 1 162 ? 8.784   42.774 83.528  1.00 29.80 ? 163  ILE A N   1 
ATOM   939  C CA  . ILE A 1 162 ? 9.145   44.178 83.645  1.00 31.98 ? 163  ILE A CA  1 
ATOM   940  C C   . ILE A 1 162 ? 8.368   44.860 84.770  1.00 33.79 ? 163  ILE A C   1 
ATOM   941  O O   . ILE A 1 162 ? 8.941   45.242 85.792  1.00 37.77 ? 163  ILE A O   1 
ATOM   942  C CB  . ILE A 1 162 ? 8.927   44.954 82.328  1.00 34.15 ? 163  ILE A CB  1 
ATOM   943  C CG1 . ILE A 1 162 ? 9.537   44.196 81.140  1.00 31.30 ? 163  ILE A CG1 1 
ATOM   944  C CG2 . ILE A 1 162 ? 9.495   46.362 82.448  1.00 34.40 ? 163  ILE A CG2 1 
ATOM   945  C CD1 . ILE A 1 162 ? 11.024  43.906 81.278  1.00 32.35 ? 163  ILE A CD1 1 
ATOM   946  N N   . THR A 1 163 ? 7.061   45.001 84.582  1.00 30.77 ? 164  THR A N   1 
ATOM   947  C CA  . THR A 1 163 ? 6.219   45.772 85.503  1.00 30.21 ? 164  THR A CA  1 
ATOM   948  C C   . THR A 1 163 ? 6.085   45.176 86.913  1.00 24.37 ? 164  THR A C   1 
ATOM   949  O O   . THR A 1 163 ? 6.388   45.840 87.894  1.00 32.29 ? 164  THR A O   1 
ATOM   950  C CB  . THR A 1 163 ? 4.804   46.019 84.920  1.00 27.49 ? 164  THR A CB  1 
ATOM   951  O OG1 . THR A 1 163 ? 4.928   46.609 83.625  1.00 35.11 ? 164  THR A OG1 1 
ATOM   952  C CG2 . THR A 1 163 ? 4.014   46.957 85.824  1.00 26.29 ? 164  THR A CG2 1 
ATOM   953  N N   . GLU A 1 164 ? 5.624   43.943 87.031  1.00 21.55 ? 165  GLU A N   1 
ATOM   954  C CA  . GLU A 1 164 ? 5.471   43.366 88.366  1.00 24.19 ? 165  GLU A CA  1 
ATOM   955  C C   . GLU A 1 164 ? 6.813   43.166 89.052  1.00 23.11 ? 165  GLU A C   1 
ATOM   956  O O   . GLU A 1 164 ? 6.936   43.388 90.254  1.00 20.26 ? 165  GLU A O   1 
ATOM   957  C CB  . GLU A 1 164 ? 4.740   42.031 88.332  1.00 21.78 ? 165  GLU A CB  1 
ATOM   958  C CG  . GLU A 1 164 ? 3.267   42.149 88.073  1.00 39.42 ? 165  GLU A CG  1 
ATOM   959  C CD  . GLU A 1 164 ? 2.587   40.788 87.940  1.00 52.19 ? 165  GLU A CD  1 
ATOM   960  O OE1 . GLU A 1 164 ? 3.134   39.778 88.459  1.00 52.04 ? 165  GLU A OE1 1 
ATOM   961  O OE2 . GLU A 1 164 ? 1.505   40.741 87.310  1.00 55.64 ? 165  GLU A OE2 1 
ATOM   962  N N   . LEU A 1 165 ? 7.804   42.711 88.296  1.00 24.53 ? 166  LEU A N   1 
ATOM   963  C CA  . LEU A 1 165 ? 9.124   42.468 88.874  1.00 24.29 ? 166  LEU A CA  1 
ATOM   964  C C   . LEU A 1 165 ? 9.646   43.766 89.485  1.00 28.41 ? 166  LEU A C   1 
ATOM   965  O O   . LEU A 1 165 ? 10.014  43.786 90.659  1.00 26.73 ? 166  LEU A O   1 
ATOM   966  C CB  . LEU A 1 165 ? 10.081  41.913 87.822  1.00 21.06 ? 166  LEU A CB  1 
ATOM   967  C CG  . LEU A 1 165 ? 11.477  41.523 88.306  1.00 25.39 ? 166  LEU A CG  1 
ATOM   968  C CD1 . LEU A 1 165 ? 11.992  40.380 87.473  1.00 26.15 ? 166  LEU A CD1 1 
ATOM   969  C CD2 . LEU A 1 165 ? 12.414  42.733 88.219  1.00 25.31 ? 166  LEU A CD2 1 
ATOM   970  N N   . SER A 1 166 ? 9.633   44.848 88.702  1.00 24.52 ? 167  SER A N   1 
ATOM   971  C CA  . SER A 1 166 ? 10.090  46.156 89.186  1.00 27.07 ? 167  SER A CA  1 
ATOM   972  C C   . SER A 1 166 ? 9.277   46.631 90.382  1.00 32.81 ? 167  SER A C   1 
ATOM   973  O O   . SER A 1 166 ? 9.833   47.155 91.337  1.00 33.08 ? 167  SER A O   1 
ATOM   974  C CB  . SER A 1 166 ? 10.045  47.224 88.083  1.00 28.56 ? 167  SER A CB  1 
ATOM   975  O OG  . SER A 1 166 ? 11.001  46.938 87.074  1.00 40.75 ? 167  SER A OG  1 
ATOM   976  N N   . ASP A 1 167 ? 7.963   46.447 90.327  1.00 32.09 ? 168  ASP A N   1 
ATOM   977  C CA  . ASP A 1 167 ? 7.107   46.823 91.444  1.00 33.37 ? 168  ASP A CA  1 
ATOM   978  C C   . ASP A 1 167 ? 7.439   46.073 92.734  1.00 29.66 ? 168  ASP A C   1 
ATOM   979  O O   . ASP A 1 167 ? 7.339   46.631 93.824  1.00 29.58 ? 168  ASP A O   1 
ATOM   980  C CB  . ASP A 1 167 ? 5.634   46.615 91.089  1.00 34.46 ? 168  ASP A CB  1 
ATOM   981  C CG  . ASP A 1 167 ? 5.107   47.679 90.138  1.00 41.40 ? 168  ASP A CG  1 
ATOM   982  O OD1 . ASP A 1 167 ? 5.917   48.484 89.628  1.00 46.76 ? 168  ASP A OD1 1 
ATOM   983  O OD2 . ASP A 1 167 ? 3.885   47.707 89.891  1.00 45.98 ? 168  ASP A OD2 1 
ATOM   984  N N   . PHE A 1 168 ? 7.809   44.802 92.620  1.00 23.60 ? 169  PHE A N   1 
ATOM   985  C CA  . PHE A 1 168 ? 8.164   44.040 93.804  1.00 27.91 ? 169  PHE A CA  1 
ATOM   986  C C   . PHE A 1 168 ? 9.338   44.711 94.525  1.00 25.53 ? 169  PHE A C   1 
ATOM   987  O O   . PHE A 1 168 ? 9.254   45.037 95.702  1.00 28.22 ? 169  PHE A O   1 
ATOM   988  C CB  . PHE A 1 168 ? 8.516   42.600 93.426  1.00 32.19 ? 169  PHE A CB  1 
ATOM   989  C CG  . PHE A 1 168 ? 7.349   41.649 93.494  1.00 30.12 ? 169  PHE A CG  1 
ATOM   990  C CD1 . PHE A 1 168 ? 6.524   41.616 94.612  1.00 29.12 ? 169  PHE A CD1 1 
ATOM   991  C CD2 . PHE A 1 168 ? 7.088   40.770 92.443  1.00 32.00 ? 169  PHE A CD2 1 
ATOM   992  C CE1 . PHE A 1 168 ? 5.451   40.720 94.694  1.00 29.59 ? 169  PHE A CE1 1 
ATOM   993  C CE2 . PHE A 1 168 ? 6.007   39.876 92.504  1.00 29.27 ? 169  PHE A CE2 1 
ATOM   994  C CZ  . PHE A 1 168 ? 5.193   39.852 93.635  1.00 30.46 ? 169  PHE A CZ  1 
ATOM   995  N N   . PHE A 1 169 ? 10.416  44.940 93.789  1.00 22.97 ? 170  PHE A N   1 
ATOM   996  C CA  . PHE A 1 169 ? 11.604  45.553 94.343  1.00 26.62 ? 170  PHE A CA  1 
ATOM   997  C C   . PHE A 1 169 ? 11.316  46.962 94.880  1.00 30.44 ? 170  PHE A C   1 
ATOM   998  O O   . PHE A 1 169 ? 11.691  47.280 96.018  1.00 27.87 ? 170  PHE A O   1 
ATOM   999  C CB  . PHE A 1 169 ? 12.740  45.555 93.307  1.00 21.75 ? 170  PHE A CB  1 
ATOM   1000 C CG  . PHE A 1 169 ? 13.306  44.186 93.040  1.00 22.76 ? 170  PHE A CG  1 
ATOM   1001 C CD1 . PHE A 1 169 ? 12.900  43.091 93.813  1.00 23.38 ? 170  PHE A CD1 1 
ATOM   1002 C CD2 . PHE A 1 169 ? 14.225  43.981 92.015  1.00 24.21 ? 170  PHE A CD2 1 
ATOM   1003 C CE1 . PHE A 1 169 ? 13.412  41.804 93.581  1.00 21.26 ? 170  PHE A CE1 1 
ATOM   1004 C CE2 . PHE A 1 169 ? 14.744  42.692 91.761  1.00 23.14 ? 170  PHE A CE2 1 
ATOM   1005 C CZ  . PHE A 1 169 ? 14.332  41.602 92.554  1.00 23.26 ? 170  PHE A CZ  1 
ATOM   1006 N N   . ARG A 1 170 ? 10.630  47.788 94.084  1.00 29.57 ? 171  ARG A N   1 
ATOM   1007 C CA  . ARG A 1 170 ? 10.357  49.170 94.496  1.00 31.42 ? 171  ARG A CA  1 
ATOM   1008 C C   . ARG A 1 170 ? 9.455   49.252 95.722  1.00 30.35 ? 171  ARG A C   1 
ATOM   1009 O O   . ARG A 1 170 ? 9.700   50.052 96.616  1.00 26.53 ? 171  ARG A O   1 
ATOM   1010 C CB  . ARG A 1 170 ? 9.813   50.016 93.343  1.00 31.80 ? 171  ARG A CB  1 
ATOM   1011 C CG  . ARG A 1 170 ? 10.762  50.016 92.165  1.00 41.56 ? 171  ARG A CG  1 
ATOM   1012 C CD  . ARG A 1 170 ? 10.598  51.220 91.266  1.00 53.26 ? 171  ARG A CD  1 
ATOM   1013 N NE  . ARG A 1 170 ? 11.599  51.183 90.203  1.00 64.41 ? 171  ARG A NE  1 
ATOM   1014 C CZ  . ARG A 1 170 ? 11.341  50.833 88.946  1.00 74.03 ? 171  ARG A CZ  1 
ATOM   1015 N NH1 . ARG A 1 170 ? 10.100  50.514 88.587  1.00 78.64 ? 171  ARG A NH1 1 
ATOM   1016 N NH2 . ARG A 1 170 ? 12.318  50.818 88.044  1.00 73.09 ? 171  ARG A NH2 1 
ATOM   1017 N N   . TYR A 1 171 ? 8.427   48.414 95.783  1.00 31.42 ? 172  TYR A N   1 
ATOM   1018 C CA  . TYR A 1 171 ? 7.545   48.427 96.943  1.00 31.07 ? 172  TYR A CA  1 
ATOM   1019 C C   . TYR A 1 171 ? 8.170   47.809 98.181  1.00 32.00 ? 172  TYR A C   1 
ATOM   1020 O O   . TYR A 1 171 ? 7.901   48.254 99.303  1.00 29.53 ? 172  TYR A O   1 
ATOM   1021 C CB  . TYR A 1 171 ? 6.197   47.791 96.626  1.00 38.13 ? 172  TYR A CB  1 
ATOM   1022 C CG  . TYR A 1 171 ? 5.291   48.761 95.907  1.00 56.42 ? 172  TYR A CG  1 
ATOM   1023 C CD1 . TYR A 1 171 ? 4.347   49.506 96.602  1.00 64.68 ? 172  TYR A CD1 1 
ATOM   1024 C CD2 . TYR A 1 171 ? 5.415   48.972 94.538  1.00 64.58 ? 172  TYR A CD2 1 
ATOM   1025 C CE1 . TYR A 1 171 ? 3.530   50.415 95.950  1.00 71.15 ? 172  TYR A CE1 1 
ATOM   1026 C CE2 . TYR A 1 171 ? 4.602   49.879 93.876  1.00 69.68 ? 172  TYR A CE2 1 
ATOM   1027 C CZ  . TYR A 1 171 ? 3.662   50.595 94.587  1.00 73.22 ? 172  TYR A CZ  1 
ATOM   1028 O OH  . TYR A 1 171 ? 2.852   51.494 93.933  1.00 78.15 ? 172  TYR A OH  1 
ATOM   1029 N N   . TYR A 1 172 ? 8.991   46.777 97.996  1.00 27.34 ? 173  TYR A N   1 
ATOM   1030 C CA  . TYR A 1 172 ? 9.642   46.188 99.150  1.00 27.15 ? 173  TYR A CA  1 
ATOM   1031 C C   . TYR A 1 172 ? 10.613  47.197 99.746  1.00 26.95 ? 173  TYR A C   1 
ATOM   1032 O O   . TYR A 1 172 ? 10.674  47.345 100.969 1.00 29.01 ? 173  TYR A O   1 
ATOM   1033 C CB  . TYR A 1 172 ? 10.361  44.883 98.807  1.00 23.21 ? 173  TYR A CB  1 
ATOM   1034 C CG  . TYR A 1 172 ? 9.423   43.720 98.662  1.00 27.50 ? 173  TYR A CG  1 
ATOM   1035 C CD1 . TYR A 1 172 ? 8.218   43.693 99.351  1.00 31.76 ? 173  TYR A CD1 1 
ATOM   1036 C CD2 . TYR A 1 172 ? 9.732   42.658 97.837  1.00 29.66 ? 173  TYR A CD2 1 
ATOM   1037 C CE1 . TYR A 1 172 ? 7.346   42.639 99.214  1.00 30.88 ? 173  TYR A CE1 1 
ATOM   1038 C CE2 . TYR A 1 172 ? 8.876   41.598 97.696  1.00 33.44 ? 173  TYR A CE2 1 
ATOM   1039 C CZ  . TYR A 1 172 ? 7.676   41.597 98.381  1.00 35.28 ? 173  TYR A CZ  1 
ATOM   1040 O OH  . TYR A 1 172 ? 6.810   40.545 98.243  1.00 35.19 ? 173  TYR A OH  1 
ATOM   1041 N N   . VAL A 1 173 ? 11.364  47.888 98.889  1.00 23.97 ? 174  VAL A N   1 
ATOM   1042 C CA  . VAL A 1 173 ? 12.304  48.892 99.384  1.00 25.90 ? 174  VAL A CA  1 
ATOM   1043 C C   . VAL A 1 173 ? 11.552  49.942 100.212 1.00 28.90 ? 174  VAL A C   1 
ATOM   1044 O O   . VAL A 1 173 ? 11.968  50.283 101.321 1.00 28.01 ? 174  VAL A O   1 
ATOM   1045 C CB  . VAL A 1 173 ? 13.161  49.535 98.260  1.00 24.88 ? 174  VAL A CB  1 
ATOM   1046 C CG1 . VAL A 1 173 ? 13.807  50.828 98.739  1.00 24.68 ? 174  VAL A CG1 1 
ATOM   1047 C CG2 . VAL A 1 173 ? 14.248  48.563 97.791  1.00 16.96 ? 174  VAL A CG2 1 
ATOM   1048 N N   . LYS A 1 174 ? 10.414  50.403 99.705  1.00 27.99 ? 175  LYS A N   1 
ATOM   1049 C CA  . LYS A 1 174 ? 9.619   51.385 100.440 1.00 30.62 ? 175  LYS A CA  1 
ATOM   1050 C C   . LYS A 1 174 ? 9.062   50.845 101.770 1.00 29.39 ? 175  LYS A C   1 
ATOM   1051 O O   . LYS A 1 174 ? 9.142   51.506 102.803 1.00 31.96 ? 175  LYS A O   1 
ATOM   1052 C CB  . LYS A 1 174 ? 8.490   51.947 99.570  1.00 34.01 ? 175  LYS A CB  1 
ATOM   1053 C CG  . LYS A 1 174 ? 7.694   53.029 100.292 1.00 45.61 ? 175  LYS A CG  1 
ATOM   1054 C CD  . LYS A 1 174 ? 6.762   53.798 99.358  1.00 54.68 ? 175  LYS A CD  1 
ATOM   1055 C CE  . LYS A 1 174 ? 5.880   54.769 100.155 1.00 59.35 ? 175  LYS A CE  1 
ATOM   1056 N NZ  . LYS A 1 174 ? 5.415   55.941 99.347  1.00 61.36 ? 175  LYS A NZ  1 
ATOM   1057 N N   . TYR A 1 175 ? 8.498   49.648 101.749 1.00 27.91 ? 176  TYR A N   1 
ATOM   1058 C CA  . TYR A 1 175 ? 7.982   49.054 102.978 1.00 31.02 ? 176  TYR A CA  1 
ATOM   1059 C C   . TYR A 1 175 ? 9.105   48.838 103.985 1.00 33.58 ? 176  TYR A C   1 
ATOM   1060 O O   . TYR A 1 175 ? 8.950   49.152 105.161 1.00 40.90 ? 176  TYR A O   1 
ATOM   1061 C CB  . TYR A 1 175 ? 7.246   47.735 102.696 1.00 30.98 ? 176  TYR A CB  1 
ATOM   1062 N N   . ALA A 1 176 ? 10.245  48.331 103.520 1.00 28.92 ? 177  ALA A N   1 
ATOM   1063 C CA  . ALA A 1 176 ? 11.341  48.013 104.425 1.00 27.79 ? 177  ALA A CA  1 
ATOM   1064 C C   . ALA A 1 176 ? 11.857  49.288 105.058 1.00 31.55 ? 177  ALA A C   1 
ATOM   1065 O O   . ALA A 1 176 ? 12.173  49.320 106.245 1.00 35.42 ? 177  ALA A O   1 
ATOM   1066 C CB  . ALA A 1 176 ? 12.467  47.273 103.702 1.00 22.05 ? 177  ALA A CB  1 
ATOM   1067 N N   . SER A 1 177 ? 11.921  50.347 104.264 1.00 31.98 ? 178  SER A N   1 
ATOM   1068 C CA  . SER A 1 177 ? 12.415  51.616 104.769 1.00 37.55 ? 178  SER A CA  1 
ATOM   1069 C C   . SER A 1 177 ? 11.537  52.098 105.923 1.00 35.18 ? 178  SER A C   1 
ATOM   1070 O O   . SER A 1 177 ? 12.038  52.660 106.894 1.00 35.81 ? 178  SER A O   1 
ATOM   1071 C CB  . SER A 1 177 ? 12.477  52.658 103.662 1.00 42.92 ? 178  SER A CB  1 
ATOM   1072 O OG  . SER A 1 177 ? 11.674  53.763 104.004 1.00 58.94 ? 178  SER A OG  1 
ATOM   1073 N N   . ASP A 1 178 ? 10.236  51.843 105.831 1.00 32.44 ? 179  ASP A N   1 
ATOM   1074 C CA  . ASP A 1 178 ? 9.334   52.131 106.948 1.00 40.73 ? 179  ASP A CA  1 
ATOM   1075 C C   . ASP A 1 178 ? 9.716   51.298 108.171 1.00 41.69 ? 179  ASP A C   1 
ATOM   1076 O O   . ASP A 1 178 ? 9.919   51.840 109.253 1.00 45.57 ? 179  ASP A O   1 
ATOM   1077 C CB  . ASP A 1 178 ? 7.872   51.876 106.572 1.00 46.25 ? 179  ASP A CB  1 
ATOM   1078 C CG  . ASP A 1 178 ? 7.362   52.837 105.498 1.00 53.21 ? 179  ASP A CG  1 
ATOM   1079 O OD1 . ASP A 1 178 ? 7.842   53.989 105.448 1.00 53.51 ? 179  ASP A OD1 1 
ATOM   1080 O OD2 . ASP A 1 178 ? 6.480   52.437 104.699 1.00 56.83 ? 179  ASP A OD2 1 
ATOM   1081 N N   . LEU A 1 179 ? 9.830   49.985 107.994 1.00 40.03 ? 180  LEU A N   1 
ATOM   1082 C CA  . LEU A 1 179 ? 10.262  49.107 109.084 1.00 39.25 ? 180  LEU A CA  1 
ATOM   1083 C C   . LEU A 1 179 ? 11.533  49.588 109.770 1.00 41.19 ? 180  LEU A C   1 
ATOM   1084 O O   . LEU A 1 179 ? 11.598  49.646 110.999 1.00 45.74 ? 180  LEU A O   1 
ATOM   1085 C CB  . LEU A 1 179 ? 10.473  47.682 108.590 1.00 38.74 ? 180  LEU A CB  1 
ATOM   1086 C CG  . LEU A 1 179 ? 9.204   46.856 108.425 1.00 46.80 ? 180  LEU A CG  1 
ATOM   1087 C CD1 . LEU A 1 179 ? 9.555   45.493 107.869 1.00 50.69 ? 180  LEU A CD1 1 
ATOM   1088 C CD2 . LEU A 1 179 ? 8.476   46.717 109.752 1.00 47.12 ? 180  LEU A CD2 1 
ATOM   1089 N N   . TYR A 1 180 ? 12.540  49.944 108.979 1.00 34.91 ? 181  TYR A N   1 
ATOM   1090 C CA  . TYR A 1 180 ? 13.816  50.340 109.552 1.00 33.89 ? 181  TYR A CA  1 
ATOM   1091 C C   . TYR A 1 180 ? 13.800  51.719 110.184 1.00 37.63 ? 181  TYR A C   1 
ATOM   1092 O O   . TYR A 1 180 ? 14.749  52.099 110.872 1.00 38.40 ? 181  TYR A O   1 
ATOM   1093 C CB  . TYR A 1 180 ? 14.934  50.234 108.518 1.00 33.93 ? 181  TYR A CB  1 
ATOM   1094 C CG  . TYR A 1 180 ? 15.271  48.802 108.182 1.00 35.18 ? 181  TYR A CG  1 
ATOM   1095 C CD1 . TYR A 1 180 ? 15.738  47.941 109.160 1.00 31.14 ? 181  TYR A CD1 1 
ATOM   1096 C CD2 . TYR A 1 180 ? 15.113  48.307 106.895 1.00 31.64 ? 181  TYR A CD2 1 
ATOM   1097 C CE1 . TYR A 1 180 ? 16.048  46.624 108.866 1.00 28.82 ? 181  TYR A CE1 1 
ATOM   1098 C CE2 . TYR A 1 180 ? 15.422  46.992 106.595 1.00 30.29 ? 181  TYR A CE2 1 
ATOM   1099 C CZ  . TYR A 1 180 ? 15.887  46.158 107.584 1.00 30.78 ? 181  TYR A CZ  1 
ATOM   1100 O OH  . TYR A 1 180 ? 16.200  44.849 107.300 1.00 34.74 ? 181  TYR A OH  1 
ATOM   1101 N N   . ALA A 1 181 ? 12.721  52.463 109.959 1.00 43.40 ? 182  ALA A N   1 
ATOM   1102 C CA  . ALA A 1 181 ? 12.598  53.810 110.512 1.00 48.29 ? 182  ALA A CA  1 
ATOM   1103 C C   . ALA A 1 181 ? 12.205  53.734 111.981 1.00 56.75 ? 182  ALA A C   1 
ATOM   1104 O O   . ALA A 1 181 ? 11.091  54.097 112.360 1.00 62.09 ? 182  ALA A O   1 
ATOM   1105 C CB  . ALA A 1 181 ? 11.570  54.623 109.723 1.00 42.16 ? 182  ALA A CB  1 
ATOM   1106 N N   . GLN A 1 182 ? 13.120  53.245 112.805 1.00 59.42 ? 183  GLN A N   1 
ATOM   1107 C CA  . GLN A 1 182 ? 12.857  53.110 114.229 1.00 61.11 ? 183  GLN A CA  1 
ATOM   1108 C C   . GLN A 1 182 ? 13.815  53.992 115.008 1.00 55.82 ? 183  GLN A C   1 
ATOM   1109 O O   . GLN A 1 182 ? 15.032  53.806 114.958 1.00 64.83 ? 183  GLN A O   1 
ATOM   1110 C CB  . GLN A 1 182 ? 12.991  51.647 114.672 1.00 63.61 ? 183  GLN A CB  1 
ATOM   1111 N N   . GLN A 1 183 ? 13.264  54.963 115.719 1.00 45.56 ? 184  GLN A N   1 
ATOM   1112 C CA  . GLN A 1 183 ? 14.076  55.801 116.580 1.00 41.80 ? 184  GLN A CA  1 
ATOM   1113 C C   . GLN A 1 183 ? 13.992  55.375 118.049 1.00 40.30 ? 184  GLN A C   1 
ATOM   1114 O O   . GLN A 1 183 ? 12.960  54.915 118.523 1.00 40.16 ? 184  GLN A O   1 
ATOM   1115 C CB  . GLN A 1 183 ? 13.719  57.281 116.406 1.00 42.89 ? 184  GLN A CB  1 
ATOM   1116 C CG  . GLN A 1 183 ? 12.273  57.648 116.689 1.00 49.46 ? 184  GLN A CG  1 
ATOM   1117 C CD  . GLN A 1 183 ? 12.001  59.142 116.470 1.00 57.80 ? 184  GLN A CD  1 
ATOM   1118 O OE1 . GLN A 1 183 ? 11.300  59.521 115.530 1.00 59.92 ? 184  GLN A OE1 1 
ATOM   1119 N NE2 . GLN A 1 183 ? 12.561  59.990 117.335 1.00 37.07 ? 184  GLN A NE2 1 
ATOM   1120 N N   . PRO A 1 184 ? 15.102  55.511 118.769 1.00 37.07 ? 185  PRO A N   1 
ATOM   1121 C CA  . PRO A 1 184 ? 15.106  55.168 120.187 1.00 41.45 ? 185  PRO A CA  1 
ATOM   1122 C C   . PRO A 1 184 ? 14.276  56.150 121.019 1.00 46.58 ? 185  PRO A C   1 
ATOM   1123 O O   . PRO A 1 184 ? 14.172  57.327 120.666 1.00 45.85 ? 185  PRO A O   1 
ATOM   1124 C CB  . PRO A 1 184 ? 16.593  55.252 120.565 1.00 37.15 ? 185  PRO A CB  1 
ATOM   1125 C CG  . PRO A 1 184 ? 17.191  56.179 119.556 1.00 36.69 ? 185  PRO A CG  1 
ATOM   1126 C CD  . PRO A 1 184 ? 16.429  55.926 118.286 1.00 37.47 ? 185  PRO A CD  1 
ATOM   1127 N N   . VAL A 1 185 ? 13.713  55.662 122.123 1.00 39.19 ? 186  VAL A N   1 
ATOM   1128 C CA  . VAL A 1 185 ? 12.816  56.450 122.958 1.00 41.09 ? 186  VAL A CA  1 
ATOM   1129 C C   . VAL A 1 185 ? 13.122  56.286 124.448 1.00 43.02 ? 186  VAL A C   1 
ATOM   1130 O O   . VAL A 1 185 ? 13.412  55.184 124.915 1.00 46.30 ? 186  VAL A O   1 
ATOM   1131 C CB  . VAL A 1 185 ? 11.323  56.087 122.677 1.00 40.77 ? 186  VAL A CB  1 
ATOM   1132 C CG1 . VAL A 1 185 ? 11.133  54.602 122.626 1.00 43.19 ? 186  VAL A CG1 1 
ATOM   1133 C CG2 . VAL A 1 185 ? 10.399  56.689 123.725 1.00 63.77 ? 186  VAL A CG2 1 
ATOM   1134 N N   . GLU A 1 186 ? 13.063  57.387 125.186 1.00 44.98 ? 187  GLU A N   1 
ATOM   1135 C CA  . GLU A 1 186 ? 13.123  57.326 126.636 1.00 51.10 ? 187  GLU A CA  1 
ATOM   1136 C C   . GLU A 1 186 ? 11.718  57.103 127.169 1.00 53.54 ? 187  GLU A C   1 
ATOM   1137 O O   . GLU A 1 186 ? 10.893  58.006 127.123 1.00 57.04 ? 187  GLU A O   1 
ATOM   1138 C CB  . GLU A 1 186 ? 13.711  58.612 127.225 1.00 48.97 ? 187  GLU A CB  1 
ATOM   1139 C CG  . GLU A 1 186 ? 13.925  58.542 128.734 1.00 62.02 ? 187  GLU A CG  1 
ATOM   1140 C CD  . GLU A 1 186 ? 14.516  59.819 129.314 1.00 66.13 ? 187  GLU A CD  1 
ATOM   1141 O OE1 . GLU A 1 186 ? 14.702  60.788 128.547 1.00 68.68 ? 187  GLU A OE1 1 
ATOM   1142 O OE2 . GLU A 1 186 ? 14.801  59.849 130.534 1.00 62.87 ? 187  GLU A OE2 1 
ATOM   1143 N N   . SER A 1 187 ? 11.453  55.895 127.661 1.00 56.44 ? 188  SER A N   1 
ATOM   1144 C CA  . SER A 1 187 ? 10.155  55.542 128.236 1.00 54.41 ? 188  SER A CA  1 
ATOM   1145 C C   . SER A 1 187 ? 9.820   56.354 129.480 1.00 52.04 ? 188  SER A C   1 
ATOM   1146 O O   . SER A 1 187 ? 10.650  57.099 129.998 1.00 53.26 ? 188  SER A O   1 
ATOM   1147 C CB  . SER A 1 187 ? 10.112  54.057 128.597 1.00 48.73 ? 188  SER A CB  1 
ATOM   1148 O OG  . SER A 1 187 ? 10.288  53.246 127.458 1.00 54.51 ? 188  SER A OG  1 
ATOM   1149 N N   . ALA A 1 188 ? 8.596   56.186 129.966 1.00 64.41 ? 189  ALA A N   1 
ATOM   1150 C CA  . ALA A 1 188 ? 8.145   56.891 131.159 1.00 66.18 ? 189  ALA A CA  1 
ATOM   1151 C C   . ALA A 1 188 ? 8.969   56.471 132.367 1.00 63.95 ? 189  ALA A C   1 
ATOM   1152 O O   . ALA A 1 188 ? 9.253   57.282 133.242 1.00 59.87 ? 189  ALA A O   1 
ATOM   1153 C CB  . ALA A 1 188 ? 6.663   56.627 131.400 1.00 67.64 ? 189  ALA A CB  1 
ATOM   1154 N N   . ASP A 1 189 ? 9.370   55.202 132.395 1.00 63.79 ? 190  ASP A N   1 
ATOM   1155 C CA  . ASP A 1 189 ? 10.140  54.661 133.515 1.00 65.64 ? 190  ASP A CA  1 
ATOM   1156 C C   . ASP A 1 189 ? 11.568  55.195 133.555 1.00 61.65 ? 190  ASP A C   1 
ATOM   1157 O O   . ASP A 1 189 ? 12.333  54.863 134.448 1.00 64.76 ? 190  ASP A O   1 
ATOM   1158 C CB  . ASP A 1 189 ? 10.145  53.126 133.483 1.00 67.74 ? 190  ASP A CB  1 
ATOM   1159 C CG  . ASP A 1 189 ? 10.679  52.571 132.181 1.00 70.28 ? 190  ASP A CG  1 
ATOM   1160 O OD1 . ASP A 1 189 ? 11.336  53.331 131.443 1.00 71.35 ? 190  ASP A OD1 1 
ATOM   1161 O OD2 . ASP A 1 189 ? 10.450  51.375 131.890 1.00 72.08 ? 190  ASP A OD2 1 
ATOM   1162 N N   . GLY A 1 190 ? 11.925  56.019 132.580 1.00 56.68 ? 191  GLY A N   1 
ATOM   1163 C CA  . GLY A 1 190 ? 13.264  56.564 132.506 1.00 56.56 ? 191  GLY A CA  1 
ATOM   1164 C C   . GLY A 1 190 ? 14.266  55.702 131.755 1.00 54.29 ? 191  GLY A C   1 
ATOM   1165 O O   . GLY A 1 190 ? 15.431  56.082 131.633 1.00 57.59 ? 191  GLY A O   1 
ATOM   1166 N N   . THR A 1 191 ? 13.835  54.547 131.255 1.00 52.69 ? 192  THR A N   1 
ATOM   1167 C CA  . THR A 1 191 ? 14.742  53.688 130.509 1.00 50.62 ? 192  THR A CA  1 
ATOM   1168 C C   . THR A 1 191 ? 14.858  54.159 129.062 1.00 63.06 ? 192  THR A C   1 
ATOM   1169 O O   . THR A 1 191 ? 14.023  54.921 128.578 1.00 48.29 ? 192  THR A O   1 
ATOM   1170 C CB  . THR A 1 191 ? 14.329  52.190 130.539 1.00 49.86 ? 192  THR A CB  1 
ATOM   1171 O OG1 . THR A 1 191 ? 13.022  52.036 129.985 1.00 49.07 ? 192  THR A OG1 1 
ATOM   1172 C CG2 . THR A 1 191 ? 14.356  51.635 131.957 1.00 52.07 ? 192  THR A CG2 1 
ATOM   1173 N N   . TRP A 1 192 ? 15.891  53.674 128.382 1.00 46.82 ? 193  TRP A N   1 
ATOM   1174 C CA  . TRP A 1 192 ? 16.296  54.172 127.076 1.00 44.98 ? 193  TRP A CA  1 
ATOM   1175 C C   . TRP A 1 192 ? 16.340  52.982 126.130 1.00 42.80 ? 193  TRP A C   1 
ATOM   1176 O O   . TRP A 1 192 ? 17.182  52.097 126.255 1.00 44.99 ? 193  TRP A O   1 
ATOM   1177 C CB  . TRP A 1 192 ? 17.652  54.871 127.217 1.00 45.48 ? 193  TRP A CB  1 
ATOM   1178 C CG  . TRP A 1 192 ? 18.299  55.406 125.955 1.00 46.72 ? 193  TRP A CG  1 
ATOM   1179 C CD1 . TRP A 1 192 ? 19.565  55.142 125.523 1.00 45.02 ? 193  TRP A CD1 1 
ATOM   1180 C CD2 . TRP A 1 192 ? 17.731  56.310 124.991 1.00 43.09 ? 193  TRP A CD2 1 
ATOM   1181 N NE1 . TRP A 1 192 ? 19.819  55.812 124.358 1.00 41.69 ? 193  TRP A NE1 1 
ATOM   1182 C CE2 . TRP A 1 192 ? 18.711  56.537 124.008 1.00 43.50 ? 193  TRP A CE2 1 
ATOM   1183 C CE3 . TRP A 1 192 ? 16.496  56.953 124.871 1.00 43.53 ? 193  TRP A CE3 1 
ATOM   1184 C CZ2 . TRP A 1 192 ? 18.492  57.371 122.910 1.00 42.88 ? 193  TRP A CZ2 1 
ATOM   1185 C CZ3 . TRP A 1 192 ? 16.283  57.786 123.782 1.00 42.64 ? 193  TRP A CZ3 1 
ATOM   1186 C CH2 . TRP A 1 192 ? 17.274  57.979 122.813 1.00 41.32 ? 193  TRP A CH2 1 
ATOM   1187 N N   . ASN A 1 193 ? 15.396  52.966 125.198 1.00 41.51 ? 194  ASN A N   1 
ATOM   1188 C CA  . ASN A 1 193 ? 15.085  51.794 124.413 1.00 39.73 ? 194  ASN A CA  1 
ATOM   1189 C C   . ASN A 1 193 ? 15.315  52.029 122.933 1.00 44.70 ? 194  ASN A C   1 
ATOM   1190 O O   . ASN A 1 193 ? 15.089  53.122 122.436 1.00 43.90 ? 194  ASN A O   1 
ATOM   1191 C CB  . ASN A 1 193 ? 13.620  51.398 124.634 1.00 40.03 ? 194  ASN A CB  1 
ATOM   1192 C CG  . ASN A 1 193 ? 13.281  51.229 126.110 1.00 42.22 ? 194  ASN A CG  1 
ATOM   1193 O OD1 . ASN A 1 193 ? 13.390  50.136 126.661 1.00 62.14 ? 194  ASN A OD1 1 
ATOM   1194 N ND2 . ASN A 1 193 ? 12.884  52.314 126.755 1.00 51.00 ? 194  ASN A ND2 1 
ATOM   1195 N N   . LYS A 1 194 ? 15.787  51.001 122.242 1.00 36.23 ? 195  LYS A N   1 
ATOM   1196 C CA  . LYS A 1 194 ? 15.786  50.974 120.789 1.00 34.33 ? 195  LYS A CA  1 
ATOM   1197 C C   . LYS A 1 194 ? 15.337  49.590 120.377 1.00 33.18 ? 195  LYS A C   1 
ATOM   1198 O O   . LYS A 1 194 ? 15.538  48.624 121.100 1.00 39.88 ? 195  LYS A O   1 
ATOM   1199 C CB  . LYS A 1 194 ? 17.166  51.259 120.209 1.00 40.81 ? 195  LYS A CB  1 
ATOM   1200 C CG  . LYS A 1 194 ? 18.249  50.305 120.676 1.00 46.46 ? 195  LYS A CG  1 
ATOM   1201 C CD  . LYS A 1 194 ? 19.328  50.096 119.613 1.00 47.40 ? 195  LYS A CD  1 
ATOM   1202 C CE  . LYS A 1 194 ? 20.617  49.572 120.243 1.00 49.16 ? 195  LYS A CE  1 
ATOM   1203 N NZ  . LYS A 1 194 ? 21.514  48.950 119.236 1.00 55.81 ? 195  LYS A NZ  1 
ATOM   1204 N N   . ALA A 1 195 ? 14.702  49.499 119.222 1.00 31.76 ? 196  ALA A N   1 
ATOM   1205 C CA  . ALA A 1 195 ? 14.314  48.221 118.701 1.00 30.61 ? 196  ALA A CA  1 
ATOM   1206 C C   . ALA A 1 195 ? 15.010  48.091 117.366 1.00 36.81 ? 196  ALA A C   1 
ATOM   1207 O O   . ALA A 1 195 ? 15.115  49.063 116.623 1.00 39.71 ? 196  ALA A O   1 
ATOM   1208 C CB  . ALA A 1 195 ? 12.806  48.146 118.544 1.00 35.58 ? 196  ALA A CB  1 
ATOM   1209 N N   . GLU A 1 196 ? 15.531  46.906 117.081 1.00 34.12 ? 197  GLU A N   1 
ATOM   1210 C CA  . GLU A 1 196 ? 16.116  46.655 115.782 1.00 37.15 ? 197  GLU A CA  1 
ATOM   1211 C C   . GLU A 1 196 ? 15.604  45.346 115.186 1.00 39.36 ? 197  GLU A C   1 
ATOM   1212 O O   . GLU A 1 196 ? 15.348  44.369 115.897 1.00 39.79 ? 197  GLU A O   1 
ATOM   1213 C CB  . GLU A 1 196 ? 17.647  46.705 115.834 1.00 41.64 ? 197  GLU A CB  1 
ATOM   1214 C CG  . GLU A 1 196 ? 18.327  45.483 116.404 1.00 53.42 ? 197  GLU A CG  1 
ATOM   1215 C CD  . GLU A 1 196 ? 19.850  45.628 116.423 1.00 66.93 ? 197  GLU A CD  1 
ATOM   1216 O OE1 . GLU A 1 196 ? 20.369  46.382 117.286 1.00 68.24 ? 197  GLU A OE1 1 
ATOM   1217 O OE2 . GLU A 1 196 ? 20.520  44.997 115.567 1.00 69.52 ? 197  GLU A OE2 1 
ATOM   1218 N N   . TYR A 1 197 ? 15.424  45.355 113.872 1.00 34.59 ? 198  TYR A N   1 
ATOM   1219 C CA  . TYR A 1 197 ? 15.062  44.161 113.136 1.00 35.29 ? 198  TYR A CA  1 
ATOM   1220 C C   . TYR A 1 197 ? 16.322  43.483 112.655 1.00 35.66 ? 198  TYR A C   1 
ATOM   1221 O O   . TYR A 1 197 ? 17.122  44.087 111.952 1.00 48.36 ? 198  TYR A O   1 
ATOM   1222 C CB  . TYR A 1 197 ? 14.208  44.537 111.943 1.00 34.81 ? 198  TYR A CB  1 
ATOM   1223 C CG  . TYR A 1 197 ? 12.820  44.948 112.328 1.00 38.34 ? 198  TYR A CG  1 
ATOM   1224 C CD1 . TYR A 1 197 ? 11.830  43.994 112.518 1.00 44.24 ? 198  TYR A CD1 1 
ATOM   1225 C CD2 . TYR A 1 197 ? 12.496  46.285 112.507 1.00 45.02 ? 198  TYR A CD2 1 
ATOM   1226 C CE1 . TYR A 1 197 ? 10.544  44.354 112.868 1.00 50.73 ? 198  TYR A CE1 1 
ATOM   1227 C CE2 . TYR A 1 197 ? 11.215  46.662 112.861 1.00 55.31 ? 198  TYR A CE2 1 
ATOM   1228 C CZ  . TYR A 1 197 ? 10.240  45.689 113.039 1.00 57.03 ? 198  TYR A CZ  1 
ATOM   1229 O OH  . TYR A 1 197 ? 8.962   46.053 113.391 1.00 61.36 ? 198  TYR A OH  1 
ATOM   1230 N N   . ARG A 1 198 ? 16.524  42.238 113.051 1.00 25.38 ? 199  ARG A N   1 
ATOM   1231 C CA  . ARG A 1 198 ? 17.675  41.499 112.547 1.00 29.83 ? 199  ARG A CA  1 
ATOM   1232 C C   . ARG A 1 198 ? 17.161  40.489 111.518 1.00 25.26 ? 199  ARG A C   1 
ATOM   1233 O O   . ARG A 1 198 ? 15.989  40.128 111.539 1.00 29.93 ? 199  ARG A O   1 
ATOM   1234 C CB  . ARG A 1 198 ? 18.439  40.831 113.701 1.00 35.27 ? 199  ARG A CB  1 
ATOM   1235 C CG  . ARG A 1 198 ? 17.684  39.704 114.335 1.00 39.26 ? 199  ARG A CG  1 
ATOM   1236 C CD  . ARG A 1 198 ? 18.100  39.402 115.784 1.00 39.68 ? 199  ARG A CD  1 
ATOM   1237 N NE  . ARG A 1 198 ? 16.961  38.754 116.420 1.00 43.90 ? 199  ARG A NE  1 
ATOM   1238 C CZ  . ARG A 1 198 ? 16.894  38.311 117.669 1.00 41.40 ? 199  ARG A CZ  1 
ATOM   1239 N NH1 . ARG A 1 198 ? 17.935  38.398 118.496 1.00 36.59 ? 199  ARG A NH1 1 
ATOM   1240 N NH2 . ARG A 1 198 ? 15.759  37.760 118.080 1.00 40.95 ? 199  ARG A NH2 1 
ATOM   1241 N N   . PRO A 1 199 ? 18.018  40.047 110.593 1.00 25.44 ? 200  PRO A N   1 
ATOM   1242 C CA  . PRO A 1 199 ? 17.546  38.996 109.682 1.00 26.87 ? 200  PRO A CA  1 
ATOM   1243 C C   . PRO A 1 199 ? 17.396  37.662 110.432 1.00 29.82 ? 200  PRO A C   1 
ATOM   1244 O O   . PRO A 1 199 ? 17.789  37.590 111.602 1.00 30.76 ? 200  PRO A O   1 
ATOM   1245 C CB  . PRO A 1 199 ? 18.702  38.876 108.698 1.00 22.04 ? 200  PRO A CB  1 
ATOM   1246 C CG  . PRO A 1 199 ? 19.901  39.166 109.549 1.00 24.06 ? 200  PRO A CG  1 
ATOM   1247 C CD  . PRO A 1 199 ? 19.458  40.304 110.427 1.00 28.08 ? 200  PRO A CD  1 
ATOM   1248 N N   . LEU A 1 200 ? 16.866  36.628 109.775 1.00 29.68 ? 201  LEU A N   1 
ATOM   1249 C CA  . LEU A 1 200 ? 16.889  35.274 110.345 1.00 27.99 ? 201  LEU A CA  1 
ATOM   1250 C C   . LEU A 1 200 ? 18.333  34.858 110.509 1.00 25.91 ? 201  LEU A C   1 
ATOM   1251 O O   . LEU A 1 200 ? 19.207  35.295 109.764 1.00 26.57 ? 201  LEU A O   1 
ATOM   1252 C CB  . LEU A 1 200 ? 16.167  34.266 109.441 1.00 25.08 ? 201  LEU A CB  1 
ATOM   1253 C CG  . LEU A 1 200 ? 14.730  34.646 109.050 1.00 28.34 ? 201  LEU A CG  1 
ATOM   1254 C CD1 . LEU A 1 200 ? 14.104  33.583 108.131 1.00 27.24 ? 201  LEU A CD1 1 
ATOM   1255 C CD2 . LEU A 1 200 ? 13.848  34.881 110.285 1.00 26.60 ? 201  LEU A CD2 1 
ATOM   1256 N N   . GLU A 1 201 ? 18.598  34.008 111.483 1.00 25.95 ? 202  GLU A N   1 
ATOM   1257 C CA  . GLU A 1 201 ? 19.968  33.614 111.731 1.00 32.18 ? 202  GLU A CA  1 
ATOM   1258 C C   . GLU A 1 201 ? 20.452  32.575 110.716 1.00 30.39 ? 202  GLU A C   1 
ATOM   1259 O O   . GLU A 1 201 ? 21.623  32.567 110.333 1.00 31.35 ? 202  GLU A O   1 
ATOM   1260 C CB  . GLU A 1 201 ? 20.113  33.073 113.148 1.00 31.19 ? 202  GLU A CB  1 
ATOM   1261 C CG  . GLU A 1 201 ? 21.543  32.800 113.506 1.00 40.58 ? 202  GLU A CG  1 
ATOM   1262 C CD  . GLU A 1 201 ? 21.746  32.643 114.995 1.00 47.44 ? 202  GLU A CD  1 
ATOM   1263 O OE1 . GLU A 1 201 ? 20.761  32.334 115.708 1.00 50.00 ? 202  GLU A OE1 1 
ATOM   1264 O OE2 . GLU A 1 201 ? 22.893  32.834 115.441 1.00 48.77 ? 202  GLU A OE2 1 
ATOM   1265 N N   . GLY A 1 202 ? 19.558  31.681 110.305 1.00 26.70 ? 203  GLY A N   1 
ATOM   1266 C CA  . GLY A 1 202 ? 19.908  30.700 109.297 1.00 28.00 ? 203  GLY A CA  1 
ATOM   1267 C C   . GLY A 1 202 ? 19.640  31.254 107.907 1.00 31.85 ? 203  GLY A C   1 
ATOM   1268 O O   . GLY A 1 202 ? 19.068  32.336 107.769 1.00 29.65 ? 203  GLY A O   1 
ATOM   1269 N N   . PHE A 1 203 ? 20.049  30.521 106.877 1.00 27.47 ? 204  PHE A N   1 
ATOM   1270 C CA  . PHE A 1 203 ? 19.862  30.977 105.505 1.00 21.15 ? 204  PHE A CA  1 
ATOM   1271 C C   . PHE A 1 203 ? 18.453  30.663 105.010 1.00 22.64 ? 204  PHE A C   1 
ATOM   1272 O O   . PHE A 1 203 ? 17.727  29.859 105.615 1.00 23.32 ? 204  PHE A O   1 
ATOM   1273 C CB  . PHE A 1 203 ? 20.896  30.334 104.567 1.00 20.34 ? 204  PHE A CB  1 
ATOM   1274 C CG  . PHE A 1 203 ? 20.763  28.838 104.447 1.00 24.71 ? 204  PHE A CG  1 
ATOM   1275 C CD1 . PHE A 1 203 ? 19.957  28.277 103.464 1.00 25.42 ? 204  PHE A CD1 1 
ATOM   1276 C CD2 . PHE A 1 203 ? 21.443  27.994 105.319 1.00 25.90 ? 204  PHE A CD2 1 
ATOM   1277 C CE1 . PHE A 1 203 ? 19.821  26.891 103.348 1.00 23.66 ? 204  PHE A CE1 1 
ATOM   1278 C CE2 . PHE A 1 203 ? 21.322  26.620 105.213 1.00 28.03 ? 204  PHE A CE2 1 
ATOM   1279 C CZ  . PHE A 1 203 ? 20.512  26.060 104.227 1.00 27.00 ? 204  PHE A CZ  1 
ATOM   1280 N N   . VAL A 1 204 ? 18.087  31.291 103.895 1.00 22.32 ? 205  VAL A N   1 
ATOM   1281 C CA  . VAL A 1 204 ? 16.781  31.096 103.272 1.00 17.99 ? 205  VAL A CA  1 
ATOM   1282 C C   . VAL A 1 204 ? 16.913  30.259 102.005 1.00 21.21 ? 205  VAL A C   1 
ATOM   1283 O O   . VAL A 1 204 ? 17.835  30.474 101.204 1.00 19.06 ? 205  VAL A O   1 
ATOM   1284 C CB  . VAL A 1 204 ? 16.170  32.445 102.900 1.00 21.04 ? 205  VAL A CB  1 
ATOM   1285 C CG1 . VAL A 1 204 ? 14.794  32.254 102.215 1.00 20.22 ? 205  VAL A CG1 1 
ATOM   1286 C CG2 . VAL A 1 204 ? 16.072  33.340 104.150 1.00 18.19 ? 205  VAL A CG2 1 
ATOM   1287 N N   . TYR A 1 205 ? 16.011  29.296 101.840 1.00 17.83 ? 206  TYR A N   1 
ATOM   1288 C CA  . TYR A 1 205 ? 15.960  28.461 100.640 1.00 22.75 ? 206  TYR A CA  1 
ATOM   1289 C C   . TYR A 1 205 ? 14.777  28.940 99.807  1.00 22.76 ? 206  TYR A C   1 
ATOM   1290 O O   . TYR A 1 205 ? 13.630  28.777 100.217 1.00 20.85 ? 206  TYR A O   1 
ATOM   1291 C CB  . TYR A 1 205 ? 15.793  26.983 101.030 1.00 19.56 ? 206  TYR A CB  1 
ATOM   1292 C CG  . TYR A 1 205 ? 15.718  25.981 99.881  1.00 19.87 ? 206  TYR A CG  1 
ATOM   1293 C CD1 . TYR A 1 205 ? 16.362  26.214 98.665  1.00 20.00 ? 206  TYR A CD1 1 
ATOM   1294 C CD2 . TYR A 1 205 ? 14.994  24.791 100.026 1.00 19.03 ? 206  TYR A CD2 1 
ATOM   1295 C CE1 . TYR A 1 205 ? 16.298  25.280 97.620  1.00 19.64 ? 206  TYR A CE1 1 
ATOM   1296 C CE2 . TYR A 1 205 ? 14.914  23.856 98.997  1.00 24.22 ? 206  TYR A CE2 1 
ATOM   1297 C CZ  . TYR A 1 205 ? 15.570  24.106 97.798  1.00 25.44 ? 206  TYR A CZ  1 
ATOM   1298 O OH  . TYR A 1 205 ? 15.467  23.188 96.783  1.00 19.59 ? 206  TYR A OH  1 
ATOM   1299 N N   . ALA A 1 206 ? 15.060  29.571 98.670  1.00 24.56 ? 207  ALA A N   1 
ATOM   1300 C CA  . ALA A 1 206 ? 14.021  30.031 97.753  1.00 15.94 ? 207  ALA A CA  1 
ATOM   1301 C C   . ALA A 1 206 ? 13.776  28.995 96.667  1.00 22.60 ? 207  ALA A C   1 
ATOM   1302 O O   . ALA A 1 206 ? 14.698  28.604 95.923  1.00 18.50 ? 207  ALA A O   1 
ATOM   1303 C CB  . ALA A 1 206 ? 14.393  31.380 97.117  1.00 16.19 ? 207  ALA A CB  1 
ATOM   1304 N N   . VAL A 1 207 ? 12.532  28.545 96.583  1.00 20.54 ? 208  VAL A N   1 
ATOM   1305 C CA  . VAL A 1 207 ? 12.115  27.606 95.550  1.00 20.13 ? 208  VAL A CA  1 
ATOM   1306 C C   . VAL A 1 207 ? 11.001  28.253 94.722  1.00 21.49 ? 208  VAL A C   1 
ATOM   1307 O O   . VAL A 1 207 ? 9.897   28.475 95.210  1.00 20.13 ? 208  VAL A O   1 
ATOM   1308 C CB  . VAL A 1 207 ? 11.637  26.318 96.183  1.00 19.07 ? 208  VAL A CB  1 
ATOM   1309 C CG1 . VAL A 1 207 ? 11.074  25.384 95.128  1.00 16.66 ? 208  VAL A CG1 1 
ATOM   1310 C CG2 . VAL A 1 207 ? 12.809  25.658 96.932  1.00 17.23 ? 208  VAL A CG2 1 
ATOM   1311 N N   . SER A 1 208 ? 11.301  28.559 93.468  1.00 19.91 ? 209  SER A N   1 
ATOM   1312 C CA  . SER A 1 208 ? 10.453  29.451 92.699  1.00 19.18 ? 209  SER A CA  1 
ATOM   1313 C C   . SER A 1 208 ? 9.791   28.695 91.542  1.00 20.20 ? 209  SER A C   1 
ATOM   1314 O O   . SER A 1 208 ? 10.349  27.727 91.042  1.00 17.43 ? 209  SER A O   1 
ATOM   1315 C CB  . SER A 1 208 ? 11.280  30.661 92.199  1.00 14.82 ? 209  SER A CB  1 
ATOM   1316 O OG  . SER A 1 208 ? 12.384  30.258 91.394  1.00 17.94 ? 209  SER A OG  1 
ATOM   1317 N N   . PRO A 1 209 ? 8.601   29.145 91.119  1.00 17.41 ? 210  PRO A N   1 
ATOM   1318 C CA  . PRO A 1 209 ? 7.797   28.464 90.094  1.00 17.23 ? 210  PRO A CA  1 
ATOM   1319 C C   . PRO A 1 209 ? 8.165   28.947 88.681  1.00 22.45 ? 210  PRO A C   1 
ATOM   1320 O O   . PRO A 1 209 ? 8.891   29.925 88.559  1.00 22.43 ? 210  PRO A O   1 
ATOM   1321 C CB  . PRO A 1 209 ? 6.370   28.902 90.442  1.00 14.42 ? 210  PRO A CB  1 
ATOM   1322 C CG  . PRO A 1 209 ? 6.583   30.362 90.861  1.00 18.21 ? 210  PRO A CG  1 
ATOM   1323 C CD  . PRO A 1 209 ? 7.904   30.323 91.674  1.00 16.58 ? 210  PRO A CD  1 
ATOM   1324 N N   . PHE A 1 210 ? 7.654   28.288 87.640  1.00 22.20 ? 211  PHE A N   1 
ATOM   1325 C CA  . PHE A 1 210 ? 7.983   28.661 86.268  1.00 19.19 ? 211  PHE A CA  1 
ATOM   1326 C C   . PHE A 1 210 ? 7.200   29.865 85.790  1.00 21.11 ? 211  PHE A C   1 
ATOM   1327 O O   . PHE A 1 210 ? 7.611   30.537 84.853  1.00 24.05 ? 211  PHE A O   1 
ATOM   1328 C CB  . PHE A 1 210 ? 7.669   27.501 85.307  1.00 21.21 ? 211  PHE A CB  1 
ATOM   1329 C CG  . PHE A 1 210 ? 6.190   27.323 85.030  1.00 17.73 ? 211  PHE A CG  1 
ATOM   1330 C CD1 . PHE A 1 210 ? 5.570   27.999 83.985  1.00 21.07 ? 211  PHE A CD1 1 
ATOM   1331 C CD2 . PHE A 1 210 ? 5.417   26.498 85.829  1.00 16.20 ? 211  PHE A CD2 1 
ATOM   1332 C CE1 . PHE A 1 210 ? 4.207   27.844 83.739  1.00 21.29 ? 211  PHE A CE1 1 
ATOM   1333 C CE2 . PHE A 1 210 ? 4.051   26.335 85.586  1.00 25.97 ? 211  PHE A CE2 1 
ATOM   1334 C CZ  . PHE A 1 210 ? 3.448   27.016 84.539  1.00 23.86 ? 211  PHE A CZ  1 
ATOM   1335 N N   . ASN A 1 211 ? 6.032   30.103 86.384  1.00 16.58 ? 212  ASN A N   1 
ATOM   1336 C CA  . ASN A 1 211 ? 5.026   30.904 85.696  1.00 17.96 ? 212  ASN A CA  1 
ATOM   1337 C C   . ASN A 1 211 ? 5.208   32.419 85.670  1.00 20.72 ? 212  ASN A C   1 
ATOM   1338 O O   . ASN A 1 211 ? 4.776   33.070 84.724  1.00 27.29 ? 212  ASN A O   1 
ATOM   1339 C CB  . ASN A 1 211 ? 3.604   30.527 86.125  1.00 22.98 ? 212  ASN A CB  1 
ATOM   1340 C CG  . ASN A 1 211 ? 3.302   30.914 87.549  1.00 18.78 ? 212  ASN A CG  1 
ATOM   1341 O OD1 . ASN A 1 211 ? 4.198   31.048 88.373  1.00 27.95 ? 212  ASN A OD1 1 
ATOM   1342 N ND2 . ASN A 1 211 ? 2.032   31.072 87.850  1.00 23.19 ? 212  ASN A ND2 1 
ATOM   1343 N N   . PHE A 1 212 ? 5.823   32.983 86.697  1.00 21.07 ? 213  PHE A N   1 
ATOM   1344 C CA  . PHE A 1 212 ? 6.168   34.407 86.652  1.00 19.86 ? 213  PHE A CA  1 
ATOM   1345 C C   . PHE A 1 212 ? 7.623   34.617 87.010  1.00 17.32 ? 213  PHE A C   1 
ATOM   1346 O O   . PHE A 1 212 ? 8.084   34.176 88.067  1.00 19.65 ? 213  PHE A O   1 
ATOM   1347 C CB  . PHE A 1 212 ? 5.261   35.233 87.574  1.00 20.00 ? 213  PHE A CB  1 
ATOM   1348 C CG  . PHE A 1 212 ? 3.869   35.416 87.027  1.00 24.90 ? 213  PHE A CG  1 
ATOM   1349 C CD1 . PHE A 1 212 ? 2.903   34.439 87.217  1.00 28.64 ? 213  PHE A CD1 1 
ATOM   1350 C CD2 . PHE A 1 212 ? 3.538   36.559 86.303  1.00 27.03 ? 213  PHE A CD2 1 
ATOM   1351 C CE1 . PHE A 1 212 ? 1.626   34.594 86.689  1.00 34.06 ? 213  PHE A CE1 1 
ATOM   1352 C CE2 . PHE A 1 212 ? 2.266   36.730 85.779  1.00 28.38 ? 213  PHE A CE2 1 
ATOM   1353 C CZ  . PHE A 1 212 ? 1.311   35.745 85.966  1.00 33.58 ? 213  PHE A CZ  1 
ATOM   1354 N N   . THR A 1 213 ? 8.346   35.274 86.116  1.00 20.80 ? 214  THR A N   1 
ATOM   1355 C CA  . THR A 1 213 ? 9.715   35.690 86.396  1.00 23.38 ? 214  THR A CA  1 
ATOM   1356 C C   . THR A 1 213 ? 9.707   36.582 87.645  1.00 25.54 ? 214  THR A C   1 
ATOM   1357 O O   . THR A 1 213 ? 10.589  36.468 88.498  1.00 21.44 ? 214  THR A O   1 
ATOM   1358 C CB  . THR A 1 213 ? 10.299  36.431 85.184  1.00 22.88 ? 214  THR A CB  1 
ATOM   1359 O OG1 . THR A 1 213 ? 10.287  35.538 84.062  1.00 23.03 ? 214  THR A OG1 1 
ATOM   1360 C CG2 . THR A 1 213 ? 11.743  36.909 85.436  1.00 21.97 ? 214  THR A CG2 1 
ATOM   1361 N N   . ALA A 1 214 ? 8.673   37.420 87.773  1.00 21.57 ? 215  ALA A N   1 
ATOM   1362 C CA  . ALA A 1 214 ? 8.566   38.348 88.900  1.00 19.01 ? 215  ALA A CA  1 
ATOM   1363 C C   . ALA A 1 214 ? 8.420   37.626 90.234  1.00 21.49 ? 215  ALA A C   1 
ATOM   1364 O O   . ALA A 1 214 ? 8.841   38.126 91.278  1.00 19.80 ? 215  ALA A O   1 
ATOM   1365 C CB  . ALA A 1 214 ? 7.399   39.304 88.695  1.00 16.88 ? 215  ALA A CB  1 
ATOM   1366 N N   . ILE A 1 215 ? 7.812   36.450 90.217  1.00 18.48 ? 216  ILE A N   1 
ATOM   1367 C CA  . ILE A 1 215 ? 7.683   35.711 91.473  1.00 18.66 ? 216  ILE A CA  1 
ATOM   1368 C C   . ILE A 1 215 ? 9.053   35.200 91.955  1.00 18.97 ? 216  ILE A C   1 
ATOM   1369 O O   . ILE A 1 215 ? 9.326   35.194 93.151  1.00 18.24 ? 216  ILE A O   1 
ATOM   1370 C CB  . ILE A 1 215 ? 6.638   34.581 91.360  1.00 19.81 ? 216  ILE A CB  1 
ATOM   1371 C CG1 . ILE A 1 215 ? 5.231   35.184 91.177  1.00 17.30 ? 216  ILE A CG1 1 
ATOM   1372 C CG2 . ILE A 1 215 ? 6.667   33.675 92.584  1.00 18.46 ? 216  ILE A CG2 1 
ATOM   1373 C CD1 . ILE A 1 215 ? 4.128   34.103 90.987  1.00 34.14 ? 216  ILE A CD1 1 
ATOM   1374 N N   . ALA A 1 216 ? 9.913   34.778 91.026  1.00 13.92 ? 217  ALA A N   1 
ATOM   1375 C CA  . ALA A 1 216 ? 11.290  34.421 91.400  1.00 19.75 ? 217  ALA A CA  1 
ATOM   1376 C C   . ALA A 1 216 ? 11.985  35.638 92.032  1.00 23.09 ? 217  ALA A C   1 
ATOM   1377 O O   . ALA A 1 216 ? 12.654  35.518 93.066  1.00 20.12 ? 217  ALA A O   1 
ATOM   1378 C CB  . ALA A 1 216 ? 12.079  33.941 90.182  1.00 16.52 ? 217  ALA A CB  1 
ATOM   1379 N N   . ALA A 1 217 ? 11.795  36.811 91.430  1.00 18.04 ? 218  ALA A N   1 
ATOM   1380 C CA  . ALA A 1 217 ? 12.381  38.039 91.994  1.00 21.59 ? 218  ALA A CA  1 
ATOM   1381 C C   . ALA A 1 217 ? 11.875  38.330 93.406  1.00 20.92 ? 218  ALA A C   1 
ATOM   1382 O O   . ALA A 1 217 ? 12.641  38.693 94.291  1.00 21.02 ? 218  ALA A O   1 
ATOM   1383 C CB  . ALA A 1 217 ? 12.129  39.228 91.083  1.00 19.25 ? 218  ALA A CB  1 
ATOM   1384 N N   . ASN A 1 218 ? 10.577  38.164 93.605  1.00 18.32 ? 219  ASN A N   1 
ATOM   1385 C CA  . ASN A 1 218 ? 9.967   38.286 94.924  1.00 20.47 ? 219  ASN A CA  1 
ATOM   1386 C C   . ASN A 1 218 ? 10.560  37.325 95.951  1.00 21.91 ? 219  ASN A C   1 
ATOM   1387 O O   . ASN A 1 218 ? 10.894  37.705 97.077  1.00 20.38 ? 219  ASN A O   1 
ATOM   1388 C CB  . ASN A 1 218 ? 8.483   37.965 94.803  1.00 30.13 ? 219  ASN A CB  1 
ATOM   1389 C CG  . ASN A 1 218 ? 7.780   37.992 96.127  1.00 33.74 ? 219  ASN A CG  1 
ATOM   1390 O OD1 . ASN A 1 218 ? 7.885   38.962 96.866  1.00 36.44 ? 219  ASN A OD1 1 
ATOM   1391 N ND2 . ASN A 1 218 ? 7.067   36.924 96.446  1.00 33.34 ? 219  ASN A ND2 1 
ATOM   1392 N N   . LEU A 1 219 ? 10.661  36.060 95.567  1.00 21.15 ? 220  LEU A N   1 
ATOM   1393 C CA  . LEU A 1 219 ? 11.077  35.020 96.502  1.00 22.11 ? 220  LEU A CA  1 
ATOM   1394 C C   . LEU A 1 219 ? 12.518  35.200 97.002  1.00 21.68 ? 220  LEU A C   1 
ATOM   1395 O O   . LEU A 1 219 ? 12.828  34.866 98.151  1.00 18.07 ? 220  LEU A O   1 
ATOM   1396 C CB  . LEU A 1 219 ? 10.913  33.653 95.859  1.00 16.97 ? 220  LEU A CB  1 
ATOM   1397 C CG  . LEU A 1 219 ? 9.461   33.211 95.695  1.00 18.62 ? 220  LEU A CG  1 
ATOM   1398 C CD1 . LEU A 1 219 ? 9.457   31.890 94.946  1.00 17.83 ? 220  LEU A CD1 1 
ATOM   1399 C CD2 . LEU A 1 219 ? 8.814   33.024 97.059  1.00 17.52 ? 220  LEU A CD2 1 
ATOM   1400 N N   . ILE A 1 220 ? 13.401  35.709 96.144  1.00 17.52 ? 221  ILE A N   1 
ATOM   1401 C CA  . ILE A 1 220 ? 14.778  35.957 96.571  1.00 19.71 ? 221  ILE A CA  1 
ATOM   1402 C C   . ILE A 1 220 ? 14.951  37.373 97.161  1.00 22.18 ? 221  ILE A C   1 
ATOM   1403 O O   . ILE A 1 220 ? 15.744  37.572 98.082  1.00 21.31 ? 221  ILE A O   1 
ATOM   1404 C CB  . ILE A 1 220 ? 15.793  35.717 95.431  1.00 18.57 ? 221  ILE A CB  1 
ATOM   1405 C CG1 . ILE A 1 220 ? 15.599  36.743 94.313  1.00 14.88 ? 221  ILE A CG1 1 
ATOM   1406 C CG2 . ILE A 1 220 ? 15.669  34.281 94.875  1.00 16.10 ? 221  ILE A CG2 1 
ATOM   1407 C CD1 . ILE A 1 220 ? 16.451  36.503 93.092  1.00 15.25 ? 221  ILE A CD1 1 
ATOM   1408 N N   . GLY A 1 221 ? 14.189  38.340 96.654  1.00 24.10 ? 222  GLY A N   1 
ATOM   1409 C CA  . GLY A 1 221 ? 14.390  39.749 96.994  1.00 20.89 ? 222  GLY A CA  1 
ATOM   1410 C C   . GLY A 1 221 ? 13.866  40.150 98.365  1.00 20.72 ? 222  GLY A C   1 
ATOM   1411 O O   . GLY A 1 221 ? 14.514  40.898 99.090  1.00 25.88 ? 222  GLY A O   1 
ATOM   1412 N N   . ALA A 1 222 ? 12.686  39.655 98.718  1.00 17.83 ? 223  ALA A N   1 
ATOM   1413 C CA  . ALA A 1 222 ? 12.107  39.920 100.028 1.00 20.94 ? 223  ALA A CA  1 
ATOM   1414 C C   . ALA A 1 222 ? 13.043  39.486 101.170 1.00 25.17 ? 223  ALA A C   1 
ATOM   1415 O O   . ALA A 1 222 ? 13.401  40.308 102.001 1.00 26.67 ? 223  ALA A O   1 
ATOM   1416 C CB  . ALA A 1 222 ? 10.693  39.271 100.162 1.00 14.72 ? 223  ALA A CB  1 
ATOM   1417 N N   . PRO A 1 223 ? 13.474  38.205 101.204 1.00 22.91 ? 224  PRO A N   1 
ATOM   1418 C CA  . PRO A 1 223 ? 14.423  37.894 102.289 1.00 20.91 ? 224  PRO A CA  1 
ATOM   1419 C C   . PRO A 1 223 ? 15.749  38.655 102.167 1.00 20.54 ? 224  PRO A C   1 
ATOM   1420 O O   . PRO A 1 223 ? 16.273  39.112 103.173 1.00 24.98 ? 224  PRO A O   1 
ATOM   1421 C CB  . PRO A 1 223 ? 14.671  36.389 102.131 1.00 20.03 ? 224  PRO A CB  1 
ATOM   1422 C CG  . PRO A 1 223 ? 14.321  36.087 100.708 1.00 25.87 ? 224  PRO A CG  1 
ATOM   1423 C CD  . PRO A 1 223 ? 13.183  37.027 100.368 1.00 20.50 ? 224  PRO A CD  1 
ATOM   1424 N N   . ALA A 1 224 ? 16.299  38.783 100.966 1.00 16.78 ? 225  ALA A N   1 
ATOM   1425 C CA  . ALA A 1 224 ? 17.642  39.373 100.863 1.00 22.25 ? 225  ALA A CA  1 
ATOM   1426 C C   . ALA A 1 224 ? 17.682  40.833 101.306 1.00 21.58 ? 225  ALA A C   1 
ATOM   1427 O O   . ALA A 1 224 ? 18.630  41.267 101.959 1.00 24.19 ? 225  ALA A O   1 
ATOM   1428 C CB  . ALA A 1 224 ? 18.218  39.215 99.458  1.00 18.53 ? 225  ALA A CB  1 
ATOM   1429 N N   . LEU A 1 225 ? 16.643  41.577 100.953 1.00 22.65 ? 226  LEU A N   1 
ATOM   1430 C CA  . LEU A 1 225 ? 16.544  42.992 101.299 1.00 24.14 ? 226  LEU A CA  1 
ATOM   1431 C C   . LEU A 1 225 ? 16.644  43.214 102.807 1.00 26.56 ? 226  LEU A C   1 
ATOM   1432 O O   . LEU A 1 225 ? 17.176  44.231 103.272 1.00 22.76 ? 226  LEU A O   1 
ATOM   1433 C CB  . LEU A 1 225 ? 15.214  43.537 100.778 1.00 26.82 ? 226  LEU A CB  1 
ATOM   1434 C CG  . LEU A 1 225 ? 15.000  45.041 100.835 1.00 28.61 ? 226  LEU A CG  1 
ATOM   1435 C CD1 . LEU A 1 225 ? 16.056  45.769 100.005 1.00 25.22 ? 226  LEU A CD1 1 
ATOM   1436 C CD2 . LEU A 1 225 ? 13.606  45.357 100.347 1.00 31.64 ? 226  LEU A CD2 1 
ATOM   1437 N N   . MET A 1 226 ? 16.139  42.247 103.569 1.00 19.57 ? 227  MET A N   1 
ATOM   1438 C CA  . MET A 1 226 ? 16.096  42.364 105.014 1.00 21.86 ? 227  MET A CA  1 
ATOM   1439 C C   . MET A 1 226 ? 17.358  41.787 105.646 1.00 22.43 ? 227  MET A C   1 
ATOM   1440 O O   . MET A 1 226 ? 17.364  41.459 106.828 1.00 25.64 ? 227  MET A O   1 
ATOM   1441 C CB  . MET A 1 226 ? 14.859  41.651 105.571 1.00 24.05 ? 227  MET A CB  1 
ATOM   1442 C CG  . MET A 1 226 ? 13.542  42.063 104.912 1.00 21.80 ? 227  MET A CG  1 
ATOM   1443 S SD  . MET A 1 226 ? 13.344  43.871 104.857 1.00 24.81 ? 227  MET A SD  1 
ATOM   1444 C CE  . MET A 1 226 ? 13.058  44.280 106.585 1.00 22.77 ? 227  MET A CE  1 
ATOM   1445 N N   . GLY A 1 227 ? 18.414  41.650 104.842 1.00 21.87 ? 228  GLY A N   1 
ATOM   1446 C CA  . GLY A 1 227 ? 19.691  41.144 105.299 1.00 20.06 ? 228  GLY A CA  1 
ATOM   1447 C C   . GLY A 1 227 ? 19.850  39.632 105.424 1.00 26.19 ? 228  GLY A C   1 
ATOM   1448 O O   . GLY A 1 227 ? 20.784  39.155 106.071 1.00 21.26 ? 228  GLY A O   1 
ATOM   1449 N N   . ASN A 1 228 ? 18.949  38.862 104.826 1.00 22.86 ? 229  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 228 ? 19.143  37.405 104.776 1.00 22.21 ? 229  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 228 ? 19.996  37.005 103.581 1.00 21.46 ? 229  ASN A C   1 
ATOM   1452 O O   . ASN A 1 228 ? 20.065  37.747 102.596 1.00 22.74 ? 229  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 228 ? 17.792  36.696 104.670 1.00 19.89 ? 229  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 228 ? 16.954  36.899 105.887 1.00 19.79 ? 229  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 228 ? 17.203  36.287 106.925 1.00 22.10 ? 229  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 228 ? 15.971  37.787 105.792 1.00 18.79 ? 229  ASN A ND2 1 
ATOM   1457 N N   . THR A 1 229 ? 20.645  35.848 103.647 1.00 20.75 ? 230  THR A N   1 
ATOM   1458 C CA  . THR A 1 229 ? 21.272  35.299 102.447 1.00 22.79 ? 230  THR A CA  1 
ATOM   1459 C C   . THR A 1 229 ? 20.518  34.064 101.958 1.00 24.54 ? 230  THR A C   1 
ATOM   1460 O O   . THR A 1 229 ? 19.742  33.454 102.700 1.00 22.36 ? 230  THR A O   1 
ATOM   1461 C CB  . THR A 1 229 ? 22.757  35.001 102.634 1.00 21.33 ? 230  THR A CB  1 
ATOM   1462 O OG1 . THR A 1 229 ? 22.927  34.082 103.723 1.00 22.78 ? 230  THR A OG1 1 
ATOM   1463 C CG2 . THR A 1 229 ? 23.505  36.298 102.919 1.00 23.66 ? 230  THR A CG2 1 
ATOM   1464 N N   . VAL A 1 230 ? 20.758  33.697 100.704 1.00 22.54 ? 231  VAL A N   1 
ATOM   1465 C CA  . VAL A 1 230 ? 19.776  32.924 99.959  1.00 18.81 ? 231  VAL A CA  1 
ATOM   1466 C C   . VAL A 1 230 ? 20.392  31.864 99.085  1.00 20.93 ? 231  VAL A C   1 
ATOM   1467 O O   . VAL A 1 230 ? 21.336  32.112 98.333  1.00 22.74 ? 231  VAL A O   1 
ATOM   1468 C CB  . VAL A 1 230 ? 18.905  33.826 99.051  1.00 19.92 ? 231  VAL A CB  1 
ATOM   1469 C CG1 . VAL A 1 230 ? 17.907  32.959 98.200  1.00 16.62 ? 231  VAL A CG1 1 
ATOM   1470 C CG2 . VAL A 1 230 ? 18.155  34.885 99.888  1.00 18.23 ? 231  VAL A CG2 1 
ATOM   1471 N N   . VAL A 1 231 ? 19.808  30.680 99.167  1.00 20.11 ? 232  VAL A N   1 
ATOM   1472 C CA  . VAL A 1 231 ? 20.162  29.593 98.291  1.00 19.81 ? 232  VAL A CA  1 
ATOM   1473 C C   . VAL A 1 231 ? 18.886  29.382 97.457  1.00 21.61 ? 232  VAL A C   1 
ATOM   1474 O O   . VAL A 1 231 ? 17.813  29.096 98.001  1.00 19.74 ? 232  VAL A O   1 
ATOM   1475 C CB  . VAL A 1 231 ? 20.567  28.371 99.153  1.00 24.84 ? 232  VAL A CB  1 
ATOM   1476 C CG1 . VAL A 1 231 ? 20.372  27.110 98.430  1.00 27.67 ? 232  VAL A CG1 1 
ATOM   1477 C CG2 . VAL A 1 231 ? 22.019  28.517 99.636  1.00 20.13 ? 232  VAL A CG2 1 
ATOM   1478 N N   . TRP A 1 232 ? 19.004  29.554 96.142  1.00 19.24 ? 233  TRP A N   1 
ATOM   1479 C CA  . TRP A 1 232 ? 17.840  29.676 95.253  1.00 19.67 ? 233  TRP A CA  1 
ATOM   1480 C C   . TRP A 1 232 ? 17.853  28.615 94.152  1.00 19.09 ? 233  TRP A C   1 
ATOM   1481 O O   . TRP A 1 232 ? 18.758  28.613 93.305  1.00 20.84 ? 233  TRP A O   1 
ATOM   1482 C CB  . TRP A 1 232 ? 17.816  31.098 94.642  1.00 19.42 ? 233  TRP A CB  1 
ATOM   1483 C CG  . TRP A 1 232 ? 16.837  31.330 93.515  1.00 16.36 ? 233  TRP A CG  1 
ATOM   1484 C CD1 . TRP A 1 232 ? 15.616  30.737 93.336  1.00 16.09 ? 233  TRP A CD1 1 
ATOM   1485 C CD2 . TRP A 1 232 ? 17.008  32.230 92.412  1.00 17.85 ? 233  TRP A CD2 1 
ATOM   1486 N NE1 . TRP A 1 232 ? 15.018  31.214 92.190  1.00 18.82 ? 233  TRP A NE1 1 
ATOM   1487 C CE2 . TRP A 1 232 ? 15.857  32.124 91.600  1.00 19.48 ? 233  TRP A CE2 1 
ATOM   1488 C CE3 . TRP A 1 232 ? 18.017  33.127 92.042  1.00 16.99 ? 233  TRP A CE3 1 
ATOM   1489 C CZ2 . TRP A 1 232 ? 15.690  32.880 90.441  1.00 18.06 ? 233  TRP A CZ2 1 
ATOM   1490 C CZ3 . TRP A 1 232 ? 17.856  33.866 90.892  1.00 21.91 ? 233  TRP A CZ3 1 
ATOM   1491 C CH2 . TRP A 1 232 ? 16.698  33.741 90.102  1.00 21.26 ? 233  TRP A CH2 1 
ATOM   1492 N N   . LYS A 1 233 ? 16.876  27.702 94.193  1.00 20.53 ? 234  LYS A N   1 
ATOM   1493 C CA  . LYS A 1 233 ? 16.680  26.708 93.128  1.00 19.54 ? 234  LYS A CA  1 
ATOM   1494 C C   . LYS A 1 233 ? 15.518  27.114 92.213  1.00 18.57 ? 234  LYS A C   1 
ATOM   1495 O O   . LYS A 1 233 ? 14.360  26.909 92.546  1.00 19.02 ? 234  LYS A O   1 
ATOM   1496 C CB  . LYS A 1 233 ? 16.427  25.300 93.703  1.00 23.82 ? 234  LYS A CB  1 
ATOM   1497 C CG  . LYS A 1 233 ? 16.483  24.195 92.640  1.00 19.48 ? 234  LYS A CG  1 
ATOM   1498 C CD  . LYS A 1 233 ? 15.572  22.987 92.990  1.00 19.75 ? 234  LYS A CD  1 
ATOM   1499 C CE  . LYS A 1 233 ? 14.080  23.364 93.004  1.00 18.86 ? 234  LYS A CE  1 
ATOM   1500 N NZ  . LYS A 1 233 ? 13.687  24.142 91.784  1.00 24.30 ? 234  LYS A NZ  1 
ATOM   1501 N N   . PRO A 1 234 ? 15.819  27.692 91.045  1.00 19.71 ? 235  PRO A N   1 
ATOM   1502 C CA  . PRO A 1 234 ? 14.703  28.079 90.175  1.00 19.36 ? 235  PRO A CA  1 
ATOM   1503 C C   . PRO A 1 234 ? 14.040  26.884 89.505  1.00 19.75 ? 235  PRO A C   1 
ATOM   1504 O O   . PRO A 1 234 ? 14.583  25.783 89.489  1.00 19.46 ? 235  PRO A O   1 
ATOM   1505 C CB  . PRO A 1 234 ? 15.379  28.917 89.101  1.00 19.81 ? 235  PRO A CB  1 
ATOM   1506 C CG  . PRO A 1 234 ? 16.747  28.257 88.972  1.00 22.41 ? 235  PRO A CG  1 
ATOM   1507 C CD  . PRO A 1 234 ? 17.123  27.944 90.417  1.00 20.72 ? 235  PRO A CD  1 
ATOM   1508 N N   . SER A 1 235 ? 12.853  27.127 88.957  1.00 21.27 ? 236  SER A N   1 
ATOM   1509 C CA  . SER A 1 235 ? 12.161  26.148 88.141  1.00 23.95 ? 236  SER A CA  1 
ATOM   1510 C C   . SER A 1 235 ? 13.027  25.830 86.925  1.00 23.52 ? 236  SER A C   1 
ATOM   1511 O O   . SER A 1 235 ? 13.611  26.744 86.315  1.00 24.32 ? 236  SER A O   1 
ATOM   1512 C CB  . SER A 1 235 ? 10.824  26.734 87.686  1.00 22.64 ? 236  SER A CB  1 
ATOM   1513 O OG  . SER A 1 235 ? 10.174  25.849 86.800  1.00 22.91 ? 236  SER A OG  1 
ATOM   1514 N N   . GLN A 1 236 ? 13.113  24.550 86.573  1.00 21.22 ? 237  GLN A N   1 
ATOM   1515 C CA  . GLN A 1 236 ? 13.815  24.127 85.366  1.00 20.33 ? 237  GLN A CA  1 
ATOM   1516 C C   . GLN A 1 236 ? 13.316  24.901 84.148  1.00 23.81 ? 237  GLN A C   1 
ATOM   1517 O O   . GLN A 1 236 ? 14.093  25.285 83.294  1.00 21.03 ? 237  GLN A O   1 
ATOM   1518 C CB  . GLN A 1 236 ? 13.611  22.634 85.114  1.00 23.46 ? 237  GLN A CB  1 
ATOM   1519 C CG  . GLN A 1 236 ? 14.099  21.709 86.214  1.00 21.58 ? 237  GLN A CG  1 
ATOM   1520 C CD  . GLN A 1 236 ? 15.575  21.377 86.092  1.00 27.12 ? 237  GLN A CD  1 
ATOM   1521 O OE1 . GLN A 1 236 ? 16.435  22.274 86.033  1.00 24.36 ? 237  GLN A OE1 1 
ATOM   1522 N NE2 . GLN A 1 236 ? 15.882  20.079 86.041  1.00 24.28 ? 237  GLN A NE2 1 
ATOM   1523 N N   . THR A 1 237 ? 12.014  25.161 84.084  1.00 21.02 ? 238  THR A N   1 
ATOM   1524 C CA  . THR A 1 237 ? 11.446  25.712 82.875  1.00 19.75 ? 238  THR A CA  1 
ATOM   1525 C C   . THR A 1 237 ? 11.283  27.242 82.929  1.00 22.61 ? 238  THR A C   1 
ATOM   1526 O O   . THR A 1 237 ? 10.569  27.820 82.115  1.00 22.13 ? 238  THR A O   1 
ATOM   1527 C CB  . THR A 1 237 ? 10.120  25.011 82.528  1.00 23.92 ? 238  THR A CB  1 
ATOM   1528 O OG1 . THR A 1 237 ? 9.232   25.119 83.638  1.00 21.14 ? 238  THR A OG1 1 
ATOM   1529 C CG2 . THR A 1 237 ? 10.364  23.542 82.267  1.00 21.20 ? 238  THR A CG2 1 
ATOM   1530 N N   . ALA A 1 238 ? 11.976  27.891 83.865  1.00 18.56 ? 239  ALA A N   1 
ATOM   1531 C CA  . ALA A 1 238 ? 12.180  29.342 83.791  1.00 18.09 ? 239  ALA A CA  1 
ATOM   1532 C C   . ALA A 1 238 ? 13.648  29.678 83.995  1.00 24.74 ? 239  ALA A C   1 
ATOM   1533 O O   . ALA A 1 238 ? 13.989  30.790 84.408  1.00 24.94 ? 239  ALA A O   1 
ATOM   1534 C CB  . ALA A 1 238 ? 11.337  30.063 84.814  1.00 17.69 ? 239  ALA A CB  1 
ATOM   1535 N N   . ALA A 1 239 ? 14.516  28.712 83.709  1.00 20.96 ? 240  ALA A N   1 
ATOM   1536 C CA  . ALA A 1 239 ? 15.943  28.893 83.937  1.00 27.01 ? 240  ALA A CA  1 
ATOM   1537 C C   . ALA A 1 239 ? 16.514  30.099 83.188  1.00 23.50 ? 240  ALA A C   1 
ATOM   1538 O O   . ALA A 1 239 ? 17.282  30.871 83.744  1.00 26.89 ? 240  ALA A O   1 
ATOM   1539 C CB  . ALA A 1 239 ? 16.727  27.603 83.582  1.00 21.77 ? 240  ALA A CB  1 
ATOM   1540 N N   . LEU A 1 240 ? 16.130  30.265 81.931  1.00 20.54 ? 241  LEU A N   1 
ATOM   1541 C CA  . LEU A 1 240 ? 16.694  31.341 81.115  1.00 24.49 ? 241  LEU A CA  1 
ATOM   1542 C C   . LEU A 1 240 ? 16.385  32.730 81.677  1.00 25.80 ? 241  LEU A C   1 
ATOM   1543 O O   . LEU A 1 240 ? 17.297  33.542 81.852  1.00 28.52 ? 241  LEU A O   1 
ATOM   1544 C CB  . LEU A 1 240 ? 16.198  31.236 79.677  1.00 28.02 ? 241  LEU A CB  1 
ATOM   1545 C CG  . LEU A 1 240 ? 16.734  32.296 78.723  1.00 32.71 ? 241  LEU A CG  1 
ATOM   1546 C CD1 . LEU A 1 240 ? 18.233  32.169 78.590  1.00 35.61 ? 241  LEU A CD1 1 
ATOM   1547 C CD2 . LEU A 1 240 ? 16.059  32.168 77.364  1.00 35.98 ? 241  LEU A CD2 1 
ATOM   1548 N N   . SER A 1 241 ? 15.112  33.012 81.957  1.00 19.32 ? 242  SER A N   1 
ATOM   1549 C CA  . SER A 1 241 ? 14.746  34.324 82.485  1.00 22.71 ? 242  SER A CA  1 
ATOM   1550 C C   . SER A 1 241 ? 15.291  34.506 83.898  1.00 21.65 ? 242  SER A C   1 
ATOM   1551 O O   . SER A 1 241 ? 15.720  35.598 84.271  1.00 23.19 ? 242  SER A O   1 
ATOM   1552 C CB  . SER A 1 241 ? 13.226  34.503 82.507  1.00 18.00 ? 242  SER A CB  1 
ATOM   1553 O OG  . SER A 1 241 ? 12.666  33.779 83.589  1.00 19.16 ? 242  SER A OG  1 
ATOM   1554 N N   . ASN A 1 242 ? 15.269  33.429 84.680  1.00 18.21 ? 243  ASN A N   1 
ATOM   1555 C CA  . ASN A 1 242 ? 15.751  33.488 86.044  1.00 21.90 ? 243  ASN A CA  1 
ATOM   1556 C C   . ASN A 1 242 ? 17.265  33.723 86.078  1.00 21.68 ? 243  ASN A C   1 
ATOM   1557 O O   . ASN A 1 242 ? 17.773  34.467 86.914  1.00 23.17 ? 243  ASN A O   1 
ATOM   1558 C CB  . ASN A 1 242 ? 15.353  32.223 86.816  1.00 21.13 ? 243  ASN A CB  1 
ATOM   1559 C CG  . ASN A 1 242 ? 13.860  32.205 87.208  1.00 17.09 ? 243  ASN A CG  1 
ATOM   1560 O OD1 . ASN A 1 242 ? 13.482  31.627 88.232  1.00 19.82 ? 243  ASN A OD1 1 
ATOM   1561 N ND2 . ASN A 1 242 ? 13.017  32.844 86.398  1.00 17.61 ? 243  ASN A ND2 1 
ATOM   1562 N N   . TYR A 1 243 ? 17.984  33.110 85.156  1.00 18.77 ? 244  TYR A N   1 
ATOM   1563 C CA  . TYR A 1 243 ? 19.427  33.330 85.095  1.00 23.75 ? 244  TYR A CA  1 
ATOM   1564 C C   . TYR A 1 243 ? 19.754  34.788 84.764  1.00 27.97 ? 244  TYR A C   1 
ATOM   1565 O O   . TYR A 1 243 ? 20.629  35.399 85.374  1.00 23.52 ? 244  TYR A O   1 
ATOM   1566 C CB  . TYR A 1 243 ? 20.090  32.421 84.071  1.00 20.59 ? 244  TYR A CB  1 
ATOM   1567 C CG  . TYR A 1 243 ? 21.566  32.719 83.906  1.00 21.42 ? 244  TYR A CG  1 
ATOM   1568 C CD1 . TYR A 1 243 ? 22.418  32.697 84.996  1.00 21.30 ? 244  TYR A CD1 1 
ATOM   1569 C CD2 . TYR A 1 243 ? 22.098  33.014 82.660  1.00 23.45 ? 244  TYR A CD2 1 
ATOM   1570 C CE1 . TYR A 1 243 ? 23.750  32.966 84.862  1.00 22.10 ? 244  TYR A CE1 1 
ATOM   1571 C CE2 . TYR A 1 243 ? 23.447  33.289 82.502  1.00 24.47 ? 244  TYR A CE2 1 
ATOM   1572 C CZ  . TYR A 1 243 ? 24.261  33.251 83.609  1.00 28.66 ? 244  TYR A CZ  1 
ATOM   1573 O OH  . TYR A 1 243 ? 25.587  33.515 83.465  1.00 29.60 ? 244  TYR A OH  1 
ATOM   1574 N N   . LEU A 1 244 ? 19.034  35.327 83.790  1.00 23.18 ? 245  LEU A N   1 
ATOM   1575 C CA  . LEU A 1 244 ? 19.165  36.723 83.415  1.00 24.85 ? 245  LEU A CA  1 
ATOM   1576 C C   . LEU A 1 244 ? 18.926  37.604 84.641  1.00 20.08 ? 245  LEU A C   1 
ATOM   1577 O O   . LEU A 1 244 ? 19.705  38.496 84.920  1.00 21.68 ? 245  LEU A O   1 
ATOM   1578 C CB  . LEU A 1 244 ? 18.152  37.052 82.330  1.00 31.03 ? 245  LEU A CB  1 
ATOM   1579 C CG  . LEU A 1 244 ? 18.594  38.022 81.244  1.00 46.65 ? 245  LEU A CG  1 
ATOM   1580 C CD1 . LEU A 1 244 ? 18.504  37.321 79.897  1.00 53.42 ? 245  LEU A CD1 1 
ATOM   1581 C CD2 . LEU A 1 244 ? 17.722  39.271 81.270  1.00 44.48 ? 245  LEU A CD2 1 
ATOM   1582 N N   . LEU A 1 245 ? 17.874  37.315 85.397  1.00 17.95 ? 246  LEU A N   1 
ATOM   1583 C CA  . LEU A 1 245 ? 17.619  38.041 86.630  1.00 17.25 ? 246  LEU A CA  1 
ATOM   1584 C C   . LEU A 1 245 ? 18.844  37.993 87.553  1.00 23.81 ? 246  LEU A C   1 
ATOM   1585 O O   . LEU A 1 245 ? 19.272  39.024 88.067  1.00 21.74 ? 246  LEU A O   1 
ATOM   1586 C CB  . LEU A 1 245 ? 16.392  37.488 87.342  1.00 16.53 ? 246  LEU A CB  1 
ATOM   1587 C CG  . LEU A 1 245 ? 16.139  37.944 88.781  1.00 21.28 ? 246  LEU A CG  1 
ATOM   1588 C CD1 . LEU A 1 245 ? 16.014  39.497 88.903  1.00 23.14 ? 246  LEU A CD1 1 
ATOM   1589 C CD2 . LEU A 1 245 ? 14.914  37.227 89.364  1.00 17.53 ? 246  LEU A CD2 1 
ATOM   1590 N N   . MET A 1 246 ? 19.415  36.802 87.726  1.00 22.71 ? 247  MET A N   1 
ATOM   1591 C CA  . MET A 1 246 ? 20.602  36.624 88.549  1.00 21.54 ? 247  MET A CA  1 
ATOM   1592 C C   . MET A 1 246 ? 21.767  37.477 88.044  1.00 24.42 ? 247  MET A C   1 
ATOM   1593 O O   . MET A 1 246 ? 22.397  38.174 88.820  1.00 24.65 ? 247  MET A O   1 
ATOM   1594 C CB  . MET A 1 246 ? 21.040  35.160 88.582  1.00 21.42 ? 247  MET A CB  1 
ATOM   1595 C CG  . MET A 1 246 ? 22.214  34.917 89.535  1.00 18.67 ? 247  MET A CG  1 
ATOM   1596 S SD  . MET A 1 246 ? 21.669  35.149 91.256  1.00 23.73 ? 247  MET A SD  1 
ATOM   1597 C CE  . MET A 1 246 ? 23.243  35.363 92.068  1.00 25.91 ? 247  MET A CE  1 
ATOM   1598 N N   . THR A 1 247 ? 22.042  37.435 86.746  1.00 19.25 ? 248  THR A N   1 
ATOM   1599 C CA  . THR A 1 247 ? 23.161  38.189 86.214  1.00 26.94 ? 248  THR A CA  1 
ATOM   1600 C C   . THR A 1 247 ? 22.924  39.698 86.330  1.00 28.40 ? 248  THR A C   1 
ATOM   1601 O O   . THR A 1 247 ? 23.875  40.462 86.463  1.00 22.92 ? 248  THR A O   1 
ATOM   1602 C CB  . THR A 1 247 ? 23.440  37.862 84.745  1.00 32.92 ? 248  THR A CB  1 
ATOM   1603 O OG1 . THR A 1 247 ? 22.335  38.299 83.950  1.00 43.57 ? 248  THR A OG1 1 
ATOM   1604 C CG2 . THR A 1 247 ? 23.635  36.393 84.556  1.00 30.11 ? 248  THR A CG2 1 
ATOM   1605 N N   . VAL A 1 248 ? 21.666  40.128 86.269  1.00 25.98 ? 249  VAL A N   1 
ATOM   1606 C CA  . VAL A 1 248 ? 21.360  41.546 86.418  1.00 25.41 ? 249  VAL A CA  1 
ATOM   1607 C C   . VAL A 1 248 ? 21.601  41.990 87.860  1.00 24.10 ? 249  VAL A C   1 
ATOM   1608 O O   . VAL A 1 248 ? 22.176  43.057 88.104  1.00 20.51 ? 249  VAL A O   1 
ATOM   1609 C CB  . VAL A 1 248 ? 19.914  41.871 85.977  1.00 27.65 ? 249  VAL A CB  1 
ATOM   1610 C CG1 . VAL A 1 248 ? 19.510  43.268 86.438  1.00 21.58 ? 249  VAL A CG1 1 
ATOM   1611 C CG2 . VAL A 1 248 ? 19.773  41.722 84.450  1.00 24.45 ? 249  VAL A CG2 1 
ATOM   1612 N N   . LEU A 1 249 ? 21.173  41.162 88.813  1.00 19.54 ? 250  LEU A N   1 
ATOM   1613 C CA  . LEU A 1 249 ? 21.472  41.411 90.222  1.00 20.65 ? 250  LEU A CA  1 
ATOM   1614 C C   . LEU A 1 249 ? 22.968  41.560 90.493  1.00 24.31 ? 250  LEU A C   1 
ATOM   1615 O O   . LEU A 1 249 ? 23.381  42.441 91.245  1.00 26.60 ? 250  LEU A O   1 
ATOM   1616 C CB  . LEU A 1 249 ? 20.899  40.296 91.089  1.00 18.92 ? 250  LEU A CB  1 
ATOM   1617 C CG  . LEU A 1 249 ? 19.395  40.341 91.308  1.00 21.88 ? 250  LEU A CG  1 
ATOM   1618 C CD1 . LEU A 1 249 ? 18.922  39.018 91.956  1.00 23.19 ? 250  LEU A CD1 1 
ATOM   1619 C CD2 . LEU A 1 249 ? 19.005  41.538 92.176  1.00 19.85 ? 250  LEU A CD2 1 
ATOM   1620 N N   . GLU A 1 250 ? 23.784  40.710 89.873  1.00 29.09 ? 251  GLU A N   1 
ATOM   1621 C CA  . GLU A 1 250 ? 25.249  40.825 89.997  1.00 30.99 ? 251  GLU A CA  1 
ATOM   1622 C C   . GLU A 1 250 ? 25.783  42.124 89.412  1.00 31.08 ? 251  GLU A C   1 
ATOM   1623 O O   . GLU A 1 250 ? 26.579  42.822 90.041  1.00 32.06 ? 251  GLU A O   1 
ATOM   1624 C CB  . GLU A 1 250 ? 25.933  39.664 89.291  1.00 29.10 ? 251  GLU A CB  1 
ATOM   1625 C CG  . GLU A 1 250 ? 25.686  38.333 89.938  1.00 40.59 ? 251  GLU A CG  1 
ATOM   1626 C CD  . GLU A 1 250 ? 26.473  37.240 89.265  1.00 58.35 ? 251  GLU A CD  1 
ATOM   1627 O OE1 . GLU A 1 250 ? 26.246  37.006 88.057  1.00 66.37 ? 251  GLU A OE1 1 
ATOM   1628 O OE2 . GLU A 1 250 ? 27.338  36.635 89.934  1.00 66.04 ? 251  GLU A OE2 1 
ATOM   1629 N N   . GLU A 1 251 ? 25.354  42.437 88.194  1.00 26.93 ? 252  GLU A N   1 
ATOM   1630 C CA  . GLU A 1 251 ? 25.736  43.692 87.573  1.00 26.60 ? 252  GLU A CA  1 
ATOM   1631 C C   . GLU A 1 251 ? 25.321  44.892 88.444  1.00 26.52 ? 252  GLU A C   1 
ATOM   1632 O O   . GLU A 1 251 ? 26.049  45.864 88.544  1.00 30.26 ? 252  GLU A O   1 
ATOM   1633 C CB  . GLU A 1 251 ? 25.141  43.823 86.164  1.00 25.96 ? 252  GLU A CB  1 
ATOM   1634 C CG  . GLU A 1 251 ? 25.472  45.178 85.528  1.00 33.68 ? 252  GLU A CG  1 
ATOM   1635 C CD  . GLU A 1 251 ? 25.038  45.291 84.085  1.00 34.21 ? 252  GLU A CD  1 
ATOM   1636 O OE1 . GLU A 1 251 ? 25.000  44.268 83.386  1.00 34.98 ? 252  GLU A OE1 1 
ATOM   1637 O OE2 . GLU A 1 251 ? 24.739  46.409 83.645  1.00 38.60 ? 252  GLU A OE2 1 
ATOM   1638 N N   . ALA A 1 252 ? 24.160  44.804 89.083  1.00 26.62 ? 253  ALA A N   1 
ATOM   1639 C CA  . ALA A 1 252 ? 23.686  45.870 89.954  1.00 24.01 ? 253  ALA A CA  1 
ATOM   1640 C C   . ALA A 1 252 ? 24.473  45.916 91.266  1.00 30.10 ? 253  ALA A C   1 
ATOM   1641 O O   . ALA A 1 252 ? 24.201  46.756 92.124  1.00 26.29 ? 253  ALA A O   1 
ATOM   1642 C CB  . ALA A 1 252 ? 22.188  45.706 90.234  1.00 22.33 ? 253  ALA A CB  1 
ATOM   1643 N N   . GLY A 1 253 ? 25.423  44.998 91.435  1.00 28.07 ? 254  GLY A N   1 
ATOM   1644 C CA  . GLY A 1 253 ? 26.288  45.020 92.598  1.00 26.99 ? 254  GLY A CA  1 
ATOM   1645 C C   . GLY A 1 253 ? 26.002  44.076 93.760  1.00 29.18 ? 254  GLY A C   1 
ATOM   1646 O O   . GLY A 1 253 ? 26.537  44.271 94.851  1.00 28.11 ? 254  GLY A O   1 
ATOM   1647 N N   . LEU A 1 254 ? 25.159  43.066 93.558  1.00 18.69 ? 255  LEU A N   1 
ATOM   1648 C CA  . LEU A 1 254 ? 24.890  42.113 94.637  1.00 24.80 ? 255  LEU A CA  1 
ATOM   1649 C C   . LEU A 1 254 ? 26.203  41.452 95.051  1.00 21.49 ? 255  LEU A C   1 
ATOM   1650 O O   . LEU A 1 254 ? 26.883  40.874 94.219  1.00 24.55 ? 255  LEU A O   1 
ATOM   1651 C CB  . LEU A 1 254 ? 23.913  41.038 94.165  1.00 23.60 ? 255  LEU A CB  1 
ATOM   1652 C CG  . LEU A 1 254 ? 23.491  40.036 95.246  1.00 23.15 ? 255  LEU A CG  1 
ATOM   1653 C CD1 . LEU A 1 254 ? 22.472  40.665 96.183  1.00 20.37 ? 255  LEU A CD1 1 
ATOM   1654 C CD2 . LEU A 1 254 ? 22.945  38.781 94.577  1.00 20.07 ? 255  LEU A CD2 1 
ATOM   1655 N N   . PRO A 1 255 ? 26.572  41.547 96.332  1.00 23.50 ? 256  PRO A N   1 
ATOM   1656 C CA  . PRO A 1 255 ? 27.850  40.932 96.723  1.00 24.22 ? 256  PRO A CA  1 
ATOM   1657 C C   . PRO A 1 255 ? 27.805  39.401 96.640  1.00 24.80 ? 256  PRO A C   1 
ATOM   1658 O O   . PRO A 1 255 ? 26.732  38.802 96.786  1.00 27.95 ? 256  PRO A O   1 
ATOM   1659 C CB  . PRO A 1 255 ? 28.035  41.387 98.186  1.00 28.02 ? 256  PRO A CB  1 
ATOM   1660 C CG  . PRO A 1 255 ? 27.134  42.608 98.340  1.00 26.28 ? 256  PRO A CG  1 
ATOM   1661 C CD  . PRO A 1 255 ? 25.946  42.284 97.445  1.00 25.76 ? 256  PRO A CD  1 
ATOM   1662 N N   . LYS A 1 256 ? 28.961  38.793 96.406  1.00 22.80 ? 257  LYS A N   1 
ATOM   1663 C CA  . LYS A 1 256 ? 29.063  37.354 96.210  1.00 25.66 ? 257  LYS A CA  1 
ATOM   1664 C C   . LYS A 1 256 ? 28.473  36.548 97.372  1.00 24.26 ? 257  LYS A C   1 
ATOM   1665 O O   . LYS A 1 256 ? 28.665  36.885 98.548  1.00 23.80 ? 257  LYS A O   1 
ATOM   1666 C CB  . LYS A 1 256 ? 30.518  36.952 95.950  1.00 29.93 ? 257  LYS A CB  1 
ATOM   1667 C CG  . LYS A 1 256 ? 31.490  37.300 97.072  1.00 36.50 ? 257  LYS A CG  1 
ATOM   1668 C CD  . LYS A 1 256 ? 32.930  37.046 96.625  1.00 40.07 ? 257  LYS A CD  1 
ATOM   1669 C CE  . LYS A 1 256 ? 33.890  36.950 97.806  1.00 40.11 ? 257  LYS A CE  1 
ATOM   1670 N N   . GLY A 1 257 ? 27.727  35.503 97.026  1.00 21.84 ? 258  GLY A N   1 
ATOM   1671 C CA  . GLY A 1 257 ? 27.188  34.579 98.015  1.00 21.68 ? 258  GLY A CA  1 
ATOM   1672 C C   . GLY A 1 257 ? 25.913  35.033 98.711  1.00 19.67 ? 258  GLY A C   1 
ATOM   1673 O O   . GLY A 1 257 ? 25.363  34.308 99.517  1.00 23.60 ? 258  GLY A O   1 
ATOM   1674 N N   . VAL A 1 258 ? 25.445  36.239 98.425  1.00 19.12 ? 259  VAL A N   1 
ATOM   1675 C CA  . VAL A 1 258 ? 24.224  36.708 99.072  1.00 19.02 ? 259  VAL A CA  1 
ATOM   1676 C C   . VAL A 1 258 ? 23.023  35.951 98.516  1.00 25.26 ? 259  VAL A C   1 
ATOM   1677 O O   . VAL A 1 258 ? 22.116  35.576 99.247  1.00 23.44 ? 259  VAL A O   1 
ATOM   1678 C CB  . VAL A 1 258 ? 24.043  38.207 98.888  1.00 20.17 ? 259  VAL A CB  1 
ATOM   1679 C CG1 . VAL A 1 258 ? 22.664  38.641 99.377  1.00 20.37 ? 259  VAL A CG1 1 
ATOM   1680 C CG2 . VAL A 1 258 ? 25.170  38.949 99.628  1.00 18.74 ? 259  VAL A CG2 1 
ATOM   1681 N N   . ILE A 1 259 ? 23.034  35.720 97.211  1.00 21.14 ? 260  ILE A N   1 
ATOM   1682 C CA  . ILE A 1 259 ? 22.027  34.890 96.583  1.00 17.59 ? 260  ILE A CA  1 
ATOM   1683 C C   . ILE A 1 259 ? 22.794  33.914 95.718  1.00 24.38 ? 260  ILE A C   1 
ATOM   1684 O O   . ILE A 1 259 ? 23.697  34.319 94.988  1.00 23.69 ? 260  ILE A O   1 
ATOM   1685 C CB  . ILE A 1 259 ? 21.054  35.701 95.714  1.00 17.25 ? 260  ILE A CB  1 
ATOM   1686 C CG1 . ILE A 1 259 ? 20.185  36.611 96.589  1.00 16.50 ? 260  ILE A CG1 1 
ATOM   1687 C CG2 . ILE A 1 259 ? 20.158  34.749 94.912  1.00 18.01 ? 260  ILE A CG2 1 
ATOM   1688 C CD1 . ILE A 1 259 ? 19.382  37.634 95.774  1.00 16.07 ? 260  ILE A CD1 1 
ATOM   1689 N N   . ASN A 1 260 ? 22.470  32.630 95.835  1.00 18.40 ? 261  ASN A N   1 
ATOM   1690 C CA  . ASN A 1 260 ? 23.155  31.614 95.066  1.00 19.12 ? 261  ASN A CA  1 
ATOM   1691 C C   . ASN A 1 260 ? 22.180  30.875 94.158  1.00 25.05 ? 261  ASN A C   1 
ATOM   1692 O O   . ASN A 1 260 ? 21.154  30.368 94.602  1.00 26.30 ? 261  ASN A O   1 
ATOM   1693 C CB  . ASN A 1 260 ? 23.929  30.672 96.000  1.00 19.89 ? 261  ASN A CB  1 
ATOM   1694 C CG  . ASN A 1 260 ? 24.913  31.427 96.884  1.00 26.83 ? 261  ASN A CG  1 
ATOM   1695 O OD1 . ASN A 1 260 ? 26.071  31.608 96.516  1.00 27.84 ? 261  ASN A OD1 1 
ATOM   1696 N ND2 . ASN A 1 260 ? 24.438  31.917 98.032  1.00 19.76 ? 261  ASN A ND2 1 
ATOM   1697 N N   . PHE A 1 261 ? 22.524  30.828 92.880  1.00 24.79 ? 262  PHE A N   1 
ATOM   1698 C CA  . PHE A 1 261 ? 21.658  30.320 91.826  1.00 21.44 ? 262  PHE A CA  1 
ATOM   1699 C C   . PHE A 1 261 ? 22.035  28.877 91.590  1.00 24.20 ? 262  PHE A C   1 
ATOM   1700 O O   . PHE A 1 261 ? 23.077  28.606 90.989  1.00 21.30 ? 262  PHE A O   1 
ATOM   1701 C CB  . PHE A 1 261 ? 21.939  31.130 90.569  1.00 23.66 ? 262  PHE A CB  1 
ATOM   1702 C CG  . PHE A 1 261 ? 21.057  30.817 89.388  1.00 19.31 ? 262  PHE A CG  1 
ATOM   1703 C CD1 . PHE A 1 261 ? 19.726  31.207 89.372  1.00 23.95 ? 262  PHE A CD1 1 
ATOM   1704 C CD2 . PHE A 1 261 ? 21.592  30.216 88.259  1.00 20.22 ? 262  PHE A CD2 1 
ATOM   1705 C CE1 . PHE A 1 261 ? 18.934  30.973 88.269  1.00 24.01 ? 262  PHE A CE1 1 
ATOM   1706 C CE2 . PHE A 1 261 ? 20.810  29.975 87.145  1.00 23.19 ? 262  PHE A CE2 1 
ATOM   1707 C CZ  . PHE A 1 261 ? 19.474  30.357 87.150  1.00 21.61 ? 262  PHE A CZ  1 
ATOM   1708 N N   . ILE A 1 262 ? 21.208  27.956 92.084  1.00 20.58 ? 263  ILE A N   1 
ATOM   1709 C CA  . ILE A 1 262 ? 21.490  26.526 91.950  1.00 21.44 ? 263  ILE A CA  1 
ATOM   1710 C C   . ILE A 1 262 ? 20.347  25.699 91.324  1.00 23.34 ? 263  ILE A C   1 
ATOM   1711 O O   . ILE A 1 262 ? 19.708  24.889 91.993  1.00 23.30 ? 263  ILE A O   1 
ATOM   1712 C CB  . ILE A 1 262 ? 21.927  25.887 93.298  1.00 26.80 ? 263  ILE A CB  1 
ATOM   1713 C CG1 . ILE A 1 262 ? 20.963  26.260 94.425  1.00 22.81 ? 263  ILE A CG1 1 
ATOM   1714 C CG2 . ILE A 1 262 ? 23.295  26.363 93.684  1.00 30.09 ? 263  ILE A CG2 1 
ATOM   1715 C CD1 . ILE A 1 262 ? 21.098  25.377 95.624  1.00 20.97 ? 263  ILE A CD1 1 
ATOM   1716 N N   . PRO A 1 263 ? 20.113  25.884 90.023  1.00 23.32 ? 264  PRO A N   1 
ATOM   1717 C CA  . PRO A 1 263 ? 19.206  24.970 89.328  1.00 23.57 ? 264  PRO A CA  1 
ATOM   1718 C C   . PRO A 1 263 ? 19.729  23.537 89.436  1.00 25.51 ? 264  PRO A C   1 
ATOM   1719 O O   . PRO A 1 263 ? 20.935  23.300 89.561  1.00 23.12 ? 264  PRO A O   1 
ATOM   1720 C CB  . PRO A 1 263 ? 19.293  25.438 87.880  1.00 21.37 ? 264  PRO A CB  1 
ATOM   1721 C CG  . PRO A 1 263 ? 20.676  26.023 87.780  1.00 21.88 ? 264  PRO A CG  1 
ATOM   1722 C CD  . PRO A 1 263 ? 20.872  26.725 89.086  1.00 21.79 ? 264  PRO A CD  1 
ATOM   1723 N N   . GLY A 1 264 ? 18.820  22.579 89.409  1.00 25.89 ? 265  GLY A N   1 
ATOM   1724 C CA  . GLY A 1 264 ? 19.227  21.189 89.428  1.00 28.42 ? 265  GLY A CA  1 
ATOM   1725 C C   . GLY A 1 264 ? 18.009  20.353 89.721  1.00 25.84 ? 265  GLY A C   1 
ATOM   1726 O O   . GLY A 1 264 ? 16.893  20.881 89.737  1.00 24.38 ? 265  GLY A O   1 
ATOM   1727 N N   . ASP A 1 265 ? 18.223  19.064 89.959  1.00 24.53 ? 266  ASP A N   1 
ATOM   1728 C CA  . ASP A 1 265 ? 17.127  18.151 90.233  1.00 24.58 ? 266  ASP A CA  1 
ATOM   1729 C C   . ASP A 1 265 ? 16.400  18.591 91.503  1.00 26.82 ? 266  ASP A C   1 
ATOM   1730 O O   . ASP A 1 265 ? 17.026  18.756 92.555  1.00 24.65 ? 266  ASP A O   1 
ATOM   1731 C CB  . ASP A 1 265 ? 17.637  16.718 90.376  1.00 37.14 ? 266  ASP A CB  1 
ATOM   1732 C CG  . ASP A 1 265 ? 16.522  15.759 90.712  1.00 38.51 ? 266  ASP A CG  1 
ATOM   1733 O OD1 . ASP A 1 265 ? 15.740  15.429 89.803  1.00 41.47 ? 266  ASP A OD1 1 
ATOM   1734 O OD2 . ASP A 1 265 ? 16.388  15.392 91.891  1.00 36.98 ? 266  ASP A OD2 1 
ATOM   1735 N N   . PRO A 1 266 ? 15.076  18.806 91.407  1.00 28.28 ? 267  PRO A N   1 
ATOM   1736 C CA  . PRO A 1 266 ? 14.369  19.476 92.507  1.00 31.70 ? 267  PRO A CA  1 
ATOM   1737 C C   . PRO A 1 266 ? 14.458  18.697 93.819  1.00 31.62 ? 267  PRO A C   1 
ATOM   1738 O O   . PRO A 1 266 ? 14.661  19.305 94.868  1.00 30.93 ? 267  PRO A O   1 
ATOM   1739 C CB  . PRO A 1 266 ? 12.914  19.554 92.010  1.00 25.57 ? 267  PRO A CB  1 
ATOM   1740 C CG  . PRO A 1 266 ? 12.986  19.340 90.546  1.00 27.45 ? 267  PRO A CG  1 
ATOM   1741 C CD  . PRO A 1 266 ? 14.169  18.446 90.306  1.00 22.73 ? 267  PRO A CD  1 
ATOM   1742 N N   . VAL A 1 267 ? 14.326  17.375 93.744  1.00 24.62 ? 268  VAL A N   1 
ATOM   1743 C CA  . VAL A 1 267 ? 14.452  16.488 94.903  1.00 26.92 ? 268  VAL A CA  1 
ATOM   1744 C C   . VAL A 1 267 ? 15.864  16.415 95.483  1.00 30.89 ? 268  VAL A C   1 
ATOM   1745 O O   . VAL A 1 267 ? 16.040  16.554 96.688  1.00 31.70 ? 268  VAL A O   1 
ATOM   1746 C CB  . VAL A 1 267 ? 13.967  15.038 94.580  1.00 35.05 ? 268  VAL A CB  1 
ATOM   1747 C CG1 . VAL A 1 267 ? 14.161  14.126 95.776  1.00 33.32 ? 268  VAL A CG1 1 
ATOM   1748 C CG2 . VAL A 1 267 ? 12.525  15.045 94.192  1.00 30.61 ? 268  VAL A CG2 1 
ATOM   1749 N N   . GLN A 1 268 ? 16.868  16.174 94.639  1.00 25.62 ? 269  GLN A N   1 
ATOM   1750 C CA  . GLN A 1 268 ? 18.236  16.074 95.130  1.00 33.10 ? 269  GLN A CA  1 
ATOM   1751 C C   . GLN A 1 268 ? 18.717  17.378 95.743  1.00 32.41 ? 269  GLN A C   1 
ATOM   1752 O O   . GLN A 1 268 ? 19.325  17.371 96.809  1.00 31.99 ? 269  GLN A O   1 
ATOM   1753 C CB  . GLN A 1 268 ? 19.205  15.656 94.022  1.00 38.56 ? 269  GLN A CB  1 
ATOM   1754 C CG  . GLN A 1 268 ? 18.908  14.305 93.391  1.00 40.03 ? 269  GLN A CG  1 
ATOM   1755 C CD  . GLN A 1 268 ? 19.994  13.897 92.422  1.00 39.93 ? 269  GLN A CD  1 
ATOM   1756 O OE1 . GLN A 1 268 ? 21.181  14.073 92.700  1.00 50.73 ? 269  GLN A OE1 1 
ATOM   1757 N NE2 . GLN A 1 268 ? 19.599  13.362 91.277  1.00 36.03 ? 269  GLN A NE2 1 
ATOM   1758 N N   . VAL A 1 269 ? 18.462  18.490 95.056  1.00 31.96 ? 270  VAL A N   1 
ATOM   1759 C CA  . VAL A 1 269 ? 18.873  19.794 95.562  1.00 29.93 ? 270  VAL A CA  1 
ATOM   1760 C C   . VAL A 1 269 ? 18.176  20.068 96.892  1.00 28.03 ? 270  VAL A C   1 
ATOM   1761 O O   . VAL A 1 269 ? 18.824  20.388 97.881  1.00 28.13 ? 270  VAL A O   1 
ATOM   1762 C CB  . VAL A 1 269 ? 18.629  20.931 94.544  1.00 25.78 ? 270  VAL A CB  1 
ATOM   1763 C CG1 . VAL A 1 269 ? 18.821  22.309 95.201  1.00 21.71 ? 270  VAL A CG1 1 
ATOM   1764 C CG2 . VAL A 1 269 ? 19.578  20.770 93.352  1.00 27.20 ? 270  VAL A CG2 1 
ATOM   1765 N N   . THR A 1 270 ? 16.863  19.890 96.916  1.00 27.80 ? 271  THR A N   1 
ATOM   1766 C CA  . THR A 1 270 ? 16.092  20.113 98.125  1.00 27.68 ? 271  THR A CA  1 
ATOM   1767 C C   . THR A 1 270 ? 16.582  19.258 99.292  1.00 32.18 ? 271  THR A C   1 
ATOM   1768 O O   . THR A 1 270 ? 16.749  19.755 100.407 1.00 32.20 ? 271  THR A O   1 
ATOM   1769 C CB  . THR A 1 270 ? 14.615  19.833 97.888  1.00 24.77 ? 271  THR A CB  1 
ATOM   1770 O OG1 . THR A 1 270 ? 14.068  20.854 97.045  1.00 21.93 ? 271  THR A OG1 1 
ATOM   1771 C CG2 . THR A 1 270 ? 13.862  19.816 99.209  1.00 23.28 ? 271  THR A CG2 1 
ATOM   1772 N N   . ASP A 1 271 ? 16.832  17.977 99.041  1.00 28.51 ? 272  ASP A N   1 
ATOM   1773 C CA  . ASP A 1 271 ? 17.281  17.114 100.120 1.00 29.32 ? 272  ASP A CA  1 
ATOM   1774 C C   . ASP A 1 271 ? 18.624  17.567 100.672 1.00 32.18 ? 272  ASP A C   1 
ATOM   1775 O O   . ASP A 1 271 ? 18.879  17.440 101.867 1.00 37.16 ? 272  ASP A O   1 
ATOM   1776 C CB  . ASP A 1 271 ? 17.361  15.641 99.692  1.00 36.23 ? 272  ASP A CB  1 
ATOM   1777 C CG  . ASP A 1 271 ? 15.986  15.005 99.444  1.00 40.58 ? 272  ASP A CG  1 
ATOM   1778 O OD1 . ASP A 1 271 ? 14.924  15.641 99.683  1.00 40.67 ? 272  ASP A OD1 1 
ATOM   1779 O OD2 . ASP A 1 271 ? 15.974  13.847 98.984  1.00 44.39 ? 272  ASP A OD2 1 
ATOM   1780 N N   . GLN A 1 272 ? 19.498  18.095 99.826  1.00 28.05 ? 273  GLN A N   1 
ATOM   1781 C CA  . GLN A 1 272 ? 20.806  18.486 100.349 1.00 28.85 ? 273  GLN A CA  1 
ATOM   1782 C C   . GLN A 1 272 ? 20.724  19.807 101.114 1.00 28.13 ? 273  GLN A C   1 
ATOM   1783 O O   . GLN A 1 272 ? 21.338  19.963 102.163 1.00 30.50 ? 273  GLN A O   1 
ATOM   1784 C CB  . GLN A 1 272 ? 21.865  18.531 99.249  1.00 29.63 ? 273  GLN A CB  1 
ATOM   1785 C CG  . GLN A 1 272 ? 23.248  18.890 99.757  1.00 35.69 ? 273  GLN A CG  1 
ATOM   1786 C CD  . GLN A 1 272 ? 23.840  17.810 100.647 1.00 44.10 ? 273  GLN A CD  1 
ATOM   1787 O OE1 . GLN A 1 272 ? 23.758  16.623 100.337 1.00 48.19 ? 273  GLN A OE1 1 
ATOM   1788 N NE2 . GLN A 1 272 ? 24.433  18.219 101.763 1.00 45.11 ? 273  GLN A NE2 1 
ATOM   1789 N N   . VAL A 1 273 ? 19.950  20.750 100.590 1.00 29.89 ? 274  VAL A N   1 
ATOM   1790 C CA  . VAL A 1 273 ? 19.729  22.020 101.277 1.00 31.31 ? 274  VAL A CA  1 
ATOM   1791 C C   . VAL A 1 273 ? 19.170  21.776 102.687 1.00 27.52 ? 274  VAL A C   1 
ATOM   1792 O O   . VAL A 1 273 ? 19.668  22.314 103.670 1.00 28.01 ? 274  VAL A O   1 
ATOM   1793 C CB  . VAL A 1 273 ? 18.773  22.932 100.469 1.00 26.38 ? 274  VAL A CB  1 
ATOM   1794 C CG1 . VAL A 1 273 ? 18.456  24.207 101.240 1.00 28.59 ? 274  VAL A CG1 1 
ATOM   1795 C CG2 . VAL A 1 273 ? 19.383  23.277 99.122  1.00 26.60 ? 274  VAL A CG2 1 
ATOM   1796 N N   . LEU A 1 274 ? 18.148  20.938 102.770 1.00 26.50 ? 275  LEU A N   1 
ATOM   1797 C CA  . LEU A 1 274 ? 17.467  20.647 104.034 1.00 33.64 ? 275  LEU A CA  1 
ATOM   1798 C C   . LEU A 1 274 ? 18.314  19.861 105.015 1.00 34.61 ? 275  LEU A C   1 
ATOM   1799 O O   . LEU A 1 274 ? 18.008  19.826 106.199 1.00 38.44 ? 275  LEU A O   1 
ATOM   1800 C CB  . LEU A 1 274 ? 16.165  19.891 103.789 1.00 31.43 ? 275  LEU A CB  1 
ATOM   1801 C CG  . LEU A 1 274 ? 15.150  20.707 103.000 1.00 29.61 ? 275  LEU A CG  1 
ATOM   1802 C CD1 . LEU A 1 274 ? 13.908  19.869 102.750 1.00 23.96 ? 275  LEU A CD1 1 
ATOM   1803 C CD2 . LEU A 1 274 ? 14.823  22.032 103.729 1.00 30.85 ? 275  LEU A CD2 1 
ATOM   1804 N N   . ALA A 1 275 ? 19.376  19.234 104.528 1.00 34.69 ? 276  ALA A N   1 
ATOM   1805 C CA  . ALA A 1 275 ? 20.292  18.518 105.403 1.00 34.54 ? 276  ALA A CA  1 
ATOM   1806 C C   . ALA A 1 275 ? 21.094  19.481 106.280 1.00 39.64 ? 276  ALA A C   1 
ATOM   1807 O O   . ALA A 1 275 ? 21.669  19.069 107.280 1.00 33.73 ? 276  ALA A O   1 
ATOM   1808 C CB  . ALA A 1 275 ? 21.234  17.656 104.586 1.00 36.23 ? 276  ALA A CB  1 
ATOM   1809 N N   . ASP A 1 276 ? 21.140  20.763 105.922 1.00 36.97 ? 277  ASP A N   1 
ATOM   1810 C CA  . ASP A 1 276 ? 22.030  21.670 106.657 1.00 34.94 ? 277  ASP A CA  1 
ATOM   1811 C C   . ASP A 1 276 ? 21.452  22.270 107.945 1.00 31.47 ? 277  ASP A C   1 
ATOM   1812 O O   . ASP A 1 276 ? 20.351  22.820 107.946 1.00 32.99 ? 277  ASP A O   1 
ATOM   1813 C CB  . ASP A 1 276 ? 22.555  22.794 105.765 1.00 34.32 ? 277  ASP A CB  1 
ATOM   1814 C CG  . ASP A 1 276 ? 23.751  23.475 106.376 1.00 38.38 ? 277  ASP A CG  1 
ATOM   1815 O OD1 . ASP A 1 276 ? 23.552  24.463 107.113 1.00 34.63 ? 277  ASP A OD1 1 
ATOM   1816 O OD2 . ASP A 1 276 ? 24.886  22.992 106.146 1.00 37.22 ? 277  ASP A OD2 1 
ATOM   1817 N N   . LYS A 1 277 ? 22.222  22.201 109.026 1.00 32.59 ? 278  LYS A N   1 
ATOM   1818 C CA  . LYS A 1 277 ? 21.748  22.608 110.352 1.00 32.10 ? 278  LYS A CA  1 
ATOM   1819 C C   . LYS A 1 277 ? 21.370  24.096 110.412 1.00 34.68 ? 278  LYS A C   1 
ATOM   1820 O O   . LYS A 1 277 ? 20.588  24.532 111.268 1.00 33.20 ? 278  LYS A O   1 
ATOM   1821 C CB  . LYS A 1 277 ? 22.803  22.274 111.416 1.00 35.46 ? 278  LYS A CB  1 
ATOM   1822 C CG  . LYS A 1 277 ? 24.032  23.189 111.377 1.00 43.71 ? 278  LYS A CG  1 
ATOM   1823 C CD  . LYS A 1 277 ? 25.142  22.704 112.313 1.00 50.29 ? 278  LYS A CD  1 
ATOM   1824 C CE  . LYS A 1 277 ? 26.296  23.707 112.403 1.00 51.12 ? 278  LYS A CE  1 
ATOM   1825 N NZ  . LYS A 1 277 ? 25.890  24.995 113.049 1.00 55.84 ? 278  LYS A NZ  1 
ATOM   1826 N N   . ASP A 1 278 ? 21.918  24.876 109.488 1.00 35.66 ? 279  ASP A N   1 
ATOM   1827 C CA  . ASP A 1 278 ? 21.670  26.304 109.473 1.00 32.69 ? 279  ASP A CA  1 
ATOM   1828 C C   . ASP A 1 278 ? 20.475  26.709 108.612 1.00 28.98 ? 279  ASP A C   1 
ATOM   1829 O O   . ASP A 1 278 ? 20.244  27.888 108.398 1.00 30.47 ? 279  ASP A O   1 
ATOM   1830 C CB  . ASP A 1 278 ? 22.927  27.048 109.030 1.00 36.67 ? 279  ASP A CB  1 
ATOM   1831 C CG  . ASP A 1 278 ? 24.031  26.954 110.052 1.00 43.89 ? 279  ASP A CG  1 
ATOM   1832 O OD1 . ASP A 1 278 ? 23.722  27.086 111.252 1.00 41.12 ? 279  ASP A OD1 1 
ATOM   1833 O OD2 . ASP A 1 278 ? 25.197  26.734 109.661 1.00 50.27 ? 279  ASP A OD2 1 
ATOM   1834 N N   . PHE A 1 279 ? 19.719  25.739 108.121 1.00 28.92 ? 280  PHE A N   1 
ATOM   1835 C CA  . PHE A 1 279 ? 18.511  26.052 107.364 1.00 26.94 ? 280  PHE A CA  1 
ATOM   1836 C C   . PHE A 1 279 ? 17.557  26.891 108.216 1.00 30.33 ? 280  PHE A C   1 
ATOM   1837 O O   . PHE A 1 279 ? 17.154  26.473 109.303 1.00 30.56 ? 280  PHE A O   1 
ATOM   1838 C CB  . PHE A 1 279 ? 17.836  24.757 106.907 1.00 29.51 ? 280  PHE A CB  1 
ATOM   1839 C CG  . PHE A 1 279 ? 16.487  24.962 106.278 1.00 25.97 ? 280  PHE A CG  1 
ATOM   1840 C CD1 . PHE A 1 279 ? 16.364  25.640 105.088 1.00 26.42 ? 280  PHE A CD1 1 
ATOM   1841 C CD2 . PHE A 1 279 ? 15.344  24.448 106.877 1.00 32.04 ? 280  PHE A CD2 1 
ATOM   1842 C CE1 . PHE A 1 279 ? 15.122  25.829 104.508 1.00 20.17 ? 280  PHE A CE1 1 
ATOM   1843 C CE2 . PHE A 1 279 ? 14.101  24.626 106.307 1.00 26.30 ? 280  PHE A CE2 1 
ATOM   1844 C CZ  . PHE A 1 279 ? 13.990  25.328 105.121 1.00 23.21 ? 280  PHE A CZ  1 
ATOM   1845 N N   . GLY A 1 280 ? 17.203  28.075 107.722 1.00 30.16 ? 281  GLY A N   1 
ATOM   1846 C CA  . GLY A 1 280 ? 16.409  29.019 108.490 1.00 27.92 ? 281  GLY A CA  1 
ATOM   1847 C C   . GLY A 1 280 ? 15.013  29.309 107.963 1.00 30.06 ? 281  GLY A C   1 
ATOM   1848 O O   . GLY A 1 280 ? 14.110  29.617 108.738 1.00 31.77 ? 281  GLY A O   1 
ATOM   1849 N N   . ALA A 1 281 ? 14.822  29.219 106.652 1.00 25.43 ? 282  ALA A N   1 
ATOM   1850 C CA  . ALA A 1 281 ? 13.495  29.422 106.089 1.00 25.44 ? 282  ALA A CA  1 
ATOM   1851 C C   . ALA A 1 281 ? 13.340  28.855 104.679 1.00 26.77 ? 282  ALA A C   1 
ATOM   1852 O O   . ALA A 1 281 ? 14.286  28.858 103.872 1.00 24.99 ? 282  ALA A O   1 
ATOM   1853 C CB  . ALA A 1 281 ? 13.134  30.913 106.089 1.00 18.45 ? 282  ALA A CB  1 
ATOM   1854 N N   . LEU A 1 282 ? 12.133  28.380 104.394 1.00 26.01 ? 283  LEU A N   1 
ATOM   1855 C CA  . LEU A 1 282 ? 11.734  28.055 103.040 1.00 23.50 ? 283  LEU A CA  1 
ATOM   1856 C C   . LEU A 1 282 ? 10.886  29.188 102.519 1.00 25.50 ? 283  LEU A C   1 
ATOM   1857 O O   . LEU A 1 282 ? 9.908   29.578 103.160 1.00 24.86 ? 283  LEU A O   1 
ATOM   1858 C CB  . LEU A 1 282 ? 10.903  26.771 103.002 1.00 19.57 ? 283  LEU A CB  1 
ATOM   1859 C CG  . LEU A 1 282 ? 10.360  26.413 101.602 1.00 23.34 ? 283  LEU A CG  1 
ATOM   1860 C CD1 . LEU A 1 282 ? 11.496  26.009 100.624 1.00 17.48 ? 283  LEU A CD1 1 
ATOM   1861 C CD2 . LEU A 1 282 ? 9.292   25.303 101.672 1.00 21.74 ? 283  LEU A CD2 1 
ATOM   1862 N N   . HIS A 1 283 ? 11.253  29.732 101.365 1.00 19.69 ? 284  HIS A N   1 
ATOM   1863 C CA  . HIS A 1 283 ? 10.385  30.684 100.698 1.00 18.75 ? 284  HIS A CA  1 
ATOM   1864 C C   . HIS A 1 283 ? 9.939   30.041 99.377  1.00 19.46 ? 284  HIS A C   1 
ATOM   1865 O O   . HIS A 1 283 ? 10.727  29.893 98.447  1.00 18.60 ? 284  HIS A O   1 
ATOM   1866 C CB  . HIS A 1 283 ? 11.099  32.027 100.478 1.00 19.99 ? 284  HIS A CB  1 
ATOM   1867 C CG  . HIS A 1 283 ? 10.156  33.180 100.296 1.00 19.28 ? 284  HIS A CG  1 
ATOM   1868 N ND1 . HIS A 1 283 ? 10.555  34.404 99.811  1.00 18.00 ? 284  HIS A ND1 1 
ATOM   1869 C CD2 . HIS A 1 283 ? 8.823   33.285 100.525 1.00 23.06 ? 284  HIS A CD2 1 
ATOM   1870 C CE1 . HIS A 1 283 ? 9.511   35.218 99.752  1.00 20.58 ? 284  HIS A CE1 1 
ATOM   1871 N NE2 . HIS A 1 283 ? 8.445   34.560 100.172 1.00 21.08 ? 284  HIS A NE2 1 
ATOM   1872 N N   . PHE A 1 284 ? 8.679   29.636 99.310  1.00 21.62 ? 285  PHE A N   1 
ATOM   1873 C CA  . PHE A 1 284 ? 8.202   28.791 98.228  1.00 20.23 ? 285  PHE A CA  1 
ATOM   1874 C C   . PHE A 1 284 ? 6.948   29.340 97.558  1.00 27.36 ? 285  PHE A C   1 
ATOM   1875 O O   . PHE A 1 284 ? 6.060   29.860 98.217  1.00 29.36 ? 285  PHE A O   1 
ATOM   1876 C CB  . PHE A 1 284 ? 7.890   27.404 98.775  1.00 18.12 ? 285  PHE A CB  1 
ATOM   1877 C CG  . PHE A 1 284 ? 7.183   26.492 97.785  1.00 23.59 ? 285  PHE A CG  1 
ATOM   1878 C CD1 . PHE A 1 284 ? 5.788   26.422 97.750  1.00 21.91 ? 285  PHE A CD1 1 
ATOM   1879 C CD2 . PHE A 1 284 ? 7.922   25.680 96.912  1.00 23.78 ? 285  PHE A CD2 1 
ATOM   1880 C CE1 . PHE A 1 284 ? 5.139   25.557 96.852  1.00 28.48 ? 285  PHE A CE1 1 
ATOM   1881 C CE2 . PHE A 1 284 ? 7.293   24.811 96.017  1.00 23.82 ? 285  PHE A CE2 1 
ATOM   1882 C CZ  . PHE A 1 284 ? 5.888   24.749 95.988  1.00 25.65 ? 285  PHE A CZ  1 
ATOM   1883 N N   . THR A 1 285 ? 6.883   29.201 96.240  1.00 27.30 ? 286  THR A N   1 
ATOM   1884 C CA  . THR A 1 285 ? 5.642   29.411 95.511  1.00 26.20 ? 286  THR A CA  1 
ATOM   1885 C C   . THR A 1 285 ? 5.539   28.322 94.466  1.00 28.10 ? 286  THR A C   1 
ATOM   1886 O O   . THR A 1 285 ? 6.495   28.067 93.725  1.00 26.39 ? 286  THR A O   1 
ATOM   1887 C CB  . THR A 1 285 ? 5.576   30.779 94.823  1.00 24.02 ? 286  THR A CB  1 
ATOM   1888 O OG1 . THR A 1 285 ? 5.650   31.803 95.813  1.00 28.48 ? 286  THR A OG1 1 
ATOM   1889 C CG2 . THR A 1 285 ? 4.261   30.930 94.057  1.00 24.91 ? 286  THR A CG2 1 
ATOM   1890 N N   . GLY A 1 286 ? 4.383   27.667 94.423  1.00 25.23 ? 287  GLY A N   1 
ATOM   1891 C CA  . GLY A 1 286 ? 4.169   26.579 93.497  1.00 26.40 ? 287  GLY A CA  1 
ATOM   1892 C C   . GLY A 1 286 ? 3.000   25.731 93.940  1.00 28.70 ? 287  GLY A C   1 
ATOM   1893 O O   . GLY A 1 286 ? 2.092   26.232 94.600  1.00 28.18 ? 287  GLY A O   1 
ATOM   1894 N N   . SER A 1 287 ? 3.043   24.447 93.606  1.00 27.94 ? 288  SER A N   1 
ATOM   1895 C CA  . SER A 1 287 ? 1.902   23.568 93.815  1.00 34.41 ? 288  SER A CA  1 
ATOM   1896 C C   . SER A 1 287 ? 1.747   23.119 95.257  1.00 33.08 ? 288  SER A C   1 
ATOM   1897 O O   . SER A 1 287 ? 2.717   22.997 95.997  1.00 33.38 ? 288  SER A O   1 
ATOM   1898 C CB  . SER A 1 287 ? 1.988   22.332 92.909  1.00 32.58 ? 288  SER A CB  1 
ATOM   1899 O OG  . SER A 1 287 ? 2.884   21.379 93.449  1.00 34.18 ? 288  SER A OG  1 
ATOM   1900 N N   . THR A 1 288 ? 0.503   22.849 95.628  1.00 30.83 ? 289  THR A N   1 
ATOM   1901 C CA  . THR A 1 288 ? 0.160   22.316 96.939  1.00 31.37 ? 289  THR A CA  1 
ATOM   1902 C C   . THR A 1 288 ? 0.887   21.035 97.277  1.00 30.50 ? 289  THR A C   1 
ATOM   1903 O O   . THR A 1 288 ? 1.377   20.862 98.393  1.00 36.16 ? 289  THR A O   1 
ATOM   1904 C CB  . THR A 1 288 ? -1.345  22.062 97.017  1.00 32.35 ? 289  THR A CB  1 
ATOM   1905 O OG1 . THR A 1 288 ? -2.009  23.322 96.879  1.00 33.37 ? 289  THR A OG1 1 
ATOM   1906 C CG2 . THR A 1 288 ? -1.718  21.431 98.351  1.00 31.18 ? 289  THR A CG2 1 
ATOM   1907 N N   . ASN A 1 289 ? 0.954   20.123 96.317  1.00 36.19 ? 290  ASN A N   1 
ATOM   1908 C CA  . ASN A 1 289 ? 1.585   18.835 96.574  1.00 36.14 ? 290  ASN A CA  1 
ATOM   1909 C C   . ASN A 1 289 ? 3.086   18.957 96.816  1.00 35.67 ? 290  ASN A C   1 
ATOM   1910 O O   . ASN A 1 289 ? 3.638   18.306 97.701  1.00 33.09 ? 290  ASN A O   1 
ATOM   1911 C CB  . ASN A 1 289 ? 1.270   17.831 95.457  1.00 44.18 ? 290  ASN A CB  1 
ATOM   1912 C CG  . ASN A 1 289 ? -0.164  17.319 95.530  1.00 53.93 ? 290  ASN A CG  1 
ATOM   1913 O OD1 . ASN A 1 289 ? -0.721  17.149 96.621  1.00 55.05 ? 290  ASN A OD1 1 
ATOM   1914 N ND2 . ASN A 1 289 ? -0.773  17.088 94.371  1.00 56.94 ? 290  ASN A ND2 1 
ATOM   1915 N N   . VAL A 1 290 ? 3.754   19.796 96.036  1.00 34.14 ? 291  VAL A N   1 
ATOM   1916 C CA  . VAL A 1 290 ? 5.176   20.002 96.282  1.00 33.48 ? 291  VAL A CA  1 
ATOM   1917 C C   . VAL A 1 290 ? 5.386   20.667 97.658  1.00 21.18 ? 291  VAL A C   1 
ATOM   1918 O O   . VAL A 1 290 ? 6.229   20.240 98.426  1.00 27.30 ? 291  VAL A O   1 
ATOM   1919 C CB  . VAL A 1 290 ? 5.857   20.784 95.134  1.00 31.64 ? 291  VAL A CB  1 
ATOM   1920 C CG1 . VAL A 1 290 ? 7.281   21.133 95.518  1.00 26.52 ? 291  VAL A CG1 1 
ATOM   1921 C CG2 . VAL A 1 290 ? 5.829   19.942 93.851  1.00 28.34 ? 291  VAL A CG2 1 
ATOM   1922 N N   . PHE A 1 291 ? 4.578   21.675 97.969  1.00 25.54 ? 292  PHE A N   1 
ATOM   1923 C CA  . PHE A 1 291 ? 4.651   22.331 99.273  1.00 27.26 ? 292  PHE A CA  1 
ATOM   1924 C C   . PHE A 1 291 ? 4.536   21.339 100.408 1.00 30.63 ? 292  PHE A C   1 
ATOM   1925 O O   . PHE A 1 291 ? 5.375   21.332 101.315 1.00 31.33 ? 292  PHE A O   1 
ATOM   1926 C CB  . PHE A 1 291 ? 3.567   23.390 99.428  1.00 28.51 ? 292  PHE A CB  1 
ATOM   1927 C CG  . PHE A 1 291 ? 3.662   24.150 100.720 1.00 35.12 ? 292  PHE A CG  1 
ATOM   1928 C CD1 . PHE A 1 291 ? 4.728   25.001 100.955 1.00 37.39 ? 292  PHE A CD1 1 
ATOM   1929 C CD2 . PHE A 1 291 ? 2.690   24.015 101.698 1.00 35.24 ? 292  PHE A CD2 1 
ATOM   1930 C CE1 . PHE A 1 291 ? 4.818   25.710 102.139 1.00 37.14 ? 292  PHE A CE1 1 
ATOM   1931 C CE2 . PHE A 1 291 ? 2.779   24.717 102.890 1.00 32.90 ? 292  PHE A CE2 1 
ATOM   1932 C CZ  . PHE A 1 291 ? 3.839   25.568 103.104 1.00 33.64 ? 292  PHE A CZ  1 
ATOM   1933 N N   . LYS A 1 292 ? 3.511   20.485 100.341 1.00 30.75 ? 293  LYS A N   1 
ATOM   1934 C CA  . LYS A 1 292 ? 3.330   19.436 101.340 1.00 30.82 ? 293  LYS A CA  1 
ATOM   1935 C C   . LYS A 1 292 ? 4.529   18.515 101.419 1.00 31.32 ? 293  LYS A C   1 
ATOM   1936 O O   . LYS A 1 292 ? 4.912   18.080 102.502 1.00 31.11 ? 293  LYS A O   1 
ATOM   1937 C CB  . LYS A 1 292 ? 2.075   18.619 101.060 1.00 34.85 ? 293  LYS A CB  1 
ATOM   1938 C CG  . LYS A 1 292 ? 0.800   19.415 101.190 1.00 42.21 ? 293  LYS A CG  1 
ATOM   1939 C CD  . LYS A 1 292 ? -0.413  18.513 101.337 1.00 49.70 ? 293  LYS A CD  1 
ATOM   1940 C CE  . LYS A 1 292 ? -1.642  19.318 101.744 1.00 52.71 ? 293  LYS A CE  1 
ATOM   1941 N NZ  . LYS A 1 292 ? -2.812  18.434 101.984 1.00 55.50 ? 293  LYS A NZ  1 
ATOM   1942 N N   . SER A 1 293 ? 5.116   18.193 100.271 1.00 33.75 ? 294  SER A N   1 
ATOM   1943 C CA  . SER A 1 293 ? 6.346   17.407 100.284 1.00 29.84 ? 294  SER A CA  1 
ATOM   1944 C C   . SER A 1 293 ? 7.438   18.171 101.042 1.00 33.56 ? 294  SER A C   1 
ATOM   1945 O O   . SER A 1 293 ? 8.063   17.631 101.950 1.00 27.39 ? 294  SER A O   1 
ATOM   1946 C CB  . SER A 1 293 ? 6.819   17.091 98.864  1.00 28.41 ? 294  SER A CB  1 
ATOM   1947 O OG  . SER A 1 293 ? 8.047   16.374 98.906  1.00 33.48 ? 294  SER A OG  1 
ATOM   1948 N N   . LEU A 1 294 ? 7.650   19.439 100.681 1.00 33.14 ? 295  LEU A N   1 
ATOM   1949 C CA  . LEU A 1 294 ? 8.691   20.235 101.339 1.00 33.04 ? 295  LEU A CA  1 
ATOM   1950 C C   . LEU A 1 294 ? 8.397   20.372 102.834 1.00 30.98 ? 295  LEU A C   1 
ATOM   1951 O O   . LEU A 1 294 ? 9.294   20.225 103.677 1.00 33.37 ? 295  LEU A O   1 
ATOM   1952 C CB  . LEU A 1 294 ? 8.784   21.618 100.697 1.00 30.93 ? 295  LEU A CB  1 
ATOM   1953 C CG  . LEU A 1 294 ? 9.454   21.640 99.321  1.00 31.23 ? 295  LEU A CG  1 
ATOM   1954 C CD1 . LEU A 1 294 ? 9.006   22.854 98.515  1.00 24.66 ? 295  LEU A CD1 1 
ATOM   1955 C CD2 . LEU A 1 294 ? 10.965  21.662 99.510  1.00 31.26 ? 295  LEU A CD2 1 
ATOM   1956 N N   . TYR A 1 295 ? 7.129   20.634 103.147 1.00 28.99 ? 296  TYR A N   1 
ATOM   1957 C CA  . TYR A 1 295 ? 6.687   20.867 104.523 1.00 31.71 ? 296  TYR A CA  1 
ATOM   1958 C C   . TYR A 1 295 ? 6.971   19.638 105.360 1.00 32.17 ? 296  TYR A C   1 
ATOM   1959 O O   . TYR A 1 295 ? 7.551   19.722 106.447 1.00 30.88 ? 296  TYR A O   1 
ATOM   1960 C CB  . TYR A 1 295 ? 5.194   21.198 104.546 1.00 34.73 ? 296  TYR A CB  1 
ATOM   1961 C CG  . TYR A 1 295 ? 4.658   21.613 105.899 1.00 34.85 ? 296  TYR A CG  1 
ATOM   1962 C CD1 . TYR A 1 295 ? 4.369   20.670 106.866 1.00 38.19 ? 296  TYR A CD1 1 
ATOM   1963 C CD2 . TYR A 1 295 ? 4.430   22.950 106.200 1.00 29.06 ? 296  TYR A CD2 1 
ATOM   1964 C CE1 . TYR A 1 295 ? 3.883   21.042 108.095 1.00 43.64 ? 296  TYR A CE1 1 
ATOM   1965 C CE2 . TYR A 1 295 ? 3.931   23.330 107.434 1.00 25.64 ? 296  TYR A CE2 1 
ATOM   1966 C CZ  . TYR A 1 295 ? 3.662   22.373 108.374 1.00 38.35 ? 296  TYR A CZ  1 
ATOM   1967 O OH  . TYR A 1 295 ? 3.180   22.721 109.610 1.00 41.77 ? 296  TYR A OH  1 
ATOM   1968 N N   . GLY A 1 296 ? 6.574   18.489 104.827 1.00 31.66 ? 297  GLY A N   1 
ATOM   1969 C CA  . GLY A 1 296 ? 6.870   17.216 105.445 1.00 30.12 ? 297  GLY A CA  1 
ATOM   1970 C C   . GLY A 1 296 ? 8.349   17.056 105.732 1.00 37.47 ? 297  GLY A C   1 
ATOM   1971 O O   . GLY A 1 296 ? 8.738   16.729 106.860 1.00 33.35 ? 297  GLY A O   1 
ATOM   1972 N N   . LYS A 1 297 ? 9.186   17.285 104.720 1.00 36.15 ? 298  LYS A N   1 
ATOM   1973 C CA  . LYS A 1 297 ? 10.628  17.098 104.908 1.00 39.33 ? 298  LYS A CA  1 
ATOM   1974 C C   . LYS A 1 297 ? 11.195  18.028 105.981 1.00 30.83 ? 298  LYS A C   1 
ATOM   1975 O O   . LYS A 1 297 ? 12.036  17.638 106.760 1.00 32.76 ? 298  LYS A O   1 
ATOM   1976 C CB  . LYS A 1 297 ? 11.389  17.250 103.591 1.00 36.88 ? 298  LYS A CB  1 
ATOM   1977 C CG  . LYS A 1 297 ? 11.189  16.076 102.663 1.00 35.98 ? 298  LYS A CG  1 
ATOM   1978 C CD  . LYS A 1 297 ? 11.844  16.309 101.312 1.00 38.44 ? 298  LYS A CD  1 
ATOM   1979 C CE  . LYS A 1 297 ? 11.731  15.047 100.438 1.00 40.01 ? 298  LYS A CE  1 
ATOM   1980 N NZ  . LYS A 1 297 ? 12.201  15.281 99.046  1.00 37.02 ? 298  LYS A NZ  1 
ATOM   1981 N N   . ILE A 1 298 ? 10.704  19.254 106.030 1.00 32.77 ? 299  ILE A N   1 
ATOM   1982 C CA  . ILE A 1 298 ? 11.174  20.199 107.031 1.00 28.62 ? 299  ILE A CA  1 
ATOM   1983 C C   . ILE A 1 298 ? 10.790  19.786 108.455 1.00 38.22 ? 299  ILE A C   1 
ATOM   1984 O O   . ILE A 1 298 ? 11.641  19.711 109.341 1.00 42.31 ? 299  ILE A O   1 
ATOM   1985 C CB  . ILE A 1 298 ? 10.686  21.606 106.687 1.00 24.95 ? 299  ILE A CB  1 
ATOM   1986 C CG1 . ILE A 1 298 ? 11.336  22.047 105.366 1.00 23.61 ? 299  ILE A CG1 1 
ATOM   1987 C CG2 . ILE A 1 298 ? 11.040  22.601 107.787 1.00 25.92 ? 299  ILE A CG2 1 
ATOM   1988 C CD1 . ILE A 1 298 ? 10.762  23.331 104.797 1.00 20.42 ? 299  ILE A CD1 1 
ATOM   1989 N N   . GLN A 1 299 ? 9.515   19.483 108.663 1.00 43.63 ? 300  GLN A N   1 
ATOM   1990 C CA  . GLN A 1 299 ? 9.030   19.136 109.994 1.00 44.98 ? 300  GLN A CA  1 
ATOM   1991 C C   . GLN A 1 299 ? 9.686   17.884 110.530 1.00 45.19 ? 300  GLN A C   1 
ATOM   1992 O O   . GLN A 1 299 ? 10.031  17.818 111.711 1.00 46.70 ? 300  GLN A O   1 
ATOM   1993 C CB  . GLN A 1 299 ? 7.507   19.000 110.001 1.00 45.62 ? 300  GLN A CB  1 
ATOM   1994 C CG  . GLN A 1 299 ? 6.804   20.283 109.588 1.00 42.51 ? 300  GLN A CG  1 
ATOM   1995 C CD  . GLN A 1 299 ? 7.184   21.479 110.456 1.00 44.94 ? 300  GLN A CD  1 
ATOM   1996 O OE1 . GLN A 1 299 ? 7.730   21.322 111.546 1.00 50.72 ? 300  GLN A OE1 1 
ATOM   1997 N NE2 . GLN A 1 299 ? 6.885   22.680 109.973 1.00 47.93 ? 300  GLN A NE2 1 
ATOM   1998 N N   . SER A 1 300 ? 9.883   16.898 109.664 1.00 43.40 ? 301  SER A N   1 
ATOM   1999 C CA  . SER A 1 300 ? 10.584  15.705 110.087 1.00 45.86 ? 301  SER A CA  1 
ATOM   2000 C C   . SER A 1 300 ? 12.004  16.087 110.524 1.00 46.45 ? 301  SER A C   1 
ATOM   2001 O O   . SER A 1 300 ? 12.517  15.596 111.532 1.00 49.85 ? 301  SER A O   1 
ATOM   2002 C CB  . SER A 1 300 ? 10.543  14.618 109.001 1.00 50.37 ? 301  SER A CB  1 
ATOM   2003 O OG  . SER A 1 300 ? 11.722  14.581 108.229 1.00 57.35 ? 301  SER A OG  1 
ATOM   2004 N N   . GLY A 1 301 ? 12.621  17.009 109.798 1.00 46.78 ? 302  GLY A N   1 
ATOM   2005 C CA  . GLY A 1 301 ? 13.930  17.500 110.198 1.00 44.92 ? 302  GLY A CA  1 
ATOM   2006 C C   . GLY A 1 301 ? 13.888  18.175 111.561 1.00 39.27 ? 302  GLY A C   1 
ATOM   2007 O O   . GLY A 1 301 ? 14.820  18.060 112.351 1.00 41.16 ? 302  GLY A O   1 
ATOM   2008 N N   . VAL A 1 302 ? 12.796  18.880 111.837 1.00 45.93 ? 303  VAL A N   1 
ATOM   2009 C CA  . VAL A 1 302 ? 12.652  19.597 113.097 1.00 49.43 ? 303  VAL A CA  1 
ATOM   2010 C C   . VAL A 1 302 ? 12.603  18.638 114.274 1.00 59.67 ? 303  VAL A C   1 
ATOM   2011 O O   . VAL A 1 302 ? 13.347  18.805 115.243 1.00 66.30 ? 303  VAL A O   1 
ATOM   2012 C CB  . VAL A 1 302 ? 11.397  20.485 113.113 1.00 47.62 ? 303  VAL A CB  1 
ATOM   2013 C CG1 . VAL A 1 302 ? 11.254  21.167 114.464 1.00 48.28 ? 303  VAL A CG1 1 
ATOM   2014 C CG2 . VAL A 1 302 ? 11.472  21.520 112.013 1.00 39.51 ? 303  VAL A CG2 1 
ATOM   2015 N N   . VAL A 1 303 ? 11.748  17.621 114.177 1.00 64.83 ? 304  VAL A N   1 
ATOM   2016 C CA  . VAL A 1 303 ? 11.558  16.678 115.283 1.00 69.25 ? 304  VAL A CA  1 
ATOM   2017 C C   . VAL A 1 303 ? 12.785  15.792 115.519 1.00 70.07 ? 304  VAL A C   1 
ATOM   2018 O O   . VAL A 1 303 ? 13.096  15.447 116.659 1.00 74.38 ? 304  VAL A O   1 
ATOM   2019 C CB  . VAL A 1 303 ? 10.254  15.843 115.135 1.00 54.10 ? 304  VAL A CB  1 
ATOM   2020 C CG1 . VAL A 1 303 ? 9.074   16.768 114.806 1.00 53.33 ? 304  VAL A CG1 1 
ATOM   2021 C CG2 . VAL A 1 303 ? 10.397  14.759 114.072 1.00 50.77 ? 304  VAL A CG2 1 
ATOM   2022 N N   . GLU A 1 304 ? 13.497  15.454 114.447 1.00 66.79 ? 305  GLU A N   1 
ATOM   2023 C CA  . GLU A 1 304 ? 14.757  14.720 114.563 1.00 60.39 ? 305  GLU A CA  1 
ATOM   2024 C C   . GLU A 1 304 ? 15.867  15.647 115.076 1.00 56.48 ? 305  GLU A C   1 
ATOM   2025 O O   . GLU A 1 304 ? 16.978  15.206 115.359 1.00 51.46 ? 305  GLU A O   1 
ATOM   2026 C CB  . GLU A 1 304 ? 15.148  14.093 113.220 1.00 56.57 ? 305  GLU A CB  1 
ATOM   2027 N N   . GLY A 1 305 ? 15.555  16.938 115.178 1.00 55.49 ? 306  GLY A N   1 
ATOM   2028 C CA  . GLY A 1 305 ? 16.450  17.909 115.783 1.00 53.72 ? 306  GLY A CA  1 
ATOM   2029 C C   . GLY A 1 305 ? 17.656  18.376 114.978 1.00 49.21 ? 306  GLY A C   1 
ATOM   2030 O O   . GLY A 1 305 ? 18.660  18.780 115.554 1.00 47.68 ? 306  GLY A O   1 
ATOM   2031 N N   . LYS A 1 306 ? 17.578  18.363 113.654 1.00 50.72 ? 307  LYS A N   1 
ATOM   2032 C CA  . LYS A 1 306 ? 18.786  18.650 112.883 1.00 49.63 ? 307  LYS A CA  1 
ATOM   2033 C C   . LYS A 1 306 ? 19.014  20.122 112.553 1.00 44.88 ? 307  LYS A C   1 
ATOM   2034 O O   . LYS A 1 306 ? 19.969  20.448 111.860 1.00 48.19 ? 307  LYS A O   1 
ATOM   2035 C CB  . LYS A 1 306 ? 18.879  17.776 111.625 1.00 46.03 ? 307  LYS A CB  1 
ATOM   2036 C CG  . LYS A 1 306 ? 17.865  18.060 110.557 1.00 40.73 ? 307  LYS A CG  1 
ATOM   2037 C CD  . LYS A 1 306 ? 17.863  16.924 109.532 1.00 46.77 ? 307  LYS A CD  1 
ATOM   2038 N N   . TYR A 1 307 ? 18.153  21.000 113.066 1.00 43.76 ? 308  TYR A N   1 
ATOM   2039 C CA  . TYR A 1 307 ? 18.231  22.436 112.795 1.00 41.81 ? 308  TYR A CA  1 
ATOM   2040 C C   . TYR A 1 307 ? 18.516  23.238 114.060 1.00 44.48 ? 308  TYR A C   1 
ATOM   2041 O O   . TYR A 1 307 ? 17.989  22.926 115.122 1.00 38.99 ? 308  TYR A O   1 
ATOM   2042 C CB  . TYR A 1 307 ? 16.921  22.939 112.186 1.00 36.13 ? 308  TYR A CB  1 
ATOM   2043 C CG  . TYR A 1 307 ? 16.560  22.262 110.893 1.00 31.52 ? 308  TYR A CG  1 
ATOM   2044 C CD1 . TYR A 1 307 ? 17.500  22.113 109.889 1.00 31.23 ? 308  TYR A CD1 1 
ATOM   2045 C CD2 . TYR A 1 307 ? 15.288  21.751 110.686 1.00 29.88 ? 308  TYR A CD2 1 
ATOM   2046 C CE1 . TYR A 1 307 ? 17.182  21.494 108.705 1.00 28.76 ? 308  TYR A CE1 1 
ATOM   2047 C CE2 . TYR A 1 307 ? 14.959  21.122 109.503 1.00 29.14 ? 308  TYR A CE2 1 
ATOM   2048 C CZ  . TYR A 1 307 ? 15.916  20.999 108.517 1.00 31.90 ? 308  TYR A CZ  1 
ATOM   2049 O OH  . TYR A 1 307 ? 15.612  20.383 107.328 1.00 39.26 ? 308  TYR A OH  1 
ATOM   2050 N N   . ARG A 1 308 ? 19.334  24.281 113.933 1.00 42.21 ? 309  ARG A N   1 
ATOM   2051 C CA  . ARG A 1 308 ? 19.656  25.151 115.058 1.00 43.94 ? 309  ARG A CA  1 
ATOM   2052 C C   . ARG A 1 308 ? 18.421  25.943 115.495 1.00 46.08 ? 309  ARG A C   1 
ATOM   2053 O O   . ARG A 1 308 ? 18.248  26.233 116.674 1.00 50.97 ? 309  ARG A O   1 
ATOM   2054 C CB  . ARG A 1 308 ? 20.794  26.107 114.672 1.00 47.10 ? 309  ARG A CB  1 
ATOM   2055 C CG  . ARG A 1 308 ? 21.498  26.783 115.854 1.00 52.64 ? 309  ARG A CG  1 
ATOM   2056 C CD  . ARG A 1 308 ? 21.140  28.258 116.014 1.00 51.10 ? 309  ARG A CD  1 
ATOM   2057 N NE  . ARG A 1 308 ? 22.002  29.139 115.224 1.00 53.75 ? 309  ARG A NE  1 
ATOM   2058 N N   . ASP A 1 309 ? 17.566  26.286 114.535 1.00 38.77 ? 310  ASP A N   1 
ATOM   2059 C CA  . ASP A 1 309 ? 16.356  27.058 114.801 1.00 43.95 ? 310  ASP A CA  1 
ATOM   2060 C C   . ASP A 1 309 ? 15.143  26.345 114.239 1.00 42.88 ? 310  ASP A C   1 
ATOM   2061 O O   . ASP A 1 309 ? 15.273  25.481 113.376 1.00 42.54 ? 310  ASP A O   1 
ATOM   2062 C CB  . ASP A 1 309 ? 16.432  28.424 114.113 1.00 53.74 ? 310  ASP A CB  1 
ATOM   2063 C CG  . ASP A 1 309 ? 17.331  29.403 114.838 1.00 65.99 ? 310  ASP A CG  1 
ATOM   2064 O OD1 . ASP A 1 309 ? 16.795  30.256 115.578 1.00 67.70 ? 310  ASP A OD1 1 
ATOM   2065 O OD2 . ASP A 1 309 ? 18.566  29.334 114.654 1.00 71.04 ? 310  ASP A OD2 1 
ATOM   2066 N N   . TYR A 1 310 ? 13.962  26.724 114.721 1.00 43.37 ? 311  TYR A N   1 
ATOM   2067 C CA  . TYR A 1 310 ? 12.710  26.347 114.073 1.00 40.16 ? 311  TYR A CA  1 
ATOM   2068 C C   . TYR A 1 310 ? 12.605  27.101 112.759 1.00 39.17 ? 311  TYR A C   1 
ATOM   2069 O O   . TYR A 1 310 ? 12.429  28.317 112.752 1.00 40.08 ? 311  TYR A O   1 
ATOM   2070 C CB  . TYR A 1 310 ? 11.516  26.696 114.960 1.00 38.55 ? 311  TYR A CB  1 
ATOM   2071 C CG  . TYR A 1 310 ? 11.346  25.735 116.105 1.00 43.17 ? 311  TYR A CG  1 
ATOM   2072 C CD1 . TYR A 1 310 ? 10.851  24.460 115.880 1.00 46.77 ? 311  TYR A CD1 1 
ATOM   2073 C CD2 . TYR A 1 310 ? 11.695  26.090 117.405 1.00 42.08 ? 311  TYR A CD2 1 
ATOM   2074 C CE1 . TYR A 1 310 ? 10.705  23.556 116.914 1.00 49.99 ? 311  TYR A CE1 1 
ATOM   2075 C CE2 . TYR A 1 310 ? 11.548  25.191 118.455 1.00 44.27 ? 311  TYR A CE2 1 
ATOM   2076 C CZ  . TYR A 1 310 ? 11.050  23.923 118.195 1.00 49.29 ? 311  TYR A CZ  1 
ATOM   2077 O OH  . TYR A 1 310 ? 10.881  23.003 119.202 1.00 52.04 ? 311  TYR A OH  1 
ATOM   2078 N N   . PRO A 1 311 ? 12.724  26.388 111.637 1.00 36.24 ? 312  PRO A N   1 
ATOM   2079 C CA  . PRO A 1 311 ? 12.688  27.129 110.370 1.00 34.22 ? 312  PRO A CA  1 
ATOM   2080 C C   . PRO A 1 311 ? 11.312  27.735 110.099 1.00 31.89 ? 312  PRO A C   1 
ATOM   2081 O O   . PRO A 1 311 ? 10.300  27.233 110.558 1.00 34.20 ? 312  PRO A O   1 
ATOM   2082 C CB  . PRO A 1 311 ? 13.041  26.072 109.323 1.00 36.70 ? 312  PRO A CB  1 
ATOM   2083 C CG  . PRO A 1 311 ? 12.790  24.756 109.991 1.00 42.92 ? 312  PRO A CG  1 
ATOM   2084 C CD  . PRO A 1 311 ? 12.961  24.948 111.456 1.00 39.14 ? 312  PRO A CD  1 
ATOM   2085 N N   . ARG A 1 312 ? 11.297  28.853 109.394 1.00 26.66 ? 313  ARG A N   1 
ATOM   2086 C CA  . ARG A 1 312 ? 10.052  29.470 109.011 1.00 30.10 ? 313  ARG A CA  1 
ATOM   2087 C C   . ARG A 1 312 ? 9.683   28.955 107.628 1.00 32.08 ? 313  ARG A C   1 
ATOM   2088 O O   . ARG A 1 312 ? 10.541  28.726 106.776 1.00 30.60 ? 313  ARG A O   1 
ATOM   2089 C CB  . ARG A 1 312 ? 10.176  30.997 109.039 1.00 32.54 ? 313  ARG A CB  1 
ATOM   2090 C CG  . ARG A 1 312 ? 10.418  31.554 110.450 1.00 40.24 ? 313  ARG A CG  1 
ATOM   2091 C CD  . ARG A 1 312 ? 10.235  33.068 110.510 1.00 43.27 ? 313  ARG A CD  1 
ATOM   2092 N NE  . ARG A 1 312 ? 10.714  33.627 111.773 1.00 47.05 ? 313  ARG A NE  1 
ATOM   2093 C CZ  . ARG A 1 312 ? 10.775  34.932 112.044 1.00 49.21 ? 313  ARG A CZ  1 
ATOM   2094 N NH1 . ARG A 1 312 ? 10.383  35.821 111.140 1.00 44.63 ? 313  ARG A NH1 1 
ATOM   2095 N NH2 . ARG A 1 312 ? 11.228  35.351 113.223 1.00 48.51 ? 313  ARG A NH2 1 
ATOM   2096 N N   . ILE A 1 313 ? 8.399   28.730 107.424 1.00 32.20 ? 314  ILE A N   1 
ATOM   2097 C CA  . ILE A 1 313 ? 7.940   28.170 106.179 1.00 32.57 ? 314  ILE A CA  1 
ATOM   2098 C C   . ILE A 1 313 ? 6.933   29.131 105.594 1.00 37.88 ? 314  ILE A C   1 
ATOM   2099 O O   . ILE A 1 313 ? 5.803   29.238 106.071 1.00 35.89 ? 314  ILE A O   1 
ATOM   2100 C CB  . ILE A 1 313 ? 7.329   26.792 106.391 1.00 32.34 ? 314  ILE A CB  1 
ATOM   2101 C CG1 . ILE A 1 313 ? 8.350   25.869 107.057 1.00 29.97 ? 314  ILE A CG1 1 
ATOM   2102 C CG2 . ILE A 1 313 ? 6.863   26.212 105.071 1.00 38.53 ? 314  ILE A CG2 1 
ATOM   2103 C CD1 . ILE A 1 313 ? 7.821   24.497 107.340 1.00 36.13 ? 314  ILE A CD1 1 
ATOM   2104 N N   . ILE A 1 314 ? 7.383   29.860 104.581 1.00 36.48 ? 315  ILE A N   1 
ATOM   2105 C CA  . ILE A 1 314 ? 6.579   30.855 103.917 1.00 31.75 ? 315  ILE A CA  1 
ATOM   2106 C C   . ILE A 1 314 ? 6.253   30.334 102.515 1.00 37.24 ? 315  ILE A C   1 
ATOM   2107 O O   . ILE A 1 314 ? 7.094   30.384 101.609 1.00 35.25 ? 315  ILE A O   1 
ATOM   2108 C CB  . ILE A 1 314 ? 7.331   32.178 103.807 1.00 32.48 ? 315  ILE A CB  1 
ATOM   2109 C CG1 . ILE A 1 314 ? 7.664   32.739 105.198 1.00 37.24 ? 315  ILE A CG1 1 
ATOM   2110 C CG2 . ILE A 1 314 ? 6.506   33.178 103.039 1.00 32.49 ? 315  ILE A CG2 1 
ATOM   2111 C CD1 . ILE A 1 314 ? 9.098   32.528 105.643 1.00 32.33 ? 315  ILE A CD1 1 
ATOM   2112 N N   . GLY A 1 315 ? 5.035   29.823 102.345 1.00 33.39 ? 316  GLY A N   1 
ATOM   2113 C CA  . GLY A 1 315 ? 4.627   29.216 101.088 1.00 32.33 ? 316  GLY A CA  1 
ATOM   2114 C C   . GLY A 1 315 ? 3.355   29.795 100.505 1.00 39.74 ? 316  GLY A C   1 
ATOM   2115 O O   . GLY A 1 315 ? 2.381   30.004 101.219 1.00 43.67 ? 316  GLY A O   1 
ATOM   2116 N N   . GLU A 1 316 ? 3.380   30.077 99.203  1.00 37.32 ? 317  GLU A N   1 
ATOM   2117 C CA  . GLU A 1 316 ? 2.191   30.471 98.456  1.00 37.60 ? 317  GLU A CA  1 
ATOM   2118 C C   . GLU A 1 316 ? 1.845   29.338 97.489  1.00 40.54 ? 317  GLU A C   1 
ATOM   2119 O O   . GLU A 1 316 ? 2.615   29.022 96.571  1.00 35.10 ? 317  GLU A O   1 
ATOM   2120 C CB  . GLU A 1 316 ? 2.424   31.783 97.693  1.00 33.26 ? 317  GLU A CB  1 
ATOM   2121 N N   . THR A 1 317 ? 0.708   28.699 97.724  1.00 36.90 ? 318  THR A N   1 
ATOM   2122 C CA  . THR A 1 317 ? 0.296   27.594 96.888  1.00 40.58 ? 318  THR A CA  1 
ATOM   2123 C C   . THR A 1 317 ? -0.846  28.029 95.989  1.00 46.69 ? 318  THR A C   1 
ATOM   2124 O O   . THR A 1 317 ? -1.114  29.222 95.828  1.00 51.18 ? 318  THR A O   1 
ATOM   2125 C CB  . THR A 1 317 ? -0.106  26.362 97.713  1.00 45.00 ? 318  THR A CB  1 
ATOM   2126 O OG1 . THR A 1 317 ? -1.051  26.742 98.717  1.00 51.07 ? 318  THR A OG1 1 
ATOM   2127 C CG2 . THR A 1 317 ? 1.103   25.775 98.396  1.00 43.00 ? 318  THR A CG2 1 
ATOM   2128 N N   . GLY A 1 318 ? -1.512  27.062 95.387  1.00 54.27 ? 319  GLY A N   1 
ATOM   2129 C CA  . GLY A 1 318 ? -2.561  27.393 94.452  1.00 56.13 ? 319  GLY A CA  1 
ATOM   2130 C C   . GLY A 1 318 ? -3.924  27.347 95.094  1.00 48.21 ? 319  GLY A C   1 
ATOM   2131 O O   . GLY A 1 318 ? -4.066  27.443 96.318  1.00 44.38 ? 319  GLY A O   1 
ATOM   2132 N N   . GLY A 1 319 ? -4.927  27.208 94.242  1.00 41.45 ? 320  GLY A N   1 
ATOM   2133 C CA  . GLY A 1 319 ? -6.302  27.139 94.672  1.00 36.98 ? 320  GLY A CA  1 
ATOM   2134 C C   . GLY A 1 319 ? -7.136  26.658 93.514  1.00 32.02 ? 320  GLY A C   1 
ATOM   2135 O O   . GLY A 1 319 ? -6.672  26.580 92.383  1.00 34.70 ? 320  GLY A O   1 
ATOM   2136 N N   . LYS A 1 320 ? -8.364  26.282 93.804  1.00 26.98 ? 321  LYS A N   1 
ATOM   2137 C CA  . LYS A 1 320 ? -9.325  26.068 92.753  1.00 23.16 ? 321  LYS A CA  1 
ATOM   2138 C C   . LYS A 1 320 ? -10.203 27.305 92.886  1.00 20.80 ? 321  LYS A C   1 
ATOM   2139 O O   . LYS A 1 320 ? -11.097 27.337 93.708  1.00 20.23 ? 321  LYS A O   1 
ATOM   2140 C CB  . LYS A 1 320 ? -10.102 24.788 93.035  1.00 24.18 ? 321  LYS A CB  1 
ATOM   2141 C CG  . LYS A 1 320 ? -11.014 24.350 91.915  1.00 26.73 ? 321  LYS A CG  1 
ATOM   2142 C CD  . LYS A 1 320 ? -10.253 23.616 90.828  1.00 26.91 ? 321  LYS A CD  1 
ATOM   2143 C CE  . LYS A 1 320 ? -11.175 23.268 89.643  1.00 22.67 ? 321  LYS A CE  1 
ATOM   2144 N NZ  . LYS A 1 320 ? -10.344 22.696 88.511  1.00 22.94 ? 321  LYS A NZ  1 
ATOM   2145 N N   . ASN A 1 321 ? -9.877  28.352 92.139  1.00 20.54 ? 322  ASN A N   1 
ATOM   2146 C CA  . ASN A 1 321 ? -10.514 29.651 92.311  1.00 19.91 ? 322  ASN A CA  1 
ATOM   2147 C C   . ASN A 1 321 ? -11.824 29.697 91.549  1.00 22.22 ? 322  ASN A C   1 
ATOM   2148 O O   . ASN A 1 321 ? -11.942 29.088 90.485  1.00 19.64 ? 322  ASN A O   1 
ATOM   2149 C CB  . ASN A 1 321 ? -9.552  30.738 91.839  1.00 18.21 ? 322  ASN A CB  1 
ATOM   2150 C CG  . ASN A 1 321 ? -8.186  30.569 92.463  1.00 22.99 ? 322  ASN A CG  1 
ATOM   2151 O OD1 . ASN A 1 321 ? -8.080  30.448 93.680  1.00 18.15 ? 322  ASN A OD1 1 
ATOM   2152 N ND2 . ASN A 1 321 ? -7.149  30.489 91.642  1.00 19.87 ? 322  ASN A ND2 1 
ATOM   2153 N N   . PHE A 1 322 ? -12.806 30.410 92.088  1.00 19.31 ? 323  PHE A N   1 
ATOM   2154 C CA  . PHE A 1 322 ? -14.161 30.332 91.542  1.00 23.80 ? 323  PHE A CA  1 
ATOM   2155 C C   . PHE A 1 322 ? -14.701 31.671 91.060  1.00 21.23 ? 323  PHE A C   1 
ATOM   2156 O O   . PHE A 1 322 ? -14.392 32.724 91.625  1.00 19.25 ? 323  PHE A O   1 
ATOM   2157 C CB  . PHE A 1 322 ? -15.130 29.758 92.593  1.00 18.60 ? 323  PHE A CB  1 
ATOM   2158 C CG  . PHE A 1 322 ? -15.229 30.593 93.849  1.00 20.32 ? 323  PHE A CG  1 
ATOM   2159 C CD1 . PHE A 1 322 ? -14.425 30.313 94.953  1.00 18.95 ? 323  PHE A CD1 1 
ATOM   2160 C CD2 . PHE A 1 322 ? -16.137 31.649 93.936  1.00 17.40 ? 323  PHE A CD2 1 
ATOM   2161 C CE1 . PHE A 1 322 ? -14.524 31.081 96.121  1.00 23.41 ? 323  PHE A CE1 1 
ATOM   2162 C CE2 . PHE A 1 322 ? -16.239 32.419 95.097  1.00 25.66 ? 323  PHE A CE2 1 
ATOM   2163 C CZ  . PHE A 1 322 ? -15.425 32.134 96.189  1.00 23.93 ? 323  PHE A CZ  1 
ATOM   2164 N N   . HIS A 1 323 ? -15.525 31.605 90.022  1.00 19.68 ? 324  HIS A N   1 
ATOM   2165 C CA  . HIS A 1 323 ? -16.417 32.695 89.662  1.00 20.04 ? 324  HIS A CA  1 
ATOM   2166 C C   . HIS A 1 323 ? -17.843 32.238 89.961  1.00 23.20 ? 324  HIS A C   1 
ATOM   2167 O O   . HIS A 1 323 ? -18.274 31.174 89.509  1.00 22.45 ? 324  HIS A O   1 
ATOM   2168 C CB  . HIS A 1 323 ? -16.310 33.049 88.184  1.00 17.31 ? 324  HIS A CB  1 
ATOM   2169 C CG  . HIS A 1 323 ? -15.134 33.910 87.849  1.00 17.53 ? 324  HIS A CG  1 
ATOM   2170 N ND1 . HIS A 1 323 ? -15.006 34.552 86.636  1.00 17.21 ? 324  HIS A ND1 1 
ATOM   2171 C CD2 . HIS A 1 323 ? -14.027 34.227 88.562  1.00 16.51 ? 324  HIS A CD2 1 
ATOM   2172 C CE1 . HIS A 1 323 ? -13.883 35.249 86.629  1.00 25.86 ? 324  HIS A CE1 1 
ATOM   2173 N NE2 . HIS A 1 323 ? -13.274 35.069 87.787  1.00 23.15 ? 324  HIS A NE2 1 
ATOM   2174 N N   . LEU A 1 324 ? -18.558 33.046 90.736  1.00 20.89 ? 325  LEU A N   1 
ATOM   2175 C CA  . LEU A 1 324 ? -19.951 32.795 91.055  1.00 20.65 ? 325  LEU A CA  1 
ATOM   2176 C C   . LEU A 1 324 ? -20.800 33.907 90.425  1.00 24.47 ? 325  LEU A C   1 
ATOM   2177 O O   . LEU A 1 324 ? -20.608 35.088 90.711  1.00 26.84 ? 325  LEU A O   1 
ATOM   2178 C CB  . LEU A 1 324 ? -20.130 32.751 92.570  1.00 19.33 ? 325  LEU A CB  1 
ATOM   2179 C CG  . LEU A 1 324 ? -21.541 32.868 93.150  1.00 25.03 ? 325  LEU A CG  1 
ATOM   2180 C CD1 . LEU A 1 324 ? -22.392 31.651 92.760  1.00 21.97 ? 325  LEU A CD1 1 
ATOM   2181 C CD2 . LEU A 1 324 ? -21.488 33.021 94.666  1.00 21.57 ? 325  LEU A CD2 1 
ATOM   2182 N N   . VAL A 1 325 ? -21.700 33.518 89.532  1.00 20.11 ? 326  VAL A N   1 
ATOM   2183 C CA  . VAL A 1 325 ? -22.594 34.440 88.847  1.00 27.18 ? 326  VAL A CA  1 
ATOM   2184 C C   . VAL A 1 325 ? -23.994 34.383 89.462  1.00 26.18 ? 326  VAL A C   1 
ATOM   2185 O O   . VAL A 1 325 ? -24.599 33.320 89.538  1.00 21.87 ? 326  VAL A O   1 
ATOM   2186 C CB  . VAL A 1 325 ? -22.709 34.085 87.346  1.00 26.93 ? 326  VAL A CB  1 
ATOM   2187 C CG1 . VAL A 1 325 ? -23.650 35.053 86.619  1.00 24.76 ? 326  VAL A CG1 1 
ATOM   2188 C CG2 . VAL A 1 325 ? -21.331 34.065 86.691  1.00 22.99 ? 326  VAL A CG2 1 
ATOM   2189 N N   . HIS A 1 326 ? -24.469 35.531 89.925  1.00 24.91 ? 327  HIS A N   1 
ATOM   2190 C CA  . HIS A 1 326 ? -25.820 35.707 90.431  1.00 26.38 ? 327  HIS A CA  1 
ATOM   2191 C C   . HIS A 1 326 ? -26.716 36.066 89.256  1.00 26.01 ? 327  HIS A C   1 
ATOM   2192 O O   . HIS A 1 326 ? -26.244 36.621 88.278  1.00 28.43 ? 327  HIS A O   1 
ATOM   2193 C CB  . HIS A 1 326 ? -25.834 36.836 91.462  1.00 27.79 ? 327  HIS A CB  1 
ATOM   2194 C CG  . HIS A 1 326 ? -27.159 37.039 92.135  1.00 31.24 ? 327  HIS A CG  1 
ATOM   2195 N ND1 . HIS A 1 326 ? -28.071 37.990 91.722  1.00 32.23 ? 327  HIS A ND1 1 
ATOM   2196 C CD2 . HIS A 1 326 ? -27.720 36.419 93.204  1.00 26.58 ? 327  HIS A CD2 1 
ATOM   2197 C CE1 . HIS A 1 326 ? -29.135 37.948 92.505  1.00 33.33 ? 327  HIS A CE1 1 
ATOM   2198 N NE2 . HIS A 1 326 ? -28.949 37.001 93.409  1.00 36.05 ? 327  HIS A NE2 1 
ATOM   2199 N N   . PRO A 1 327 ? -28.009 35.719 89.327  1.00 28.99 ? 328  PRO A N   1 
ATOM   2200 C CA  . PRO A 1 327 ? -28.858 36.009 88.160  1.00 31.64 ? 328  PRO A CA  1 
ATOM   2201 C C   . PRO A 1 327 ? -28.994 37.499 87.839  1.00 33.71 ? 328  PRO A C   1 
ATOM   2202 O O   . PRO A 1 327 ? -29.347 37.832 86.714  1.00 34.50 ? 328  PRO A O   1 
ATOM   2203 C CB  . PRO A 1 327 ? -30.224 35.391 88.517  1.00 32.92 ? 328  PRO A CB  1 
ATOM   2204 C CG  . PRO A 1 327 ? -30.106 34.895 89.931  1.00 37.55 ? 328  PRO A CG  1 
ATOM   2205 C CD  . PRO A 1 327 ? -28.655 34.818 90.296  1.00 32.58 ? 328  PRO A CD  1 
ATOM   2206 N N   . SER A 1 328 ? -28.683 38.367 88.794  1.00 26.74 ? 329  SER A N   1 
ATOM   2207 C CA  . SER A 1 328 ? -28.763 39.797 88.567  1.00 30.27 ? 329  SER A CA  1 
ATOM   2208 C C   . SER A 1 328 ? -27.516 40.358 87.882  1.00 37.35 ? 329  SER A C   1 
ATOM   2209 O O   . SER A 1 328 ? -27.427 41.560 87.667  1.00 39.72 ? 329  SER A O   1 
ATOM   2210 C CB  . SER A 1 328 ? -28.965 40.525 89.891  1.00 28.22 ? 329  SER A CB  1 
ATOM   2211 O OG  . SER A 1 328 ? -27.735 40.644 90.597  1.00 29.46 ? 329  SER A OG  1 
ATOM   2212 N N   . ALA A 1 329 ? -26.553 39.507 87.542  1.00 32.03 ? 330  ALA A N   1 
ATOM   2213 C CA  . ALA A 1 329 ? -25.276 40.004 87.032  1.00 30.61 ? 330  ALA A CA  1 
ATOM   2214 C C   . ALA A 1 329 ? -25.381 40.621 85.629  1.00 31.26 ? 330  ALA A C   1 
ATOM   2215 O O   . ALA A 1 329 ? -26.238 40.242 84.840  1.00 33.50 ? 330  ALA A O   1 
ATOM   2216 C CB  . ALA A 1 329 ? -24.230 38.889 87.044  1.00 29.25 ? 330  ALA A CB  1 
ATOM   2217 N N   . ASN A 1 330 ? -24.515 41.578 85.316  1.00 27.24 ? 331  ASN A N   1 
ATOM   2218 C CA  . ASN A 1 330 ? -24.325 41.915 83.913  1.00 31.22 ? 331  ASN A CA  1 
ATOM   2219 C C   . ASN A 1 330 ? -23.616 40.737 83.240  1.00 28.85 ? 331  ASN A C   1 
ATOM   2220 O O   . ASN A 1 330 ? -22.475 40.420 83.574  1.00 28.78 ? 331  ASN A O   1 
ATOM   2221 C CB  . ASN A 1 330 ? -23.526 43.210 83.746  1.00 35.53 ? 331  ASN A CB  1 
ATOM   2222 C CG  . ASN A 1 330 ? -23.439 43.643 82.303  1.00 41.31 ? 331  ASN A CG  1 
ATOM   2223 O OD1 . ASN A 1 330 ? -22.457 43.372 81.620  1.00 38.68 ? 331  ASN A OD1 1 
ATOM   2224 N ND2 . ASN A 1 330 ? -24.492 44.299 81.819  1.00 46.93 ? 331  ASN A ND2 1 
ATOM   2225 N N   . ILE A 1 331 ? -24.303 40.074 82.317  1.00 29.18 ? 332  ILE A N   1 
ATOM   2226 C CA  . ILE A 1 331 ? -23.842 38.796 81.785  1.00 30.06 ? 332  ILE A CA  1 
ATOM   2227 C C   . ILE A 1 331 ? -22.607 38.955 80.904  1.00 35.67 ? 332  ILE A C   1 
ATOM   2228 O O   . ILE A 1 331 ? -21.656 38.171 80.995  1.00 32.02 ? 332  ILE A O   1 
ATOM   2229 C CB  . ILE A 1 331 ? -24.956 38.093 80.988  1.00 36.16 ? 332  ILE A CB  1 
ATOM   2230 C CG1 . ILE A 1 331 ? -26.161 37.825 81.896  1.00 38.10 ? 332  ILE A CG1 1 
ATOM   2231 C CG2 . ILE A 1 331 ? -24.449 36.784 80.374  1.00 33.65 ? 332  ILE A CG2 1 
ATOM   2232 C CD1 . ILE A 1 331 ? -25.819 36.938 83.119  1.00 39.10 ? 332  ILE A CD1 1 
ATOM   2233 N N   . SER A 1 332 ? -22.627 39.975 80.054  1.00 30.15 ? 333  SER A N   1 
ATOM   2234 C CA  . SER A 1 332 ? -21.539 40.214 79.123  1.00 35.31 ? 333  SER A CA  1 
ATOM   2235 C C   . SER A 1 332 ? -20.228 40.474 79.864  1.00 30.65 ? 333  SER A C   1 
ATOM   2236 O O   . SER A 1 332 ? -19.207 39.854 79.577  1.00 27.65 ? 333  SER A O   1 
ATOM   2237 C CB  . SER A 1 332 ? -21.876 41.390 78.202  1.00 43.53 ? 333  SER A CB  1 
ATOM   2238 O OG  . SER A 1 332 ? -20.764 41.710 77.384  1.00 51.86 ? 333  SER A OG  1 
ATOM   2239 N N   . HIS A 1 333 ? -20.263 41.388 80.828  1.00 29.04 ? 334  HIS A N   1 
ATOM   2240 C CA  . HIS A 1 333 ? -19.103 41.632 81.666  1.00 28.02 ? 334  HIS A CA  1 
ATOM   2241 C C   . HIS A 1 333 ? -18.641 40.339 82.374  1.00 27.25 ? 334  HIS A C   1 
ATOM   2242 O O   . HIS A 1 333 ? -17.450 40.062 82.442  1.00 23.55 ? 334  HIS A O   1 
ATOM   2243 C CB  . HIS A 1 333 ? -19.407 42.725 82.683  1.00 26.01 ? 334  HIS A CB  1 
ATOM   2244 C CG  . HIS A 1 333 ? -18.296 42.977 83.648  1.00 25.03 ? 334  HIS A CG  1 
ATOM   2245 N ND1 . HIS A 1 333 ? -17.090 43.524 83.268  1.00 24.28 ? 334  HIS A ND1 1 
ATOM   2246 C CD2 . HIS A 1 333 ? -18.200 42.746 84.977  1.00 28.64 ? 334  HIS A CD2 1 
ATOM   2247 C CE1 . HIS A 1 333 ? -16.297 43.618 84.319  1.00 23.11 ? 334  HIS A CE1 1 
ATOM   2248 N NE2 . HIS A 1 333 ? -16.948 43.155 85.371  1.00 29.95 ? 334  HIS A NE2 1 
ATOM   2249 N N   . ALA A 1 334 ? -19.586 39.558 82.889  1.00 28.66 ? 335  ALA A N   1 
ATOM   2250 C CA  . ALA A 1 334 ? -19.243 38.330 83.599  1.00 25.60 ? 335  ALA A CA  1 
ATOM   2251 C C   . ALA A 1 334 ? -18.586 37.318 82.658  1.00 27.76 ? 335  ALA A C   1 
ATOM   2252 O O   . ALA A 1 334 ? -17.669 36.603 83.050  1.00 29.67 ? 335  ALA A O   1 
ATOM   2253 C CB  . ALA A 1 334 ? -20.473 37.727 84.266  1.00 21.26 ? 335  ALA A CB  1 
ATOM   2254 N N   . VAL A 1 335 ? -19.066 37.264 81.416  1.00 27.82 ? 336  VAL A N   1 
ATOM   2255 C CA  . VAL A 1 335 ? -18.482 36.391 80.404  1.00 24.68 ? 336  VAL A CA  1 
ATOM   2256 C C   . VAL A 1 335 ? -17.035 36.783 80.097  1.00 26.23 ? 336  VAL A C   1 
ATOM   2257 O O   . VAL A 1 335 ? -16.128 35.954 80.158  1.00 23.70 ? 336  VAL A O   1 
ATOM   2258 C CB  . VAL A 1 335 ? -19.317 36.397 79.103  1.00 26.54 ? 336  VAL A CB  1 
ATOM   2259 C CG1 . VAL A 1 335 ? -18.571 35.682 77.988  1.00 22.56 ? 336  VAL A CG1 1 
ATOM   2260 C CG2 . VAL A 1 335 ? -20.662 35.724 79.330  1.00 26.88 ? 336  VAL A CG2 1 
ATOM   2261 N N   . LEU A 1 336 ? -16.815 38.056 79.773  1.00 24.04 ? 337  LEU A N   1 
ATOM   2262 C CA  . LEU A 1 336 ? -15.487 38.502 79.398  1.00 25.50 ? 337  LEU A CA  1 
ATOM   2263 C C   . LEU A 1 336 ? -14.501 38.368 80.559  1.00 27.66 ? 337  LEU A C   1 
ATOM   2264 O O   . LEU A 1 336 ? -13.352 37.994 80.356  1.00 26.28 ? 337  LEU A O   1 
ATOM   2265 C CB  . LEU A 1 336 ? -15.540 39.935 78.878  1.00 31.72 ? 337  LEU A CB  1 
ATOM   2266 C CG  . LEU A 1 336 ? -16.250 40.040 77.524  1.00 32.10 ? 337  LEU A CG  1 
ATOM   2267 C CD1 . LEU A 1 336 ? -16.697 41.481 77.248  1.00 33.25 ? 337  LEU A CD1 1 
ATOM   2268 C CD2 . LEU A 1 336 ? -15.309 39.545 76.434  1.00 32.06 ? 337  LEU A CD2 1 
ATOM   2269 N N   . SER A 1 337 ? -14.959 38.662 81.775  1.00 20.88 ? 338  SER A N   1 
ATOM   2270 C CA  . SER A 1 337 ? -14.114 38.535 82.949  1.00 21.77 ? 338  SER A CA  1 
ATOM   2271 C C   . SER A 1 337 ? -13.749 37.074 83.178  1.00 23.50 ? 338  SER A C   1 
ATOM   2272 O O   . SER A 1 337 ? -12.633 36.772 83.587  1.00 17.95 ? 338  SER A O   1 
ATOM   2273 C CB  . SER A 1 337 ? -14.844 39.067 84.180  1.00 27.41 ? 338  SER A CB  1 
ATOM   2274 O OG  . SER A 1 337 ? -15.217 40.422 83.982  1.00 30.71 ? 338  SER A OG  1 
ATOM   2275 N N   . THR A 1 338 ? -14.701 36.176 82.922  1.00 21.53 ? 339  THR A N   1 
ATOM   2276 C CA  . THR A 1 338 ? -14.444 34.749 83.066  1.00 22.15 ? 339  THR A CA  1 
ATOM   2277 C C   . THR A 1 338 ? -13.493 34.229 81.991  1.00 25.46 ? 339  THR A C   1 
ATOM   2278 O O   . THR A 1 338 ? -12.607 33.419 82.278  1.00 23.92 ? 339  THR A O   1 
ATOM   2279 C CB  . THR A 1 338 ? -15.742 33.936 83.058  1.00 18.31 ? 339  THR A CB  1 
ATOM   2280 O OG1 . THR A 1 338 ? -16.545 34.372 84.160  1.00 20.67 ? 339  THR A OG1 1 
ATOM   2281 C CG2 . THR A 1 338 ? -15.439 32.436 83.216  1.00 18.30 ? 339  THR A CG2 1 
ATOM   2282 N N   . ILE A 1 339 ? -13.664 34.690 80.756  1.00 25.60 ? 340  ILE A N   1 
ATOM   2283 C CA  . ILE A 1 339 ? -12.733 34.302 79.704  1.00 28.33 ? 340  ILE A CA  1 
ATOM   2284 C C   . ILE A 1 339 ? -11.312 34.734 80.096  1.00 30.56 ? 340  ILE A C   1 
ATOM   2285 O O   . ILE A 1 339 ? -10.369 33.922 80.082  1.00 26.10 ? 340  ILE A O   1 
ATOM   2286 C CB  . ILE A 1 339 ? -13.124 34.881 78.338  1.00 28.49 ? 340  ILE A CB  1 
ATOM   2287 C CG1 . ILE A 1 339 ? -14.235 34.044 77.710  1.00 26.12 ? 340  ILE A CG1 1 
ATOM   2288 C CG2 . ILE A 1 339 ? -11.939 34.878 77.408  1.00 20.02 ? 340  ILE A CG2 1 
ATOM   2289 C CD1 . ILE A 1 339 ? -15.015 34.793 76.641  1.00 30.46 ? 340  ILE A CD1 1 
ATOM   2290 N N   . ARG A 1 340 ? -11.175 35.991 80.502  1.00 26.73 ? 341  ARG A N   1 
ATOM   2291 C CA  . ARG A 1 340 ? -9.871  36.497 80.911  1.00 27.86 ? 341  ARG A CA  1 
ATOM   2292 C C   . ARG A 1 340 ? -9.346  35.784 82.168  1.00 27.24 ? 341  ARG A C   1 
ATOM   2293 O O   . ARG A 1 340 ? -8.193  35.378 82.208  1.00 25.60 ? 341  ARG A O   1 
ATOM   2294 C CB  . ARG A 1 340 ? -9.898  38.023 81.116  1.00 27.96 ? 341  ARG A CB  1 
ATOM   2295 C CG  . ARG A 1 340 ? -9.910  38.826 79.829  1.00 37.47 ? 341  ARG A CG  1 
ATOM   2296 C CD  . ARG A 1 340 ? -9.954  40.337 80.108  1.00 44.69 ? 341  ARG A CD  1 
ATOM   2297 N N   . GLY A 1 341 ? -10.188 35.626 83.185  1.00 22.41 ? 342  GLY A N   1 
ATOM   2298 C CA  . GLY A 1 341 ? -9.741  35.028 84.435  1.00 23.25 ? 342  GLY A CA  1 
ATOM   2299 C C   . GLY A 1 341 ? -9.307  33.574 84.312  1.00 25.88 ? 342  GLY A C   1 
ATOM   2300 O O   . GLY A 1 341 ? -8.485  33.090 85.081  1.00 26.49 ? 342  GLY A O   1 
ATOM   2301 N N   . THR A 1 342 ? -9.853  32.881 83.325  1.00 22.12 ? 343  THR A N   1 
ATOM   2302 C CA  . THR A 1 342 ? -9.632  31.449 83.169  1.00 19.65 ? 343  THR A CA  1 
ATOM   2303 C C   . THR A 1 342 ? -8.532  31.112 82.158  1.00 20.44 ? 343  THR A C   1 
ATOM   2304 O O   . THR A 1 342 ? -7.733  30.208 82.389  1.00 19.49 ? 343  THR A O   1 
ATOM   2305 C CB  . THR A 1 342 ? -10.929 30.760 82.675  1.00 20.88 ? 343  THR A CB  1 
ATOM   2306 O OG1 . THR A 1 342 ? -12.022 31.160 83.512  1.00 26.59 ? 343  THR A OG1 1 
ATOM   2307 C CG2 . THR A 1 342 ? -10.791 29.232 82.673  1.00 19.02 ? 343  THR A CG2 1 
ATOM   2308 N N   . PHE A 1 343 ? -8.515  31.815 81.028  1.00 17.78 ? 344  PHE A N   1 
ATOM   2309 C CA  . PHE A 1 343 ? -7.742  31.359 79.882  1.00 24.14 ? 344  PHE A CA  1 
ATOM   2310 C C   . PHE A 1 343 ? -6.477  32.178 79.610  1.00 28.48 ? 344  PHE A C   1 
ATOM   2311 O O   . PHE A 1 343 ? -5.628  31.774 78.813  1.00 27.54 ? 344  PHE A O   1 
ATOM   2312 C CB  . PHE A 1 343 ? -8.640  31.273 78.635  1.00 18.30 ? 344  PHE A CB  1 
ATOM   2313 C CG  . PHE A 1 343 ? -9.832  30.340 78.801  1.00 21.94 ? 344  PHE A CG  1 
ATOM   2314 C CD1 . PHE A 1 343 ? -9.640  28.987 79.071  1.00 23.56 ? 344  PHE A CD1 1 
ATOM   2315 C CD2 . PHE A 1 343 ? -11.137 30.818 78.672  1.00 21.32 ? 344  PHE A CD2 1 
ATOM   2316 C CE1 . PHE A 1 343 ? -10.734 28.124 79.230  1.00 21.98 ? 344  PHE A CE1 1 
ATOM   2317 C CE2 . PHE A 1 343 ? -12.243 29.968 78.823  1.00 21.49 ? 344  PHE A CE2 1 
ATOM   2318 C CZ  . PHE A 1 343 ? -12.044 28.622 79.103  1.00 25.26 ? 344  PHE A CZ  1 
ATOM   2319 N N   . GLU A 1 344 ? -6.358  33.326 80.272  1.00 26.64 ? 345  GLU A N   1 
ATOM   2320 C CA  . GLU A 1 344 ? -5.171  34.166 80.152  1.00 22.82 ? 345  GLU A CA  1 
ATOM   2321 C C   . GLU A 1 344 ? -3.952  33.361 80.593  1.00 24.62 ? 345  GLU A C   1 
ATOM   2322 O O   . GLU A 1 344 ? -3.981  32.694 81.631  1.00 19.37 ? 345  GLU A O   1 
ATOM   2323 C CB  . GLU A 1 344 ? -5.326  35.441 80.995  1.00 27.34 ? 345  GLU A CB  1 
ATOM   2324 C CG  . GLU A 1 344 ? -4.141  36.403 80.956  1.00 45.61 ? 345  GLU A CG  1 
ATOM   2325 C CD  . GLU A 1 344 ? -3.813  36.910 79.554  1.00 52.90 ? 345  GLU A CD  1 
ATOM   2326 O OE1 . GLU A 1 344 ? -4.639  36.742 78.632  1.00 55.07 ? 345  GLU A OE1 1 
ATOM   2327 O OE2 . GLU A 1 344 ? -2.722  37.488 79.377  1.00 53.49 ? 345  GLU A OE2 1 
ATOM   2328 N N   . PHE A 1 345 ? -2.904  33.380 79.772  1.00 22.09 ? 346  PHE A N   1 
ATOM   2329 C CA  . PHE A 1 345 ? -1.705  32.577 80.021  1.00 18.32 ? 346  PHE A CA  1 
ATOM   2330 C C   . PHE A 1 345 ? -2.046  31.102 80.239  1.00 20.46 ? 346  PHE A C   1 
ATOM   2331 O O   . PHE A 1 345 ? -1.430  30.428 81.068  1.00 20.92 ? 346  PHE A O   1 
ATOM   2332 C CB  . PHE A 1 345 ? -0.852  33.135 81.193  1.00 16.28 ? 346  PHE A CB  1 
ATOM   2333 C CG  . PHE A 1 345 ? 0.516   32.487 81.290  1.00 19.86 ? 346  PHE A CG  1 
ATOM   2334 C CD1 . PHE A 1 345 ? 1.229   32.186 80.137  1.00 20.75 ? 346  PHE A CD1 1 
ATOM   2335 C CD2 . PHE A 1 345 ? 1.067   32.148 82.514  1.00 22.57 ? 346  PHE A CD2 1 
ATOM   2336 C CE1 . PHE A 1 345 ? 2.473   31.567 80.191  1.00 20.50 ? 346  PHE A CE1 1 
ATOM   2337 C CE2 . PHE A 1 345 ? 2.307   31.524 82.585  1.00 21.24 ? 346  PHE A CE2 1 
ATOM   2338 C CZ  . PHE A 1 345 ? 3.011   31.234 81.418  1.00 23.02 ? 346  PHE A CZ  1 
ATOM   2339 N N   . GLN A 1 346 ? -3.043  30.616 79.496  1.00 21.19 ? 347  GLN A N   1 
ATOM   2340 C CA  . GLN A 1 346 ? -3.468  29.216 79.563  1.00 17.55 ? 347  GLN A CA  1 
ATOM   2341 C C   . GLN A 1 346 ? -3.906  28.747 80.963  1.00 20.32 ? 347  GLN A C   1 
ATOM   2342 O O   . GLN A 1 346 ? -3.786  27.568 81.286  1.00 23.42 ? 347  GLN A O   1 
ATOM   2343 C CB  . GLN A 1 346 ? -2.385  28.283 79.006  1.00 21.92 ? 347  GLN A CB  1 
ATOM   2344 C CG  . GLN A 1 346 ? -2.218  28.366 77.481  1.00 25.81 ? 347  GLN A CG  1 
ATOM   2345 C CD  . GLN A 1 346 ? -1.782  29.751 77.047  1.00 29.36 ? 347  GLN A CD  1 
ATOM   2346 O OE1 . GLN A 1 346 ? -2.599  30.556 76.593  1.00 27.10 ? 347  GLN A OE1 1 
ATOM   2347 N NE2 . GLN A 1 346 ? -0.499  30.060 77.246  1.00 24.60 ? 347  GLN A NE2 1 
ATOM   2348 N N   . GLY A 1 347 ? -4.422  29.660 81.781  1.00 19.91 ? 348  GLY A N   1 
ATOM   2349 C CA  . GLY A 1 347 ? -4.847  29.308 83.122  1.00 17.33 ? 348  GLY A CA  1 
ATOM   2350 C C   . GLY A 1 347 ? -3.699  29.018 84.087  1.00 20.45 ? 348  GLY A C   1 
ATOM   2351 O O   . GLY A 1 347 ? -3.920  28.484 85.176  1.00 24.90 ? 348  GLY A O   1 
ATOM   2352 N N   . GLN A 1 348 ? -2.475  29.392 83.710  1.00 16.95 ? 349  GLN A N   1 
ATOM   2353 C CA  . GLN A 1 348 ? -1.291  29.056 84.515  1.00 22.13 ? 349  GLN A CA  1 
ATOM   2354 C C   . GLN A 1 348 ? -0.942  30.142 85.527  1.00 27.88 ? 349  GLN A C   1 
ATOM   2355 O O   . GLN A 1 348 ? 0.185   30.611 85.611  1.00 26.54 ? 349  GLN A O   1 
ATOM   2356 C CB  . GLN A 1 348 ? -0.103  28.729 83.609  1.00 17.33 ? 349  GLN A CB  1 
ATOM   2357 C CG  . GLN A 1 348 ? -0.340  27.463 82.755  1.00 16.33 ? 349  GLN A CG  1 
ATOM   2358 C CD  . GLN A 1 348 ? 0.804   27.198 81.800  1.00 21.66 ? 349  GLN A CD  1 
ATOM   2359 O OE1 . GLN A 1 348 ? 1.361   26.087 81.746  1.00 19.13 ? 349  GLN A OE1 1 
ATOM   2360 N NE2 . GLN A 1 348 ? 1.167   28.225 81.032  1.00 17.19 ? 349  GLN A NE2 1 
ATOM   2361 N N   . LYS A 1 349 ? -1.939  30.536 86.297  1.00 35.19 ? 350  LYS A N   1 
ATOM   2362 C CA  . LYS A 1 349 ? -1.762  31.502 87.365  1.00 29.55 ? 350  LYS A CA  1 
ATOM   2363 C C   . LYS A 1 349 ? -2.372  30.918 88.628  1.00 30.69 ? 350  LYS A C   1 
ATOM   2364 O O   . LYS A 1 349 ? -3.433  30.296 88.582  1.00 26.27 ? 350  LYS A O   1 
ATOM   2365 C CB  . LYS A 1 349 ? -2.490  32.783 87.029  1.00 27.38 ? 350  LYS A CB  1 
ATOM   2366 C CG  . LYS A 1 349 ? -2.040  33.468 85.777  1.00 23.75 ? 350  LYS A CG  1 
ATOM   2367 C CD  . LYS A 1 349 ? -2.952  34.669 85.557  1.00 29.80 ? 350  LYS A CD  1 
ATOM   2368 C CE  . LYS A 1 349 ? -2.628  35.401 84.267  1.00 37.25 ? 350  LYS A CE  1 
ATOM   2369 N NZ  . LYS A 1 349 ? -3.177  36.797 84.279  1.00 43.32 ? 350  LYS A NZ  1 
ATOM   2370 N N   . CYS A 1 350 ? -1.704  31.115 89.758  1.00 28.72 ? 351  CYS A N   1 
ATOM   2371 C CA  . CYS A 1 350 ? -2.248  30.690 91.038  1.00 30.19 ? 351  CYS A CA  1 
ATOM   2372 C C   . CYS A 1 350 ? -3.665  31.233 91.282  1.00 23.01 ? 351  CYS A C   1 
ATOM   2373 O O   . CYS A 1 350 ? -4.431  30.634 92.030  1.00 25.27 ? 351  CYS A O   1 
ATOM   2374 C CB  . CYS A 1 350 ? -1.315  31.124 92.176  1.00 41.84 ? 351  CYS A CB  1 
ATOM   2375 S SG  . CYS A 1 350 ? -0.149  32.441 91.723  1.00 91.24 ? 351  CYS A SG  1 
ATOM   2376 N N   . SER A 1 351 ? -3.989  32.375 90.669  1.00 20.32 ? 352  SER A N   1 
ATOM   2377 C CA  . SER A 1 351 ? -5.268  33.032 90.886  1.00 27.99 ? 352  SER A CA  1 
ATOM   2378 C C   . SER A 1 351 ? -6.274  32.785 89.754  1.00 28.03 ? 352  SER A C   1 
ATOM   2379 O O   . SER A 1 351 ? -7.385  33.321 89.797  1.00 25.20 ? 352  SER A O   1 
ATOM   2380 C CB  . SER A 1 351 ? -5.044  34.530 91.013  1.00 29.70 ? 352  SER A CB  1 
ATOM   2381 O OG  . SER A 1 351 ? -4.546  35.012 89.779  1.00 35.08 ? 352  SER A OG  1 
ATOM   2382 N N   . ALA A 1 352 ? -5.872  32.010 88.738  1.00 22.99 ? 353  ALA A N   1 
ATOM   2383 C CA  . ALA A 1 352 ? -6.752  31.646 87.612  1.00 21.92 ? 353  ALA A CA  1 
ATOM   2384 C C   . ALA A 1 352 ? -8.127  31.137 88.062  1.00 19.96 ? 353  ALA A C   1 
ATOM   2385 O O   . ALA A 1 352 ? -8.218  30.331 88.974  1.00 24.79 ? 353  ALA A O   1 
ATOM   2386 C CB  . ALA A 1 352 ? -6.089  30.570 86.756  1.00 18.09 ? 353  ALA A CB  1 
ATOM   2387 N N   . ALA A 1 353 ? -9.188  31.582 87.404  1.00 19.48 ? 354  ALA A N   1 
ATOM   2388 C CA  . ALA A 1 353 ? -10.497 30.960 87.608  1.00 24.81 ? 354  ALA A CA  1 
ATOM   2389 C C   . ALA A 1 353 ? -10.493 29.562 86.988  1.00 21.57 ? 354  ALA A C   1 
ATOM   2390 O O   . ALA A 1 353 ? -10.027 29.383 85.858  1.00 21.19 ? 354  ALA A O   1 
ATOM   2391 C CB  . ALA A 1 353 ? -11.579 31.799 86.964  1.00 22.83 ? 354  ALA A CB  1 
ATOM   2392 N N   . SER A 1 354 ? -11.015 28.573 87.697  1.00 15.48 ? 355  SER A N   1 
ATOM   2393 C CA  . SER A 1 354 ? -11.171 27.255 87.073  1.00 19.58 ? 355  SER A CA  1 
ATOM   2394 C C   . SER A 1 354 ? -12.513 26.591 87.376  1.00 19.86 ? 355  SER A C   1 
ATOM   2395 O O   . SER A 1 354 ? -12.836 25.521 86.845  1.00 18.96 ? 355  SER A O   1 
ATOM   2396 C CB  . SER A 1 354 ? -10.024 26.322 87.468  1.00 24.43 ? 355  SER A CB  1 
ATOM   2397 O OG  . SER A 1 354 ? -9.936  26.192 88.869  1.00 25.09 ? 355  SER A OG  1 
ATOM   2398 N N   . ARG A 1 355 ? -13.303 27.204 88.239  1.00 18.61 ? 356  ARG A N   1 
ATOM   2399 C CA  . ARG A 1 355 ? -14.670 26.710 88.408  1.00 18.25 ? 356  ARG A CA  1 
ATOM   2400 C C   . ARG A 1 355 ? -15.635 27.868 88.325  1.00 17.99 ? 356  ARG A C   1 
ATOM   2401 O O   . ARG A 1 355 ? -15.330 28.974 88.778  1.00 20.38 ? 356  ARG A O   1 
ATOM   2402 C CB  . ARG A 1 355 ? -14.844 25.924 89.703  1.00 18.67 ? 356  ARG A CB  1 
ATOM   2403 C CG  . ARG A 1 355 ? -14.309 26.624 90.944  1.00 21.44 ? 356  ARG A CG  1 
ATOM   2404 C CD  . ARG A 1 355 ? -14.642 25.835 92.221  1.00 21.58 ? 356  ARG A CD  1 
ATOM   2405 N NE  . ARG A 1 355 ? -13.838 26.298 93.344  1.00 20.58 ? 356  ARG A NE  1 
ATOM   2406 C CZ  . ARG A 1 355 ? -14.265 26.365 94.600  1.00 22.90 ? 356  ARG A CZ  1 
ATOM   2407 N NH1 . ARG A 1 355 ? -15.502 25.999 94.913  1.00 23.32 ? 356  ARG A NH1 1 
ATOM   2408 N NH2 . ARG A 1 355 ? -13.446 26.796 95.548  1.00 21.23 ? 356  ARG A NH2 1 
ATOM   2409 N N   . LEU A 1 356 ? -16.796 27.609 87.743  1.00 17.47 ? 357  LEU A N   1 
ATOM   2410 C CA  . LEU A 1 356 ? -17.779 28.652 87.475  1.00 17.74 ? 357  LEU A CA  1 
ATOM   2411 C C   . LEU A 1 356 ? -19.168 28.173 87.898  1.00 23.85 ? 357  LEU A C   1 
ATOM   2412 O O   . LEU A 1 356 ? -19.563 27.057 87.577  1.00 23.37 ? 357  LEU A O   1 
ATOM   2413 C CB  . LEU A 1 356 ? -17.768 28.962 85.974  1.00 20.00 ? 357  LEU A CB  1 
ATOM   2414 C CG  . LEU A 1 356 ? -18.874 29.853 85.408  1.00 23.00 ? 357  LEU A CG  1 
ATOM   2415 C CD1 . LEU A 1 356 ? -18.695 31.302 85.853  1.00 18.47 ? 357  LEU A CD1 1 
ATOM   2416 C CD2 . LEU A 1 356 ? -18.909 29.723 83.873  1.00 19.19 ? 357  LEU A CD2 1 
ATOM   2417 N N   . TYR A 1 357 ? -19.902 29.010 88.627  1.00 20.54 ? 358  TYR A N   1 
ATOM   2418 C CA  . TYR A 1 357 ? -21.259 28.675 89.034  1.00 20.66 ? 358  TYR A CA  1 
ATOM   2419 C C   . TYR A 1 357 ? -22.199 29.626 88.306  1.00 24.48 ? 358  TYR A C   1 
ATOM   2420 O O   . TYR A 1 357 ? -22.087 30.848 88.455  1.00 24.09 ? 358  TYR A O   1 
ATOM   2421 C CB  . TYR A 1 357 ? -21.429 28.771 90.560  1.00 19.42 ? 358  TYR A CB  1 
ATOM   2422 C CG  . TYR A 1 357 ? -20.468 27.866 91.337  1.00 24.83 ? 358  TYR A CG  1 
ATOM   2423 C CD1 . TYR A 1 357 ? -19.139 28.234 91.526  1.00 24.21 ? 358  TYR A CD1 1 
ATOM   2424 C CD2 . TYR A 1 357 ? -20.895 26.644 91.873  1.00 20.70 ? 358  TYR A CD2 1 
ATOM   2425 C CE1 . TYR A 1 357 ? -18.261 27.430 92.233  1.00 23.24 ? 358  TYR A CE1 1 
ATOM   2426 C CE2 . TYR A 1 357 ? -20.020 25.827 92.582  1.00 22.16 ? 358  TYR A CE2 1 
ATOM   2427 C CZ  . TYR A 1 357 ? -18.693 26.234 92.748  1.00 22.50 ? 358  TYR A CZ  1 
ATOM   2428 O OH  . TYR A 1 357 ? -17.800 25.455 93.443  1.00 22.14 ? 358  TYR A OH  1 
ATOM   2429 N N   . LEU A 1 358 ? -23.089 29.060 87.489  1.00 25.74 ? 359  LEU A N   1 
ATOM   2430 C CA  . LEU A 1 358 ? -24.036 29.839 86.686  1.00 28.10 ? 359  LEU A CA  1 
ATOM   2431 C C   . LEU A 1 358 ? -25.457 29.546 87.117  1.00 30.25 ? 359  LEU A C   1 
ATOM   2432 O O   . LEU A 1 358 ? -25.800 28.395 87.336  1.00 23.86 ? 359  LEU A O   1 
ATOM   2433 C CB  . LEU A 1 358 ? -23.956 29.440 85.218  1.00 22.01 ? 359  LEU A CB  1 
ATOM   2434 C CG  . LEU A 1 358 ? -22.745 29.853 84.430  1.00 26.76 ? 359  LEU A CG  1 
ATOM   2435 C CD1 . LEU A 1 358 ? -22.977 29.382 83.009  1.00 24.78 ? 359  LEU A CD1 1 
ATOM   2436 C CD2 . LEU A 1 358 ? -22.544 31.378 84.508  1.00 23.28 ? 359  LEU A CD2 1 
ATOM   2437 N N   . PRO A 1 359 ? -26.296 30.585 87.211  1.00 22.46 ? 360  PRO A N   1 
ATOM   2438 C CA  . PRO A 1 359 ? -27.714 30.301 87.442  1.00 26.74 ? 360  PRO A CA  1 
ATOM   2439 C C   . PRO A 1 359 ? -28.325 29.684 86.188  1.00 27.16 ? 360  PRO A C   1 
ATOM   2440 O O   . PRO A 1 359 ? -27.985 30.088 85.081  1.00 29.13 ? 360  PRO A O   1 
ATOM   2441 C CB  . PRO A 1 359 ? -28.312 31.681 87.705  1.00 28.46 ? 360  PRO A CB  1 
ATOM   2442 C CG  . PRO A 1 359 ? -27.379 32.648 86.995  1.00 30.81 ? 360  PRO A CG  1 
ATOM   2443 C CD  . PRO A 1 359 ? -26.011 32.021 87.061  1.00 25.61 ? 360  PRO A CD  1 
ATOM   2444 N N   . GLU A 1 360 ? -29.211 28.714 86.360  1.00 25.93 ? 361  GLU A N   1 
ATOM   2445 C CA  . GLU A 1 360 ? -29.880 28.089 85.220  1.00 32.93 ? 361  GLU A CA  1 
ATOM   2446 C C   . GLU A 1 360 ? -30.542 29.073 84.234  1.00 36.69 ? 361  GLU A C   1 
ATOM   2447 O O   . GLU A 1 360 ? -30.414 28.905 83.022  1.00 39.41 ? 361  GLU A O   1 
ATOM   2448 C CB  . GLU A 1 360 ? -30.866 27.012 85.698  1.00 34.15 ? 361  GLU A CB  1 
ATOM   2449 C CG  . GLU A 1 360 ? -30.146 25.842 86.380  1.00 39.85 ? 361  GLU A CG  1 
ATOM   2450 C CD  . GLU A 1 360 ? -31.039 24.651 86.679  1.00 46.04 ? 361  GLU A CD  1 
ATOM   2451 O OE1 . GLU A 1 360 ? -32.267 24.818 86.807  1.00 49.10 ? 361  GLU A OE1 1 
ATOM   2452 O OE2 . GLU A 1 360 ? -30.494 23.539 86.795  1.00 49.39 ? 361  GLU A OE2 1 
ATOM   2453 N N   . SER A 1 361 ? -31.210 30.111 84.737  1.00 30.36 ? 362  SER A N   1 
ATOM   2454 C CA  . SER A 1 361 ? -31.906 31.033 83.843  1.00 33.80 ? 362  SER A CA  1 
ATOM   2455 C C   . SER A 1 361 ? -30.951 31.802 82.919  1.00 38.46 ? 362  SER A C   1 
ATOM   2456 O O   . SER A 1 361 ? -31.362 32.285 81.868  1.00 41.01 ? 362  SER A O   1 
ATOM   2457 C CB  . SER A 1 361 ? -32.774 32.013 84.630  1.00 31.93 ? 362  SER A CB  1 
ATOM   2458 O OG  . SER A 1 361 ? -31.966 32.988 85.282  1.00 40.30 ? 362  SER A OG  1 
ATOM   2459 N N   . LYS A 1 362 ? -29.680 31.906 83.297  1.00 38.80 ? 363  LYS A N   1 
ATOM   2460 C CA  . LYS A 1 362 ? -28.731 32.724 82.531  1.00 34.07 ? 363  LYS A CA  1 
ATOM   2461 C C   . LYS A 1 362 ? -27.695 31.883 81.797  1.00 32.96 ? 363  LYS A C   1 
ATOM   2462 O O   . LYS A 1 362 ? -26.855 32.404 81.062  1.00 30.79 ? 363  LYS A O   1 
ATOM   2463 C CB  . LYS A 1 362 ? -28.021 33.713 83.455  1.00 33.28 ? 363  LYS A CB  1 
ATOM   2464 C CG  . LYS A 1 362 ? -28.958 34.619 84.232  1.00 34.38 ? 363  LYS A CG  1 
ATOM   2465 C CD  . LYS A 1 362 ? -29.734 35.530 83.305  1.00 39.24 ? 363  LYS A CD  1 
ATOM   2466 C CE  . LYS A 1 362 ? -30.699 36.404 84.084  1.00 45.92 ? 363  LYS A CE  1 
ATOM   2467 N NZ  . LYS A 1 362 ? -31.679 37.073 83.176  1.00 56.23 ? 363  LYS A NZ  1 
ATOM   2468 N N   . SER A 1 363 ? -27.775 30.575 81.991  1.00 34.00 ? 364  SER A N   1 
ATOM   2469 C CA  . SER A 1 363 ? -26.754 29.657 81.513  1.00 33.31 ? 364  SER A CA  1 
ATOM   2470 C C   . SER A 1 363 ? -26.566 29.682 80.014  1.00 33.46 ? 364  SER A C   1 
ATOM   2471 O O   . SER A 1 363 ? -25.451 29.847 79.534  1.00 33.05 ? 364  SER A O   1 
ATOM   2472 C CB  . SER A 1 363 ? -27.081 28.240 81.962  1.00 34.69 ? 364  SER A CB  1 
ATOM   2473 O OG  . SER A 1 363 ? -27.038 28.196 83.367  1.00 45.89 ? 364  SER A OG  1 
ATOM   2474 N N   . GLU A 1 364 ? -27.661 29.503 79.284  1.00 34.14 ? 365  GLU A N   1 
ATOM   2475 C CA  . GLU A 1 364 ? -27.612 29.451 77.831  1.00 32.71 ? 365  GLU A CA  1 
ATOM   2476 C C   . GLU A 1 364 ? -27.021 30.739 77.284  1.00 35.88 ? 365  GLU A C   1 
ATOM   2477 O O   . GLU A 1 364 ? -26.150 30.714 76.414  1.00 35.11 ? 365  GLU A O   1 
ATOM   2478 C CB  . GLU A 1 364 ? -29.011 29.197 77.247  1.00 32.61 ? 365  GLU A CB  1 
ATOM   2479 N N   . GLU A 1 365 ? -27.473 31.870 77.811  1.00 35.27 ? 366  GLU A N   1 
ATOM   2480 C CA  . GLU A 1 365 ? -26.984 33.150 77.329  1.00 29.76 ? 366  GLU A CA  1 
ATOM   2481 C C   . GLU A 1 365 ? -25.490 33.343 77.624  1.00 34.03 ? 366  GLU A C   1 
ATOM   2482 O O   . GLU A 1 365 ? -24.731 33.739 76.746  1.00 35.83 ? 366  GLU A O   1 
ATOM   2483 C CB  . GLU A 1 365 ? -27.805 34.301 77.913  1.00 31.06 ? 366  GLU A CB  1 
ATOM   2484 C CG  . GLU A 1 365 ? -27.247 35.684 77.552  1.00 38.64 ? 366  GLU A CG  1 
ATOM   2485 C CD  . GLU A 1 365 ? -27.919 36.816 78.323  1.00 44.06 ? 366  GLU A CD  1 
ATOM   2486 O OE1 . GLU A 1 365 ? -28.913 36.552 79.037  1.00 48.69 ? 366  GLU A OE1 1 
ATOM   2487 O OE2 . GLU A 1 365 ? -27.455 37.969 78.219  1.00 46.26 ? 366  GLU A OE2 1 
ATOM   2488 N N   . PHE A 1 366 ? -25.079 33.071 78.862  1.00 33.60 ? 367  PHE A N   1 
ATOM   2489 C CA  . PHE A 1 366 ? -23.682 33.224 79.273  1.00 26.70 ? 367  PHE A CA  1 
ATOM   2490 C C   . PHE A 1 366 ? -22.795 32.330 78.397  1.00 28.49 ? 367  PHE A C   1 
ATOM   2491 O O   . PHE A 1 366 ? -21.827 32.786 77.792  1.00 26.27 ? 367  PHE A O   1 
ATOM   2492 C CB  . PHE A 1 366 ? -23.543 32.852 80.761  1.00 22.65 ? 367  PHE A CB  1 
ATOM   2493 C CG  . PHE A 1 366 ? -22.144 33.029 81.336  1.00 24.90 ? 367  PHE A CG  1 
ATOM   2494 C CD1 . PHE A 1 366 ? -21.114 32.152 81.015  1.00 26.36 ? 367  PHE A CD1 1 
ATOM   2495 C CD2 . PHE A 1 366 ? -21.878 34.053 82.239  1.00 25.69 ? 367  PHE A CD2 1 
ATOM   2496 C CE1 . PHE A 1 366 ? -19.822 32.318 81.560  1.00 20.33 ? 367  PHE A CE1 1 
ATOM   2497 C CE2 . PHE A 1 366 ? -20.604 34.225 82.789  1.00 20.66 ? 367  PHE A CE2 1 
ATOM   2498 C CZ  . PHE A 1 366 ? -19.579 33.361 82.447  1.00 20.07 ? 367  PHE A CZ  1 
ATOM   2499 N N   . LEU A 1 367 ? -23.147 31.053 78.312  1.00 28.04 ? 368  LEU A N   1 
ATOM   2500 C CA  . LEU A 1 367 ? -22.320 30.100 77.593  1.00 26.08 ? 368  LEU A CA  1 
ATOM   2501 C C   . LEU A 1 367 ? -22.261 30.422 76.101  1.00 33.18 ? 368  LEU A C   1 
ATOM   2502 O O   . LEU A 1 367 ? -21.192 30.367 75.500  1.00 34.22 ? 368  LEU A O   1 
ATOM   2503 C CB  . LEU A 1 367 ? -22.790 28.661 77.868  1.00 26.26 ? 368  LEU A CB  1 
ATOM   2504 C CG  . LEU A 1 367 ? -22.571 28.265 79.335  1.00 27.59 ? 368  LEU A CG  1 
ATOM   2505 C CD1 . LEU A 1 367 ? -23.234 26.918 79.654  1.00 26.28 ? 368  LEU A CD1 1 
ATOM   2506 C CD2 . LEU A 1 367 ? -21.079 28.242 79.693  1.00 24.07 ? 368  LEU A CD2 1 
ATOM   2507 N N   . SER A 1 368 ? -23.400 30.778 75.509  1.00 35.85 ? 369  SER A N   1 
ATOM   2508 C CA  . SER A 1 368 ? -23.408 31.198 74.108  1.00 35.86 ? 369  SER A CA  1 
ATOM   2509 C C   . SER A 1 368 ? -22.468 32.348 73.826  1.00 36.49 ? 369  SER A C   1 
ATOM   2510 O O   . SER A 1 368 ? -21.666 32.270 72.899  1.00 38.59 ? 369  SER A O   1 
ATOM   2511 C CB  . SER A 1 368 ? -24.810 31.565 73.641  1.00 37.62 ? 369  SER A CB  1 
ATOM   2512 O OG  . SER A 1 368 ? -25.544 30.387 73.439  1.00 40.26 ? 369  SER A OG  1 
ATOM   2513 N N   . ASP A 1 369 ? -22.573 33.418 74.611  1.00 34.28 ? 370  ASP A N   1 
ATOM   2514 C CA  . ASP A 1 369 ? -21.666 34.542 74.455  1.00 33.55 ? 370  ASP A CA  1 
ATOM   2515 C C   . ASP A 1 369 ? -20.219 34.057 74.588  1.00 38.46 ? 370  ASP A C   1 
ATOM   2516 O O   . ASP A 1 369 ? -19.359 34.407 73.771  1.00 38.25 ? 370  ASP A O   1 
ATOM   2517 C CB  . ASP A 1 369 ? -21.920 35.623 75.510  1.00 45.06 ? 370  ASP A CB  1 
ATOM   2518 C CG  . ASP A 1 369 ? -23.299 36.247 75.406  1.00 57.57 ? 370  ASP A CG  1 
ATOM   2519 O OD1 . ASP A 1 369 ? -23.967 36.087 74.365  1.00 66.02 ? 370  ASP A OD1 1 
ATOM   2520 O OD2 . ASP A 1 369 ? -23.713 36.916 76.375  1.00 58.91 ? 370  ASP A OD2 1 
ATOM   2521 N N   . MET A 1 370 ? -19.960 33.244 75.615  1.00 32.88 ? 371  MET A N   1 
ATOM   2522 C CA  . MET A 1 370 ? -18.598 32.789 75.882  1.00 31.03 ? 371  MET A CA  1 
ATOM   2523 C C   . MET A 1 370 ? -18.046 32.011 74.714  1.00 27.27 ? 371  MET A C   1 
ATOM   2524 O O   . MET A 1 370 ? -16.947 32.274 74.251  1.00 33.82 ? 371  MET A O   1 
ATOM   2525 C CB  . MET A 1 370 ? -18.516 31.923 77.143  1.00 31.67 ? 371  MET A CB  1 
ATOM   2526 C CG  . MET A 1 370 ? -17.107 31.347 77.379  1.00 27.85 ? 371  MET A CG  1 
ATOM   2527 S SD  . MET A 1 370 ? -16.932 30.511 78.969  1.00 29.58 ? 371  MET A SD  1 
ATOM   2528 C CE  . MET A 1 370 ? -16.676 31.897 80.037  1.00 33.98 ? 371  MET A CE  1 
ATOM   2529 N N   . PHE A 1 371 ? -18.814 31.046 74.240  1.00 26.88 ? 372  PHE A N   1 
ATOM   2530 C CA  . PHE A 1 371 ? -18.344 30.216 73.147  1.00 34.40 ? 372  PHE A CA  1 
ATOM   2531 C C   . PHE A 1 371 ? -18.177 31.047 71.867  1.00 37.61 ? 372  PHE A C   1 
ATOM   2532 O O   . PHE A 1 371 ? -17.203 30.875 71.138  1.00 38.90 ? 372  PHE A O   1 
ATOM   2533 C CB  . PHE A 1 371 ? -19.276 29.024 72.938  1.00 30.25 ? 372  PHE A CB  1 
ATOM   2534 C CG  . PHE A 1 371 ? -19.437 28.161 74.166  1.00 33.44 ? 372  PHE A CG  1 
ATOM   2535 C CD1 . PHE A 1 371 ? -18.489 28.189 75.182  1.00 33.53 ? 372  PHE A CD1 1 
ATOM   2536 C CD2 . PHE A 1 371 ? -20.535 27.327 74.306  1.00 35.36 ? 372  PHE A CD2 1 
ATOM   2537 C CE1 . PHE A 1 371 ? -18.631 27.399 76.310  1.00 32.88 ? 372  PHE A CE1 1 
ATOM   2538 C CE2 . PHE A 1 371 ? -20.682 26.534 75.438  1.00 34.04 ? 372  PHE A CE2 1 
ATOM   2539 C CZ  . PHE A 1 371 ? -19.721 26.574 76.439  1.00 29.84 ? 372  PHE A CZ  1 
ATOM   2540 N N   . GLY A 1 372 ? -19.111 31.955 71.604  1.00 34.58 ? 373  GLY A N   1 
ATOM   2541 C CA  . GLY A 1 372 ? -18.994 32.812 70.436  1.00 37.50 ? 373  GLY A CA  1 
ATOM   2542 C C   . GLY A 1 372 ? -17.742 33.672 70.517  1.00 42.60 ? 373  GLY A C   1 
ATOM   2543 O O   . GLY A 1 372 ? -17.026 33.840 69.527  1.00 45.41 ? 373  GLY A O   1 
ATOM   2544 N N   . ILE A 1 373 ? -17.464 34.199 71.707  1.00 38.77 ? 374  ILE A N   1 
ATOM   2545 C CA  . ILE A 1 373 ? -16.282 35.026 71.901  1.00 37.01 ? 374  ILE A CA  1 
ATOM   2546 C C   . ILE A 1 373 ? -14.994 34.215 71.792  1.00 41.37 ? 374  ILE A C   1 
ATOM   2547 O O   . ILE A 1 373 ? -14.034 34.658 71.175  1.00 41.46 ? 374  ILE A O   1 
ATOM   2548 C CB  . ILE A 1 373 ? -16.304 35.785 73.239  1.00 35.07 ? 374  ILE A CB  1 
ATOM   2549 C CG1 . ILE A 1 373 ? -17.419 36.835 73.235  1.00 36.74 ? 374  ILE A CG1 1 
ATOM   2550 C CG2 . ILE A 1 373 ? -14.951 36.468 73.479  1.00 32.52 ? 374  ILE A CG2 1 
ATOM   2551 C CD1 . ILE A 1 373 ? -17.702 37.439 74.598  1.00 37.59 ? 374  ILE A CD1 1 
ATOM   2552 N N   . LEU A 1 374 ? -14.974 33.029 72.387  1.00 39.94 ? 375  LEU A N   1 
ATOM   2553 C CA  . LEU A 1 374 ? -13.822 32.154 72.254  1.00 37.27 ? 375  LEU A CA  1 
ATOM   2554 C C   . LEU A 1 374 ? -13.636 31.797 70.785  1.00 40.12 ? 375  LEU A C   1 
ATOM   2555 O O   . LEU A 1 374 ? -12.516 31.745 70.282  1.00 40.61 ? 375  LEU A O   1 
ATOM   2556 C CB  . LEU A 1 374 ? -14.000 30.892 73.105  1.00 35.32 ? 375  LEU A CB  1 
ATOM   2557 C CG  . LEU A 1 374 ? -13.944 31.062 74.631  1.00 29.98 ? 375  LEU A CG  1 
ATOM   2558 C CD1 . LEU A 1 374 ? -14.216 29.739 75.356  1.00 25.01 ? 375  LEU A CD1 1 
ATOM   2559 C CD2 . LEU A 1 374 ? -12.616 31.659 75.056  1.00 21.89 ? 375  LEU A CD2 1 
ATOM   2560 N N   . GLN A 1 375 ? -14.747 31.574 70.091  1.00 49.58 ? 376  GLN A N   1 
ATOM   2561 C CA  . GLN A 1 375 ? -14.710 31.256 68.666  1.00 53.33 ? 376  GLN A CA  1 
ATOM   2562 C C   . GLN A 1 375 ? -14.112 32.382 67.822  1.00 54.93 ? 376  GLN A C   1 
ATOM   2563 O O   . GLN A 1 375 ? -13.229 32.147 66.993  1.00 54.93 ? 376  GLN A O   1 
ATOM   2564 C CB  . GLN A 1 375 ? -16.114 30.928 68.158  1.00 58.23 ? 376  GLN A CB  1 
ATOM   2565 C CG  . GLN A 1 375 ? -16.108 30.244 66.811  1.00 61.09 ? 376  GLN A CG  1 
ATOM   2566 C CD  . GLN A 1 375 ? -15.270 28.982 66.826  1.00 63.34 ? 376  GLN A CD  1 
ATOM   2567 O OE1 . GLN A 1 375 ? -14.373 28.812 65.999  1.00 66.83 ? 376  GLN A OE1 1 
ATOM   2568 N NE2 . GLN A 1 375 ? -15.559 28.085 67.767  1.00 58.83 ? 376  GLN A NE2 1 
ATOM   2569 N N   . SER A 1 376 ? -14.595 33.602 68.042  1.00 55.86 ? 377  SER A N   1 
ATOM   2570 C CA  . SER A 1 376 ? -14.158 34.765 67.270  1.00 54.43 ? 377  SER A CA  1 
ATOM   2571 C C   . SER A 1 376 ? -12.655 35.052 67.350  1.00 57.06 ? 377  SER A C   1 
ATOM   2572 O O   . SER A 1 376 ? -12.100 35.690 66.458  1.00 63.01 ? 377  SER A O   1 
ATOM   2573 C CB  . SER A 1 376 ? -14.960 36.008 67.675  1.00 53.67 ? 377  SER A CB  1 
ATOM   2574 N N   . GLN A 1 377 ? -11.993 34.586 68.407  1.00 56.35 ? 378  GLN A N   1 
ATOM   2575 C CA  . GLN A 1 377 ? -10.555 34.835 68.578  1.00 55.22 ? 378  GLN A CA  1 
ATOM   2576 C C   . GLN A 1 377 ? -9.731  34.025 67.582  1.00 60.90 ? 378  GLN A C   1 
ATOM   2577 O O   . GLN A 1 377 ? -10.186 32.992 67.081  1.00 64.56 ? 378  GLN A O   1 
ATOM   2578 C CB  . GLN A 1 377 ? -10.107 34.515 70.007  1.00 49.12 ? 378  GLN A CB  1 
ATOM   2579 N N   . PHE A 1 397 ? -5.997  27.949 70.159  1.00 61.10 ? 398  PHE A N   1 
ATOM   2580 C CA  . PHE A 1 397 ? -4.812  28.004 71.021  1.00 59.64 ? 398  PHE A CA  1 
ATOM   2581 C C   . PHE A 1 397 ? -4.373  29.446 71.244  1.00 59.15 ? 398  PHE A C   1 
ATOM   2582 O O   . PHE A 1 397 ? -4.047  30.152 70.295  1.00 59.76 ? 398  PHE A O   1 
ATOM   2583 C CB  . PHE A 1 397 ? -3.659  27.197 70.416  1.00 57.71 ? 398  PHE A CB  1 
ATOM   2584 C CG  . PHE A 1 397 ? -4.018  25.768 70.099  1.00 60.02 ? 398  PHE A CG  1 
ATOM   2585 C CD1 . PHE A 1 397 ? -4.775  25.011 70.987  1.00 54.55 ? 398  PHE A CD1 1 
ATOM   2586 C CD2 . PHE A 1 397 ? -3.618  25.182 68.901  1.00 57.29 ? 398  PHE A CD2 1 
ATOM   2587 C CE1 . PHE A 1 397 ? -5.116  23.688 70.687  1.00 49.11 ? 398  PHE A CE1 1 
ATOM   2588 C CE2 . PHE A 1 397 ? -3.959  23.861 68.602  1.00 52.78 ? 398  PHE A CE2 1 
ATOM   2589 C CZ  . PHE A 1 397 ? -4.707  23.118 69.500  1.00 46.16 ? 398  PHE A CZ  1 
ATOM   2590 N N   . MET A 1 398 ? -4.365  29.884 72.498  1.00 58.89 ? 399  MET A N   1 
ATOM   2591 C CA  . MET A 1 398 ? -3.980  31.255 72.814  1.00 58.70 ? 399  MET A CA  1 
ATOM   2592 C C   . MET A 1 398 ? -2.475  31.340 73.059  1.00 53.20 ? 399  MET A C   1 
ATOM   2593 O O   . MET A 1 398 ? -1.887  32.415 72.992  1.00 56.64 ? 399  MET A O   1 
ATOM   2594 C CB  . MET A 1 398 ? -4.760  31.756 74.036  1.00 61.33 ? 399  MET A CB  1 
ATOM   2595 C CG  . MET A 1 398 ? -6.284  31.577 73.937  1.00 61.72 ? 399  MET A CG  1 
ATOM   2596 S SD  . MET A 1 398 ? -7.195  32.552 75.164  1.00 74.49 ? 399  MET A SD  1 
ATOM   2597 C CE  . MET A 1 398 ? -8.856  32.544 74.486  1.00 39.10 ? 399  MET A CE  1 
ATOM   2598 N N   . GLY A 1 399 ? -1.871  30.184 73.328  1.00 44.50 ? 400  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 399 ? -0.471  30.054 73.703  1.00 33.25 ? 400  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 399 ? -0.301  28.640 74.245  1.00 27.44 ? 400  GLY A C   1 
ATOM   2601 O O   . GLY A 1 399 ? -1.291  27.959 74.481  1.00 27.90 ? 400  GLY A O   1 
ATOM   2602 N N   . PRO A 1 400 ? 0.942   28.186 74.450  1.00 25.67 ? 401  PRO A N   1 
ATOM   2603 C CA  . PRO A 1 400 ? 1.158   26.814 74.943  1.00 22.77 ? 401  PRO A CA  1 
ATOM   2604 C C   . PRO A 1 400 ? 1.114   26.712 76.471  1.00 22.51 ? 401  PRO A C   1 
ATOM   2605 O O   . PRO A 1 400 ? 1.211   27.739 77.159  1.00 21.94 ? 401  PRO A O   1 
ATOM   2606 C CB  . PRO A 1 400 ? 2.581   26.510 74.470  1.00 24.03 ? 401  PRO A CB  1 
ATOM   2607 C CG  . PRO A 1 400 ? 3.285   27.881 74.584  1.00 23.65 ? 401  PRO A CG  1 
ATOM   2608 C CD  . PRO A 1 400 ? 2.209   28.929 74.281  1.00 25.89 ? 401  PRO A CD  1 
ATOM   2609 N N   . VAL A 1 401 ? 0.955   25.493 76.993  1.00 23.18 ? 402  VAL A N   1 
ATOM   2610 C CA  . VAL A 1 401 ? 1.201   25.232 78.412  1.00 22.54 ? 402  VAL A CA  1 
ATOM   2611 C C   . VAL A 1 401 ? 2.697   24.943 78.513  1.00 25.70 ? 402  VAL A C   1 
ATOM   2612 O O   . VAL A 1 401 ? 3.347   24.754 77.490  1.00 25.32 ? 402  VAL A O   1 
ATOM   2613 C CB  . VAL A 1 401 ? 0.370   24.048 78.978  1.00 19.72 ? 402  VAL A CB  1 
ATOM   2614 C CG1 . VAL A 1 401 ? -1.084  24.416 79.087  1.00 23.35 ? 402  VAL A CG1 1 
ATOM   2615 C CG2 . VAL A 1 401 ? 0.525   22.801 78.131  1.00 20.87 ? 402  VAL A CG2 1 
ATOM   2616 N N   . ILE A 1 402 ? 3.227   24.882 79.731  1.00 19.44 ? 403  ILE A N   1 
ATOM   2617 C CA  . ILE A 1 402 ? 4.667   25.015 79.967  1.00 21.18 ? 403  ILE A CA  1 
ATOM   2618 C C   . ILE A 1 402 ? 5.530   23.837 79.517  1.00 26.50 ? 403  ILE A C   1 
ATOM   2619 O O   . ILE A 1 402 ? 6.630   24.033 79.017  1.00 31.23 ? 403  ILE A O   1 
ATOM   2620 C CB  . ILE A 1 402 ? 4.972   25.369 81.465  1.00 22.17 ? 403  ILE A CB  1 
ATOM   2621 C CG1 . ILE A 1 402 ? 6.473   25.574 81.704  1.00 18.77 ? 403  ILE A CG1 1 
ATOM   2622 C CG2 . ILE A 1 402 ? 4.402   24.310 82.426  1.00 21.83 ? 403  ILE A CG2 1 
ATOM   2623 C CD1 . ILE A 1 402 ? 7.036   26.737 80.941  1.00 20.11 ? 403  ILE A CD1 1 
ATOM   2624 N N   . HIS A 1 403 ? 5.053   22.617 79.701  1.00 26.30 ? 404  HIS A N   1 
ATOM   2625 C CA  . HIS A 1 403 ? 5.852   21.442 79.329  1.00 25.03 ? 404  HIS A CA  1 
ATOM   2626 C C   . HIS A 1 403 ? 4.991   20.214 79.073  1.00 26.80 ? 404  HIS A C   1 
ATOM   2627 O O   . HIS A 1 403 ? 3.769   20.244 79.251  1.00 26.15 ? 404  HIS A O   1 
ATOM   2628 C CB  . HIS A 1 403 ? 6.911   21.114 80.386  1.00 22.00 ? 404  HIS A CB  1 
ATOM   2629 C CG  . HIS A 1 403 ? 6.390   21.077 81.794  1.00 31.79 ? 404  HIS A CG  1 
ATOM   2630 N ND1 . HIS A 1 403 ? 5.261   20.373 82.159  1.00 27.85 ? 404  HIS A ND1 1 
ATOM   2631 C CD2 . HIS A 1 403 ? 6.856   21.650 82.930  1.00 32.90 ? 404  HIS A CD2 1 
ATOM   2632 C CE1 . HIS A 1 403 ? 5.061   20.507 83.458  1.00 26.34 ? 404  HIS A CE1 1 
ATOM   2633 N NE2 . HIS A 1 403 ? 6.011   21.283 83.949  1.00 26.85 ? 404  HIS A NE2 1 
ATOM   2634 N N   . GLU A 1 404 ? 5.648   19.132 78.678  1.00 25.51 ? 405  GLU A N   1 
ATOM   2635 C CA  . GLU A 1 404 ? 4.960   17.931 78.228  1.00 27.63 ? 405  GLU A CA  1 
ATOM   2636 C C   . GLU A 1 404 ? 4.180   17.282 79.346  1.00 26.46 ? 405  GLU A C   1 
ATOM   2637 O O   . GLU A 1 404 ? 3.112   16.705 79.108  1.00 28.13 ? 405  GLU A O   1 
ATOM   2638 C CB  . GLU A 1 404 ? 5.962   16.926 77.668  1.00 28.64 ? 405  GLU A CB  1 
ATOM   2639 C CG  . GLU A 1 404 ? 5.316   15.649 77.155  1.00 32.10 ? 405  GLU A CG  1 
ATOM   2640 C CD  . GLU A 1 404 ? 6.270   14.814 76.339  1.00 36.21 ? 405  GLU A CD  1 
ATOM   2641 O OE1 . GLU A 1 404 ? 7.491   14.993 76.489  1.00 44.79 ? 405  GLU A OE1 1 
ATOM   2642 O OE2 . GLU A 1 404 ? 5.801   13.994 75.531  1.00 41.65 ? 405  GLU A OE2 1 
ATOM   2643 N N   . GLN A 1 405 ? 4.725   17.367 80.561  1.00 23.88 ? 406  GLN A N   1 
ATOM   2644 C CA  . GLN A 1 405 ? 4.106   16.756 81.728  1.00 27.92 ? 406  GLN A CA  1 
ATOM   2645 C C   . GLN A 1 405 ? 2.766   17.436 82.023  1.00 30.81 ? 406  GLN A C   1 
ATOM   2646 O O   . GLN A 1 405 ? 1.791   16.774 82.346  1.00 30.25 ? 406  GLN A O   1 
ATOM   2647 C CB  . GLN A 1 405 ? 5.032   16.815 82.952  1.00 27.80 ? 406  GLN A CB  1 
ATOM   2648 C CG  . GLN A 1 405 ? 6.227   15.869 82.866  1.00 41.71 ? 406  GLN A CG  1 
ATOM   2649 C CD  . GLN A 1 405 ? 7.246   16.289 81.802  1.00 51.38 ? 406  GLN A CD  1 
ATOM   2650 O OE1 . GLN A 1 405 ? 7.552   17.478 81.653  1.00 44.21 ? 406  GLN A OE1 1 
ATOM   2651 N NE2 . GLN A 1 405 ? 7.759   15.313 81.046  1.00 57.01 ? 406  GLN A NE2 1 
ATOM   2652 N N   . SER A 1 406 ? 2.732   18.761 81.900  1.00 28.00 ? 407  SER A N   1 
ATOM   2653 C CA  . SER A 1 406 ? 1.476   19.487 82.009  1.00 25.33 ? 407  SER A CA  1 
ATOM   2654 C C   . SER A 1 406 ? 0.540   19.173 80.843  1.00 26.75 ? 407  SER A C   1 
ATOM   2655 O O   . SER A 1 406 ? -0.663  18.984 81.046  1.00 28.85 ? 407  SER A O   1 
ATOM   2656 C CB  . SER A 1 406 ? 1.705   20.990 82.078  1.00 22.20 ? 407  SER A CB  1 
ATOM   2657 O OG  . SER A 1 406 ? 0.465   21.666 81.972  1.00 21.71 ? 407  SER A OG  1 
ATOM   2658 N N   . PHE A 1 407 ? 1.084   19.137 79.626  1.00 26.43 ? 408  PHE A N   1 
ATOM   2659 C CA  . PHE A 1 407 ? 0.282   18.772 78.459  1.00 25.09 ? 408  PHE A CA  1 
ATOM   2660 C C   . PHE A 1 407 ? -0.391  17.409 78.665  1.00 25.60 ? 408  PHE A C   1 
ATOM   2661 O O   . PHE A 1 407 ? -1.596  17.255 78.434  1.00 23.39 ? 408  PHE A O   1 
ATOM   2662 C CB  . PHE A 1 407 ? 1.150   18.724 77.201  1.00 23.93 ? 408  PHE A CB  1 
ATOM   2663 C CG  . PHE A 1 407 ? 0.387   18.385 75.958  1.00 24.92 ? 408  PHE A CG  1 
ATOM   2664 C CD1 . PHE A 1 407 ? 0.207   17.066 75.572  1.00 26.07 ? 408  PHE A CD1 1 
ATOM   2665 C CD2 . PHE A 1 407 ? -0.171  19.390 75.175  1.00 24.81 ? 408  PHE A CD2 1 
ATOM   2666 C CE1 . PHE A 1 407 ? -0.498  16.759 74.420  1.00 27.08 ? 408  PHE A CE1 1 
ATOM   2667 C CE2 . PHE A 1 407 ? -0.886  19.081 74.020  1.00 25.84 ? 408  PHE A CE2 1 
ATOM   2668 C CZ  . PHE A 1 407 ? -1.047  17.762 73.646  1.00 26.96 ? 408  PHE A CZ  1 
ATOM   2669 N N   . ASP A 1 408 ? 0.394   16.419 79.091  1.00 24.82 ? 409  ASP A N   1 
ATOM   2670 C CA  . ASP A 1 408 ? -0.140  15.063 79.261  1.00 28.79 ? 409  ASP A CA  1 
ATOM   2671 C C   . ASP A 1 408 ? -1.209  14.987 80.371  1.00 29.66 ? 409  ASP A C   1 
ATOM   2672 O O   . ASP A 1 408 ? -2.207  14.288 80.210  1.00 30.65 ? 409  ASP A O   1 
ATOM   2673 C CB  . ASP A 1 408 ? 0.972   14.040 79.515  1.00 27.94 ? 409  ASP A CB  1 
ATOM   2674 C CG  . ASP A 1 408 ? 1.861   13.788 78.285  1.00 35.83 ? 409  ASP A CG  1 
ATOM   2675 O OD1 . ASP A 1 408 ? 1.421   14.002 77.132  1.00 35.70 ? 409  ASP A OD1 1 
ATOM   2676 O OD2 . ASP A 1 408 ? 3.015   13.349 78.482  1.00 42.31 ? 409  ASP A OD2 1 
ATOM   2677 N N   . LYS A 1 409 ? -1.016  15.706 81.481  1.00 23.96 ? 410  LYS A N   1 
ATOM   2678 C CA  . LYS A 1 409 ? -2.031  15.716 82.547  1.00 25.54 ? 410  LYS A CA  1 
ATOM   2679 C C   . LYS A 1 409 ? -3.355  16.274 82.019  1.00 21.70 ? 410  LYS A C   1 
ATOM   2680 O O   . LYS A 1 409 ? -4.428  15.746 82.287  1.00 30.90 ? 410  LYS A O   1 
ATOM   2681 C CB  . LYS A 1 409 ? -1.571  16.542 83.759  1.00 25.50 ? 410  LYS A CB  1 
ATOM   2682 N N   . LEU A 1 410 ? -3.258  17.360 81.266  1.00 23.69 ? 411  LEU A N   1 
ATOM   2683 C CA  . LEU A 1 410 ? -4.423  18.021 80.704  1.00 26.99 ? 411  LEU A CA  1 
ATOM   2684 C C   . LEU A 1 410 ? -5.153  17.160 79.657  1.00 31.80 ? 411  LEU A C   1 
ATOM   2685 O O   . LEU A 1 410 ? -6.379  17.210 79.543  1.00 29.52 ? 411  LEU A O   1 
ATOM   2686 C CB  . LEU A 1 410 ? -3.988  19.344 80.090  1.00 20.73 ? 411  LEU A CB  1 
ATOM   2687 C CG  . LEU A 1 410 ? -3.508  20.347 81.136  1.00 19.66 ? 411  LEU A CG  1 
ATOM   2688 C CD1 . LEU A 1 410 ? -2.860  21.538 80.455  1.00 19.50 ? 411  LEU A CD1 1 
ATOM   2689 C CD2 . LEU A 1 410 ? -4.710  20.784 81.953  1.00 20.34 ? 411  LEU A CD2 1 
ATOM   2690 N N   . VAL A 1 411 ? -4.394  16.395 78.879  1.00 28.75 ? 412  VAL A N   1 
ATOM   2691 C CA  . VAL A 1 411 ? -4.991  15.478 77.926  1.00 27.56 ? 412  VAL A CA  1 
ATOM   2692 C C   . VAL A 1 411 ? -5.818  14.440 78.680  1.00 27.12 ? 412  VAL A C   1 
ATOM   2693 O O   . VAL A 1 411 ? -6.930  14.118 78.283  1.00 31.75 ? 412  VAL A O   1 
ATOM   2694 C CB  . VAL A 1 411 ? -3.926  14.788 77.067  1.00 28.65 ? 412  VAL A CB  1 
ATOM   2695 C CG1 . VAL A 1 411 ? -4.476  13.486 76.471  1.00 31.09 ? 412  VAL A CG1 1 
ATOM   2696 C CG2 . VAL A 1 411 ? -3.465  15.717 75.983  1.00 25.87 ? 412  VAL A CG2 1 
ATOM   2697 N N   . LYS A 1 412 ? -5.279  13.949 79.791  1.00 26.59 ? 413  LYS A N   1 
ATOM   2698 C CA  . LYS A 1 412 ? -5.976  12.973 80.609  1.00 31.21 ? 413  LYS A CA  1 
ATOM   2699 C C   . LYS A 1 412 ? -7.265  13.561 81.176  1.00 29.30 ? 413  LYS A C   1 
ATOM   2700 O O   . LYS A 1 412 ? -8.305  12.906 81.196  1.00 30.39 ? 413  LYS A O   1 
ATOM   2701 C CB  . LYS A 1 412 ? -5.085  12.481 81.748  1.00 34.43 ? 413  LYS A CB  1 
ATOM   2702 C CG  . LYS A 1 412 ? -5.704  11.328 82.521  1.00 39.10 ? 413  LYS A CG  1 
ATOM   2703 C CD  . LYS A 1 412 ? -4.806  10.857 83.664  1.00 42.11 ? 413  LYS A CD  1 
ATOM   2704 C CE  . LYS A 1 412 ? -5.225  9.469  84.162  1.00 41.94 ? 413  LYS A CE  1 
ATOM   2705 N NZ  . LYS A 1 412 ? -6.701  9.353  84.304  1.00 38.75 ? 413  LYS A NZ  1 
ATOM   2706 N N   . VAL A 1 413 ? -7.186  14.800 81.632  1.00 28.05 ? 414  VAL A N   1 
ATOM   2707 C CA  . VAL A 1 413 ? -8.348  15.487 82.172  1.00 25.76 ? 414  VAL A CA  1 
ATOM   2708 C C   . VAL A 1 413 ? -9.455  15.539 81.132  1.00 28.28 ? 414  VAL A C   1 
ATOM   2709 O O   . VAL A 1 413 ? -10.623 15.240 81.428  1.00 24.03 ? 414  VAL A O   1 
ATOM   2710 C CB  . VAL A 1 413 ? -7.988  16.919 82.595  1.00 21.52 ? 414  VAL A CB  1 
ATOM   2711 C CG1 . VAL A 1 413 ? -9.249  17.709 82.921  1.00 20.89 ? 414  VAL A CG1 1 
ATOM   2712 C CG2 . VAL A 1 413 ? -7.042  16.873 83.782  1.00 27.87 ? 414  VAL A CG2 1 
ATOM   2713 N N   . ILE A 1 414 ? -9.076  15.913 79.910  1.00 26.56 ? 415  ILE A N   1 
ATOM   2714 C CA  . ILE A 1 414 ? -10.030 16.083 78.816  1.00 23.12 ? 415  ILE A CA  1 
ATOM   2715 C C   . ILE A 1 414 ? -10.605 14.735 78.391  1.00 29.74 ? 415  ILE A C   1 
ATOM   2716 O O   . ILE A 1 414 ? -11.826 14.569 78.251  1.00 30.23 ? 415  ILE A O   1 
ATOM   2717 C CB  . ILE A 1 414 ? -9.351  16.768 77.617  1.00 23.45 ? 415  ILE A CB  1 
ATOM   2718 C CG1 . ILE A 1 414 ? -9.113  18.250 77.922  1.00 22.40 ? 415  ILE A CG1 1 
ATOM   2719 C CG2 . ILE A 1 414 ? -10.145 16.576 76.321  1.00 24.44 ? 415  ILE A CG2 1 
ATOM   2720 C CD1 . ILE A 1 414 ? -8.193  18.914 76.940  1.00 22.71 ? 415  ILE A CD1 1 
ATOM   2721 N N   . GLU A 1 415 ? -9.723  13.763 78.204  1.00 30.94 ? 416  GLU A N   1 
ATOM   2722 C CA  . GLU A 1 415 ? -10.153 12.434 77.768  1.00 32.19 ? 416  GLU A CA  1 
ATOM   2723 C C   . GLU A 1 415 ? -11.035 11.753 78.807  1.00 30.42 ? 416  GLU A C   1 
ATOM   2724 O O   . GLU A 1 415 ? -12.050 11.161 78.459  1.00 32.72 ? 416  GLU A O   1 
ATOM   2725 C CB  . GLU A 1 415 ? -8.948  11.571 77.416  1.00 30.71 ? 416  GLU A CB  1 
ATOM   2726 C CG  . GLU A 1 415 ? -8.260  12.064 76.164  1.00 36.69 ? 416  GLU A CG  1 
ATOM   2727 C CD  . GLU A 1 415 ? -9.166  11.945 74.957  1.00 37.71 ? 416  GLU A CD  1 
ATOM   2728 O OE1 . GLU A 1 415 ? -9.912  10.953 74.888  1.00 41.97 ? 416  GLU A OE1 1 
ATOM   2729 O OE2 . GLU A 1 415 ? -9.143  12.838 74.086  1.00 40.85 ? 416  GLU A OE2 1 
ATOM   2730 N N   . ASP A 1 416 ? -10.655 11.861 80.079  1.00 30.03 ? 417  ASP A N   1 
ATOM   2731 C CA  . ASP A 1 416 ? -11.464 11.315 81.164  1.00 32.42 ? 417  ASP A CA  1 
ATOM   2732 C C   . ASP A 1 416 ? -12.850 11.957 81.177  1.00 38.22 ? 417  ASP A C   1 
ATOM   2733 O O   . ASP A 1 416 ? -13.846 11.275 81.433  1.00 39.11 ? 417  ASP A O   1 
ATOM   2734 C CB  . ASP A 1 416 ? -10.784 11.499 82.524  1.00 32.79 ? 417  ASP A CB  1 
ATOM   2735 C CG  . ASP A 1 416 ? -9.621  10.536 82.737  1.00 39.04 ? 417  ASP A CG  1 
ATOM   2736 O OD1 . ASP A 1 416 ? -9.454  9.606  81.922  1.00 37.48 ? 417  ASP A OD1 1 
ATOM   2737 O OD2 . ASP A 1 416 ? -8.886  10.702 83.735  1.00 41.51 ? 417  ASP A OD2 1 
ATOM   2738 N N   . ALA A 1 417 ? -12.915 13.256 80.876  1.00 32.41 ? 418  ALA A N   1 
ATOM   2739 C CA  . ALA A 1 417 ? -14.197 13.956 80.857  1.00 30.11 ? 418  ALA A CA  1 
ATOM   2740 C C   . ALA A 1 417 ? -15.149 13.302 79.856  1.00 38.06 ? 418  ALA A C   1 
ATOM   2741 O O   . ALA A 1 417 ? -16.354 13.258 80.079  1.00 39.61 ? 418  ALA A O   1 
ATOM   2742 C CB  . ALA A 1 417 ? -14.015 15.440 80.547  1.00 22.86 ? 418  ALA A CB  1 
ATOM   2743 N N   . LYS A 1 418 ? -14.603 12.761 78.768  1.00 38.32 ? 419  LYS A N   1 
ATOM   2744 C CA  . LYS A 1 418 ? -15.449 12.171 77.739  1.00 37.87 ? 419  LYS A CA  1 
ATOM   2745 C C   . LYS A 1 418 ? -16.077 10.873 78.215  1.00 34.80 ? 419  LYS A C   1 
ATOM   2746 O O   . LYS A 1 418 ? -17.075 10.430 77.662  1.00 41.41 ? 419  LYS A O   1 
ATOM   2747 C CB  . LYS A 1 418 ? -14.681 11.954 76.434  1.00 33.09 ? 419  LYS A CB  1 
ATOM   2748 C CG  . LYS A 1 418 ? -14.317 13.241 75.703  1.00 34.19 ? 419  LYS A CG  1 
ATOM   2749 C CD  . LYS A 1 418 ? -13.352 12.926 74.559  1.00 40.59 ? 419  LYS A CD  1 
ATOM   2750 C CE  . LYS A 1 418 ? -12.818 14.177 73.892  1.00 41.81 ? 419  LYS A CE  1 
ATOM   2751 N NZ  . LYS A 1 418 ? -11.481 13.959 73.262  1.00 43.24 ? 419  LYS A NZ  1 
ATOM   2752 N N   . LYS A 1 419 ? -15.507 10.271 79.253  1.00 38.27 ? 420  LYS A N   1 
ATOM   2753 C CA  . LYS A 1 419 ? -15.971 8.954  79.693  1.00 39.51 ? 420  LYS A CA  1 
ATOM   2754 C C   . LYS A 1 419 ? -16.798 9.024  80.967  1.00 38.57 ? 420  LYS A C   1 
ATOM   2755 O O   . LYS A 1 419 ? -17.271 8.003  81.454  1.00 46.31 ? 420  LYS A O   1 
ATOM   2756 C CB  . LYS A 1 419 ? -14.782 8.017  79.916  1.00 44.33 ? 420  LYS A CB  1 
ATOM   2757 C CG  . LYS A 1 419 ? -13.903 7.797  78.685  1.00 46.21 ? 420  LYS A CG  1 
ATOM   2758 C CD  . LYS A 1 419 ? -12.490 7.363  79.082  1.00 41.92 ? 420  LYS A CD  1 
ATOM   2759 N N   . ASP A 1 420 ? -16.957 10.229 81.508  1.00 34.73 ? 421  ASP A N   1 
ATOM   2760 C CA  . ASP A 1 420 ? -17.678 10.450 82.761  1.00 30.31 ? 421  ASP A CA  1 
ATOM   2761 C C   . ASP A 1 420 ? -19.087 10.959 82.471  1.00 33.44 ? 421  ASP A C   1 
ATOM   2762 O O   . ASP A 1 420 ? -19.261 12.004 81.846  1.00 33.76 ? 421  ASP A O   1 
ATOM   2763 C CB  . ASP A 1 420 ? -16.917 11.468 83.622  1.00 30.75 ? 421  ASP A CB  1 
ATOM   2764 C CG  . ASP A 1 420 ? -17.397 11.505 85.059  1.00 33.24 ? 421  ASP A CG  1 
ATOM   2765 O OD1 . ASP A 1 420 ? -18.590 11.250 85.322  1.00 34.88 ? 421  ASP A OD1 1 
ATOM   2766 O OD2 . ASP A 1 420 ? -16.572 11.804 85.942  1.00 34.92 ? 421  ASP A OD2 1 
ATOM   2767 N N   . PRO A 1 421 ? -20.109 10.212 82.924  1.00 34.07 ? 422  PRO A N   1 
ATOM   2768 C CA  . PRO A 1 421 ? -21.506 10.590 82.682  1.00 30.38 ? 422  PRO A CA  1 
ATOM   2769 C C   . PRO A 1 421 ? -21.914 11.898 83.366  1.00 28.39 ? 422  PRO A C   1 
ATOM   2770 O O   . PRO A 1 421 ? -22.878 12.530 82.920  1.00 25.95 ? 422  PRO A O   1 
ATOM   2771 C CB  . PRO A 1 421 ? -22.307 9.415  83.276  1.00 31.12 ? 422  PRO A CB  1 
ATOM   2772 C CG  . PRO A 1 421 ? -21.321 8.295  83.413  1.00 30.38 ? 422  PRO A CG  1 
ATOM   2773 C CD  . PRO A 1 421 ? -19.993 8.939  83.654  1.00 31.48 ? 422  PRO A CD  1 
ATOM   2774 N N   . GLU A 1 422 ? -21.219 12.288 84.432  1.00 29.15 ? 423  GLU A N   1 
ATOM   2775 C CA  . GLU A 1 422 ? -21.521 13.555 85.112  1.00 29.15 ? 423  GLU A CA  1 
ATOM   2776 C C   . GLU A 1 422 ? -20.776 14.757 84.531  1.00 31.93 ? 423  GLU A C   1 
ATOM   2777 O O   . GLU A 1 422 ? -20.944 15.888 85.008  1.00 30.37 ? 423  GLU A O   1 
ATOM   2778 C CB  . GLU A 1 422 ? -21.231 13.446 86.607  1.00 30.58 ? 423  GLU A CB  1 
ATOM   2779 C CG  . GLU A 1 422 ? -22.167 12.462 87.315  1.00 36.54 ? 423  GLU A CG  1 
ATOM   2780 C CD  . GLU A 1 422 ? -21.912 12.395 88.800  1.00 39.88 ? 423  GLU A CD  1 
ATOM   2781 O OE1 . GLU A 1 422 ? -20.739 12.498 89.219  1.00 42.07 ? 423  GLU A OE1 1 
ATOM   2782 O OE2 . GLU A 1 422 ? -22.888 12.250 89.553  1.00 45.69 ? 423  GLU A OE2 1 
ATOM   2783 N N   . LEU A 1 423 ? -19.949 14.511 83.513  1.00 30.05 ? 424  LEU A N   1 
ATOM   2784 C CA  . LEU A 1 423 ? -19.196 15.583 82.860  1.00 32.29 ? 424  LEU A CA  1 
ATOM   2785 C C   . LEU A 1 423 ? -19.625 15.721 81.417  1.00 30.03 ? 424  LEU A C   1 
ATOM   2786 O O   . LEU A 1 423 ? -20.000 14.744 80.774  1.00 31.79 ? 424  LEU A O   1 
ATOM   2787 C CB  . LEU A 1 423 ? -17.684 15.302 82.905  1.00 22.64 ? 424  LEU A CB  1 
ATOM   2788 C CG  . LEU A 1 423 ? -17.093 15.266 84.315  1.00 29.50 ? 424  LEU A CG  1 
ATOM   2789 C CD1 . LEU A 1 423 ? -15.608 14.924 84.272  1.00 29.91 ? 424  LEU A CD1 1 
ATOM   2790 C CD2 . LEU A 1 423 ? -17.315 16.599 85.017  1.00 24.86 ? 424  LEU A CD2 1 
ATOM   2791 N N   . GLU A 1 424 ? -19.535 16.931 80.890  1.00 30.29 ? 425  GLU A N   1 
ATOM   2792 C CA  . GLU A 1 424 ? -19.792 17.129 79.473  1.00 34.06 ? 425  GLU A CA  1 
ATOM   2793 C C   . GLU A 1 424 ? -18.943 18.262 78.930  1.00 28.38 ? 425  GLU A C   1 
ATOM   2794 O O   . GLU A 1 424 ? -18.979 19.380 79.443  1.00 32.06 ? 425  GLU A O   1 
ATOM   2795 C CB  . GLU A 1 424 ? -21.282 17.391 79.225  1.00 36.35 ? 425  GLU A CB  1 
ATOM   2796 C CG  . GLU A 1 424 ? -21.604 17.657 77.772  1.00 43.92 ? 425  GLU A CG  1 
ATOM   2797 C CD  . GLU A 1 424 ? -23.064 18.003 77.542  1.00 53.30 ? 425  GLU A CD  1 
ATOM   2798 O OE1 . GLU A 1 424 ? -23.887 17.788 78.461  1.00 58.40 ? 425  GLU A OE1 1 
ATOM   2799 O OE2 . GLU A 1 424 ? -23.384 18.503 76.441  1.00 58.31 ? 425  GLU A OE2 1 
ATOM   2800 N N   . ILE A 1 425 ? -18.159 17.973 77.899  1.00 26.66 ? 426  ILE A N   1 
ATOM   2801 C CA  . ILE A 1 425 ? -17.356 19.014 77.276  1.00 29.80 ? 426  ILE A CA  1 
ATOM   2802 C C   . ILE A 1 425 ? -18.238 19.894 76.409  1.00 33.17 ? 426  ILE A C   1 
ATOM   2803 O O   . ILE A 1 425 ? -18.716 19.464 75.363  1.00 33.77 ? 426  ILE A O   1 
ATOM   2804 C CB  . ILE A 1 425 ? -16.203 18.454 76.441  1.00 29.51 ? 426  ILE A CB  1 
ATOM   2805 C CG1 . ILE A 1 425 ? -15.335 17.544 77.304  1.00 30.60 ? 426  ILE A CG1 1 
ATOM   2806 C CG2 . ILE A 1 425 ? -15.360 19.585 75.901  1.00 28.16 ? 426  ILE A CG2 1 
ATOM   2807 C CD1 . ILE A 1 425 ? -14.166 16.972 76.567  1.00 26.56 ? 426  ILE A CD1 1 
ATOM   2808 N N   . LEU A 1 426 ? -18.457 21.128 76.852  1.00 28.92 ? 427  LEU A N   1 
ATOM   2809 C CA  . LEU A 1 426 ? -19.344 22.027 76.128  1.00 29.08 ? 427  LEU A CA  1 
ATOM   2810 C C   . LEU A 1 426 ? -18.608 22.734 75.015  1.00 31.72 ? 427  LEU A C   1 
ATOM   2811 O O   . LEU A 1 426 ? -19.203 23.111 74.006  1.00 30.65 ? 427  LEU A O   1 
ATOM   2812 C CB  . LEU A 1 426 ? -19.972 23.048 77.069  1.00 27.92 ? 427  LEU A CB  1 
ATOM   2813 C CG  . LEU A 1 426 ? -20.887 22.453 78.136  1.00 29.14 ? 427  LEU A CG  1 
ATOM   2814 C CD1 . LEU A 1 426 ? -21.268 23.514 79.153  1.00 33.33 ? 427  LEU A CD1 1 
ATOM   2815 C CD2 . LEU A 1 426 ? -22.121 21.851 77.489  1.00 32.04 ? 427  LEU A CD2 1 
ATOM   2816 N N   . TYR A 1 427 ? -17.307 22.907 75.194  1.00 28.76 ? 428  TYR A N   1 
ATOM   2817 C CA  . TYR A 1 427 ? -16.521 23.651 74.229  1.00 30.63 ? 428  TYR A CA  1 
ATOM   2818 C C   . TYR A 1 427 ? -15.086 23.238 74.347  1.00 28.92 ? 428  TYR A C   1 
ATOM   2819 O O   . TYR A 1 427 ? -14.596 23.043 75.456  1.00 27.21 ? 428  TYR A O   1 
ATOM   2820 C CB  . TYR A 1 427 ? -16.599 25.150 74.524  1.00 32.12 ? 428  TYR A CB  1 
ATOM   2821 C CG  . TYR A 1 427 ? -15.815 26.004 73.543  1.00 35.71 ? 428  TYR A CG  1 
ATOM   2822 C CD1 . TYR A 1 427 ? -16.410 26.488 72.377  1.00 37.50 ? 428  TYR A CD1 1 
ATOM   2823 C CD2 . TYR A 1 427 ? -14.479 26.321 73.774  1.00 36.98 ? 428  TYR A CD2 1 
ATOM   2824 C CE1 . TYR A 1 427 ? -15.691 27.268 71.468  1.00 40.49 ? 428  TYR A CE1 1 
ATOM   2825 C CE2 . TYR A 1 427 ? -13.752 27.105 72.874  1.00 37.08 ? 428  TYR A CE2 1 
ATOM   2826 C CZ  . TYR A 1 427 ? -14.363 27.573 71.725  1.00 40.93 ? 428  TYR A CZ  1 
ATOM   2827 O OH  . TYR A 1 427 ? -13.653 28.351 70.838  1.00 43.57 ? 428  TYR A OH  1 
ATOM   2828 N N   . GLY A 1 428 ? -14.411 23.126 73.207  1.00 31.54 ? 429  GLY A N   1 
ATOM   2829 C CA  . GLY A 1 428 ? -12.962 23.023 73.174  1.00 26.20 ? 429  GLY A CA  1 
ATOM   2830 C C   . GLY A 1 428 ? -12.465 21.609 73.355  1.00 28.89 ? 429  GLY A C   1 
ATOM   2831 O O   . GLY A 1 428 ? -12.959 20.701 72.710  1.00 32.25 ? 429  GLY A O   1 
ATOM   2832 N N   . GLY A 1 429 ? -11.479 21.423 74.229  1.00 29.96 ? 430  GLY A N   1 
ATOM   2833 C CA  . GLY A 1 429 ? -10.931 20.100 74.470  1.00 29.28 ? 430  GLY A CA  1 
ATOM   2834 C C   . GLY A 1 429 ? -9.949  19.635 73.409  1.00 32.25 ? 430  GLY A C   1 
ATOM   2835 O O   . GLY A 1 429 ? -9.589  18.459 73.355  1.00 37.35 ? 430  GLY A O   1 
ATOM   2836 N N   . GLN A 1 430 ? -9.504  20.555 72.563  1.00 31.09 ? 431  GLN A N   1 
ATOM   2837 C CA  . GLN A 1 430 ? -8.513  20.224 71.542  1.00 34.21 ? 431  GLN A CA  1 
ATOM   2838 C C   . GLN A 1 430 ? -7.089  20.374 72.051  1.00 32.82 ? 431  GLN A C   1 
ATOM   2839 O O   . GLN A 1 430 ? -6.780  21.281 72.826  1.00 31.05 ? 431  GLN A O   1 
ATOM   2840 C CB  . GLN A 1 430 ? -8.689  21.110 70.318  1.00 42.86 ? 431  GLN A CB  1 
ATOM   2841 C CG  . GLN A 1 430 ? -9.830  20.693 69.436  1.00 55.43 ? 431  GLN A CG  1 
ATOM   2842 C CD  . GLN A 1 430 ? -10.702 21.862 69.089  1.00 66.45 ? 431  GLN A CD  1 
ATOM   2843 O OE1 . GLN A 1 430 ? -10.812 22.817 69.864  1.00 68.60 ? 431  GLN A OE1 1 
ATOM   2844 N NE2 . GLN A 1 430 ? -11.328 21.809 67.918  1.00 70.98 ? 431  GLN A NE2 1 
ATOM   2845 N N   . TYR A 1 431 ? -6.213  19.506 71.570  1.00 31.39 ? 432  TYR A N   1 
ATOM   2846 C CA  . TYR A 1 431 ? -4.816  19.532 71.976  1.00 35.97 ? 432  TYR A CA  1 
ATOM   2847 C C   . TYR A 1 431 ? -3.961  18.980 70.849  1.00 34.05 ? 432  TYR A C   1 
ATOM   2848 O O   . TYR A 1 431 ? -4.443  18.203 70.034  1.00 33.21 ? 432  TYR A O   1 
ATOM   2849 C CB  . TYR A 1 431 ? -4.611  18.731 73.260  1.00 29.94 ? 432  TYR A CB  1 
ATOM   2850 C CG  . TYR A 1 431 ? -5.187  17.333 73.216  1.00 37.31 ? 432  TYR A CG  1 
ATOM   2851 C CD1 . TYR A 1 431 ? -4.464  16.279 72.673  1.00 34.91 ? 432  TYR A CD1 1 
ATOM   2852 C CD2 . TYR A 1 431 ? -6.461  17.070 73.717  1.00 37.53 ? 432  TYR A CD2 1 
ATOM   2853 C CE1 . TYR A 1 431 ? -4.989  15.000 72.635  1.00 34.23 ? 432  TYR A CE1 1 
ATOM   2854 C CE2 . TYR A 1 431 ? -6.996  15.804 73.678  1.00 35.30 ? 432  TYR A CE2 1 
ATOM   2855 C CZ  . TYR A 1 431 ? -6.260  14.767 73.138  1.00 37.48 ? 432  TYR A CZ  1 
ATOM   2856 O OH  . TYR A 1 431 ? -6.801  13.493 73.106  1.00 38.49 ? 432  TYR A OH  1 
ATOM   2857 N N   . ASP A 1 432 ? -2.703  19.403 70.804  1.00 35.28 ? 433  ASP A N   1 
ATOM   2858 C CA  . ASP A 1 432 ? -1.766  19.042 69.732  1.00 34.46 ? 433  ASP A CA  1 
ATOM   2859 C C   . ASP A 1 432 ? -0.354  19.324 70.240  1.00 34.48 ? 433  ASP A C   1 
ATOM   2860 O O   . ASP A 1 432 ? -0.023  20.466 70.551  1.00 34.12 ? 433  ASP A O   1 
ATOM   2861 C CB  . ASP A 1 432 ? -2.042  19.907 68.505  1.00 38.41 ? 433  ASP A CB  1 
ATOM   2862 C CG  . ASP A 1 432 ? -1.233  19.490 67.277  1.00 44.15 ? 433  ASP A CG  1 
ATOM   2863 O OD1 . ASP A 1 432 ? -0.157  18.870 67.415  1.00 42.39 ? 433  ASP A OD1 1 
ATOM   2864 O OD2 . ASP A 1 432 ? -1.681  19.814 66.158  1.00 51.64 ? 433  ASP A OD2 1 
ATOM   2865 N N   . LYS A 1 433 ? 0.473   18.287 70.331  1.00 33.74 ? 434  LYS A N   1 
ATOM   2866 C CA  . LYS A 1 433 ? 1.829   18.430 70.839  1.00 30.12 ? 434  LYS A CA  1 
ATOM   2867 C C   . LYS A 1 433 ? 2.839   18.258 69.705  1.00 40.86 ? 434  LYS A C   1 
ATOM   2868 O O   . LYS A 1 433 ? 4.019   18.023 69.964  1.00 39.03 ? 434  LYS A O   1 
ATOM   2869 C CB  . LYS A 1 433 ? 2.109   17.395 71.938  1.00 41.35 ? 434  LYS A CB  1 
ATOM   2870 C CG  . LYS A 1 433 ? 1.839   15.934 71.503  1.00 43.17 ? 434  LYS A CG  1 
ATOM   2871 C CD  . LYS A 1 433 ? 2.642   14.886 72.301  1.00 43.67 ? 434  LYS A CD  1 
ATOM   2872 C CE  . LYS A 1 433 ? 2.290   14.880 73.795  1.00 45.42 ? 434  LYS A CE  1 
ATOM   2873 N NZ  . LYS A 1 433 ? 2.965   13.790 74.563  1.00 42.18 ? 434  LYS A NZ  1 
ATOM   2874 N N   . SER A 1 434 ? 2.384   18.350 68.453  1.00 35.07 ? 435  SER A N   1 
ATOM   2875 C CA  . SER A 1 434 ? 3.296   18.155 67.319  1.00 39.87 ? 435  SER A CA  1 
ATOM   2876 C C   . SER A 1 434 ? 4.384   19.237 67.206  1.00 38.53 ? 435  SER A C   1 
ATOM   2877 O O   . SER A 1 434 ? 5.497   18.948 66.770  1.00 41.80 ? 435  SER A O   1 
ATOM   2878 C CB  . SER A 1 434 ? 2.532   17.989 65.989  1.00 43.41 ? 435  SER A CB  1 
ATOM   2879 O OG  . SER A 1 434 ? 1.853   19.176 65.618  1.00 43.79 ? 435  SER A OG  1 
ATOM   2880 N N   . GLN A 1 435 ? 4.075   20.470 67.609  1.00 35.74 ? 436  GLN A N   1 
ATOM   2881 C CA  . GLN A 1 435 ? 5.057   21.561 67.524  1.00 38.27 ? 436  GLN A CA  1 
ATOM   2882 C C   . GLN A 1 435 ? 5.372   22.165 68.894  1.00 36.52 ? 436  GLN A C   1 
ATOM   2883 O O   . GLN A 1 435 ? 6.539   22.323 69.256  1.00 34.11 ? 436  GLN A O   1 
ATOM   2884 C CB  . GLN A 1 435 ? 4.583   22.655 66.559  1.00 38.45 ? 436  GLN A CB  1 
ATOM   2885 N N   . GLY A 1 436 ? 4.327   22.514 69.646  1.00 29.91 ? 437  GLY A N   1 
ATOM   2886 C CA  . GLY A 1 436 ? 4.482   22.996 71.012  1.00 31.18 ? 437  GLY A CA  1 
ATOM   2887 C C   . GLY A 1 436 ? 3.443   22.312 71.888  1.00 34.79 ? 437  GLY A C   1 
ATOM   2888 O O   . GLY A 1 436 ? 2.710   21.449 71.395  1.00 33.96 ? 437  GLY A O   1 
ATOM   2889 N N   . TRP A 1 437 ? 3.371   22.673 73.173  1.00 27.95 ? 438  TRP A N   1 
ATOM   2890 C CA  . TRP A 1 437 ? 2.402   22.032 74.066  1.00 24.98 ? 438  TRP A CA  1 
ATOM   2891 C C   . TRP A 1 437 ? 1.101   22.802 74.046  1.00 31.10 ? 438  TRP A C   1 
ATOM   2892 O O   . TRP A 1 437 ? 0.836   23.600 74.938  1.00 29.55 ? 438  TRP A O   1 
ATOM   2893 C CB  . TRP A 1 437 ? 2.932   21.923 75.490  1.00 23.93 ? 438  TRP A CB  1 
ATOM   2894 C CG  . TRP A 1 437 ? 4.356   21.495 75.528  1.00 28.25 ? 438  TRP A CG  1 
ATOM   2895 C CD1 . TRP A 1 437 ? 5.417   22.231 75.963  1.00 28.61 ? 438  TRP A CD1 1 
ATOM   2896 C CD2 . TRP A 1 437 ? 4.889   20.243 75.083  1.00 29.56 ? 438  TRP A CD2 1 
ATOM   2897 N NE1 . TRP A 1 437 ? 6.580   21.508 75.827  1.00 29.09 ? 438  TRP A NE1 1 
ATOM   2898 C CE2 . TRP A 1 437 ? 6.283   20.287 75.284  1.00 30.52 ? 438  TRP A CE2 1 
ATOM   2899 C CE3 . TRP A 1 437 ? 4.320   19.083 74.540  1.00 31.92 ? 438  TRP A CE3 1 
ATOM   2900 C CZ2 . TRP A 1 437 ? 7.122   19.217 74.961  1.00 31.55 ? 438  TRP A CZ2 1 
ATOM   2901 C CZ3 . TRP A 1 437 ? 5.157   18.018 74.218  1.00 31.69 ? 438  TRP A CZ3 1 
ATOM   2902 C CH2 . TRP A 1 437 ? 6.540   18.097 74.428  1.00 29.29 ? 438  TRP A CH2 1 
ATOM   2903 N N   . PHE A 1 438 ? 0.287   22.558 73.021  1.00 28.82 ? 439  PHE A N   1 
ATOM   2904 C CA  . PHE A 1 438 ? -0.906  23.366 72.799  1.00 27.84 ? 439  PHE A CA  1 
ATOM   2905 C C   . PHE A 1 438 ? -2.201  22.654 73.221  1.00 30.04 ? 439  PHE A C   1 
ATOM   2906 O O   . PHE A 1 438 ? -2.562  21.625 72.665  1.00 27.60 ? 439  PHE A O   1 
ATOM   2907 C CB  . PHE A 1 438 ? -0.978  23.826 71.334  1.00 26.80 ? 439  PHE A CB  1 
ATOM   2908 C CG  . PHE A 1 438 ? 0.067   24.848 70.970  1.00 28.30 ? 439  PHE A CG  1 
ATOM   2909 C CD1 . PHE A 1 438 ? -0.083  26.179 71.356  1.00 28.00 ? 439  PHE A CD1 1 
ATOM   2910 C CD2 . PHE A 1 438 ? 1.210   24.478 70.268  1.00 30.33 ? 439  PHE A CD2 1 
ATOM   2911 C CE1 . PHE A 1 438 ? 0.881   27.130 71.035  1.00 29.30 ? 439  PHE A CE1 1 
ATOM   2912 C CE2 . PHE A 1 438 ? 2.187   25.423 69.946  1.00 28.99 ? 439  PHE A CE2 1 
ATOM   2913 C CZ  . PHE A 1 438 ? 2.018   26.753 70.321  1.00 26.69 ? 439  PHE A CZ  1 
ATOM   2914 N N   . VAL A 1 439 ? -2.874  23.225 74.214  1.00 27.11 ? 440  VAL A N   1 
ATOM   2915 C CA  . VAL A 1 439 ? -4.166  22.760 74.682  1.00 23.58 ? 440  VAL A CA  1 
ATOM   2916 C C   . VAL A 1 439 ? -5.099  23.948 74.564  1.00 24.96 ? 440  VAL A C   1 
ATOM   2917 O O   . VAL A 1 439 ? -4.823  25.027 75.100  1.00 25.14 ? 440  VAL A O   1 
ATOM   2918 C CB  . VAL A 1 439 ? -4.122  22.296 76.172  1.00 24.35 ? 440  VAL A CB  1 
ATOM   2919 C CG1 . VAL A 1 439 ? -5.492  21.770 76.606  1.00 22.78 ? 440  VAL A CG1 1 
ATOM   2920 C CG2 . VAL A 1 439 ? -3.069  21.225 76.380  1.00 22.33 ? 440  VAL A CG2 1 
ATOM   2921 N N   . GLY A 1 440 ? -6.208  23.764 73.869  1.00 25.94 ? 441  GLY A N   1 
ATOM   2922 C CA  . GLY A 1 440 ? -7.116  24.864 73.627  1.00 24.40 ? 441  GLY A CA  1 
ATOM   2923 C C   . GLY A 1 440 ? -8.032  25.075 74.809  1.00 26.38 ? 441  GLY A C   1 
ATOM   2924 O O   . GLY A 1 440 ? -8.157  24.197 75.666  1.00 24.50 ? 441  GLY A O   1 
ATOM   2925 N N   . PRO A 1 441 ? -8.689  26.238 74.852  1.00 25.52 ? 442  PRO A N   1 
ATOM   2926 C CA  . PRO A 1 441 ? -9.640  26.578 75.908  1.00 30.09 ? 442  PRO A CA  1 
ATOM   2927 C C   . PRO A 1 441 ? -10.664 25.465 75.971  1.00 30.00 ? 442  PRO A C   1 
ATOM   2928 O O   . PRO A 1 441 ? -11.082 24.994 74.923  1.00 37.58 ? 442  PRO A O   1 
ATOM   2929 C CB  . PRO A 1 441 ? -10.293 27.861 75.385  1.00 30.94 ? 442  PRO A CB  1 
ATOM   2930 C CG  . PRO A 1 441 ? -9.310  28.436 74.465  1.00 32.77 ? 442  PRO A CG  1 
ATOM   2931 C CD  . PRO A 1 441 ? -8.618  27.275 73.815  1.00 30.00 ? 442  PRO A CD  1 
ATOM   2932 N N   . THR A 1 442 ? -11.032 25.029 77.167  1.00 26.97 ? 443  THR A N   1 
ATOM   2933 C CA  . THR A 1 442 ? -11.938 23.903 77.312  1.00 26.37 ? 443  THR A CA  1 
ATOM   2934 C C   . THR A 1 442 ? -12.923 24.211 78.415  1.00 25.91 ? 443  THR A C   1 
ATOM   2935 O O   . THR A 1 442 ? -12.518 24.621 79.497  1.00 22.00 ? 443  THR A O   1 
ATOM   2936 C CB  . THR A 1 442 ? -11.165 22.619 77.662  1.00 23.94 ? 443  THR A CB  1 
ATOM   2937 O OG1 . THR A 1 442 ? -10.210 22.352 76.631  1.00 27.21 ? 443  THR A OG1 1 
ATOM   2938 C CG2 . THR A 1 442 ? -12.106 21.441 77.796  1.00 26.04 ? 443  THR A CG2 1 
ATOM   2939 N N   . VAL A 1 443 ? -14.213 24.036 78.135  1.00 24.71 ? 444  VAL A N   1 
ATOM   2940 C CA  . VAL A 1 443 ? -15.254 24.261 79.138  1.00 20.69 ? 444  VAL A CA  1 
ATOM   2941 C C   . VAL A 1 443 ? -16.016 22.972 79.336  1.00 25.32 ? 444  VAL A C   1 
ATOM   2942 O O   . VAL A 1 443 ? -16.608 22.445 78.399  1.00 24.95 ? 444  VAL A O   1 
ATOM   2943 C CB  . VAL A 1 443 ? -16.220 25.381 78.711  1.00 20.38 ? 444  VAL A CB  1 
ATOM   2944 C CG1 . VAL A 1 443 ? -17.293 25.627 79.780  1.00 20.10 ? 444  VAL A CG1 1 
ATOM   2945 C CG2 . VAL A 1 443 ? -15.447 26.650 78.416  1.00 26.12 ? 444  VAL A CG2 1 
ATOM   2946 N N   . ILE A 1 444 ? -15.976 22.462 80.561  1.00 26.32 ? 445  ILE A N   1 
ATOM   2947 C CA  . ILE A 1 444 ? -16.597 21.197 80.925  1.00 20.46 ? 445  ILE A CA  1 
ATOM   2948 C C   . ILE A 1 444 ? -17.705 21.449 81.947  1.00 25.76 ? 445  ILE A C   1 
ATOM   2949 O O   . ILE A 1 444 ? -17.476 22.106 82.967  1.00 22.88 ? 445  ILE A O   1 
ATOM   2950 C CB  . ILE A 1 444 ? -15.555 20.248 81.544  1.00 24.56 ? 445  ILE A CB  1 
ATOM   2951 C CG1 . ILE A 1 444 ? -14.308 20.174 80.646  1.00 24.20 ? 445  ILE A CG1 1 
ATOM   2952 C CG2 . ILE A 1 444 ? -16.163 18.871 81.804  1.00 21.36 ? 445  ILE A CG2 1 
ATOM   2953 C CD1 . ILE A 1 444 ? -13.268 19.141 81.079  1.00 20.55 ? 445  ILE A CD1 1 
ATOM   2954 N N   . LYS A 1 445 ? -18.908 20.959 81.655  1.00 21.88 ? 446  LYS A N   1 
ATOM   2955 C CA  . LYS A 1 445 ? -20.037 21.065 82.568  1.00 24.45 ? 446  LYS A CA  1 
ATOM   2956 C C   . LYS A 1 445 ? -20.069 19.866 83.525  1.00 23.97 ? 446  LYS A C   1 
ATOM   2957 O O   . LYS A 1 445 ? -20.010 18.724 83.095  1.00 22.83 ? 446  LYS A O   1 
ATOM   2958 C CB  . LYS A 1 445 ? -21.352 21.143 81.776  1.00 29.70 ? 446  LYS A CB  1 
ATOM   2959 C CG  . LYS A 1 445 ? -22.619 21.093 82.621  1.00 29.32 ? 446  LYS A CG  1 
ATOM   2960 C CD  . LYS A 1 445 ? -23.869 21.337 81.744  1.00 37.63 ? 446  LYS A CD  1 
ATOM   2961 C CE  . LYS A 1 445 ? -25.185 21.282 82.546  1.00 33.87 ? 446  LYS A CE  1 
ATOM   2962 N NZ  . LYS A 1 445 ? -26.375 21.429 81.642  1.00 37.44 ? 446  LYS A NZ  1 
ATOM   2963 N N   . ALA A 1 446 ? -20.140 20.126 84.825  1.00 20.64 ? 447  ALA A N   1 
ATOM   2964 C CA  . ALA A 1 446 ? -20.278 19.047 85.800  1.00 20.90 ? 447  ALA A CA  1 
ATOM   2965 C C   . ALA A 1 446 ? -21.719 19.003 86.268  1.00 26.09 ? 447  ALA A C   1 
ATOM   2966 O O   . ALA A 1 446 ? -22.360 20.047 86.460  1.00 23.50 ? 447  ALA A O   1 
ATOM   2967 C CB  . ALA A 1 446 ? -19.340 19.242 86.991  1.00 20.32 ? 447  ALA A CB  1 
ATOM   2968 N N   . LYS A 1 447 ? -22.241 17.799 86.447  1.00 24.84 ? 448  LYS A N   1 
ATOM   2969 C CA  . LYS A 1 447 ? -23.655 17.659 86.784  1.00 31.16 ? 448  LYS A CA  1 
ATOM   2970 C C   . LYS A 1 447 ? -23.925 17.567 88.289  1.00 36.73 ? 448  LYS A C   1 
ATOM   2971 O O   . LYS A 1 447 ? -25.076 17.478 88.710  1.00 48.98 ? 448  LYS A O   1 
ATOM   2972 C CB  . LYS A 1 447 ? -24.289 16.501 86.013  1.00 31.15 ? 448  LYS A CB  1 
ATOM   2973 C CG  . LYS A 1 447 ? -24.294 16.728 84.510  1.00 29.22 ? 448  LYS A CG  1 
ATOM   2974 C CD  . LYS A 1 447 ? -25.265 15.788 83.796  1.00 32.69 ? 448  LYS A CD  1 
ATOM   2975 C CE  . LYS A 1 447 ? -25.036 15.779 82.280  1.00 35.15 ? 448  LYS A CE  1 
ATOM   2976 N NZ  . LYS A 1 447 ? -23.743 15.102 81.885  1.00 33.23 ? 448  LYS A NZ  1 
ATOM   2977 N N   . ARG A 1 448 ? -22.863 17.589 89.090  1.00 28.64 ? 449  ARG A N   1 
ATOM   2978 C CA  . ARG A 1 448 ? -22.999 17.819 90.526  1.00 31.52 ? 449  ARG A CA  1 
ATOM   2979 C C   . ARG A 1 448 ? -21.917 18.796 91.001  1.00 33.31 ? 449  ARG A C   1 
ATOM   2980 O O   . ARG A 1 448 ? -20.824 18.850 90.427  1.00 27.46 ? 449  ARG A O   1 
ATOM   2981 C CB  . ARG A 1 448 ? -22.960 16.511 91.318  1.00 30.17 ? 449  ARG A CB  1 
ATOM   2982 C CG  . ARG A 1 448 ? -21.707 15.706 91.136  1.00 33.54 ? 449  ARG A CG  1 
ATOM   2983 C CD  . ARG A 1 448 ? -21.823 14.419 91.923  1.00 37.82 ? 449  ARG A CD  1 
ATOM   2984 N NE  . ARG A 1 448 ? -20.707 13.523 91.659  1.00 32.23 ? 449  ARG A NE  1 
ATOM   2985 C CZ  . ARG A 1 448 ? -19.692 13.346 92.485  1.00 28.04 ? 449  ARG A CZ  1 
ATOM   2986 N NH1 . ARG A 1 448 ? -19.658 14.006 93.634  1.00 28.29 ? 449  ARG A NH1 1 
ATOM   2987 N NH2 . ARG A 1 448 ? -18.723 12.501 92.166  1.00 33.72 ? 449  ARG A NH2 1 
ATOM   2988 N N   . PRO A 1 449 ? -22.227 19.579 92.045  1.00 32.51 ? 450  PRO A N   1 
ATOM   2989 C CA  . PRO A 1 449 ? -21.339 20.683 92.422  1.00 28.58 ? 450  PRO A CA  1 
ATOM   2990 C C   . PRO A 1 449 ? -20.079 20.223 93.152  1.00 28.87 ? 450  PRO A C   1 
ATOM   2991 O O   . PRO A 1 449 ? -19.088 20.964 93.163  1.00 27.78 ? 450  PRO A O   1 
ATOM   2992 C CB  . PRO A 1 449 ? -22.220 21.541 93.331  1.00 32.84 ? 450  PRO A CB  1 
ATOM   2993 C CG  . PRO A 1 449 ? -23.213 20.592 93.913  1.00 31.03 ? 450  PRO A CG  1 
ATOM   2994 C CD  . PRO A 1 449 ? -23.436 19.514 92.886  1.00 32.00 ? 450  PRO A CD  1 
ATOM   2995 N N   . ASP A 1 450 ? -20.109 19.017 93.723  1.00 27.64 ? 451  ASP A N   1 
ATOM   2996 C CA  . ASP A 1 450 ? -18.955 18.470 94.441  1.00 26.55 ? 451  ASP A CA  1 
ATOM   2997 C C   . ASP A 1 450 ? -18.217 17.420 93.624  1.00 27.12 ? 451  ASP A C   1 
ATOM   2998 O O   . ASP A 1 450 ? -17.470 16.608 94.170  1.00 25.12 ? 451  ASP A O   1 
ATOM   2999 C CB  . ASP A 1 450 ? -19.365 17.875 95.797  1.00 30.80 ? 451  ASP A CB  1 
ATOM   3000 C CG  . ASP A 1 450 ? -20.414 16.771 95.671  1.00 44.35 ? 451  ASP A CG  1 
ATOM   3001 O OD1 . ASP A 1 450 ? -21.019 16.613 94.588  1.00 46.49 ? 451  ASP A OD1 1 
ATOM   3002 O OD2 . ASP A 1 450 ? -20.652 16.069 96.675  1.00 50.76 ? 451  ASP A OD2 1 
ATOM   3003 N N   . HIS A 1 451 ? -18.445 17.423 92.318  1.00 26.55 ? 452  HIS A N   1 
ATOM   3004 C CA  . HIS A 1 451 ? -17.660 16.585 91.429  1.00 27.62 ? 452  HIS A CA  1 
ATOM   3005 C C   . HIS A 1 451 ? -16.181 16.967 91.560  1.00 28.30 ? 452  HIS A C   1 
ATOM   3006 O O   . HIS A 1 451 ? -15.853 18.144 91.738  1.00 28.08 ? 452  HIS A O   1 
ATOM   3007 C CB  . HIS A 1 451 ? -18.124 16.758 89.985  1.00 27.02 ? 452  HIS A CB  1 
ATOM   3008 C CG  . HIS A 1 451 ? -17.574 15.727 89.050  1.00 28.37 ? 452  HIS A CG  1 
ATOM   3009 N ND1 . HIS A 1 451 ? -16.300 15.802 88.525  1.00 28.87 ? 452  HIS A ND1 1 
ATOM   3010 C CD2 . HIS A 1 451 ? -18.121 14.591 88.556  1.00 29.31 ? 452  HIS A CD2 1 
ATOM   3011 C CE1 . HIS A 1 451 ? -16.090 14.756 87.744  1.00 33.56 ? 452  HIS A CE1 1 
ATOM   3012 N NE2 . HIS A 1 451 ? -17.180 14.007 87.743  1.00 31.29 ? 452  HIS A NE2 1 
ATOM   3013 N N   . PRO A 1 452 ? -15.289 15.966 91.477  1.00 23.63 ? 453  PRO A N   1 
ATOM   3014 C CA  . PRO A 1 452 ? -13.842 16.184 91.542  1.00 26.83 ? 453  PRO A CA  1 
ATOM   3015 C C   . PRO A 1 452 ? -13.332 17.254 90.570  1.00 24.79 ? 453  PRO A C   1 
ATOM   3016 O O   . PRO A 1 452 ? -12.375 17.940 90.910  1.00 23.26 ? 453  PRO A O   1 
ATOM   3017 C CB  . PRO A 1 452 ? -13.262 14.805 91.183  1.00 28.53 ? 453  PRO A CB  1 
ATOM   3018 C CG  . PRO A 1 452 ? -14.325 13.829 91.673  1.00 27.40 ? 453  PRO A CG  1 
ATOM   3019 C CD  . PRO A 1 452 ? -15.642 14.531 91.455  1.00 23.76 ? 453  PRO A CD  1 
ATOM   3020 N N   . TYR A 1 453 ? -13.928 17.402 89.391  1.00 24.12 ? 454  TYR A N   1 
ATOM   3021 C CA  . TYR A 1 453 ? -13.453 18.451 88.489  1.00 18.91 ? 454  TYR A CA  1 
ATOM   3022 C C   . TYR A 1 453 ? -13.748 19.842 89.030  1.00 19.35 ? 454  TYR A C   1 
ATOM   3023 O O   . TYR A 1 453 ? -13.208 20.800 88.515  1.00 20.83 ? 454  TYR A O   1 
ATOM   3024 C CB  . TYR A 1 453 ? -14.039 18.316 87.085  1.00 21.56 ? 454  TYR A CB  1 
ATOM   3025 C CG  . TYR A 1 453 ? -13.315 17.316 86.214  1.00 23.86 ? 454  TYR A CG  1 
ATOM   3026 C CD1 . TYR A 1 453 ? -12.841 16.113 86.737  1.00 25.04 ? 454  TYR A CD1 1 
ATOM   3027 C CD2 . TYR A 1 453 ? -13.117 17.566 84.865  1.00 19.94 ? 454  TYR A CD2 1 
ATOM   3028 C CE1 . TYR A 1 453 ? -12.185 15.197 85.931  1.00 23.68 ? 454  TYR A CE1 1 
ATOM   3029 C CE2 . TYR A 1 453 ? -12.463 16.656 84.057  1.00 21.86 ? 454  TYR A CE2 1 
ATOM   3030 C CZ  . TYR A 1 453 ? -11.996 15.483 84.585  1.00 21.08 ? 454  TYR A CZ  1 
ATOM   3031 O OH  . TYR A 1 453 ? -11.349 14.589 83.751  1.00 26.70 ? 454  TYR A OH  1 
ATOM   3032 N N   . MET A 1 454 ? -14.610 19.946 90.048  1.00 23.47 ? 455  MET A N   1 
ATOM   3033 C CA  . MET A 1 454 ? -14.883 21.229 90.696  1.00 28.00 ? 455  MET A CA  1 
ATOM   3034 C C   . MET A 1 454 ? -13.868 21.529 91.801  1.00 29.16 ? 455  MET A C   1 
ATOM   3035 O O   . MET A 1 454 ? -13.829 22.632 92.322  1.00 26.90 ? 455  MET A O   1 
ATOM   3036 C CB  . MET A 1 454 ? -16.302 21.287 91.288  1.00 27.90 ? 455  MET A CB  1 
ATOM   3037 C CG  . MET A 1 454 ? -17.447 21.208 90.261  1.00 29.12 ? 455  MET A CG  1 
ATOM   3038 S SD  . MET A 1 454 ? -17.522 22.693 89.244  1.00 28.78 ? 455  MET A SD  1 
ATOM   3039 C CE  . MET A 1 454 ? -18.169 23.850 90.457  1.00 26.11 ? 455  MET A CE  1 
ATOM   3040 N N   . SER A 1 455 ? -13.044 20.557 92.166  1.00 29.64 ? 456  SER A N   1 
ATOM   3041 C CA  . SER A 1 455 ? -12.069 20.814 93.222  1.00 30.56 ? 456  SER A CA  1 
ATOM   3042 C C   . SER A 1 455 ? -10.613 20.508 92.847  1.00 32.14 ? 456  SER A C   1 
ATOM   3043 O O   . SER A 1 455 ? -9.693  21.052 93.442  1.00 37.38 ? 456  SER A O   1 
ATOM   3044 C CB  . SER A 1 455 ? -12.449 20.054 94.488  1.00 24.72 ? 456  SER A CB  1 
ATOM   3045 O OG  . SER A 1 455 ? -12.589 18.685 94.196  1.00 36.94 ? 456  SER A OG  1 
ATOM   3046 N N   . THR A 1 456 ? -10.390 19.642 91.870  1.00 26.40 ? 457  THR A N   1 
ATOM   3047 C CA  . THR A 1 456 ? -9.017  19.321 91.492  1.00 26.68 ? 457  THR A CA  1 
ATOM   3048 C C   . THR A 1 456 ? -8.367  20.417 90.644  1.00 30.30 ? 457  THR A C   1 
ATOM   3049 O O   . THR A 1 456 ? -8.942  20.889 89.659  1.00 29.43 ? 457  THR A O   1 
ATOM   3050 C CB  . THR A 1 456 ? -8.935  18.003 90.737  1.00 28.91 ? 457  THR A CB  1 
ATOM   3051 O OG1 . THR A 1 456 ? -9.557  16.968 91.516  1.00 32.14 ? 457  THR A OG1 1 
ATOM   3052 C CG2 . THR A 1 456 ? -7.469  17.654 90.444  1.00 23.21 ? 457  THR A CG2 1 
ATOM   3053 N N   . GLU A 1 457 ? -7.152  20.802 91.021  1.00 32.03 ? 458  GLU A N   1 
ATOM   3054 C CA  . GLU A 1 457 ? -6.452  21.890 90.354  1.00 28.36 ? 458  GLU A CA  1 
ATOM   3055 C C   . GLU A 1 457 ? -5.756  21.340 89.104  1.00 33.68 ? 458  GLU A C   1 
ATOM   3056 O O   . GLU A 1 457 ? -4.957  20.410 89.202  1.00 33.92 ? 458  GLU A O   1 
ATOM   3057 C CB  . GLU A 1 457 ? -5.444  22.509 91.322  1.00 32.65 ? 458  GLU A CB  1 
ATOM   3058 C CG  . GLU A 1 457 ? -4.680  23.702 90.777  1.00 48.66 ? 458  GLU A CG  1 
ATOM   3059 C CD  . GLU A 1 457 ? -4.088  24.551 91.895  1.00 65.30 ? 458  GLU A CD  1 
ATOM   3060 O OE1 . GLU A 1 457 ? -3.525  25.629 91.601  1.00 65.57 ? 458  GLU A OE1 1 
ATOM   3061 O OE2 . GLU A 1 457 ? -4.198  24.140 93.074  1.00 74.37 ? 458  GLU A OE2 1 
ATOM   3062 N N   . PHE A 1 458 ? -6.070  21.896 87.933  1.00 25.50 ? 459  PHE A N   1 
ATOM   3063 C CA  . PHE A 1 458 ? -5.494  21.405 86.675  1.00 25.22 ? 459  PHE A CA  1 
ATOM   3064 C C   . PHE A 1 458 ? -4.394  22.314 86.114  1.00 21.11 ? 459  PHE A C   1 
ATOM   3065 O O   . PHE A 1 458 ? -3.614  21.884 85.278  1.00 25.33 ? 459  PHE A O   1 
ATOM   3066 C CB  . PHE A 1 458 ? -6.579  21.258 85.607  1.00 28.51 ? 459  PHE A CB  1 
ATOM   3067 C CG  . PHE A 1 458 ? -7.678  20.309 85.978  1.00 28.63 ? 459  PHE A CG  1 
ATOM   3068 C CD1 . PHE A 1 458 ? -7.384  19.031 86.456  1.00 21.24 ? 459  PHE A CD1 1 
ATOM   3069 C CD2 . PHE A 1 458 ? -9.012  20.693 85.856  1.00 27.64 ? 459  PHE A CD2 1 
ATOM   3070 C CE1 . PHE A 1 458 ? -8.409  18.139 86.795  1.00 20.97 ? 459  PHE A CE1 1 
ATOM   3071 C CE2 . PHE A 1 458 ? -10.042 19.808 86.194  1.00 26.47 ? 459  PHE A CE2 1 
ATOM   3072 C CZ  . PHE A 1 458 ? -9.735  18.536 86.660  1.00 24.86 ? 459  PHE A CZ  1 
ATOM   3073 N N   . PHE A 1 459 ? -4.370  23.578 86.533  1.00 18.07 ? 460  PHE A N   1 
ATOM   3074 C CA  . PHE A 1 459 ? -3.375  24.547 86.051  1.00 25.88 ? 460  PHE A CA  1 
ATOM   3075 C C   . PHE A 1 459 ? -3.218  24.502 84.526  1.00 28.57 ? 460  PHE A C   1 
ATOM   3076 O O   . PHE A 1 459 ? -2.142  24.184 84.016  1.00 23.50 ? 460  PHE A O   1 
ATOM   3077 C CB  . PHE A 1 459 ? -2.022  24.301 86.721  1.00 28.63 ? 460  PHE A CB  1 
ATOM   3078 C CG  . PHE A 1 459 ? -1.294  25.563 87.074  1.00 32.67 ? 460  PHE A CG  1 
ATOM   3079 C CD1 . PHE A 1 459 ? -0.059  25.856 86.501  1.00 30.69 ? 460  PHE A CD1 1 
ATOM   3080 C CD2 . PHE A 1 459 ? -1.857  26.473 87.958  1.00 31.10 ? 460  PHE A CD2 1 
ATOM   3081 C CE1 . PHE A 1 459 ? 0.612   27.015 86.822  1.00 30.16 ? 460  PHE A CE1 1 
ATOM   3082 C CE2 . PHE A 1 459 ? -1.197  27.652 88.278  1.00 38.07 ? 460  PHE A CE2 1 
ATOM   3083 C CZ  . PHE A 1 459 ? 0.051   27.917 87.715  1.00 37.55 ? 460  PHE A CZ  1 
ATOM   3084 N N   . GLY A 1 460 ? -4.312  24.776 83.817  1.00 22.91 ? 461  GLY A N   1 
ATOM   3085 C CA  . GLY A 1 460 ? -4.349  24.697 82.370  1.00 17.16 ? 461  GLY A CA  1 
ATOM   3086 C C   . GLY A 1 460 ? -5.655  25.338 81.944  1.00 23.56 ? 461  GLY A C   1 
ATOM   3087 O O   . GLY A 1 460 ? -6.442  25.739 82.804  1.00 23.31 ? 461  GLY A O   1 
ATOM   3088 N N   . PRO A 1 461 ? -5.897  25.448 80.629  1.00 21.03 ? 462  PRO A N   1 
ATOM   3089 C CA  . PRO A 1 461 ? -7.034  26.247 80.169  1.00 24.34 ? 462  PRO A CA  1 
ATOM   3090 C C   . PRO A 1 461 ? -8.331  25.438 80.191  1.00 24.56 ? 462  PRO A C   1 
ATOM   3091 O O   . PRO A 1 461 ? -8.973  25.247 79.166  1.00 25.40 ? 462  PRO A O   1 
ATOM   3092 C CB  . PRO A 1 461 ? -6.627  26.610 78.739  1.00 18.61 ? 462  PRO A CB  1 
ATOM   3093 C CG  . PRO A 1 461 ? -5.863  25.425 78.282  1.00 19.19 ? 462  PRO A CG  1 
ATOM   3094 C CD  . PRO A 1 461 ? -5.086  24.961 79.499  1.00 22.07 ? 462  PRO A CD  1 
ATOM   3095 N N   . ILE A 1 462 ? -8.702  24.977 81.379  1.00 22.07 ? 463  ILE A N   1 
ATOM   3096 C CA  . ILE A 1 462 ? -9.877  24.152 81.564  1.00 21.21 ? 463  ILE A CA  1 
ATOM   3097 C C   . ILE A 1 462 ? -10.806 24.725 82.633  1.00 24.46 ? 463  ILE A C   1 
ATOM   3098 O O   . ILE A 1 462 ? -10.430 24.865 83.795  1.00 28.24 ? 463  ILE A O   1 
ATOM   3099 C CB  . ILE A 1 462 ? -9.478  22.726 81.962  1.00 23.01 ? 463  ILE A CB  1 
ATOM   3100 C CG1 . ILE A 1 462 ? -8.630  22.100 80.844  1.00 19.88 ? 463  ILE A CG1 1 
ATOM   3101 C CG2 . ILE A 1 462 ? -10.735 21.889 82.254  1.00 24.51 ? 463  ILE A CG2 1 
ATOM   3102 C CD1 . ILE A 1 462 ? -8.240  20.682 81.115  1.00 23.20 ? 463  ILE A CD1 1 
ATOM   3103 N N   . LEU A 1 463 ? -12.024 25.054 82.229  1.00 20.65 ? 464  LEU A N   1 
ATOM   3104 C CA  . LEU A 1 463 ? -13.013 25.592 83.143  1.00 17.54 ? 464  LEU A CA  1 
ATOM   3105 C C   . LEU A 1 463 ? -14.083 24.543 83.406  1.00 17.93 ? 464  LEU A C   1 
ATOM   3106 O O   . LEU A 1 463 ? -14.656 23.979 82.470  1.00 24.41 ? 464  LEU A O   1 
ATOM   3107 C CB  . LEU A 1 463 ? -13.666 26.832 82.516  1.00 17.72 ? 464  LEU A CB  1 
ATOM   3108 C CG  . LEU A 1 463 ? -14.764 27.474 83.356  1.00 23.99 ? 464  LEU A CG  1 
ATOM   3109 C CD1 . LEU A 1 463 ? -14.149 28.000 84.665  1.00 21.88 ? 464  LEU A CD1 1 
ATOM   3110 C CD2 . LEU A 1 463 ? -15.454 28.605 82.581  1.00 22.58 ? 464  LEU A CD2 1 
ATOM   3111 N N   . THR A 1 464 ? -14.363 24.279 84.673  1.00 17.87 ? 465  THR A N   1 
ATOM   3112 C CA  . THR A 1 464 ? -15.460 23.383 85.017  1.00 18.11 ? 465  THR A CA  1 
ATOM   3113 C C   . THR A 1 464 ? -16.675 24.211 85.430  1.00 22.76 ? 465  THR A C   1 
ATOM   3114 O O   . THR A 1 464 ? -16.548 25.110 86.250  1.00 21.20 ? 465  THR A O   1 
ATOM   3115 C CB  . THR A 1 464 ? -15.073 22.411 86.140  1.00 21.48 ? 465  THR A CB  1 
ATOM   3116 O OG1 . THR A 1 464 ? -13.854 21.744 85.785  1.00 20.81 ? 465  THR A OG1 1 
ATOM   3117 C CG2 . THR A 1 464 ? -16.183 21.371 86.367  1.00 20.09 ? 465  THR A CG2 1 
ATOM   3118 N N   . VAL A 1 465 ? -17.844 23.941 84.844  1.00 23.18 ? 466  VAL A N   1 
ATOM   3119 C CA  . VAL A 1 465 ? -19.013 24.760 85.150  1.00 18.97 ? 466  VAL A CA  1 
ATOM   3120 C C   . VAL A 1 465 ? -20.146 23.951 85.770  1.00 20.20 ? 466  VAL A C   1 
ATOM   3121 O O   . VAL A 1 465 ? -20.460 22.835 85.330  1.00 21.23 ? 466  VAL A O   1 
ATOM   3122 C CB  . VAL A 1 465 ? -19.482 25.639 83.929  1.00 30.71 ? 466  VAL A CB  1 
ATOM   3123 C CG1 . VAL A 1 465 ? -19.740 24.799 82.702  1.00 35.56 ? 466  VAL A CG1 1 
ATOM   3124 C CG2 . VAL A 1 465 ? -20.733 26.454 84.285  1.00 26.96 ? 466  VAL A CG2 1 
ATOM   3125 N N   . TYR A 1 466 ? -20.711 24.489 86.847  1.00 22.18 ? 467  TYR A N   1 
ATOM   3126 C CA  . TYR A 1 466 ? -21.893 23.898 87.463  1.00 23.48 ? 467  TYR A CA  1 
ATOM   3127 C C   . TYR A 1 466 ? -23.038 24.904 87.420  1.00 26.82 ? 467  TYR A C   1 
ATOM   3128 O O   . TYR A 1 466 ? -22.860 26.072 87.783  1.00 24.85 ? 467  TYR A O   1 
ATOM   3129 C CB  . TYR A 1 466 ? -21.639 23.492 88.915  1.00 24.12 ? 467  TYR A CB  1 
ATOM   3130 C CG  . TYR A 1 466 ? -22.900 22.952 89.553  1.00 26.58 ? 467  TYR A CG  1 
ATOM   3131 C CD1 . TYR A 1 466 ? -23.366 21.688 89.231  1.00 24.48 ? 467  TYR A CD1 1 
ATOM   3132 C CD2 . TYR A 1 466 ? -23.645 23.718 90.446  1.00 25.59 ? 467  TYR A CD2 1 
ATOM   3133 C CE1 . TYR A 1 466 ? -24.531 21.195 89.773  1.00 26.45 ? 467  TYR A CE1 1 
ATOM   3134 C CE2 . TYR A 1 466 ? -24.828 23.227 91.003  1.00 24.93 ? 467  TYR A CE2 1 
ATOM   3135 C CZ  . TYR A 1 466 ? -25.256 21.964 90.658  1.00 29.07 ? 467  TYR A CZ  1 
ATOM   3136 O OH  . TYR A 1 466 ? -26.412 21.453 91.184  1.00 30.88 ? 467  TYR A OH  1 
ATOM   3137 N N   . GLU A 1 467 ? -24.201 24.441 86.971  1.00 27.11 ? 468  GLU A N   1 
ATOM   3138 C CA  . GLU A 1 467 ? -25.386 25.279 86.807  1.00 29.20 ? 468  GLU A CA  1 
ATOM   3139 C C   . GLU A 1 467 ? -26.369 25.014 87.929  1.00 26.73 ? 468  GLU A C   1 
ATOM   3140 O O   . GLU A 1 467 ? -26.741 23.891 88.161  1.00 27.10 ? 468  GLU A O   1 
ATOM   3141 C CB  . GLU A 1 467 ? -26.038 24.998 85.455  1.00 30.99 ? 468  GLU A CB  1 
ATOM   3142 C CG  . GLU A 1 467 ? -25.129 25.419 84.322  1.00 32.51 ? 468  GLU A CG  1 
ATOM   3143 C CD  . GLU A 1 467 ? -25.605 24.978 82.963  1.00 42.87 ? 468  GLU A CD  1 
ATOM   3144 O OE1 . GLU A 1 467 ? -26.759 24.520 82.845  1.00 42.41 ? 468  GLU A OE1 1 
ATOM   3145 O OE2 . GLU A 1 467 ? -24.813 25.096 82.003  1.00 46.90 ? 468  GLU A OE2 1 
ATOM   3146 N N   . TYR A 1 468 ? -26.757 26.053 88.654  1.00 30.71 ? 469  TYR A N   1 
ATOM   3147 C CA  . TYR A 1 468 ? -27.616 25.875 89.810  1.00 25.66 ? 469  TYR A CA  1 
ATOM   3148 C C   . TYR A 1 468 ? -28.948 26.581 89.565  1.00 31.12 ? 469  TYR A C   1 
ATOM   3149 O O   . TYR A 1 468 ? -28.981 27.637 88.929  1.00 32.34 ? 469  TYR A O   1 
ATOM   3150 C CB  . TYR A 1 468 ? -26.932 26.444 91.056  1.00 22.74 ? 469  TYR A CB  1 
ATOM   3151 C CG  . TYR A 1 468 ? -26.765 27.956 91.028  1.00 29.22 ? 469  TYR A CG  1 
ATOM   3152 C CD1 . TYR A 1 468 ? -25.655 28.552 90.420  1.00 22.65 ? 469  TYR A CD1 1 
ATOM   3153 C CD2 . TYR A 1 468 ? -27.723 28.788 91.610  1.00 34.28 ? 469  TYR A CD2 1 
ATOM   3154 C CE1 . TYR A 1 468 ? -25.503 29.943 90.399  1.00 24.16 ? 469  TYR A CE1 1 
ATOM   3155 C CE2 . TYR A 1 468 ? -27.591 30.169 91.590  1.00 23.53 ? 469  TYR A CE2 1 
ATOM   3156 C CZ  . TYR A 1 468 ? -26.490 30.743 90.979  1.00 28.93 ? 469  TYR A CZ  1 
ATOM   3157 O OH  . TYR A 1 468 ? -26.379 32.113 90.984  1.00 23.97 ? 469  TYR A OH  1 
ATOM   3158 N N   . PRO A 1 469 ? -30.053 25.992 90.056  1.00 31.06 ? 470  PRO A N   1 
ATOM   3159 C CA  . PRO A 1 469 ? -31.363 26.655 89.985  1.00 31.97 ? 470  PRO A CA  1 
ATOM   3160 C C   . PRO A 1 469 ? -31.313 28.005 90.688  1.00 29.78 ? 470  PRO A C   1 
ATOM   3161 O O   . PRO A 1 469 ? -30.763 28.097 91.788  1.00 28.42 ? 470  PRO A O   1 
ATOM   3162 C CB  . PRO A 1 469 ? -32.281 25.689 90.737  1.00 33.22 ? 470  PRO A CB  1 
ATOM   3163 C CG  . PRO A 1 469 ? -31.661 24.338 90.517  1.00 31.07 ? 470  PRO A CG  1 
ATOM   3164 C CD  . PRO A 1 469 ? -30.160 24.604 90.545  1.00 30.24 ? 470  PRO A CD  1 
ATOM   3165 N N   . ASP A 1 470 ? -31.853 29.035 90.041  1.00 32.59 ? 471  ASP A N   1 
ATOM   3166 C CA  . ASP A 1 470 ? -31.739 30.411 90.525  1.00 33.43 ? 471  ASP A CA  1 
ATOM   3167 C C   . ASP A 1 470 ? -32.083 30.563 92.003  1.00 35.48 ? 471  ASP A C   1 
ATOM   3168 O O   . ASP A 1 470 ? -31.404 31.288 92.728  1.00 38.50 ? 471  ASP A O   1 
ATOM   3169 C CB  . ASP A 1 470 ? -32.610 31.360 89.689  1.00 32.42 ? 471  ASP A CB  1 
ATOM   3170 C CG  . ASP A 1 470 ? -32.101 31.524 88.269  1.00 36.92 ? 471  ASP A CG  1 
ATOM   3171 O OD1 . ASP A 1 470 ? -31.684 30.512 87.658  1.00 33.47 ? 471  ASP A OD1 1 
ATOM   3172 O OD2 . ASP A 1 470 ? -32.111 32.668 87.764  1.00 38.01 ? 471  ASP A OD2 1 
ATOM   3173 N N   . THR A 1 471 ? -33.124 29.865 92.452  1.00 33.96 ? 472  THR A N   1 
ATOM   3174 C CA  . THR A 1 471 ? -33.583 29.991 93.836  1.00 35.94 ? 472  THR A CA  1 
ATOM   3175 C C   . THR A 1 471 ? -32.571 29.445 94.837  1.00 34.73 ? 472  THR A C   1 
ATOM   3176 O O   . THR A 1 471 ? -32.625 29.761 96.027  1.00 32.44 ? 472  THR A O   1 
ATOM   3177 C CB  . THR A 1 471 ? -34.928 29.279 94.054  1.00 42.43 ? 472  THR A CB  1 
ATOM   3178 O OG1 . THR A 1 471 ? -34.783 27.881 93.772  1.00 47.52 ? 472  THR A OG1 1 
ATOM   3179 C CG2 . THR A 1 471 ? -35.991 29.876 93.143  1.00 40.73 ? 472  THR A CG2 1 
ATOM   3180 N N   . GLU A 1 472 ? -31.637 28.634 94.356  1.00 30.51 ? 473  GLU A N   1 
ATOM   3181 C CA  . GLU A 1 472 ? -30.681 28.014 95.254  1.00 33.88 ? 473  GLU A CA  1 
ATOM   3182 C C   . GLU A 1 472 ? -29.350 28.767 95.402  1.00 32.81 ? 473  GLU A C   1 
ATOM   3183 O O   . GLU A 1 472 ? -28.349 28.180 95.818  1.00 32.02 ? 473  GLU A O   1 
ATOM   3184 C CB  . GLU A 1 472 ? -30.494 26.555 94.860  1.00 42.50 ? 473  GLU A CB  1 
ATOM   3185 C CG  . GLU A 1 472 ? -31.830 25.807 94.878  1.00 52.69 ? 473  GLU A CG  1 
ATOM   3186 C CD  . GLU A 1 472 ? -31.702 24.333 94.544  1.00 63.76 ? 473  GLU A CD  1 
ATOM   3187 O OE1 . GLU A 1 472 ? -30.616 23.918 94.075  1.00 67.24 ? 473  GLU A OE1 1 
ATOM   3188 O OE2 . GLU A 1 472 ? -32.694 23.593 94.756  1.00 68.67 ? 473  GLU A OE2 1 
ATOM   3189 N N   . PHE A 1 473 ? -29.356 30.072 95.103  1.00 35.54 ? 474  PHE A N   1 
ATOM   3190 C CA  . PHE A 1 473 ? -28.132 30.896 95.183  1.00 29.71 ? 474  PHE A CA  1 
ATOM   3191 C C   . PHE A 1 473 ? -27.522 30.868 96.574  1.00 29.44 ? 474  PHE A C   1 
ATOM   3192 O O   . PHE A 1 473 ? -26.323 30.655 96.719  1.00 32.10 ? 474  PHE A O   1 
ATOM   3193 C CB  . PHE A 1 473 ? -28.390 32.361 94.795  1.00 29.79 ? 474  PHE A CB  1 
ATOM   3194 C CG  . PHE A 1 473 ? -27.203 33.267 95.050  1.00 31.25 ? 474  PHE A CG  1 
ATOM   3195 C CD1 . PHE A 1 473 ? -26.110 33.268 94.181  1.00 23.68 ? 474  PHE A CD1 1 
ATOM   3196 C CD2 . PHE A 1 473 ? -27.177 34.101 96.157  1.00 28.81 ? 474  PHE A CD2 1 
ATOM   3197 C CE1 . PHE A 1 473 ? -25.015 34.086 94.410  1.00 24.75 ? 474  PHE A CE1 1 
ATOM   3198 C CE2 . PHE A 1 473 ? -26.099 34.923 96.396  1.00 24.90 ? 474  PHE A CE2 1 
ATOM   3199 C CZ  . PHE A 1 473 ? -25.003 34.916 95.523  1.00 27.39 ? 474  PHE A CZ  1 
ATOM   3200 N N   . ASN A 1 474 ? -28.341 31.095 97.599  1.00 26.18 ? 475  ASN A N   1 
ATOM   3201 C CA  . ASN A 1 474 ? -27.824 31.024 98.965  1.00 29.57 ? 475  ASN A CA  1 
ATOM   3202 C C   . ASN A 1 474 ? -27.213 29.653 99.284  1.00 33.36 ? 475  ASN A C   1 
ATOM   3203 O O   . ASN A 1 474 ? -26.130 29.566 99.876  1.00 31.46 ? 475  ASN A O   1 
ATOM   3204 C CB  . ASN A 1 474 ? -28.895 31.387 99.980  1.00 27.95 ? 475  ASN A CB  1 
ATOM   3205 C CG  . ASN A 1 474 ? -29.220 32.868 99.974  1.00 39.82 ? 475  ASN A CG  1 
ATOM   3206 O OD1 . ASN A 1 474 ? -28.580 33.655 99.283  1.00 36.96 ? 475  ASN A OD1 1 
ATOM   3207 N ND2 . ASN A 1 474 ? -30.211 33.253 100.750 1.00 42.69 ? 475  ASN A ND2 1 
ATOM   3208 N N   . GLU A 1 475 ? -27.897 28.597 98.852  1.00 26.11 ? 476  GLU A N   1 
ATOM   3209 C CA  . GLU A 1 475 ? -27.438 27.224 99.063  1.00 30.83 ? 476  GLU A CA  1 
ATOM   3210 C C   . GLU A 1 475 ? -26.096 26.977 98.379  1.00 27.65 ? 476  GLU A C   1 
ATOM   3211 O O   . GLU A 1 475 ? -25.220 26.329 98.929  1.00 32.72 ? 476  GLU A O   1 
ATOM   3212 C CB  . GLU A 1 475 ? -28.472 26.219 98.550  1.00 26.29 ? 476  GLU A CB  1 
ATOM   3213 N N   . ILE A 1 476 ? -25.942 27.504 97.174  1.00 27.39 ? 477  ILE A N   1 
ATOM   3214 C CA  . ILE A 1 476 ? -24.693 27.352 96.447  1.00 22.69 ? 477  ILE A CA  1 
ATOM   3215 C C   . ILE A 1 476 ? -23.520 28.042 97.169  1.00 23.95 ? 477  ILE A C   1 
ATOM   3216 O O   . ILE A 1 476 ? -22.376 27.574 97.093  1.00 24.16 ? 477  ILE A O   1 
ATOM   3217 C CB  . ILE A 1 476 ? -24.832 27.823 94.973  1.00 40.15 ? 477  ILE A CB  1 
ATOM   3218 C CG1 . ILE A 1 476 ? -24.134 26.860 94.018  1.00 45.25 ? 477  ILE A CG1 1 
ATOM   3219 C CG2 . ILE A 1 476 ? -24.226 29.189 94.781  1.00 47.19 ? 477  ILE A CG2 1 
ATOM   3220 C CD1 . ILE A 1 476 ? -24.616 25.425 94.099  1.00 39.12 ? 477  ILE A CD1 1 
ATOM   3221 N N   . CYS A 1 477 ? -23.784 29.135 97.884  1.00 25.69 ? 478  CYS A N   1 
ATOM   3222 C CA  . CYS A 1 477 ? -22.692 29.813 98.591  1.00 28.22 ? 478  CYS A CA  1 
ATOM   3223 C C   . CYS A 1 477 ? -22.212 28.940 99.742  1.00 27.45 ? 478  CYS A C   1 
ATOM   3224 O O   . CYS A 1 477 ? -21.018 28.906 100.040 1.00 26.54 ? 478  CYS A O   1 
ATOM   3225 C CB  . CYS A 1 477 ? -23.105 31.193 99.139  1.00 26.43 ? 478  CYS A CB  1 
ATOM   3226 S SG  . CYS A 1 477 ? -23.498 32.456 97.900  1.00 28.80 ? 478  CYS A SG  1 
ATOM   3227 N N   . ASP A 1 478 ? -23.162 28.277 100.401 1.00 25.79 ? 479  ASP A N   1 
ATOM   3228 C CA  . ASP A 1 478 ? -22.881 27.359 101.498 1.00 32.13 ? 479  ASP A CA  1 
ATOM   3229 C C   . ASP A 1 478 ? -22.069 26.196 100.969 1.00 38.99 ? 479  ASP A C   1 
ATOM   3230 O O   . ASP A 1 478 ? -21.122 25.756 101.608 1.00 44.11 ? 479  ASP A O   1 
ATOM   3231 C CB  . ASP A 1 478 ? -24.179 26.829 102.121 1.00 36.50 ? 479  ASP A CB  1 
ATOM   3232 C CG  . ASP A 1 478 ? -25.076 27.941 102.663 1.00 53.85 ? 479  ASP A CG  1 
ATOM   3233 O OD1 . ASP A 1 478 ? -24.557 29.031 102.993 1.00 61.87 ? 479  ASP A OD1 1 
ATOM   3234 O OD2 . ASP A 1 478 ? -26.306 27.724 102.765 1.00 56.29 ? 479  ASP A OD2 1 
ATOM   3235 N N   . ILE A 1 479 ? -22.443 25.710 99.789  1.00 38.10 ? 480  ILE A N   1 
ATOM   3236 C CA  . ILE A 1 479 ? -21.763 24.579 99.183  1.00 38.80 ? 480  ILE A CA  1 
ATOM   3237 C C   . ILE A 1 479 ? -20.305 24.929 98.925  1.00 46.98 ? 480  ILE A C   1 
ATOM   3238 O O   . ILE A 1 479 ? -19.431 24.077 99.018  1.00 51.36 ? 480  ILE A O   1 
ATOM   3239 C CB  . ILE A 1 479 ? -22.493 24.099 97.889  1.00 30.92 ? 480  ILE A CB  1 
ATOM   3240 C CG1 . ILE A 1 479 ? -23.765 23.328 98.257  1.00 29.75 ? 480  ILE A CG1 1 
ATOM   3241 C CG2 . ILE A 1 479 ? -21.621 23.190 97.062  1.00 28.30 ? 480  ILE A CG2 1 
ATOM   3242 C CD1 . ILE A 1 479 ? -24.739 23.098 97.091  1.00 31.79 ? 480  ILE A CD1 1 
ATOM   3243 N N   . ILE A 1 480 ? -20.030 26.195 98.637  1.00 48.27 ? 481  ILE A N   1 
ATOM   3244 C CA  . ILE A 1 480 ? -18.652 26.617 98.391  1.00 41.62 ? 481  ILE A CA  1 
ATOM   3245 C C   . ILE A 1 480 ? -17.880 26.763 99.709  1.00 45.16 ? 481  ILE A C   1 
ATOM   3246 O O   . ILE A 1 480 ? -16.768 26.262 99.863  1.00 49.07 ? 481  ILE A O   1 
ATOM   3247 C CB  . ILE A 1 480 ? -18.633 27.930 97.604  1.00 38.60 ? 481  ILE A CB  1 
ATOM   3248 C CG1 . ILE A 1 480 ? -19.330 27.731 96.257  1.00 31.10 ? 481  ILE A CG1 1 
ATOM   3249 C CG2 . ILE A 1 480 ? -17.218 28.415 97.402  1.00 39.34 ? 481  ILE A CG2 1 
ATOM   3250 C CD1 . ILE A 1 480 ? -19.579 29.007 95.528  1.00 30.20 ? 481  ILE A CD1 1 
ATOM   3251 N N   . ASP A 1 481 ? -18.499 27.446 100.659 1.00 44.88 ? 482  ASP A N   1 
ATOM   3252 C CA  . ASP A 1 481 ? -17.944 27.638 101.989 1.00 52.43 ? 482  ASP A CA  1 
ATOM   3253 C C   . ASP A 1 481 ? -17.666 26.314 102.689 1.00 60.33 ? 482  ASP A C   1 
ATOM   3254 O O   . ASP A 1 481 ? -16.604 26.136 103.287 1.00 62.63 ? 482  ASP A O   1 
ATOM   3255 C CB  . ASP A 1 481 ? -18.932 28.443 102.833 1.00 56.90 ? 482  ASP A CB  1 
ATOM   3256 C CG  . ASP A 1 481 ? -18.559 28.477 104.305 1.00 58.15 ? 482  ASP A CG  1 
ATOM   3257 O OD1 . ASP A 1 481 ? -17.407 28.846 104.613 1.00 59.70 ? 482  ASP A OD1 1 
ATOM   3258 O OD2 . ASP A 1 481 ? -19.423 28.137 105.149 1.00 57.32 ? 482  ASP A OD2 1 
ATOM   3259 N N   . ASN A 1 482 ? -18.629 25.395 102.631 1.00 57.79 ? 483  ASN A N   1 
ATOM   3260 C CA  . ASN A 1 482 ? -18.492 24.101 103.300 1.00 54.73 ? 483  ASN A CA  1 
ATOM   3261 C C   . ASN A 1 482 ? -17.847 23.023 102.425 1.00 63.19 ? 483  ASN A C   1 
ATOM   3262 O O   . ASN A 1 482 ? -17.948 21.838 102.729 1.00 69.30 ? 483  ASN A O   1 
ATOM   3263 C CB  . ASN A 1 482 ? -19.840 23.616 103.833 1.00 44.51 ? 483  ASN A CB  1 
ATOM   3264 N N   . THR A 1 483 ? -17.188 23.435 101.342 1.00 64.09 ? 484  THR A N   1 
ATOM   3265 C CA  . THR A 1 483 ? -16.497 22.493 100.459 1.00 62.95 ? 484  THR A CA  1 
ATOM   3266 C C   . THR A 1 483 ? -15.430 23.180 99.605  1.00 68.44 ? 484  THR A C   1 
ATOM   3267 O O   . THR A 1 483 ? -14.312 23.432 100.066 1.00 69.93 ? 484  THR A O   1 
ATOM   3268 C CB  . THR A 1 483 ? -17.478 21.755 99.535  1.00 56.79 ? 484  THR A CB  1 
ATOM   3269 N N   . TYR A 1 486 ? -10.922 25.563 99.851  1.00 46.22 ? 487  TYR A N   1 
ATOM   3270 C CA  . TYR A 1 486 ? -9.471  25.740 99.788  1.00 45.54 ? 487  TYR A CA  1 
ATOM   3271 C C   . TYR A 1 486 ? -9.066  26.612 98.596  1.00 53.94 ? 487  TYR A C   1 
ATOM   3272 O O   . TYR A 1 486 ? -8.507  26.109 97.612  1.00 60.86 ? 487  TYR A O   1 
ATOM   3273 C CB  . TYR A 1 486 ? -8.775  24.376 99.693  1.00 32.96 ? 487  TYR A CB  1 
ATOM   3274 N N   . ALA A 1 487 ? -9.339  27.913 98.672  1.00 47.77 ? 488  ALA A N   1 
ATOM   3275 C CA  . ALA A 1 487 ? -9.126  28.777 97.512  1.00 45.02 ? 488  ALA A CA  1 
ATOM   3276 C C   . ALA A 1 487 ? -8.376  30.052 97.817  1.00 38.77 ? 488  ALA A C   1 
ATOM   3277 O O   . ALA A 1 487 ? -8.522  30.651 98.868  1.00 43.03 ? 488  ALA A O   1 
ATOM   3278 C CB  . ALA A 1 487 ? -10.460 29.094 96.788  1.00 47.33 ? 488  ALA A CB  1 
ATOM   3279 N N   . LEU A 1 488 ? -7.566  30.450 96.853  1.00 38.13 ? 489  LEU A N   1 
ATOM   3280 C CA  . LEU A 1 488 ? -6.817  31.680 96.903  1.00 30.36 ? 489  LEU A CA  1 
ATOM   3281 C C   . LEU A 1 488 ? -7.704  32.888 96.572  1.00 36.46 ? 489  LEU A C   1 
ATOM   3282 O O   . LEU A 1 488 ? -7.734  33.877 97.311  1.00 32.65 ? 489  LEU A O   1 
ATOM   3283 C CB  . LEU A 1 488 ? -5.673  31.583 95.899  1.00 33.79 ? 489  LEU A CB  1 
ATOM   3284 C CG  . LEU A 1 488 ? -4.597  32.648 96.014  1.00 39.11 ? 489  LEU A CG  1 
ATOM   3285 C CD1 . LEU A 1 488 ? -4.001  32.607 97.412  1.00 36.74 ? 489  LEU A CD1 1 
ATOM   3286 C CD2 . LEU A 1 488 ? -3.542  32.388 94.962  1.00 42.35 ? 489  LEU A CD2 1 
ATOM   3287 N N   . THR A 1 489 ? -8.421  32.815 95.453  1.00 25.58 ? 490  THR A N   1 
ATOM   3288 C CA  . THR A 1 489 ? -9.240  33.939 95.032  1.00 24.76 ? 490  THR A CA  1 
ATOM   3289 C C   . THR A 1 489 ? -10.631 33.455 94.635  1.00 26.02 ? 490  THR A C   1 
ATOM   3290 O O   . THR A 1 489 ? -10.830 32.268 94.326  1.00 23.05 ? 490  THR A O   1 
ATOM   3291 C CB  . THR A 1 489 ? -8.611  34.666 93.831  1.00 27.25 ? 490  THR A CB  1 
ATOM   3292 O OG1 . THR A 1 489 ? -8.627  33.792 92.695  1.00 26.29 ? 490  THR A OG1 1 
ATOM   3293 C CG2 . THR A 1 489 ? -7.175  35.071 94.121  1.00 26.39 ? 490  THR A CG2 1 
ATOM   3294 N N   . GLY A 1 490 ? -11.592 34.374 94.647  1.00 21.57 ? 491  GLY A N   1 
ATOM   3295 C CA  . GLY A 1 490 ? -12.936 34.078 94.184  1.00 19.57 ? 491  GLY A CA  1 
ATOM   3296 C C   . GLY A 1 490 ? -13.654 35.370 93.840  1.00 20.57 ? 491  GLY A C   1 
ATOM   3297 O O   . GLY A 1 490 ? -13.243 36.459 94.253  1.00 20.11 ? 491  GLY A O   1 
ATOM   3298 N N   . ALA A 1 491 ? -14.732 35.256 93.090  1.00 17.14 ? 492  ALA A N   1 
ATOM   3299 C CA  . ALA A 1 491 ? -15.436 36.448 92.609  1.00 23.65 ? 492  ALA A CA  1 
ATOM   3300 C C   . ALA A 1 491 ? -16.917 36.190 92.499  1.00 18.35 ? 492  ALA A C   1 
ATOM   3301 O O   . ALA A 1 491 ? -17.345 35.076 92.165  1.00 24.18 ? 492  ALA A O   1 
ATOM   3302 C CB  . ALA A 1 491 ? -14.909 36.867 91.253  1.00 18.34 ? 492  ALA A CB  1 
ATOM   3303 N N   . ILE A 1 492 ? -17.693 37.230 92.773  1.00 23.57 ? 493  ILE A N   1 
ATOM   3304 C CA  . ILE A 1 492 ? -19.103 37.203 92.504  1.00 19.87 ? 493  ILE A CA  1 
ATOM   3305 C C   . ILE A 1 492 ? -19.433 38.275 91.479  1.00 25.41 ? 493  ILE A C   1 
ATOM   3306 O O   . ILE A 1 492 ? -18.922 39.391 91.539  1.00 22.86 ? 493  ILE A O   1 
ATOM   3307 C CB  . ILE A 1 492 ? -19.942 37.433 93.767  1.00 24.86 ? 493  ILE A CB  1 
ATOM   3308 C CG1 . ILE A 1 492 ? -21.427 37.369 93.401  1.00 25.53 ? 493  ILE A CG1 1 
ATOM   3309 C CG2 . ILE A 1 492 ? -19.584 38.767 94.416  1.00 21.13 ? 493  ILE A CG2 1 
ATOM   3310 C CD1 . ILE A 1 492 ? -22.350 37.209 94.580  1.00 30.93 ? 493  ILE A CD1 1 
ATOM   3311 N N   . PHE A 1 493 ? -20.292 37.916 90.539  1.00 20.64 ? 494  PHE A N   1 
ATOM   3312 C CA  . PHE A 1 493 ? -20.796 38.837 89.556  1.00 24.47 ? 494  PHE A CA  1 
ATOM   3313 C C   . PHE A 1 493 ? -22.290 38.973 89.834  1.00 28.01 ? 494  PHE A C   1 
ATOM   3314 O O   . PHE A 1 493 ? -23.020 37.977 89.842  1.00 26.20 ? 494  PHE A O   1 
ATOM   3315 C CB  . PHE A 1 493 ? -20.504 38.323 88.143  1.00 24.22 ? 494  PHE A CB  1 
ATOM   3316 C CG  . PHE A 1 493 ? -19.019 38.247 87.832  1.00 22.62 ? 494  PHE A CG  1 
ATOM   3317 C CD1 . PHE A 1 493 ? -18.390 39.264 87.153  1.00 20.19 ? 494  PHE A CD1 1 
ATOM   3318 C CD2 . PHE A 1 493 ? -18.260 37.166 88.267  1.00 21.31 ? 494  PHE A CD2 1 
ATOM   3319 C CE1 . PHE A 1 493 ? -17.019 39.202 86.891  1.00 25.23 ? 494  PHE A CE1 1 
ATOM   3320 C CE2 . PHE A 1 493 ? -16.890 37.083 87.997  1.00 23.57 ? 494  PHE A CE2 1 
ATOM   3321 C CZ  . PHE A 1 493 ? -16.269 38.112 87.313  1.00 21.25 ? 494  PHE A CZ  1 
ATOM   3322 N N   . ALA A 1 494 ? -22.722 40.205 90.083  1.00 23.22 ? 495  ALA A N   1 
ATOM   3323 C CA  . ALA A 1 494 ? -24.076 40.481 90.546  1.00 32.02 ? 495  ALA A CA  1 
ATOM   3324 C C   . ALA A 1 494 ? -24.267 41.981 90.586  1.00 29.70 ? 495  ALA A C   1 
ATOM   3325 O O   . ALA A 1 494 ? -23.284 42.718 90.691  1.00 29.66 ? 495  ALA A O   1 
ATOM   3326 C CB  . ALA A 1 494 ? -24.272 39.915 91.941  1.00 24.38 ? 495  ALA A CB  1 
ATOM   3327 N N   . LYS A 1 495 ? -25.528 42.420 90.521  1.00 30.13 ? 496  LYS A N   1 
ATOM   3328 C CA  . LYS A 1 495 ? -25.897 43.821 90.749  1.00 38.21 ? 496  LYS A CA  1 
ATOM   3329 C C   . LYS A 1 495 ? -26.571 43.968 92.114  1.00 37.86 ? 496  LYS A C   1 
ATOM   3330 O O   . LYS A 1 495 ? -26.434 44.993 92.791  1.00 34.99 ? 496  LYS A O   1 
ATOM   3331 C CB  . LYS A 1 495 ? -26.852 44.331 89.655  1.00 44.55 ? 496  LYS A CB  1 
ATOM   3332 C CG  . LYS A 1 495 ? -26.255 44.320 88.240  1.00 55.12 ? 496  LYS A CG  1 
ATOM   3333 C CD  . LYS A 1 495 ? -27.235 44.836 87.178  1.00 58.78 ? 496  LYS A CD  1 
ATOM   3334 C CE  . LYS A 1 495 ? -27.125 44.033 85.876  1.00 60.37 ? 496  LYS A CE  1 
ATOM   3335 N NZ  . LYS A 1 495 ? -27.159 44.855 84.623  1.00 65.19 ? 496  LYS A NZ  1 
ATOM   3336 N N   . ASP A 1 496 ? -27.298 42.923 92.503  1.00 37.00 ? 497  ASP A N   1 
ATOM   3337 C CA  . ASP A 1 496 ? -28.083 42.911 93.732  1.00 36.04 ? 497  ASP A CA  1 
ATOM   3338 C C   . ASP A 1 496 ? -27.202 42.940 94.972  1.00 32.30 ? 497  ASP A C   1 
ATOM   3339 O O   . ASP A 1 496 ? -26.481 41.985 95.236  1.00 33.46 ? 497  ASP A O   1 
ATOM   3340 C CB  . ASP A 1 496 ? -28.959 41.662 93.755  1.00 41.17 ? 497  ASP A CB  1 
ATOM   3341 C CG  . ASP A 1 496 ? -29.916 41.640 94.924  1.00 45.94 ? 497  ASP A CG  1 
ATOM   3342 O OD1 . ASP A 1 496 ? -29.479 41.808 96.087  1.00 41.07 ? 497  ASP A OD1 1 
ATOM   3343 O OD2 . ASP A 1 496 ? -31.117 41.456 94.666  1.00 56.61 ? 497  ASP A OD2 1 
ATOM   3344 N N   . ARG A 1 497 ? -27.295 44.018 95.750  1.00 31.55 ? 498  ARG A N   1 
ATOM   3345 C CA  . ARG A 1 497 ? -26.408 44.221 96.910  1.00 34.11 ? 498  ARG A CA  1 
ATOM   3346 C C   . ARG A 1 497 ? -26.615 43.218 98.042  1.00 35.57 ? 498  ARG A C   1 
ATOM   3347 O O   . ARG A 1 497 ? -25.680 42.929 98.783  1.00 34.17 ? 498  ARG A O   1 
ATOM   3348 C CB  . ARG A 1 497 ? -26.592 45.624 97.497  1.00 38.18 ? 498  ARG A CB  1 
ATOM   3349 C CG  . ARG A 1 497 ? -25.786 46.689 96.841  1.00 31.47 ? 498  ARG A CG  1 
ATOM   3350 C CD  . ARG A 1 497 ? -24.324 46.444 97.076  1.00 42.90 ? 498  ARG A CD  1 
ATOM   3351 N NE  . ARG A 1 497 ? -23.646 46.485 95.808  1.00 36.05 ? 498  ARG A NE  1 
ATOM   3352 C CZ  . ARG A 1 497 ? -22.336 46.451 95.642  1.00 35.00 ? 498  ARG A CZ  1 
ATOM   3353 N NH1 . ARG A 1 497 ? -21.511 46.363 96.681  1.00 28.82 ? 498  ARG A NH1 1 
ATOM   3354 N NH2 . ARG A 1 497 ? -21.865 46.497 94.407  1.00 34.76 ? 498  ARG A NH2 1 
ATOM   3355 N N   . LYS A 1 498 ? -27.849 42.739 98.202  1.00 38.42 ? 499  LYS A N   1 
ATOM   3356 C CA  . LYS A 1 498 ? -28.165 41.768 99.247  1.00 43.97 ? 499  LYS A CA  1 
ATOM   3357 C C   . LYS A 1 498 ? -27.418 40.470 98.955  1.00 38.19 ? 499  LYS A C   1 
ATOM   3358 O O   . LYS A 1 498 ? -26.758 39.911 99.828  1.00 41.66 ? 499  LYS A O   1 
ATOM   3359 C CB  . LYS A 1 498 ? -29.681 41.530 99.354  1.00 32.59 ? 499  LYS A CB  1 
ATOM   3360 N N   . ALA A 1 499 ? -27.496 40.023 97.708  1.00 32.76 ? 500  ALA A N   1 
ATOM   3361 C CA  . ALA A 1 499 ? -26.786 38.824 97.286  1.00 31.14 ? 500  ALA A CA  1 
ATOM   3362 C C   . ALA A 1 499 ? -25.271 39.013 97.405  1.00 32.60 ? 500  ALA A C   1 
ATOM   3363 O O   . ALA A 1 499 ? -24.560 38.126 97.894  1.00 31.23 ? 500  ALA A O   1 
ATOM   3364 C CB  . ALA A 1 499 ? -27.193 38.442 95.880  1.00 28.12 ? 500  ALA A CB  1 
ATOM   3365 N N   . ILE A 1 500 ? -24.777 40.179 96.996  1.00 34.67 ? 501  ILE A N   1 
ATOM   3366 C CA  . ILE A 1 500 ? -23.353 40.455 97.108  1.00 31.98 ? 501  ILE A CA  1 
ATOM   3367 C C   . ILE A 1 500 ? -22.918 40.381 98.560  1.00 33.99 ? 501  ILE A C   1 
ATOM   3368 O O   . ILE A 1 500 ? -21.929 39.721 98.872  1.00 31.62 ? 501  ILE A O   1 
ATOM   3369 C CB  . ILE A 1 500 ? -22.950 41.839 96.536  1.00 30.87 ? 501  ILE A CB  1 
ATOM   3370 C CG1 . ILE A 1 500 ? -22.960 41.823 95.008  1.00 27.53 ? 501  ILE A CG1 1 
ATOM   3371 C CG2 . ILE A 1 500 ? -21.559 42.205 97.015  1.00 26.26 ? 501  ILE A CG2 1 
ATOM   3372 C CD1 . ILE A 1 500 ? -22.937 43.198 94.384  1.00 26.43 ? 501  ILE A CD1 1 
ATOM   3373 N N   . GLU A 1 501 ? -23.665 41.037 99.447  1.00 33.43 ? 502  GLU A N   1 
ATOM   3374 C CA  . GLU A 1 501 ? -23.316 41.034 100.875 1.00 39.10 ? 502  GLU A CA  1 
ATOM   3375 C C   . GLU A 1 501 ? -23.360 39.635 101.489 1.00 35.27 ? 502  GLU A C   1 
ATOM   3376 O O   . GLU A 1 501 ? -22.478 39.254 102.249 1.00 36.40 ? 502  GLU A O   1 
ATOM   3377 C CB  . GLU A 1 501 ? -24.241 41.963 101.660 1.00 46.15 ? 502  GLU A CB  1 
ATOM   3378 C CG  . GLU A 1 501 ? -23.890 42.091 103.126 1.00 53.50 ? 502  GLU A CG  1 
ATOM   3379 C CD  . GLU A 1 501 ? -25.033 42.683 103.954 1.00 64.75 ? 502  GLU A CD  1 
ATOM   3380 O OE1 . GLU A 1 501 ? -26.175 42.767 103.445 1.00 68.07 ? 502  GLU A OE1 1 
ATOM   3381 O OE2 . GLU A 1 501 ? -24.790 43.064 105.121 1.00 68.17 ? 502  GLU A OE2 1 
ATOM   3382 N N   . TYR A 1 502 ? -24.401 38.877 101.163 1.00 35.25 ? 503  TYR A N   1 
ATOM   3383 C CA  . TYR A 1 502 ? -24.538 37.522 101.669 1.00 32.50 ? 503  TYR A CA  1 
ATOM   3384 C C   . TYR A 1 502 ? -23.358 36.648 101.239 1.00 34.23 ? 503  TYR A C   1 
ATOM   3385 O O   . TYR A 1 502 ? -22.781 35.923 102.053 1.00 38.62 ? 503  TYR A O   1 
ATOM   3386 C CB  . TYR A 1 502 ? -25.851 36.907 101.195 1.00 32.83 ? 503  TYR A CB  1 
ATOM   3387 C CG  . TYR A 1 502 ? -26.079 35.507 101.719 1.00 38.18 ? 503  TYR A CG  1 
ATOM   3388 C CD1 . TYR A 1 502 ? -25.550 34.404 101.064 1.00 38.39 ? 503  TYR A CD1 1 
ATOM   3389 C CD2 . TYR A 1 502 ? -26.810 35.288 102.874 1.00 40.14 ? 503  TYR A CD2 1 
ATOM   3390 C CE1 . TYR A 1 502 ? -25.748 33.123 101.543 1.00 36.54 ? 503  TYR A CE1 1 
ATOM   3391 C CE2 . TYR A 1 502 ? -27.010 34.009 103.356 1.00 43.39 ? 503  TYR A CE2 1 
ATOM   3392 C CZ  . TYR A 1 502 ? -26.478 32.932 102.685 1.00 41.70 ? 503  TYR A CZ  1 
ATOM   3393 O OH  . TYR A 1 502 ? -26.668 31.651 103.153 1.00 52.50 ? 503  TYR A OH  1 
ATOM   3394 N N   . ALA A 1 503 ? -23.013 36.706 99.955  1.00 33.36 ? 504  ALA A N   1 
ATOM   3395 C CA  . ALA A 1 503 ? -21.869 35.962 99.434  1.00 31.48 ? 504  ALA A CA  1 
ATOM   3396 C C   . ALA A 1 503 ? -20.561 36.455 100.062 1.00 35.11 ? 504  ALA A C   1 
ATOM   3397 O O   . ALA A 1 503 ? -19.716 35.653 100.456 1.00 35.74 ? 504  ALA A O   1 
ATOM   3398 C CB  . ALA A 1 503 ? -21.800 36.092 97.907  1.00 28.36 ? 504  ALA A CB  1 
ATOM   3399 N N   . ASP A 1 504 ? -20.404 37.777 100.135 1.00 34.69 ? 505  ASP A N   1 
ATOM   3400 C CA  . ASP A 1 504 ? -19.235 38.382 100.765 1.00 40.48 ? 505  ASP A CA  1 
ATOM   3401 C C   . ASP A 1 504 ? -19.014 37.757 102.141 1.00 39.89 ? 505  ASP A C   1 
ATOM   3402 O O   . ASP A 1 504 ? -17.922 37.305 102.438 1.00 43.08 ? 505  ASP A O   1 
ATOM   3403 C CB  . ASP A 1 504 ? -19.407 39.900 100.869 1.00 49.38 ? 505  ASP A CB  1 
ATOM   3404 C CG  . ASP A 1 504 ? -18.072 40.659 100.944 1.00 55.19 ? 505  ASP A CG  1 
ATOM   3405 O OD1 . ASP A 1 504 ? -16.995 40.021 101.006 1.00 46.42 ? 505  ASP A OD1 1 
ATOM   3406 O OD2 . ASP A 1 504 ? -18.112 41.915 100.947 1.00 58.11 ? 505  ASP A OD2 1 
ATOM   3407 N N   . GLU A 1 505 ? -20.061 37.678 102.959 1.00 40.75 ? 506  GLU A N   1 
ATOM   3408 C CA  . GLU A 1 505 ? -19.925 37.131 104.313 1.00 40.70 ? 506  GLU A CA  1 
ATOM   3409 C C   . GLU A 1 505 ? -19.832 35.600 104.389 1.00 39.90 ? 506  GLU A C   1 
ATOM   3410 O O   . GLU A 1 505 ? -19.008 35.068 105.123 1.00 45.13 ? 506  GLU A O   1 
ATOM   3411 C CB  . GLU A 1 505 ? -21.053 37.636 105.232 1.00 46.52 ? 506  GLU A CB  1 
ATOM   3412 N N   . LYS A 1 506 ? -20.685 34.892 103.659 1.00 36.63 ? 507  LYS A N   1 
ATOM   3413 C CA  . LYS A 1 506 ? -20.654 33.430 103.668 1.00 35.63 ? 507  LYS A CA  1 
ATOM   3414 C C   . LYS A 1 506 ? -19.347 32.869 103.115 1.00 35.28 ? 507  LYS A C   1 
ATOM   3415 O O   . LYS A 1 506 ? -18.906 31.795 103.516 1.00 32.68 ? 507  LYS A O   1 
ATOM   3416 C CB  . LYS A 1 506 ? -21.812 32.836 102.862 1.00 34.73 ? 507  LYS A CB  1 
ATOM   3417 C CG  . LYS A 1 506 ? -22.146 31.398 103.247 1.00 38.49 ? 507  LYS A CG  1 
ATOM   3418 C CD  . LYS A 1 506 ? -23.030 31.349 104.511 1.00 37.46 ? 507  LYS A CD  1 
ATOM   3419 N N   . LEU A 1 507 ? -18.742 33.589 102.180 1.00 33.06 ? 508  LEU A N   1 
ATOM   3420 C CA  . LEU A 1 507 ? -17.526 33.104 101.542 1.00 31.89 ? 508  LEU A CA  1 
ATOM   3421 C C   . LEU A 1 507 ? -16.291 33.730 102.163 1.00 35.77 ? 508  LEU A C   1 
ATOM   3422 O O   . LEU A 1 507 ? -15.217 33.687 101.570 1.00 37.79 ? 508  LEU A O   1 
ATOM   3423 C CB  . LEU A 1 507 ? -17.555 33.392 100.037 1.00 24.16 ? 508  LEU A CB  1 
ATOM   3424 C CG  . LEU A 1 507 ? -18.781 32.828 99.309  1.00 31.20 ? 508  LEU A CG  1 
ATOM   3425 C CD1 . LEU A 1 507 ? -18.823 33.316 97.863  1.00 26.45 ? 508  LEU A CD1 1 
ATOM   3426 C CD2 . LEU A 1 507 ? -18.791 31.304 99.388  1.00 30.97 ? 508  LEU A CD2 1 
ATOM   3427 N N   . LYS A 1 508 ? -16.437 34.313 103.352 1.00 37.88 ? 509  LYS A N   1 
ATOM   3428 C CA  . LYS A 1 508 ? -15.315 35.028 103.955 1.00 39.69 ? 509  LYS A CA  1 
ATOM   3429 C C   . LYS A 1 508 ? -14.089 34.133 104.185 1.00 35.71 ? 509  LYS A C   1 
ATOM   3430 O O   . LYS A 1 508 ? -12.971 34.607 104.094 1.00 29.78 ? 509  LYS A O   1 
ATOM   3431 C CB  . LYS A 1 508 ? -15.722 35.792 105.232 1.00 42.57 ? 509  LYS A CB  1 
ATOM   3432 C CG  . LYS A 1 508 ? -15.801 34.975 106.499 1.00 40.43 ? 509  LYS A CG  1 
ATOM   3433 C CD  . LYS A 1 508 ? -16.060 35.874 107.712 1.00 40.57 ? 509  LYS A CD  1 
ATOM   3434 N N   . PHE A 1 509 ? -14.299 32.841 104.445 1.00 40.25 ? 510  PHE A N   1 
ATOM   3435 C CA  . PHE A 1 509 ? -13.183 31.897 104.598 1.00 38.76 ? 510  PHE A CA  1 
ATOM   3436 C C   . PHE A 1 509 ? -12.847 31.095 103.327 1.00 42.38 ? 510  PHE A C   1 
ATOM   3437 O O   . PHE A 1 509 ? -11.975 30.231 103.349 1.00 43.73 ? 510  PHE A O   1 
ATOM   3438 C CB  . PHE A 1 509 ? -13.459 30.917 105.732 1.00 39.88 ? 510  PHE A CB  1 
ATOM   3439 C CG  . PHE A 1 509 ? -13.537 31.558 107.083 1.00 45.48 ? 510  PHE A CG  1 
ATOM   3440 C CD1 . PHE A 1 509 ? -12.387 31.935 107.750 1.00 45.36 ? 510  PHE A CD1 1 
ATOM   3441 C CD2 . PHE A 1 509 ? -14.758 31.775 107.688 1.00 47.09 ? 510  PHE A CD2 1 
ATOM   3442 C CE1 . PHE A 1 509 ? -12.460 32.521 108.991 1.00 46.29 ? 510  PHE A CE1 1 
ATOM   3443 C CE2 . PHE A 1 509 ? -14.835 32.368 108.933 1.00 53.19 ? 510  PHE A CE2 1 
ATOM   3444 C CZ  . PHE A 1 509 ? -13.686 32.741 109.585 1.00 50.13 ? 510  PHE A CZ  1 
ATOM   3445 N N   . SER A 1 510 ? -13.525 31.388 102.223 1.00 38.16 ? 511  SER A N   1 
ATOM   3446 C CA  . SER A 1 510 ? -13.403 30.574 101.021 1.00 32.99 ? 511  SER A CA  1 
ATOM   3447 C C   . SER A 1 510 ? -12.428 31.147 100.013 1.00 37.16 ? 511  SER A C   1 
ATOM   3448 O O   . SER A 1 510 ? -12.214 30.554 98.965  1.00 42.29 ? 511  SER A O   1 
ATOM   3449 C CB  . SER A 1 510 ? -14.771 30.419 100.344 1.00 34.94 ? 511  SER A CB  1 
ATOM   3450 O OG  . SER A 1 510 ? -15.724 29.881 101.249 1.00 46.21 ? 511  SER A OG  1 
ATOM   3451 N N   . ALA A 1 511 ? -11.864 32.310 100.316 1.00 30.53 ? 512  ALA A N   1 
ATOM   3452 C CA  . ALA A 1 511 ? -10.885 32.947 99.446  1.00 31.91 ? 512  ALA A CA  1 
ATOM   3453 C C   . ALA A 1 511 ? -10.231 34.101 100.198 1.00 32.89 ? 512  ALA A C   1 
ATOM   3454 O O   . ALA A 1 511 ? -10.895 34.789 100.971 1.00 30.79 ? 512  ALA A O   1 
ATOM   3455 C CB  . ALA A 1 511 ? -11.546 33.458 98.181  1.00 34.00 ? 512  ALA A CB  1 
ATOM   3456 N N   . GLY A 1 512 ? -8.935  34.305 99.979  1.00 31.82 ? 513  GLY A N   1 
ATOM   3457 C CA  . GLY A 1 512 ? -8.216  35.379 100.644 1.00 30.66 ? 513  GLY A CA  1 
ATOM   3458 C C   . GLY A 1 512 ? -8.457  36.699 99.939  1.00 34.01 ? 513  GLY A C   1 
ATOM   3459 O O   . GLY A 1 512 ? -8.418  37.782 100.541 1.00 38.30 ? 513  GLY A O   1 
ATOM   3460 N N   . ASN A 1 513 ? -8.694  36.612 98.640  1.00 28.27 ? 514  ASN A N   1 
ATOM   3461 C CA  . ASN A 1 513 ? -9.063  37.788 97.862  1.00 30.54 ? 514  ASN A CA  1 
ATOM   3462 C C   . ASN A 1 513 ? -10.404 37.556 97.199  1.00 32.41 ? 514  ASN A C   1 
ATOM   3463 O O   . ASN A 1 513 ? -10.557 36.627 96.411  1.00 32.52 ? 514  ASN A O   1 
ATOM   3464 C CB  . ASN A 1 513 ? -8.003  38.095 96.815  1.00 35.09 ? 514  ASN A CB  1 
ATOM   3465 C CG  . ASN A 1 513 ? -6.707  38.548 97.437  1.00 40.81 ? 514  ASN A CG  1 
ATOM   3466 O OD1 . ASN A 1 513 ? -6.496  39.739 97.657  1.00 42.63 ? 514  ASN A OD1 1 
ATOM   3467 N ND2 . ASN A 1 513 ? -5.840  37.598 97.746  1.00 40.10 ? 514  ASN A ND2 1 
ATOM   3468 N N   . PHE A 1 514 ? -11.373 38.399 97.533  1.00 25.14 ? 515  PHE A N   1 
ATOM   3469 C CA  . PHE A 1 514 ? -12.715 38.236 97.026  1.00 27.49 ? 515  PHE A CA  1 
ATOM   3470 C C   . PHE A 1 514 ? -12.983 39.414 96.116  1.00 28.96 ? 515  PHE A C   1 
ATOM   3471 O O   . PHE A 1 514 ? -12.686 40.545 96.465  1.00 32.85 ? 515  PHE A O   1 
ATOM   3472 C CB  . PHE A 1 514 ? -13.710 38.201 98.186  1.00 23.32 ? 515  PHE A CB  1 
ATOM   3473 C CG  . PHE A 1 514 ? -15.115 37.879 97.770  1.00 28.68 ? 515  PHE A CG  1 
ATOM   3474 C CD1 . PHE A 1 514 ? -15.445 36.604 97.320  1.00 26.25 ? 515  PHE A CD1 1 
ATOM   3475 C CD2 . PHE A 1 514 ? -16.114 38.842 97.846  1.00 26.92 ? 515  PHE A CD2 1 
ATOM   3476 C CE1 . PHE A 1 514 ? -16.741 36.304 96.950  1.00 24.02 ? 515  PHE A CE1 1 
ATOM   3477 C CE2 . PHE A 1 514 ? -17.419 38.552 97.470  1.00 28.16 ? 515  PHE A CE2 1 
ATOM   3478 C CZ  . PHE A 1 514 ? -17.738 37.280 97.026  1.00 28.63 ? 515  PHE A CZ  1 
ATOM   3479 N N   . TYR A 1 515 ? -13.535 39.155 94.944  1.00 23.97 ? 516  TYR A N   1 
ATOM   3480 C CA  . TYR A 1 515 ? -13.748 40.222 93.980  1.00 23.79 ? 516  TYR A CA  1 
ATOM   3481 C C   . TYR A 1 515 ? -15.225 40.367 93.664  1.00 25.96 ? 516  TYR A C   1 
ATOM   3482 O O   . TYR A 1 515 ? -15.967 39.379 93.599  1.00 27.77 ? 516  TYR A O   1 
ATOM   3483 C CB  . TYR A 1 515 ? -12.959 39.936 92.700  1.00 24.84 ? 516  TYR A CB  1 
ATOM   3484 C CG  . TYR A 1 515 ? -11.465 39.902 92.914  1.00 26.36 ? 516  TYR A CG  1 
ATOM   3485 C CD1 . TYR A 1 515 ? -10.822 38.741 93.349  1.00 23.76 ? 516  TYR A CD1 1 
ATOM   3486 C CD2 . TYR A 1 515 ? -10.692 41.040 92.707  1.00 26.18 ? 516  TYR A CD2 1 
ATOM   3487 C CE1 . TYR A 1 515 ? -9.448  38.721 93.553  1.00 25.41 ? 516  TYR A CE1 1 
ATOM   3488 C CE2 . TYR A 1 515 ? -9.329  41.025 92.905  1.00 23.51 ? 516  TYR A CE2 1 
ATOM   3489 C CZ  . TYR A 1 515 ? -8.712  39.874 93.325  1.00 25.04 ? 516  TYR A CZ  1 
ATOM   3490 O OH  . TYR A 1 515 ? -7.353  39.886 93.514  1.00 33.63 ? 516  TYR A OH  1 
ATOM   3491 N N   . ILE A 1 516 ? -15.654 41.603 93.462  1.00 26.99 ? 517  ILE A N   1 
ATOM   3492 C CA  . ILE A 1 516 ? -17.035 41.865 93.110  1.00 23.88 ? 517  ILE A CA  1 
ATOM   3493 C C   . ILE A 1 516 ? -17.044 42.422 91.689  1.00 26.48 ? 517  ILE A C   1 
ATOM   3494 O O   . ILE A 1 516 ? -16.489 43.493 91.440  1.00 21.10 ? 517  ILE A O   1 
ATOM   3495 C CB  . ILE A 1 516 ? -17.688 42.835 94.129  1.00 28.53 ? 517  ILE A CB  1 
ATOM   3496 C CG1 . ILE A 1 516 ? -17.740 42.188 95.528  1.00 25.83 ? 517  ILE A CG1 1 
ATOM   3497 C CG2 . ILE A 1 516 ? -19.094 43.265 93.672  1.00 27.33 ? 517  ILE A CG2 1 
ATOM   3498 C CD1 . ILE A 1 516 ? -18.043 43.199 96.663  1.00 24.04 ? 517  ILE A CD1 1 
ATOM   3499 N N   . ASN A 1 517 ? -17.642 41.678 90.765  1.00 20.75 ? 518  ASN A N   1 
ATOM   3500 C CA  . ASN A 1 517 ? -17.707 42.071 89.361  1.00 24.91 ? 518  ASN A CA  1 
ATOM   3501 C C   . ASN A 1 517 ? -16.328 42.314 88.778  1.00 25.38 ? 518  ASN A C   1 
ATOM   3502 O O   . ASN A 1 517 ? -16.111 43.231 87.983  1.00 24.93 ? 518  ASN A O   1 
ATOM   3503 C CB  . ASN A 1 517 ? -18.612 43.296 89.181  1.00 24.43 ? 518  ASN A CB  1 
ATOM   3504 C CG  . ASN A 1 517 ? -20.056 42.987 89.527  1.00 28.25 ? 518  ASN A CG  1 
ATOM   3505 O OD1 . ASN A 1 517 ? -20.526 41.883 89.268  1.00 27.05 ? 518  ASN A OD1 1 
ATOM   3506 N ND2 . ASN A 1 517 ? -20.754 43.942 90.141  1.00 24.00 ? 518  ASN A ND2 1 
ATOM   3507 N N   . ASP A 1 518 ? -15.386 41.499 89.214  1.00 21.76 ? 519  ASP A N   1 
ATOM   3508 C CA  . ASP A 1 518 ? -14.053 41.555 88.670  1.00 27.77 ? 519  ASP A CA  1 
ATOM   3509 C C   . ASP A 1 518 ? -13.549 40.124 88.575  1.00 27.23 ? 519  ASP A C   1 
ATOM   3510 O O   . ASP A 1 518 ? -13.909 39.277 89.395  1.00 28.58 ? 519  ASP A O   1 
ATOM   3511 C CB  . ASP A 1 518 ? -13.162 42.384 89.589  1.00 31.18 ? 519  ASP A CB  1 
ATOM   3512 C CG  . ASP A 1 518 ? -11.986 43.018 88.855  1.00 39.27 ? 519  ASP A CG  1 
ATOM   3513 O OD1 . ASP A 1 518 ? -11.928 42.923 87.604  1.00 40.67 ? 519  ASP A OD1 1 
ATOM   3514 O OD2 . ASP A 1 518 ? -11.130 43.619 89.542  1.00 45.04 ? 519  ASP A OD2 1 
ATOM   3515 N N   . LYS A 1 519 ? -12.740 39.843 87.564  1.00 25.93 ? 520  LYS A N   1 
ATOM   3516 C CA  . LYS A 1 519 ? -12.117 38.529 87.455  1.00 21.95 ? 520  LYS A CA  1 
ATOM   3517 C C   . LYS A 1 519 ? -11.292 38.236 88.709  1.00 25.97 ? 520  LYS A C   1 
ATOM   3518 O O   . LYS A 1 519 ? -10.761 39.154 89.349  1.00 19.19 ? 520  LYS A O   1 
ATOM   3519 C CB  . LYS A 1 519 ? -11.274 38.411 86.187  1.00 23.06 ? 520  LYS A CB  1 
ATOM   3520 C CG  . LYS A 1 519 ? -10.121 39.397 86.081  1.00 28.94 ? 520  LYS A CG  1 
ATOM   3521 C CD  . LYS A 1 519 ? -9.419  39.235 84.721  1.00 32.61 ? 520  LYS A CD  1 
ATOM   3522 C CE  . LYS A 1 519 ? -8.116  40.015 84.643  1.00 32.35 ? 520  LYS A CE  1 
ATOM   3523 N NZ  . LYS A 1 519 ? -8.399  41.460 84.642  1.00 41.98 ? 520  LYS A NZ  1 
ATOM   3524 N N   . CYS A 1 520 ? -11.224 36.955 89.079  1.00 26.97 ? 521  CYS A N   1 
ATOM   3525 C CA  . CYS A 1 520 ? -10.571 36.571 90.326  1.00 27.44 ? 521  CYS A CA  1 
ATOM   3526 C C   . CYS A 1 520 ? -9.045  36.589 90.200  1.00 27.40 ? 521  CYS A C   1 
ATOM   3527 O O   . CYS A 1 520 ? -8.345  36.250 91.142  1.00 29.19 ? 521  CYS A O   1 
ATOM   3528 C CB  . CYS A 1 520 ? -11.056 35.196 90.801  1.00 25.67 ? 521  CYS A CB  1 
ATOM   3529 S SG  . CYS A 1 520 ? -10.613 33.874 89.659  1.00 31.08 ? 521  CYS A SG  1 
ATOM   3530 N N   . THR A 1 521 ? -8.541  36.962 89.027  1.00 30.75 ? 522  THR A N   1 
ATOM   3531 C CA  . THR A 1 521 ? -7.112  37.228 88.853  1.00 37.74 ? 522  THR A CA  1 
ATOM   3532 C C   . THR A 1 521 ? -6.811  38.725 89.042  1.00 42.55 ? 522  THR A C   1 
ATOM   3533 O O   . THR A 1 521 ? -5.657  39.136 89.048  1.00 48.65 ? 522  THR A O   1 
ATOM   3534 C CB  . THR A 1 521 ? -6.607  36.796 87.456  1.00 31.52 ? 522  THR A CB  1 
ATOM   3535 O OG1 . THR A 1 521 ? -7.318  37.516 86.448  1.00 30.64 ? 522  THR A OG1 1 
ATOM   3536 C CG2 . THR A 1 521 ? -6.801  35.306 87.245  1.00 26.45 ? 522  THR A CG2 1 
ATOM   3537 N N   . GLY A 1 522 ? -7.859  39.532 89.191  1.00 43.00 ? 523  GLY A N   1 
ATOM   3538 C CA  . GLY A 1 522 ? -7.702  40.964 89.401  1.00 46.97 ? 523  GLY A CA  1 
ATOM   3539 C C   . GLY A 1 522 ? -7.246  41.709 88.158  1.00 56.86 ? 523  GLY A C   1 
ATOM   3540 O O   . GLY A 1 522 ? -6.792  42.859 88.236  1.00 63.63 ? 523  GLY A O   1 
ATOM   3541 N N   . ASN A 1 546 ? 4.616   43.440 104.512 1.00 59.18 ? 547  ASN A N   1 
ATOM   3542 C CA  . ASN A 1 546 ? 4.209   42.587 105.630 1.00 56.69 ? 547  ASN A CA  1 
ATOM   3543 C C   . ASN A 1 546 ? 4.791   41.182 105.521 1.00 53.79 ? 547  ASN A C   1 
ATOM   3544 O O   . ASN A 1 546 ? 4.961   40.487 106.526 1.00 54.74 ? 547  ASN A O   1 
ATOM   3545 C CB  . ASN A 1 546 ? 2.685   42.510 105.737 1.00 60.28 ? 547  ASN A CB  1 
ATOM   3546 N N   . ILE A 1 547 ? 5.086   40.766 104.291 1.00 44.08 ? 548  ILE A N   1 
ATOM   3547 C CA  . ILE A 1 547 ? 5.823   39.536 104.063 1.00 35.19 ? 548  ILE A CA  1 
ATOM   3548 C C   . ILE A 1 547 ? 7.287   39.737 104.490 1.00 33.31 ? 548  ILE A C   1 
ATOM   3549 O O   . ILE A 1 547 ? 7.971   38.788 104.873 1.00 37.56 ? 548  ILE A O   1 
ATOM   3550 C CB  . ILE A 1 547 ? 5.717   39.090 102.587 1.00 40.97 ? 548  ILE A CB  1 
ATOM   3551 C CG1 . ILE A 1 547 ? 5.706   37.564 102.475 1.00 50.28 ? 548  ILE A CG1 1 
ATOM   3552 C CG2 . ILE A 1 547 ? 6.812   39.705 101.732 1.00 38.99 ? 548  ILE A CG2 1 
ATOM   3553 C CD1 . ILE A 1 547 ? 7.069   36.944 102.392 1.00 56.90 ? 548  ILE A CD1 1 
ATOM   3554 N N   . LEU A 1 548 ? 7.752   40.984 104.459 1.00 29.03 ? 549  LEU A N   1 
ATOM   3555 C CA  . LEU A 1 548 ? 9.105   41.312 104.891 1.00 27.88 ? 549  LEU A CA  1 
ATOM   3556 C C   . LEU A 1 548 ? 9.298   40.961 106.360 1.00 27.25 ? 549  LEU A C   1 
ATOM   3557 O O   . LEU A 1 548 ? 10.359  40.508 106.772 1.00 32.04 ? 549  LEU A O   1 
ATOM   3558 C CB  . LEU A 1 548 ? 9.391   42.796 104.669 1.00 27.05 ? 549  LEU A CB  1 
ATOM   3559 C CG  . LEU A 1 548 ? 9.332   43.243 103.212 1.00 30.10 ? 549  LEU A CG  1 
ATOM   3560 C CD1 . LEU A 1 548 ? 9.543   44.758 103.116 1.00 30.63 ? 549  LEU A CD1 1 
ATOM   3561 C CD2 . LEU A 1 548 ? 10.366  42.483 102.387 1.00 25.51 ? 549  LEU A CD2 1 
ATOM   3562 N N   . SER A 1 549 ? 8.256   41.156 107.148 1.00 26.94 ? 550  SER A N   1 
ATOM   3563 C CA  . SER A 1 549 ? 8.351   40.912 108.573 1.00 32.43 ? 550  SER A CA  1 
ATOM   3564 C C   . SER A 1 549 ? 8.557   39.415 108.885 1.00 33.74 ? 550  SER A C   1 
ATOM   3565 O O   . SER A 1 549 ? 9.123   39.061 109.919 1.00 32.56 ? 550  SER A O   1 
ATOM   3566 C CB  . SER A 1 549 ? 7.107   41.458 109.272 1.00 37.11 ? 550  SER A CB  1 
ATOM   3567 O OG  . SER A 1 549 ? 6.112   40.458 109.339 1.00 46.06 ? 550  SER A OG  1 
ATOM   3568 N N   . ARG A 1 550 ? 8.128   38.534 107.980 1.00 31.58 ? 551  ARG A N   1 
ATOM   3569 C CA  . ARG A 1 550 ? 8.415   37.106 108.139 1.00 29.40 ? 551  ARG A CA  1 
ATOM   3570 C C   . ARG A 1 550 ? 9.912   36.788 107.998 1.00 30.77 ? 551  ARG A C   1 
ATOM   3571 O O   . ARG A 1 550 ? 10.365  35.721 108.396 1.00 32.58 ? 551  ARG A O   1 
ATOM   3572 C CB  . ARG A 1 550 ? 7.598   36.275 107.148 1.00 30.56 ? 551  ARG A CB  1 
ATOM   3573 C CG  . ARG A 1 550 ? 6.088   36.499 107.263 1.00 35.79 ? 551  ARG A CG  1 
ATOM   3574 C CD  . ARG A 1 550 ? 5.364   35.371 108.013 1.00 48.99 ? 551  ARG A CD  1 
ATOM   3575 N NE  . ARG A 1 550 ? 5.671   35.327 109.442 1.00 63.32 ? 551  ARG A NE  1 
ATOM   3576 C CZ  . ARG A 1 550 ? 6.124   34.249 110.087 1.00 70.05 ? 551  ARG A CZ  1 
ATOM   3577 N NH1 . ARG A 1 550 ? 6.376   34.314 111.392 1.00 69.06 ? 551  ARG A NH1 1 
ATOM   3578 N NH2 . ARG A 1 550 ? 6.324   33.104 109.434 1.00 68.48 ? 551  ARG A NH2 1 
ATOM   3579 N N   . PHE A 1 551 ? 10.690  37.718 107.454 1.00 29.91 ? 552  PHE A N   1 
ATOM   3580 C CA  . PHE A 1 551 ? 12.111  37.445 107.244 1.00 31.16 ? 552  PHE A CA  1 
ATOM   3581 C C   . PHE A 1 551 ? 13.049  38.195 108.186 1.00 32.58 ? 552  PHE A C   1 
ATOM   3582 O O   . PHE A 1 551 ? 14.270  38.223 107.973 1.00 28.44 ? 552  PHE A O   1 
ATOM   3583 C CB  . PHE A 1 551 ? 12.494  37.670 105.785 1.00 24.00 ? 552  PHE A CB  1 
ATOM   3584 C CG  . PHE A 1 551 ? 11.886  36.666 104.866 1.00 26.23 ? 552  PHE A CG  1 
ATOM   3585 C CD1 . PHE A 1 551 ? 12.333  35.353 104.871 1.00 24.88 ? 552  PHE A CD1 1 
ATOM   3586 C CD2 . PHE A 1 551 ? 10.837  37.014 104.031 1.00 29.44 ? 552  PHE A CD2 1 
ATOM   3587 C CE1 . PHE A 1 551 ? 11.757  34.408 104.044 1.00 25.13 ? 552  PHE A CE1 1 
ATOM   3588 C CE2 . PHE A 1 551 ? 10.258  36.072 103.192 1.00 29.87 ? 552  PHE A CE2 1 
ATOM   3589 C CZ  . PHE A 1 551 ? 10.721  34.769 103.200 1.00 27.18 ? 552  PHE A CZ  1 
ATOM   3590 N N   . VAL A 1 552 ? 12.480  38.784 109.231 1.00 26.06 ? 553  VAL A N   1 
ATOM   3591 C CA  . VAL A 1 552 ? 13.282  39.419 110.263 1.00 27.13 ? 553  VAL A CA  1 
ATOM   3592 C C   . VAL A 1 552 ? 12.766  39.023 111.619 1.00 30.82 ? 553  VAL A C   1 
ATOM   3593 O O   . VAL A 1 552 ? 11.693  38.439 111.742 1.00 30.46 ? 553  VAL A O   1 
ATOM   3594 C CB  . VAL A 1 552 ? 13.214  40.961 110.201 1.00 28.11 ? 553  VAL A CB  1 
ATOM   3595 C CG1 . VAL A 1 552 ? 13.866  41.473 108.935 1.00 30.50 ? 553  VAL A CG1 1 
ATOM   3596 C CG2 . VAL A 1 552 ? 11.772  41.431 110.308 1.00 24.91 ? 553  VAL A CG2 1 
ATOM   3597 N N   . SER A 1 553 ? 13.535  39.365 112.643 1.00 28.06 ? 554  SER A N   1 
ATOM   3598 C CA  . SER A 1 553 ? 13.103  39.163 114.009 1.00 36.21 ? 554  SER A CA  1 
ATOM   3599 C C   . SER A 1 553 ? 13.377  40.445 114.799 1.00 35.95 ? 554  SER A C   1 
ATOM   3600 O O   . SER A 1 553 ? 14.407  41.077 114.605 1.00 33.84 ? 554  SER A O   1 
ATOM   3601 C CB  . SER A 1 553 ? 13.884  38.001 114.604 1.00 41.69 ? 554  SER A CB  1 
ATOM   3602 O OG  . SER A 1 553 ? 13.363  37.652 115.858 1.00 49.17 ? 554  SER A OG  1 
ATOM   3603 N N   . ILE A 1 554 ? 12.457  40.833 115.676 1.00 35.50 ? 555  ILE A N   1 
ATOM   3604 C CA  . ILE A 1 554 ? 12.646  42.038 116.476 1.00 31.56 ? 555  ILE A CA  1 
ATOM   3605 C C   . ILE A 1 554 ? 13.534  41.752 117.683 1.00 33.73 ? 555  ILE A C   1 
ATOM   3606 O O   . ILE A 1 554 ? 13.468  40.694 118.301 1.00 36.95 ? 555  ILE A O   1 
ATOM   3607 C CB  . ILE A 1 554 ? 11.312  42.687 116.923 1.00 40.17 ? 555  ILE A CB  1 
ATOM   3608 C CG1 . ILE A 1 554 ? 11.557  44.084 117.487 1.00 42.53 ? 555  ILE A CG1 1 
ATOM   3609 C CG2 . ILE A 1 554 ? 10.609  41.842 117.964 1.00 47.02 ? 555  ILE A CG2 1 
ATOM   3610 C CD1 . ILE A 1 554 ? 12.172  45.032 116.480 1.00 45.25 ? 555  ILE A CD1 1 
ATOM   3611 N N   . ARG A 1 555 ? 14.387  42.708 117.998 1.00 31.20 ? 556  ARG A N   1 
ATOM   3612 C CA  . ARG A 1 555 ? 15.272  42.581 119.127 1.00 34.77 ? 556  ARG A CA  1 
ATOM   3613 C C   . ARG A 1 555 ? 15.312  43.924 119.819 1.00 37.75 ? 556  ARG A C   1 
ATOM   3614 O O   . ARG A 1 555 ? 15.684  44.919 119.206 1.00 36.16 ? 556  ARG A O   1 
ATOM   3615 C CB  . ARG A 1 555 ? 16.662  42.186 118.633 1.00 36.01 ? 556  ARG A CB  1 
ATOM   3616 C CG  . ARG A 1 555 ? 17.642  41.851 119.734 1.00 45.07 ? 556  ARG A CG  1 
ATOM   3617 C CD  . ARG A 1 555 ? 18.484  43.050 120.046 1.00 51.17 ? 556  ARG A CD  1 
ATOM   3618 N NE  . ARG A 1 555 ? 19.700  42.647 120.720 1.00 53.76 ? 556  ARG A NE  1 
ATOM   3619 C CZ  . ARG A 1 555 ? 20.858  43.270 120.586 1.00 45.58 ? 556  ARG A CZ  1 
ATOM   3620 N NH1 . ARG A 1 555 ? 20.954  44.331 119.793 1.00 43.73 ? 556  ARG A NH1 1 
ATOM   3621 N NH2 . ARG A 1 555 ? 21.910  42.822 121.241 1.00 46.18 ? 556  ARG A NH2 1 
ATOM   3622 N N   . ASN A 1 556 ? 14.936  43.949 121.097 1.00 38.31 ? 557  ASN A N   1 
ATOM   3623 C CA  . ASN A 1 556 ? 14.894  45.187 121.861 1.00 33.49 ? 557  ASN A CA  1 
ATOM   3624 C C   . ASN A 1 556 ? 16.061  45.312 122.805 1.00 39.94 ? 557  ASN A C   1 
ATOM   3625 O O   . ASN A 1 556 ? 16.432  44.353 123.475 1.00 42.86 ? 557  ASN A O   1 
ATOM   3626 C CB  . ASN A 1 556 ? 13.596  45.289 122.667 1.00 40.24 ? 557  ASN A CB  1 
ATOM   3627 C CG  . ASN A 1 556 ? 12.359  45.119 121.800 1.00 47.16 ? 557  ASN A CG  1 
ATOM   3628 O OD1 . ASN A 1 556 ? 12.054  45.970 120.961 1.00 48.16 ? 557  ASN A OD1 1 
ATOM   3629 N ND2 . ASN A 1 556 ? 11.637  44.015 122.000 1.00 48.60 ? 557  ASN A ND2 1 
ATOM   3630 N N   . THR A 1 557 ? 16.637  46.505 122.857 1.00 35.18 ? 558  THR A N   1 
ATOM   3631 C CA  . THR A 1 557 ? 17.666  46.812 123.819 1.00 36.61 ? 558  THR A CA  1 
ATOM   3632 C C   . THR A 1 557 ? 17.064  47.823 124.769 1.00 39.29 ? 558  THR A C   1 
ATOM   3633 O O   . THR A 1 557 ? 16.471  48.805 124.328 1.00 38.07 ? 558  THR A O   1 
ATOM   3634 C CB  . THR A 1 557 ? 18.892  47.405 123.122 1.00 35.87 ? 558  THR A CB  1 
ATOM   3635 O OG1 . THR A 1 557 ? 19.383  46.453 122.172 1.00 34.82 ? 558  THR A OG1 1 
ATOM   3636 C CG2 . THR A 1 557 ? 19.981  47.745 124.114 1.00 37.39 ? 558  THR A CG2 1 
ATOM   3637 N N   . LYS A 1 558 ? 17.175  47.557 126.067 1.00 40.13 ? 559  LYS A N   1 
ATOM   3638 C CA  . LYS A 1 558 ? 16.683  48.475 127.072 1.00 42.03 ? 559  LYS A CA  1 
ATOM   3639 C C   . LYS A 1 558 ? 17.815  48.802 128.023 1.00 43.61 ? 559  LYS A C   1 
ATOM   3640 O O   . LYS A 1 558 ? 18.434  47.912 128.600 1.00 44.19 ? 559  LYS A O   1 
ATOM   3641 C CB  . LYS A 1 558 ? 15.506  47.882 127.851 1.00 43.13 ? 559  LYS A CB  1 
ATOM   3642 C CG  . LYS A 1 558 ? 15.102  48.741 129.068 1.00 45.51 ? 559  LYS A CG  1 
ATOM   3643 C CD  . LYS A 1 558 ? 13.947  48.132 129.868 1.00 61.20 ? 559  LYS A CD  1 
ATOM   3644 C CE  . LYS A 1 558 ? 12.689  47.991 129.007 1.00 56.95 ? 559  LYS A CE  1 
ATOM   3645 N NZ  . LYS A 1 558 ? 12.015  49.301 128.815 1.00 53.09 ? 559  LYS A NZ  1 
ATOM   3646 N N   . GLU A 1 559 ? 18.097  50.085 128.180 1.00 44.38 ? 560  GLU A N   1 
ATOM   3647 C CA  . GLU A 1 559 ? 19.150  50.492 129.078 1.00 45.98 ? 560  GLU A CA  1 
ATOM   3648 C C   . GLU A 1 559 ? 18.577  51.213 130.287 1.00 48.37 ? 560  GLU A C   1 
ATOM   3649 O O   . GLU A 1 559 ? 17.714  52.072 130.152 1.00 48.64 ? 560  GLU A O   1 
ATOM   3650 C CB  . GLU A 1 559 ? 20.150  51.381 128.353 1.00 45.19 ? 560  GLU A CB  1 
ATOM   3651 C CG  . GLU A 1 559 ? 21.150  52.014 129.294 1.00 47.01 ? 560  GLU A CG  1 
ATOM   3652 C CD  . GLU A 1 559 ? 22.408  52.453 128.599 1.00 46.11 ? 560  GLU A CD  1 
ATOM   3653 O OE1 . GLU A 1 559 ? 22.494  52.360 127.354 1.00 44.13 ? 560  GLU A OE1 1 
ATOM   3654 O OE2 . GLU A 1 559 ? 23.321  52.885 129.307 1.00 47.50 ? 560  GLU A OE2 1 
ATOM   3655 N N   . ASN A 1 560 ? 19.061  50.857 131.469 1.00 50.22 ? 561  ASN A N   1 
ATOM   3656 C CA  . ASN A 1 560 ? 18.631  51.508 132.695 1.00 52.76 ? 561  ASN A CA  1 
ATOM   3657 C C   . ASN A 1 560 ? 19.783  52.274 133.338 1.00 54.23 ? 561  ASN A C   1 
ATOM   3658 O O   . ASN A 1 560 ? 20.925  51.827 133.295 1.00 53.87 ? 561  ASN A O   1 
ATOM   3659 C CB  . ASN A 1 560 ? 18.025  50.490 133.663 1.00 54.12 ? 561  ASN A CB  1 
ATOM   3660 C CG  . ASN A 1 560 ? 17.882  51.037 135.072 1.00 57.09 ? 561  ASN A CG  1 
ATOM   3661 O OD1 . ASN A 1 560 ? 18.656  50.688 135.952 1.00 58.57 ? 561  ASN A OD1 1 
ATOM   3662 N ND2 . ASN A 1 560 ? 16.902  51.904 135.285 1.00 58.08 ? 561  ASN A ND2 1 
ATOM   3663 N N   . PHE A 1 561 ? 19.477  53.429 133.922 1.00 55.96 ? 562  PHE A N   1 
ATOM   3664 C CA  . PHE A 1 561 ? 20.507  54.332 134.430 1.00 57.34 ? 562  PHE A CA  1 
ATOM   3665 C C   . PHE A 1 561 ? 20.594  54.378 135.947 1.00 60.29 ? 562  PHE A C   1 
ATOM   3666 O O   . PHE A 1 561 ? 21.634  54.731 136.501 1.00 61.51 ? 562  PHE A O   1 
ATOM   3667 C CB  . PHE A 1 561 ? 20.296  55.737 133.869 1.00 57.17 ? 562  PHE A CB  1 
ATOM   3668 C CG  . PHE A 1 561 ? 20.148  55.768 132.374 1.00 54.47 ? 562  PHE A CG  1 
ATOM   3669 C CD1 . PHE A 1 561 ? 21.208  55.426 131.553 1.00 52.72 ? 562  PHE A CD1 1 
ATOM   3670 C CD2 . PHE A 1 561 ? 18.945  56.127 131.789 1.00 53.79 ? 562  PHE A CD2 1 
ATOM   3671 C CE1 . PHE A 1 561 ? 21.073  55.446 130.176 1.00 50.38 ? 562  PHE A CE1 1 
ATOM   3672 C CE2 . PHE A 1 561 ? 18.809  56.149 130.414 1.00 51.43 ? 562  PHE A CE2 1 
ATOM   3673 C CZ  . PHE A 1 561 ? 19.879  55.809 129.609 1.00 49.74 ? 562  PHE A CZ  1 
ATOM   3674 N N   . TYR A 1 562 ? 19.510  54.019 136.622 1.00 61.54 ? 563  TYR A N   1 
ATOM   3675 C CA  . TYR A 1 562 ? 19.490  54.047 138.082 1.00 64.55 ? 563  TYR A CA  1 
ATOM   3676 C C   . TYR A 1 562 ? 20.278  52.886 138.685 1.00 65.07 ? 563  TYR A C   1 
ATOM   3677 O O   . TYR A 1 562 ? 20.182  51.751 138.238 1.00 63.57 ? 563  TYR A O   1 
ATOM   3678 C CB  . TYR A 1 562 ? 18.053  54.046 138.600 1.00 65.86 ? 563  TYR A CB  1 
ATOM   3679 N N   . GLU A 1 563 ? 21.061  53.180 139.708 1.00 67.32 ? 564  GLU A N   1 
ATOM   3680 C CA  . GLU A 1 563 ? 21.854  52.157 140.376 1.00 78.43 ? 564  GLU A CA  1 
ATOM   3681 C C   . GLU A 1 563 ? 21.267  51.827 141.740 1.00 75.61 ? 564  GLU A C   1 
ATOM   3682 O O   . GLU A 1 563 ? 21.146  52.701 142.596 1.00 76.31 ? 564  GLU A O   1 
ATOM   3683 C CB  . GLU A 1 563 ? 23.308  52.614 140.505 1.00 68.60 ? 564  GLU A CB  1 
ATOM   3684 C CG  . GLU A 1 563 ? 23.985  52.817 139.147 1.00 68.46 ? 564  GLU A CG  1 
ATOM   3685 C CD  . GLU A 1 563 ? 25.380  53.393 139.265 1.00 68.75 ? 564  GLU A CD  1 
ATOM   3686 O OE1 . GLU A 1 563 ? 25.805  53.694 140.398 1.00 71.04 ? 564  GLU A OE1 1 
ATOM   3687 O OE2 . GLU A 1 563 ? 26.049  53.550 138.224 1.00 68.51 ? 564  GLU A OE2 1 
ATOM   3688 N N   . LEU A 1 564 ? 20.899  50.560 141.924 1.00 74.83 ? 565  LEU A N   1 
ATOM   3689 C CA  . LEU A 1 564 ? 20.274  50.081 143.160 1.00 76.52 ? 565  LEU A CA  1 
ATOM   3690 C C   . LEU A 1 564 ? 21.166  50.244 144.391 1.00 78.17 ? 565  LEU A C   1 
ATOM   3691 O O   . LEU A 1 564 ? 22.391  50.194 144.294 1.00 78.90 ? 565  LEU A O   1 
ATOM   3692 C CB  . LEU A 1 564 ? 19.860  48.614 143.002 1.00 74.70 ? 565  LEU A CB  1 
ATOM   3693 C CG  . LEU A 1 564 ? 18.789  48.334 141.945 1.00 74.04 ? 565  LEU A CG  1 
ATOM   3694 C CD1 . LEU A 1 564 ? 18.911  46.919 141.387 1.00 68.63 ? 565  LEU A CD1 1 
ATOM   3695 C CD2 . LEU A 1 564 ? 17.406  48.556 142.539 1.00 76.23 ? 565  LEU A CD2 1 
ATOM   3696 N N   . ASP B 1 42  ? -7.662  46.809 154.432 1.00 72.77 ? 43   ASP B N   1 
ATOM   3697 C CA  . ASP B 1 42  ? -7.124  46.351 153.145 1.00 74.45 ? 43   ASP B CA  1 
ATOM   3698 C C   . ASP B 1 42  ? -6.270  45.089 153.293 1.00 74.43 ? 43   ASP B C   1 
ATOM   3699 O O   . ASP B 1 42  ? -6.448  44.115 152.553 1.00 72.84 ? 43   ASP B O   1 
ATOM   3700 C CB  . ASP B 1 42  ? -6.325  47.458 152.448 1.00 72.85 ? 43   ASP B CB  1 
ATOM   3701 N N   . TRP B 1 43  ? -5.332  45.120 154.236 1.00 70.84 ? 44   TRP B N   1 
ATOM   3702 C CA  . TRP B 1 43  ? -4.582  43.923 154.593 1.00 67.96 ? 44   TRP B CA  1 
ATOM   3703 C C   . TRP B 1 43  ? -5.541  42.974 155.313 1.00 66.63 ? 44   TRP B C   1 
ATOM   3704 O O   . TRP B 1 43  ? -5.422  41.752 155.218 1.00 66.87 ? 44   TRP B O   1 
ATOM   3705 C CB  . TRP B 1 43  ? -3.381  44.275 155.477 1.00 64.53 ? 44   TRP B CB  1 
ATOM   3706 N N   . ASP B 1 44  ? -6.506  43.554 156.019 1.00 61.21 ? 45   ASP B N   1 
ATOM   3707 C CA  . ASP B 1 44  ? -7.595  42.789 156.606 1.00 63.70 ? 45   ASP B CA  1 
ATOM   3708 C C   . ASP B 1 44  ? -8.403  42.080 155.524 1.00 61.30 ? 45   ASP B C   1 
ATOM   3709 O O   . ASP B 1 44  ? -8.842  40.946 155.710 1.00 60.43 ? 45   ASP B O   1 
ATOM   3710 C CB  . ASP B 1 44  ? -8.509  43.704 157.425 1.00 66.53 ? 45   ASP B CB  1 
ATOM   3711 N N   . LEU B 1 45  ? -8.590  42.754 154.392 1.00 59.64 ? 46   LEU B N   1 
ATOM   3712 C CA  . LEU B 1 45  ? -9.356  42.199 153.282 1.00 60.53 ? 46   LEU B CA  1 
ATOM   3713 C C   . LEU B 1 45  ? -8.610  41.029 152.673 1.00 58.59 ? 46   LEU B C   1 
ATOM   3714 O O   . LEU B 1 45  ? -9.213  40.026 152.280 1.00 57.64 ? 46   LEU B O   1 
ATOM   3715 C CB  . LEU B 1 45  ? -9.612  43.255 152.202 1.00 58.15 ? 46   LEU B CB  1 
ATOM   3716 C CG  . LEU B 1 45  ? -10.773 44.224 152.428 1.00 64.63 ? 46   LEU B CG  1 
ATOM   3717 C CD1 . LEU B 1 45  ? -12.067 43.460 152.695 1.00 65.48 ? 46   LEU B CD1 1 
ATOM   3718 C CD2 . LEU B 1 45  ? -10.468 45.176 153.572 1.00 71.80 ? 46   LEU B CD2 1 
ATOM   3719 N N   . LEU B 1 46  ? -7.292  41.174 152.585 1.00 55.97 ? 47   LEU B N   1 
ATOM   3720 C CA  . LEU B 1 46  ? -6.456  40.129 152.020 1.00 55.27 ? 47   LEU B CA  1 
ATOM   3721 C C   . LEU B 1 46  ? -6.427  38.947 152.967 1.00 55.87 ? 47   LEU B C   1 
ATOM   3722 O O   . LEU B 1 46  ? -6.611  37.805 152.548 1.00 54.62 ? 47   LEU B O   1 
ATOM   3723 C CB  . LEU B 1 46  ? -5.034  40.631 151.775 1.00 53.27 ? 47   LEU B CB  1 
ATOM   3724 C CG  . LEU B 1 46  ? -4.121  39.572 151.162 1.00 52.99 ? 47   LEU B CG  1 
ATOM   3725 C CD1 . LEU B 1 46  ? -4.673  39.122 149.822 1.00 47.41 ? 47   LEU B CD1 1 
ATOM   3726 C CD2 . LEU B 1 46  ? -2.691  40.080 151.013 1.00 56.70 ? 47   LEU B CD2 1 
ATOM   3727 N N   . ARG B 1 47  ? -6.197  39.237 154.246 1.00 54.05 ? 48   ARG B N   1 
ATOM   3728 C CA  . ARG B 1 47  ? -6.156  38.202 155.272 1.00 65.60 ? 48   ARG B CA  1 
ATOM   3729 C C   . ARG B 1 47  ? -7.427  37.367 155.211 1.00 67.08 ? 48   ARG B C   1 
ATOM   3730 O O   . ARG B 1 47  ? -7.375  36.137 155.262 1.00 57.71 ? 48   ARG B O   1 
ATOM   3731 C CB  . ARG B 1 47  ? -5.983  38.818 156.664 1.00 64.99 ? 48   ARG B CB  1 
ATOM   3732 N N   . ALA B 1 48  ? -8.562  38.047 155.063 1.00 57.14 ? 49   ALA B N   1 
ATOM   3733 C CA  . ALA B 1 48  ? -9.855  37.374 155.002 1.00 61.93 ? 49   ALA B CA  1 
ATOM   3734 C C   . ALA B 1 48  ? -9.961  36.462 153.783 1.00 58.68 ? 49   ALA B C   1 
ATOM   3735 O O   . ALA B 1 48  ? -10.462 35.339 153.886 1.00 57.44 ? 49   ALA B O   1 
ATOM   3736 C CB  . ALA B 1 48  ? -10.993 38.389 155.018 1.00 58.28 ? 49   ALA B CB  1 
ATOM   3737 N N   . SER B 1 49  ? -9.484  36.945 152.634 1.00 53.91 ? 50   SER B N   1 
ATOM   3738 C CA  . SER B 1 49  ? -9.448  36.123 151.425 1.00 52.29 ? 50   SER B CA  1 
ATOM   3739 C C   . SER B 1 49  ? -8.534  34.908 151.595 1.00 52.71 ? 50   SER B C   1 
ATOM   3740 O O   . SER B 1 49  ? -8.916  33.793 151.252 1.00 60.11 ? 50   SER B O   1 
ATOM   3741 C CB  . SER B 1 49  ? -9.037  36.941 150.201 1.00 49.71 ? 50   SER B CB  1 
ATOM   3742 O OG  . SER B 1 49  ? -10.127 37.693 149.699 1.00 63.84 ? 50   SER B OG  1 
ATOM   3743 N N   . LEU B 1 50  ? -7.338  35.126 152.132 1.00 52.84 ? 51   LEU B N   1 
ATOM   3744 C CA  . LEU B 1 50  ? -6.412  34.027 152.399 1.00 58.34 ? 51   LEU B CA  1 
ATOM   3745 C C   . LEU B 1 50  ? -7.032  32.973 153.319 1.00 62.12 ? 51   LEU B C   1 
ATOM   3746 O O   . LEU B 1 50  ? -6.928  31.779 153.056 1.00 56.15 ? 51   LEU B O   1 
ATOM   3747 C CB  . LEU B 1 50  ? -5.102  34.551 152.993 1.00 53.45 ? 51   LEU B CB  1 
ATOM   3748 C CG  . LEU B 1 50  ? -4.220  35.342 152.023 1.00 53.27 ? 51   LEU B CG  1 
ATOM   3749 C CD1 . LEU B 1 50  ? -3.156  36.145 152.756 1.00 51.39 ? 51   LEU B CD1 1 
ATOM   3750 C CD2 . LEU B 1 50  ? -3.585  34.414 150.994 1.00 49.59 ? 51   LEU B CD2 1 
ATOM   3751 N N   . MET B 1 51  ? -7.689  33.419 154.387 1.00 63.74 ? 52   MET B N   1 
ATOM   3752 C CA  . MET B 1 51  ? -8.295  32.495 155.340 1.00 68.06 ? 52   MET B CA  1 
ATOM   3753 C C   . MET B 1 51  ? -9.434  31.688 154.713 1.00 66.33 ? 52   MET B C   1 
ATOM   3754 O O   . MET B 1 51  ? -9.571  30.494 154.985 1.00 69.19 ? 52   MET B O   1 
ATOM   3755 C CB  . MET B 1 51  ? -8.790  33.225 156.599 1.00 72.65 ? 52   MET B CB  1 
ATOM   3756 C CG  . MET B 1 51  ? -7.693  33.749 157.522 1.00 74.94 ? 52   MET B CG  1 
ATOM   3757 S SD  . MET B 1 51  ? -6.637  32.471 158.248 1.00 99.07 ? 52   MET B SD  1 
ATOM   3758 C CE  . MET B 1 51  ? -7.848  31.243 158.745 1.00 71.09 ? 52   MET B CE  1 
ATOM   3759 N N   . LYS B 1 52  ? -10.246 32.344 153.884 1.00 62.17 ? 53   LYS B N   1 
ATOM   3760 C CA  . LYS B 1 52  ? -11.348 31.675 153.190 1.00 61.53 ? 53   LYS B CA  1 
ATOM   3761 C C   . LYS B 1 52  ? -10.844 30.424 152.475 1.00 62.12 ? 53   LYS B C   1 
ATOM   3762 O O   . LYS B 1 52  ? -11.255 29.304 152.804 1.00 60.22 ? 53   LYS B O   1 
ATOM   3763 C CB  . LYS B 1 52  ? -12.025 32.623 152.193 1.00 57.14 ? 53   LYS B CB  1 
ATOM   3764 N N   . PHE B 1 53  ? -9.933  30.629 151.520 1.00 63.75 ? 54   PHE B N   1 
ATOM   3765 C CA  . PHE B 1 53  ? -9.302  29.541 150.763 1.00 61.91 ? 54   PHE B CA  1 
ATOM   3766 C C   . PHE B 1 53  ? -8.454  28.611 151.628 1.00 62.36 ? 54   PHE B C   1 
ATOM   3767 O O   . PHE B 1 53  ? -8.265  27.448 151.278 1.00 63.71 ? 54   PHE B O   1 
ATOM   3768 C CB  . PHE B 1 53  ? -8.422  30.089 149.630 1.00 57.75 ? 54   PHE B CB  1 
ATOM   3769 C CG  . PHE B 1 53  ? -9.183  30.827 148.557 1.00 62.97 ? 54   PHE B CG  1 
ATOM   3770 C CD1 . PHE B 1 53  ? -9.903  30.137 147.597 1.00 66.76 ? 54   PHE B CD1 1 
ATOM   3771 C CD2 . PHE B 1 53  ? -9.160  32.214 148.499 1.00 67.62 ? 54   PHE B CD2 1 
ATOM   3772 C CE1 . PHE B 1 53  ? -10.597 30.819 146.601 1.00 72.96 ? 54   PHE B CE1 1 
ATOM   3773 C CE2 . PHE B 1 53  ? -9.850  32.903 147.507 1.00 71.90 ? 54   PHE B CE2 1 
ATOM   3774 C CZ  . PHE B 1 53  ? -10.566 32.205 146.554 1.00 72.52 ? 54   PHE B CZ  1 
ATOM   3775 N N   . LYS B 1 54  ? -7.918  29.121 152.734 1.00 65.22 ? 55   LYS B N   1 
ATOM   3776 C CA  . LYS B 1 54  ? -7.094  28.288 153.621 1.00 69.34 ? 55   LYS B CA  1 
ATOM   3777 C C   . LYS B 1 54  ? -7.934  27.320 154.434 1.00 65.86 ? 55   LYS B C   1 
ATOM   3778 O O   . LYS B 1 54  ? -7.481  26.232 154.769 1.00 67.60 ? 55   LYS B O   1 
ATOM   3779 C CB  . LYS B 1 54  ? -6.237  29.137 154.573 1.00 70.91 ? 55   LYS B CB  1 
ATOM   3780 C CG  . LYS B 1 54  ? -4.903  29.605 153.992 1.00 68.35 ? 55   LYS B CG  1 
ATOM   3781 C CD  . LYS B 1 54  ? -3.984  30.191 155.062 1.00 59.09 ? 55   LYS B CD  1 
ATOM   3782 N N   . SER B 1 55  ? -9.161  27.720 154.743 1.00 73.50 ? 56   SER B N   1 
ATOM   3783 C CA  . SER B 1 55  ? -10.004 26.978 155.688 1.00 79.40 ? 56   SER B CA  1 
ATOM   3784 C C   . SER B 1 55  ? -10.535 25.660 155.128 1.00 81.43 ? 56   SER B C   1 
ATOM   3785 O O   . SER B 1 55  ? -10.549 24.637 155.819 1.00 84.29 ? 56   SER B O   1 
ATOM   3786 C CB  . SER B 1 55  ? -11.173 27.851 156.149 1.00 79.78 ? 56   SER B CB  1 
ATOM   3787 O OG  . SER B 1 55  ? -10.700 29.015 156.802 1.00 81.29 ? 56   SER B OG  1 
ATOM   3788 N N   . SER B 1 56  ? -10.976 25.697 153.875 1.00 79.65 ? 57   SER B N   1 
ATOM   3789 C CA  . SER B 1 56  ? -11.509 24.520 153.207 1.00 78.46 ? 57   SER B CA  1 
ATOM   3790 C C   . SER B 1 56  ? -10.817 24.316 151.863 1.00 74.70 ? 57   SER B C   1 
ATOM   3791 O O   . SER B 1 56  ? -9.942  25.095 151.479 1.00 72.96 ? 57   SER B O   1 
ATOM   3792 C CB  . SER B 1 56  ? -13.017 24.668 153.012 1.00 79.72 ? 57   SER B CB  1 
ATOM   3793 O OG  . SER B 1 56  ? -13.334 25.956 152.507 1.00 78.94 ? 57   SER B OG  1 
ATOM   3794 N N   . SER B 1 57  ? -11.205 23.263 151.152 1.00 71.94 ? 58   SER B N   1 
ATOM   3795 C CA  . SER B 1 57  ? -10.632 22.974 149.842 1.00 65.50 ? 58   SER B CA  1 
ATOM   3796 C C   . SER B 1 57  ? -11.709 23.113 148.780 1.00 59.73 ? 58   SER B C   1 
ATOM   3797 O O   . SER B 1 57  ? -12.691 22.383 148.787 1.00 65.22 ? 58   SER B O   1 
ATOM   3798 C CB  . SER B 1 57  ? -10.060 21.563 149.815 1.00 61.90 ? 58   SER B CB  1 
ATOM   3799 O OG  . SER B 1 57  ? -9.396  21.273 151.035 1.00 73.75 ? 58   SER B OG  1 
ATOM   3800 N N   . LEU B 1 58  ? -11.523 24.054 147.864 1.00 57.22 ? 59   LEU B N   1 
ATOM   3801 C CA  . LEU B 1 58  ? -12.545 24.340 146.869 1.00 56.15 ? 59   LEU B CA  1 
ATOM   3802 C C   . LEU B 1 58  ? -12.550 23.301 145.754 1.00 62.75 ? 59   LEU B C   1 
ATOM   3803 O O   . LEU B 1 58  ? -11.499 22.938 145.226 1.00 62.70 ? 59   LEU B O   1 
ATOM   3804 C CB  . LEU B 1 58  ? -12.333 25.734 146.289 1.00 53.78 ? 59   LEU B CB  1 
ATOM   3805 C CG  . LEU B 1 58  ? -13.356 26.209 145.256 1.00 53.93 ? 59   LEU B CG  1 
ATOM   3806 C CD1 . LEU B 1 58  ? -14.541 26.841 145.960 1.00 55.40 ? 59   LEU B CD1 1 
ATOM   3807 C CD2 . LEU B 1 58  ? -12.729 27.174 144.268 1.00 49.88 ? 59   LEU B CD2 1 
ATOM   3808 N N   . GLU B 1 59  ? -13.737 22.822 145.400 1.00 63.09 ? 60   GLU B N   1 
ATOM   3809 C CA  . GLU B 1 59  ? -13.892 21.950 144.245 1.00 60.90 ? 60   GLU B CA  1 
ATOM   3810 C C   . GLU B 1 59  ? -13.882 22.802 142.986 1.00 60.15 ? 60   GLU B C   1 
ATOM   3811 O O   . GLU B 1 59  ? -14.780 23.618 142.770 1.00 52.90 ? 60   GLU B O   1 
ATOM   3812 C CB  . GLU B 1 59  ? -15.200 21.171 144.325 1.00 64.05 ? 60   GLU B CB  1 
ATOM   3813 N N   . VAL B 1 60  ? -12.856 22.621 142.163 1.00 58.31 ? 61   VAL B N   1 
ATOM   3814 C CA  . VAL B 1 60  ? -12.769 23.339 140.902 1.00 53.02 ? 61   VAL B CA  1 
ATOM   3815 C C   . VAL B 1 60  ? -13.293 22.469 139.769 1.00 53.67 ? 61   VAL B C   1 
ATOM   3816 O O   . VAL B 1 60  ? -12.769 21.387 139.517 1.00 55.57 ? 61   VAL B O   1 
ATOM   3817 C CB  . VAL B 1 60  ? -11.333 23.758 140.600 1.00 47.72 ? 61   VAL B CB  1 
ATOM   3818 C CG1 . VAL B 1 60  ? -11.246 24.343 139.195 1.00 45.47 ? 61   VAL B CG1 1 
ATOM   3819 C CG2 . VAL B 1 60  ? -10.854 24.749 141.647 1.00 47.68 ? 61   VAL B CG2 1 
ATOM   3820 N N   . PRO B 1 61  ? -14.338 22.941 139.082 1.00 54.32 ? 62   PRO B N   1 
ATOM   3821 C CA  . PRO B 1 61  ? -14.989 22.154 138.036 1.00 53.13 ? 62   PRO B CA  1 
ATOM   3822 C C   . PRO B 1 61  ? -14.387 22.429 136.674 1.00 51.90 ? 62   PRO B C   1 
ATOM   3823 O O   . PRO B 1 61  ? -13.561 23.339 136.514 1.00 50.41 ? 62   PRO B O   1 
ATOM   3824 C CB  . PRO B 1 61  ? -16.408 22.715 138.046 1.00 53.22 ? 62   PRO B CB  1 
ATOM   3825 C CG  . PRO B 1 61  ? -16.193 24.171 138.314 1.00 54.73 ? 62   PRO B CG  1 
ATOM   3826 C CD  . PRO B 1 61  ? -15.019 24.232 139.291 1.00 56.40 ? 62   PRO B CD  1 
ATOM   3827 N N   . LEU B 1 62  ? -14.807 21.645 135.691 1.00 50.42 ? 63   LEU B N   1 
ATOM   3828 C CA  . LEU B 1 62  ? -14.600 22.028 134.312 1.00 49.63 ? 63   LEU B CA  1 
ATOM   3829 C C   . LEU B 1 62  ? -15.603 23.130 134.037 1.00 50.99 ? 63   LEU B C   1 
ATOM   3830 O O   . LEU B 1 62  ? -16.630 23.220 134.714 1.00 55.30 ? 63   LEU B O   1 
ATOM   3831 C CB  . LEU B 1 62  ? -14.880 20.858 133.376 1.00 50.20 ? 63   LEU B CB  1 
ATOM   3832 C CG  . LEU B 1 62  ? -14.173 19.532 133.617 1.00 47.10 ? 63   LEU B CG  1 
ATOM   3833 C CD1 . LEU B 1 62  ? -14.554 18.571 132.508 1.00 47.60 ? 63   LEU B CD1 1 
ATOM   3834 C CD2 . LEU B 1 62  ? -12.666 19.721 133.680 1.00 51.55 ? 63   LEU B CD2 1 
ATOM   3835 N N   . VAL B 1 63  ? -15.305 23.981 133.065 1.00 47.58 ? 64   VAL B N   1 
ATOM   3836 C CA  . VAL B 1 63  ? -16.302 24.920 132.575 1.00 48.03 ? 64   VAL B CA  1 
ATOM   3837 C C   . VAL B 1 63  ? -16.400 24.780 131.066 1.00 45.58 ? 64   VAL B C   1 
ATOM   3838 O O   . VAL B 1 63  ? -15.536 25.252 130.327 1.00 48.48 ? 64   VAL B O   1 
ATOM   3839 C CB  . VAL B 1 63  ? -15.986 26.396 132.918 1.00 48.48 ? 64   VAL B CB  1 
ATOM   3840 C CG1 . VAL B 1 63  ? -17.115 27.282 132.415 1.00 45.10 ? 64   VAL B CG1 1 
ATOM   3841 C CG2 . VAL B 1 63  ? -15.782 26.592 134.419 1.00 41.08 ? 64   VAL B CG2 1 
ATOM   3842 N N   . ILE B 1 64  ? -17.460 24.120 130.622 1.00 46.43 ? 65   ILE B N   1 
ATOM   3843 C CA  . ILE B 1 64  ? -17.674 23.838 129.214 1.00 45.51 ? 65   ILE B CA  1 
ATOM   3844 C C   . ILE B 1 64  ? -19.028 24.390 128.802 1.00 43.84 ? 65   ILE B C   1 
ATOM   3845 O O   . ILE B 1 64  ? -20.039 24.104 129.442 1.00 47.32 ? 65   ILE B O   1 
ATOM   3846 C CB  . ILE B 1 64  ? -17.642 22.319 128.960 1.00 47.51 ? 65   ILE B CB  1 
ATOM   3847 C CG1 . ILE B 1 64  ? -16.230 21.783 129.239 1.00 46.84 ? 65   ILE B CG1 1 
ATOM   3848 C CG2 . ILE B 1 64  ? -18.105 21.998 127.538 1.00 43.38 ? 65   ILE B CG2 1 
ATOM   3849 C CD1 . ILE B 1 64  ? -16.130 20.280 129.277 1.00 43.95 ? 65   ILE B CD1 1 
ATOM   3850 N N   . ASN B 1 65  ? -19.040 25.180 127.735 1.00 42.53 ? 66   ASN B N   1 
ATOM   3851 C CA  . ASN B 1 65  ? -20.263 25.809 127.249 1.00 45.70 ? 66   ASN B CA  1 
ATOM   3852 C C   . ASN B 1 65  ? -21.007 26.563 128.351 1.00 44.44 ? 66   ASN B C   1 
ATOM   3853 O O   . ASN B 1 65  ? -22.229 26.506 128.431 1.00 47.29 ? 66   ASN B O   1 
ATOM   3854 C CB  . ASN B 1 65  ? -21.186 24.767 126.607 1.00 47.64 ? 66   ASN B CB  1 
ATOM   3855 C CG  . ASN B 1 65  ? -21.961 25.323 125.426 1.00 52.75 ? 66   ASN B CG  1 
ATOM   3856 O OD1 . ASN B 1 65  ? -21.510 26.251 124.741 1.00 52.27 ? 66   ASN B OD1 1 
ATOM   3857 N ND2 . ASN B 1 65  ? -23.134 24.755 125.177 1.00 55.06 ? 66   ASN B ND2 1 
ATOM   3858 N N   . GLY B 1 66  ? -20.256 27.247 129.209 1.00 43.03 ? 67   GLY B N   1 
ATOM   3859 C CA  . GLY B 1 66  ? -20.834 28.043 130.278 1.00 43.20 ? 67   GLY B CA  1 
ATOM   3860 C C   . GLY B 1 66  ? -21.299 27.261 131.492 1.00 49.25 ? 67   GLY B C   1 
ATOM   3861 O O   . GLY B 1 66  ? -21.691 27.845 132.502 1.00 55.79 ? 67   GLY B O   1 
ATOM   3862 N N   . GLU B 1 67  ? -21.252 25.937 131.406 1.00 48.58 ? 68   GLU B N   1 
ATOM   3863 C CA  . GLU B 1 67  ? -21.716 25.096 132.503 1.00 50.18 ? 68   GLU B CA  1 
ATOM   3864 C C   . GLU B 1 67  ? -20.565 24.578 133.373 1.00 54.10 ? 68   GLU B C   1 
ATOM   3865 O O   . GLU B 1 67  ? -19.528 24.147 132.862 1.00 50.42 ? 68   GLU B O   1 
ATOM   3866 C CB  . GLU B 1 67  ? -22.553 23.926 131.965 1.00 51.59 ? 68   GLU B CB  1 
ATOM   3867 N N   . ARG B 1 68  ? -20.752 24.619 134.690 1.00 59.48 ? 69   ARG B N   1 
ATOM   3868 C CA  . ARG B 1 68  ? -19.747 24.106 135.605 1.00 60.06 ? 69   ARG B CA  1 
ATOM   3869 C C   . ARG B 1 68  ? -19.923 22.597 135.713 1.00 64.89 ? 69   ARG B C   1 
ATOM   3870 O O   . ARG B 1 68  ? -20.993 22.120 136.091 1.00 63.96 ? 69   ARG B O   1 
ATOM   3871 C CB  . ARG B 1 68  ? -19.867 24.776 136.977 1.00 48.25 ? 69   ARG B CB  1 
ATOM   3872 N N   . ILE B 1 69  ? -18.883 21.844 135.357 1.00 67.20 ? 70   ILE B N   1 
ATOM   3873 C CA  . ILE B 1 69  ? -18.927 20.383 135.465 1.00 63.71 ? 70   ILE B CA  1 
ATOM   3874 C C   . ILE B 1 69  ? -17.972 19.857 136.532 1.00 62.53 ? 70   ILE B C   1 
ATOM   3875 O O   . ILE B 1 69  ? -16.750 19.945 136.390 1.00 63.10 ? 70   ILE B O   1 
ATOM   3876 C CB  . ILE B 1 69  ? -18.587 19.690 134.133 1.00 62.47 ? 70   ILE B CB  1 
ATOM   3877 C CG1 . ILE B 1 69  ? -19.586 20.082 133.047 1.00 63.82 ? 70   ILE B CG1 1 
ATOM   3878 C CG2 . ILE B 1 69  ? -18.568 18.175 134.318 1.00 59.18 ? 70   ILE B CG2 1 
ATOM   3879 C CD1 . ILE B 1 69  ? -19.184 19.601 131.674 1.00 63.40 ? 70   ILE B CD1 1 
ATOM   3880 N N   . TYR B 1 70  ? -18.542 19.298 137.593 1.00 56.72 ? 71   TYR B N   1 
ATOM   3881 C CA  . TYR B 1 70  ? -17.767 18.747 138.697 1.00 60.41 ? 71   TYR B CA  1 
ATOM   3882 C C   . TYR B 1 70  ? -17.467 17.263 138.478 1.00 65.41 ? 71   TYR B C   1 
ATOM   3883 O O   . TYR B 1 70  ? -17.976 16.657 137.530 1.00 57.47 ? 71   TYR B O   1 
ATOM   3884 C CB  . TYR B 1 70  ? -18.499 18.976 140.026 1.00 57.62 ? 71   TYR B CB  1 
ATOM   3885 C CG  . TYR B 1 70  ? -18.576 20.441 140.409 1.00 62.25 ? 71   TYR B CG  1 
ATOM   3886 C CD1 . TYR B 1 70  ? -17.533 21.052 141.099 1.00 63.89 ? 71   TYR B CD1 1 
ATOM   3887 C CD2 . TYR B 1 70  ? -19.673 21.222 140.056 1.00 57.87 ? 71   TYR B CD2 1 
ATOM   3888 C CE1 . TYR B 1 70  ? -17.584 22.389 141.444 1.00 58.35 ? 71   TYR B CE1 1 
ATOM   3889 C CE2 . TYR B 1 70  ? -19.733 22.563 140.400 1.00 54.61 ? 71   TYR B CE2 1 
ATOM   3890 C CZ  . TYR B 1 70  ? -18.686 23.136 141.097 1.00 57.79 ? 71   TYR B CZ  1 
ATOM   3891 O OH  . TYR B 1 70  ? -18.731 24.464 141.447 1.00 56.17 ? 71   TYR B OH  1 
ATOM   3892 N N   . ASP B 1 71  ? -16.638 16.687 139.349 1.00 58.45 ? 72   ASP B N   1 
ATOM   3893 C CA  . ASP B 1 71  ? -16.209 15.306 139.179 1.00 68.74 ? 72   ASP B CA  1 
ATOM   3894 C C   . ASP B 1 71  ? -17.400 14.356 139.204 1.00 73.55 ? 72   ASP B C   1 
ATOM   3895 O O   . ASP B 1 71  ? -17.397 13.338 138.509 1.00 77.36 ? 72   ASP B O   1 
ATOM   3896 C CB  . ASP B 1 71  ? -15.167 14.907 140.230 1.00 68.67 ? 72   ASP B CB  1 
ATOM   3897 C CG  . ASP B 1 71  ? -15.768 14.697 141.603 1.00 75.25 ? 72   ASP B CG  1 
ATOM   3898 O OD1 . ASP B 1 71  ? -16.219 13.567 141.898 1.00 75.49 ? 72   ASP B OD1 1 
ATOM   3899 O OD2 . ASP B 1 71  ? -15.779 15.661 142.393 1.00 80.00 ? 72   ASP B OD2 1 
ATOM   3900 N N   . ASN B 1 72  ? -18.412 14.717 139.994 1.00 63.45 ? 73   ASN B N   1 
ATOM   3901 C CA  . ASN B 1 72  ? -19.667 13.969 140.103 1.00 65.76 ? 73   ASN B CA  1 
ATOM   3902 C C   . ASN B 1 72  ? -19.502 12.451 140.074 1.00 77.22 ? 73   ASN B C   1 
ATOM   3903 O O   . ASN B 1 72  ? -20.154 11.762 139.286 1.00 79.87 ? 73   ASN B O   1 
ATOM   3904 C CB  . ASN B 1 72  ? -20.679 14.426 139.046 1.00 66.92 ? 73   ASN B CB  1 
ATOM   3905 C CG  . ASN B 1 72  ? -21.102 15.886 139.224 1.00 70.10 ? 73   ASN B CG  1 
ATOM   3906 O OD1 . ASN B 1 72  ? -21.025 16.689 138.290 1.00 68.89 ? 73   ASN B OD1 1 
ATOM   3907 N ND2 . ASN B 1 72  ? -21.552 16.232 140.427 1.00 74.91 ? 73   ASN B ND2 1 
ATOM   3908 N N   . ASN B 1 73  ? -18.601 11.954 140.919 1.00 77.11 ? 74   ASN B N   1 
ATOM   3909 C CA  . ASN B 1 73  ? -18.411 10.520 141.120 1.00 85.38 ? 74   ASN B CA  1 
ATOM   3910 C C   . ASN B 1 73  ? -17.958 9.763  139.869 1.00 83.64 ? 74   ASN B C   1 
ATOM   3911 O O   . ASN B 1 73  ? -18.160 8.552  139.761 1.00 85.50 ? 74   ASN B O   1 
ATOM   3912 C CB  . ASN B 1 73  ? -19.694 9.890  141.681 1.00 89.93 ? 74   ASN B CB  1 
ATOM   3913 C CG  . ASN B 1 73  ? -20.277 10.679 142.844 1.00 92.01 ? 74   ASN B CG  1 
ATOM   3914 O OD1 . ASN B 1 73  ? -21.083 11.597 142.654 1.00 87.47 ? 74   ASN B OD1 1 
ATOM   3915 N ND2 . ASN B 1 73  ? -19.876 10.318 144.059 1.00 96.51 ? 74   ASN B ND2 1 
ATOM   3916 N N   . GLU B 1 74  ? -17.357 10.474 138.922 1.00 77.91 ? 75   GLU B N   1 
ATOM   3917 C CA  . GLU B 1 74  ? -16.873 9.838  137.705 1.00 77.84 ? 75   GLU B CA  1 
ATOM   3918 C C   . GLU B 1 74  ? -15.436 10.256 137.439 1.00 77.60 ? 75   GLU B C   1 
ATOM   3919 O O   . GLU B 1 74  ? -14.551 9.416  137.247 1.00 75.90 ? 75   GLU B O   1 
ATOM   3920 C CB  . GLU B 1 74  ? -17.756 10.211 136.513 1.00 77.02 ? 75   GLU B CB  1 
ATOM   3921 N N   . ARG B 1 75  ? -15.207 11.564 137.455 1.00 73.28 ? 76   ARG B N   1 
ATOM   3922 C CA  . ARG B 1 75  ? -13.913 12.122 137.068 1.00 69.87 ? 76   ARG B CA  1 
ATOM   3923 C C   . ARG B 1 75  ? -12.841 12.059 138.158 1.00 71.60 ? 76   ARG B C   1 
ATOM   3924 O O   . ARG B 1 75  ? -13.141 12.069 139.352 1.00 62.58 ? 76   ARG B O   1 
ATOM   3925 C CB  . ARG B 1 75  ? -14.094 13.562 136.575 1.00 63.97 ? 76   ARG B CB  1 
ATOM   3926 C CG  . ARG B 1 75  ? -14.982 13.660 135.349 1.00 57.29 ? 76   ARG B CG  1 
ATOM   3927 C CD  . ARG B 1 75  ? -15.303 15.098 134.959 1.00 61.29 ? 76   ARG B CD  1 
ATOM   3928 N NE  . ARG B 1 75  ? -16.208 15.130 133.814 1.00 60.72 ? 76   ARG B NE  1 
ATOM   3929 C CZ  . ARG B 1 75  ? -17.517 14.911 133.894 1.00 62.65 ? 76   ARG B CZ  1 
ATOM   3930 N NH1 . ARG B 1 75  ? -18.078 14.660 135.070 1.00 57.86 ? 76   ARG B NH1 1 
ATOM   3931 N NH2 . ARG B 1 75  ? -18.264 14.950 132.799 1.00 55.44 ? 76   ARG B NH2 1 
ATOM   3932 N N   . ALA B 1 76  ? -11.583 11.996 137.728 1.00 71.51 ? 77   ALA B N   1 
ATOM   3933 C CA  . ALA B 1 76  ? -10.457 12.058 138.651 1.00 69.90 ? 77   ALA B CA  1 
ATOM   3934 C C   . ALA B 1 76  ? -10.375 13.462 139.247 1.00 66.88 ? 77   ALA B C   1 
ATOM   3935 O O   . ALA B 1 76  ? -10.807 14.432 138.630 1.00 67.72 ? 77   ALA B O   1 
ATOM   3936 C CB  . ALA B 1 76  ? -9.163  11.694 137.936 1.00 58.84 ? 77   ALA B CB  1 
ATOM   3937 N N   . LEU B 1 77  ? -9.853  13.562 140.463 1.00 63.94 ? 78   LEU B N   1 
ATOM   3938 C CA  . LEU B 1 77  ? -9.639  14.855 141.092 1.00 60.90 ? 78   LEU B CA  1 
ATOM   3939 C C   . LEU B 1 77  ? -8.155  15.046 141.354 1.00 61.87 ? 78   LEU B C   1 
ATOM   3940 O O   . LEU B 1 77  ? -7.533  14.230 142.043 1.00 58.69 ? 78   LEU B O   1 
ATOM   3941 C CB  . LEU B 1 77  ? -10.395 14.956 142.418 1.00 64.18 ? 78   LEU B CB  1 
ATOM   3942 C CG  . LEU B 1 77  ? -11.909 15.146 142.430 1.00 64.58 ? 78   LEU B CG  1 
ATOM   3943 C CD1 . LEU B 1 77  ? -12.418 15.104 143.864 1.00 67.42 ? 78   LEU B CD1 1 
ATOM   3944 C CD2 . LEU B 1 77  ? -12.290 16.455 141.769 1.00 63.00 ? 78   LEU B CD2 1 
ATOM   3945 N N   . PHE B 1 78  ? -7.586  16.114 140.799 1.00 56.88 ? 79   PHE B N   1 
ATOM   3946 C CA  . PHE B 1 78  ? -6.213  16.481 141.115 1.00 57.38 ? 79   PHE B CA  1 
ATOM   3947 C C   . PHE B 1 78  ? -6.240  17.386 142.339 1.00 58.53 ? 79   PHE B C   1 
ATOM   3948 O O   . PHE B 1 78  ? -7.009  18.341 142.392 1.00 55.38 ? 79   PHE B O   1 
ATOM   3949 C CB  . PHE B 1 78  ? -5.536  17.178 139.930 1.00 56.52 ? 79   PHE B CB  1 
ATOM   3950 C CG  . PHE B 1 78  ? -4.168  17.748 140.250 1.00 59.70 ? 79   PHE B CG  1 
ATOM   3951 C CD1 . PHE B 1 78  ? -3.043  16.927 140.280 1.00 60.48 ? 79   PHE B CD1 1 
ATOM   3952 C CD2 . PHE B 1 78  ? -4.007  19.103 140.514 1.00 56.11 ? 79   PHE B CD2 1 
ATOM   3953 C CE1 . PHE B 1 78  ? -1.783  17.448 140.567 1.00 56.20 ? 79   PHE B CE1 1 
ATOM   3954 C CE2 . PHE B 1 78  ? -2.751  19.628 140.809 1.00 55.95 ? 79   PHE B CE2 1 
ATOM   3955 C CZ  . PHE B 1 78  ? -1.637  18.799 140.836 1.00 53.67 ? 79   PHE B CZ  1 
ATOM   3956 N N   . PRO B 1 79  ? -5.426  17.062 143.351 1.00 61.64 ? 80   PRO B N   1 
ATOM   3957 C CA  . PRO B 1 79  ? -5.342  17.926 144.530 1.00 59.53 ? 80   PRO B CA  1 
ATOM   3958 C C   . PRO B 1 79  ? -4.263  18.998 144.371 1.00 53.53 ? 80   PRO B C   1 
ATOM   3959 O O   . PRO B 1 79  ? -3.065  18.706 144.346 1.00 53.20 ? 80   PRO B O   1 
ATOM   3960 C CB  . PRO B 1 79  ? -4.984  16.945 145.651 1.00 58.11 ? 80   PRO B CB  1 
ATOM   3961 C CG  . PRO B 1 79  ? -4.215  15.863 144.964 1.00 62.81 ? 80   PRO B CG  1 
ATOM   3962 C CD  . PRO B 1 79  ? -4.748  15.767 143.554 1.00 63.68 ? 80   PRO B CD  1 
ATOM   3963 N N   . GLN B 1 80  ? -4.695  20.243 144.246 1.00 52.18 ? 81   GLN B N   1 
ATOM   3964 C CA  . GLN B 1 80  ? -3.751  21.345 144.165 1.00 50.38 ? 81   GLN B CA  1 
ATOM   3965 C C   . GLN B 1 80  ? -3.429  21.777 145.578 1.00 54.41 ? 81   GLN B C   1 
ATOM   3966 O O   . GLN B 1 80  ? -4.317  22.203 146.317 1.00 53.36 ? 81   GLN B O   1 
ATOM   3967 C CB  . GLN B 1 80  ? -4.322  22.533 143.369 1.00 48.43 ? 81   GLN B CB  1 
ATOM   3968 C CG  . GLN B 1 80  ? -3.386  23.728 143.373 1.00 49.44 ? 81   GLN B CG  1 
ATOM   3969 C CD  . GLN B 1 80  ? -3.905  24.933 142.603 1.00 53.33 ? 81   GLN B CD  1 
ATOM   3970 O OE1 . GLN B 1 80  ? -5.084  25.007 142.237 1.00 53.74 ? 81   GLN B OE1 1 
ATOM   3971 N NE2 . GLN B 1 80  ? -3.019  25.897 142.365 1.00 43.43 ? 81   GLN B NE2 1 
ATOM   3972 N N   . THR B 1 81  ? -2.164  21.670 145.960 1.00 51.57 ? 82   THR B N   1 
ATOM   3973 C CA  . THR B 1 81  ? -1.778  22.021 147.319 1.00 60.29 ? 82   THR B CA  1 
ATOM   3974 C C   . THR B 1 81  ? -0.971  23.313 147.367 1.00 57.73 ? 82   THR B C   1 
ATOM   3975 O O   . THR B 1 81  ? -0.462  23.781 146.351 1.00 49.22 ? 82   THR B O   1 
ATOM   3976 C CB  . THR B 1 81  ? -0.972  20.894 147.981 1.00 64.45 ? 82   THR B CB  1 
ATOM   3977 O OG1 . THR B 1 81  ? 0.213   20.649 147.214 1.00 53.19 ? 82   THR B OG1 1 
ATOM   3978 C CG2 . THR B 1 81  ? -1.810  19.621 148.054 1.00 56.48 ? 82   THR B CG2 1 
ATOM   3979 N N   . ASN B 1 82  ? -0.874  23.890 148.557 1.00 55.43 ? 83   ASN B N   1 
ATOM   3980 C CA  . ASN B 1 82  ? -0.081  25.084 148.761 1.00 51.86 ? 83   ASN B CA  1 
ATOM   3981 C C   . ASN B 1 82  ? 1.387   24.682 148.725 1.00 50.87 ? 83   ASN B C   1 
ATOM   3982 O O   . ASN B 1 82  ? 1.825   23.898 149.543 1.00 52.57 ? 83   ASN B O   1 
ATOM   3983 C CB  . ASN B 1 82  ? -0.450  25.711 150.108 1.00 54.12 ? 83   ASN B CB  1 
ATOM   3984 C CG  . ASN B 1 82  ? 0.262   27.024 150.366 1.00 57.64 ? 83   ASN B CG  1 
ATOM   3985 O OD1 . ASN B 1 82  ? 1.253   27.351 149.710 1.00 57.62 ? 83   ASN B OD1 1 
ATOM   3986 N ND2 . ASN B 1 82  ? -0.238  27.783 151.340 1.00 52.91 ? 83   ASN B ND2 1 
ATOM   3987 N N   . PRO B 1 83  ? 2.150   25.211 147.753 1.00 50.50 ? 84   PRO B N   1 
ATOM   3988 C CA  . PRO B 1 83  ? 3.580   24.890 147.652 1.00 48.35 ? 84   PRO B CA  1 
ATOM   3989 C C   . PRO B 1 83  ? 4.390   25.337 148.872 1.00 49.58 ? 84   PRO B C   1 
ATOM   3990 O O   . PRO B 1 83  ? 5.489   24.833 149.082 1.00 49.70 ? 84   PRO B O   1 
ATOM   3991 C CB  . PRO B 1 83  ? 4.029   25.661 146.400 1.00 45.90 ? 84   PRO B CB  1 
ATOM   3992 C CG  . PRO B 1 83  ? 2.967   26.674 146.153 1.00 45.13 ? 84   PRO B CG  1 
ATOM   3993 C CD  . PRO B 1 83  ? 1.699   26.066 146.642 1.00 46.72 ? 84   PRO B CD  1 
ATOM   3994 N N   . ALA B 1 84  ? 3.853   26.269 149.655 1.00 49.92 ? 85   ALA B N   1 
ATOM   3995 C CA  . ALA B 1 84  ? 4.499   26.703 150.884 1.00 51.15 ? 85   ALA B CA  1 
ATOM   3996 C C   . ALA B 1 84  ? 4.106   25.806 152.067 1.00 59.09 ? 85   ALA B C   1 
ATOM   3997 O O   . ALA B 1 84  ? 4.642   25.938 153.172 1.00 57.00 ? 85   ALA B O   1 
ATOM   3998 C CB  . ALA B 1 84  ? 4.154   28.156 151.178 1.00 50.65 ? 85   ALA B CB  1 
ATOM   3999 N N   . ASN B 1 85  ? 3.181   24.884 151.819 1.00 54.54 ? 86   ASN B N   1 
ATOM   4000 C CA  . ASN B 1 85  ? 2.590   24.067 152.874 1.00 57.16 ? 86   ASN B CA  1 
ATOM   4001 C C   . ASN B 1 85  ? 1.765   22.965 152.226 1.00 57.51 ? 86   ASN B C   1 
ATOM   4002 O O   . ASN B 1 85  ? 0.545   23.068 152.130 1.00 60.63 ? 86   ASN B O   1 
ATOM   4003 C CB  . ASN B 1 85  ? 1.691   24.939 153.748 1.00 58.20 ? 86   ASN B CB  1 
ATOM   4004 C CG  . ASN B 1 85  ? 1.303   24.269 155.047 1.00 63.63 ? 86   ASN B CG  1 
ATOM   4005 O OD1 . ASN B 1 85  ? 1.369   23.046 155.183 1.00 64.97 ? 86   ASN B OD1 1 
ATOM   4006 N ND2 . ASN B 1 85  ? 0.891   25.074 156.014 1.00 65.33 ? 86   ASN B ND2 1 
ATOM   4007 N N   . HIS B 1 86  ? 2.437   21.923 151.754 1.00 62.98 ? 87   HIS B N   1 
ATOM   4008 C CA  . HIS B 1 86  ? 1.813   20.986 150.825 1.00 65.48 ? 87   HIS B CA  1 
ATOM   4009 C C   . HIS B 1 86  ? 0.821   20.013 151.453 1.00 66.38 ? 87   HIS B C   1 
ATOM   4010 O O   . HIS B 1 86  ? 0.142   19.280 150.740 1.00 68.59 ? 87   HIS B O   1 
ATOM   4011 C CB  . HIS B 1 86  ? 2.868   20.243 149.994 1.00 66.35 ? 87   HIS B CB  1 
ATOM   4012 C CG  . HIS B 1 86  ? 3.992   19.670 150.802 1.00 66.91 ? 87   HIS B CG  1 
ATOM   4013 N ND1 . HIS B 1 86  ? 3.787   18.848 151.892 1.00 69.21 ? 87   HIS B ND1 1 
ATOM   4014 C CD2 . HIS B 1 86  ? 5.335   19.792 150.669 1.00 64.76 ? 87   HIS B CD2 1 
ATOM   4015 C CE1 . HIS B 1 86  ? 4.956   18.494 152.399 1.00 69.61 ? 87   HIS B CE1 1 
ATOM   4016 N NE2 . HIS B 1 86  ? 5.910   19.054 151.676 1.00 68.94 ? 87   HIS B NE2 1 
ATOM   4017 N N   . GLN B 1 87  ? 0.731   20.009 152.778 1.00 66.50 ? 88   GLN B N   1 
ATOM   4018 C CA  . GLN B 1 87  ? -0.275  19.197 153.444 1.00 69.98 ? 88   GLN B CA  1 
ATOM   4019 C C   . GLN B 1 87  ? -1.628  19.859 153.230 1.00 70.11 ? 88   GLN B C   1 
ATOM   4020 O O   . GLN B 1 87  ? -2.674  19.211 153.284 1.00 73.69 ? 88   GLN B O   1 
ATOM   4021 C CB  . GLN B 1 87  ? 0.038   19.056 154.938 1.00 66.89 ? 88   GLN B CB  1 
ATOM   4022 N N   . GLN B 1 88  ? -1.586  21.159 152.962 1.00 67.73 ? 89   GLN B N   1 
ATOM   4023 C CA  . GLN B 1 88  ? -2.787  21.965 152.781 1.00 68.09 ? 89   GLN B CA  1 
ATOM   4024 C C   . GLN B 1 88  ? -3.323  21.940 151.346 1.00 65.07 ? 89   GLN B C   1 
ATOM   4025 O O   . GLN B 1 88  ? -2.672  22.422 150.415 1.00 63.20 ? 89   GLN B O   1 
ATOM   4026 C CB  . GLN B 1 88  ? -2.488  23.404 153.197 1.00 70.95 ? 89   GLN B CB  1 
ATOM   4027 C CG  . GLN B 1 88  ? -3.612  24.384 152.968 1.00 72.52 ? 89   GLN B CG  1 
ATOM   4028 C CD  . GLN B 1 88  ? -3.161  25.812 153.185 1.00 75.42 ? 89   GLN B CD  1 
ATOM   4029 O OE1 . GLN B 1 88  ? -3.947  26.746 153.069 1.00 77.20 ? 89   GLN B OE1 1 
ATOM   4030 N NE2 . GLN B 1 88  ? -1.886  25.988 153.503 1.00 76.91 ? 89   GLN B NE2 1 
ATOM   4031 N N   . VAL B 1 89  ? -4.524  21.389 151.184 1.00 63.63 ? 90   VAL B N   1 
ATOM   4032 C CA  . VAL B 1 89  ? -5.188  21.321 149.886 1.00 60.97 ? 90   VAL B CA  1 
ATOM   4033 C C   . VAL B 1 89  ? -6.055  22.555 149.661 1.00 58.04 ? 90   VAL B C   1 
ATOM   4034 O O   . VAL B 1 89  ? -7.043  22.776 150.367 1.00 59.50 ? 90   VAL B O   1 
ATOM   4035 C CB  . VAL B 1 89  ? -6.085  20.071 149.764 1.00 62.74 ? 90   VAL B CB  1 
ATOM   4036 C CG1 . VAL B 1 89  ? -6.746  20.026 148.389 1.00 59.32 ? 90   VAL B CG1 1 
ATOM   4037 C CG2 . VAL B 1 89  ? -5.286  18.806 150.032 1.00 62.32 ? 90   VAL B CG2 1 
ATOM   4038 N N   . LEU B 1 90  ? -5.674  23.357 148.672 1.00 55.52 ? 91   LEU B N   1 
ATOM   4039 C CA  . LEU B 1 90  ? -6.427  24.555 148.312 1.00 58.95 ? 91   LEU B CA  1 
ATOM   4040 C C   . LEU B 1 90  ? -7.606  24.222 147.414 1.00 56.98 ? 91   LEU B C   1 
ATOM   4041 O O   . LEU B 1 90  ? -8.645  24.883 147.459 1.00 59.78 ? 91   LEU B O   1 
ATOM   4042 C CB  . LEU B 1 90  ? -5.520  25.538 147.585 1.00 55.83 ? 91   LEU B CB  1 
ATOM   4043 C CG  . LEU B 1 90  ? -4.278  25.972 148.353 1.00 56.66 ? 91   LEU B CG  1 
ATOM   4044 C CD1 . LEU B 1 90  ? -3.297  26.600 147.397 1.00 54.09 ? 91   LEU B CD1 1 
ATOM   4045 C CD2 . LEU B 1 90  ? -4.664  26.946 149.453 1.00 58.76 ? 91   LEU B CD2 1 
ATOM   4046 N N   . ALA B 1 91  ? -7.437  23.198 146.587 1.00 54.89 ? 92   ALA B N   1 
ATOM   4047 C CA  . ALA B 1 91  ? -8.472  22.834 145.636 1.00 54.44 ? 92   ALA B CA  1 
ATOM   4048 C C   . ALA B 1 91  ? -8.417  21.372 145.220 1.00 54.34 ? 92   ALA B C   1 
ATOM   4049 O O   . ALA B 1 91  ? -7.343  20.793 145.072 1.00 61.34 ? 92   ALA B O   1 
ATOM   4050 C CB  . ALA B 1 91  ? -8.390  23.730 144.408 1.00 50.74 ? 92   ALA B CB  1 
ATOM   4051 N N   . ASN B 1 92  ? -9.589  20.782 145.042 1.00 58.42 ? 93   ASN B N   1 
ATOM   4052 C CA  . ASN B 1 92  ? -9.703  19.500 144.370 1.00 56.17 ? 93   ASN B CA  1 
ATOM   4053 C C   . ASN B 1 92  ? -10.204 19.762 142.968 1.00 54.41 ? 93   ASN B C   1 
ATOM   4054 O O   . ASN B 1 92  ? -11.366 20.132 142.760 1.00 56.62 ? 93   ASN B O   1 
ATOM   4055 C CB  . ASN B 1 92  ? -10.643 18.569 145.123 1.00 58.95 ? 93   ASN B CB  1 
ATOM   4056 C CG  . ASN B 1 92  ? -10.073 18.130 146.443 1.00 60.95 ? 93   ASN B CG  1 
ATOM   4057 O OD1 . ASN B 1 92  ? -10.672 18.344 147.494 1.00 65.78 ? 93   ASN B OD1 1 
ATOM   4058 N ND2 . ASN B 1 92  ? -8.897  17.523 146.400 1.00 60.87 ? 93   ASN B ND2 1 
ATOM   4059 N N   . VAL B 1 93  ? -9.305  19.596 142.008 1.00 52.90 ? 94   VAL B N   1 
ATOM   4060 C CA  . VAL B 1 93  ? -9.564  20.016 140.644 1.00 50.85 ? 94   VAL B CA  1 
ATOM   4061 C C   . VAL B 1 93  ? -10.147 18.872 139.841 1.00 63.88 ? 94   VAL B C   1 
ATOM   4062 O O   . VAL B 1 93  ? -9.565  17.790 139.770 1.00 52.57 ? 94   VAL B O   1 
ATOM   4063 C CB  . VAL B 1 93  ? -8.283  20.526 139.984 1.00 49.46 ? 94   VAL B CB  1 
ATOM   4064 C CG1 . VAL B 1 93  ? -8.588  21.186 138.625 1.00 46.69 ? 94   VAL B CG1 1 
ATOM   4065 C CG2 . VAL B 1 93  ? -7.585  21.506 140.921 1.00 48.32 ? 94   VAL B CG2 1 
ATOM   4066 N N   . THR B 1 94  ? -11.314 19.115 139.259 1.00 57.88 ? 95   THR B N   1 
ATOM   4067 C CA  . THR B 1 94  ? -11.963 18.138 138.404 1.00 59.49 ? 95   THR B CA  1 
ATOM   4068 C C   . THR B 1 94  ? -11.118 17.908 137.162 1.00 54.59 ? 95   THR B C   1 
ATOM   4069 O O   . THR B 1 94  ? -10.620 18.860 136.557 1.00 52.23 ? 95   THR B O   1 
ATOM   4070 C CB  . THR B 1 94  ? -13.364 18.611 138.006 1.00 61.98 ? 95   THR B CB  1 
ATOM   4071 O OG1 . THR B 1 94  ? -14.160 18.739 139.189 1.00 64.51 ? 95   THR B OG1 1 
ATOM   4072 C CG2 . THR B 1 94  ? -14.017 17.621 137.065 1.00 52.77 ? 95   THR B CG2 1 
ATOM   4073 N N   . GLN B 1 95  ? -10.937 16.643 136.793 1.00 56.35 ? 96   GLN B N   1 
ATOM   4074 C CA  . GLN B 1 95  ? -10.104 16.302 135.645 1.00 54.72 ? 96   GLN B CA  1 
ATOM   4075 C C   . GLN B 1 95  ? -10.956 15.943 134.433 1.00 53.95 ? 96   GLN B C   1 
ATOM   4076 O O   . GLN B 1 95  ? -11.924 15.185 134.548 1.00 57.32 ? 96   GLN B O   1 
ATOM   4077 C CB  . GLN B 1 95  ? -9.154  15.158 135.995 1.00 51.89 ? 96   GLN B CB  1 
ATOM   4078 C CG  . GLN B 1 95  ? -8.252  15.458 137.176 1.00 55.66 ? 96   GLN B CG  1 
ATOM   4079 C CD  . GLN B 1 95  ? -7.187  16.486 136.858 1.00 55.06 ? 96   GLN B CD  1 
ATOM   4080 O OE1 . GLN B 1 95  ? -6.083  16.140 136.441 1.00 49.24 ? 96   GLN B OE1 1 
ATOM   4081 N NE2 . GLN B 1 95  ? -7.513  17.761 137.055 1.00 56.91 ? 96   GLN B NE2 1 
ATOM   4082 N N   . ALA B 1 96  ? -10.585 16.493 133.279 1.00 48.50 ? 97   ALA B N   1 
ATOM   4083 C CA  . ALA B 1 96  ? -11.337 16.316 132.035 1.00 58.47 ? 97   ALA B CA  1 
ATOM   4084 C C   . ALA B 1 96  ? -11.176 14.932 131.389 1.00 59.40 ? 97   ALA B C   1 
ATOM   4085 O O   . ALA B 1 96  ? -10.060 14.498 131.094 1.00 59.21 ? 97   ALA B O   1 
ATOM   4086 C CB  . ALA B 1 96  ? -10.960 17.408 131.038 1.00 45.73 ? 97   ALA B CB  1 
ATOM   4087 N N   . THR B 1 97  ? -12.298 14.249 131.164 1.00 59.86 ? 98   THR B N   1 
ATOM   4088 C CA  . THR B 1 97  ? -12.287 12.990 130.425 1.00 61.07 ? 98   THR B CA  1 
ATOM   4089 C C   . THR B 1 97  ? -12.179 13.292 128.933 1.00 59.91 ? 98   THR B C   1 
ATOM   4090 O O   . THR B 1 97  ? -12.280 14.448 128.524 1.00 54.14 ? 98   THR B O   1 
ATOM   4091 C CB  . THR B 1 97  ? -13.562 12.145 130.676 1.00 64.49 ? 98   THR B CB  1 
ATOM   4092 O OG1 . THR B 1 97  ? -14.689 12.766 130.041 1.00 63.92 ? 98   THR B OG1 1 
ATOM   4093 C CG2 . THR B 1 97  ? -13.836 11.999 132.167 1.00 56.15 ? 98   THR B CG2 1 
ATOM   4094 N N   . GLU B 1 98  ? -11.976 12.252 128.130 1.00 62.00 ? 99   GLU B N   1 
ATOM   4095 C CA  . GLU B 1 98  ? -11.930 12.380 126.678 1.00 59.54 ? 99   GLU B CA  1 
ATOM   4096 C C   . GLU B 1 98  ? -13.229 12.965 126.166 1.00 58.45 ? 99   GLU B C   1 
ATOM   4097 O O   . GLU B 1 98  ? -13.232 13.862 125.317 1.00 58.58 ? 99   GLU B O   1 
ATOM   4098 C CB  . GLU B 1 98  ? -11.747 11.007 126.040 1.00 63.49 ? 99   GLU B CB  1 
ATOM   4099 C CG  . GLU B 1 98  ? -10.464 10.841 125.284 1.00 68.49 ? 99   GLU B CG  1 
ATOM   4100 C CD  . GLU B 1 98  ? -9.589  9.793  125.905 1.00 78.50 ? 99   GLU B CD  1 
ATOM   4101 O OE1 . GLU B 1 98  ? -9.052  8.950  125.160 1.00 83.19 ? 99   GLU B OE1 1 
ATOM   4102 O OE2 . GLU B 1 98  ? -9.448  9.812  127.144 1.00 82.23 ? 99   GLU B OE2 1 
ATOM   4103 N N   . LYS B 1 99  ? -14.329 12.427 126.688 1.00 51.96 ? 100  LYS B N   1 
ATOM   4104 C CA  . LYS B 1 99  ? -15.662 12.887 126.344 1.00 62.75 ? 100  LYS B CA  1 
ATOM   4105 C C   . LYS B 1 99  ? -15.744 14.383 126.582 1.00 57.80 ? 100  LYS B C   1 
ATOM   4106 O O   . LYS B 1 99  ? -16.045 15.144 125.663 1.00 60.46 ? 100  LYS B O   1 
ATOM   4107 C CB  . LYS B 1 99  ? -16.716 12.164 127.185 1.00 67.54 ? 100  LYS B CB  1 
ATOM   4108 C CG  . LYS B 1 99  ? -18.130 12.401 126.698 1.00 75.05 ? 100  LYS B CG  1 
ATOM   4109 C CD  . LYS B 1 99  ? -18.279 11.906 125.267 1.00 80.96 ? 100  LYS B CD  1 
ATOM   4110 C CE  . LYS B 1 99  ? -19.415 12.604 124.537 1.00 81.79 ? 100  LYS B CE  1 
ATOM   4111 N NZ  . LYS B 1 99  ? -19.182 12.591 123.064 1.00 81.05 ? 100  LYS B NZ  1 
ATOM   4112 N N   . ASP B 1 100 ? -15.458 14.789 127.817 1.00 55.33 ? 101  ASP B N   1 
ATOM   4113 C CA  . ASP B 1 100 ? -15.424 16.198 128.205 1.00 56.57 ? 101  ASP B CA  1 
ATOM   4114 C C   . ASP B 1 100 ? -14.671 17.048 127.188 1.00 52.82 ? 101  ASP B C   1 
ATOM   4115 O O   . ASP B 1 100 ? -15.118 18.139 126.819 1.00 49.82 ? 101  ASP B O   1 
ATOM   4116 C CB  . ASP B 1 100 ? -14.757 16.364 129.572 1.00 56.24 ? 101  ASP B CB  1 
ATOM   4117 C CG  . ASP B 1 100 ? -15.566 15.763 130.703 1.00 57.76 ? 101  ASP B CG  1 
ATOM   4118 O OD1 . ASP B 1 100 ? -16.815 15.724 130.614 1.00 63.73 ? 101  ASP B OD1 1 
ATOM   4119 O OD2 . ASP B 1 100 ? -14.942 15.343 131.698 1.00 56.87 ? 101  ASP B OD2 1 
ATOM   4120 N N   . VAL B 1 101 ? -13.531 16.535 126.733 1.00 50.53 ? 102  VAL B N   1 
ATOM   4121 C CA  . VAL B 1 101 ? -12.703 17.266 125.789 1.00 50.88 ? 102  VAL B CA  1 
ATOM   4122 C C   . VAL B 1 101 ? -13.372 17.394 124.421 1.00 50.92 ? 102  VAL B C   1 
ATOM   4123 O O   . VAL B 1 101 ? -13.340 18.464 123.797 1.00 41.38 ? 102  VAL B O   1 
ATOM   4124 C CB  . VAL B 1 101 ? -11.298 16.650 125.677 1.00 48.48 ? 102  VAL B CB  1 
ATOM   4125 C CG1 . VAL B 1 101 ? -10.470 17.398 124.647 1.00 42.59 ? 102  VAL B CG1 1 
ATOM   4126 C CG2 . VAL B 1 101 ? -10.611 16.705 127.026 1.00 43.82 ? 102  VAL B CG2 1 
ATOM   4127 N N   . MET B 1 102 ? -13.986 16.308 123.965 1.00 50.73 ? 103  MET B N   1 
ATOM   4128 C CA  . MET B 1 102 ? -14.741 16.336 122.717 1.00 53.09 ? 103  MET B CA  1 
ATOM   4129 C C   . MET B 1 102 ? -15.877 17.342 122.823 1.00 51.56 ? 103  MET B C   1 
ATOM   4130 O O   . MET B 1 102 ? -16.148 18.093 121.880 1.00 51.21 ? 103  MET B O   1 
ATOM   4131 C CB  . MET B 1 102 ? -15.278 14.942 122.370 1.00 52.38 ? 103  MET B CB  1 
ATOM   4132 C CG  . MET B 1 102 ? -14.196 13.964 121.907 1.00 57.71 ? 103  MET B CG  1 
ATOM   4133 S SD  . MET B 1 102 ? -14.799 12.264 121.710 1.00 68.25 ? 103  MET B SD  1 
ATOM   4134 C CE  . MET B 1 102 ? -16.326 12.558 120.812 1.00 68.04 ? 103  MET B CE  1 
ATOM   4135 N N   . ASN B 1 103 ? -16.527 17.368 123.982 1.00 53.59 ? 104  ASN B N   1 
ATOM   4136 C CA  . ASN B 1 103 ? -17.587 18.343 124.236 1.00 50.67 ? 104  ASN B CA  1 
ATOM   4137 C C   . ASN B 1 103 ? -17.079 19.784 124.245 1.00 47.66 ? 104  ASN B C   1 
ATOM   4138 O O   . ASN B 1 103 ? -17.748 20.682 123.734 1.00 54.18 ? 104  ASN B O   1 
ATOM   4139 C CB  . ASN B 1 103 ? -18.309 18.027 125.543 1.00 51.13 ? 104  ASN B CB  1 
ATOM   4140 C CG  . ASN B 1 103 ? -19.022 16.688 125.501 1.00 59.49 ? 104  ASN B CG  1 
ATOM   4141 O OD1 . ASN B 1 103 ? -19.435 16.229 124.431 1.00 58.03 ? 104  ASN B OD1 1 
ATOM   4142 N ND2 . ASN B 1 103 ? -19.168 16.049 126.666 1.00 49.86 ? 104  ASN B ND2 1 
ATOM   4143 N N   . ALA B 1 104 ? -15.898 20.011 124.816 1.00 42.49 ? 105  ALA B N   1 
ATOM   4144 C CA  . ALA B 1 104 ? -15.347 21.368 124.859 1.00 43.16 ? 105  ALA B CA  1 
ATOM   4145 C C   . ALA B 1 104 ? -15.053 21.874 123.460 1.00 42.28 ? 105  ALA B C   1 
ATOM   4146 O O   . ALA B 1 104 ? -15.358 23.021 123.127 1.00 41.91 ? 105  ALA B O   1 
ATOM   4147 C CB  . ALA B 1 104 ? -14.096 21.421 125.714 1.00 43.59 ? 105  ALA B CB  1 
ATOM   4148 N N   . VAL B 1 105 ? -14.457 21.010 122.644 1.00 43.58 ? 106  VAL B N   1 
ATOM   4149 C CA  . VAL B 1 105 ? -14.153 21.350 121.256 1.00 44.43 ? 106  VAL B CA  1 
ATOM   4150 C C   . VAL B 1 105 ? -15.435 21.739 120.509 1.00 43.67 ? 106  VAL B C   1 
ATOM   4151 O O   . VAL B 1 105 ? -15.481 22.760 119.811 1.00 42.06 ? 106  VAL B O   1 
ATOM   4152 C CB  . VAL B 1 105 ? -13.469 20.164 120.523 1.00 42.11 ? 106  VAL B CB  1 
ATOM   4153 C CG1 . VAL B 1 105 ? -13.356 20.441 119.027 1.00 39.61 ? 106  VAL B CG1 1 
ATOM   4154 C CG2 . VAL B 1 105 ? -12.100 19.860 121.136 1.00 37.99 ? 106  VAL B CG2 1 
ATOM   4155 N N   . LYS B 1 106 ? -16.474 20.920 120.664 1.00 44.96 ? 107  LYS B N   1 
ATOM   4156 C CA  . LYS B 1 106 ? -17.753 21.196 120.024 1.00 46.23 ? 107  LYS B CA  1 
ATOM   4157 C C   . LYS B 1 106 ? -18.348 22.524 120.497 1.00 44.52 ? 107  LYS B C   1 
ATOM   4158 O O   . LYS B 1 106 ? -18.819 23.328 119.688 1.00 43.82 ? 107  LYS B O   1 
ATOM   4159 C CB  . LYS B 1 106 ? -18.749 20.051 120.243 1.00 46.83 ? 107  LYS B CB  1 
ATOM   4160 C CG  . LYS B 1 106 ? -20.173 20.436 119.857 1.00 48.72 ? 107  LYS B CG  1 
ATOM   4161 C CD  . LYS B 1 106 ? -20.949 19.273 119.272 1.00 55.14 ? 107  LYS B CD  1 
ATOM   4162 C CE  . LYS B 1 106 ? -22.297 19.743 118.718 1.00 61.15 ? 107  LYS B CE  1 
ATOM   4163 N NZ  . LYS B 1 106 ? -23.220 20.248 119.781 1.00 58.94 ? 107  LYS B NZ  1 
ATOM   4164 N N   . ALA B 1 107 ? -18.316 22.746 121.808 1.00 45.23 ? 108  ALA B N   1 
ATOM   4165 C CA  . ALA B 1 107 ? -18.809 23.990 122.386 1.00 41.35 ? 108  ALA B CA  1 
ATOM   4166 C C   . ALA B 1 107 ? -18.155 25.189 121.710 1.00 40.96 ? 108  ALA B C   1 
ATOM   4167 O O   . ALA B 1 107 ? -18.833 26.140 121.321 1.00 37.44 ? 108  ALA B O   1 
ATOM   4168 C CB  . ALA B 1 107 ? -18.555 24.014 123.884 1.00 37.90 ? 108  ALA B CB  1 
ATOM   4169 N N   . ALA B 1 108 ? -16.835 25.124 121.553 1.00 42.14 ? 109  ALA B N   1 
ATOM   4170 C CA  . ALA B 1 108 ? -16.083 26.211 120.942 1.00 36.94 ? 109  ALA B CA  1 
ATOM   4171 C C   . ALA B 1 108 ? -16.446 26.381 119.467 1.00 41.96 ? 109  ALA B C   1 
ATOM   4172 O O   . ALA B 1 108 ? -16.475 27.504 118.949 1.00 36.20 ? 109  ALA B O   1 
ATOM   4173 C CB  . ALA B 1 108 ? -14.585 25.971 121.101 1.00 39.98 ? 109  ALA B CB  1 
ATOM   4174 N N   . LYS B 1 109 ? -16.708 25.258 118.794 1.00 45.81 ? 110  LYS B N   1 
ATOM   4175 C CA  . LYS B 1 109 ? -17.110 25.274 117.385 1.00 46.77 ? 110  LYS B CA  1 
ATOM   4176 C C   . LYS B 1 109 ? -18.493 25.920 117.227 1.00 45.42 ? 110  LYS B C   1 
ATOM   4177 O O   . LYS B 1 109 ? -18.695 26.781 116.371 1.00 47.54 ? 110  LYS B O   1 
ATOM   4178 C CB  . LYS B 1 109 ? -17.091 23.854 116.790 1.00 40.42 ? 110  LYS B CB  1 
ATOM   4179 N N   . ASP B 1 110 ? -19.425 25.521 118.084 1.00 43.48 ? 111  ASP B N   1 
ATOM   4180 C CA  . ASP B 1 110 ? -20.791 26.039 118.052 1.00 44.75 ? 111  ASP B CA  1 
ATOM   4181 C C   . ASP B 1 110 ? -20.896 27.506 118.459 1.00 50.32 ? 111  ASP B C   1 
ATOM   4182 O O   . ASP B 1 110 ? -21.830 28.194 118.054 1.00 52.09 ? 111  ASP B O   1 
ATOM   4183 C CB  . ASP B 1 110 ? -21.705 25.201 118.948 1.00 42.83 ? 111  ASP B CB  1 
ATOM   4184 C CG  . ASP B 1 110 ? -21.795 23.743 118.499 1.00 52.62 ? 111  ASP B CG  1 
ATOM   4185 O OD1 . ASP B 1 110 ? -21.452 23.463 117.328 1.00 53.46 ? 111  ASP B OD1 1 
ATOM   4186 O OD2 . ASP B 1 110 ? -22.207 22.879 119.313 1.00 55.05 ? 111  ASP B OD2 1 
ATOM   4187 N N   . ALA B 1 111 ? -19.954 27.988 119.265 1.00 47.94 ? 112  ALA B N   1 
ATOM   4188 C CA  . ALA B 1 111 ? -20.032 29.368 119.757 1.00 44.07 ? 112  ALA B CA  1 
ATOM   4189 C C   . ALA B 1 111 ? -19.400 30.333 118.772 1.00 40.82 ? 112  ALA B C   1 
ATOM   4190 O O   . ALA B 1 111 ? -19.547 31.549 118.893 1.00 48.72 ? 112  ALA B O   1 
ATOM   4191 C CB  . ALA B 1 111 ? -19.378 29.496 121.141 1.00 36.77 ? 112  ALA B CB  1 
ATOM   4192 N N   . LYS B 1 112 ? -18.726 29.767 117.777 1.00 36.20 ? 113  LYS B N   1 
ATOM   4193 C CA  . LYS B 1 112 ? -17.832 30.510 116.890 1.00 35.02 ? 113  LYS B CA  1 
ATOM   4194 C C   . LYS B 1 112 ? -18.488 31.629 116.076 1.00 36.35 ? 113  LYS B C   1 
ATOM   4195 O O   . LYS B 1 112 ? -18.023 32.765 116.114 1.00 36.54 ? 113  LYS B O   1 
ATOM   4196 C CB  . LYS B 1 112 ? -17.079 29.524 115.982 1.00 32.48 ? 113  LYS B CB  1 
ATOM   4197 C CG  . LYS B 1 112 ? -16.059 30.139 115.054 1.00 32.34 ? 113  LYS B CG  1 
ATOM   4198 C CD  . LYS B 1 112 ? -15.036 30.987 115.783 1.00 32.04 ? 113  LYS B CD  1 
ATOM   4199 C CE  . LYS B 1 112 ? -13.861 31.315 114.858 1.00 32.92 ? 113  LYS B CE  1 
ATOM   4200 N NZ  . LYS B 1 112 ? -13.127 30.074 114.436 1.00 34.79 ? 113  LYS B NZ  1 
ATOM   4201 N N   . LYS B 1 113 ? -19.555 31.324 115.341 1.00 39.47 ? 114  LYS B N   1 
ATOM   4202 C CA  . LYS B 1 113 ? -20.189 32.338 114.487 1.00 40.01 ? 114  LYS B CA  1 
ATOM   4203 C C   . LYS B 1 113 ? -20.742 33.517 115.303 1.00 38.99 ? 114  LYS B C   1 
ATOM   4204 O O   . LYS B 1 113 ? -20.467 34.687 115.009 1.00 36.73 ? 114  LYS B O   1 
ATOM   4205 C CB  . LYS B 1 113 ? -21.290 31.724 113.619 1.00 40.36 ? 114  LYS B CB  1 
ATOM   4206 N N   . ASP B 1 114 ? -21.511 33.205 116.339 1.00 45.01 ? 115  ASP B N   1 
ATOM   4207 C CA  . ASP B 1 114 ? -22.051 34.244 117.212 1.00 41.58 ? 115  ASP B CA  1 
ATOM   4208 C C   . ASP B 1 114 ? -20.961 35.043 117.924 1.00 41.81 ? 115  ASP B C   1 
ATOM   4209 O O   . ASP B 1 114 ? -21.177 36.201 118.276 1.00 43.41 ? 115  ASP B O   1 
ATOM   4210 C CB  . ASP B 1 114 ? -23.018 33.649 118.229 1.00 46.82 ? 115  ASP B CB  1 
ATOM   4211 C CG  . ASP B 1 114 ? -24.309 33.188 117.591 1.00 54.40 ? 115  ASP B CG  1 
ATOM   4212 O OD1 . ASP B 1 114 ? -24.545 33.551 116.417 1.00 57.51 ? 115  ASP B OD1 1 
ATOM   4213 O OD2 . ASP B 1 114 ? -25.091 32.481 118.262 1.00 55.81 ? 115  ASP B OD2 1 
ATOM   4214 N N   . TRP B 1 115 ? -19.790 34.438 118.126 1.00 39.05 ? 116  TRP B N   1 
ATOM   4215 C CA  . TRP B 1 115 ? -18.695 35.157 118.776 1.00 32.71 ? 116  TRP B CA  1 
ATOM   4216 C C   . TRP B 1 115 ? -18.014 36.115 117.808 1.00 29.72 ? 116  TRP B C   1 
ATOM   4217 O O   . TRP B 1 115 ? -17.793 37.277 118.141 1.00 24.62 ? 116  TRP B O   1 
ATOM   4218 C CB  . TRP B 1 115 ? -17.674 34.200 119.412 1.00 30.23 ? 116  TRP B CB  1 
ATOM   4219 C CG  . TRP B 1 115 ? -16.491 34.888 120.067 1.00 31.32 ? 116  TRP B CG  1 
ATOM   4220 C CD1 . TRP B 1 115 ? -15.175 34.761 119.724 1.00 29.88 ? 116  TRP B CD1 1 
ATOM   4221 C CD2 . TRP B 1 115 ? -16.528 35.806 121.170 1.00 31.30 ? 116  TRP B CD2 1 
ATOM   4222 N NE1 . TRP B 1 115 ? -14.389 35.528 120.555 1.00 30.07 ? 116  TRP B NE1 1 
ATOM   4223 C CE2 . TRP B 1 115 ? -15.195 36.175 121.454 1.00 29.58 ? 116  TRP B CE2 1 
ATOM   4224 C CE3 . TRP B 1 115 ? -17.558 36.332 121.964 1.00 31.11 ? 116  TRP B CE3 1 
ATOM   4225 C CZ2 . TRP B 1 115 ? -14.868 37.063 122.480 1.00 31.44 ? 116  TRP B CZ2 1 
ATOM   4226 C CZ3 . TRP B 1 115 ? -17.230 37.210 122.993 1.00 29.47 ? 116  TRP B CZ3 1 
ATOM   4227 C CH2 . TRP B 1 115 ? -15.899 37.566 123.240 1.00 28.42 ? 116  TRP B CH2 1 
ATOM   4228 N N   . TYR B 1 116 ? -17.684 35.661 116.603 1.00 32.11 ? 117  TYR B N   1 
ATOM   4229 C CA  . TYR B 1 116 ? -17.019 36.588 115.697 1.00 30.81 ? 117  TYR B CA  1 
ATOM   4230 C C   . TYR B 1 116 ? -17.967 37.606 115.065 1.00 37.42 ? 117  TYR B C   1 
ATOM   4231 O O   . TYR B 1 116 ? -17.519 38.600 114.497 1.00 41.50 ? 117  TYR B O   1 
ATOM   4232 C CB  . TYR B 1 116 ? -16.107 35.902 114.668 1.00 32.84 ? 117  TYR B CB  1 
ATOM   4233 C CG  . TYR B 1 116 ? -16.756 35.149 113.528 1.00 42.69 ? 117  TYR B CG  1 
ATOM   4234 C CD1 . TYR B 1 116 ? -17.446 35.815 112.522 1.00 44.34 ? 117  TYR B CD1 1 
ATOM   4235 C CD2 . TYR B 1 116 ? -16.612 33.769 113.418 1.00 46.47 ? 117  TYR B CD2 1 
ATOM   4236 C CE1 . TYR B 1 116 ? -18.015 35.118 111.469 1.00 43.26 ? 117  TYR B CE1 1 
ATOM   4237 C CE2 . TYR B 1 116 ? -17.168 33.070 112.366 1.00 48.26 ? 117  TYR B CE2 1 
ATOM   4238 C CZ  . TYR B 1 116 ? -17.867 33.751 111.396 1.00 47.33 ? 117  TYR B CZ  1 
ATOM   4239 O OH  . TYR B 1 116 ? -18.420 33.060 110.345 1.00 50.63 ? 117  TYR B OH  1 
ATOM   4240 N N   . ASN B 1 117 ? -19.269 37.359 115.175 1.00 42.42 ? 118  ASN B N   1 
ATOM   4241 C CA  . ASN B 1 117 ? -20.267 38.333 114.736 1.00 42.64 ? 118  ASN B CA  1 
ATOM   4242 C C   . ASN B 1 117 ? -20.640 39.309 115.846 1.00 42.63 ? 118  ASN B C   1 
ATOM   4243 O O   . ASN B 1 117 ? -21.289 40.323 115.589 1.00 44.44 ? 118  ASN B O   1 
ATOM   4244 C CB  . ASN B 1 117 ? -21.533 37.646 114.208 1.00 37.77 ? 118  ASN B CB  1 
ATOM   4245 C CG  . ASN B 1 117 ? -21.324 36.977 112.857 1.00 39.24 ? 118  ASN B CG  1 
ATOM   4246 O OD1 . ASN B 1 117 ? -20.557 37.451 112.014 1.00 36.18 ? 118  ASN B OD1 1 
ATOM   4247 N ND2 . ASN B 1 117 ? -22.024 35.871 112.641 1.00 39.27 ? 118  ASN B ND2 1 
ATOM   4248 N N   . LEU B 1 118 ? -20.264 38.994 117.082 1.00 41.25 ? 119  LEU B N   1 
ATOM   4249 C CA  . LEU B 1 118 ? -20.418 39.963 118.163 1.00 40.51 ? 119  LEU B CA  1 
ATOM   4250 C C   . LEU B 1 118 ? -19.420 41.080 117.889 1.00 37.00 ? 119  LEU B C   1 
ATOM   4251 O O   . LEU B 1 118 ? -18.235 40.815 117.731 1.00 36.63 ? 119  LEU B O   1 
ATOM   4252 C CB  . LEU B 1 118 ? -20.149 39.326 119.527 1.00 41.66 ? 119  LEU B CB  1 
ATOM   4253 C CG  . LEU B 1 118 ? -20.539 40.209 120.711 1.00 40.83 ? 119  LEU B CG  1 
ATOM   4254 C CD1 . LEU B 1 118 ? -22.034 40.395 120.707 1.00 45.08 ? 119  LEU B CD1 1 
ATOM   4255 C CD2 . LEU B 1 118 ? -20.071 39.632 122.049 1.00 38.84 ? 119  LEU B CD2 1 
ATOM   4256 N N   . PRO B 1 119 ? -19.902 42.328 117.798 1.00 32.53 ? 120  PRO B N   1 
ATOM   4257 C CA  . PRO B 1 119 ? -19.028 43.444 117.427 1.00 32.02 ? 120  PRO B CA  1 
ATOM   4258 C C   . PRO B 1 119 ? -17.829 43.555 118.366 1.00 34.92 ? 120  PRO B C   1 
ATOM   4259 O O   . PRO B 1 119 ? -17.938 43.260 119.563 1.00 31.93 ? 120  PRO B O   1 
ATOM   4260 C CB  . PRO B 1 119 ? -19.930 44.679 117.587 1.00 28.43 ? 120  PRO B CB  1 
ATOM   4261 C CG  . PRO B 1 119 ? -21.327 44.151 117.557 1.00 32.21 ? 120  PRO B CG  1 
ATOM   4262 C CD  . PRO B 1 119 ? -21.267 42.771 118.131 1.00 36.19 ? 120  PRO B CD  1 
ATOM   4263 N N   . PHE B 1 120 ? -16.696 43.966 117.807 1.00 32.24 ? 121  PHE B N   1 
ATOM   4264 C CA  . PHE B 1 120 ? -15.477 44.144 118.570 1.00 33.15 ? 121  PHE B CA  1 
ATOM   4265 C C   . PHE B 1 120 ? -15.685 44.950 119.849 1.00 36.77 ? 121  PHE B C   1 
ATOM   4266 O O   . PHE B 1 120 ? -15.060 44.675 120.873 1.00 35.29 ? 121  PHE B O   1 
ATOM   4267 C CB  . PHE B 1 120 ? -14.442 44.854 117.712 1.00 30.25 ? 121  PHE B CB  1 
ATOM   4268 C CG  . PHE B 1 120 ? -13.230 45.271 118.472 1.00 30.04 ? 121  PHE B CG  1 
ATOM   4269 C CD1 . PHE B 1 120 ? -12.348 44.318 118.957 1.00 25.62 ? 121  PHE B CD1 1 
ATOM   4270 C CD2 . PHE B 1 120 ? -12.975 46.611 118.720 1.00 31.47 ? 121  PHE B CD2 1 
ATOM   4271 C CE1 . PHE B 1 120 ? -11.212 44.699 119.665 1.00 28.91 ? 121  PHE B CE1 1 
ATOM   4272 C CE2 . PHE B 1 120 ? -11.840 47.002 119.430 1.00 33.52 ? 121  PHE B CE2 1 
ATOM   4273 C CZ  . PHE B 1 120 ? -10.956 46.042 119.899 1.00 30.76 ? 121  PHE B CZ  1 
ATOM   4274 N N   . TYR B 1 121 ? -16.556 45.954 119.777 1.00 34.99 ? 122  TYR B N   1 
ATOM   4275 C CA  . TYR B 1 121 ? -16.826 46.810 120.918 1.00 33.49 ? 122  TYR B CA  1 
ATOM   4276 C C   . TYR B 1 121 ? -17.291 45.956 122.084 1.00 32.12 ? 122  TYR B C   1 
ATOM   4277 O O   . TYR B 1 121 ? -16.889 46.169 123.231 1.00 25.03 ? 122  TYR B O   1 
ATOM   4278 C CB  . TYR B 1 121 ? -17.886 47.855 120.568 1.00 28.41 ? 122  TYR B CB  1 
ATOM   4279 C CG  . TYR B 1 121 ? -18.277 48.760 121.720 1.00 27.45 ? 122  TYR B CG  1 
ATOM   4280 C CD1 . TYR B 1 121 ? -17.474 49.837 122.100 1.00 26.33 ? 122  TYR B CD1 1 
ATOM   4281 C CD2 . TYR B 1 121 ? -19.452 48.539 122.425 1.00 23.30 ? 122  TYR B CD2 1 
ATOM   4282 C CE1 . TYR B 1 121 ? -17.844 50.674 123.169 1.00 29.89 ? 122  TYR B CE1 1 
ATOM   4283 C CE2 . TYR B 1 121 ? -19.832 49.364 123.485 1.00 28.10 ? 122  TYR B CE2 1 
ATOM   4284 C CZ  . TYR B 1 121 ? -19.028 50.423 123.856 1.00 28.25 ? 122  TYR B CZ  1 
ATOM   4285 O OH  . TYR B 1 121 ? -19.429 51.226 124.902 1.00 25.74 ? 122  TYR B OH  1 
ATOM   4286 N N   . ASP B 1 122 ? -18.122 44.971 121.771 1.00 27.79 ? 123  ASP B N   1 
ATOM   4287 C CA  . ASP B 1 122 ? -18.720 44.146 122.798 1.00 30.38 ? 123  ASP B CA  1 
ATOM   4288 C C   . ASP B 1 122 ? -17.769 43.061 123.277 1.00 33.05 ? 123  ASP B C   1 
ATOM   4289 O O   . ASP B 1 122 ? -17.675 42.824 124.474 1.00 34.94 ? 123  ASP B O   1 
ATOM   4290 C CB  . ASP B 1 122 ? -20.044 43.567 122.307 1.00 38.17 ? 123  ASP B CB  1 
ATOM   4291 C CG  . ASP B 1 122 ? -21.072 44.652 122.005 1.00 40.60 ? 123  ASP B CG  1 
ATOM   4292 O OD1 . ASP B 1 122 ? -21.250 44.988 120.821 1.00 40.49 ? 123  ASP B OD1 1 
ATOM   4293 O OD2 . ASP B 1 122 ? -21.685 45.187 122.954 1.00 47.67 ? 123  ASP B OD2 1 
ATOM   4294 N N   . ARG B 1 123 ? -17.053 42.421 122.353 1.00 29.72 ? 124  ARG B N   1 
ATOM   4295 C CA  . ARG B 1 123 ? -16.016 41.474 122.743 1.00 33.29 ? 124  ARG B CA  1 
ATOM   4296 C C   . ARG B 1 123 ? -15.022 42.139 123.694 1.00 31.76 ? 124  ARG B C   1 
ATOM   4297 O O   . ARG B 1 123 ? -14.652 41.551 124.701 1.00 33.17 ? 124  ARG B O   1 
ATOM   4298 C CB  . ARG B 1 123 ? -15.293 40.899 121.526 1.00 32.68 ? 124  ARG B CB  1 
ATOM   4299 C CG  . ARG B 1 123 ? -16.230 40.294 120.499 1.00 29.86 ? 124  ARG B CG  1 
ATOM   4300 C CD  . ARG B 1 123 ? -15.541 39.306 119.616 1.00 26.43 ? 124  ARG B CD  1 
ATOM   4301 N NE  . ARG B 1 123 ? -14.367 39.839 118.922 1.00 30.59 ? 124  ARG B NE  1 
ATOM   4302 C CZ  . ARG B 1 123 ? -14.382 40.375 117.700 1.00 31.91 ? 124  ARG B CZ  1 
ATOM   4303 N NH1 . ARG B 1 123 ? -15.522 40.502 117.026 1.00 33.98 ? 124  ARG B NH1 1 
ATOM   4304 N NH2 . ARG B 1 123 ? -13.253 40.790 117.146 1.00 27.06 ? 124  ARG B NH2 1 
ATOM   4305 N N   . SER B 1 124 ? -14.617 43.368 123.378 1.00 28.39 ? 125  SER B N   1 
ATOM   4306 C CA  . SER B 1 124 ? -13.690 44.123 124.214 1.00 29.33 ? 125  SER B CA  1 
ATOM   4307 C C   . SER B 1 124 ? -14.257 44.398 125.592 1.00 31.02 ? 125  SER B C   1 
ATOM   4308 O O   . SER B 1 124 ? -13.544 44.300 126.589 1.00 32.32 ? 125  SER B O   1 
ATOM   4309 C CB  . SER B 1 124 ? -13.324 45.454 123.560 1.00 26.29 ? 125  SER B CB  1 
ATOM   4310 O OG  . SER B 1 124 ? -12.681 45.231 122.327 1.00 30.44 ? 125  SER B OG  1 
ATOM   4311 N N   . ALA B 1 125 ? -15.538 44.755 125.642 1.00 30.56 ? 126  ALA B N   1 
ATOM   4312 C CA  . ALA B 1 125 ? -16.172 45.140 126.899 1.00 28.48 ? 126  ALA B CA  1 
ATOM   4313 C C   . ALA B 1 125 ? -16.071 44.023 127.931 1.00 30.64 ? 126  ALA B C   1 
ATOM   4314 O O   . ALA B 1 125 ? -15.860 44.276 129.117 1.00 32.25 ? 126  ALA B O   1 
ATOM   4315 C CB  . ALA B 1 125 ? -17.622 45.526 126.679 1.00 26.59 ? 126  ALA B CB  1 
ATOM   4316 N N   . ILE B 1 126 ? -16.217 42.789 127.468 1.00 27.39 ? 127  ILE B N   1 
ATOM   4317 C CA  . ILE B 1 126 ? -16.084 41.621 128.331 1.00 30.14 ? 127  ILE B CA  1 
ATOM   4318 C C   . ILE B 1 126 ? -14.696 41.552 128.990 1.00 32.14 ? 127  ILE B C   1 
ATOM   4319 O O   . ILE B 1 126 ? -14.576 41.283 130.185 1.00 33.99 ? 127  ILE B O   1 
ATOM   4320 C CB  . ILE B 1 126 ? -16.362 40.340 127.537 1.00 34.06 ? 127  ILE B CB  1 
ATOM   4321 C CG1 . ILE B 1 126 ? -17.837 40.322 127.102 1.00 31.76 ? 127  ILE B CG1 1 
ATOM   4322 C CG2 . ILE B 1 126 ? -16.000 39.101 128.366 1.00 31.08 ? 127  ILE B CG2 1 
ATOM   4323 C CD1 . ILE B 1 126 ? -18.145 39.333 126.021 1.00 34.93 ? 127  ILE B CD1 1 
ATOM   4324 N N   . PHE B 1 127 ? -13.659 41.833 128.212 1.00 30.95 ? 128  PHE B N   1 
ATOM   4325 C CA  . PHE B 1 127 ? -12.297 41.710 128.703 1.00 31.57 ? 128  PHE B CA  1 
ATOM   4326 C C   . PHE B 1 127 ? -11.882 42.866 129.569 1.00 35.08 ? 128  PHE B C   1 
ATOM   4327 O O   . PHE B 1 127 ? -11.200 42.665 130.575 1.00 37.63 ? 128  PHE B O   1 
ATOM   4328 C CB  . PHE B 1 127 ? -11.325 41.446 127.552 1.00 27.72 ? 128  PHE B CB  1 
ATOM   4329 C CG  . PHE B 1 127 ? -11.442 40.045 127.030 1.00 37.30 ? 128  PHE B CG  1 
ATOM   4330 C CD1 . PHE B 1 127 ? -10.818 38.996 127.693 1.00 35.51 ? 128  PHE B CD1 1 
ATOM   4331 C CD2 . PHE B 1 127 ? -12.253 39.757 125.943 1.00 35.64 ? 128  PHE B CD2 1 
ATOM   4332 C CE1 . PHE B 1 127 ? -10.962 37.694 127.254 1.00 32.06 ? 128  PHE B CE1 1 
ATOM   4333 C CE2 . PHE B 1 127 ? -12.395 38.457 125.497 1.00 33.99 ? 128  PHE B CE2 1 
ATOM   4334 C CZ  . PHE B 1 127 ? -11.748 37.423 126.162 1.00 36.42 ? 128  PHE B CZ  1 
ATOM   4335 N N   . LEU B 1 128 ? -12.319 44.069 129.204 1.00 35.64 ? 129  LEU B N   1 
ATOM   4336 C CA  . LEU B 1 128 ? -12.072 45.247 130.032 1.00 32.34 ? 129  LEU B CA  1 
ATOM   4337 C C   . LEU B 1 128 ? -12.846 45.128 131.347 1.00 34.83 ? 129  LEU B C   1 
ATOM   4338 O O   . LEU B 1 128 ? -12.334 45.480 132.417 1.00 40.24 ? 129  LEU B O   1 
ATOM   4339 C CB  . LEU B 1 128 ? -12.466 46.540 129.300 1.00 33.55 ? 129  LEU B CB  1 
ATOM   4340 C CG  . LEU B 1 128 ? -11.706 46.948 128.028 1.00 30.61 ? 129  LEU B CG  1 
ATOM   4341 C CD1 . LEU B 1 128 ? -12.328 48.231 127.460 1.00 29.40 ? 129  LEU B CD1 1 
ATOM   4342 C CD2 . LEU B 1 128 ? -10.210 47.155 128.291 1.00 25.00 ? 129  LEU B CD2 1 
ATOM   4343 N N   . LYS B 1 129 ? -14.078 44.634 131.268 1.00 29.13 ? 130  LYS B N   1 
ATOM   4344 C CA  . LYS B 1 129 ? -14.887 44.463 132.464 1.00 35.18 ? 130  LYS B CA  1 
ATOM   4345 C C   . LYS B 1 129 ? -14.220 43.443 133.383 1.00 36.19 ? 130  LYS B C   1 
ATOM   4346 O O   . LYS B 1 129 ? -14.199 43.619 134.602 1.00 35.57 ? 130  LYS B O   1 
ATOM   4347 C CB  . LYS B 1 129 ? -16.306 44.029 132.100 1.00 32.31 ? 130  LYS B CB  1 
ATOM   4348 C CG  . LYS B 1 129 ? -17.196 43.657 133.272 1.00 42.67 ? 130  LYS B CG  1 
ATOM   4349 C CD  . LYS B 1 129 ? -17.571 44.850 134.132 1.00 52.88 ? 130  LYS B CD  1 
ATOM   4350 C CE  . LYS B 1 129 ? -18.954 44.657 134.752 1.00 55.61 ? 130  LYS B CE  1 
ATOM   4351 N NZ  . LYS B 1 129 ? -20.000 44.512 133.682 1.00 54.41 ? 130  LYS B NZ  1 
ATOM   4352 N N   . ALA B 1 130 ? -13.659 42.391 132.788 1.00 35.32 ? 131  ALA B N   1 
ATOM   4353 C CA  . ALA B 1 130 ? -12.983 41.351 133.560 1.00 34.19 ? 131  ALA B CA  1 
ATOM   4354 C C   . ALA B 1 130 ? -11.777 41.930 134.291 1.00 29.46 ? 131  ALA B C   1 
ATOM   4355 O O   . ALA B 1 130 ? -11.615 41.730 135.493 1.00 30.95 ? 131  ALA B O   1 
ATOM   4356 C CB  . ALA B 1 130 ? -12.559 40.198 132.660 1.00 28.92 ? 131  ALA B CB  1 
ATOM   4357 N N   . ALA B 1 131 ? -10.944 42.658 133.554 1.00 32.70 ? 132  ALA B N   1 
ATOM   4358 C CA  . ALA B 1 131 ? -9.760  43.285 134.125 1.00 32.27 ? 132  ALA B CA  1 
ATOM   4359 C C   . ALA B 1 131 ? -10.128 44.182 135.301 1.00 35.23 ? 132  ALA B C   1 
ATOM   4360 O O   . ALA B 1 131 ? -9.478  44.154 136.344 1.00 37.70 ? 132  ALA B O   1 
ATOM   4361 C CB  . ALA B 1 131 ? -9.007  44.076 133.069 1.00 30.14 ? 132  ALA B CB  1 
ATOM   4362 N N   . ASP B 1 132 ? -11.182 44.968 135.146 1.00 31.64 ? 133  ASP B N   1 
ATOM   4363 C CA  . ASP B 1 132 ? -11.538 45.897 136.200 1.00 40.10 ? 133  ASP B CA  1 
ATOM   4364 C C   . ASP B 1 132 ? -12.234 45.228 137.383 1.00 43.00 ? 133  ASP B C   1 
ATOM   4365 O O   . ASP B 1 132 ? -12.122 45.713 138.509 1.00 44.03 ? 133  ASP B O   1 
ATOM   4366 C CB  . ASP B 1 132 ? -12.314 47.088 135.644 1.00 56.54 ? 133  ASP B CB  1 
ATOM   4367 C CG  . ASP B 1 132 ? -11.410 48.061 134.884 1.00 69.49 ? 133  ASP B CG  1 
ATOM   4368 O OD1 . ASP B 1 132 ? -11.014 47.756 133.728 1.00 65.84 ? 133  ASP B OD1 1 
ATOM   4369 O OD2 . ASP B 1 132 ? -11.086 49.129 135.455 1.00 77.43 ? 133  ASP B OD2 1 
ATOM   4370 N N   . LEU B 1 133 ? -12.917 44.108 137.149 1.00 32.14 ? 134  LEU B N   1 
ATOM   4371 C CA  . LEU B 1 133 ? -13.473 43.337 138.268 1.00 42.06 ? 134  LEU B CA  1 
ATOM   4372 C C   . LEU B 1 133 ? -12.342 42.694 139.073 1.00 39.57 ? 134  LEU B C   1 
ATOM   4373 O O   . LEU B 1 133 ? -12.384 42.622 140.299 1.00 46.77 ? 134  LEU B O   1 
ATOM   4374 C CB  . LEU B 1 133 ? -14.460 42.265 137.787 1.00 41.57 ? 134  LEU B CB  1 
ATOM   4375 C CG  . LEU B 1 133 ? -15.820 42.713 137.233 1.00 41.24 ? 134  LEU B CG  1 
ATOM   4376 C CD1 . LEU B 1 133 ? -16.558 41.546 136.577 1.00 37.35 ? 134  LEU B CD1 1 
ATOM   4377 C CD2 . LEU B 1 133 ? -16.675 43.338 138.323 1.00 41.49 ? 134  LEU B CD2 1 
ATOM   4378 N N   . ILE B 1 134 ? -11.324 42.230 138.367 1.00 36.44 ? 135  ILE B N   1 
ATOM   4379 C CA  . ILE B 1 134 ? -10.195 41.611 139.018 1.00 37.19 ? 135  ILE B CA  1 
ATOM   4380 C C   . ILE B 1 134 ? -9.427  42.659 139.815 1.00 42.03 ? 135  ILE B C   1 
ATOM   4381 O O   . ILE B 1 134 ? -8.945  42.373 140.903 1.00 41.23 ? 135  ILE B O   1 
ATOM   4382 C CB  . ILE B 1 134 ? -9.290  40.872 138.009 1.00 35.44 ? 135  ILE B CB  1 
ATOM   4383 C CG1 . ILE B 1 134 ? -9.949  39.548 137.604 1.00 35.43 ? 135  ILE B CG1 1 
ATOM   4384 C CG2 . ILE B 1 134 ? -7.912  40.607 138.605 1.00 35.39 ? 135  ILE B CG2 1 
ATOM   4385 C CD1 . ILE B 1 134 ? -9.280  38.858 136.446 1.00 33.56 ? 135  ILE B CD1 1 
ATOM   4386 N N   . SER B 1 135 ? -9.356  43.881 139.297 1.00 40.89 ? 136  SER B N   1 
ATOM   4387 C CA  . SER B 1 135 ? -8.634  44.948 139.986 1.00 40.16 ? 136  SER B CA  1 
ATOM   4388 C C   . SER B 1 135 ? -9.401  45.489 141.186 1.00 41.42 ? 136  SER B C   1 
ATOM   4389 O O   . SER B 1 135 ? -8.820  46.097 142.078 1.00 48.10 ? 136  SER B O   1 
ATOM   4390 C CB  . SER B 1 135 ? -8.319  46.082 139.020 1.00 41.61 ? 136  SER B CB  1 
ATOM   4391 O OG  . SER B 1 135 ? -7.563  45.602 137.926 1.00 46.63 ? 136  SER B OG  1 
ATOM   4392 N N   . THR B 1 136 ? -10.707 45.261 141.212 1.00 37.36 ? 137  THR B N   1 
ATOM   4393 C CA  . THR B 1 136 ? -11.545 45.814 142.269 1.00 40.18 ? 137  THR B CA  1 
ATOM   4394 C C   . THR B 1 136 ? -12.276 44.718 143.038 1.00 43.43 ? 137  THR B C   1 
ATOM   4395 O O   . THR B 1 136 ? -11.741 44.162 143.996 1.00 46.24 ? 137  THR B O   1 
ATOM   4396 C CB  . THR B 1 136 ? -12.590 46.808 141.702 1.00 43.68 ? 137  THR B CB  1 
ATOM   4397 O OG1 . THR B 1 136 ? -13.473 46.114 140.808 1.00 40.86 ? 137  THR B OG1 1 
ATOM   4398 C CG2 . THR B 1 136 ? -11.896 47.953 140.951 1.00 40.83 ? 137  THR B CG2 1 
ATOM   4399 N N   . LYS B 1 137 ? -13.494 44.415 142.594 1.00 47.01 ? 138  LYS B N   1 
ATOM   4400 C CA  . LYS B 1 137 ? -14.397 43.488 143.275 1.00 46.78 ? 138  LYS B CA  1 
ATOM   4401 C C   . LYS B 1 137 ? -13.697 42.239 143.770 1.00 45.17 ? 138  LYS B C   1 
ATOM   4402 O O   . LYS B 1 137 ? -13.915 41.805 144.899 1.00 50.43 ? 138  LYS B O   1 
ATOM   4403 C CB  . LYS B 1 137 ? -15.529 43.073 142.329 1.00 46.90 ? 138  LYS B CB  1 
ATOM   4404 C CG  . LYS B 1 137 ? -16.561 42.149 142.948 1.00 49.60 ? 138  LYS B CG  1 
ATOM   4405 C CD  . LYS B 1 137 ? -17.670 41.819 141.953 1.00 48.81 ? 138  LYS B CD  1 
ATOM   4406 C CE  . LYS B 1 137 ? -18.811 41.042 142.620 1.00 46.65 ? 138  LYS B CE  1 
ATOM   4407 N N   . TYR B 1 138 ? -12.843 41.670 142.925 1.00 42.11 ? 139  TYR B N   1 
ATOM   4408 C CA  . TYR B 1 138 ? -12.247 40.371 143.218 1.00 46.25 ? 139  TYR B CA  1 
ATOM   4409 C C   . TYR B 1 138 ? -10.744 40.443 143.450 1.00 45.43 ? 139  TYR B C   1 
ATOM   4410 O O   . TYR B 1 138 ? -10.053 39.421 143.369 1.00 47.37 ? 139  TYR B O   1 
ATOM   4411 C CB  . TYR B 1 138 ? -12.542 39.392 142.080 1.00 49.84 ? 139  TYR B CB  1 
ATOM   4412 C CG  . TYR B 1 138 ? -14.002 39.045 141.933 1.00 53.90 ? 139  TYR B CG  1 
ATOM   4413 C CD1 . TYR B 1 138 ? -14.755 38.648 143.030 1.00 58.25 ? 139  TYR B CD1 1 
ATOM   4414 C CD2 . TYR B 1 138 ? -14.629 39.127 140.702 1.00 52.79 ? 139  TYR B CD2 1 
ATOM   4415 C CE1 . TYR B 1 138 ? -16.085 38.329 142.896 1.00 63.56 ? 139  TYR B CE1 1 
ATOM   4416 C CE2 . TYR B 1 138 ? -15.956 38.813 140.560 1.00 54.68 ? 139  TYR B CE2 1 
ATOM   4417 C CZ  . TYR B 1 138 ? -16.681 38.413 141.656 1.00 62.43 ? 139  TYR B CZ  1 
ATOM   4418 O OH  . TYR B 1 138 ? -18.011 38.100 141.511 1.00 67.02 ? 139  TYR B OH  1 
ATOM   4419 N N   . ARG B 1 139 ? -10.249 41.645 143.732 1.00 41.30 ? 140  ARG B N   1 
ATOM   4420 C CA  . ARG B 1 139 ? -8.822  41.869 143.935 1.00 42.24 ? 140  ARG B CA  1 
ATOM   4421 C C   . ARG B 1 139 ? -8.229  40.902 144.966 1.00 46.84 ? 140  ARG B C   1 
ATOM   4422 O O   . ARG B 1 139 ? -7.239  40.219 144.695 1.00 39.66 ? 140  ARG B O   1 
ATOM   4423 C CB  . ARG B 1 139 ? -8.571  43.311 144.363 1.00 47.97 ? 140  ARG B CB  1 
ATOM   4424 C CG  . ARG B 1 139 ? -7.108  43.651 144.494 1.00 54.81 ? 140  ARG B CG  1 
ATOM   4425 C CD  . ARG B 1 139 ? -6.897  45.018 145.116 1.00 60.97 ? 140  ARG B CD  1 
ATOM   4426 N NE  . ARG B 1 139 ? -5.558  45.501 144.810 1.00 67.98 ? 140  ARG B NE  1 
ATOM   4427 C CZ  . ARG B 1 139 ? -5.247  46.185 143.712 1.00 69.26 ? 140  ARG B CZ  1 
ATOM   4428 N NH1 . ARG B 1 139 ? -6.190  46.481 142.825 1.00 68.05 ? 140  ARG B NH1 1 
ATOM   4429 N NH2 . ARG B 1 139 ? -3.997  46.580 143.501 1.00 69.37 ? 140  ARG B NH2 1 
ATOM   4430 N N   . TYR B 1 140 ? -8.869  40.815 146.130 1.00 42.11 ? 141  TYR B N   1 
ATOM   4431 C CA  . TYR B 1 140 ? -8.346  40.002 147.227 1.00 53.11 ? 141  TYR B CA  1 
ATOM   4432 C C   . TYR B 1 140 ? -8.487  38.491 147.017 1.00 49.21 ? 141  TYR B C   1 
ATOM   4433 O O   . TYR B 1 140 ? -7.571  37.738 147.332 1.00 47.73 ? 141  TYR B O   1 
ATOM   4434 C CB  . TYR B 1 140 ? -8.931  40.477 148.565 1.00 45.76 ? 141  TYR B CB  1 
ATOM   4435 C CG  . TYR B 1 140 ? -8.668  41.949 148.763 1.00 54.67 ? 141  TYR B CG  1 
ATOM   4436 C CD1 . TYR B 1 140 ? -7.392  42.403 149.078 1.00 54.21 ? 141  TYR B CD1 1 
ATOM   4437 C CD2 . TYR B 1 140 ? -9.679  42.891 148.582 1.00 56.14 ? 141  TYR B CD2 1 
ATOM   4438 C CE1 . TYR B 1 140 ? -7.131  43.752 149.241 1.00 58.15 ? 141  TYR B CE1 1 
ATOM   4439 C CE2 . TYR B 1 140 ? -9.430  44.246 148.741 1.00 59.09 ? 141  TYR B CE2 1 
ATOM   4440 C CZ  . TYR B 1 140 ? -8.152  44.671 149.073 1.00 64.12 ? 141  TYR B CZ  1 
ATOM   4441 O OH  . TYR B 1 140 ? -7.889  46.017 149.239 1.00 70.14 ? 141  TYR B OH  1 
ATOM   4442 N N   . ASP B 1 141 ? -9.615  38.052 146.469 1.00 43.93 ? 142  ASP B N   1 
ATOM   4443 C CA  . ASP B 1 141 ? -9.764  36.647 146.118 1.00 44.15 ? 142  ASP B CA  1 
ATOM   4444 C C   . ASP B 1 141 ? -8.686  36.233 145.116 1.00 42.45 ? 142  ASP B C   1 
ATOM   4445 O O   . ASP B 1 141 ? -8.040  35.197 145.283 1.00 42.90 ? 142  ASP B O   1 
ATOM   4446 C CB  . ASP B 1 141 ? -11.150 36.372 145.534 1.00 51.66 ? 142  ASP B CB  1 
ATOM   4447 C CG  . ASP B 1 141 ? -12.254 36.422 146.586 1.00 55.95 ? 142  ASP B CG  1 
ATOM   4448 O OD1 . ASP B 1 141 ? -11.934 36.474 147.796 1.00 54.34 ? 142  ASP B OD1 1 
ATOM   4449 O OD2 . ASP B 1 141 ? -13.441 36.393 146.199 1.00 57.19 ? 142  ASP B OD2 1 
ATOM   4450 N N   . MET B 1 142 ? -8.483  37.049 144.085 1.00 40.61 ? 143  MET B N   1 
ATOM   4451 C CA  . MET B 1 142 ? -7.506  36.714 143.053 1.00 39.02 ? 143  MET B CA  1 
ATOM   4452 C C   . MET B 1 142 ? -6.085  36.737 143.618 1.00 49.14 ? 143  MET B C   1 
ATOM   4453 O O   . MET B 1 142 ? -5.260  35.879 143.294 1.00 47.47 ? 143  MET B O   1 
ATOM   4454 C CB  . MET B 1 142 ? -7.631  37.652 141.853 1.00 37.20 ? 143  MET B CB  1 
ATOM   4455 C CG  . MET B 1 142 ? -6.617  37.382 140.754 1.00 50.37 ? 143  MET B CG  1 
ATOM   4456 S SD  . MET B 1 142 ? -6.610  35.664 140.184 1.00 40.66 ? 143  MET B SD  1 
ATOM   4457 C CE  . MET B 1 142 ? -7.774  35.755 138.830 1.00 37.05 ? 143  MET B CE  1 
ATOM   4458 N N   . LEU B 1 143 ? -5.805  37.720 144.466 1.00 49.44 ? 144  LEU B N   1 
ATOM   4459 C CA  . LEU B 1 143 ? -4.518  37.785 145.135 1.00 48.03 ? 144  LEU B CA  1 
ATOM   4460 C C   . LEU B 1 143 ? -4.289  36.516 145.942 1.00 48.46 ? 144  LEU B C   1 
ATOM   4461 O O   . LEU B 1 143 ? -3.273  35.848 145.777 1.00 41.22 ? 144  LEU B O   1 
ATOM   4462 C CB  . LEU B 1 143 ? -4.440  39.010 146.045 1.00 46.05 ? 144  LEU B CB  1 
ATOM   4463 C CG  . LEU B 1 143 ? -4.191  40.338 145.335 1.00 42.91 ? 144  LEU B CG  1 
ATOM   4464 C CD1 . LEU B 1 143 ? -4.244  41.464 146.340 1.00 40.41 ? 144  LEU B CD1 1 
ATOM   4465 C CD2 . LEU B 1 143 ? -2.857  40.313 144.629 1.00 40.52 ? 144  LEU B CD2 1 
ATOM   4466 N N   . ALA B 1 144 ? -5.253  36.179 146.793 1.00 43.24 ? 145  ALA B N   1 
ATOM   4467 C CA  . ALA B 1 144 ? -5.117  35.031 147.686 1.00 45.00 ? 145  ALA B CA  1 
ATOM   4468 C C   . ALA B 1 144 ? -4.908  33.739 146.905 1.00 46.24 ? 145  ALA B C   1 
ATOM   4469 O O   . ALA B 1 144 ? -4.036  32.933 147.246 1.00 45.05 ? 145  ALA B O   1 
ATOM   4470 C CB  . ALA B 1 144 ? -6.325  34.917 148.610 1.00 46.95 ? 145  ALA B CB  1 
ATOM   4471 N N   . ALA B 1 145 ? -5.690  33.562 145.847 1.00 43.49 ? 146  ALA B N   1 
ATOM   4472 C CA  . ALA B 1 145 ? -5.594  32.374 145.005 1.00 47.48 ? 146  ALA B CA  1 
ATOM   4473 C C   . ALA B 1 145 ? -4.223  32.228 144.336 1.00 44.82 ? 146  ALA B C   1 
ATOM   4474 O O   . ALA B 1 145 ? -3.683  31.127 144.240 1.00 44.17 ? 146  ALA B O   1 
ATOM   4475 C CB  . ALA B 1 145 ? -6.687  32.387 143.955 1.00 42.16 ? 146  ALA B CB  1 
ATOM   4476 N N   . THR B 1 146 ? -3.668  33.335 143.861 1.00 43.04 ? 147  THR B N   1 
ATOM   4477 C CA  . THR B 1 146 ? -2.370  33.291 143.188 1.00 38.90 ? 147  THR B CA  1 
ATOM   4478 C C   . THR B 1 146 ? -1.256  33.046 144.205 1.00 48.21 ? 147  THR B C   1 
ATOM   4479 O O   . THR B 1 146 ? -0.390  32.200 144.004 1.00 39.82 ? 147  THR B O   1 
ATOM   4480 C CB  . THR B 1 146 ? -2.121  34.588 142.410 1.00 37.21 ? 147  THR B CB  1 
ATOM   4481 O OG1 . THR B 1 146 ? -3.076  34.673 141.347 1.00 37.70 ? 147  THR B OG1 1 
ATOM   4482 C CG2 . THR B 1 146 ? -0.722  34.615 141.840 1.00 36.09 ? 147  THR B CG2 1 
ATOM   4483 N N   . MET B 1 147 ? -1.316  33.784 145.307 1.00 40.90 ? 148  MET B N   1 
ATOM   4484 C CA  . MET B 1 147 ? -0.393  33.620 146.413 1.00 42.12 ? 148  MET B CA  1 
ATOM   4485 C C   . MET B 1 147 ? -0.375  32.189 146.922 1.00 43.58 ? 148  MET B C   1 
ATOM   4486 O O   . MET B 1 147 ? 0.676   31.569 147.005 1.00 43.79 ? 148  MET B O   1 
ATOM   4487 C CB  . MET B 1 147 ? -0.790  34.545 147.563 1.00 44.51 ? 148  MET B CB  1 
ATOM   4488 C CG  . MET B 1 147 ? -0.440  35.994 147.340 1.00 46.23 ? 148  MET B CG  1 
ATOM   4489 S SD  . MET B 1 147 ? -1.214  37.069 148.557 1.00 46.59 ? 148  MET B SD  1 
ATOM   4490 C CE  . MET B 1 147 ? -0.494  36.418 150.067 1.00 46.02 ? 148  MET B CE  1 
ATOM   4491 N N   . LEU B 1 148 ? -1.546  31.680 147.280 1.00 44.82 ? 149  LEU B N   1 
ATOM   4492 C CA  . LEU B 1 148 ? -1.647  30.366 147.902 1.00 52.46 ? 149  LEU B CA  1 
ATOM   4493 C C   . LEU B 1 148 ? -1.300  29.260 146.912 1.00 50.91 ? 149  LEU B C   1 
ATOM   4494 O O   . LEU B 1 148 ? -0.519  28.359 147.222 1.00 46.58 ? 149  LEU B O   1 
ATOM   4495 C CB  . LEU B 1 148 ? -3.043  30.151 148.499 1.00 48.18 ? 149  LEU B CB  1 
ATOM   4496 C CG  . LEU B 1 148 ? -3.359  30.955 149.770 1.00 51.48 ? 149  LEU B CG  1 
ATOM   4497 C CD1 . LEU B 1 148 ? -4.860  31.033 150.052 1.00 52.27 ? 149  LEU B CD1 1 
ATOM   4498 C CD2 . LEU B 1 148 ? -2.636  30.364 150.962 1.00 51.54 ? 149  LEU B CD2 1 
ATOM   4499 N N   . GLY B 1 149 ? -1.874  29.345 145.718 1.00 44.40 ? 150  GLY B N   1 
ATOM   4500 C CA  . GLY B 1 149 ? -1.743  28.295 144.727 1.00 43.84 ? 150  GLY B CA  1 
ATOM   4501 C C   . GLY B 1 149 ? -0.403  28.252 144.014 1.00 53.09 ? 150  GLY B C   1 
ATOM   4502 O O   . GLY B 1 149 ? 0.101   27.178 143.700 1.00 42.70 ? 150  GLY B O   1 
ATOM   4503 N N   . GLN B 1 150 ? 0.184   29.411 143.744 1.00 41.08 ? 151  GLN B N   1 
ATOM   4504 C CA  . GLN B 1 150 ? 1.410   29.413 142.960 1.00 39.73 ? 151  GLN B CA  1 
ATOM   4505 C C   . GLN B 1 150 ? 2.643   29.804 143.770 1.00 40.04 ? 151  GLN B C   1 
ATOM   4506 O O   . GLN B 1 150 ? 3.747   29.873 143.237 1.00 39.06 ? 151  GLN B O   1 
ATOM   4507 C CB  . GLN B 1 150 ? 1.241   30.257 141.684 1.00 37.78 ? 151  GLN B CB  1 
ATOM   4508 C CG  . GLN B 1 150 ? 0.200   29.674 140.725 1.00 37.44 ? 151  GLN B CG  1 
ATOM   4509 C CD  . GLN B 1 150 ? -0.720  30.724 140.122 1.00 37.96 ? 151  GLN B CD  1 
ATOM   4510 O OE1 . GLN B 1 150 ? -1.831  30.959 140.618 1.00 37.16 ? 151  GLN B OE1 1 
ATOM   4511 N NE2 . GLN B 1 150 ? -0.269  31.355 139.036 1.00 34.74 ? 151  GLN B NE2 1 
ATOM   4512 N N   . GLY B 1 151 ? 2.448   30.038 145.066 1.00 41.53 ? 152  GLY B N   1 
ATOM   4513 C CA  . GLY B 1 151 ? 3.554   30.261 145.982 1.00 42.21 ? 152  GLY B CA  1 
ATOM   4514 C C   . GLY B 1 151 ? 4.184   31.629 145.832 1.00 47.15 ? 152  GLY B C   1 
ATOM   4515 O O   . GLY B 1 151 ? 5.411   31.772 145.825 1.00 40.63 ? 152  GLY B O   1 
ATOM   4516 N N   . LYS B 1 152 ? 3.337   32.642 145.699 1.00 44.29 ? 153  LYS B N   1 
ATOM   4517 C CA  . LYS B 1 152 ? 3.810   34.013 145.574 1.00 43.42 ? 153  LYS B CA  1 
ATOM   4518 C C   . LYS B 1 152 ? 3.507   34.794 146.834 1.00 40.93 ? 153  LYS B C   1 
ATOM   4519 O O   . LYS B 1 152 ? 2.492   34.556 147.479 1.00 42.18 ? 153  LYS B O   1 
ATOM   4520 C CB  . LYS B 1 152 ? 3.148   34.705 144.373 1.00 42.87 ? 153  LYS B CB  1 
ATOM   4521 C CG  . LYS B 1 152 ? 3.507   34.076 143.039 1.00 43.61 ? 153  LYS B CG  1 
ATOM   4522 C CD  . LYS B 1 152 ? 3.048   34.940 141.857 1.00 39.24 ? 153  LYS B CD  1 
ATOM   4523 C CE  . LYS B 1 152 ? 3.632   34.404 140.565 1.00 39.51 ? 153  LYS B CE  1 
ATOM   4524 N NZ  . LYS B 1 152 ? 3.376   35.276 139.392 1.00 35.41 ? 153  LYS B NZ  1 
ATOM   4525 N N   . ASN B 1 153 ? 4.386   35.727 147.186 1.00 44.16 ? 154  ASN B N   1 
ATOM   4526 C CA  . ASN B 1 153 ? 4.052   36.709 148.207 1.00 41.89 ? 154  ASN B CA  1 
ATOM   4527 C C   . ASN B 1 153 ? 3.083   37.731 147.611 1.00 42.28 ? 154  ASN B C   1 
ATOM   4528 O O   . ASN B 1 153 ? 2.740   37.649 146.429 1.00 40.85 ? 154  ASN B O   1 
ATOM   4529 C CB  . ASN B 1 153 ? 5.304   37.380 148.779 1.00 47.33 ? 154  ASN B CB  1 
ATOM   4530 C CG  . ASN B 1 153 ? 6.130   38.097 147.719 1.00 47.73 ? 154  ASN B CG  1 
ATOM   4531 O OD1 . ASN B 1 153 ? 5.616   38.920 146.956 1.00 47.50 ? 154  ASN B OD1 1 
ATOM   4532 N ND2 . ASN B 1 153 ? 7.424   37.782 147.668 1.00 44.18 ? 154  ASN B ND2 1 
ATOM   4533 N N   . VAL B 1 154 ? 2.648   38.694 148.414 1.00 45.45 ? 155  VAL B N   1 
ATOM   4534 C CA  . VAL B 1 154 ? 1.604   39.616 147.980 1.00 46.13 ? 155  VAL B CA  1 
ATOM   4535 C C   . VAL B 1 154 ? 2.048   40.519 146.831 1.00 39.45 ? 155  VAL B C   1 
ATOM   4536 O O   . VAL B 1 154 ? 1.257   40.836 145.946 1.00 38.78 ? 155  VAL B O   1 
ATOM   4537 C CB  . VAL B 1 154 ? 1.050   40.456 149.165 1.00 50.03 ? 155  VAL B CB  1 
ATOM   4538 C CG1 . VAL B 1 154 ? 2.163   41.232 149.853 1.00 47.51 ? 155  VAL B CG1 1 
ATOM   4539 C CG2 . VAL B 1 154 ? -0.066  41.381 148.696 1.00 49.68 ? 155  VAL B CG2 1 
ATOM   4540 N N   . TYR B 1 155 ? 3.313   40.918 146.827 1.00 39.97 ? 156  TYR B N   1 
ATOM   4541 C CA  . TYR B 1 155 ? 3.800   41.824 145.787 1.00 39.50 ? 156  TYR B CA  1 
ATOM   4542 C C   . TYR B 1 155 ? 3.974   41.096 144.462 1.00 38.52 ? 156  TYR B C   1 
ATOM   4543 O O   . TYR B 1 155 ? 3.610   41.612 143.393 1.00 39.04 ? 156  TYR B O   1 
ATOM   4544 C CB  . TYR B 1 155 ? 5.091   42.519 146.233 1.00 46.93 ? 156  TYR B CB  1 
ATOM   4545 C CG  . TYR B 1 155 ? 4.939   43.221 147.573 1.00 60.13 ? 156  TYR B CG  1 
ATOM   4546 C CD1 . TYR B 1 155 ? 4.179   44.384 147.688 1.00 63.06 ? 156  TYR B CD1 1 
ATOM   4547 C CD2 . TYR B 1 155 ? 5.538   42.711 148.730 1.00 62.39 ? 156  TYR B CD2 1 
ATOM   4548 C CE1 . TYR B 1 155 ? 4.024   45.028 148.915 1.00 65.20 ? 156  TYR B CE1 1 
ATOM   4549 C CE2 . TYR B 1 155 ? 5.388   43.348 149.958 1.00 64.03 ? 156  TYR B CE2 1 
ATOM   4550 C CZ  . TYR B 1 155 ? 4.630   44.506 150.045 1.00 66.14 ? 156  TYR B CZ  1 
ATOM   4551 O OH  . TYR B 1 155 ? 4.474   45.147 151.260 1.00 66.24 ? 156  TYR B OH  1 
ATOM   4552 N N   . GLN B 1 156 ? 4.500   39.880 144.523 1.00 38.76 ? 157  GLN B N   1 
ATOM   4553 C CA  . GLN B 1 156 ? 4.613   39.072 143.310 1.00 40.46 ? 157  GLN B CA  1 
ATOM   4554 C C   . GLN B 1 156 ? 3.225   38.800 142.731 1.00 38.28 ? 157  GLN B C   1 
ATOM   4555 O O   . GLN B 1 156 ? 3.028   38.886 141.527 1.00 39.04 ? 157  GLN B O   1 
ATOM   4556 C CB  . GLN B 1 156 ? 5.334   37.758 143.592 1.00 39.04 ? 157  GLN B CB  1 
ATOM   4557 C CG  . GLN B 1 156 ? 6.766   37.918 144.090 1.00 38.12 ? 157  GLN B CG  1 
ATOM   4558 C CD  . GLN B 1 156 ? 7.305   36.635 144.701 1.00 43.28 ? 157  GLN B CD  1 
ATOM   4559 O OE1 . GLN B 1 156 ? 6.558   35.850 145.293 1.00 47.09 ? 157  GLN B OE1 1 
ATOM   4560 N NE2 . GLN B 1 156 ? 8.602   36.415 144.561 1.00 43.80 ? 157  GLN B NE2 1 
ATOM   4561 N N   . ALA B 1 157 ? 2.262   38.500 143.598 1.00 35.84 ? 158  ALA B N   1 
ATOM   4562 C CA  . ALA B 1 157 ? 0.901   38.215 143.141 1.00 40.98 ? 158  ALA B CA  1 
ATOM   4563 C C   . ALA B 1 157 ? 0.237   39.444 142.513 1.00 36.56 ? 158  ALA B C   1 
ATOM   4564 O O   . ALA B 1 157 ? -0.375  39.351 141.457 1.00 34.42 ? 158  ALA B O   1 
ATOM   4565 C CB  . ALA B 1 157 ? 0.059   37.682 144.278 1.00 42.59 ? 158  ALA B CB  1 
ATOM   4566 N N   . GLU B 1 158 ? 0.384   40.596 143.154 1.00 38.18 ? 159  GLU B N   1 
ATOM   4567 C CA  . GLU B 1 158 ? -0.253  41.814 142.672 1.00 44.57 ? 159  GLU B CA  1 
ATOM   4568 C C   . GLU B 1 158 ? 0.257   42.197 141.289 1.00 43.64 ? 159  GLU B C   1 
ATOM   4569 O O   . GLU B 1 158 ? -0.512  42.557 140.399 1.00 38.69 ? 159  GLU B O   1 
ATOM   4570 C CB  . GLU B 1 158 ? -0.013  42.961 143.643 1.00 49.99 ? 159  GLU B CB  1 
ATOM   4571 C CG  . GLU B 1 158 ? -1.098  44.011 143.599 1.00 63.69 ? 159  GLU B CG  1 
ATOM   4572 C CD  . GLU B 1 158 ? -0.755  45.224 144.430 1.00 77.53 ? 159  GLU B CD  1 
ATOM   4573 O OE1 . GLU B 1 158 ? 0.435   45.386 144.781 1.00 82.70 ? 159  GLU B OE1 1 
ATOM   4574 O OE2 . GLU B 1 158 ? -1.675  46.014 144.736 1.00 82.18 ? 159  GLU B OE2 1 
ATOM   4575 N N   . ILE B 1 159 ? 1.565   42.109 141.120 1.00 43.99 ? 160  ILE B N   1 
ATOM   4576 C CA  . ILE B 1 159 ? 2.197   42.446 139.865 1.00 39.90 ? 160  ILE B CA  1 
ATOM   4577 C C   . ILE B 1 159 ? 1.693   41.507 138.762 1.00 38.22 ? 160  ILE B C   1 
ATOM   4578 O O   . ILE B 1 159 ? 1.519   41.919 137.613 1.00 30.73 ? 160  ILE B O   1 
ATOM   4579 C CB  . ILE B 1 159 ? 3.735   42.385 140.009 1.00 42.10 ? 160  ILE B CB  1 
ATOM   4580 C CG1 . ILE B 1 159 ? 4.360   43.725 139.652 1.00 50.30 ? 160  ILE B CG1 1 
ATOM   4581 C CG2 . ILE B 1 159 ? 4.343   41.294 139.151 1.00 48.42 ? 160  ILE B CG2 1 
ATOM   4582 C CD1 . ILE B 1 159 ? 5.465   44.140 140.625 1.00 57.36 ? 160  ILE B CD1 1 
ATOM   4583 N N   . ASP B 1 160 ? 1.434   40.257 139.133 1.00 33.34 ? 161  ASP B N   1 
ATOM   4584 C CA  . ASP B 1 160 ? 1.023   39.239 138.181 1.00 33.41 ? 161  ASP B CA  1 
ATOM   4585 C C   . ASP B 1 160 ? -0.466  39.330 137.914 1.00 35.16 ? 161  ASP B C   1 
ATOM   4586 O O   . ASP B 1 160 ? -0.897  39.843 136.870 1.00 31.24 ? 161  ASP B O   1 
ATOM   4587 C CB  . ASP B 1 160 ? 1.395   37.854 138.718 1.00 37.70 ? 161  ASP B CB  1 
ATOM   4588 C CG  . ASP B 1 160 ? 0.776   36.708 137.923 1.00 36.36 ? 161  ASP B CG  1 
ATOM   4589 O OD1 . ASP B 1 160 ? 0.259   36.908 136.805 1.00 35.38 ? 161  ASP B OD1 1 
ATOM   4590 O OD2 . ASP B 1 160 ? 0.818   35.575 138.438 1.00 39.59 ? 161  ASP B OD2 1 
ATOM   4591 N N   . CYS B 1 161 ? -1.248  38.846 138.870 1.00 35.95 ? 162  CYS B N   1 
ATOM   4592 C CA  . CYS B 1 161 ? -2.659  38.580 138.626 1.00 40.01 ? 162  CYS B CA  1 
ATOM   4593 C C   . CYS B 1 161 ? -3.540  39.828 138.673 1.00 42.53 ? 162  CYS B C   1 
ATOM   4594 O O   . CYS B 1 161 ? -4.726  39.756 138.358 1.00 46.64 ? 162  CYS B O   1 
ATOM   4595 C CB  . CYS B 1 161 ? -3.179  37.516 139.591 1.00 33.13 ? 162  CYS B CB  1 
ATOM   4596 S SG  . CYS B 1 161 ? -3.276  38.120 141.251 1.00 41.70 ? 162  CYS B SG  1 
ATOM   4597 N N   . ILE B 1 162 ? -2.972  40.969 139.050 1.00 40.46 ? 163  ILE B N   1 
ATOM   4598 C CA  . ILE B 1 162 ? -3.719  42.227 138.956 1.00 38.58 ? 163  ILE B CA  1 
ATOM   4599 C C   . ILE B 1 162 ? -3.155  43.114 137.848 1.00 39.39 ? 163  ILE B C   1 
ATOM   4600 O O   . ILE B 1 162 ? -3.761  43.258 136.791 1.00 47.05 ? 163  ILE B O   1 
ATOM   4601 C CB  . ILE B 1 162 ? -3.736  43.013 140.290 1.00 38.12 ? 163  ILE B CB  1 
ATOM   4602 C CG1 . ILE B 1 162 ? -4.108  42.100 141.463 1.00 37.97 ? 163  ILE B CG1 1 
ATOM   4603 C CG2 . ILE B 1 162 ? -4.685  44.195 140.198 1.00 41.23 ? 163  ILE B CG2 1 
ATOM   4604 C CD1 . ILE B 1 162 ? -5.545  41.555 141.420 1.00 41.85 ? 163  ILE B CD1 1 
ATOM   4605 N N   . THR B 1 163 ? -1.980  43.685 138.087 1.00 40.66 ? 164  THR B N   1 
ATOM   4606 C CA  . THR B 1 163 ? -1.368  44.640 137.155 1.00 40.20 ? 164  THR B CA  1 
ATOM   4607 C C   . THR B 1 163 ? -1.107  44.108 135.740 1.00 38.79 ? 164  THR B C   1 
ATOM   4608 O O   . THR B 1 163 ? -1.640  44.651 134.769 1.00 36.96 ? 164  THR B O   1 
ATOM   4609 C CB  . THR B 1 163 ? -0.067  45.246 137.738 1.00 46.94 ? 164  THR B CB  1 
ATOM   4610 O OG1 . THR B 1 163 ? -0.353  45.867 139.001 1.00 48.52 ? 164  THR B OG1 1 
ATOM   4611 C CG2 . THR B 1 163 ? 0.508   46.281 136.785 1.00 44.32 ? 164  THR B CG2 1 
ATOM   4612 N N   . GLU B 1 164 ? -0.291  43.063 135.607 1.00 34.63 ? 165  GLU B N   1 
ATOM   4613 C CA  . GLU B 1 164 ? 0.006   42.525 134.278 1.00 36.09 ? 165  GLU B CA  1 
ATOM   4614 C C   . GLU B 1 164 ? -1.234  41.956 133.577 1.00 34.39 ? 165  GLU B C   1 
ATOM   4615 O O   . GLU B 1 164 ? -1.441  42.186 132.383 1.00 35.07 ? 165  GLU B O   1 
ATOM   4616 C CB  . GLU B 1 164 ? 1.118   41.476 134.329 1.00 42.81 ? 165  GLU B CB  1 
ATOM   4617 C CG  . GLU B 1 164 ? 2.504   42.058 134.462 1.00 54.63 ? 165  GLU B CG  1 
ATOM   4618 C CD  . GLU B 1 164 ? 3.538   41.008 134.817 1.00 63.33 ? 165  GLU B CD  1 
ATOM   4619 O OE1 . GLU B 1 164 ? 3.255   39.805 134.617 1.00 65.03 ? 165  GLU B OE1 1 
ATOM   4620 O OE2 . GLU B 1 164 ? 4.629   41.386 135.306 1.00 63.54 ? 165  GLU B OE2 1 
ATOM   4621 N N   . LEU B 1 165 ? -2.055  41.220 134.320 1.00 32.10 ? 166  LEU B N   1 
ATOM   4622 C CA  . LEU B 1 165 ? -3.279  40.658 133.766 1.00 34.68 ? 166  LEU B CA  1 
ATOM   4623 C C   . LEU B 1 165 ? -4.139  41.767 133.178 1.00 37.58 ? 166  LEU B C   1 
ATOM   4624 O O   . LEU B 1 165 ? -4.503  41.711 132.012 1.00 34.88 ? 166  LEU B O   1 
ATOM   4625 C CB  . LEU B 1 165 ? -4.052  39.870 134.828 1.00 36.92 ? 166  LEU B CB  1 
ATOM   4626 C CG  . LEU B 1 165 ? -5.270  39.042 134.395 1.00 39.06 ? 166  LEU B CG  1 
ATOM   4627 C CD1 . LEU B 1 165 ? -5.469  37.829 135.325 1.00 29.57 ? 166  LEU B CD1 1 
ATOM   4628 C CD2 . LEU B 1 165 ? -6.532  39.895 134.357 1.00 38.23 ? 166  LEU B CD2 1 
ATOM   4629 N N   . SER B 1 166 ? -4.450  42.778 133.982 1.00 38.88 ? 167  SER B N   1 
ATOM   4630 C CA  . SER B 1 166 ? -5.260  43.884 133.501 1.00 39.89 ? 167  SER B CA  1 
ATOM   4631 C C   . SER B 1 166 ? -4.582  44.596 132.333 1.00 41.88 ? 167  SER B C   1 
ATOM   4632 O O   . SER B 1 166 ? -5.249  45.073 131.418 1.00 41.65 ? 167  SER B O   1 
ATOM   4633 C CB  . SER B 1 166 ? -5.565  44.864 134.628 1.00 42.19 ? 167  SER B CB  1 
ATOM   4634 O OG  . SER B 1 166 ? -6.395  44.257 135.608 1.00 49.87 ? 167  SER B OG  1 
ATOM   4635 N N   . ASP B 1 167 ? -3.254  44.647 132.356 1.00 37.77 ? 168  ASP B N   1 
ATOM   4636 C CA  . ASP B 1 167 ? -2.506  45.277 131.279 1.00 36.33 ? 168  ASP B CA  1 
ATOM   4637 C C   . ASP B 1 167 ? -2.628  44.521 129.958 1.00 37.25 ? 168  ASP B C   1 
ATOM   4638 O O   . ASP B 1 167 ? -2.747  45.137 128.896 1.00 37.44 ? 168  ASP B O   1 
ATOM   4639 C CB  . ASP B 1 167 ? -1.033  45.435 131.650 1.00 41.48 ? 168  ASP B CB  1 
ATOM   4640 C CG  . ASP B 1 167 ? -0.760  46.705 132.442 1.00 53.61 ? 168  ASP B CG  1 
ATOM   4641 O OD1 . ASP B 1 167 ? -1.714  47.277 133.016 1.00 58.80 ? 168  ASP B OD1 1 
ATOM   4642 O OD2 . ASP B 1 167 ? 0.416   47.129 132.492 1.00 56.90 ? 168  ASP B OD2 1 
ATOM   4643 N N   . PHE B 1 168 ? -2.578  43.194 130.015 1.00 35.71 ? 169  PHE B N   1 
ATOM   4644 C CA  . PHE B 1 168 ? -2.758  42.393 128.805 1.00 38.63 ? 169  PHE B CA  1 
ATOM   4645 C C   . PHE B 1 168 ? -4.101  42.716 128.146 1.00 34.05 ? 169  PHE B C   1 
ATOM   4646 O O   . PHE B 1 168 ? -4.160  43.008 126.964 1.00 35.04 ? 169  PHE B O   1 
ATOM   4647 C CB  . PHE B 1 168 ? -2.660  40.899 129.116 1.00 39.23 ? 169  PHE B CB  1 
ATOM   4648 C CG  . PHE B 1 168 ? -1.256  40.350 129.066 1.00 40.85 ? 169  PHE B CG  1 
ATOM   4649 C CD1 . PHE B 1 168 ? -0.440  40.587 127.972 1.00 36.34 ? 169  PHE B CD1 1 
ATOM   4650 C CD2 . PHE B 1 168 ? -0.759  39.579 130.113 1.00 42.07 ? 169  PHE B CD2 1 
ATOM   4651 C CE1 . PHE B 1 168 ? 0.845   40.068 127.920 1.00 35.13 ? 169  PHE B CE1 1 
ATOM   4652 C CE2 . PHE B 1 168 ? 0.531   39.059 130.068 1.00 35.93 ? 169  PHE B CE2 1 
ATOM   4653 C CZ  . PHE B 1 168 ? 1.331   39.309 128.969 1.00 33.25 ? 169  PHE B CZ  1 
ATOM   4654 N N   . PHE B 1 169 ? -5.171  42.693 128.926 1.00 33.55 ? 170  PHE B N   1 
ATOM   4655 C CA  . PHE B 1 169 ? -6.501  42.968 128.389 1.00 33.80 ? 170  PHE B CA  1 
ATOM   4656 C C   . PHE B 1 169 ? -6.640  44.391 127.830 1.00 38.91 ? 170  PHE B C   1 
ATOM   4657 O O   . PHE B 1 169 ? -7.025  44.570 126.669 1.00 35.89 ? 170  PHE B O   1 
ATOM   4658 C CB  . PHE B 1 169 ? -7.569  42.671 129.439 1.00 30.35 ? 170  PHE B CB  1 
ATOM   4659 C CG  . PHE B 1 169 ? -7.753  41.199 129.707 1.00 34.02 ? 170  PHE B CG  1 
ATOM   4660 C CD1 . PHE B 1 169 ? -7.076  40.251 128.942 1.00 28.16 ? 170  PHE B CD1 1 
ATOM   4661 C CD2 . PHE B 1 169 ? -8.609  40.760 130.712 1.00 31.73 ? 170  PHE B CD2 1 
ATOM   4662 C CE1 . PHE B 1 169 ? -7.258  38.892 129.173 1.00 27.48 ? 170  PHE B CE1 1 
ATOM   4663 C CE2 . PHE B 1 169 ? -8.788  39.401 130.948 1.00 34.85 ? 170  PHE B CE2 1 
ATOM   4664 C CZ  . PHE B 1 169 ? -8.106  38.466 130.176 1.00 31.79 ? 170  PHE B CZ  1 
ATOM   4665 N N   . ARG B 1 170 ? -6.294  45.393 128.637 1.00 39.15 ? 171  ARG B N   1 
ATOM   4666 C CA  . ARG B 1 170 ? -6.397  46.782 128.195 1.00 37.75 ? 171  ARG B CA  1 
ATOM   4667 C C   . ARG B 1 170 ? -5.539  47.068 126.969 1.00 40.80 ? 171  ARG B C   1 
ATOM   4668 O O   . ARG B 1 170 ? -6.000  47.712 126.027 1.00 41.87 ? 171  ARG B O   1 
ATOM   4669 C CB  . ARG B 1 170 ? -6.088  47.754 129.331 1.00 36.93 ? 171  ARG B CB  1 
ATOM   4670 C CG  . ARG B 1 170 ? -7.027  47.568 130.511 1.00 49.47 ? 171  ARG B CG  1 
ATOM   4671 C CD  . ARG B 1 170 ? -6.962  48.698 131.552 1.00 56.70 ? 171  ARG B CD  1 
ATOM   4672 N NE  . ARG B 1 170 ? -7.848  48.399 132.679 1.00 65.15 ? 171  ARG B NE  1 
ATOM   4673 C CZ  . ARG B 1 170 ? -7.429  48.029 133.889 1.00 66.98 ? 171  ARG B CZ  1 
ATOM   4674 N NH1 . ARG B 1 170 ? -6.130  47.939 134.139 1.00 73.40 ? 171  ARG B NH1 1 
ATOM   4675 N NH2 . ARG B 1 170 ? -8.304  47.764 134.852 1.00 59.43 ? 171  ARG B NH2 1 
ATOM   4676 N N   . TYR B 1 171 ? -4.307  46.568 126.951 1.00 35.44 ? 172  TYR B N   1 
ATOM   4677 C CA  . TYR B 1 171 ? -3.451  46.814 125.798 1.00 32.57 ? 172  TYR B CA  1 
ATOM   4678 C C   . TYR B 1 171 ? -3.895  46.082 124.537 1.00 39.48 ? 172  TYR B C   1 
ATOM   4679 O O   . TYR B 1 171 ? -3.823  46.636 123.439 1.00 41.55 ? 172  TYR B O   1 
ATOM   4680 C CB  . TYR B 1 171 ? -1.972  46.565 126.109 1.00 38.88 ? 172  TYR B CB  1 
ATOM   4681 C CG  . TYR B 1 171 ? -1.338  47.730 126.856 1.00 54.75 ? 172  TYR B CG  1 
ATOM   4682 C CD1 . TYR B 1 171 ? -0.451  48.597 126.220 1.00 61.64 ? 172  TYR B CD1 1 
ATOM   4683 C CD2 . TYR B 1 171 ? -1.657  47.983 128.192 1.00 59.19 ? 172  TYR B CD2 1 
ATOM   4684 C CE1 . TYR B 1 171 ? 0.120   49.667 126.902 1.00 63.99 ? 172  TYR B CE1 1 
ATOM   4685 C CE2 . TYR B 1 171 ? -1.096  49.047 128.877 1.00 61.32 ? 172  TYR B CE2 1 
ATOM   4686 C CZ  . TYR B 1 171 ? -0.209  49.884 128.229 1.00 65.08 ? 172  TYR B CZ  1 
ATOM   4687 O OH  . TYR B 1 171 ? 0.346   50.938 128.917 1.00 68.13 ? 172  TYR B OH  1 
ATOM   4688 N N   . TYR B 1 172 ? -4.358  44.847 124.683 1.00 34.00 ? 173  TYR B N   1 
ATOM   4689 C CA  . TYR B 1 172 ? -4.866  44.136 123.525 1.00 34.85 ? 173  TYR B CA  1 
ATOM   4690 C C   . TYR B 1 172 ? -6.078  44.831 122.932 1.00 29.59 ? 173  TYR B C   1 
ATOM   4691 O O   . TYR B 1 172 ? -6.241  44.843 121.714 1.00 26.71 ? 173  TYR B O   1 
ATOM   4692 C CB  . TYR B 1 172 ? -5.203  42.682 123.854 1.00 34.90 ? 173  TYR B CB  1 
ATOM   4693 C CG  . TYR B 1 172 ? -3.972  41.832 123.992 1.00 36.33 ? 173  TYR B CG  1 
ATOM   4694 C CD1 . TYR B 1 172 ? -2.820  42.150 123.292 1.00 40.29 ? 173  TYR B CD1 1 
ATOM   4695 C CD2 . TYR B 1 172 ? -3.952  40.726 124.832 1.00 38.08 ? 173  TYR B CD2 1 
ATOM   4696 C CE1 . TYR B 1 172 ? -1.686  41.390 123.409 1.00 38.94 ? 173  TYR B CE1 1 
ATOM   4697 C CE2 . TYR B 1 172 ? -2.816  39.960 124.960 1.00 38.65 ? 173  TYR B CE2 1 
ATOM   4698 C CZ  . TYR B 1 172 ? -1.685  40.300 124.242 1.00 39.15 ? 173  TYR B CZ  1 
ATOM   4699 O OH  . TYR B 1 172 ? -0.537  39.556 124.347 1.00 37.46 ? 173  TYR B OH  1 
ATOM   4700 N N   . VAL B 1 173 ? -6.926  45.397 123.784 1.00 26.93 ? 174  VAL B N   1 
ATOM   4701 C CA  . VAL B 1 173 ? -8.111  46.073 123.287 1.00 32.01 ? 174  VAL B CA  1 
ATOM   4702 C C   . VAL B 1 173 ? -7.708  47.300 122.466 1.00 33.93 ? 174  VAL B C   1 
ATOM   4703 O O   . VAL B 1 173 ? -8.208  47.504 121.361 1.00 33.22 ? 174  VAL B O   1 
ATOM   4704 C CB  . VAL B 1 173 ? -9.133  46.385 124.414 1.00 31.22 ? 174  VAL B CB  1 
ATOM   4705 C CG1 . VAL B 1 173 ? -10.167 47.384 123.952 1.00 23.96 ? 174  VAL B CG1 1 
ATOM   4706 C CG2 . VAL B 1 173 ? -9.832  45.095 124.856 1.00 28.85 ? 174  VAL B CG2 1 
ATOM   4707 N N   . LYS B 1 174 ? -6.765  48.081 122.976 1.00 36.82 ? 175  LYS B N   1 
ATOM   4708 C CA  . LYS B 1 174 ? -6.231  49.194 122.210 1.00 36.05 ? 175  LYS B CA  1 
ATOM   4709 C C   . LYS B 1 174 ? -5.597  48.738 120.889 1.00 39.55 ? 175  LYS B C   1 
ATOM   4710 O O   . LYS B 1 174 ? -5.904  49.296 119.831 1.00 38.62 ? 175  LYS B O   1 
ATOM   4711 C CB  . LYS B 1 174 ? -5.221  50.006 123.030 1.00 36.72 ? 175  LYS B CB  1 
ATOM   4712 C CG  . LYS B 1 174 ? -4.646  51.206 122.274 1.00 34.57 ? 175  LYS B CG  1 
ATOM   4713 N N   . TYR B 1 175 ? -4.725  47.729 120.940 1.00 32.73 ? 176  TYR B N   1 
ATOM   4714 C CA  . TYR B 1 175 ? -4.017  47.292 119.734 1.00 34.78 ? 176  TYR B CA  1 
ATOM   4715 C C   . TYR B 1 175 ? -4.985  46.753 118.696 1.00 38.45 ? 176  TYR B C   1 
ATOM   4716 O O   . TYR B 1 175 ? -4.837  47.026 117.507 1.00 43.71 ? 176  TYR B O   1 
ATOM   4717 C CB  . TYR B 1 175 ? -2.958  46.229 120.036 1.00 40.14 ? 176  TYR B CB  1 
ATOM   4718 C CG  . TYR B 1 175 ? -1.864  46.682 120.989 1.00 58.17 ? 176  TYR B CG  1 
ATOM   4719 C CD1 . TYR B 1 175 ? -1.544  48.034 121.132 1.00 63.13 ? 176  TYR B CD1 1 
ATOM   4720 C CD2 . TYR B 1 175 ? -1.151  45.755 121.753 1.00 65.56 ? 176  TYR B CD2 1 
ATOM   4721 C CE1 . TYR B 1 175 ? -0.548  48.447 122.008 1.00 64.93 ? 176  TYR B CE1 1 
ATOM   4722 C CE2 . TYR B 1 175 ? -0.157  46.158 122.632 1.00 66.81 ? 176  TYR B CE2 1 
ATOM   4723 C CZ  . TYR B 1 175 ? 0.138   47.503 122.753 1.00 68.09 ? 176  TYR B CZ  1 
ATOM   4724 O OH  . TYR B 1 175 ? 1.125   47.902 123.621 1.00 72.24 ? 176  TYR B OH  1 
ATOM   4725 N N   . ALA B 1 176 ? -5.968  45.982 119.150 1.00 34.00 ? 177  ALA B N   1 
ATOM   4726 C CA  . ALA B 1 176 ? -6.935  45.384 118.243 1.00 37.23 ? 177  ALA B CA  1 
ATOM   4727 C C   . ALA B 1 176 ? -7.792  46.484 117.632 1.00 38.86 ? 177  ALA B C   1 
ATOM   4728 O O   . ALA B 1 176 ? -8.138  46.440 116.455 1.00 35.18 ? 177  ALA B O   1 
ATOM   4729 C CB  . ALA B 1 176 ? -7.810  44.356 118.968 1.00 31.23 ? 177  ALA B CB  1 
ATOM   4730 N N   . SER B 1 177 ? -8.117  47.473 118.450 1.00 40.19 ? 178  SER B N   1 
ATOM   4731 C CA  . SER B 1 177 ? -8.928  48.590 118.008 1.00 40.33 ? 178  SER B CA  1 
ATOM   4732 C C   . SER B 1 177 ? -8.289  49.276 116.812 1.00 37.63 ? 178  SER B C   1 
ATOM   4733 O O   . SER B 1 177 ? -8.975  49.605 115.844 1.00 34.08 ? 178  SER B O   1 
ATOM   4734 C CB  . SER B 1 177 ? -9.116  49.585 119.145 1.00 40.68 ? 178  SER B CB  1 
ATOM   4735 O OG  . SER B 1 177 ? -10.231 50.413 118.886 1.00 49.53 ? 178  SER B OG  1 
ATOM   4736 N N   . ASP B 1 178 ? -6.975  49.473 116.875 1.00 38.82 ? 179  ASP B N   1 
ATOM   4737 C CA  . ASP B 1 178 ? -6.239  50.064 115.764 1.00 41.85 ? 179  ASP B CA  1 
ATOM   4738 C C   . ASP B 1 178 ? -6.311  49.151 114.561 1.00 40.10 ? 179  ASP B C   1 
ATOM   4739 O O   . ASP B 1 178 ? -6.564  49.608 113.451 1.00 43.51 ? 179  ASP B O   1 
ATOM   4740 C CB  . ASP B 1 178 ? -4.770  50.284 116.123 1.00 46.67 ? 179  ASP B CB  1 
ATOM   4741 C CG  . ASP B 1 178 ? -4.586  51.243 117.281 1.00 49.20 ? 179  ASP B CG  1 
ATOM   4742 O OD1 . ASP B 1 178 ? -5.490  52.070 117.522 1.00 45.06 ? 179  ASP B OD1 1 
ATOM   4743 O OD2 . ASP B 1 178 ? -3.531  51.163 117.950 1.00 53.49 ? 179  ASP B OD2 1 
ATOM   4744 N N   . LEU B 1 179 ? -6.068  47.863 114.790 1.00 38.44 ? 180  LEU B N   1 
ATOM   4745 C CA  . LEU B 1 179 ? -6.104  46.866 113.725 1.00 38.24 ? 180  LEU B CA  1 
ATOM   4746 C C   . LEU B 1 179 ? -7.400  46.928 112.934 1.00 38.72 ? 180  LEU B C   1 
ATOM   4747 O O   . LEU B 1 179 ? -7.385  46.925 111.712 1.00 45.75 ? 180  LEU B O   1 
ATOM   4748 C CB  . LEU B 1 179 ? -5.936  45.461 114.299 1.00 48.48 ? 180  LEU B CB  1 
ATOM   4749 C CG  . LEU B 1 179 ? -4.567  44.798 114.138 1.00 58.21 ? 180  LEU B CG  1 
ATOM   4750 C CD1 . LEU B 1 179 ? -4.630  43.329 114.555 1.00 60.18 ? 180  LEU B CD1 1 
ATOM   4751 C CD2 . LEU B 1 179 ? -4.068  44.927 112.710 1.00 61.52 ? 180  LEU B CD2 1 
ATOM   4752 N N   . TYR B 1 180 ? -8.519  47.006 113.649 1.00 37.58 ? 181  TYR B N   1 
ATOM   4753 C CA  . TYR B 1 180 ? -9.846  47.009 113.043 1.00 37.04 ? 181  TYR B CA  1 
ATOM   4754 C C   . TYR B 1 180 ? -10.264 48.372 112.481 1.00 41.60 ? 181  TYR B C   1 
ATOM   4755 O O   . TYR B 1 180 ? -11.404 48.542 112.041 1.00 39.00 ? 181  TYR B O   1 
ATOM   4756 C CB  . TYR B 1 180 ? -10.887 46.567 114.077 1.00 35.32 ? 181  TYR B CB  1 
ATOM   4757 C CG  . TYR B 1 180 ? -10.865 45.094 114.425 1.00 39.15 ? 181  TYR B CG  1 
ATOM   4758 C CD1 . TYR B 1 180 ? -10.827 44.116 113.439 1.00 40.40 ? 181  TYR B CD1 1 
ATOM   4759 C CD2 . TYR B 1 180 ? -10.890 44.683 115.745 1.00 36.97 ? 181  TYR B CD2 1 
ATOM   4760 C CE1 . TYR B 1 180 ? -10.823 42.765 113.769 1.00 39.27 ? 181  TYR B CE1 1 
ATOM   4761 C CE2 . TYR B 1 180 ? -10.882 43.345 116.082 1.00 37.72 ? 181  TYR B CE2 1 
ATOM   4762 C CZ  . TYR B 1 180 ? -10.849 42.393 115.098 1.00 38.42 ? 181  TYR B CZ  1 
ATOM   4763 O OH  . TYR B 1 180 ? -10.850 41.073 115.466 1.00 32.86 ? 181  TYR B OH  1 
ATOM   4764 N N   . ALA B 1 181 ? -9.350  49.338 112.503 1.00 44.82 ? 182  ALA B N   1 
ATOM   4765 C CA  . ALA B 1 181 ? -9.677  50.705 112.113 1.00 50.88 ? 182  ALA B CA  1 
ATOM   4766 C C   . ALA B 1 181 ? -9.456  50.960 110.626 1.00 54.00 ? 182  ALA B C   1 
ATOM   4767 O O   . ALA B 1 181 ? -9.160  52.081 110.222 1.00 60.65 ? 182  ALA B O   1 
ATOM   4768 C CB  . ALA B 1 181 ? -8.877  51.702 112.947 1.00 51.29 ? 182  ALA B CB  1 
ATOM   4769 N N   . GLN B 1 182 ? -9.606  49.915 109.823 1.00 55.59 ? 183  GLN B N   1 
ATOM   4770 C CA  . GLN B 1 182 ? -9.460  50.013 108.378 1.00 60.18 ? 183  GLN B CA  1 
ATOM   4771 C C   . GLN B 1 182 ? -10.687 50.677 107.772 1.00 57.99 ? 183  GLN B C   1 
ATOM   4772 O O   . GLN B 1 182 ? -11.820 50.366 108.137 1.00 64.01 ? 183  GLN B O   1 
ATOM   4773 C CB  . GLN B 1 182 ? -9.265  48.617 107.762 1.00 63.20 ? 183  GLN B CB  1 
ATOM   4774 N N   . GLN B 1 183 ? -10.459 51.600 106.851 1.00 50.96 ? 184  GLN B N   1 
ATOM   4775 C CA  . GLN B 1 183 ? -11.551 52.195 106.109 1.00 41.30 ? 184  GLN B CA  1 
ATOM   4776 C C   . GLN B 1 183 ? -11.415 51.824 104.641 1.00 34.94 ? 184  GLN B C   1 
ATOM   4777 O O   . GLN B 1 183 ? -10.311 51.743 104.111 1.00 32.40 ? 184  GLN B O   1 
ATOM   4778 C CB  . GLN B 1 183 ? -11.589 53.715 106.299 1.00 46.75 ? 184  GLN B CB  1 
ATOM   4779 C CG  . GLN B 1 183 ? -10.407 54.469 105.730 1.00 52.86 ? 184  GLN B CG  1 
ATOM   4780 C CD  . GLN B 1 183 ? -10.345 55.916 106.214 1.00 58.48 ? 184  GLN B CD  1 
ATOM   4781 O OE1 . GLN B 1 183 ? -9.673  56.216 107.201 1.00 61.04 ? 184  GLN B OE1 1 
ATOM   4782 N NE2 . GLN B 1 183 ? -11.045 56.818 105.517 1.00 52.65 ? 184  GLN B NE2 1 
ATOM   4783 N N   . PRO B 1 184 ? -12.548 51.582 103.979 1.00 31.62 ? 185  PRO B N   1 
ATOM   4784 C CA  . PRO B 1 184 ? -12.512 51.265 102.557 1.00 29.35 ? 185  PRO B CA  1 
ATOM   4785 C C   . PRO B 1 184 ? -11.923 52.425 101.764 1.00 31.90 ? 185  PRO B C   1 
ATOM   4786 O O   . PRO B 1 184 ? -12.045 53.585 102.177 1.00 33.44 ? 185  PRO B O   1 
ATOM   4787 C CB  . PRO B 1 184 ? -13.992 51.063 102.211 1.00 24.61 ? 185  PRO B CB  1 
ATOM   4788 C CG  . PRO B 1 184 ? -14.724 51.850 103.253 1.00 24.87 ? 185  PRO B CG  1 
ATOM   4789 C CD  . PRO B 1 184 ? -13.923 51.697 104.490 1.00 28.34 ? 185  PRO B CD  1 
ATOM   4790 N N   . VAL B 1 185 ? -11.264 52.121 100.652 1.00 32.08 ? 186  VAL B N   1 
ATOM   4791 C CA  . VAL B 1 185 ? -10.679 53.173 99.822  1.00 34.03 ? 186  VAL B CA  1 
ATOM   4792 C C   . VAL B 1 185 ? -10.929 52.930 98.347  1.00 33.58 ? 186  VAL B C   1 
ATOM   4793 O O   . VAL B 1 185 ? -10.957 51.781 97.866  1.00 29.61 ? 186  VAL B O   1 
ATOM   4794 C CB  . VAL B 1 185 ? -9.136  53.369 100.060 1.00 45.25 ? 186  VAL B CB  1 
ATOM   4795 C CG1 . VAL B 1 185 ? -8.797  53.370 101.549 1.00 42.81 ? 186  VAL B CG1 1 
ATOM   4796 C CG2 . VAL B 1 185 ? -8.317  52.310 99.327  1.00 42.36 ? 186  VAL B CG2 1 
ATOM   4797 N N   . GLU B 1 186 ? -11.141 54.021 97.629  1.00 26.20 ? 187  GLU B N   1 
ATOM   4798 C CA  . GLU B 1 186 ? -11.153 53.956 96.192  1.00 31.08 ? 187  GLU B CA  1 
ATOM   4799 C C   . GLU B 1 186 ? -9.711  54.065 95.723  1.00 38.51 ? 187  GLU B C   1 
ATOM   4800 O O   . GLU B 1 186 ? -9.006  54.990 96.106  1.00 44.01 ? 187  GLU B O   1 
ATOM   4801 C CB  . GLU B 1 186 ? -12.004 55.080 95.615  1.00 32.25 ? 187  GLU B CB  1 
ATOM   4802 C CG  . GLU B 1 186 ? -12.129 55.031 94.117  1.00 41.21 ? 187  GLU B CG  1 
ATOM   4803 C CD  . GLU B 1 186 ? -13.149 56.017 93.616  1.00 50.80 ? 187  GLU B CD  1 
ATOM   4804 O OE1 . GLU B 1 186 ? -13.615 56.845 94.438  1.00 52.61 ? 187  GLU B OE1 1 
ATOM   4805 O OE2 . GLU B 1 186 ? -13.486 55.955 92.411  1.00 53.93 ? 187  GLU B OE2 1 
ATOM   4806 N N   . SER B 1 187 ? -9.264  53.102 94.920  1.00 42.43 ? 188  SER B N   1 
ATOM   4807 C CA  . SER B 1 187 ? -7.885  53.087 94.439  1.00 44.63 ? 188  SER B CA  1 
ATOM   4808 C C   . SER B 1 187 ? -7.690  53.956 93.203  1.00 47.16 ? 188  SER B C   1 
ATOM   4809 O O   . SER B 1 187 ? -8.651  54.499 92.644  1.00 43.33 ? 188  SER B O   1 
ATOM   4810 C CB  . SER B 1 187 ? -7.435  51.663 94.127  1.00 49.48 ? 188  SER B CB  1 
ATOM   4811 O OG  . SER B 1 187 ? -7.240  50.926 95.318  1.00 58.66 ? 188  SER B OG  1 
ATOM   4812 N N   . ALA B 1 188 ? -6.434  54.063 92.776  1.00 51.64 ? 189  ALA B N   1 
ATOM   4813 C CA  . ALA B 1 188 ? -6.090  54.828 91.584  1.00 50.48 ? 189  ALA B CA  1 
ATOM   4814 C C   . ALA B 1 188 ? -6.886  54.326 90.376  1.00 46.77 ? 189  ALA B C   1 
ATOM   4815 O O   . ALA B 1 188 ? -7.480  55.117 89.644  1.00 47.50 ? 189  ALA B O   1 
ATOM   4816 C CB  . ALA B 1 188 ? -4.592  54.749 91.325  1.00 46.39 ? 189  ALA B CB  1 
ATOM   4817 N N   . ASP B 1 189 ? -6.922  53.004 90.206  1.00 48.81 ? 190  ASP B N   1 
ATOM   4818 C CA  . ASP B 1 189 ? -7.662  52.345 89.119  1.00 47.19 ? 190  ASP B CA  1 
ATOM   4819 C C   . ASP B 1 189 ? -9.194  52.481 89.159  1.00 43.38 ? 190  ASP B C   1 
ATOM   4820 O O   . ASP B 1 189 ? -9.879  52.064 88.227  1.00 46.86 ? 190  ASP B O   1 
ATOM   4821 C CB  . ASP B 1 189 ? -7.295  50.857 89.065  1.00 52.91 ? 190  ASP B CB  1 
ATOM   4822 C CG  . ASP B 1 189 ? -7.464  50.161 90.410  1.00 55.79 ? 190  ASP B CG  1 
ATOM   4823 O OD1 . ASP B 1 189 ? -8.204  50.684 91.271  1.00 53.22 ? 190  ASP B OD1 1 
ATOM   4824 O OD2 . ASP B 1 189 ? -6.856  49.085 90.612  1.00 60.28 ? 190  ASP B OD2 1 
ATOM   4825 N N   . GLY B 1 190 ? -9.739  53.048 90.229  1.00 39.80 ? 191  GLY B N   1 
ATOM   4826 C CA  . GLY B 1 190 ? -11.183 53.203 90.322  1.00 39.90 ? 191  GLY B CA  1 
ATOM   4827 C C   . GLY B 1 190 ? -11.896 52.049 91.019  1.00 40.55 ? 191  GLY B C   1 
ATOM   4828 O O   . GLY B 1 190 ? -13.125 52.071 91.159  1.00 36.40 ? 191  GLY B O   1 
ATOM   4829 N N   . THR B 1 191 ? -11.129 51.049 91.461  1.00 37.72 ? 192  THR B N   1 
ATOM   4830 C CA  . THR B 1 191 ? -11.683 49.956 92.255  1.00 35.00 ? 192  THR B CA  1 
ATOM   4831 C C   . THR B 1 191 ? -11.895 50.350 93.710  1.00 35.93 ? 192  THR B C   1 
ATOM   4832 O O   . THR B 1 191 ? -11.219 51.224 94.241  1.00 37.82 ? 192  THR B O   1 
ATOM   4833 C CB  . THR B 1 191 ? -10.836 48.661 92.203  1.00 30.17 ? 192  THR B CB  1 
ATOM   4834 O OG1 . THR B 1 191 ? -9.561  48.896 92.789  1.00 29.70 ? 192  THR B OG1 1 
ATOM   4835 C CG2 . THR B 1 191 ? -10.676 48.170 90.770  1.00 31.62 ? 192  THR B CG2 1 
ATOM   4836 N N   . TRP B 1 192 ? -12.844 49.675 94.342  1.00 28.15 ? 193  TRP B N   1 
ATOM   4837 C CA  . TRP B 1 192 ? -13.326 50.016 95.665  1.00 27.06 ? 193  TRP B CA  1 
ATOM   4838 C C   . TRP B 1 192 ? -12.982 48.856 96.593  1.00 26.30 ? 193  TRP B C   1 
ATOM   4839 O O   . TRP B 1 192 ? -13.462 47.725 96.411  1.00 29.86 ? 193  TRP B O   1 
ATOM   4840 C CB  . TRP B 1 192 ? -14.833 50.251 95.561  1.00 27.17 ? 193  TRP B CB  1 
ATOM   4841 C CG  . TRP B 1 192 ? -15.566 50.647 96.823  1.00 26.26 ? 193  TRP B CG  1 
ATOM   4842 C CD1 . TRP B 1 192 ? -16.719 50.097 97.290  1.00 25.98 ? 193  TRP B CD1 1 
ATOM   4843 C CD2 . TRP B 1 192 ? -15.220 51.698 97.744  1.00 30.84 ? 193  TRP B CD2 1 
ATOM   4844 N NE1 . TRP B 1 192 ? -17.112 50.730 98.444  1.00 25.47 ? 193  TRP B NE1 1 
ATOM   4845 C CE2 . TRP B 1 192 ? -16.208 51.712 98.747  1.00 25.06 ? 193  TRP B CE2 1 
ATOM   4846 C CE3 . TRP B 1 192 ? -14.182 52.630 97.810  1.00 25.72 ? 193  TRP B CE3 1 
ATOM   4847 C CZ2 . TRP B 1 192 ? -16.183 52.612 99.807  1.00 27.37 ? 193  TRP B CZ2 1 
ATOM   4848 C CZ3 . TRP B 1 192 ? -14.151 53.523 98.882  1.00 25.15 ? 193  TRP B CZ3 1 
ATOM   4849 C CH2 . TRP B 1 192 ? -15.140 53.501 99.862  1.00 27.99 ? 193  TRP B CH2 1 
ATOM   4850 N N   . ASN B 1 193 ? -12.134 49.141 97.574  1.00 25.56 ? 194  ASN B N   1 
ATOM   4851 C CA  . ASN B 1 193 ? -11.454 48.118 98.356  1.00 24.99 ? 194  ASN B CA  1 
ATOM   4852 C C   . ASN B 1 193 ? -11.728 48.190 99.837  1.00 33.24 ? 194  ASN B C   1 
ATOM   4853 O O   . ASN B 1 193 ? -11.730 49.267 100.417 1.00 29.21 ? 194  ASN B O   1 
ATOM   4854 C CB  . ASN B 1 193 ? -9.937  48.244 98.160  1.00 25.15 ? 194  ASN B CB  1 
ATOM   4855 C CG  . ASN B 1 193 ? -9.533  48.086 96.715  1.00 30.35 ? 194  ASN B CG  1 
ATOM   4856 O OD1 . ASN B 1 193 ? -9.317  46.976 96.249  1.00 37.81 ? 194  ASN B OD1 1 
ATOM   4857 N ND2 . ASN B 1 193 ? -9.469  49.194 95.986  1.00 35.23 ? 194  ASN B ND2 1 
ATOM   4858 N N   . LYS B 1 194 ? -11.938 47.035 100.459 1.00 27.52 ? 195  LYS B N   1 
ATOM   4859 C CA  . LYS B 1 194 ? -11.938 46.967 101.911 1.00 26.54 ? 195  LYS B CA  1 
ATOM   4860 C C   . LYS B 1 194 ? -11.132 45.759 102.350 1.00 26.67 ? 195  LYS B C   1 
ATOM   4861 O O   . LYS B 1 194 ? -11.039 44.759 101.638 1.00 34.34 ? 195  LYS B O   1 
ATOM   4862 C CB  . LYS B 1 194 ? -13.357 46.881 102.473 1.00 27.59 ? 195  LYS B CB  1 
ATOM   4863 C CG  . LYS B 1 194 ? -14.128 45.712 101.940 1.00 30.99 ? 195  LYS B CG  1 
ATOM   4864 C CD  . LYS B 1 194 ? -15.388 45.403 102.754 1.00 22.96 ? 195  LYS B CD  1 
ATOM   4865 C CE  . LYS B 1 194 ? -15.965 44.081 102.235 1.00 32.82 ? 195  LYS B CE  1 
ATOM   4866 N NZ  . LYS B 1 194 ? -17.304 43.804 102.750 1.00 34.34 ? 195  LYS B NZ  1 
ATOM   4867 N N   . ALA B 1 195 ? -10.530 45.863 103.519 1.00 29.83 ? 196  ALA B N   1 
ATOM   4868 C CA  . ALA B 1 195 ? -9.784  44.755 104.065 1.00 34.33 ? 196  ALA B CA  1 
ATOM   4869 C C   . ALA B 1 195 ? -10.454 44.419 105.367 1.00 37.50 ? 196  ALA B C   1 
ATOM   4870 O O   . ALA B 1 195 ? -10.825 45.320 106.122 1.00 39.08 ? 196  ALA B O   1 
ATOM   4871 C CB  . ALA B 1 195 ? -8.355  45.156 104.305 1.00 31.01 ? 196  ALA B CB  1 
ATOM   4872 N N   . GLU B 1 196 ? -10.643 43.129 105.623 1.00 34.22 ? 197  GLU B N   1 
ATOM   4873 C CA  . GLU B 1 196 ? -11.152 42.714 106.917 1.00 37.80 ? 197  GLU B CA  1 
ATOM   4874 C C   . GLU B 1 196 ? -10.290 41.621 107.509 1.00 36.90 ? 197  GLU B C   1 
ATOM   4875 O O   . GLU B 1 196 ? -9.757  40.781 106.792 1.00 36.88 ? 197  GLU B O   1 
ATOM   4876 C CB  . GLU B 1 196 ? -12.628 42.297 106.853 1.00 42.03 ? 197  GLU B CB  1 
ATOM   4877 C CG  . GLU B 1 196 ? -12.956 41.250 105.830 1.00 56.41 ? 197  GLU B CG  1 
ATOM   4878 C CD  . GLU B 1 196 ? -14.006 41.723 104.832 1.00 68.18 ? 197  GLU B CD  1 
ATOM   4879 O OE1 . GLU B 1 196 ? -13.782 41.553 103.608 1.00 73.32 ? 197  GLU B OE1 1 
ATOM   4880 O OE2 . GLU B 1 196 ? -15.048 42.270 105.269 1.00 68.20 ? 197  GLU B OE2 1 
ATOM   4881 N N   . TYR B 1 197 ? -10.145 41.665 108.828 1.00 37.88 ? 198  TYR B N   1 
ATOM   4882 C CA  . TYR B 1 197 ? -9.419  40.653 109.576 1.00 40.24 ? 198  TYR B CA  1 
ATOM   4883 C C   . TYR B 1 197 ? -10.367 39.613 110.151 1.00 39.74 ? 198  TYR B C   1 
ATOM   4884 O O   . TYR B 1 197 ? -11.057 39.878 111.133 1.00 52.49 ? 198  TYR B O   1 
ATOM   4885 C CB  . TYR B 1 197 ? -8.679  41.313 110.730 1.00 40.22 ? 198  TYR B CB  1 
ATOM   4886 C CG  . TYR B 1 197 ? -7.476  42.112 110.324 1.00 44.17 ? 198  TYR B CG  1 
ATOM   4887 C CD1 . TYR B 1 197 ? -6.327  41.480 109.854 1.00 46.53 ? 198  TYR B CD1 1 
ATOM   4888 C CD2 . TYR B 1 197 ? -7.471  43.498 110.432 1.00 50.12 ? 198  TYR B CD2 1 
ATOM   4889 C CE1 . TYR B 1 197 ? -5.212  42.205 109.494 1.00 49.53 ? 198  TYR B CE1 1 
ATOM   4890 C CE2 . TYR B 1 197 ? -6.360  44.235 110.072 1.00 55.40 ? 198  TYR B CE2 1 
ATOM   4891 C CZ  . TYR B 1 197 ? -5.231  43.583 109.606 1.00 56.48 ? 198  TYR B CZ  1 
ATOM   4892 O OH  . TYR B 1 197 ? -4.121  44.314 109.246 1.00 64.35 ? 198  TYR B OH  1 
ATOM   4893 N N   . ARG B 1 198 ? -10.396 38.427 109.558 1.00 32.69 ? 199  ARG B N   1 
ATOM   4894 C CA  . ARG B 1 198 ? -11.212 37.339 110.081 1.00 34.38 ? 199  ARG B CA  1 
ATOM   4895 C C   . ARG B 1 198 ? -10.382 36.590 111.120 1.00 34.70 ? 199  ARG B C   1 
ATOM   4896 O O   . ARG B 1 198 ? -9.160  36.618 111.062 1.00 34.11 ? 199  ARG B O   1 
ATOM   4897 C CB  . ARG B 1 198 ? -11.614 36.408 108.936 1.00 40.71 ? 199  ARG B CB  1 
ATOM   4898 C CG  . ARG B 1 198 ? -10.462 36.108 108.015 1.00 45.17 ? 199  ARG B CG  1 
ATOM   4899 C CD  . ARG B 1 198 ? -10.838 35.360 106.728 1.00 43.79 ? 199  ARG B CD  1 
ATOM   4900 N NE  . ARG B 1 198 ? -9.603  35.044 106.012 1.00 45.04 ? 199  ARG B NE  1 
ATOM   4901 C CZ  . ARG B 1 198 ? -9.516  34.502 104.801 1.00 47.89 ? 199  ARG B CZ  1 
ATOM   4902 N NH1 . ARG B 1 198 ? -10.607 34.191 104.108 1.00 42.62 ? 199  ARG B NH1 1 
ATOM   4903 N NH2 . ARG B 1 198 ? -8.316  34.268 104.282 1.00 51.30 ? 199  ARG B NH2 1 
ATOM   4904 N N   . PRO B 1 199 ? -11.036 35.912 112.073 1.00 32.96 ? 200  PRO B N   1 
ATOM   4905 C CA  . PRO B 1 199 ? -10.263 35.052 112.974 1.00 30.23 ? 200  PRO B CA  1 
ATOM   4906 C C   . PRO B 1 199 ? -9.812  33.819 112.211 1.00 39.31 ? 200  PRO B C   1 
ATOM   4907 O O   . PRO B 1 199 ? -10.199 33.651 111.055 1.00 38.28 ? 200  PRO B O   1 
ATOM   4908 C CB  . PRO B 1 199 ? -11.302 34.605 113.988 1.00 27.82 ? 200  PRO B CB  1 
ATOM   4909 C CG  . PRO B 1 199 ? -12.560 34.533 113.182 1.00 34.39 ? 200  PRO B CG  1 
ATOM   4910 C CD  . PRO B 1 199 ? -12.486 35.704 112.222 1.00 30.41 ? 200  PRO B CD  1 
ATOM   4911 N N   . LEU B 1 200 ? -9.033  32.957 112.855 1.00 38.66 ? 201  LEU B N   1 
ATOM   4912 C CA  . LEU B 1 200 ? -8.687  31.677 112.265 1.00 33.38 ? 201  LEU B CA  1 
ATOM   4913 C C   . LEU B 1 200 ? -9.971  30.902 112.120 1.00 34.56 ? 201  LEU B C   1 
ATOM   4914 O O   . LEU B 1 200 ? -10.914 31.096 112.890 1.00 38.04 ? 201  LEU B O   1 
ATOM   4915 C CB  . LEU B 1 200 ? -7.704  30.914 113.145 1.00 36.75 ? 201  LEU B CB  1 
ATOM   4916 C CG  . LEU B 1 200 ? -6.438  31.675 113.566 1.00 38.36 ? 201  LEU B CG  1 
ATOM   4917 C CD1 . LEU B 1 200 ? -5.485  30.745 114.309 1.00 41.69 ? 201  LEU B CD1 1 
ATOM   4918 C CD2 . LEU B 1 200 ? -5.741  32.333 112.376 1.00 34.13 ? 201  LEU B CD2 1 
ATOM   4919 N N   . GLU B 1 201 ? -10.033 30.037 111.121 1.00 34.38 ? 202  GLU B N   1 
ATOM   4920 C CA  . GLU B 1 201 ? -11.268 29.307 110.878 1.00 38.34 ? 202  GLU B CA  1 
ATOM   4921 C C   . GLU B 1 201 ? -11.422 28.165 111.873 1.00 41.58 ? 202  GLU B C   1 
ATOM   4922 O O   . GLU B 1 201 ? -12.540 27.825 112.268 1.00 47.28 ? 202  GLU B O   1 
ATOM   4923 C CB  . GLU B 1 201 ? -11.326 28.793 109.435 1.00 45.03 ? 202  GLU B CB  1 
ATOM   4924 C CG  . GLU B 1 201 ? -12.651 28.141 109.064 1.00 54.03 ? 202  GLU B CG  1 
ATOM   4925 C CD  . GLU B 1 201 ? -12.705 27.681 107.613 1.00 58.00 ? 202  GLU B CD  1 
ATOM   4926 O OE1 . GLU B 1 201 ? -11.674 27.782 106.910 1.00 52.82 ? 202  GLU B OE1 1 
ATOM   4927 O OE2 . GLU B 1 201 ? -13.784 27.215 107.178 1.00 62.76 ? 202  GLU B OE2 1 
ATOM   4928 N N   . GLY B 1 202 ? -10.299 27.573 112.277 1.00 33.99 ? 203  GLY B N   1 
ATOM   4929 C CA  . GLY B 1 202 ? -10.323 26.506 113.264 1.00 31.67 ? 203  GLY B CA  1 
ATOM   4930 C C   . GLY B 1 202 ? -10.203 27.046 114.680 1.00 36.30 ? 203  GLY B C   1 
ATOM   4931 O O   . GLY B 1 202 ? -9.964  28.241 114.872 1.00 30.50 ? 203  GLY B O   1 
ATOM   4932 N N   . PHE B 1 203 ? -10.356 26.174 115.675 1.00 36.20 ? 204  PHE B N   1 
ATOM   4933 C CA  . PHE B 1 203 ? -10.317 26.613 117.068 1.00 37.56 ? 204  PHE B CA  1 
ATOM   4934 C C   . PHE B 1 203 ? -8.891  26.680 117.620 1.00 40.28 ? 204  PHE B C   1 
ATOM   4935 O O   . PHE B 1 203 ? -7.987  25.975 117.149 1.00 39.51 ? 204  PHE B O   1 
ATOM   4936 C CB  . PHE B 1 203 ? -11.174 25.705 117.962 1.00 32.92 ? 204  PHE B CB  1 
ATOM   4937 C CG  . PHE B 1 203 ? -10.599 24.332 118.162 1.00 37.44 ? 204  PHE B CG  1 
ATOM   4938 C CD1 . PHE B 1 203 ? -9.697  24.080 119.187 1.00 37.90 ? 204  PHE B CD1 1 
ATOM   4939 C CD2 . PHE B 1 203 ? -10.963 23.288 117.330 1.00 35.70 ? 204  PHE B CD2 1 
ATOM   4940 C CE1 . PHE B 1 203 ? -9.164  22.819 119.368 1.00 38.53 ? 204  PHE B CE1 1 
ATOM   4941 C CE2 . PHE B 1 203 ? -10.438 22.028 117.513 1.00 39.33 ? 204  PHE B CE2 1 
ATOM   4942 C CZ  . PHE B 1 203 ? -9.539  21.792 118.530 1.00 41.67 ? 204  PHE B CZ  1 
ATOM   4943 N N   . VAL B 1 204 ? -8.719  27.518 118.640 1.00 34.24 ? 205  VAL B N   1 
ATOM   4944 C CA  . VAL B 1 204 ? -7.445  27.689 119.320 1.00 31.97 ? 205  VAL B CA  1 
ATOM   4945 C C   . VAL B 1 204 ? -7.376  26.862 120.600 1.00 33.92 ? 205  VAL B C   1 
ATOM   4946 O O   . VAL B 1 204 ? -8.311  26.858 121.417 1.00 39.27 ? 205  VAL B O   1 
ATOM   4947 C CB  . VAL B 1 204 ? -7.230  29.159 119.703 1.00 28.37 ? 205  VAL B CB  1 
ATOM   4948 C CG1 . VAL B 1 204 ? -5.881  29.332 120.401 1.00 29.23 ? 205  VAL B CG1 1 
ATOM   4949 C CG2 . VAL B 1 204 ? -7.338  30.043 118.478 1.00 27.53 ? 205  VAL B CG2 1 
ATOM   4950 N N   . TYR B 1 205 ? -6.265  26.161 120.771 1.00 32.73 ? 206  TYR B N   1 
ATOM   4951 C CA  . TYR B 1 205 ? -6.014  25.382 121.979 1.00 33.73 ? 206  TYR B CA  1 
ATOM   4952 C C   . TYR B 1 205 ? -5.006  26.163 122.803 1.00 33.99 ? 206  TYR B C   1 
ATOM   4953 O O   . TYR B 1 205 ? -3.879  26.389 122.360 1.00 29.54 ? 206  TYR B O   1 
ATOM   4954 C CB  . TYR B 1 205 ? -5.448  24.020 121.595 1.00 37.00 ? 206  TYR B CB  1 
ATOM   4955 C CG  . TYR B 1 205 ? -5.090  23.074 122.733 1.00 39.42 ? 206  TYR B CG  1 
ATOM   4956 C CD1 . TYR B 1 205 ? -5.743  23.125 123.967 1.00 36.19 ? 206  TYR B CD1 1 
ATOM   4957 C CD2 . TYR B 1 205 ? -4.096  22.114 122.559 1.00 39.22 ? 206  TYR B CD2 1 
ATOM   4958 C CE1 . TYR B 1 205 ? -5.408  22.240 124.996 1.00 35.45 ? 206  TYR B CE1 1 
ATOM   4959 C CE2 . TYR B 1 205 ? -3.757  21.233 123.572 1.00 39.98 ? 206  TYR B CE2 1 
ATOM   4960 C CZ  . TYR B 1 205 ? -4.412  21.294 124.784 1.00 40.29 ? 206  TYR B CZ  1 
ATOM   4961 O OH  . TYR B 1 205 ? -4.047  20.407 125.774 1.00 40.52 ? 206  TYR B OH  1 
ATOM   4962 N N   . ALA B 1 206 ? -5.419  26.606 123.985 1.00 32.29 ? 207  ALA B N   1 
ATOM   4963 C CA  . ALA B 1 206 ? -4.528  27.372 124.850 1.00 29.74 ? 207  ALA B CA  1 
ATOM   4964 C C   . ALA B 1 206 ? -3.964  26.497 125.977 1.00 31.45 ? 207  ALA B C   1 
ATOM   4965 O O   . ALA B 1 206 ? -4.719  25.916 126.758 1.00 30.96 ? 207  ALA B O   1 
ATOM   4966 C CB  . ALA B 1 206 ? -5.252  28.573 125.415 1.00 28.29 ? 207  ALA B CB  1 
ATOM   4967 N N   . VAL B 1 207 ? -2.636  26.405 126.042 1.00 31.45 ? 208  VAL B N   1 
ATOM   4968 C CA  . VAL B 1 207 ? -1.961  25.618 127.063 1.00 30.52 ? 208  VAL B CA  1 
ATOM   4969 C C   . VAL B 1 207 ? -1.098  26.544 127.913 1.00 29.93 ? 208  VAL B C   1 
ATOM   4970 O O   . VAL B 1 207 ? -0.065  27.036 127.458 1.00 29.04 ? 208  VAL B O   1 
ATOM   4971 C CB  . VAL B 1 207 ? -1.105  24.509 126.433 1.00 32.47 ? 208  VAL B CB  1 
ATOM   4972 C CG1 . VAL B 1 207 ? -0.283  23.821 127.487 1.00 35.13 ? 208  VAL B CG1 1 
ATOM   4973 C CG2 . VAL B 1 207 ? -1.991  23.499 125.699 1.00 32.74 ? 208  VAL B CG2 1 
ATOM   4974 N N   . SER B 1 208 ? -1.536  26.775 129.149 1.00 32.61 ? 209  SER B N   1 
ATOM   4975 C CA  . SER B 1 208 ? -0.986  27.835 129.994 1.00 30.06 ? 209  SER B CA  1 
ATOM   4976 C C   . SER B 1 208 ? -0.120  27.286 131.133 1.00 38.05 ? 209  SER B C   1 
ATOM   4977 O O   . SER B 1 208 ? -0.389  26.212 131.660 1.00 32.26 ? 209  SER B O   1 
ATOM   4978 C CB  . SER B 1 208 ? -2.106  28.726 130.545 1.00 30.05 ? 209  SER B CB  1 
ATOM   4979 O OG  . SER B 1 208 ? -3.013  28.006 131.364 1.00 31.42 ? 209  SER B OG  1 
ATOM   4980 N N   . PRO B 1 209 ? 0.928   28.031 131.511 1.00 30.39 ? 210  PRO B N   1 
ATOM   4981 C CA  . PRO B 1 209 ? 1.868   27.575 132.537 1.00 33.49 ? 210  PRO B CA  1 
ATOM   4982 C C   . PRO B 1 209 ? 1.387   27.953 133.946 1.00 35.43 ? 210  PRO B C   1 
ATOM   4983 O O   . PRO B 1 209 ? 0.409   28.696 134.076 1.00 33.58 ? 210  PRO B O   1 
ATOM   4984 C CB  . PRO B 1 209 ? 3.139   28.336 132.176 1.00 30.12 ? 210  PRO B CB  1 
ATOM   4985 C CG  . PRO B 1 209 ? 2.606   29.671 131.689 1.00 32.56 ? 210  PRO B CG  1 
ATOM   4986 C CD  . PRO B 1 209 ? 1.298   29.355 130.978 1.00 33.72 ? 210  PRO B CD  1 
ATOM   4987 N N   . PHE B 1 210 ? 2.053   27.437 134.979 1.00 33.10 ? 211  PHE B N   1 
ATOM   4988 C CA  . PHE B 1 210 ? 1.676   27.735 136.362 1.00 34.13 ? 211  PHE B CA  1 
ATOM   4989 C C   . PHE B 1 210 ? 2.129   29.115 136.811 1.00 36.39 ? 211  PHE B C   1 
ATOM   4990 O O   . PHE B 1 210 ? 1.525   29.709 137.704 1.00 34.69 ? 211  PHE B O   1 
ATOM   4991 C CB  . PHE B 1 210 ? 2.305   26.718 137.319 1.00 35.92 ? 211  PHE B CB  1 
ATOM   4992 C CG  . PHE B 1 210 ? 3.786   26.938 137.561 1.00 35.24 ? 211  PHE B CG  1 
ATOM   4993 C CD1 . PHE B 1 210 ? 4.228   27.715 138.619 1.00 35.54 ? 211  PHE B CD1 1 
ATOM   4994 C CD2 . PHE B 1 210 ? 4.730   26.358 136.731 1.00 36.62 ? 211  PHE B CD2 1 
ATOM   4995 C CE1 . PHE B 1 210 ? 5.582   27.918 138.836 1.00 38.25 ? 211  PHE B CE1 1 
ATOM   4996 C CE2 . PHE B 1 210 ? 6.089   26.549 136.946 1.00 34.47 ? 211  PHE B CE2 1 
ATOM   4997 C CZ  . PHE B 1 210 ? 6.513   27.336 137.999 1.00 35.25 ? 211  PHE B CZ  1 
ATOM   4998 N N   . ASN B 1 211 ? 3.222   29.607 136.235 1.00 32.33 ? 212  ASN B N   1 
ATOM   4999 C CA  . ASN B 1 211 ? 3.965   30.686 136.890 1.00 37.53 ? 212  ASN B CA  1 
ATOM   5000 C C   . ASN B 1 211 ? 3.332   32.083 136.928 1.00 35.46 ? 212  ASN B C   1 
ATOM   5001 O O   . ASN B 1 211 ? 3.568   32.847 137.861 1.00 37.62 ? 212  ASN B O   1 
ATOM   5002 C CB  . ASN B 1 211 ? 5.438   30.724 136.455 1.00 38.26 ? 212  ASN B CB  1 
ATOM   5003 C CG  . ASN B 1 211 ? 5.632   31.161 135.020 1.00 35.17 ? 212  ASN B CG  1 
ATOM   5004 O OD1 . ASN B 1 211 ? 4.735   31.054 134.183 1.00 38.38 ? 212  ASN B OD1 1 
ATOM   5005 N ND2 . ASN B 1 211 ? 6.830   31.645 134.724 1.00 31.13 ? 212  ASN B ND2 1 
ATOM   5006 N N   . PHE B 1 212 ? 2.524   32.413 135.936 1.00 30.55 ? 213  PHE B N   1 
ATOM   5007 C CA  . PHE B 1 212 ? 1.825   33.689 135.962 1.00 37.11 ? 213  PHE B CA  1 
ATOM   5008 C C   . PHE B 1 212 ? 0.370   33.520 135.597 1.00 32.06 ? 213  PHE B C   1 
ATOM   5009 O O   . PHE B 1 212 ? 0.050   33.041 134.519 1.00 34.19 ? 213  PHE B O   1 
ATOM   5010 C CB  . PHE B 1 212 ? 2.484   34.707 135.023 1.00 36.88 ? 213  PHE B CB  1 
ATOM   5011 C CG  . PHE B 1 212 ? 3.755   35.293 135.574 1.00 42.17 ? 213  PHE B CG  1 
ATOM   5012 C CD1 . PHE B 1 212 ? 4.956   34.609 135.458 1.00 41.62 ? 213  PHE B CD1 1 
ATOM   5013 C CD2 . PHE B 1 212 ? 3.742   36.519 136.225 1.00 37.86 ? 213  PHE B CD2 1 
ATOM   5014 C CE1 . PHE B 1 212 ? 6.120   35.136 135.977 1.00 45.42 ? 213  PHE B CE1 1 
ATOM   5015 C CE2 . PHE B 1 212 ? 4.904   37.057 136.739 1.00 41.65 ? 213  PHE B CE2 1 
ATOM   5016 C CZ  . PHE B 1 212 ? 6.099   36.360 136.618 1.00 45.64 ? 213  PHE B CZ  1 
ATOM   5017 N N   . THR B 1 213 ? -0.506  33.914 136.512 1.00 30.98 ? 214  THR B N   1 
ATOM   5018 C CA  . THR B 1 213 ? -1.920  33.991 136.211 1.00 32.95 ? 214  THR B CA  1 
ATOM   5019 C C   . THR B 1 213 ? -2.143  34.868 134.966 1.00 35.63 ? 214  THR B C   1 
ATOM   5020 O O   . THR B 1 213 ? -3.003  34.559 134.143 1.00 34.59 ? 214  THR B O   1 
ATOM   5021 C CB  . THR B 1 213 ? -2.693  34.551 137.411 1.00 37.39 ? 214  THR B CB  1 
ATOM   5022 O OG1 . THR B 1 213 ? -2.350  33.797 138.582 1.00 39.22 ? 214  THR B OG1 1 
ATOM   5023 C CG2 . THR B 1 213 ? -4.211  34.488 137.174 1.00 32.39 ? 214  THR B CG2 1 
ATOM   5024 N N   . ALA B 1 214 ? -1.346  35.930 134.817 1.00 32.25 ? 215  ALA B N   1 
ATOM   5025 C CA  . ALA B 1 214 ? -1.522  36.880 133.711 1.00 31.59 ? 215  ALA B CA  1 
ATOM   5026 C C   . ALA B 1 214 ? -1.218  36.263 132.351 1.00 31.40 ? 215  ALA B C   1 
ATOM   5027 O O   . ALA B 1 214 ? -1.757  36.691 131.333 1.00 31.69 ? 215  ALA B O   1 
ATOM   5028 C CB  . ALA B 1 214 ? -0.672  38.150 133.922 1.00 29.96 ? 215  ALA B CB  1 
ATOM   5029 N N   . ILE B 1 215 ? -0.361  35.253 132.331 1.00 31.01 ? 216  ILE B N   1 
ATOM   5030 C CA  . ILE B 1 215 ? -0.014  34.607 131.067 1.00 28.94 ? 216  ILE B CA  1 
ATOM   5031 C C   . ILE B 1 215 ? -1.174  33.745 130.593 1.00 28.47 ? 216  ILE B C   1 
ATOM   5032 O O   . ILE B 1 215 ? -1.461  33.676 129.400 1.00 30.62 ? 216  ILE B O   1 
ATOM   5033 C CB  . ILE B 1 215 ? 1.282   33.785 131.184 1.00 26.55 ? 216  ILE B CB  1 
ATOM   5034 C CG1 . ILE B 1 215 ? 2.486   34.724 131.221 1.00 30.15 ? 216  ILE B CG1 1 
ATOM   5035 C CG2 . ILE B 1 215 ? 1.437   32.826 130.006 1.00 26.29 ? 216  ILE B CG2 1 
ATOM   5036 C CD1 . ILE B 1 215 ? 3.783   34.019 131.615 1.00 38.36 ? 216  ILE B CD1 1 
ATOM   5037 N N   . ALA B 1 216 ? -1.846  33.096 131.536 1.00 27.82 ? 217  ALA B N   1 
ATOM   5038 C CA  . ALA B 1 216 ? -3.088  32.399 131.235 1.00 33.52 ? 217  ALA B CA  1 
ATOM   5039 C C   . ALA B 1 216 ? -4.109  33.354 130.589 1.00 32.92 ? 217  ALA B C   1 
ATOM   5040 O O   . ALA B 1 216 ? -4.737  33.015 129.587 1.00 36.89 ? 217  ALA B O   1 
ATOM   5041 C CB  . ALA B 1 216 ? -3.672  31.763 132.509 1.00 33.59 ? 217  ALA B CB  1 
ATOM   5042 N N   . ALA B 1 217 ? -4.261  34.547 131.160 1.00 32.94 ? 218  ALA B N   1 
ATOM   5043 C CA  . ALA B 1 217 ? -5.162  35.555 130.596 1.00 31.98 ? 218  ALA B CA  1 
ATOM   5044 C C   . ALA B 1 217 ? -4.707  35.945 129.198 1.00 35.14 ? 218  ALA B C   1 
ATOM   5045 O O   . ALA B 1 217 ? -5.519  36.101 128.282 1.00 34.37 ? 218  ALA B O   1 
ATOM   5046 C CB  . ALA B 1 217 ? -5.221  36.784 131.492 1.00 27.94 ? 218  ALA B CB  1 
ATOM   5047 N N   . ASN B 1 218 ? -3.399  36.095 129.037 1.00 33.32 ? 219  ASN B N   1 
ATOM   5048 C CA  . ASN B 1 218 ? -2.846  36.412 127.733 1.00 31.14 ? 219  ASN B CA  1 
ATOM   5049 C C   . ASN B 1 218 ? -3.144  35.322 126.715 1.00 31.17 ? 219  ASN B C   1 
ATOM   5050 O O   . ASN B 1 218 ? -3.556  35.606 125.593 1.00 31.21 ? 219  ASN B O   1 
ATOM   5051 C CB  . ASN B 1 218 ? -1.341  36.636 127.824 1.00 30.41 ? 219  ASN B CB  1 
ATOM   5052 C CG  . ASN B 1 218 ? -0.698  36.812 126.463 1.00 38.82 ? 219  ASN B CG  1 
ATOM   5053 O OD1 . ASN B 1 218 ? -1.069  37.701 125.709 1.00 40.36 ? 219  ASN B OD1 1 
ATOM   5054 N ND2 . ASN B 1 218 ? 0.280   35.976 126.150 1.00 40.42 ? 219  ASN B ND2 1 
ATOM   5055 N N   . LEU B 1 219 ? -2.935  34.072 127.109 1.00 30.97 ? 220  LEU B N   1 
ATOM   5056 C CA  . LEU B 1 219 ? -3.061  32.962 126.174 1.00 30.39 ? 220  LEU B CA  1 
ATOM   5057 C C   . LEU B 1 219 ? -4.491  32.780 125.672 1.00 30.34 ? 220  LEU B C   1 
ATOM   5058 O O   . LEU B 1 219 ? -4.705  32.448 124.504 1.00 32.34 ? 220  LEU B O   1 
ATOM   5059 C CB  . LEU B 1 219 ? -2.535  31.664 126.797 1.00 32.23 ? 220  LEU B CB  1 
ATOM   5060 C CG  . LEU B 1 219 ? -1.023  31.687 127.041 1.00 34.16 ? 220  LEU B CG  1 
ATOM   5061 C CD1 . LEU B 1 219 ? -0.589  30.468 127.818 1.00 32.65 ? 220  LEU B CD1 1 
ATOM   5062 C CD2 . LEU B 1 219 ? -0.245  31.804 125.732 1.00 30.84 ? 220  LEU B CD2 1 
ATOM   5063 N N   . ILE B 1 220 ? -5.467  32.998 126.547 1.00 30.62 ? 221  ILE B N   1 
ATOM   5064 C CA  . ILE B 1 220 ? -6.865  32.852 126.138 1.00 33.02 ? 221  ILE B CA  1 
ATOM   5065 C C   . ILE B 1 220 ? -7.450  34.146 125.539 1.00 34.70 ? 221  ILE B C   1 
ATOM   5066 O O   . ILE B 1 220 ? -8.255  34.092 124.614 1.00 32.44 ? 221  ILE B O   1 
ATOM   5067 C CB  . ILE B 1 220 ? -7.763  32.346 127.291 1.00 36.11 ? 221  ILE B CB  1 
ATOM   5068 C CG1 . ILE B 1 220 ? -7.838  33.389 128.415 1.00 34.79 ? 221  ILE B CG1 1 
ATOM   5069 C CG2 . ILE B 1 220 ? -7.272  30.968 127.817 1.00 28.42 ? 221  ILE B CG2 1 
ATOM   5070 C CD1 . ILE B 1 220 ? -8.746  32.994 129.577 1.00 32.22 ? 221  ILE B CD1 1 
ATOM   5071 N N   . GLY B 1 221 ? -7.031  35.300 126.056 1.00 29.58 ? 222  GLY B N   1 
ATOM   5072 C CA  . GLY B 1 221 ? -7.660  36.563 125.707 1.00 28.73 ? 222  GLY B CA  1 
ATOM   5073 C C   . GLY B 1 221 ? -7.244  37.143 124.371 1.00 30.47 ? 222  GLY B C   1 
ATOM   5074 O O   . GLY B 1 221 ? -8.062  37.738 123.676 1.00 33.52 ? 222  GLY B O   1 
ATOM   5075 N N   . ALA B 1 222 ? -5.975  36.987 124.012 1.00 31.41 ? 223  ALA B N   1 
ATOM   5076 C CA  . ALA B 1 222 ? -5.503  37.455 122.716 1.00 32.16 ? 223  ALA B CA  1 
ATOM   5077 C C   . ALA B 1 222 ? -6.287  36.811 121.567 1.00 36.08 ? 223  ALA B C   1 
ATOM   5078 O O   . ALA B 1 222 ? -6.899  37.534 120.785 1.00 34.24 ? 223  ALA B O   1 
ATOM   5079 C CB  . ALA B 1 222 ? -3.985  37.253 122.547 1.00 21.82 ? 223  ALA B CB  1 
ATOM   5080 N N   . PRO B 1 223 ? -6.300  35.459 121.475 1.00 34.75 ? 224  PRO B N   1 
ATOM   5081 C CA  . PRO B 1 223 ? -7.097  34.893 120.381 1.00 32.82 ? 224  PRO B CA  1 
ATOM   5082 C C   . PRO B 1 223 ? -8.595  35.179 120.510 1.00 34.77 ? 224  PRO B C   1 
ATOM   5083 O O   . PRO B 1 223 ? -9.233  35.450 119.490 1.00 36.78 ? 224  PRO B O   1 
ATOM   5084 C CB  . PRO B 1 223 ? -6.837  33.386 120.502 1.00 30.47 ? 224  PRO B CB  1 
ATOM   5085 C CG  . PRO B 1 223 ? -6.501  33.187 121.939 1.00 28.78 ? 224  PRO B CG  1 
ATOM   5086 C CD  . PRO B 1 223 ? -5.694  34.392 122.297 1.00 27.63 ? 224  PRO B CD  1 
ATOM   5087 N N   . ALA B 1 224 ? -9.146  35.134 121.723 1.00 29.81 ? 225  ALA B N   1 
ATOM   5088 C CA  . ALA B 1 224 ? -10.587 35.319 121.876 1.00 32.30 ? 225  ALA B CA  1 
ATOM   5089 C C   . ALA B 1 224 ? -11.033 36.721 121.461 1.00 34.98 ? 225  ALA B C   1 
ATOM   5090 O O   . ALA B 1 224 ? -12.107 36.888 120.883 1.00 34.23 ? 225  ALA B O   1 
ATOM   5091 C CB  . ALA B 1 224 ? -11.042 35.009 123.283 1.00 27.91 ? 225  ALA B CB  1 
ATOM   5092 N N   . LEU B 1 225 ? -10.197 37.716 121.738 1.00 28.65 ? 226  LEU B N   1 
ATOM   5093 C CA  . LEU B 1 225 ? -10.539 39.089 121.417 1.00 28.50 ? 226  LEU B CA  1 
ATOM   5094 C C   . LEU B 1 225 ? -10.679 39.245 119.907 1.00 36.11 ? 226  LEU B C   1 
ATOM   5095 O O   . LEU B 1 225 ? -11.485 40.047 119.421 1.00 34.17 ? 226  LEU B O   1 
ATOM   5096 C CB  . LEU B 1 225 ? -9.471  40.045 121.944 1.00 28.89 ? 226  LEU B CB  1 
ATOM   5097 C CG  . LEU B 1 225 ? -9.851  41.520 122.002 1.00 38.98 ? 226  LEU B CG  1 
ATOM   5098 C CD1 . LEU B 1 225 ? -10.945 41.751 123.033 1.00 40.80 ? 226  LEU B CD1 1 
ATOM   5099 C CD2 . LEU B 1 225 ? -8.629  42.359 122.314 1.00 41.06 ? 226  LEU B CD2 1 
ATOM   5100 N N   . MET B 1 226 ? -9.894  38.473 119.162 1.00 32.38 ? 227  MET B N   1 
ATOM   5101 C CA  . MET B 1 226 ? -9.899  38.599 117.713 1.00 27.85 ? 227  MET B CA  1 
ATOM   5102 C C   . MET B 1 226 ? -10.982 37.749 117.064 1.00 29.98 ? 227  MET B C   1 
ATOM   5103 O O   . MET B 1 226 ? -11.003 37.599 115.845 1.00 33.18 ? 227  MET B O   1 
ATOM   5104 C CB  . MET B 1 226 ? -8.525  38.265 117.139 1.00 27.91 ? 227  MET B CB  1 
ATOM   5105 C CG  . MET B 1 226 ? -7.394  39.066 117.791 1.00 27.60 ? 227  MET B CG  1 
ATOM   5106 S SD  . MET B 1 226 ? -7.721  40.852 117.817 1.00 30.69 ? 227  MET B SD  1 
ATOM   5107 C CE  . MET B 1 226 ? -7.465  41.269 116.088 1.00 26.83 ? 227  MET B CE  1 
ATOM   5108 N N   . GLY B 1 227 ? -11.876 37.192 117.876 1.00 25.23 ? 228  GLY B N   1 
ATOM   5109 C CA  . GLY B 1 227 ? -13.017 36.460 117.354 1.00 23.18 ? 228  GLY B CA  1 
ATOM   5110 C C   . GLY B 1 227 ? -12.811 34.961 117.270 1.00 37.67 ? 228  GLY B C   1 
ATOM   5111 O O   . GLY B 1 227 ? -13.595 34.250 116.640 1.00 34.92 ? 228  GLY B O   1 
ATOM   5112 N N   . ASN B 1 228 ? -11.753 34.473 117.908 1.00 32.65 ? 229  ASN B N   1 
ATOM   5113 C CA  . ASN B 1 228 ? -11.511 33.043 117.973 1.00 28.08 ? 229  ASN B CA  1 
ATOM   5114 C C   . ASN B 1 228 ? -12.195 32.476 119.182 1.00 28.39 ? 229  ASN B C   1 
ATOM   5115 O O   . ASN B 1 228 ? -12.490 33.209 120.123 1.00 30.85 ? 229  ASN B O   1 
ATOM   5116 C CB  . ASN B 1 228 ? -10.015 32.743 118.044 1.00 26.60 ? 229  ASN B CB  1 
ATOM   5117 C CG  . ASN B 1 228 ? -9.282  33.243 116.843 1.00 31.25 ? 229  ASN B CG  1 
ATOM   5118 O OD1 . ASN B 1 228 ? -9.265  32.591 115.797 1.00 35.50 ? 229  ASN B OD1 1 
ATOM   5119 N ND2 . ASN B 1 228 ? -8.686  34.423 116.965 1.00 26.50 ? 229  ASN B ND2 1 
ATOM   5120 N N   . THR B 1 229 ? -12.471 31.179 119.146 1.00 27.44 ? 230  THR B N   1 
ATOM   5121 C CA  . THR B 1 229 ? -12.961 30.478 120.324 1.00 29.91 ? 230  THR B CA  1 
ATOM   5122 C C   . THR B 1 229 ? -11.884 29.487 120.770 1.00 36.62 ? 230  THR B C   1 
ATOM   5123 O O   . THR B 1 229 ? -11.015 29.095 119.980 1.00 33.18 ? 230  THR B O   1 
ATOM   5124 C CB  . THR B 1 229 ? -14.325 29.777 120.088 1.00 34.86 ? 230  THR B CB  1 
ATOM   5125 O OG1 . THR B 1 229 ? -14.214 28.833 119.017 1.00 36.08 ? 230  THR B OG1 1 
ATOM   5126 C CG2 . THR B 1 229 ? -15.401 30.806 119.744 1.00 37.39 ? 230  THR B CG2 1 
ATOM   5127 N N   . VAL B 1 230 ? -11.934 29.092 122.038 1.00 35.43 ? 231  VAL B N   1 
ATOM   5128 C CA  . VAL B 1 230 ? -10.764 28.524 122.684 1.00 36.90 ? 231  VAL B CA  1 
ATOM   5129 C C   . VAL B 1 230 ? -11.108 27.336 123.568 1.00 43.15 ? 231  VAL B C   1 
ATOM   5130 O O   . VAL B 1 230 ? -12.091 27.375 124.323 1.00 45.03 ? 231  VAL B O   1 
ATOM   5131 C CB  . VAL B 1 230 ? -10.049 29.596 123.561 1.00 32.55 ? 231  VAL B CB  1 
ATOM   5132 C CG1 . VAL B 1 230 ? -8.785  29.035 124.172 1.00 33.66 ? 231  VAL B CG1 1 
ATOM   5133 C CG2 . VAL B 1 230 ? -9.731  30.871 122.748 1.00 26.96 ? 231  VAL B CG2 1 
ATOM   5134 N N   . VAL B 1 231 ? -10.315 26.270 123.454 1.00 41.15 ? 232  VAL B N   1 
ATOM   5135 C CA  . VAL B 1 231 ? -10.290 25.232 124.474 1.00 35.74 ? 232  VAL B CA  1 
ATOM   5136 C C   . VAL B 1 231 ? -9.002  25.417 125.272 1.00 34.91 ? 232  VAL B C   1 
ATOM   5137 O O   . VAL B 1 231 ? -7.910  25.521 124.714 1.00 33.09 ? 232  VAL B O   1 
ATOM   5138 C CB  . VAL B 1 231 ? -10.405 23.796 123.902 1.00 41.84 ? 232  VAL B CB  1 
ATOM   5139 C CG1 . VAL B 1 231 ? -11.773 23.581 123.293 1.00 44.65 ? 232  VAL B CG1 1 
ATOM   5140 C CG2 . VAL B 1 231 ? -9.311  23.518 122.891 1.00 42.63 ? 232  VAL B CG2 1 
ATOM   5141 N N   . TRP B 1 232 ? -9.146  25.483 126.587 1.00 32.94 ? 233  TRP B N   1 
ATOM   5142 C CA  . TRP B 1 232 ? -8.074  25.949 127.444 1.00 36.30 ? 233  TRP B CA  1 
ATOM   5143 C C   . TRP B 1 232 ? -7.793  24.940 128.545 1.00 37.11 ? 233  TRP B C   1 
ATOM   5144 O O   . TRP B 1 232 ? -8.667  24.669 129.365 1.00 35.16 ? 233  TRP B O   1 
ATOM   5145 C CB  . TRP B 1 232 ? -8.484  27.291 128.056 1.00 37.71 ? 233  TRP B CB  1 
ATOM   5146 C CG  . TRP B 1 232 ? -7.583  27.797 129.142 1.00 38.88 ? 233  TRP B CG  1 
ATOM   5147 C CD1 . TRP B 1 232 ? -6.241  27.572 129.275 1.00 31.50 ? 233  TRP B CD1 1 
ATOM   5148 C CD2 . TRP B 1 232 ? -7.967  28.612 130.258 1.00 36.11 ? 233  TRP B CD2 1 
ATOM   5149 N NE1 . TRP B 1 232 ? -5.767  28.204 130.396 1.00 31.54 ? 233  TRP B NE1 1 
ATOM   5150 C CE2 . TRP B 1 232 ? -6.802  28.853 131.017 1.00 35.34 ? 233  TRP B CE2 1 
ATOM   5151 C CE3 . TRP B 1 232 ? -9.175  29.183 130.675 1.00 32.65 ? 233  TRP B CE3 1 
ATOM   5152 C CZ2 . TRP B 1 232 ? -6.813  29.629 132.177 1.00 36.83 ? 233  TRP B CZ2 1 
ATOM   5153 C CZ3 . TRP B 1 232 ? -9.186  29.955 131.831 1.00 34.58 ? 233  TRP B CZ3 1 
ATOM   5154 C CH2 . TRP B 1 232 ? -8.014  30.164 132.569 1.00 39.41 ? 233  TRP B CH2 1 
ATOM   5155 N N   . LYS B 1 233 ? -6.576  24.394 128.558 1.00 34.04 ? 234  LYS B N   1 
ATOM   5156 C CA  . LYS B 1 233 ? -6.140  23.515 129.638 1.00 39.56 ? 234  LYS B CA  1 
ATOM   5157 C C   . LYS B 1 233 ? -5.120  24.220 130.527 1.00 34.88 ? 234  LYS B C   1 
ATOM   5158 O O   . LYS B 1 233 ? -3.956  24.315 130.182 1.00 39.79 ? 234  LYS B O   1 
ATOM   5159 C CB  . LYS B 1 233 ? -5.528  22.228 129.084 1.00 40.91 ? 234  LYS B CB  1 
ATOM   5160 C CG  . LYS B 1 233 ? -5.228  21.184 130.151 1.00 40.62 ? 234  LYS B CG  1 
ATOM   5161 C CD  . LYS B 1 233 ? -4.096  20.237 129.732 1.00 43.70 ? 234  LYS B CD  1 
ATOM   5162 C CE  . LYS B 1 233 ? -2.763  20.973 129.595 1.00 42.28 ? 234  LYS B CE  1 
ATOM   5163 N NZ  . LYS B 1 233 ? -2.360  21.629 130.868 1.00 36.65 ? 234  LYS B NZ  1 
ATOM   5164 N N   . PRO B 1 234 ? -5.557  24.705 131.688 1.00 37.90 ? 235  PRO B N   1 
ATOM   5165 C CA  . PRO B 1 234 ? -4.637  25.415 132.578 1.00 40.04 ? 235  PRO B CA  1 
ATOM   5166 C C   . PRO B 1 234 ? -3.631  24.454 133.201 1.00 42.52 ? 235  PRO B C   1 
ATOM   5167 O O   . PRO B 1 234 ? -3.836  23.241 133.176 1.00 37.25 ? 235  PRO B O   1 
ATOM   5168 C CB  . PRO B 1 234 ? -5.563  25.935 133.667 1.00 43.18 ? 235  PRO B CB  1 
ATOM   5169 C CG  . PRO B 1 234 ? -6.599  24.815 133.782 1.00 43.50 ? 235  PRO B CG  1 
ATOM   5170 C CD  . PRO B 1 234 ? -6.854  24.428 132.337 1.00 39.97 ? 235  PRO B CD  1 
ATOM   5171 N N   . SER B 1 235 ? -2.549  25.002 133.744 1.00 41.00 ? 236  SER B N   1 
ATOM   5172 C CA  . SER B 1 235 ? -1.609  24.213 134.526 1.00 42.66 ? 236  SER B CA  1 
ATOM   5173 C C   . SER B 1 235 ? -2.323  23.631 135.741 1.00 41.37 ? 236  SER B C   1 
ATOM   5174 O O   . SER B 1 235 ? -3.176  24.285 136.341 1.00 42.53 ? 236  SER B O   1 
ATOM   5175 C CB  . SER B 1 235 ? -0.432  25.077 134.976 1.00 35.75 ? 236  SER B CB  1 
ATOM   5176 O OG  . SER B 1 235 ? 0.395   24.358 135.878 1.00 36.88 ? 236  SER B OG  1 
ATOM   5177 N N   . GLN B 1 236 ? -1.985  22.397 136.101 1.00 47.24 ? 237  GLN B N   1 
ATOM   5178 C CA  . GLN B 1 236 ? -2.597  21.765 137.266 1.00 48.00 ? 237  GLN B CA  1 
ATOM   5179 C C   . GLN B 1 236 ? -2.343  22.598 138.525 1.00 48.07 ? 237  GLN B C   1 
ATOM   5180 O O   . GLN B 1 236 ? -3.211  22.722 139.387 1.00 48.47 ? 237  GLN B O   1 
ATOM   5181 C CB  . GLN B 1 236 ? -2.060  20.342 137.461 1.00 52.19 ? 237  GLN B CB  1 
ATOM   5182 C CG  . GLN B 1 236 ? -2.314  19.389 136.299 1.00 51.73 ? 237  GLN B CG  1 
ATOM   5183 C CD  . GLN B 1 236 ? -3.679  18.731 136.379 1.00 57.85 ? 237  GLN B CD  1 
ATOM   5184 O OE1 . GLN B 1 236 ? -4.674  19.373 136.740 1.00 57.73 ? 237  GLN B OE1 1 
ATOM   5185 N NE2 . GLN B 1 236 ? -3.732  17.437 136.057 1.00 55.05 ? 237  GLN B NE2 1 
ATOM   5186 N N   . THR B 1 237 ? -1.158  23.190 138.614 1.00 41.06 ? 238  THR B N   1 
ATOM   5187 C CA  . THR B 1 237 ? -0.772  23.923 139.812 1.00 43.06 ? 238  THR B CA  1 
ATOM   5188 C C   . THR B 1 237 ? -1.062  25.423 139.752 1.00 40.14 ? 238  THR B C   1 
ATOM   5189 O O   . THR B 1 237 ? -0.515  26.188 140.540 1.00 44.63 ? 238  THR B O   1 
ATOM   5190 C CB  . THR B 1 237 ? 0.711   23.698 140.149 1.00 41.56 ? 238  THR B CB  1 
ATOM   5191 O OG1 . THR B 1 237 ? 1.513   24.024 139.005 1.00 43.17 ? 238  THR B OG1 1 
ATOM   5192 C CG2 . THR B 1 237 ? 0.951   22.239 140.546 1.00 43.17 ? 238  THR B CG2 1 
ATOM   5193 N N   . ALA B 1 238 ? -1.913  25.840 138.815 1.00 39.14 ? 239  ALA B N   1 
ATOM   5194 C CA  . ALA B 1 238 ? -2.432  27.202 138.807 1.00 38.20 ? 239  ALA B CA  1 
ATOM   5195 C C   . ALA B 1 238 ? -3.954  27.178 138.725 1.00 42.24 ? 239  ALA B C   1 
ATOM   5196 O O   . ALA B 1 238 ? -4.591  28.202 138.454 1.00 40.61 ? 239  ALA B O   1 
ATOM   5197 C CB  . ALA B 1 238 ? -1.855  27.987 137.650 1.00 36.73 ? 239  ALA B CB  1 
ATOM   5198 N N   . ALA B 1 239 ? -4.532  26.003 138.958 1.00 40.22 ? 240  ALA B N   1 
ATOM   5199 C CA  . ALA B 1 239 ? -5.959  25.785 138.734 1.00 40.82 ? 240  ALA B CA  1 
ATOM   5200 C C   . ALA B 1 239 ? -6.870  26.722 139.532 1.00 46.19 ? 240  ALA B C   1 
ATOM   5201 O O   . ALA B 1 239 ? -7.873  27.211 139.005 1.00 43.75 ? 240  ALA B O   1 
ATOM   5202 C CB  . ALA B 1 239 ? -6.320  24.335 139.002 1.00 42.63 ? 240  ALA B CB  1 
ATOM   5203 N N   . LEU B 1 240 ? -6.520  26.977 140.789 1.00 42.28 ? 241  LEU B N   1 
ATOM   5204 C CA  . LEU B 1 240 ? -7.340  27.835 141.642 1.00 46.88 ? 241  LEU B CA  1 
ATOM   5205 C C   . LEU B 1 240 ? -7.479  29.235 141.051 1.00 45.62 ? 241  LEU B C   1 
ATOM   5206 O O   . LEU B 1 240 ? -8.589  29.725 140.857 1.00 44.26 ? 241  LEU B O   1 
ATOM   5207 C CB  . LEU B 1 240 ? -6.764  27.924 143.054 1.00 47.73 ? 241  LEU B CB  1 
ATOM   5208 C CG  . LEU B 1 240 ? -7.631  28.672 144.073 1.00 55.01 ? 241  LEU B CG  1 
ATOM   5209 C CD1 . LEU B 1 240 ? -8.972  27.975 144.266 1.00 55.93 ? 241  LEU B CD1 1 
ATOM   5210 C CD2 . LEU B 1 240 ? -6.917  28.811 145.414 1.00 56.21 ? 241  LEU B CD2 1 
ATOM   5211 N N   . SER B 1 241 ? -6.349  29.870 140.755 1.00 45.80 ? 242  SER B N   1 
ATOM   5212 C CA  . SER B 1 241 ? -6.372  31.226 140.217 1.00 43.14 ? 242  SER B CA  1 
ATOM   5213 C C   . SER B 1 241 ? -6.915  31.232 138.795 1.00 43.04 ? 242  SER B C   1 
ATOM   5214 O O   . SER B 1 241 ? -7.580  32.179 138.387 1.00 36.24 ? 242  SER B O   1 
ATOM   5215 C CB  . SER B 1 241 ? -4.982  31.880 140.264 1.00 42.58 ? 242  SER B CB  1 
ATOM   5216 O OG  . SER B 1 241 ? -4.100  31.345 139.286 1.00 42.69 ? 242  SER B OG  1 
ATOM   5217 N N   . ASN B 1 242 ? -6.636  30.169 138.048 1.00 36.86 ? 243  ASN B N   1 
ATOM   5218 C CA  . ASN B 1 242 ? -7.082  30.096 136.662 1.00 40.39 ? 243  ASN B CA  1 
ATOM   5219 C C   . ASN B 1 242 ? -8.602  29.909 136.576 1.00 40.86 ? 243  ASN B C   1 
ATOM   5220 O O   . ASN B 1 242 ? -9.270  30.465 135.697 1.00 38.02 ? 243  ASN B O   1 
ATOM   5221 C CB  . ASN B 1 242 ? -6.327  28.995 135.904 1.00 37.53 ? 243  ASN B CB  1 
ATOM   5222 C CG  . ASN B 1 242 ? -4.915  29.418 135.495 1.00 35.74 ? 243  ASN B CG  1 
ATOM   5223 O OD1 . ASN B 1 242 ? -4.391  28.953 134.485 1.00 37.82 ? 243  ASN B OD1 1 
ATOM   5224 N ND2 . ASN B 1 242 ? -4.302  30.314 136.270 1.00 34.80 ? 243  ASN B ND2 1 
ATOM   5225 N N   . TYR B 1 243 ? -9.152  29.147 137.512 1.00 42.74 ? 244  TYR B N   1 
ATOM   5226 C CA  . TYR B 1 243 ? -10.596 28.975 137.570 1.00 47.54 ? 244  TYR B CA  1 
ATOM   5227 C C   . TYR B 1 243 ? -11.267 30.308 137.904 1.00 46.53 ? 244  TYR B C   1 
ATOM   5228 O O   . TYR B 1 243 ? -12.296 30.677 137.319 1.00 43.41 ? 244  TYR B O   1 
ATOM   5229 C CB  . TYR B 1 243 ? -10.974 27.905 138.588 1.00 49.28 ? 244  TYR B CB  1 
ATOM   5230 C CG  . TYR B 1 243 ? -12.458 27.803 138.794 1.00 52.10 ? 244  TYR B CG  1 
ATOM   5231 C CD1 . TYR B 1 243 ? -13.300 27.488 137.733 1.00 49.40 ? 244  TYR B CD1 1 
ATOM   5232 C CD2 . TYR B 1 243 ? -13.023 28.033 140.045 1.00 44.00 ? 244  TYR B CD2 1 
ATOM   5233 C CE1 . TYR B 1 243 ? -14.661 27.404 137.909 1.00 50.58 ? 244  TYR B CE1 1 
ATOM   5234 C CE2 . TYR B 1 243 ? -14.385 27.953 140.233 1.00 51.55 ? 244  TYR B CE2 1 
ATOM   5235 C CZ  . TYR B 1 243 ? -15.203 27.638 139.163 1.00 51.56 ? 244  TYR B CZ  1 
ATOM   5236 O OH  . TYR B 1 243 ? -16.564 27.563 139.348 1.00 51.52 ? 244  TYR B OH  1 
ATOM   5237 N N   . LEU B 1 244 ? -10.648 31.038 138.825 1.00 40.17 ? 245  LEU B N   1 
ATOM   5238 C CA  . LEU B 1 244 ? -11.151 32.334 139.244 1.00 40.39 ? 245  LEU B CA  1 
ATOM   5239 C C   . LEU B 1 244 ? -11.208 33.285 138.057 1.00 41.09 ? 245  LEU B C   1 
ATOM   5240 O O   . LEU B 1 244 ? -12.211 33.969 137.841 1.00 45.65 ? 245  LEU B O   1 
ATOM   5241 C CB  . LEU B 1 244 ? -10.262 32.903 140.337 1.00 45.31 ? 245  LEU B CB  1 
ATOM   5242 C CG  . LEU B 1 244 ? -10.971 33.685 141.439 1.00 52.29 ? 245  LEU B CG  1 
ATOM   5243 C CD1 . LEU B 1 244 ? -10.278 33.448 142.775 1.00 50.86 ? 245  LEU B CD1 1 
ATOM   5244 C CD2 . LEU B 1 244 ? -10.979 35.164 141.090 1.00 57.85 ? 245  LEU B CD2 1 
ATOM   5245 N N   . LEU B 1 245 ? -10.135 33.320 137.279 1.00 36.11 ? 246  LEU B N   1 
ATOM   5246 C CA  . LEU B 1 245 ? -10.132 34.092 136.041 1.00 37.79 ? 246  LEU B CA  1 
ATOM   5247 C C   . LEU B 1 245 ? -11.310 33.701 135.130 1.00 37.58 ? 246  LEU B C   1 
ATOM   5248 O O   . LEU B 1 245 ? -12.007 34.562 134.589 1.00 40.22 ? 246  LEU B O   1 
ATOM   5249 C CB  . LEU B 1 245 ? -8.797  33.913 135.317 1.00 37.86 ? 246  LEU B CB  1 
ATOM   5250 C CG  . LEU B 1 245 ? -8.687  34.423 133.884 1.00 38.48 ? 246  LEU B CG  1 
ATOM   5251 C CD1 . LEU B 1 245 ? -8.982  35.923 133.794 1.00 30.31 ? 246  LEU B CD1 1 
ATOM   5252 C CD2 . LEU B 1 245 ? -7.298  34.089 133.329 1.00 35.25 ? 246  LEU B CD2 1 
ATOM   5253 N N   . MET B 1 246 ? -11.530 32.401 134.980 1.00 35.78 ? 247  MET B N   1 
ATOM   5254 C CA  . MET B 1 246 ? -12.634 31.890 134.180 1.00 40.07 ? 247  MET B CA  1 
ATOM   5255 C C   . MET B 1 246 ? -13.998 32.370 134.694 1.00 45.25 ? 247  MET B C   1 
ATOM   5256 O O   . MET B 1 246 ? -14.831 32.822 133.908 1.00 47.68 ? 247  MET B O   1 
ATOM   5257 C CB  . MET B 1 246 ? -12.615 30.358 134.146 1.00 41.85 ? 247  MET B CB  1 
ATOM   5258 C CG  . MET B 1 246 ? -13.660 29.749 133.210 1.00 44.75 ? 247  MET B CG  1 
ATOM   5259 S SD  . MET B 1 246 ? -13.324 30.156 131.478 1.00 42.57 ? 247  MET B SD  1 
ATOM   5260 C CE  . MET B 1 246 ? -14.795 29.538 130.676 1.00 47.52 ? 247  MET B CE  1 
ATOM   5261 N N   . THR B 1 247 ? -14.236 32.275 136.000 1.00 39.99 ? 248  THR B N   1 
ATOM   5262 C CA  . THR B 1 247 ? -15.538 32.684 136.522 1.00 44.32 ? 248  THR B CA  1 
ATOM   5263 C C   . THR B 1 247 ? -15.731 34.188 136.376 1.00 46.86 ? 248  THR B C   1 
ATOM   5264 O O   . THR B 1 247 ? -16.851 34.660 136.172 1.00 47.78 ? 248  THR B O   1 
ATOM   5265 C CB  . THR B 1 247 ? -15.764 32.276 137.988 1.00 51.17 ? 248  THR B CB  1 
ATOM   5266 O OG1 . THR B 1 247 ? -14.796 32.914 138.820 1.00 56.07 ? 248  THR B OG1 1 
ATOM   5267 C CG2 . THR B 1 247 ? -15.651 30.778 138.148 1.00 54.86 ? 248  THR B CG2 1 
ATOM   5268 N N   . VAL B 1 248 ? -14.636 34.937 136.463 1.00 43.21 ? 249  VAL B N   1 
ATOM   5269 C CA  . VAL B 1 248 ? -14.706 36.380 136.292 1.00 41.54 ? 249  VAL B CA  1 
ATOM   5270 C C   . VAL B 1 248 ? -15.088 36.753 134.853 1.00 45.61 ? 249  VAL B C   1 
ATOM   5271 O O   . VAL B 1 248 ? -15.970 37.594 134.638 1.00 45.58 ? 249  VAL B O   1 
ATOM   5272 C CB  . VAL B 1 248 ? -13.398 37.074 136.717 1.00 38.23 ? 249  VAL B CB  1 
ATOM   5273 C CG1 . VAL B 1 248 ? -13.363 38.505 136.202 1.00 35.80 ? 249  VAL B CG1 1 
ATOM   5274 C CG2 . VAL B 1 248 ? -13.257 37.046 138.238 1.00 39.75 ? 249  VAL B CG2 1 
ATOM   5275 N N   . LEU B 1 249 ? -14.436 36.120 133.877 1.00 38.24 ? 250  LEU B N   1 
ATOM   5276 C CA  . LEU B 1 249 ? -14.815 36.272 132.473 1.00 34.55 ? 250  LEU B CA  1 
ATOM   5277 C C   . LEU B 1 249 ? -16.295 35.970 132.228 1.00 41.40 ? 250  LEU B C   1 
ATOM   5278 O O   . LEU B 1 249 ? -16.966 36.684 131.478 1.00 41.15 ? 250  LEU B O   1 
ATOM   5279 C CB  . LEU B 1 249 ? -13.949 35.390 131.592 1.00 34.34 ? 250  LEU B CB  1 
ATOM   5280 C CG  . LEU B 1 249 ? -12.517 35.888 131.458 1.00 34.86 ? 250  LEU B CG  1 
ATOM   5281 C CD1 . LEU B 1 249 ? -11.657 34.787 130.908 1.00 37.74 ? 250  LEU B CD1 1 
ATOM   5282 C CD2 . LEU B 1 249 ? -12.465 37.115 130.543 1.00 33.03 ? 250  LEU B CD2 1 
ATOM   5283 N N   . GLU B 1 250 ? -16.810 34.927 132.875 1.00 44.52 ? 251  GLU B N   1 
ATOM   5284 C CA  . GLU B 1 250 ? -18.231 34.599 132.768 1.00 46.78 ? 251  GLU B CA  1 
ATOM   5285 C C   . GLU B 1 250 ? -19.125 35.698 133.344 1.00 44.21 ? 251  GLU B C   1 
ATOM   5286 O O   . GLU B 1 250 ? -20.113 36.088 132.725 1.00 41.84 ? 251  GLU B O   1 
ATOM   5287 C CB  . GLU B 1 250 ? -18.520 33.273 133.454 1.00 48.55 ? 251  GLU B CB  1 
ATOM   5288 C CG  . GLU B 1 250 ? -17.689 32.144 132.902 1.00 53.49 ? 251  GLU B CG  1 
ATOM   5289 C CD  . GLU B 1 250 ? -18.536 31.062 132.294 1.00 61.15 ? 251  GLU B CD  1 
ATOM   5290 O OE1 . GLU B 1 250 ? -19.033 30.206 133.059 1.00 58.77 ? 251  GLU B OE1 1 
ATOM   5291 O OE2 . GLU B 1 250 ? -18.707 31.073 131.054 1.00 67.85 ? 251  GLU B OE2 1 
ATOM   5292 N N   . GLU B 1 251 ? -18.771 36.192 134.524 1.00 38.83 ? 252  GLU B N   1 
ATOM   5293 C CA  . GLU B 1 251 ? -19.526 37.265 135.149 1.00 43.10 ? 252  GLU B CA  1 
ATOM   5294 C C   . GLU B 1 251 ? -19.484 38.530 134.285 1.00 45.30 ? 252  GLU B C   1 
ATOM   5295 O O   . GLU B 1 251 ? -20.474 39.268 134.193 1.00 43.03 ? 252  GLU B O   1 
ATOM   5296 C CB  . GLU B 1 251 ? -18.988 37.549 136.555 1.00 46.32 ? 252  GLU B CB  1 
ATOM   5297 C CG  . GLU B 1 251 ? -19.717 38.667 137.280 1.00 48.11 ? 252  GLU B CG  1 
ATOM   5298 C CD  . GLU B 1 251 ? -19.209 38.884 138.693 1.00 49.69 ? 252  GLU B CD  1 
ATOM   5299 O OE1 . GLU B 1 251 ? -18.890 37.891 139.378 1.00 48.53 ? 252  GLU B OE1 1 
ATOM   5300 O OE2 . GLU B 1 251 ? -19.122 40.053 139.120 1.00 51.39 ? 252  GLU B OE2 1 
ATOM   5301 N N   . ALA B 1 252 ? -18.343 38.756 133.632 1.00 39.49 ? 253  ALA B N   1 
ATOM   5302 C CA  . ALA B 1 252 ? -18.166 39.915 132.760 1.00 36.20 ? 253  ALA B CA  1 
ATOM   5303 C C   . ALA B 1 252 ? -18.930 39.753 131.453 1.00 35.22 ? 253  ALA B C   1 
ATOM   5304 O O   . ALA B 1 252 ? -18.911 40.643 130.608 1.00 35.10 ? 253  ALA B O   1 
ATOM   5305 C CB  . ALA B 1 252 ? -16.689 40.173 132.485 1.00 33.97 ? 253  ALA B CB  1 
ATOM   5306 N N   . GLY B 1 253 ? -19.595 38.614 131.287 1.00 36.77 ? 254  GLY B N   1 
ATOM   5307 C CA  . GLY B 1 253 ? -20.462 38.397 130.140 1.00 38.58 ? 254  GLY B CA  1 
ATOM   5308 C C   . GLY B 1 253 ? -19.923 37.550 128.996 1.00 40.03 ? 254  GLY B C   1 
ATOM   5309 O O   . GLY B 1 253 ? -20.483 37.581 127.901 1.00 41.98 ? 254  GLY B O   1 
ATOM   5310 N N   . LEU B 1 254 ? -18.852 36.793 129.227 1.00 39.91 ? 255  LEU B N   1 
ATOM   5311 C CA  . LEU B 1 254 ? -18.328 35.898 128.190 1.00 36.24 ? 255  LEU B CA  1 
ATOM   5312 C C   . LEU B 1 254 ? -19.396 34.887 127.771 1.00 33.80 ? 255  LEU B C   1 
ATOM   5313 O O   . LEU B 1 254 ? -19.939 34.168 128.613 1.00 38.16 ? 255  LEU B O   1 
ATOM   5314 C CB  . LEU B 1 254 ? -17.079 35.157 128.677 1.00 37.63 ? 255  LEU B CB  1 
ATOM   5315 C CG  . LEU B 1 254 ? -16.369 34.303 127.613 1.00 37.84 ? 255  LEU B CG  1 
ATOM   5316 C CD1 . LEU B 1 254 ? -15.722 35.193 126.576 1.00 33.05 ? 255  LEU B CD1 1 
ATOM   5317 C CD2 . LEU B 1 254 ? -15.336 33.351 128.231 1.00 36.73 ? 255  LEU B CD2 1 
ATOM   5318 N N   . PRO B 1 255 ? -19.730 34.848 126.469 1.00 33.07 ? 256  PRO B N   1 
ATOM   5319 C CA  . PRO B 1 255 ? -20.780 33.918 126.021 1.00 38.02 ? 256  PRO B CA  1 
ATOM   5320 C C   . PRO B 1 255 ? -20.364 32.447 126.187 1.00 40.32 ? 256  PRO B C   1 
ATOM   5321 O O   . PRO B 1 255 ? -19.168 32.137 126.195 1.00 42.34 ? 256  PRO B O   1 
ATOM   5322 C CB  . PRO B 1 255 ? -20.970 34.279 124.533 1.00 34.39 ? 256  PRO B CB  1 
ATOM   5323 C CG  . PRO B 1 255 ? -20.458 35.694 124.407 1.00 32.48 ? 256  PRO B CG  1 
ATOM   5324 C CD  . PRO B 1 255 ? -19.297 35.757 125.392 1.00 33.05 ? 256  PRO B CD  1 
ATOM   5325 N N   . LYS B 1 256 ? -21.344 31.563 126.327 1.00 39.00 ? 257  LYS B N   1 
ATOM   5326 C CA  . LYS B 1 256 ? -21.078 30.141 126.496 1.00 42.97 ? 257  LYS B CA  1 
ATOM   5327 C C   . LYS B 1 256 ? -20.222 29.596 125.357 1.00 41.82 ? 257  LYS B C   1 
ATOM   5328 O O   . LYS B 1 256 ? -20.445 29.920 124.190 1.00 43.82 ? 257  LYS B O   1 
ATOM   5329 C CB  . LYS B 1 256 ? -22.390 29.343 126.615 1.00 48.69 ? 257  LYS B CB  1 
ATOM   5330 C CG  . LYS B 1 256 ? -23.327 29.456 125.409 1.00 50.34 ? 257  LYS B CG  1 
ATOM   5331 C CD  . LYS B 1 256 ? -24.563 28.552 125.546 1.00 52.28 ? 257  LYS B CD  1 
ATOM   5332 N N   . GLY B 1 257 ? -19.221 28.796 125.709 1.00 39.00 ? 258  GLY B N   1 
ATOM   5333 C CA  . GLY B 1 257 ? -18.421 28.088 124.723 1.00 39.06 ? 258  GLY B CA  1 
ATOM   5334 C C   . GLY B 1 257 ? -17.299 28.863 124.062 1.00 38.33 ? 258  GLY B C   1 
ATOM   5335 O O   . GLY B 1 257 ? -16.475 28.283 123.349 1.00 43.58 ? 258  GLY B O   1 
ATOM   5336 N N   . VAL B 1 258 ? -17.242 30.169 124.288 1.00 36.36 ? 259  VAL B N   1 
ATOM   5337 C CA  . VAL B 1 258 ? -16.213 30.977 123.643 1.00 29.95 ? 259  VAL B CA  1 
ATOM   5338 C C   . VAL B 1 258 ? -14.829 30.606 124.185 1.00 32.51 ? 259  VAL B C   1 
ATOM   5339 O O   . VAL B 1 258 ? -13.850 30.560 123.453 1.00 32.72 ? 259  VAL B O   1 
ATOM   5340 C CB  . VAL B 1 258 ? -16.486 32.478 123.788 1.00 31.08 ? 259  VAL B CB  1 
ATOM   5341 C CG1 . VAL B 1 258 ? -15.299 33.287 123.277 1.00 30.17 ? 259  VAL B CG1 1 
ATOM   5342 C CG2 . VAL B 1 258 ? -17.741 32.853 123.017 1.00 35.73 ? 259  VAL B CG2 1 
ATOM   5343 N N   . ILE B 1 259 ? -14.766 30.332 125.477 1.00 35.85 ? 260  ILE B N   1 
ATOM   5344 C CA  . ILE B 1 259 ? -13.567 29.793 126.083 1.00 35.73 ? 260  ILE B CA  1 
ATOM   5345 C C   . ILE B 1 259 ? -14.037 28.651 126.938 1.00 40.08 ? 260  ILE B C   1 
ATOM   5346 O O   . ILE B 1 259 ? -15.041 28.771 127.631 1.00 42.60 ? 260  ILE B O   1 
ATOM   5347 C CB  . ILE B 1 259 ? -12.842 30.837 126.948 1.00 30.22 ? 260  ILE B CB  1 
ATOM   5348 C CG1 . ILE B 1 259 ? -12.298 31.965 126.061 1.00 28.67 ? 260  ILE B CG1 1 
ATOM   5349 C CG2 . ILE B 1 259 ? -11.713 30.188 127.738 1.00 32.33 ? 260  ILE B CG2 1 
ATOM   5350 C CD1 . ILE B 1 259 ? -11.788 33.167 126.837 1.00 31.71 ? 260  ILE B CD1 1 
ATOM   5351 N N   . ASN B 1 260 ? -13.333 27.529 126.868 1.00 40.57 ? 261  ASN B N   1 
ATOM   5352 C CA  . ASN B 1 260 ? -13.705 26.365 127.648 1.00 37.24 ? 261  ASN B CA  1 
ATOM   5353 C C   . ASN B 1 260 ? -12.541 25.907 128.523 1.00 39.83 ? 261  ASN B C   1 
ATOM   5354 O O   . ASN B 1 260 ? -11.437 25.682 128.044 1.00 39.09 ? 261  ASN B O   1 
ATOM   5355 C CB  . ASN B 1 260 ? -14.215 25.258 126.729 1.00 39.23 ? 261  ASN B CB  1 
ATOM   5356 C CG  . ASN B 1 260 ? -15.428 25.701 125.918 1.00 43.77 ? 261  ASN B CG  1 
ATOM   5357 O OD1 . ASN B 1 260 ? -16.572 25.592 126.375 1.00 44.23 ? 261  ASN B OD1 1 
ATOM   5358 N ND2 . ASN B 1 260 ? -15.182 26.226 124.723 1.00 40.65 ? 261  ASN B ND2 1 
ATOM   5359 N N   . PHE B 1 261 ? -12.811 25.802 129.817 1.00 43.21 ? 262  PHE B N   1 
ATOM   5360 C CA  . PHE B 1 261 ? -11.801 25.611 130.845 1.00 39.58 ? 262  PHE B CA  1 
ATOM   5361 C C   . PHE B 1 261 ? -11.750 24.122 131.139 1.00 41.46 ? 262  PHE B C   1 
ATOM   5362 O O   . PHE B 1 261 ? -12.670 23.588 131.753 1.00 39.98 ? 262  PHE B O   1 
ATOM   5363 C CB  . PHE B 1 261 ? -12.254 26.406 132.072 1.00 41.88 ? 262  PHE B CB  1 
ATOM   5364 C CG  . PHE B 1 261 ? -11.368 26.278 133.288 1.00 42.40 ? 262  PHE B CG  1 
ATOM   5365 C CD1 . PHE B 1 261 ? -10.194 27.023 133.399 1.00 40.19 ? 262  PHE B CD1 1 
ATOM   5366 C CD2 . PHE B 1 261 ? -11.752 25.481 134.354 1.00 39.77 ? 262  PHE B CD2 1 
ATOM   5367 C CE1 . PHE B 1 261 ? -9.403  26.934 134.532 1.00 41.00 ? 262  PHE B CE1 1 
ATOM   5368 C CE2 . PHE B 1 261 ? -10.970 25.391 135.488 1.00 47.59 ? 262  PHE B CE2 1 
ATOM   5369 C CZ  . PHE B 1 261 ? -9.788  26.115 135.577 1.00 45.00 ? 262  PHE B CZ  1 
ATOM   5370 N N   . ILE B 1 262 ? -10.697 23.445 130.680 1.00 38.27 ? 263  ILE B N   1 
ATOM   5371 C CA  . ILE B 1 262 ? -10.634 21.992 130.830 1.00 42.29 ? 263  ILE B CA  1 
ATOM   5372 C C   . ILE B 1 262 ? -9.362  21.460 131.482 1.00 44.23 ? 263  ILE B C   1 
ATOM   5373 O O   . ILE B 1 262 ? -8.552  20.817 130.819 1.00 40.61 ? 263  ILE B O   1 
ATOM   5374 C CB  . ILE B 1 262 ? -10.854 21.234 129.487 1.00 39.92 ? 263  ILE B CB  1 
ATOM   5375 C CG1 . ILE B 1 262 ? -10.033 21.853 128.360 1.00 38.08 ? 263  ILE B CG1 1 
ATOM   5376 C CG2 . ILE B 1 262 ? -12.323 21.194 129.112 1.00 40.50 ? 263  ILE B CG2 1 
ATOM   5377 C CD1 . ILE B 1 262 ? -10.059 21.026 127.110 1.00 38.27 ? 263  ILE B CD1 1 
ATOM   5378 N N   . PRO B 1 263 ? -9.198  21.695 132.793 1.00 42.98 ? 264  PRO B N   1 
ATOM   5379 C CA  . PRO B 1 263 ? -8.070  21.078 133.491 1.00 41.68 ? 264  PRO B CA  1 
ATOM   5380 C C   . PRO B 1 263 ? -8.148  19.562 133.361 1.00 43.35 ? 264  PRO B C   1 
ATOM   5381 O O   . PRO B 1 263 ? -9.244  19.024 133.247 1.00 44.49 ? 264  PRO B O   1 
ATOM   5382 C CB  . PRO B 1 263 ? -8.292  21.497 134.945 1.00 43.20 ? 264  PRO B CB  1 
ATOM   5383 C CG  . PRO B 1 263 ? -9.751  21.835 135.034 1.00 43.64 ? 264  PRO B CG  1 
ATOM   5384 C CD  . PRO B 1 263 ? -10.081 22.431 133.709 1.00 44.66 ? 264  PRO B CD  1 
ATOM   5385 N N   . GLY B 1 264 ? -7.002  18.888 133.355 1.00 43.57 ? 265  GLY B N   1 
ATOM   5386 C CA  . GLY B 1 264 ? -6.967  17.441 133.265 1.00 45.25 ? 265  GLY B CA  1 
ATOM   5387 C C   . GLY B 1 264 ? -5.548  16.957 133.031 1.00 46.59 ? 265  GLY B C   1 
ATOM   5388 O O   . GLY B 1 264 ? -4.613  17.760 133.004 1.00 43.50 ? 265  GLY B O   1 
ATOM   5389 N N   . ASP B 1 265 ? -5.373  15.648 132.878 1.00 46.45 ? 266  ASP B N   1 
ATOM   5390 C CA  . ASP B 1 265 ? -4.057  15.129 132.538 1.00 46.23 ? 266  ASP B CA  1 
ATOM   5391 C C   . ASP B 1 265 ? -3.554  15.776 131.246 1.00 47.05 ? 266  ASP B C   1 
ATOM   5392 O O   . ASP B 1 265 ? -4.259  15.747 130.235 1.00 43.89 ? 266  ASP B O   1 
ATOM   5393 C CB  . ASP B 1 265 ? -4.107  13.625 132.361 1.00 49.49 ? 266  ASP B CB  1 
ATOM   5394 C CG  . ASP B 1 265 ? -2.765  13.055 132.041 1.00 51.80 ? 266  ASP B CG  1 
ATOM   5395 O OD1 . ASP B 1 265 ? -1.950  12.940 132.977 1.00 53.60 ? 266  ASP B OD1 1 
ATOM   5396 O OD2 . ASP B 1 265 ? -2.524  12.748 130.858 1.00 52.35 ? 266  ASP B OD2 1 
ATOM   5397 N N   . PRO B 1 266 ? -2.345  16.375 131.283 1.00 42.96 ? 267  PRO B N   1 
ATOM   5398 C CA  . PRO B 1 266 ? -1.815  17.133 130.140 1.00 47.93 ? 267  PRO B CA  1 
ATOM   5399 C C   . PRO B 1 266 ? -1.727  16.310 128.863 1.00 48.85 ? 267  PRO B C   1 
ATOM   5400 O O   . PRO B 1 266 ? -2.131  16.795 127.809 1.00 47.74 ? 267  PRO B O   1 
ATOM   5401 C CB  . PRO B 1 266 ? -0.412  17.553 130.607 1.00 44.26 ? 267  PRO B CB  1 
ATOM   5402 C CG  . PRO B 1 266 ? -0.531  17.632 132.091 1.00 45.77 ? 267  PRO B CG  1 
ATOM   5403 C CD  . PRO B 1 266 ? -1.471  16.495 132.465 1.00 51.77 ? 267  PRO B CD  1 
ATOM   5404 N N   . VAL B 1 267 ? -1.227  15.084 128.956 1.00 42.70 ? 268  VAL B N   1 
ATOM   5405 C CA  . VAL B 1 267 ? -1.018  14.282 127.759 1.00 53.07 ? 268  VAL B CA  1 
ATOM   5406 C C   . VAL B 1 267 ? -2.353  13.816 127.190 1.00 53.61 ? 268  VAL B C   1 
ATOM   5407 O O   . VAL B 1 267 ? -2.611  13.952 125.992 1.00 51.84 ? 268  VAL B O   1 
ATOM   5408 C CB  . VAL B 1 267 ? -0.095  13.068 128.029 1.00 54.56 ? 268  VAL B CB  1 
ATOM   5409 C CG1 . VAL B 1 267 ? -0.144  12.084 126.855 1.00 45.26 ? 268  VAL B CG1 1 
ATOM   5410 C CG2 . VAL B 1 267 ? 1.327   13.535 128.295 1.00 43.44 ? 268  VAL B CG2 1 
ATOM   5411 N N   . GLN B 1 268 ? -3.200  13.277 128.060 1.00 45.44 ? 269  GLN B N   1 
ATOM   5412 C CA  . GLN B 1 268 ? -4.520  12.805 127.667 1.00 50.72 ? 269  GLN B CA  1 
ATOM   5413 C C   . GLN B 1 268 ? -5.375  13.892 127.015 1.00 51.62 ? 269  GLN B C   1 
ATOM   5414 O O   . GLN B 1 268 ? -5.920  13.691 125.926 1.00 53.82 ? 269  GLN B O   1 
ATOM   5415 C CB  . GLN B 1 268 ? -5.243  12.234 128.882 1.00 58.52 ? 269  GLN B CB  1 
ATOM   5416 C CG  . GLN B 1 268 ? -6.614  11.704 128.581 1.00 67.47 ? 269  GLN B CG  1 
ATOM   5417 C CD  . GLN B 1 268 ? -7.068  10.701 129.611 1.00 79.57 ? 269  GLN B CD  1 
ATOM   5418 O OE1 . GLN B 1 268 ? -6.447  10.550 130.668 1.00 85.30 ? 269  GLN B OE1 1 
ATOM   5419 N NE2 . GLN B 1 268 ? -8.148  9.995  129.307 1.00 84.34 ? 269  GLN B NE2 1 
ATOM   5420 N N   . VAL B 1 269 ? -5.488  15.038 127.682 1.00 43.85 ? 270  VAL B N   1 
ATOM   5421 C CA  . VAL B 1 269 ? -6.291  16.156 127.171 1.00 42.46 ? 270  VAL B CA  1 
ATOM   5422 C C   . VAL B 1 269 ? -5.752  16.631 125.820 1.00 44.94 ? 270  VAL B C   1 
ATOM   5423 O O   . VAL B 1 269 ? -6.509  16.866 124.869 1.00 41.87 ? 270  VAL B O   1 
ATOM   5424 C CB  . VAL B 1 269 ? -6.313  17.339 128.182 1.00 45.35 ? 270  VAL B CB  1 
ATOM   5425 C CG1 . VAL B 1 269 ? -6.847  18.618 127.536 1.00 39.82 ? 270  VAL B CG1 1 
ATOM   5426 C CG2 . VAL B 1 269 ? -7.107  16.963 129.436 1.00 46.72 ? 270  VAL B CG2 1 
ATOM   5427 N N   . THR B 1 270 ? -4.429  16.740 125.745 1.00 45.54 ? 271  THR B N   1 
ATOM   5428 C CA  . THR B 1 270 ? -3.745  17.185 124.540 1.00 41.29 ? 271  THR B CA  1 
ATOM   5429 C C   . THR B 1 270 ? -3.981  16.268 123.333 1.00 42.94 ? 271  THR B C   1 
ATOM   5430 O O   . THR B 1 270 ? -4.266  16.739 122.234 1.00 46.63 ? 271  THR B O   1 
ATOM   5431 C CB  . THR B 1 270 ? -2.241  17.320 124.805 1.00 42.57 ? 271  THR B CB  1 
ATOM   5432 O OG1 . THR B 1 270 ? -2.011  18.454 125.651 1.00 41.46 ? 271  THR B OG1 1 
ATOM   5433 C CG2 . THR B 1 270 ? -1.470  17.484 123.507 1.00 42.79 ? 271  THR B CG2 1 
ATOM   5434 N N   . ASP B 1 271 ? -3.862  14.963 123.533 1.00 44.71 ? 272  ASP B N   1 
ATOM   5435 C CA  . ASP B 1 271 ? -3.974  14.027 122.418 1.00 47.30 ? 272  ASP B CA  1 
ATOM   5436 C C   . ASP B 1 271 ? -5.373  14.076 121.826 1.00 47.51 ? 272  ASP B C   1 
ATOM   5437 O O   . ASP B 1 271 ? -5.546  13.955 120.617 1.00 48.36 ? 272  ASP B O   1 
ATOM   5438 C CB  . ASP B 1 271 ? -3.626  12.597 122.853 1.00 44.31 ? 272  ASP B CB  1 
ATOM   5439 C CG  . ASP B 1 271 ? -2.146  12.419 123.190 1.00 53.40 ? 272  ASP B CG  1 
ATOM   5440 O OD1 . ASP B 1 271 ? -1.328  13.315 122.865 1.00 50.10 ? 272  ASP B OD1 1 
ATOM   5441 O OD2 . ASP B 1 271 ? -1.799  11.366 123.773 1.00 56.98 ? 272  ASP B OD2 1 
ATOM   5442 N N   . GLN B 1 272 ? -6.368  14.266 122.687 1.00 48.39 ? 273  GLN B N   1 
ATOM   5443 C CA  . GLN B 1 272 ? -7.759  14.354 122.250 1.00 49.50 ? 273  GLN B CA  1 
ATOM   5444 C C   . GLN B 1 272 ? -8.054  15.658 121.509 1.00 47.41 ? 273  GLN B C   1 
ATOM   5445 O O   . GLN B 1 272 ? -8.692  15.639 120.461 1.00 48.28 ? 273  GLN B O   1 
ATOM   5446 C CB  . GLN B 1 272 ? -8.714  14.193 123.434 1.00 50.29 ? 273  GLN B CB  1 
ATOM   5447 C CG  . GLN B 1 272 ? -10.190 14.206 123.047 1.00 55.95 ? 273  GLN B CG  1 
ATOM   5448 C CD  . GLN B 1 272 ? -10.556 13.095 122.081 1.00 59.15 ? 273  GLN B CD  1 
ATOM   5449 O OE1 . GLN B 1 272 ? -10.427 11.910 122.398 1.00 62.02 ? 273  GLN B OE1 1 
ATOM   5450 N NE2 . GLN B 1 272 ? -11.011 13.475 120.890 1.00 61.21 ? 273  GLN B NE2 1 
ATOM   5451 N N   . VAL B 1 273 ? -7.595  16.787 122.049 1.00 45.24 ? 274  VAL B N   1 
ATOM   5452 C CA  . VAL B 1 273 ? -7.760  18.065 121.359 1.00 43.68 ? 274  VAL B CA  1 
ATOM   5453 C C   . VAL B 1 273 ? -7.152  18.020 119.959 1.00 42.73 ? 274  VAL B C   1 
ATOM   5454 O O   . VAL B 1 273 ? -7.764  18.455 118.976 1.00 47.17 ? 274  VAL B O   1 
ATOM   5455 C CB  . VAL B 1 273 ? -7.105  19.234 122.125 1.00 41.70 ? 274  VAL B CB  1 
ATOM   5456 C CG1 . VAL B 1 273 ? -7.147  20.499 121.280 1.00 37.82 ? 274  VAL B CG1 1 
ATOM   5457 C CG2 . VAL B 1 273 ? -7.794  19.463 123.462 1.00 42.69 ? 274  VAL B CG2 1 
ATOM   5458 N N   . LEU B 1 274 ? -5.943  17.479 119.880 1.00 40.02 ? 275  LEU B N   1 
ATOM   5459 C CA  . LEU B 1 274 ? -5.195  17.421 118.627 1.00 46.61 ? 275  LEU B CA  1 
ATOM   5460 C C   . LEU B 1 274 ? -5.755  16.423 117.600 1.00 51.28 ? 275  LEU B C   1 
ATOM   5461 O O   . LEU B 1 274 ? -5.310  16.388 116.448 1.00 53.83 ? 275  LEU B O   1 
ATOM   5462 C CB  . LEU B 1 274 ? -3.721  17.123 118.919 1.00 46.82 ? 275  LEU B CB  1 
ATOM   5463 C CG  . LEU B 1 274 ? -3.002  18.241 119.687 1.00 44.49 ? 275  LEU B CG  1 
ATOM   5464 C CD1 . LEU B 1 274 ? -1.536  17.925 119.887 1.00 44.07 ? 275  LEU B CD1 1 
ATOM   5465 C CD2 . LEU B 1 274 ? -3.169  19.580 118.979 1.00 42.08 ? 275  LEU B CD2 1 
ATOM   5466 N N   . ALA B 1 275 ? -6.731  15.620 118.007 1.00 50.88 ? 276  ALA B N   1 
ATOM   5467 C CA  . ALA B 1 275 ? -7.296  14.628 117.100 1.00 51.66 ? 276  ALA B CA  1 
ATOM   5468 C C   . ALA B 1 275 ? -8.408  15.208 116.238 1.00 52.33 ? 276  ALA B C   1 
ATOM   5469 O O   . ALA B 1 275 ? -8.840  14.576 115.281 1.00 55.35 ? 276  ALA B O   1 
ATOM   5470 C CB  . ALA B 1 275 ? -7.792  13.405 117.868 1.00 48.17 ? 276  ALA B CB  1 
ATOM   5471 N N   . ASP B 1 276 ? -8.861  16.414 116.572 1.00 49.49 ? 277  ASP B N   1 
ATOM   5472 C CA  . ASP B 1 276 ? -9.996  17.025 115.878 1.00 47.65 ? 277  ASP B CA  1 
ATOM   5473 C C   . ASP B 1 276 ? -9.553  17.776 114.621 1.00 51.43 ? 277  ASP B C   1 
ATOM   5474 O O   . ASP B 1 276 ? -8.605  18.569 114.661 1.00 55.40 ? 277  ASP B O   1 
ATOM   5475 C CB  . ASP B 1 276 ? -10.745 17.973 116.825 1.00 49.39 ? 277  ASP B CB  1 
ATOM   5476 C CG  . ASP B 1 276 ? -12.115 18.368 116.302 1.00 50.27 ? 277  ASP B CG  1 
ATOM   5477 O OD1 . ASP B 1 276 ? -12.235 19.457 115.698 1.00 52.14 ? 277  ASP B OD1 1 
ATOM   5478 O OD2 . ASP B 1 276 ? -13.067 17.583 116.498 1.00 51.98 ? 277  ASP B OD2 1 
ATOM   5479 N N   . LYS B 1 277 ? -10.251 17.538 113.512 1.00 49.88 ? 278  LYS B N   1 
ATOM   5480 C CA  . LYS B 1 277 ? -9.915  18.156 112.227 1.00 46.54 ? 278  LYS B CA  1 
ATOM   5481 C C   . LYS B 1 277 ? -9.972  19.686 112.243 1.00 51.57 ? 278  LYS B C   1 
ATOM   5482 O O   . LYS B 1 277 ? -9.393  20.343 111.377 1.00 51.26 ? 278  LYS B O   1 
ATOM   5483 C CB  . LYS B 1 277 ? -10.840 17.629 111.129 1.00 43.08 ? 278  LYS B CB  1 
ATOM   5484 N N   . ASP B 1 278 ? -10.678 20.254 113.216 1.00 53.44 ? 279  ASP B N   1 
ATOM   5485 C CA  . ASP B 1 278 ? -10.856 21.701 113.265 1.00 52.88 ? 279  ASP B CA  1 
ATOM   5486 C C   . ASP B 1 278 ? -9.805  22.424 114.106 1.00 49.02 ? 279  ASP B C   1 
ATOM   5487 O O   . ASP B 1 278 ? -9.911  23.628 114.314 1.00 50.31 ? 279  ASP B O   1 
ATOM   5488 C CB  . ASP B 1 278 ? -12.253 22.057 113.776 1.00 55.31 ? 279  ASP B CB  1 
ATOM   5489 C CG  . ASP B 1 278 ? -13.356 21.523 112.882 1.00 54.89 ? 279  ASP B CG  1 
ATOM   5490 O OD1 . ASP B 1 278 ? -13.208 21.639 111.644 1.00 50.58 ? 279  ASP B OD1 1 
ATOM   5491 O OD2 . ASP B 1 278 ? -14.363 20.993 113.420 1.00 51.70 ? 279  ASP B OD2 1 
ATOM   5492 N N   . PHE B 1 279 ? -8.808  21.693 114.597 1.00 46.09 ? 280  PHE B N   1 
ATOM   5493 C CA  . PHE B 1 279 ? -7.696  22.306 115.325 1.00 43.90 ? 280  PHE B CA  1 
ATOM   5494 C C   . PHE B 1 279 ? -7.007  23.376 114.471 1.00 39.36 ? 280  PHE B C   1 
ATOM   5495 O O   . PHE B 1 279 ? -6.533  23.098 113.373 1.00 43.61 ? 280  PHE B O   1 
ATOM   5496 C CB  . PHE B 1 279 ? -6.687  21.241 115.769 1.00 45.87 ? 280  PHE B CB  1 
ATOM   5497 C CG  . PHE B 1 279 ? -5.469  21.806 116.437 1.00 49.07 ? 280  PHE B CG  1 
ATOM   5498 C CD1 . PHE B 1 279 ? -5.567  22.433 117.668 1.00 46.02 ? 280  PHE B CD1 1 
ATOM   5499 C CD2 . PHE B 1 279 ? -4.224  21.718 115.831 1.00 51.16 ? 280  PHE B CD2 1 
ATOM   5500 C CE1 . PHE B 1 279 ? -4.445  22.962 118.282 1.00 47.20 ? 280  PHE B CE1 1 
ATOM   5501 C CE2 . PHE B 1 279 ? -3.104  22.242 116.438 1.00 49.36 ? 280  PHE B CE2 1 
ATOM   5502 C CZ  . PHE B 1 279 ? -3.212  22.865 117.665 1.00 46.34 ? 280  PHE B CZ  1 
ATOM   5503 N N   . GLY B 1 280 ? -6.958  24.602 114.977 1.00 35.13 ? 281  GLY B N   1 
ATOM   5504 C CA  . GLY B 1 280 ? -6.509  25.730 114.178 1.00 32.83 ? 281  GLY B CA  1 
ATOM   5505 C C   . GLY B 1 280 ? -5.217  26.376 114.649 1.00 38.91 ? 281  GLY B C   1 
ATOM   5506 O O   . GLY B 1 280 ? -4.437  26.891 113.839 1.00 32.71 ? 281  GLY B O   1 
ATOM   5507 N N   . ALA B 1 281 ? -4.992  26.363 115.963 1.00 39.07 ? 282  ALA B N   1 
ATOM   5508 C CA  . ALA B 1 281 ? -3.788  26.959 116.520 1.00 35.49 ? 282  ALA B CA  1 
ATOM   5509 C C   . ALA B 1 281 ? -3.475  26.490 117.926 1.00 33.42 ? 282  ALA B C   1 
ATOM   5510 O O   . ALA B 1 281 ? -4.373  26.224 118.729 1.00 36.36 ? 282  ALA B O   1 
ATOM   5511 C CB  . ALA B 1 281 ? -3.870  28.491 116.488 1.00 31.47 ? 282  ALA B CB  1 
ATOM   5512 N N   . LEU B 1 282 ? -2.183  26.389 118.207 1.00 33.33 ? 283  LEU B N   1 
ATOM   5513 C CA  . LEU B 1 282 ? -1.700  26.167 119.554 1.00 29.03 ? 283  LEU B CA  1 
ATOM   5514 C C   . LEU B 1 282 ? -1.228  27.491 120.107 1.00 35.71 ? 283  LEU B C   1 
ATOM   5515 O O   . LEU B 1 282 ? -0.451  28.205 119.462 1.00 34.85 ? 283  LEU B O   1 
ATOM   5516 C CB  . LEU B 1 282 ? -0.530  25.191 119.552 1.00 31.62 ? 283  LEU B CB  1 
ATOM   5517 C CG  . LEU B 1 282 ? 0.155   25.043 120.917 1.00 34.44 ? 283  LEU B CG  1 
ATOM   5518 C CD1 . LEU B 1 282 ? -0.840  24.483 121.932 1.00 33.57 ? 283  LEU B CD1 1 
ATOM   5519 C CD2 . LEU B 1 282 ? 1.410   24.161 120.829 1.00 28.90 ? 283  LEU B CD2 1 
ATOM   5520 N N   . HIS B 1 283 ? -1.717  27.847 121.286 1.00 37.34 ? 284  HIS B N   1 
ATOM   5521 C CA  . HIS B 1 283 ? -1.177  29.006 121.978 1.00 35.54 ? 284  HIS B CA  1 
ATOM   5522 C C   . HIS B 1 283 ? -0.576  28.521 123.292 1.00 36.79 ? 284  HIS B C   1 
ATOM   5523 O O   . HIS B 1 283 ? -1.300  28.176 124.236 1.00 34.19 ? 284  HIS B O   1 
ATOM   5524 C CB  . HIS B 1 283 ? -2.239  30.079 122.214 1.00 26.29 ? 284  HIS B CB  1 
ATOM   5525 C CG  . HIS B 1 283 ? -1.668  31.454 122.370 1.00 29.65 ? 284  HIS B CG  1 
ATOM   5526 N ND1 . HIS B 1 283 ? -2.385  32.507 122.897 1.00 25.98 ? 284  HIS B ND1 1 
ATOM   5527 C CD2 . HIS B 1 283 ? -0.445  31.948 122.059 1.00 23.72 ? 284  HIS B CD2 1 
ATOM   5528 C CE1 . HIS B 1 283 ? -1.627  33.589 122.903 1.00 23.65 ? 284  HIS B CE1 1 
ATOM   5529 N NE2 . HIS B 1 283 ? -0.444  33.274 122.406 1.00 23.07 ? 284  HIS B NE2 1 
ATOM   5530 N N   . PHE B 1 284 ? 0.754   28.490 123.322 1.00 37.93 ? 285  PHE B N   1 
ATOM   5531 C CA  . PHE B 1 284 ? 1.511   27.814 124.363 1.00 34.71 ? 285  PHE B CA  1 
ATOM   5532 C C   . PHE B 1 284 ? 2.519   28.715 125.045 1.00 33.97 ? 285  PHE B C   1 
ATOM   5533 O O   . PHE B 1 284 ? 3.191   29.515 124.407 1.00 36.86 ? 285  PHE B O   1 
ATOM   5534 C CB  . PHE B 1 284 ? 2.254   26.615 123.780 1.00 30.35 ? 285  PHE B CB  1 
ATOM   5535 C CG  . PHE B 1 284 ? 3.103   25.879 124.787 1.00 36.62 ? 285  PHE B CG  1 
ATOM   5536 C CD1 . PHE B 1 284 ? 4.472   26.124 124.883 1.00 40.27 ? 285  PHE B CD1 1 
ATOM   5537 C CD2 . PHE B 1 284 ? 2.526   24.951 125.657 1.00 36.52 ? 285  PHE B CD2 1 
ATOM   5538 C CE1 . PHE B 1 284 ? 5.261   25.441 125.818 1.00 39.35 ? 285  PHE B CE1 1 
ATOM   5539 C CE2 . PHE B 1 284 ? 3.297   24.262 126.595 1.00 36.04 ? 285  PHE B CE2 1 
ATOM   5540 C CZ  . PHE B 1 284 ? 4.673   24.507 126.676 1.00 38.26 ? 285  PHE B CZ  1 
ATOM   5541 N N   . THR B 1 285 ? 2.627   28.564 126.357 1.00 36.77 ? 286  THR B N   1 
ATOM   5542 C CA  . THR B 1 285 ? 3.758   29.104 127.094 1.00 32.69 ? 286  THR B CA  1 
ATOM   5543 C C   . THR B 1 285 ? 4.154   28.098 128.177 1.00 38.58 ? 286  THR B C   1 
ATOM   5544 O O   . THR B 1 285 ? 3.326   27.678 128.981 1.00 37.56 ? 286  THR B O   1 
ATOM   5545 C CB  . THR B 1 285 ? 3.439   30.457 127.699 1.00 32.24 ? 286  THR B CB  1 
ATOM   5546 O OG1 . THR B 1 285 ? 3.088   31.353 126.645 1.00 31.37 ? 286  THR B OG1 1 
ATOM   5547 C CG2 . THR B 1 285 ? 4.650   31.013 128.453 1.00 35.13 ? 286  THR B CG2 1 
ATOM   5548 N N   . GLY B 1 286 ? 5.420   27.702 128.172 1.00 36.82 ? 287  GLY B N   1 
ATOM   5549 C CA  . GLY B 1 286 ? 5.912   26.688 129.082 1.00 38.24 ? 287  GLY B CA  1 
ATOM   5550 C C   . GLY B 1 286 ? 7.276   26.216 128.628 1.00 40.60 ? 287  GLY B C   1 
ATOM   5551 O O   . GLY B 1 286 ? 7.947   26.894 127.857 1.00 40.11 ? 287  GLY B O   1 
ATOM   5552 N N   . SER B 1 287 ? 7.673   25.037 129.085 1.00 43.12 ? 288  SER B N   1 
ATOM   5553 C CA  . SER B 1 287 ? 9.001   24.524 128.803 1.00 40.40 ? 288  SER B CA  1 
ATOM   5554 C C   . SER B 1 287 ? 9.223   24.147 127.344 1.00 44.44 ? 288  SER B C   1 
ATOM   5555 O O   . SER B 1 287 ? 8.296   23.748 126.630 1.00 40.27 ? 288  SER B O   1 
ATOM   5556 C CB  . SER B 1 287 ? 9.302   23.310 129.678 1.00 35.01 ? 288  SER B CB  1 
ATOM   5557 O OG  . SER B 1 287 ? 8.477   22.208 129.326 1.00 36.92 ? 288  SER B OG  1 
ATOM   5558 N N   . THR B 1 288 ? 10.485  24.253 126.935 1.00 44.78 ? 289  THR B N   1 
ATOM   5559 C CA  . THR B 1 288 ? 10.935  23.879 125.611 1.00 43.41 ? 289  THR B CA  1 
ATOM   5560 C C   . THR B 1 288 ? 10.587  22.438 125.292 1.00 47.36 ? 289  THR B C   1 
ATOM   5561 O O   . THR B 1 288 ? 10.058  22.136 124.223 1.00 51.66 ? 289  THR B O   1 
ATOM   5562 C CB  . THR B 1 288 ? 12.451  24.091 125.495 1.00 46.56 ? 289  THR B CB  1 
ATOM   5563 O OG1 . THR B 1 288 ? 12.719  25.498 125.413 1.00 49.66 ? 289  THR B OG1 1 
ATOM   5564 C CG2 . THR B 1 288 ? 13.003  23.405 124.259 1.00 41.50 ? 289  THR B CG2 1 
ATOM   5565 N N   . ASN B 1 289 ? 10.871  21.544 126.230 1.00 54.15 ? 290  ASN B N   1 
ATOM   5566 C CA  . ASN B 1 289 ? 10.619  20.126 126.015 1.00 51.31 ? 290  ASN B CA  1 
ATOM   5567 C C   . ASN B 1 289 ? 9.136   19.826 125.749 1.00 48.88 ? 290  ASN B C   1 
ATOM   5568 O O   . ASN B 1 289 ? 8.787   19.048 124.853 1.00 45.90 ? 290  ASN B O   1 
ATOM   5569 C CB  . ASN B 1 289 ? 11.157  19.309 127.197 1.00 61.08 ? 290  ASN B CB  1 
ATOM   5570 C CG  . ASN B 1 289 ? 12.688  19.222 127.208 1.00 66.54 ? 290  ASN B CG  1 
ATOM   5571 O OD1 . ASN B 1 289 ? 13.370  19.894 126.432 1.00 66.44 ? 290  ASN B OD1 1 
ATOM   5572 N ND2 . ASN B 1 289 ? 13.226  18.388 128.090 1.00 67.98 ? 290  ASN B ND2 1 
ATOM   5573 N N   . VAL B 1 290 ? 8.260   20.453 126.523 1.00 51.59 ? 291  VAL B N   1 
ATOM   5574 C CA  . VAL B 1 290 ? 6.831   20.254 126.323 1.00 51.50 ? 291  VAL B CA  1 
ATOM   5575 C C   . VAL B 1 290 ? 6.392   20.833 124.971 1.00 42.48 ? 291  VAL B C   1 
ATOM   5576 O O   . VAL B 1 290 ? 5.617   20.207 124.246 1.00 43.84 ? 291  VAL B O   1 
ATOM   5577 C CB  . VAL B 1 290 ? 5.995   20.812 127.504 1.00 50.37 ? 291  VAL B CB  1 
ATOM   5578 C CG1 . VAL B 1 290 ? 4.523   20.928 127.124 1.00 46.81 ? 291  VAL B CG1 1 
ATOM   5579 C CG2 . VAL B 1 290 ? 6.163   19.915 128.733 1.00 48.75 ? 291  VAL B CG2 1 
ATOM   5580 N N   . PHE B 1 291 ? 6.925   21.999 124.619 1.00 37.36 ? 292  PHE B N   1 
ATOM   5581 C CA  . PHE B 1 291 ? 6.615   22.595 123.328 1.00 38.24 ? 292  PHE B CA  1 
ATOM   5582 C C   . PHE B 1 291 ? 7.007   21.657 122.206 1.00 41.70 ? 292  PHE B C   1 
ATOM   5583 O O   . PHE B 1 291 ? 6.224   21.439 121.277 1.00 36.14 ? 292  PHE B O   1 
ATOM   5584 C CB  . PHE B 1 291 ? 7.323   23.930 123.143 1.00 39.54 ? 292  PHE B CB  1 
ATOM   5585 C CG  . PHE B 1 291 ? 7.098   24.556 121.781 1.00 43.14 ? 292  PHE B CG  1 
ATOM   5586 C CD1 . PHE B 1 291 ? 5.948   25.286 121.519 1.00 40.43 ? 292  PHE B CD1 1 
ATOM   5587 C CD2 . PHE B 1 291 ? 8.040   24.422 120.770 1.00 42.46 ? 292  PHE B CD2 1 
ATOM   5588 C CE1 . PHE B 1 291 ? 5.742   25.871 120.275 1.00 39.44 ? 292  PHE B CE1 1 
ATOM   5589 C CE2 . PHE B 1 291 ? 7.837   25.006 119.521 1.00 40.68 ? 292  PHE B CE2 1 
ATOM   5590 C CZ  . PHE B 1 291 ? 6.687   25.732 119.280 1.00 39.17 ? 292  PHE B CZ  1 
ATOM   5591 N N   . LYS B 1 292 ? 8.214   21.100 122.298 1.00 43.02 ? 293  LYS B N   1 
ATOM   5592 C CA  . LYS B 1 292 ? 8.720   20.226 121.249 1.00 44.50 ? 293  LYS B CA  1 
ATOM   5593 C C   . LYS B 1 292 ? 7.789   19.031 121.058 1.00 47.20 ? 293  LYS B C   1 
ATOM   5594 O O   . LYS B 1 292 ? 7.476   18.650 119.924 1.00 51.49 ? 293  LYS B O   1 
ATOM   5595 C CB  . LYS B 1 292 ? 10.151  19.775 121.556 1.00 49.27 ? 293  LYS B CB  1 
ATOM   5596 N N   . SER B 1 293 ? 7.325   18.458 122.167 1.00 46.12 ? 294  SER B N   1 
ATOM   5597 C CA  . SER B 1 293 ? 6.363   17.363 122.107 1.00 42.35 ? 294  SER B CA  1 
ATOM   5598 C C   . SER B 1 293 ? 5.084   17.792 121.397 1.00 46.45 ? 294  SER B C   1 
ATOM   5599 O O   . SER B 1 293 ? 4.620   17.103 120.485 1.00 49.28 ? 294  SER B O   1 
ATOM   5600 C CB  . SER B 1 293 ? 6.013   16.872 123.506 1.00 41.23 ? 294  SER B CB  1 
ATOM   5601 O OG  . SER B 1 293 ? 5.019   15.860 123.445 1.00 43.58 ? 294  SER B OG  1 
ATOM   5602 N N   . LEU B 1 294 ? 4.520   18.926 121.828 1.00 40.81 ? 295  LEU B N   1 
ATOM   5603 C CA  . LEU B 1 294 ? 3.280   19.449 121.250 1.00 42.70 ? 295  LEU B CA  1 
ATOM   5604 C C   . LEU B 1 294 ? 3.497   19.633 119.761 1.00 42.48 ? 295  LEU B C   1 
ATOM   5605 O O   . LEU B 1 294 ? 2.733   19.115 118.940 1.00 43.27 ? 295  LEU B O   1 
ATOM   5606 C CB  . LEU B 1 294 ? 2.884   20.788 121.897 1.00 33.70 ? 295  LEU B CB  1 
ATOM   5607 C CG  . LEU B 1 294 ? 2.368   20.702 123.341 1.00 38.67 ? 295  LEU B CG  1 
ATOM   5608 C CD1 . LEU B 1 294 ? 2.280   22.062 123.977 1.00 33.66 ? 295  LEU B CD1 1 
ATOM   5609 C CD2 . LEU B 1 294 ? 1.008   20.012 123.411 1.00 36.64 ? 295  LEU B CD2 1 
ATOM   5610 N N   . TYR B 1 295 ? 4.576   20.346 119.444 1.00 39.77 ? 296  TYR B N   1 
ATOM   5611 C CA  . TYR B 1 295 ? 5.022   20.583 118.078 1.00 40.72 ? 296  TYR B CA  1 
ATOM   5612 C C   . TYR B 1 295 ? 5.088   19.301 117.266 1.00 42.71 ? 296  TYR B C   1 
ATOM   5613 O O   . TYR B 1 295 ? 4.527   19.218 116.180 1.00 45.32 ? 296  TYR B O   1 
ATOM   5614 C CB  . TYR B 1 295 ? 6.396   21.244 118.095 1.00 42.24 ? 296  TYR B CB  1 
ATOM   5615 C CG  . TYR B 1 295 ? 6.814   21.801 116.761 1.00 42.44 ? 296  TYR B CG  1 
ATOM   5616 C CD1 . TYR B 1 295 ? 7.384   20.981 115.793 1.00 45.36 ? 296  TYR B CD1 1 
ATOM   5617 C CD2 . TYR B 1 295 ? 6.633   23.147 116.462 1.00 36.79 ? 296  TYR B CD2 1 
ATOM   5618 C CE1 . TYR B 1 295 ? 7.760   21.489 114.565 1.00 46.44 ? 296  TYR B CE1 1 
ATOM   5619 C CE2 . TYR B 1 295 ? 7.013   23.663 115.244 1.00 38.42 ? 296  TYR B CE2 1 
ATOM   5620 C CZ  . TYR B 1 295 ? 7.569   22.828 114.295 1.00 44.35 ? 296  TYR B CZ  1 
ATOM   5621 O OH  . TYR B 1 295 ? 7.946   23.328 113.076 1.00 47.16 ? 296  TYR B OH  1 
ATOM   5622 N N   . GLY B 1 296 ? 5.778   18.300 117.796 1.00 45.41 ? 297  GLY B N   1 
ATOM   5623 C CA  . GLY B 1 296 ? 5.893   17.030 117.112 1.00 47.23 ? 297  GLY B CA  1 
ATOM   5624 C C   . GLY B 1 296 ? 4.538   16.406 116.866 1.00 47.60 ? 297  GLY B C   1 
ATOM   5625 O O   . GLY B 1 296 ? 4.217   15.991 115.752 1.00 46.64 ? 297  GLY B O   1 
ATOM   5626 N N   . LYS B 1 297 ? 3.734   16.338 117.918 1.00 50.68 ? 298  LYS B N   1 
ATOM   5627 C CA  . LYS B 1 297 ? 2.387   15.797 117.801 1.00 52.29 ? 298  LYS B CA  1 
ATOM   5628 C C   . LYS B 1 297 ? 1.564   16.539 116.751 1.00 47.63 ? 298  LYS B C   1 
ATOM   5629 O O   . LYS B 1 297 ? 0.841   15.918 115.983 1.00 51.57 ? 298  LYS B O   1 
ATOM   5630 C CB  . LYS B 1 297 ? 1.680   15.818 119.157 1.00 50.99 ? 298  LYS B CB  1 
ATOM   5631 C CG  . LYS B 1 297 ? 2.045   14.651 120.040 1.00 47.10 ? 298  LYS B CG  1 
ATOM   5632 C CD  . LYS B 1 297 ? 1.572   14.856 121.464 1.00 46.87 ? 298  LYS B CD  1 
ATOM   5633 C CE  . LYS B 1 297 ? 1.823   13.605 122.291 1.00 47.25 ? 298  LYS B CE  1 
ATOM   5634 N NZ  . LYS B 1 297 ? 1.055   13.644 123.558 1.00 46.34 ? 298  LYS B NZ  1 
ATOM   5635 N N   . ILE B 1 298 ? 1.686   17.863 116.705 1.00 45.69 ? 299  ILE B N   1 
ATOM   5636 C CA  . ILE B 1 298 ? 0.907   18.639 115.748 1.00 46.10 ? 299  ILE B CA  1 
ATOM   5637 C C   . ILE B 1 298 ? 1.360   18.361 114.317 1.00 54.56 ? 299  ILE B C   1 
ATOM   5638 O O   . ILE B 1 298 ? 0.532   18.129 113.431 1.00 57.01 ? 299  ILE B O   1 
ATOM   5639 C CB  . ILE B 1 298 ? 0.971   20.145 116.035 1.00 42.83 ? 299  ILE B CB  1 
ATOM   5640 C CG1 . ILE B 1 298 ? 0.297   20.469 117.373 1.00 41.59 ? 299  ILE B CG1 1 
ATOM   5641 C CG2 . ILE B 1 298 ? 0.311   20.921 114.911 1.00 43.50 ? 299  ILE B CG2 1 
ATOM   5642 C CD1 . ILE B 1 298 ? 0.375   21.960 117.777 1.00 30.79 ? 299  ILE B CD1 1 
ATOM   5643 N N   . GLN B 1 299 ? 2.674   18.364 114.098 1.00 55.49 ? 300  GLN B N   1 
ATOM   5644 C CA  . GLN B 1 299 ? 3.224   18.150 112.762 1.00 55.64 ? 300  GLN B CA  1 
ATOM   5645 C C   . GLN B 1 299 ? 2.930   16.759 112.233 1.00 60.27 ? 300  GLN B C   1 
ATOM   5646 O O   . GLN B 1 299 ? 2.755   16.576 111.025 1.00 62.48 ? 300  GLN B O   1 
ATOM   5647 C CB  . GLN B 1 299 ? 4.726   18.435 112.726 1.00 55.02 ? 300  GLN B CB  1 
ATOM   5648 C CG  . GLN B 1 299 ? 5.101   19.850 113.165 1.00 55.85 ? 300  GLN B CG  1 
ATOM   5649 C CD  . GLN B 1 299 ? 4.496   20.952 112.295 1.00 58.20 ? 300  GLN B CD  1 
ATOM   5650 O OE1 . GLN B 1 299 ? 3.823   20.683 111.302 1.00 62.93 ? 300  GLN B OE1 1 
ATOM   5651 N NE2 . GLN B 1 299 ? 4.751   22.205 112.666 1.00 56.91 ? 300  GLN B NE2 1 
ATOM   5652 N N   . SER B 1 300 ? 2.878   15.786 113.138 1.00 60.64 ? 301  SER B N   1 
ATOM   5653 C CA  . SER B 1 300 ? 2.464   14.444 112.780 1.00 66.20 ? 301  SER B CA  1 
ATOM   5654 C C   . SER B 1 300 ? 1.131   14.568 112.078 1.00 68.98 ? 301  SER B C   1 
ATOM   5655 O O   . SER B 1 300 ? 0.982   14.166 110.924 1.00 73.99 ? 301  SER B O   1 
ATOM   5656 C CB  . SER B 1 300 ? 2.294   13.578 114.027 1.00 72.43 ? 301  SER B CB  1 
ATOM   5657 O OG  . SER B 1 300 ? 3.451   13.611 114.839 1.00 78.03 ? 301  SER B OG  1 
ATOM   5658 N N   . GLY B 1 301 ? 0.173   15.157 112.787 1.00 63.59 ? 302  GLY B N   1 
ATOM   5659 C CA  . GLY B 1 301 ? -1.170  15.332 112.277 1.00 56.63 ? 302  GLY B CA  1 
ATOM   5660 C C   . GLY B 1 301 ? -1.175  16.033 110.939 1.00 52.49 ? 302  GLY B C   1 
ATOM   5661 O O   . GLY B 1 301 ? -1.839  15.579 110.010 1.00 49.49 ? 302  GLY B O   1 
ATOM   5662 N N   . VAL B 1 302 ? -0.427  17.131 110.839 1.00 55.68 ? 303  VAL B N   1 
ATOM   5663 C CA  . VAL B 1 302 ? -0.353  17.897 109.598 1.00 58.15 ? 303  VAL B CA  1 
ATOM   5664 C C   . VAL B 1 302 ? 0.026   17.028 108.397 1.00 69.27 ? 303  VAL B C   1 
ATOM   5665 O O   . VAL B 1 302 ? -0.701  16.986 107.399 1.00 69.35 ? 303  VAL B O   1 
ATOM   5666 C CB  . VAL B 1 302 ? 0.642   19.057 109.701 1.00 55.76 ? 303  VAL B CB  1 
ATOM   5667 C CG1 . VAL B 1 302 ? 0.750   19.765 108.358 1.00 57.09 ? 303  VAL B CG1 1 
ATOM   5668 C CG2 . VAL B 1 302 ? 0.204   20.033 110.779 1.00 48.64 ? 303  VAL B CG2 1 
ATOM   5669 N N   . VAL B 1 303 ? 1.154   16.326 108.501 1.00 72.69 ? 304  VAL B N   1 
ATOM   5670 C CA  . VAL B 1 303 ? 1.614   15.472 107.408 1.00 68.16 ? 304  VAL B CA  1 
ATOM   5671 C C   . VAL B 1 303 ? 0.645   14.320 107.145 1.00 71.98 ? 304  VAL B C   1 
ATOM   5672 O O   . VAL B 1 303 ? 0.352   14.009 105.988 1.00 75.31 ? 304  VAL B O   1 
ATOM   5673 C CB  . VAL B 1 303 ? 3.042   14.952 107.639 1.00 63.04 ? 304  VAL B CB  1 
ATOM   5674 C CG1 . VAL B 1 303 ? 3.530   14.160 106.420 1.00 56.73 ? 304  VAL B CG1 1 
ATOM   5675 C CG2 . VAL B 1 303 ? 3.975   16.119 107.930 1.00 58.57 ? 304  VAL B CG2 1 
ATOM   5676 N N   . GLU B 1 304 ? 0.122   13.713 108.210 1.00 71.71 ? 305  GLU B N   1 
ATOM   5677 C CA  . GLU B 1 304 ? -0.915  12.683 108.073 1.00 69.46 ? 305  GLU B CA  1 
ATOM   5678 C C   . GLU B 1 304 ? -2.235  13.280 107.562 1.00 69.04 ? 305  GLU B C   1 
ATOM   5679 O O   . GLU B 1 304 ? -3.181  12.554 107.266 1.00 71.62 ? 305  GLU B O   1 
ATOM   5680 C CB  . GLU B 1 304 ? -1.135  11.937 109.395 1.00 63.98 ? 305  GLU B CB  1 
ATOM   5681 N N   . GLY B 1 305 ? -2.291  14.606 107.468 1.00 69.62 ? 306  GLY B N   1 
ATOM   5682 C CA  . GLY B 1 305 ? -3.443  15.299 106.909 1.00 68.04 ? 306  GLY B CA  1 
ATOM   5683 C C   . GLY B 1 305 ? -4.697  15.284 107.765 1.00 61.99 ? 306  GLY B C   1 
ATOM   5684 O O   . GLY B 1 305 ? -5.811  15.285 107.246 1.00 54.60 ? 306  GLY B O   1 
ATOM   5685 N N   . LYS B 1 306 ? -4.511  15.281 109.080 1.00 63.26 ? 307  LYS B N   1 
ATOM   5686 C CA  . LYS B 1 306 ? -5.615  15.220 110.031 1.00 59.29 ? 307  LYS B CA  1 
ATOM   5687 C C   . LYS B 1 306 ? -6.441  16.496 109.972 1.00 55.14 ? 307  LYS B C   1 
ATOM   5688 O O   . LYS B 1 306 ? -7.618  16.488 110.310 1.00 51.37 ? 307  LYS B O   1 
ATOM   5689 C CB  . LYS B 1 306 ? -5.069  15.043 111.453 1.00 57.56 ? 307  LYS B CB  1 
ATOM   5690 C CG  . LYS B 1 306 ? -5.610  13.843 112.208 1.00 64.21 ? 307  LYS B CG  1 
ATOM   5691 C CD  . LYS B 1 306 ? -4.496  13.156 113.013 1.00 70.87 ? 307  LYS B CD  1 
ATOM   5692 C CE  . LYS B 1 306 ? -4.750  13.203 114.521 1.00 69.73 ? 307  LYS B CE  1 
ATOM   5693 N NZ  . LYS B 1 306 ? -3.644  13.874 115.277 1.00 61.73 ? 307  LYS B NZ  1 
ATOM   5694 N N   . TYR B 1 307 ? -5.822  17.583 109.525 1.00 53.15 ? 308  TYR B N   1 
ATOM   5695 C CA  . TYR B 1 307 ? -6.390  18.918 109.708 1.00 49.27 ? 308  TYR B CA  1 
ATOM   5696 C C   . TYR B 1 307 ? -6.914  19.570 108.440 1.00 48.43 ? 308  TYR B C   1 
ATOM   5697 O O   . TYR B 1 307 ? -6.401  19.331 107.353 1.00 48.76 ? 308  TYR B O   1 
ATOM   5698 C CB  . TYR B 1 307 ? -5.351  19.831 110.356 1.00 34.94 ? 308  TYR B CB  1 
ATOM   5699 C CG  . TYR B 1 307 ? -4.819  19.256 111.636 1.00 38.00 ? 308  TYR B CG  1 
ATOM   5700 C CD1 . TYR B 1 307 ? -5.688  18.803 112.616 1.00 41.50 ? 308  TYR B CD1 1 
ATOM   5701 C CD2 . TYR B 1 307 ? -3.453  19.131 111.857 1.00 39.14 ? 308  TYR B CD2 1 
ATOM   5702 C CE1 . TYR B 1 307 ? -5.222  18.254 113.798 1.00 44.98 ? 308  TYR B CE1 1 
ATOM   5703 C CE2 . TYR B 1 307 ? -2.969  18.580 113.041 1.00 42.04 ? 308  TYR B CE2 1 
ATOM   5704 C CZ  . TYR B 1 307 ? -3.865  18.145 114.007 1.00 47.03 ? 308  TYR B CZ  1 
ATOM   5705 O OH  . TYR B 1 307 ? -3.420  17.601 115.190 1.00 51.53 ? 308  TYR B OH  1 
ATOM   5706 N N   . ARG B 1 308 ? -7.932  20.410 108.610 1.00 51.57 ? 309  ARG B N   1 
ATOM   5707 C CA  . ARG B 1 308 ? -8.543  21.156 107.521 1.00 51.57 ? 309  ARG B CA  1 
ATOM   5708 C C   . ARG B 1 308 ? -7.620  22.249 107.038 1.00 55.16 ? 309  ARG B C   1 
ATOM   5709 O O   . ARG B 1 308 ? -7.633  22.604 105.864 1.00 60.69 ? 309  ARG B O   1 
ATOM   5710 C CB  . ARG B 1 308 ? -9.851  21.794 107.994 1.00 52.46 ? 309  ARG B CB  1 
ATOM   5711 N N   . ASP B 1 309 ? -6.837  22.799 107.963 1.00 52.85 ? 310  ASP B N   1 
ATOM   5712 C CA  . ASP B 1 309 ? -5.952  23.924 107.682 1.00 46.65 ? 310  ASP B CA  1 
ATOM   5713 C C   . ASP B 1 309 ? -4.540  23.639 108.166 1.00 40.52 ? 310  ASP B C   1 
ATOM   5714 O O   . ASP B 1 309 ? -4.316  22.715 108.941 1.00 40.31 ? 310  ASP B O   1 
ATOM   5715 C CB  . ASP B 1 309 ? -6.437  25.174 108.417 1.00 50.92 ? 310  ASP B CB  1 
ATOM   5716 C CG  . ASP B 1 309 ? -7.653  25.800 107.775 1.00 61.60 ? 310  ASP B CG  1 
ATOM   5717 O OD1 . ASP B 1 309 ? -7.477  26.598 106.830 1.00 64.69 ? 310  ASP B OD1 1 
ATOM   5718 O OD2 . ASP B 1 309 ? -8.781  25.512 108.227 1.00 66.38 ? 310  ASP B OD2 1 
ATOM   5719 N N   . TYR B 1 310 ? -3.588  24.452 107.730 1.00 41.23 ? 311  TYR B N   1 
ATOM   5720 C CA  . TYR B 1 310 ? -2.282  24.454 108.381 1.00 46.88 ? 311  TYR B CA  1 
ATOM   5721 C C   . TYR B 1 310 ? -2.397  25.165 109.721 1.00 47.11 ? 311  TYR B C   1 
ATOM   5722 O O   . TYR B 1 310 ? -2.569  26.380 109.772 1.00 51.25 ? 311  TYR B O   1 
ATOM   5723 C CB  . TYR B 1 310 ? -1.218  25.108 107.497 1.00 45.30 ? 311  TYR B CB  1 
ATOM   5724 C CG  . TYR B 1 310 ? -0.752  24.176 106.410 1.00 46.22 ? 311  TYR B CG  1 
ATOM   5725 C CD1 . TYR B 1 310 ? -0.034  23.028 106.725 1.00 47.49 ? 311  TYR B CD1 1 
ATOM   5726 C CD2 . TYR B 1 310 ? -1.044  24.422 105.077 1.00 42.44 ? 311  TYR B CD2 1 
ATOM   5727 C CE1 . TYR B 1 310 ? 0.392   22.160 105.745 1.00 52.37 ? 311  TYR B CE1 1 
ATOM   5728 C CE2 . TYR B 1 310 ? -0.621  23.550 104.083 1.00 42.50 ? 311  TYR B CE2 1 
ATOM   5729 C CZ  . TYR B 1 310 ? 0.092   22.429 104.423 1.00 52.40 ? 311  TYR B CZ  1 
ATOM   5730 O OH  . TYR B 1 310 ? 0.510   21.560 103.444 1.00 62.15 ? 311  TYR B OH  1 
ATOM   5731 N N   . PRO B 1 311 ? -2.327  24.402 110.816 1.00 45.89 ? 312  PRO B N   1 
ATOM   5732 C CA  . PRO B 1 311 ? -2.488  25.019 112.130 1.00 45.16 ? 312  PRO B CA  1 
ATOM   5733 C C   . PRO B 1 311 ? -1.338  25.968 112.433 1.00 43.28 ? 312  PRO B C   1 
ATOM   5734 O O   . PRO B 1 311 ? -0.248  25.805 111.891 1.00 41.75 ? 312  PRO B O   1 
ATOM   5735 C CB  . PRO B 1 311 ? -2.497  23.823 113.086 1.00 48.48 ? 312  PRO B CB  1 
ATOM   5736 C CG  . PRO B 1 311 ? -1.827  22.746 112.362 1.00 51.75 ? 312  PRO B CG  1 
ATOM   5737 C CD  . PRO B 1 311 ? -2.075  22.956 110.904 1.00 48.77 ? 312  PRO B CD  1 
ATOM   5738 N N   . ARG B 1 312 ? -1.601  26.980 113.252 1.00 43.01 ? 313  ARG B N   1 
ATOM   5739 C CA  . ARG B 1 312 ? -0.567  27.927 113.649 1.00 42.32 ? 313  ARG B CA  1 
ATOM   5740 C C   . ARG B 1 312 ? -0.046  27.605 115.045 1.00 43.53 ? 313  ARG B C   1 
ATOM   5741 O O   . ARG B 1 312 ? -0.822  27.438 115.985 1.00 44.53 ? 313  ARG B O   1 
ATOM   5742 C CB  . ARG B 1 312 ? -1.103  29.357 113.606 1.00 39.72 ? 313  ARG B CB  1 
ATOM   5743 C CG  . ARG B 1 312 ? -1.514  29.808 112.220 1.00 48.71 ? 313  ARG B CG  1 
ATOM   5744 C CD  . ARG B 1 312 ? -1.880  31.288 112.190 1.00 53.18 ? 313  ARG B CD  1 
ATOM   5745 N NE  . ARG B 1 312 ? -2.206  31.733 110.839 1.00 56.16 ? 313  ARG B NE  1 
ATOM   5746 C CZ  . ARG B 1 312 ? -2.636  32.954 110.539 1.00 60.73 ? 313  ARG B CZ  1 
ATOM   5747 N NH1 . ARG B 1 312 ? -2.792  33.855 111.496 1.00 58.35 ? 313  ARG B NH1 1 
ATOM   5748 N NH2 . ARG B 1 312 ? -2.912  33.274 109.281 1.00 63.88 ? 313  ARG B NH2 1 
ATOM   5749 N N   . ILE B 1 313 ? 1.271   27.516 115.177 1.00 40.29 ? 314  ILE B N   1 
ATOM   5750 C CA  . ILE B 1 313 ? 1.872   27.211 116.461 1.00 36.55 ? 314  ILE B CA  1 
ATOM   5751 C C   . ILE B 1 313 ? 2.510   28.459 117.050 1.00 40.33 ? 314  ILE B C   1 
ATOM   5752 O O   . ILE B 1 313 ? 3.574   28.881 116.615 1.00 48.56 ? 314  ILE B O   1 
ATOM   5753 C CB  . ILE B 1 313 ? 2.901   26.091 116.322 1.00 36.97 ? 314  ILE B CB  1 
ATOM   5754 C CG1 . ILE B 1 313 ? 2.240   24.864 115.697 1.00 38.29 ? 314  ILE B CG1 1 
ATOM   5755 C CG2 . ILE B 1 313 ? 3.481   25.734 117.673 1.00 43.39 ? 314  ILE B CG2 1 
ATOM   5756 C CD1 . ILE B 1 313 ? 3.200   23.777 115.313 1.00 44.92 ? 314  ILE B CD1 1 
ATOM   5757 N N   . ILE B 1 314 ? 1.839   29.068 118.022 1.00 35.96 ? 315  ILE B N   1 
ATOM   5758 C CA  . ILE B 1 314 ? 2.354   30.267 118.665 1.00 34.09 ? 315  ILE B CA  1 
ATOM   5759 C C   . ILE B 1 314 ? 2.811   29.895 120.067 1.00 47.24 ? 315  ILE B C   1 
ATOM   5760 O O   . ILE B 1 314 ? 1.999   29.792 120.993 1.00 48.04 ? 315  ILE B O   1 
ATOM   5761 C CB  . ILE B 1 314 ? 1.295   31.380 118.753 1.00 35.53 ? 315  ILE B CB  1 
ATOM   5762 C CG1 . ILE B 1 314 ? 0.807   31.787 117.355 1.00 37.61 ? 315  ILE B CG1 1 
ATOM   5763 C CG2 . ILE B 1 314 ? 1.847   32.601 119.482 1.00 33.63 ? 315  ILE B CG2 1 
ATOM   5764 C CD1 . ILE B 1 314 ? -0.470  31.114 116.926 1.00 32.00 ? 315  ILE B CD1 1 
ATOM   5765 N N   . GLY B 1 315 ? 4.115   29.689 120.219 1.00 49.50 ? 316  GLY B N   1 
ATOM   5766 C CA  . GLY B 1 315 ? 4.665   29.223 121.477 1.00 49.68 ? 316  GLY B CA  1 
ATOM   5767 C C   . GLY B 1 315 ? 5.782   30.097 122.009 1.00 46.36 ? 316  GLY B C   1 
ATOM   5768 O O   . GLY B 1 315 ? 6.648   30.535 121.259 1.00 40.05 ? 316  GLY B O   1 
ATOM   5769 N N   . GLU B 1 316 ? 5.747   30.356 123.314 1.00 45.50 ? 317  GLU B N   1 
ATOM   5770 C CA  . GLU B 1 316 ? 6.825   31.055 124.001 1.00 42.43 ? 317  GLU B CA  1 
ATOM   5771 C C   . GLU B 1 316 ? 7.469   30.095 125.008 1.00 49.84 ? 317  GLU B C   1 
ATOM   5772 O O   . GLU B 1 316 ? 6.795   29.511 125.866 1.00 46.85 ? 317  GLU B O   1 
ATOM   5773 C CB  . GLU B 1 316 ? 6.311   32.319 124.699 1.00 40.20 ? 317  GLU B CB  1 
ATOM   5774 N N   . THR B 1 317 ? 8.775   29.914 124.883 1.00 51.19 ? 318  THR B N   1 
ATOM   5775 C CA  . THR B 1 317 ? 9.497   29.025 125.773 1.00 55.13 ? 318  THR B CA  1 
ATOM   5776 C C   . THR B 1 317 ? 10.424  29.857 126.637 1.00 57.25 ? 318  THR B C   1 
ATOM   5777 O O   . THR B 1 317 ? 10.500  31.080 126.487 1.00 55.58 ? 318  THR B O   1 
ATOM   5778 C CB  . THR B 1 317 ? 10.311  27.980 124.989 1.00 57.98 ? 318  THR B CB  1 
ATOM   5779 O OG1 . THR B 1 317 ? 11.181  28.646 124.062 1.00 65.73 ? 318  THR B OG1 1 
ATOM   5780 C CG2 . THR B 1 317 ? 9.387   27.057 124.221 1.00 53.42 ? 318  THR B CG2 1 
ATOM   5781 N N   . GLY B 1 318 ? 11.118  29.197 127.553 1.00 62.67 ? 319  GLY B N   1 
ATOM   5782 C CA  . GLY B 1 318 ? 12.111  29.876 128.358 1.00 64.47 ? 319  GLY B CA  1 
ATOM   5783 C C   . GLY B 1 318 ? 13.432  29.946 127.619 1.00 61.18 ? 319  GLY B C   1 
ATOM   5784 O O   . GLY B 1 318 ? 13.495  29.809 126.395 1.00 59.17 ? 319  GLY B O   1 
ATOM   5785 N N   . GLY B 1 319 ? 14.497  30.165 128.375 1.00 58.74 ? 320  GLY B N   1 
ATOM   5786 C CA  . GLY B 1 319 ? 15.835  30.158 127.826 1.00 51.30 ? 320  GLY B CA  1 
ATOM   5787 C C   . GLY B 1 319 ? 16.787  30.002 128.981 1.00 44.45 ? 320  GLY B C   1 
ATOM   5788 O O   . GLY B 1 319 ? 16.363  29.885 130.124 1.00 52.49 ? 320  GLY B O   1 
ATOM   5789 N N   . LYS B 1 320 ? 18.075  29.972 128.688 1.00 36.35 ? 321  LYS B N   1 
ATOM   5790 C CA  . LYS B 1 320 ? 19.074  30.059 129.734 1.00 35.17 ? 321  LYS B CA  1 
ATOM   5791 C C   . LYS B 1 320 ? 19.575  31.503 129.702 1.00 33.85 ? 321  LYS B C   1 
ATOM   5792 O O   . LYS B 1 320 ? 20.515  31.839 128.977 1.00 30.19 ? 321  LYS B O   1 
ATOM   5793 C CB  . LYS B 1 320 ? 20.212  29.086 129.454 1.00 34.36 ? 321  LYS B CB  1 
ATOM   5794 C CG  . LYS B 1 320 ? 21.167  28.920 130.610 1.00 36.12 ? 321  LYS B CG  1 
ATOM   5795 C CD  . LYS B 1 320 ? 20.615  27.973 131.660 1.00 39.75 ? 321  LYS B CD  1 
ATOM   5796 C CE  . LYS B 1 320 ? 21.603  27.800 132.814 1.00 40.57 ? 321  LYS B CE  1 
ATOM   5797 N NZ  . LYS B 1 320 ? 21.005  27.060 133.953 1.00 35.44 ? 321  LYS B NZ  1 
ATOM   5798 N N   . ASN B 1 321 ? 18.924  32.373 130.458 1.00 32.23 ? 322  ASN B N   1 
ATOM   5799 C CA  . ASN B 1 321 ? 19.210  33.791 130.330 1.00 27.72 ? 322  ASN B CA  1 
ATOM   5800 C C   . ASN B 1 321 ? 20.489  34.167 131.059 1.00 30.59 ? 322  ASN B C   1 
ATOM   5801 O O   . ASN B 1 321 ? 20.817  33.573 132.085 1.00 31.88 ? 322  ASN B O   1 
ATOM   5802 C CB  . ASN B 1 321 ? 17.998  34.574 130.798 1.00 26.90 ? 322  ASN B CB  1 
ATOM   5803 C CG  . ASN B 1 321 ? 16.716  34.027 130.186 1.00 30.95 ? 322  ASN B CG  1 
ATOM   5804 O OD1 . ASN B 1 321 ? 16.584  33.956 128.961 1.00 26.51 ? 322  ASN B OD1 1 
ATOM   5805 N ND2 . ASN B 1 321 ? 15.790  33.605 131.027 1.00 33.23 ? 322  ASN B ND2 1 
ATOM   5806 N N   . PHE B 1 322 ? 21.228  35.125 130.507 1.00 32.69 ? 323  PHE B N   1 
ATOM   5807 C CA  . PHE B 1 322 ? 22.560  35.434 131.015 1.00 31.87 ? 323  PHE B CA  1 
ATOM   5808 C C   . PHE B 1 322 ? 22.696  36.848 131.562 1.00 31.90 ? 323  PHE B C   1 
ATOM   5809 O O   . PHE B 1 322 ? 22.038  37.785 131.095 1.00 29.98 ? 323  PHE B O   1 
ATOM   5810 C CB  . PHE B 1 322 ? 23.634  35.196 129.938 1.00 28.58 ? 323  PHE B CB  1 
ATOM   5811 C CG  . PHE B 1 322 ? 23.491  36.072 128.708 1.00 31.85 ? 323  PHE B CG  1 
ATOM   5812 C CD1 . PHE B 1 322 ? 22.820  35.616 127.584 1.00 33.31 ? 323  PHE B CD1 1 
ATOM   5813 C CD2 . PHE B 1 322 ? 24.054  37.335 128.664 1.00 36.50 ? 323  PHE B CD2 1 
ATOM   5814 C CE1 . PHE B 1 322 ? 22.696  36.414 126.456 1.00 34.98 ? 323  PHE B CE1 1 
ATOM   5815 C CE2 . PHE B 1 322 ? 23.926  38.135 127.536 1.00 34.75 ? 323  PHE B CE2 1 
ATOM   5816 C CZ  . PHE B 1 322 ? 23.252  37.674 126.436 1.00 32.09 ? 323  PHE B CZ  1 
ATOM   5817 N N   . HIS B 1 323 ? 23.570  36.978 132.554 1.00 30.42 ? 324  HIS B N   1 
ATOM   5818 C CA  . HIS B 1 323 ? 24.076  38.264 132.999 1.00 31.97 ? 324  HIS B CA  1 
ATOM   5819 C C   . HIS B 1 323 ? 25.576  38.282 132.703 1.00 31.98 ? 324  HIS B C   1 
ATOM   5820 O O   . HIS B 1 323 ? 26.318  37.426 133.173 1.00 33.51 ? 324  HIS B O   1 
ATOM   5821 C CB  . HIS B 1 323 ? 23.819  38.473 134.498 1.00 31.87 ? 324  HIS B CB  1 
ATOM   5822 C CG  . HIS B 1 323 ? 22.471  39.056 134.807 1.00 31.75 ? 324  HIS B CG  1 
ATOM   5823 N ND1 . HIS B 1 323 ? 22.158  39.601 136.037 1.00 32.80 ? 324  HIS B ND1 1 
ATOM   5824 C CD2 . HIS B 1 323 ? 21.356  39.179 134.048 1.00 28.97 ? 324  HIS B CD2 1 
ATOM   5825 C CE1 . HIS B 1 323 ? 20.910  40.042 136.017 1.00 28.51 ? 324  HIS B CE1 1 
ATOM   5826 N NE2 . HIS B 1 323 ? 20.403  39.797 134.822 1.00 30.28 ? 324  HIS B NE2 1 
ATOM   5827 N N   . LEU B 1 324 ? 26.010  39.240 131.894 1.00 34.11 ? 325  LEU B N   1 
ATOM   5828 C CA  . LEU B 1 324 ? 27.420  39.378 131.556 1.00 29.37 ? 325  LEU B CA  1 
ATOM   5829 C C   . LEU B 1 324 ? 27.955  40.633 132.239 1.00 29.65 ? 325  LEU B C   1 
ATOM   5830 O O   . LEU B 1 324 ? 27.455  41.734 132.017 1.00 33.78 ? 325  LEU B O   1 
ATOM   5831 C CB  . LEU B 1 324 ? 27.598  39.462 130.036 1.00 29.09 ? 325  LEU B CB  1 
ATOM   5832 C CG  . LEU B 1 324 ? 28.947  39.944 129.489 1.00 32.98 ? 325  LEU B CG  1 
ATOM   5833 C CD1 . LEU B 1 324 ? 30.070  38.988 129.893 1.00 30.73 ? 325  LEU B CD1 1 
ATOM   5834 C CD2 . LEU B 1 324 ? 28.901  40.137 127.974 1.00 31.79 ? 325  LEU B CD2 1 
ATOM   5835 N N   . VAL B 1 325 ? 28.952  40.463 133.095 1.00 31.46 ? 326  VAL B N   1 
ATOM   5836 C CA  . VAL B 1 325 ? 29.505  41.590 133.821 1.00 33.43 ? 326  VAL B CA  1 
ATOM   5837 C C   . VAL B 1 325 ? 30.870  41.972 133.269 1.00 35.21 ? 326  VAL B C   1 
ATOM   5838 O O   . VAL B 1 325 ? 31.793  41.164 133.272 1.00 35.24 ? 326  VAL B O   1 
ATOM   5839 C CB  . VAL B 1 325 ? 29.619  41.286 135.321 1.00 35.67 ? 326  VAL B CB  1 
ATOM   5840 C CG1 . VAL B 1 325 ? 30.398  42.392 136.028 1.00 36.54 ? 326  VAL B CG1 1 
ATOM   5841 C CG2 . VAL B 1 325 ? 28.234  41.127 135.922 1.00 31.88 ? 326  VAL B CG2 1 
ATOM   5842 N N   . HIS B 1 326 ? 30.970  43.198 132.772 1.00 33.17 ? 327  HIS B N   1 
ATOM   5843 C CA  . HIS B 1 326 ? 32.216  43.750 132.255 1.00 38.66 ? 327  HIS B CA  1 
ATOM   5844 C C   . HIS B 1 326 ? 33.017  44.358 133.411 1.00 37.23 ? 327  HIS B C   1 
ATOM   5845 O O   . HIS B 1 326 ? 32.433  44.833 134.383 1.00 44.28 ? 327  HIS B O   1 
ATOM   5846 C CB  . HIS B 1 326 ? 31.894  44.815 131.201 1.00 39.65 ? 327  HIS B CB  1 
ATOM   5847 C CG  . HIS B 1 326 ? 33.099  45.403 130.541 1.00 43.82 ? 327  HIS B CG  1 
ATOM   5848 N ND1 . HIS B 1 326 ? 33.817  46.443 131.092 1.00 48.52 ? 327  HIS B ND1 1 
ATOM   5849 C CD2 . HIS B 1 326 ? 33.721  45.088 129.380 1.00 42.57 ? 327  HIS B CD2 1 
ATOM   5850 C CE1 . HIS B 1 326 ? 34.822  46.752 130.292 1.00 52.03 ? 327  HIS B CE1 1 
ATOM   5851 N NE2 . HIS B 1 326 ? 34.786  45.945 129.248 1.00 48.18 ? 327  HIS B NE2 1 
ATOM   5852 N N   . PRO B 1 327 ? 34.354  44.335 133.322 1.00 41.44 ? 328  PRO B N   1 
ATOM   5853 C CA  . PRO B 1 327 ? 35.170  44.839 134.436 1.00 44.83 ? 328  PRO B CA  1 
ATOM   5854 C C   . PRO B 1 327 ? 34.892  46.291 134.826 1.00 44.46 ? 328  PRO B C   1 
ATOM   5855 O O   . PRO B 1 327 ? 35.208  46.681 135.949 1.00 48.32 ? 328  PRO B O   1 
ATOM   5856 C CB  . PRO B 1 327 ? 36.608  44.675 133.930 1.00 45.96 ? 328  PRO B CB  1 
ATOM   5857 C CG  . PRO B 1 327 ? 36.505  44.245 132.498 1.00 47.27 ? 328  PRO B CG  1 
ATOM   5858 C CD  . PRO B 1 327 ? 35.172  43.625 132.327 1.00 44.11 ? 328  PRO B CD  1 
ATOM   5859 N N   . SER B 1 328 ? 34.286  47.068 133.931 1.00 40.38 ? 329  SER B N   1 
ATOM   5860 C CA  . SER B 1 328 ? 33.990  48.460 134.228 1.00 41.43 ? 329  SER B CA  1 
ATOM   5861 C C   . SER B 1 328 ? 32.638  48.648 134.917 1.00 45.34 ? 329  SER B C   1 
ATOM   5862 O O   . SER B 1 328 ? 32.204  49.777 135.122 1.00 46.40 ? 329  SER B O   1 
ATOM   5863 C CB  . SER B 1 328 ? 34.026  49.304 132.949 1.00 40.89 ? 329  SER B CB  1 
ATOM   5864 O OG  . SER B 1 328 ? 32.858  49.116 132.166 1.00 37.40 ? 329  SER B OG  1 
ATOM   5865 N N   . ALA B 1 329 ? 31.972  47.555 135.274 1.00 43.01 ? 330  ALA B N   1 
ATOM   5866 C CA  . ALA B 1 329 ? 30.612  47.650 135.801 1.00 43.92 ? 330  ALA B CA  1 
ATOM   5867 C C   . ALA B 1 329 ? 30.592  48.233 137.202 1.00 43.18 ? 330  ALA B C   1 
ATOM   5868 O O   . ALA B 1 329 ? 31.537  48.053 137.967 1.00 43.11 ? 330  ALA B O   1 
ATOM   5869 C CB  . ALA B 1 329 ? 29.935  46.284 135.795 1.00 43.85 ? 330  ALA B CB  1 
ATOM   5870 N N   . ASN B 1 330 ? 29.517  48.942 137.538 1.00 41.67 ? 331  ASN B N   1 
ATOM   5871 C CA  . ASN B 1 330 ? 29.287  49.268 138.934 1.00 42.57 ? 331  ASN B CA  1 
ATOM   5872 C C   . ASN B 1 330 ? 28.907  47.966 139.609 1.00 40.84 ? 331  ASN B C   1 
ATOM   5873 O O   . ASN B 1 330 ? 27.832  47.415 139.356 1.00 39.42 ? 331  ASN B O   1 
ATOM   5874 C CB  . ASN B 1 330 ? 28.184  50.302 139.108 1.00 46.97 ? 331  ASN B CB  1 
ATOM   5875 C CG  . ASN B 1 330 ? 27.877  50.567 140.572 1.00 56.04 ? 331  ASN B CG  1 
ATOM   5876 O OD1 . ASN B 1 330 ? 27.027  49.908 141.170 1.00 55.18 ? 331  ASN B OD1 1 
ATOM   5877 N ND2 . ASN B 1 330 ? 28.593  51.519 141.166 1.00 60.00 ? 331  ASN B ND2 1 
ATOM   5878 N N   . ILE B 1 331 ? 29.804  47.455 140.440 1.00 43.02 ? 332  ILE B N   1 
ATOM   5879 C CA  . ILE B 1 331 ? 29.693  46.080 140.912 1.00 44.57 ? 332  ILE B CA  1 
ATOM   5880 C C   . ILE B 1 331 ? 28.471  45.876 141.793 1.00 47.84 ? 332  ILE B C   1 
ATOM   5881 O O   . ILE B 1 331 ? 27.772  44.874 141.676 1.00 48.25 ? 332  ILE B O   1 
ATOM   5882 C CB  . ILE B 1 331 ? 30.974  45.639 141.634 1.00 48.49 ? 332  ILE B CB  1 
ATOM   5883 C CG1 . ILE B 1 331 ? 32.108  45.487 140.616 1.00 49.29 ? 332  ILE B CG1 1 
ATOM   5884 C CG2 . ILE B 1 331 ? 30.765  44.322 142.384 1.00 50.28 ? 332  ILE B CG2 1 
ATOM   5885 C CD1 . ILE B 1 331 ? 31.774  44.556 139.464 1.00 42.56 ? 332  ILE B CD1 1 
ATOM   5886 N N   . SER B 1 332 ? 28.201  46.851 142.648 1.00 47.46 ? 333  SER B N   1 
ATOM   5887 C CA  . SER B 1 332 ? 27.093  46.770 143.585 1.00 48.37 ? 333  SER B CA  1 
ATOM   5888 C C   . SER B 1 332 ? 25.743  46.651 142.873 1.00 45.46 ? 333  SER B C   1 
ATOM   5889 O O   . SER B 1 332 ? 24.884  45.861 143.270 1.00 44.45 ? 333  SER B O   1 
ATOM   5890 C CB  . SER B 1 332 ? 27.109  48.000 144.495 1.00 52.77 ? 333  SER B CB  1 
ATOM   5891 O OG  . SER B 1 332 ? 25.909  48.097 145.233 1.00 58.57 ? 333  SER B OG  1 
ATOM   5892 N N   . HIS B 1 333 ? 25.569  47.434 141.815 1.00 42.19 ? 334  HIS B N   1 
ATOM   5893 C CA  . HIS B 1 333 ? 24.330  47.425 141.051 1.00 40.96 ? 334  HIS B CA  1 
ATOM   5894 C C   . HIS B 1 333 ? 24.187  46.104 140.320 1.00 40.94 ? 334  HIS B C   1 
ATOM   5895 O O   . HIS B 1 333 ? 23.093  45.550 140.228 1.00 36.75 ? 334  HIS B O   1 
ATOM   5896 C CB  . HIS B 1 333 ? 24.315  48.573 140.039 1.00 39.88 ? 334  HIS B CB  1 
ATOM   5897 C CG  . HIS B 1 333 ? 23.132  48.554 139.123 1.00 41.66 ? 334  HIS B CG  1 
ATOM   5898 N ND1 . HIS B 1 333 ? 21.857  48.867 139.543 1.00 43.33 ? 334  HIS B ND1 1 
ATOM   5899 C CD2 . HIS B 1 333 ? 23.029  48.252 137.804 1.00 39.75 ? 334  HIS B CD2 1 
ATOM   5900 C CE1 . HIS B 1 333 ? 21.020  48.767 138.524 1.00 39.21 ? 334  HIS B CE1 1 
ATOM   5901 N NE2 . HIS B 1 333 ? 21.707  48.398 137.456 1.00 41.18 ? 334  HIS B NE2 1 
ATOM   5902 N N   . ALA B 1 334 ? 25.302  45.609 139.794 1.00 37.58 ? 335  ALA B N   1 
ATOM   5903 C CA  . ALA B 1 334 ? 25.302  44.344 139.078 1.00 36.37 ? 335  ALA B CA  1 
ATOM   5904 C C   . ALA B 1 334 ? 24.926  43.200 140.018 1.00 39.14 ? 335  ALA B C   1 
ATOM   5905 O O   . ALA B 1 334 ? 24.190  42.283 139.632 1.00 36.57 ? 335  ALA B O   1 
ATOM   5906 C CB  . ALA B 1 334 ? 26.657  44.098 138.449 1.00 32.18 ? 335  ALA B CB  1 
ATOM   5907 N N   . VAL B 1 335 ? 25.426  43.261 141.251 1.00 36.53 ? 336  VAL B N   1 
ATOM   5908 C CA  . VAL B 1 335 ? 25.134  42.231 142.244 1.00 40.29 ? 336  VAL B CA  1 
ATOM   5909 C C   . VAL B 1 335 ? 23.649  42.216 142.613 1.00 42.94 ? 336  VAL B C   1 
ATOM   5910 O O   . VAL B 1 335 ? 22.996  41.174 142.593 1.00 41.97 ? 336  VAL B O   1 
ATOM   5911 C CB  . VAL B 1 335 ? 25.961  42.429 143.525 1.00 42.25 ? 336  VAL B CB  1 
ATOM   5912 C CG1 . VAL B 1 335 ? 25.468  41.498 144.630 1.00 43.30 ? 336  VAL B CG1 1 
ATOM   5913 C CG2 . VAL B 1 335 ? 27.440  42.189 143.255 1.00 42.62 ? 336  VAL B CG2 1 
ATOM   5914 N N   . LEU B 1 336 ? 23.124  43.382 142.956 1.00 42.49 ? 337  LEU B N   1 
ATOM   5915 C CA  . LEU B 1 336 ? 21.736  43.489 143.349 1.00 40.09 ? 337  LEU B CA  1 
ATOM   5916 C C   . LEU B 1 336 ? 20.811  43.052 142.212 1.00 41.25 ? 337  LEU B C   1 
ATOM   5917 O O   . LEU B 1 336 ? 19.837  42.326 142.435 1.00 39.56 ? 337  LEU B O   1 
ATOM   5918 C CB  . LEU B 1 336 ? 21.428  44.919 143.785 1.00 39.67 ? 337  LEU B CB  1 
ATOM   5919 C CG  . LEU B 1 336 ? 21.987  45.266 145.157 1.00 45.08 ? 337  LEU B CG  1 
ATOM   5920 C CD1 . LEU B 1 336 ? 21.768  46.741 145.496 1.00 42.79 ? 337  LEU B CD1 1 
ATOM   5921 C CD2 . LEU B 1 336 ? 21.345  44.360 146.196 1.00 49.09 ? 337  LEU B CD2 1 
ATOM   5922 N N   . SER B 1 337 ? 21.129  43.488 140.998 1.00 38.80 ? 338  SER B N   1 
ATOM   5923 C CA  . SER B 1 337 ? 20.358  43.117 139.821 1.00 37.32 ? 338  SER B CA  1 
ATOM   5924 C C   . SER B 1 337 ? 20.395  41.605 139.589 1.00 37.08 ? 338  SER B C   1 
ATOM   5925 O O   . SER B 1 337 ? 19.403  41.013 139.182 1.00 32.77 ? 338  SER B O   1 
ATOM   5926 C CB  . SER B 1 337 ? 20.885  43.848 138.576 1.00 41.34 ? 338  SER B CB  1 
ATOM   5927 O OG  . SER B 1 337 ? 20.949  45.250 138.790 1.00 40.20 ? 338  SER B OG  1 
ATOM   5928 N N   . THR B 1 338 ? 21.540  40.988 139.853 1.00 35.77 ? 339  THR B N   1 
ATOM   5929 C CA  . THR B 1 338 ? 21.692  39.558 139.618 1.00 38.79 ? 339  THR B CA  1 
ATOM   5930 C C   . THR B 1 338 ? 20.903  38.743 140.644 1.00 41.27 ? 339  THR B C   1 
ATOM   5931 O O   . THR B 1 338 ? 20.297  37.726 140.310 1.00 37.68 ? 339  THR B O   1 
ATOM   5932 C CB  . THR B 1 338 ? 23.173  39.151 139.603 1.00 34.59 ? 339  THR B CB  1 
ATOM   5933 O OG1 . THR B 1 338 ? 23.844  39.885 138.571 1.00 35.38 ? 339  THR B OG1 1 
ATOM   5934 C CG2 . THR B 1 338 ? 23.324  37.676 139.313 1.00 32.71 ? 339  THR B CG2 1 
ATOM   5935 N N   . ILE B 1 339 ? 20.893  39.208 141.887 1.00 41.15 ? 340  ILE B N   1 
ATOM   5936 C CA  . ILE B 1 339 ? 20.069  38.591 142.925 1.00 40.88 ? 340  ILE B CA  1 
ATOM   5937 C C   . ILE B 1 339 ? 18.592  38.640 142.553 1.00 37.42 ? 340  ILE B C   1 
ATOM   5938 O O   . ILE B 1 339 ? 17.909  37.610 142.552 1.00 35.96 ? 340  ILE B O   1 
ATOM   5939 C CB  . ILE B 1 339 ? 20.291  39.266 144.288 1.00 45.39 ? 340  ILE B CB  1 
ATOM   5940 C CG1 . ILE B 1 339 ? 21.716  38.973 144.769 1.00 47.04 ? 340  ILE B CG1 1 
ATOM   5941 C CG2 . ILE B 1 339 ? 19.236  38.803 145.299 1.00 36.68 ? 340  ILE B CG2 1 
ATOM   5942 C CD1 . ILE B 1 339 ? 22.044  39.502 146.137 1.00 49.43 ? 340  ILE B CD1 1 
ATOM   5943 N N   . ARG B 1 340 ? 18.107  39.828 142.199 1.00 36.42 ? 341  ARG B N   1 
ATOM   5944 C CA  . ARG B 1 340 ? 16.703  39.987 141.827 1.00 37.77 ? 341  ARG B CA  1 
ATOM   5945 C C   . ARG B 1 340 ? 16.377  39.179 140.573 1.00 39.83 ? 341  ARG B C   1 
ATOM   5946 O O   . ARG B 1 340 ? 15.360  38.497 140.516 1.00 40.66 ? 341  ARG B O   1 
ATOM   5947 C CB  . ARG B 1 340 ? 16.340  41.464 141.641 1.00 32.39 ? 341  ARG B CB  1 
ATOM   5948 N N   . GLY B 1 341 ? 17.250  39.230 139.574 1.00 39.71 ? 342  GLY B N   1 
ATOM   5949 C CA  . GLY B 1 341 ? 16.969  38.579 138.305 1.00 30.85 ? 342  GLY B CA  1 
ATOM   5950 C C   . GLY B 1 341 ? 17.019  37.064 138.394 1.00 31.86 ? 342  GLY B C   1 
ATOM   5951 O O   . GLY B 1 341 ? 16.365  36.364 137.624 1.00 31.82 ? 342  GLY B O   1 
ATOM   5952 N N   . THR B 1 342 ? 17.802  36.549 139.338 1.00 33.35 ? 343  THR B N   1 
ATOM   5953 C CA  . THR B 1 342 ? 17.997  35.109 139.451 1.00 34.54 ? 343  THR B CA  1 
ATOM   5954 C C   . THR B 1 342 ? 17.014  34.470 140.424 1.00 40.34 ? 343  THR B C   1 
ATOM   5955 O O   . THR B 1 342 ? 16.457  33.403 140.154 1.00 40.34 ? 343  THR B O   1 
ATOM   5956 C CB  . THR B 1 342 ? 19.423  34.791 139.939 1.00 35.53 ? 343  THR B CB  1 
ATOM   5957 O OG1 . THR B 1 342 ? 20.372  35.400 139.057 1.00 38.76 ? 343  THR B OG1 1 
ATOM   5958 C CG2 . THR B 1 342 ? 19.672  33.284 139.997 1.00 36.75 ? 343  THR B CG2 1 
ATOM   5959 N N   . PHE B 1 343 ? 16.806  35.134 141.556 1.00 33.36 ? 344  PHE B N   1 
ATOM   5960 C CA  . PHE B 1 343 ? 16.224  34.484 142.721 1.00 39.58 ? 344  PHE B CA  1 
ATOM   5961 C C   . PHE B 1 343 ? 14.793  34.915 143.003 1.00 43.21 ? 344  PHE B C   1 
ATOM   5962 O O   . PHE B 1 343 ? 14.086  34.255 143.764 1.00 46.68 ? 344  PHE B O   1 
ATOM   5963 C CB  . PHE B 1 343 ? 17.117  34.716 143.945 1.00 35.93 ? 344  PHE B CB  1 
ATOM   5964 C CG  . PHE B 1 343 ? 18.505  34.130 143.799 1.00 52.30 ? 344  PHE B CG  1 
ATOM   5965 C CD1 . PHE B 1 343 ? 18.676  32.807 143.412 1.00 36.08 ? 344  PHE B CD1 1 
ATOM   5966 C CD2 . PHE B 1 343 ? 19.633  34.906 144.023 1.00 36.10 ? 344  PHE B CD2 1 
ATOM   5967 C CE1 . PHE B 1 343 ? 19.948  32.269 143.263 1.00 39.43 ? 344  PHE B CE1 1 
ATOM   5968 C CE2 . PHE B 1 343 ? 20.906  34.378 143.876 1.00 39.71 ? 344  PHE B CE2 1 
ATOM   5969 C CZ  . PHE B 1 343 ? 21.067  33.057 143.494 1.00 36.89 ? 344  PHE B CZ  1 
ATOM   5970 N N   . GLU B 1 344 ? 14.368  36.015 142.390 1.00 36.39 ? 345  GLU B N   1 
ATOM   5971 C CA  . GLU B 1 344 ? 13.011  36.497 142.578 1.00 36.31 ? 345  GLU B CA  1 
ATOM   5972 C C   . GLU B 1 344 ? 12.052  35.430 142.080 1.00 33.79 ? 345  GLU B C   1 
ATOM   5973 O O   . GLU B 1 344 ? 12.256  34.860 141.008 1.00 32.89 ? 345  GLU B O   1 
ATOM   5974 C CB  . GLU B 1 344 ? 12.795  37.815 141.826 1.00 38.93 ? 345  GLU B CB  1 
ATOM   5975 C CG  . GLU B 1 344 ? 11.363  38.343 141.834 1.00 48.49 ? 345  GLU B CG  1 
ATOM   5976 C CD  . GLU B 1 344 ? 10.889  38.796 143.219 1.00 58.07 ? 345  GLU B CD  1 
ATOM   5977 O OE1 . GLU B 1 344 ? 11.733  38.953 144.134 1.00 55.22 ? 345  GLU B OE1 1 
ATOM   5978 O OE2 . GLU B 1 344 ? 9.664   39.007 143.384 1.00 61.93 ? 345  GLU B OE2 1 
ATOM   5979 N N   . PHE B 1 345 ? 11.022  35.157 142.872 1.00 34.78 ? 346  PHE B N   1 
ATOM   5980 C CA  . PHE B 1 345 ? 10.085  34.061 142.616 1.00 35.00 ? 346  PHE B CA  1 
ATOM   5981 C C   . PHE B 1 345 ? 10.801  32.726 142.324 1.00 38.71 ? 346  PHE B C   1 
ATOM   5982 O O   . PHE B 1 345 ? 10.392  31.952 141.446 1.00 37.15 ? 346  PHE B O   1 
ATOM   5983 C CB  . PHE B 1 345 ? 9.058   34.426 141.522 1.00 33.81 ? 346  PHE B CB  1 
ATOM   5984 C CG  . PHE B 1 345 ? 7.922   33.437 141.415 1.00 40.05 ? 346  PHE B CG  1 
ATOM   5985 C CD1 . PHE B 1 345 ? 7.351   32.894 142.560 1.00 35.82 ? 346  PHE B CD1 1 
ATOM   5986 C CD2 . PHE B 1 345 ? 7.452   33.024 140.187 1.00 33.27 ? 346  PHE B CD2 1 
ATOM   5987 C CE1 . PHE B 1 345 ? 6.320   31.963 142.472 1.00 36.38 ? 346  PHE B CE1 1 
ATOM   5988 C CE2 . PHE B 1 345 ? 6.418   32.097 140.097 1.00 33.80 ? 346  PHE B CE2 1 
ATOM   5989 C CZ  . PHE B 1 345 ? 5.854   31.567 141.236 1.00 35.35 ? 346  PHE B CZ  1 
ATOM   5990 N N   . GLN B 1 346 ? 11.889  32.488 143.056 1.00 35.97 ? 347  GLN B N   1 
ATOM   5991 C CA  . GLN B 1 346 ? 12.658  31.249 142.963 1.00 36.39 ? 347  GLN B CA  1 
ATOM   5992 C C   . GLN B 1 346 ? 13.179  30.970 141.552 1.00 38.01 ? 347  GLN B C   1 
ATOM   5993 O O   . GLN B 1 346 ? 13.420  29.819 141.189 1.00 37.33 ? 347  GLN B O   1 
ATOM   5994 C CB  . GLN B 1 346 ? 11.843  30.061 143.492 1.00 37.67 ? 347  GLN B CB  1 
ATOM   5995 C CG  . GLN B 1 346 ? 11.536  30.119 145.001 1.00 43.28 ? 347  GLN B CG  1 
ATOM   5996 C CD  . GLN B 1 346 ? 10.825  31.403 145.429 1.00 44.05 ? 347  GLN B CD  1 
ATOM   5997 O OE1 . GLN B 1 346 ? 11.474  32.382 145.794 1.00 42.53 ? 347  GLN B OE1 1 
ATOM   5998 N NE2 . GLN B 1 346 ? 9.490   31.410 145.358 1.00 39.41 ? 347  GLN B NE2 1 
ATOM   5999 N N   . GLY B 1 347 ? 13.341  32.025 140.758 1.00 35.96 ? 348  GLY B N   1 
ATOM   6000 C CA  . GLY B 1 347 ? 13.842  31.891 139.400 1.00 32.52 ? 348  GLY B CA  1 
ATOM   6001 C C   . GLY B 1 347 ? 12.852  31.248 138.447 1.00 36.77 ? 348  GLY B C   1 
ATOM   6002 O O   . GLY B 1 347 ? 13.228  30.764 137.383 1.00 37.04 ? 348  GLY B O   1 
ATOM   6003 N N   . GLN B 1 348 ? 11.578  31.249 138.827 1.00 37.27 ? 349  GLN B N   1 
ATOM   6004 C CA  . GLN B 1 348 ? 10.534  30.609 138.028 1.00 37.20 ? 349  GLN B CA  1 
ATOM   6005 C C   . GLN B 1 348 ? 9.902   31.584 137.021 1.00 37.55 ? 349  GLN B C   1 
ATOM   6006 O O   . GLN B 1 348 ? 8.680   31.697 136.909 1.00 35.88 ? 349  GLN B O   1 
ATOM   6007 C CB  . GLN B 1 348 ? 9.477   29.990 138.949 1.00 33.41 ? 349  GLN B CB  1 
ATOM   6008 C CG  . GLN B 1 348 ? 10.061  28.981 139.937 1.00 34.86 ? 349  GLN B CG  1 
ATOM   6009 C CD  . GLN B 1 348 ? 8.993   28.321 140.780 1.00 43.16 ? 349  GLN B CD  1 
ATOM   6010 O OE1 . GLN B 1 348 ? 8.829   27.096 140.754 1.00 37.09 ? 349  GLN B OE1 1 
ATOM   6011 N NE2 . GLN B 1 348 ? 8.241   29.136 141.521 1.00 37.63 ? 349  GLN B NE2 1 
ATOM   6012 N N   . LYS B 1 349 ? 10.763  32.283 136.293 1.00 39.57 ? 350  LYS B N   1 
ATOM   6013 C CA  . LYS B 1 349 ? 10.336  33.198 135.252 1.00 35.33 ? 350  LYS B CA  1 
ATOM   6014 C C   . LYS B 1 349 ? 11.031  32.806 133.972 1.00 38.12 ? 350  LYS B C   1 
ATOM   6015 O O   . LYS B 1 349 ? 12.211  32.455 133.987 1.00 33.15 ? 350  LYS B O   1 
ATOM   6016 C CB  . LYS B 1 349 ? 10.721  34.625 135.613 1.00 37.49 ? 350  LYS B CB  1 
ATOM   6017 C CG  . LYS B 1 349 ? 10.176  35.120 136.943 1.00 38.63 ? 350  LYS B CG  1 
ATOM   6018 C CD  . LYS B 1 349 ? 10.524  36.586 137.106 1.00 41.70 ? 350  LYS B CD  1 
ATOM   6019 C CE  . LYS B 1 349 ? 10.121  37.122 138.453 1.00 45.82 ? 350  LYS B CE  1 
ATOM   6020 N NZ  . LYS B 1 349 ? 10.490  38.563 138.542 1.00 53.39 ? 350  LYS B NZ  1 
ATOM   6021 N N   . CYS B 1 350 ? 10.311  32.853 132.857 1.00 42.66 ? 351  CYS B N   1 
ATOM   6022 C CA  A CYS B 1 350 ? 10.923  32.506 131.586 0.58 42.69 ? 351  CYS B CA  1 
ATOM   6023 C CA  B CYS B 1 350 ? 10.893  32.557 131.553 0.42 43.34 ? 351  CYS B CA  1 
ATOM   6024 C C   . CYS B 1 350 ? 12.093  33.459 131.303 1.00 42.83 ? 351  CYS B C   1 
ATOM   6025 O O   . CYS B 1 350 ? 13.032  33.097 130.591 1.00 42.86 ? 351  CYS B O   1 
ATOM   6026 C CB  A CYS B 1 350 ? 9.881   32.483 130.448 0.58 45.04 ? 351  CYS B CB  1 
ATOM   6027 C CB  B CYS B 1 350 ? 9.856   32.789 130.454 0.42 44.52 ? 351  CYS B CB  1 
ATOM   6028 S SG  A CYS B 1 350 ? 8.763   31.007 130.444 0.58 54.80 ? 351  CYS B SG  1 
ATOM   6029 S SG  B CYS B 1 350 ? 9.355   34.513 130.312 0.42 38.81 ? 351  CYS B SG  1 
ATOM   6030 N N   . SER B 1 351 ? 12.063  34.648 131.903 1.00 25.85 ? 352  SER B N   1 
ATOM   6031 C CA  . SER B 1 351 ? 13.129  35.628 131.684 1.00 33.70 ? 352  SER B CA  1 
ATOM   6032 C C   . SER B 1 351 ? 14.250  35.607 132.731 1.00 35.08 ? 352  SER B C   1 
ATOM   6033 O O   . SER B 1 351 ? 15.174  36.416 132.663 1.00 28.87 ? 352  SER B O   1 
ATOM   6034 C CB  . SER B 1 351 ? 12.531  37.031 131.619 1.00 34.53 ? 352  SER B CB  1 
ATOM   6035 O OG  . SER B 1 351 ? 11.827  37.332 132.810 1.00 39.38 ? 352  SER B OG  1 
ATOM   6036 N N   . ALA B 1 352 ? 14.169  34.685 133.690 1.00 34.76 ? 353  ALA B N   1 
ATOM   6037 C CA  . ALA B 1 352 ? 15.079  34.683 134.841 1.00 33.20 ? 353  ALA B CA  1 
ATOM   6038 C C   . ALA B 1 352 ? 16.540  34.485 134.450 1.00 31.99 ? 353  ALA B C   1 
ATOM   6039 O O   . ALA B 1 352 ? 16.855  33.669 133.580 1.00 28.03 ? 353  ALA B O   1 
ATOM   6040 C CB  . ALA B 1 352 ? 14.654  33.624 135.865 1.00 28.93 ? 353  ALA B CB  1 
ATOM   6041 N N   . ALA B 1 353 ? 17.428  35.241 135.091 1.00 28.07 ? 354  ALA B N   1 
ATOM   6042 C CA  . ALA B 1 353 ? 18.865  35.016 134.939 1.00 34.18 ? 354  ALA B CA  1 
ATOM   6043 C C   . ALA B 1 353 ? 19.237  33.654 135.508 1.00 34.70 ? 354  ALA B C   1 
ATOM   6044 O O   . ALA B 1 353 ? 18.836  33.321 136.627 1.00 35.13 ? 354  ALA B O   1 
ATOM   6045 C CB  . ALA B 1 353 ? 19.635  36.090 135.671 1.00 31.52 ? 354  ALA B CB  1 
ATOM   6046 N N   . SER B 1 354 ? 20.006  32.861 134.768 1.00 30.84 ? 355  SER B N   1 
ATOM   6047 C CA  . SER B 1 354 ? 20.471  31.596 135.337 1.00 32.63 ? 355  SER B CA  1 
ATOM   6048 C C   . SER B 1 354 ? 21.948  31.298 135.074 1.00 34.51 ? 355  SER B C   1 
ATOM   6049 O O   . SER B 1 354 ? 22.484  30.309 135.570 1.00 36.28 ? 355  SER B O   1 
ATOM   6050 C CB  . SER B 1 354 ? 19.577  30.428 134.904 1.00 32.32 ? 355  SER B CB  1 
ATOM   6051 O OG  . SER B 1 354 ? 19.662  30.227 133.513 1.00 33.96 ? 355  SER B OG  1 
ATOM   6052 N N   . ARG B 1 355 ? 22.604  32.146 134.289 1.00 32.04 ? 356  ARG B N   1 
ATOM   6053 C CA  . ARG B 1 355 ? 24.048  32.039 134.122 1.00 33.85 ? 356  ARG B CA  1 
ATOM   6054 C C   . ARG B 1 355 ? 24.698  33.426 134.184 1.00 35.37 ? 356  ARG B C   1 
ATOM   6055 O O   . ARG B 1 355 ? 24.155  34.406 133.679 1.00 37.81 ? 356  ARG B O   1 
ATOM   6056 C CB  . ARG B 1 355 ? 24.416  31.296 132.833 1.00 33.99 ? 356  ARG B CB  1 
ATOM   6057 C CG  . ARG B 1 355 ? 24.034  32.019 131.559 1.00 37.95 ? 356  ARG B CG  1 
ATOM   6058 C CD  . ARG B 1 355 ? 24.385  31.229 130.300 1.00 36.91 ? 356  ARG B CD  1 
ATOM   6059 N NE  . ARG B 1 355 ? 23.497  31.591 129.197 1.00 35.59 ? 356  ARG B NE  1 
ATOM   6060 C CZ  . ARG B 1 355 ? 23.866  31.656 127.921 1.00 31.92 ? 356  ARG B CZ  1 
ATOM   6061 N NH1 . ARG B 1 355 ? 25.117  31.386 127.580 1.00 31.20 ? 356  ARG B NH1 1 
ATOM   6062 N NH2 . ARG B 1 355 ? 22.982  31.995 126.987 1.00 29.90 ? 356  ARG B NH2 1 
ATOM   6063 N N   . LEU B 1 356 ? 25.854  33.495 134.828 1.00 32.07 ? 357  LEU B N   1 
ATOM   6064 C CA  . LEU B 1 356 ? 26.520  34.756 135.095 1.00 33.07 ? 357  LEU B CA  1 
ATOM   6065 C C   . LEU B 1 356 ? 27.960  34.653 134.622 1.00 32.87 ? 357  LEU B C   1 
ATOM   6066 O O   . LEU B 1 356 ? 28.620  33.655 134.877 1.00 33.01 ? 357  LEU B O   1 
ATOM   6067 C CB  . LEU B 1 356 ? 26.499  35.021 136.600 1.00 34.91 ? 357  LEU B CB  1 
ATOM   6068 C CG  . LEU B 1 356 ? 27.346  36.168 137.143 1.00 35.14 ? 357  LEU B CG  1 
ATOM   6069 C CD1 . LEU B 1 356 ? 26.779  37.519 136.698 1.00 30.72 ? 357  LEU B CD1 1 
ATOM   6070 C CD2 . LEU B 1 356 ? 27.433  36.073 138.657 1.00 33.93 ? 357  LEU B CD2 1 
ATOM   6071 N N   . TYR B 1 357 ? 28.438  35.671 133.912 1.00 37.14 ? 358  TYR B N   1 
ATOM   6072 C CA  . TYR B 1 357 ? 29.835  35.710 133.486 1.00 35.84 ? 358  TYR B CA  1 
ATOM   6073 C C   . TYR B 1 357 ? 30.566  36.835 134.204 1.00 35.87 ? 358  TYR B C   1 
ATOM   6074 O O   . TYR B 1 357 ? 30.202  38.007 134.069 1.00 38.95 ? 358  TYR B O   1 
ATOM   6075 C CB  . TYR B 1 357 ? 29.951  35.886 131.975 1.00 29.44 ? 358  TYR B CB  1 
ATOM   6076 C CG  . TYR B 1 357 ? 29.305  34.780 131.189 1.00 29.04 ? 358  TYR B CG  1 
ATOM   6077 C CD1 . TYR B 1 357 ? 27.947  34.802 130.923 1.00 30.86 ? 358  TYR B CD1 1 
ATOM   6078 C CD2 . TYR B 1 357 ? 30.053  33.708 130.713 1.00 29.36 ? 358  TYR B CD2 1 
ATOM   6079 C CE1 . TYR B 1 357 ? 27.344  33.798 130.201 1.00 31.52 ? 358  TYR B CE1 1 
ATOM   6080 C CE2 . TYR B 1 357 ? 29.461  32.697 129.989 1.00 35.91 ? 358  TYR B CE2 1 
ATOM   6081 C CZ  . TYR B 1 357 ? 28.102  32.747 129.739 1.00 35.41 ? 358  TYR B CZ  1 
ATOM   6082 O OH  . TYR B 1 357 ? 27.493  31.750 129.020 1.00 35.32 ? 358  TYR B OH  1 
ATOM   6083 N N   . LEU B 1 358 ? 31.596  36.466 134.963 1.00 38.65 ? 359  LEU B N   1 
ATOM   6084 C CA  . LEU B 1 358 ? 32.333  37.413 135.793 1.00 39.66 ? 359  LEU B CA  1 
ATOM   6085 C C   . LEU B 1 358 ? 33.788  37.556 135.376 1.00 42.72 ? 359  LEU B C   1 
ATOM   6086 O O   . LEU B 1 358 ? 34.473  36.561 135.135 1.00 41.65 ? 359  LEU B O   1 
ATOM   6087 C CB  . LEU B 1 358 ? 32.297  36.981 137.259 1.00 38.03 ? 359  LEU B CB  1 
ATOM   6088 C CG  . LEU B 1 358 ? 30.991  37.128 138.029 1.00 36.78 ? 359  LEU B CG  1 
ATOM   6089 C CD1 . LEU B 1 358 ? 31.208  36.688 139.481 1.00 36.04 ? 359  LEU B CD1 1 
ATOM   6090 C CD2 . LEU B 1 358 ? 30.463  38.557 137.946 1.00 34.22 ? 359  LEU B CD2 1 
ATOM   6091 N N   . PRO B 1 359 ? 34.277  38.804 135.317 1.00 41.77 ? 360  PRO B N   1 
ATOM   6092 C CA  . PRO B 1 359 ? 35.711  39.007 135.097 1.00 40.90 ? 360  PRO B CA  1 
ATOM   6093 C C   . PRO B 1 359 ? 36.473  38.632 136.359 1.00 45.87 ? 360  PRO B C   1 
ATOM   6094 O O   . PRO B 1 359 ? 36.048  38.998 137.454 1.00 49.28 ? 360  PRO B O   1 
ATOM   6095 C CB  . PRO B 1 359 ? 35.817  40.508 134.821 1.00 40.55 ? 360  PRO B CB  1 
ATOM   6096 C CG  . PRO B 1 359 ? 34.635  41.114 135.497 1.00 41.09 ? 360  PRO B CG  1 
ATOM   6097 C CD  . PRO B 1 359 ? 33.554  40.065 135.565 1.00 39.59 ? 360  PRO B CD  1 
ATOM   6098 N N   . GLU B 1 360 ? 37.571  37.901 136.201 1.00 49.25 ? 361  GLU B N   1 
ATOM   6099 C CA  . GLU B 1 360 ? 38.358  37.413 137.331 1.00 49.12 ? 361  GLU B CA  1 
ATOM   6100 C C   . GLU B 1 360 ? 38.715  38.496 138.341 1.00 45.90 ? 361  GLU B C   1 
ATOM   6101 O O   . GLU B 1 360 ? 38.643  38.271 139.549 1.00 43.87 ? 361  GLU B O   1 
ATOM   6102 C CB  . GLU B 1 360 ? 39.619  36.704 136.839 1.00 54.98 ? 361  GLU B CB  1 
ATOM   6103 C CG  . GLU B 1 360 ? 39.381  35.232 136.518 1.00 65.08 ? 361  GLU B CG  1 
ATOM   6104 C CD  . GLU B 1 360 ? 40.498  34.614 135.704 1.00 73.32 ? 361  GLU B CD  1 
ATOM   6105 O OE1 . GLU B 1 360 ? 41.372  35.368 135.223 1.00 74.98 ? 361  GLU B OE1 1 
ATOM   6106 O OE2 . GLU B 1 360 ? 40.500  33.373 135.543 1.00 76.52 ? 361  GLU B OE2 1 
ATOM   6107 N N   . SER B 1 361 ? 39.057  39.681 137.846 1.00 45.69 ? 362  SER B N   1 
ATOM   6108 C CA  . SER B 1 361 ? 39.518  40.760 138.718 1.00 49.82 ? 362  SER B CA  1 
ATOM   6109 C C   . SER B 1 361 ? 38.434  41.285 139.654 1.00 51.19 ? 362  SER B C   1 
ATOM   6110 O O   . SER B 1 361 ? 38.740  41.947 140.645 1.00 51.01 ? 362  SER B O   1 
ATOM   6111 C CB  . SER B 1 361 ? 40.094  41.916 137.898 1.00 52.55 ? 362  SER B CB  1 
ATOM   6112 O OG  . SER B 1 361 ? 39.071  42.615 137.210 1.00 53.15 ? 362  SER B OG  1 
ATOM   6113 N N   . LYS B 1 362 ? 37.173  40.984 139.344 1.00 51.60 ? 363  LYS B N   1 
ATOM   6114 C CA  . LYS B 1 362 ? 36.044  41.500 140.123 1.00 50.82 ? 363  LYS B CA  1 
ATOM   6115 C C   . LYS B 1 362 ? 35.205  40.393 140.776 1.00 47.67 ? 363  LYS B C   1 
ATOM   6116 O O   . LYS B 1 362 ? 34.228  40.674 141.474 1.00 44.40 ? 363  LYS B O   1 
ATOM   6117 C CB  . LYS B 1 362 ? 35.148  42.376 139.236 1.00 46.22 ? 363  LYS B CB  1 
ATOM   6118 C CG  . LYS B 1 362 ? 35.855  43.559 138.596 1.00 46.95 ? 363  LYS B CG  1 
ATOM   6119 C CD  . LYS B 1 362 ? 36.154  44.642 139.620 1.00 47.56 ? 363  LYS B CD  1 
ATOM   6120 C CE  . LYS B 1 362 ? 36.665  45.918 138.957 1.00 48.52 ? 363  LYS B CE  1 
ATOM   6121 N N   . SER B 1 363 ? 35.594  39.144 140.539 1.00 48.45 ? 364  SER B N   1 
ATOM   6122 C CA  . SER B 1 363 ? 34.825  37.985 140.978 1.00 49.78 ? 364  SER B CA  1 
ATOM   6123 C C   . SER B 1 363 ? 34.659  37.944 142.484 1.00 50.78 ? 364  SER B C   1 
ATOM   6124 O O   . SER B 1 363 ? 33.537  37.829 142.992 1.00 46.75 ? 364  SER B O   1 
ATOM   6125 C CB  . SER B 1 363 ? 35.508  36.700 140.517 1.00 57.69 ? 364  SER B CB  1 
ATOM   6126 O OG  . SER B 1 363 ? 35.625  36.680 139.108 1.00 66.72 ? 364  SER B OG  1 
ATOM   6127 N N   . GLU B 1 364 ? 35.789  38.021 143.187 1.00 52.91 ? 365  GLU B N   1 
ATOM   6128 C CA  . GLU B 1 364 ? 35.803  37.945 144.644 1.00 49.84 ? 365  GLU B CA  1 
ATOM   6129 C C   . GLU B 1 364 ? 34.942  39.037 145.260 1.00 48.54 ? 365  GLU B C   1 
ATOM   6130 O O   . GLU B 1 364 ? 34.183  38.769 146.186 1.00 49.54 ? 365  GLU B O   1 
ATOM   6131 C CB  . GLU B 1 364 ? 37.235  38.011 145.195 1.00 47.80 ? 365  GLU B CB  1 
ATOM   6132 N N   . GLU B 1 365 ? 35.038  40.260 144.741 1.00 43.67 ? 366  GLU B N   1 
ATOM   6133 C CA  . GLU B 1 365 ? 34.248  41.345 145.315 1.00 48.88 ? 366  GLU B CA  1 
ATOM   6134 C C   . GLU B 1 365 ? 32.761  41.119 145.048 1.00 52.99 ? 366  GLU B C   1 
ATOM   6135 O O   . GLU B 1 365 ? 31.945  41.181 145.977 1.00 52.59 ? 366  GLU B O   1 
ATOM   6136 C CB  . GLU B 1 365 ? 34.685  42.719 144.792 1.00 52.16 ? 366  GLU B CB  1 
ATOM   6137 C CG  . GLU B 1 365 ? 33.979  43.875 145.498 1.00 56.47 ? 366  GLU B CG  1 
ATOM   6138 C CD  . GLU B 1 365 ? 33.782  45.101 144.619 1.00 62.97 ? 366  GLU B CD  1 
ATOM   6139 O OE1 . GLU B 1 365 ? 34.506  45.233 143.610 1.00 65.32 ? 366  GLU B OE1 1 
ATOM   6140 O OE2 . GLU B 1 365 ? 32.897  45.932 144.939 1.00 62.72 ? 366  GLU B OE2 1 
ATOM   6141 N N   . PHE B 1 366 ? 32.430  40.848 143.780 1.00 50.89 ? 367  PHE B N   1 
ATOM   6142 C CA  . PHE B 1 366 ? 31.059  40.581 143.343 1.00 40.34 ? 367  PHE B CA  1 
ATOM   6143 C C   . PHE B 1 366 ? 30.427  39.490 144.196 1.00 43.14 ? 367  PHE B C   1 
ATOM   6144 O O   . PHE B 1 366 ? 29.358  39.684 144.779 1.00 41.45 ? 367  PHE B O   1 
ATOM   6145 C CB  . PHE B 1 366 ? 31.051  40.130 141.876 1.00 36.99 ? 367  PHE B CB  1 
ATOM   6146 C CG  . PHE B 1 366 ? 29.662  39.954 141.290 1.00 38.09 ? 367  PHE B CG  1 
ATOM   6147 C CD1 . PHE B 1 366 ? 28.923  38.809 141.533 1.00 35.95 ? 367  PHE B CD1 1 
ATOM   6148 C CD2 . PHE B 1 366 ? 29.108  40.933 140.486 1.00 39.41 ? 367  PHE B CD2 1 
ATOM   6149 C CE1 . PHE B 1 366 ? 27.655  38.658 141.000 1.00 36.03 ? 367  PHE B CE1 1 
ATOM   6150 C CE2 . PHE B 1 366 ? 27.833  40.785 139.942 1.00 38.25 ? 367  PHE B CE2 1 
ATOM   6151 C CZ  . PHE B 1 366 ? 27.112  39.649 140.199 1.00 37.04 ? 367  PHE B CZ  1 
ATOM   6152 N N   . LEU B 1 367 ? 31.101  38.341 144.264 1.00 40.32 ? 368  LEU B N   1 
ATOM   6153 C CA  . LEU B 1 367 ? 30.544  37.163 144.917 1.00 41.41 ? 368  LEU B CA  1 
ATOM   6154 C C   . LEU B 1 367 ? 30.446  37.342 146.422 1.00 49.94 ? 368  LEU B C   1 
ATOM   6155 O O   . LEU B 1 367 ? 29.457  36.938 147.039 1.00 50.72 ? 368  LEU B O   1 
ATOM   6156 C CB  . LEU B 1 367 ? 31.367  35.922 144.573 1.00 40.85 ? 368  LEU B CB  1 
ATOM   6157 C CG  . LEU B 1 367 ? 31.250  35.462 143.117 1.00 40.26 ? 368  LEU B CG  1 
ATOM   6158 C CD1 . LEU B 1 367 ? 32.202  34.303 142.843 1.00 39.51 ? 368  LEU B CD1 1 
ATOM   6159 C CD2 . LEU B 1 367 ? 29.804  35.076 142.785 1.00 36.75 ? 368  LEU B CD2 1 
ATOM   6160 N N   . SER B 1 368 ? 31.477  37.948 147.006 1.00 52.14 ? 369  SER B N   1 
ATOM   6161 C CA  . SER B 1 368 ? 31.447  38.336 148.412 1.00 54.65 ? 369  SER B CA  1 
ATOM   6162 C C   . SER B 1 368 ? 30.229  39.214 148.725 1.00 49.91 ? 369  SER B C   1 
ATOM   6163 O O   . SER B 1 368 ? 29.512  38.969 149.703 1.00 46.80 ? 369  SER B O   1 
ATOM   6164 C CB  . SER B 1 368 ? 32.744  39.057 148.793 1.00 58.81 ? 369  SER B CB  1 
ATOM   6165 O OG  . SER B 1 368 ? 32.550  39.935 149.884 1.00 66.38 ? 369  SER B OG  1 
ATOM   6166 N N   . ASP B 1 369 ? 30.002  40.230 147.891 1.00 46.27 ? 370  ASP B N   1 
ATOM   6167 C CA  . ASP B 1 369 ? 28.841  41.106 148.043 1.00 54.99 ? 370  ASP B CA  1 
ATOM   6168 C C   . ASP B 1 369 ? 27.550  40.300 148.047 1.00 53.20 ? 370  ASP B C   1 
ATOM   6169 O O   . ASP B 1 369 ? 26.715  40.449 148.936 1.00 50.88 ? 370  ASP B O   1 
ATOM   6170 C CB  . ASP B 1 369 ? 28.767  42.128 146.902 1.00 62.52 ? 370  ASP B CB  1 
ATOM   6171 C CG  . ASP B 1 369 ? 29.727  43.286 147.083 1.00 67.40 ? 370  ASP B CG  1 
ATOM   6172 O OD1 . ASP B 1 369 ? 30.747  43.113 147.783 1.00 64.91 ? 370  ASP B OD1 1 
ATOM   6173 O OD2 . ASP B 1 369 ? 29.461  44.369 146.513 1.00 70.37 ? 370  ASP B OD2 1 
ATOM   6174 N N   . MET B 1 370 ? 27.408  39.442 147.044 1.00 49.75 ? 371  MET B N   1 
ATOM   6175 C CA  . MET B 1 370 ? 26.173  38.700 146.827 1.00 45.69 ? 371  MET B CA  1 
ATOM   6176 C C   . MET B 1 370 ? 25.879  37.742 147.972 1.00 47.63 ? 371  MET B C   1 
ATOM   6177 O O   . MET B 1 370 ? 24.763  37.711 148.498 1.00 50.79 ? 371  MET B O   1 
ATOM   6178 C CB  . MET B 1 370 ? 26.247  37.936 145.501 1.00 45.23 ? 371  MET B CB  1 
ATOM   6179 C CG  . MET B 1 370 ? 25.096  36.972 145.274 1.00 47.39 ? 371  MET B CG  1 
ATOM   6180 S SD  . MET B 1 370 ? 25.238  36.113 143.696 1.00 44.55 ? 371  MET B SD  1 
ATOM   6181 C CE  . MET B 1 370 ? 24.705  37.415 142.603 1.00 47.16 ? 371  MET B CE  1 
ATOM   6182 N N   . PHE B 1 371 ? 26.886  36.965 148.355 1.00 45.33 ? 372  PHE B N   1 
ATOM   6183 C CA  . PHE B 1 371 ? 26.724  36.011 149.441 1.00 51.97 ? 372  PHE B CA  1 
ATOM   6184 C C   . PHE B 1 371 ? 26.358  36.744 150.730 1.00 55.62 ? 372  PHE B C   1 
ATOM   6185 O O   . PHE B 1 371 ? 25.554  36.255 151.519 1.00 62.98 ? 372  PHE B O   1 
ATOM   6186 C CB  . PHE B 1 371 ? 27.984  35.149 149.622 1.00 49.64 ? 372  PHE B CB  1 
ATOM   6187 C CG  . PHE B 1 371 ? 28.364  34.354 148.391 1.00 47.42 ? 372  PHE B CG  1 
ATOM   6188 C CD1 . PHE B 1 371 ? 27.456  34.170 147.350 1.00 47.58 ? 372  PHE B CD1 1 
ATOM   6189 C CD2 . PHE B 1 371 ? 29.631  33.797 148.273 1.00 46.43 ? 372  PHE B CD2 1 
ATOM   6190 C CE1 . PHE B 1 371 ? 27.804  33.451 146.210 1.00 43.95 ? 372  PHE B CE1 1 
ATOM   6191 C CE2 . PHE B 1 371 ? 29.987  33.069 147.138 1.00 45.60 ? 372  PHE B CE2 1 
ATOM   6192 C CZ  . PHE B 1 371 ? 29.067  32.903 146.102 1.00 42.69 ? 372  PHE B CZ  1 
ATOM   6193 N N   . GLY B 1 372 ? 26.920  37.934 150.923 1.00 53.85 ? 373  GLY B N   1 
ATOM   6194 C CA  . GLY B 1 372 ? 26.599  38.738 152.092 1.00 53.93 ? 373  GLY B CA  1 
ATOM   6195 C C   . GLY B 1 372 ? 25.140  39.158 152.139 1.00 54.45 ? 373  GLY B C   1 
ATOM   6196 O O   . GLY B 1 372 ? 24.478  39.036 153.175 1.00 54.85 ? 373  GLY B O   1 
ATOM   6197 N N   . ILE B 1 373 ? 24.633  39.654 151.012 1.00 50.52 ? 374  ILE B N   1 
ATOM   6198 C CA  . ILE B 1 373 ? 23.242  40.085 150.932 1.00 52.92 ? 374  ILE B CA  1 
ATOM   6199 C C   . ILE B 1 373 ? 22.294  38.902 151.094 1.00 57.24 ? 374  ILE B C   1 
ATOM   6200 O O   . ILE B 1 373 ? 21.300  38.982 151.814 1.00 65.68 ? 374  ILE B O   1 
ATOM   6201 C CB  . ILE B 1 373 ? 22.958  40.813 149.613 1.00 52.54 ? 374  ILE B CB  1 
ATOM   6202 C CG1 . ILE B 1 373 ? 23.703  42.151 149.590 1.00 54.54 ? 374  ILE B CG1 1 
ATOM   6203 C CG2 . ILE B 1 373 ? 21.470  41.026 149.433 1.00 47.37 ? 374  ILE B CG2 1 
ATOM   6204 C CD1 . ILE B 1 373 ? 23.945  42.697 148.203 1.00 53.11 ? 374  ILE B CD1 1 
ATOM   6205 N N   . LEU B 1 374 ? 22.626  37.792 150.445 1.00 53.69 ? 375  LEU B N   1 
ATOM   6206 C CA  . LEU B 1 374 ? 21.821  36.580 150.534 1.00 52.56 ? 375  LEU B CA  1 
ATOM   6207 C C   . LEU B 1 374 ? 21.744  36.042 151.958 1.00 54.06 ? 375  LEU B C   1 
ATOM   6208 O O   . LEU B 1 374 ? 20.662  35.699 152.435 1.00 52.57 ? 375  LEU B O   1 
ATOM   6209 C CB  . LEU B 1 374 ? 22.383  35.508 149.601 1.00 52.26 ? 375  LEU B CB  1 
ATOM   6210 C CG  . LEU B 1 374 ? 22.157  35.767 148.112 1.00 44.28 ? 375  LEU B CG  1 
ATOM   6211 C CD1 . LEU B 1 374 ? 22.867  34.718 147.277 1.00 44.26 ? 375  LEU B CD1 1 
ATOM   6212 C CD2 . LEU B 1 374 ? 20.665  35.778 147.807 1.00 42.87 ? 375  LEU B CD2 1 
ATOM   6213 N N   . GLN B 1 375 ? 22.897  35.960 152.624 1.00 57.23 ? 376  GLN B N   1 
ATOM   6214 C CA  . GLN B 1 375 ? 22.951  35.501 154.011 1.00 59.95 ? 376  GLN B CA  1 
ATOM   6215 C C   . GLN B 1 375 ? 22.190  36.463 154.927 1.00 61.45 ? 376  GLN B C   1 
ATOM   6216 O O   . GLN B 1 375 ? 21.654  36.055 155.953 1.00 61.84 ? 376  GLN B O   1 
ATOM   6217 C CB  . GLN B 1 375 ? 24.402  35.314 154.489 1.00 55.79 ? 376  GLN B CB  1 
ATOM   6218 N N   . SER B 1 376 ? 22.134  37.735 154.542 1.00 63.60 ? 377  SER B N   1 
ATOM   6219 C CA  . SER B 1 376 ? 21.388  38.731 155.305 1.00 63.11 ? 377  SER B CA  1 
ATOM   6220 C C   . SER B 1 376 ? 19.891  38.444 155.251 1.00 66.79 ? 377  SER B C   1 
ATOM   6221 O O   . SER B 1 376 ? 19.229  38.386 156.284 1.00 69.03 ? 377  SER B O   1 
ATOM   6222 C CB  . SER B 1 376 ? 21.674  40.140 154.782 1.00 60.38 ? 377  SER B CB  1 
ATOM   6223 N N   . GLN B 1 377 ? 19.366  38.256 154.043 1.00 69.66 ? 378  GLN B N   1 
ATOM   6224 C CA  . GLN B 1 377 ? 17.932  38.027 153.841 1.00 67.31 ? 378  GLN B CA  1 
ATOM   6225 C C   . GLN B 1 377 ? 17.461  36.726 154.490 1.00 71.21 ? 378  GLN B C   1 
ATOM   6226 O O   . GLN B 1 377 ? 17.019  36.718 155.641 1.00 73.93 ? 378  GLN B O   1 
ATOM   6227 C CB  . GLN B 1 377 ? 17.591  38.024 152.348 1.00 60.95 ? 378  GLN B CB  1 
ATOM   6228 N N   . ARG B 1 395 ? 12.209  29.846 156.390 1.00 75.14 ? 396  ARG B N   1 
ATOM   6229 C CA  . ARG B 1 395 ? 13.360  30.611 156.870 1.00 80.63 ? 396  ARG B CA  1 
ATOM   6230 C C   . ARG B 1 395 ? 14.639  30.230 156.128 1.00 83.74 ? 396  ARG B C   1 
ATOM   6231 O O   . ARG B 1 395 ? 15.078  29.084 156.200 1.00 86.63 ? 396  ARG B O   1 
ATOM   6232 C CB  . ARG B 1 395 ? 13.561  30.402 158.372 1.00 83.11 ? 396  ARG B CB  1 
ATOM   6233 N N   . GLY B 1 396 ? 15.238  31.195 155.432 1.00 79.13 ? 397  GLY B N   1 
ATOM   6234 C CA  . GLY B 1 396 ? 16.401  30.933 154.599 1.00 71.64 ? 397  GLY B CA  1 
ATOM   6235 C C   . GLY B 1 396 ? 15.978  30.629 153.170 1.00 66.60 ? 397  GLY B C   1 
ATOM   6236 O O   . GLY B 1 396 ? 16.807  30.339 152.308 1.00 65.98 ? 397  GLY B O   1 
ATOM   6237 N N   . PHE B 1 397 ? 14.670  30.690 152.932 1.00 58.76 ? 398  PHE B N   1 
ATOM   6238 C CA  . PHE B 1 397 ? 14.095  30.486 151.613 1.00 51.37 ? 398  PHE B CA  1 
ATOM   6239 C C   . PHE B 1 397 ? 13.209  31.690 151.324 1.00 53.60 ? 398  PHE B C   1 
ATOM   6240 O O   . PHE B 1 397 ? 12.463  32.129 152.197 1.00 53.11 ? 398  PHE B O   1 
ATOM   6241 C CB  . PHE B 1 397 ? 13.252  29.206 151.583 1.00 50.45 ? 398  PHE B CB  1 
ATOM   6242 C CG  . PHE B 1 397 ? 13.992  27.967 152.040 1.00 55.85 ? 398  PHE B CG  1 
ATOM   6243 C CD1 . PHE B 1 397 ? 14.705  27.196 151.134 1.00 55.74 ? 398  PHE B CD1 1 
ATOM   6244 C CD2 . PHE B 1 397 ? 13.967  27.571 153.374 1.00 54.65 ? 398  PHE B CD2 1 
ATOM   6245 C CE1 . PHE B 1 397 ? 15.387  26.061 151.545 1.00 56.51 ? 398  PHE B CE1 1 
ATOM   6246 C CE2 . PHE B 1 397 ? 14.647  26.436 153.794 1.00 54.73 ? 398  PHE B CE2 1 
ATOM   6247 C CZ  . PHE B 1 397 ? 15.359  25.681 152.879 1.00 58.24 ? 398  PHE B CZ  1 
ATOM   6248 N N   . MET B 1 398 ? 13.283  32.224 150.107 1.00 50.06 ? 399  MET B N   1 
ATOM   6249 C CA  . MET B 1 398 ? 12.503  33.411 149.755 1.00 49.87 ? 399  MET B CA  1 
ATOM   6250 C C   . MET B 1 398 ? 11.059  33.056 149.395 1.00 50.94 ? 399  MET B C   1 
ATOM   6251 O O   . MET B 1 398 ? 10.203  33.926 149.296 1.00 55.88 ? 399  MET B O   1 
ATOM   6252 C CB  . MET B 1 398 ? 13.157  34.147 148.590 1.00 46.00 ? 399  MET B CB  1 
ATOM   6253 C CG  . MET B 1 398 ? 14.655  34.373 148.746 1.00 47.44 ? 399  MET B CG  1 
ATOM   6254 S SD  . MET B 1 398 ? 15.377  35.168 147.294 1.00 61.39 ? 399  MET B SD  1 
ATOM   6255 C CE  . MET B 1 398 ? 14.679  36.826 147.374 1.00 63.01 ? 399  MET B CE  1 
ATOM   6256 N N   . GLY B 1 399 ? 10.802  31.768 149.201 1.00 49.95 ? 400  GLY B N   1 
ATOM   6257 C CA  . GLY B 1 399 ? 9.496   31.276 148.808 1.00 45.92 ? 400  GLY B CA  1 
ATOM   6258 C C   . GLY B 1 399 ? 9.659   29.879 148.242 1.00 47.22 ? 400  GLY B C   1 
ATOM   6259 O O   . GLY B 1 399 ? 10.778  29.453 147.964 1.00 47.07 ? 400  GLY B O   1 
ATOM   6260 N N   . PRO B 1 400 ? 8.548   29.152 148.074 1.00 48.83 ? 401  PRO B N   1 
ATOM   6261 C CA  . PRO B 1 400 ? 8.615   27.774 147.578 1.00 44.55 ? 401  PRO B CA  1 
ATOM   6262 C C   . PRO B 1 400 ? 8.756   27.686 146.064 1.00 45.97 ? 401  PRO B C   1 
ATOM   6263 O O   . PRO B 1 400 ? 8.416   28.645 145.352 1.00 41.22 ? 401  PRO B O   1 
ATOM   6264 C CB  . PRO B 1 400 ? 7.247   27.210 147.967 1.00 45.80 ? 401  PRO B CB  1 
ATOM   6265 C CG  . PRO B 1 400 ? 6.333   28.392 147.942 1.00 45.20 ? 401  PRO B CG  1 
ATOM   6266 C CD  . PRO B 1 400 ? 7.168   29.565 148.395 1.00 44.83 ? 401  PRO B CD  1 
ATOM   6267 N N   . VAL B 1 401 ? 9.244   26.545 145.579 1.00 42.75 ? 402  VAL B N   1 
ATOM   6268 C CA  . VAL B 1 401 ? 9.061   26.192 144.171 1.00 45.66 ? 402  VAL B CA  1 
ATOM   6269 C C   . VAL B 1 401 ? 7.713   25.477 144.054 1.00 42.10 ? 402  VAL B C   1 
ATOM   6270 O O   . VAL B 1 401 ? 7.107   25.129 145.069 1.00 43.73 ? 402  VAL B O   1 
ATOM   6271 C CB  . VAL B 1 401 ? 10.219  25.351 143.584 1.00 41.12 ? 402  VAL B CB  1 
ATOM   6272 C CG1 . VAL B 1 401 ? 11.496  26.178 143.524 1.00 40.33 ? 402  VAL B CG1 1 
ATOM   6273 C CG2 . VAL B 1 401 ? 10.435  24.056 144.377 1.00 43.00 ? 402  VAL B CG2 1 
ATOM   6274 N N   . ILE B 1 402 ? 7.256   25.263 142.827 1.00 40.99 ? 403  ILE B N   1 
ATOM   6275 C CA  . ILE B 1 402 ? 5.842   25.002 142.562 1.00 41.27 ? 403  ILE B CA  1 
ATOM   6276 C C   . ILE B 1 402 ? 5.301   23.631 142.980 1.00 44.42 ? 403  ILE B C   1 
ATOM   6277 O O   . ILE B 1 402 ? 4.176   23.541 143.489 1.00 47.60 ? 403  ILE B O   1 
ATOM   6278 C CB  . ILE B 1 402 ? 5.493   25.290 141.081 1.00 40.39 ? 403  ILE B CB  1 
ATOM   6279 C CG1 . ILE B 1 402 ? 3.988   25.151 140.840 1.00 43.96 ? 403  ILE B CG1 1 
ATOM   6280 C CG2 . ILE B 1 402 ? 6.273   24.383 140.156 1.00 39.14 ? 403  ILE B CG2 1 
ATOM   6281 C CD1 . ILE B 1 402 ? 3.157   26.110 141.655 1.00 44.37 ? 403  ILE B CD1 1 
ATOM   6282 N N   . HIS B 1 403 ? 6.084   22.576 142.769 1.00 43.55 ? 404  HIS B N   1 
ATOM   6283 C CA  . HIS B 1 403 ? 5.659   21.223 143.125 1.00 45.36 ? 404  HIS B CA  1 
ATOM   6284 C C   . HIS B 1 403 ? 6.837   20.277 143.380 1.00 46.23 ? 404  HIS B C   1 
ATOM   6285 O O   . HIS B 1 403 ? 8.002   20.659 143.243 1.00 50.23 ? 404  HIS B O   1 
ATOM   6286 C CB  . HIS B 1 403 ? 4.725   20.641 142.060 1.00 45.06 ? 404  HIS B CB  1 
ATOM   6287 C CG  . HIS B 1 403 ? 5.216   20.826 140.659 1.00 43.22 ? 404  HIS B CG  1 
ATOM   6288 N ND1 . HIS B 1 403 ? 6.510   20.542 140.279 1.00 46.82 ? 404  HIS B ND1 1 
ATOM   6289 C CD2 . HIS B 1 403 ? 4.589   21.284 139.546 1.00 56.04 ? 404  HIS B CD2 1 
ATOM   6290 C CE1 . HIS B 1 403 ? 6.658   20.812 138.992 1.00 45.84 ? 404  HIS B CE1 1 
ATOM   6291 N NE2 . HIS B 1 403 ? 5.507   21.264 138.524 1.00 40.61 ? 404  HIS B NE2 1 
ATOM   6292 N N   . GLU B 1 404 ? 6.517   19.040 143.743 1.00 54.93 ? 405  GLU B N   1 
ATOM   6293 C CA  . GLU B 1 404 ? 7.520   18.059 144.155 1.00 52.45 ? 405  GLU B CA  1 
ATOM   6294 C C   . GLU B 1 404 ? 8.482   17.712 143.021 1.00 50.32 ? 405  GLU B C   1 
ATOM   6295 O O   . GLU B 1 404 ? 9.681   17.495 143.238 1.00 48.90 ? 405  GLU B O   1 
ATOM   6296 C CB  . GLU B 1 404 ? 6.830   16.785 144.657 1.00 51.50 ? 405  GLU B CB  1 
ATOM   6297 N N   . GLN B 1 405 ? 7.938   17.649 141.811 1.00 46.96 ? 406  GLN B N   1 
ATOM   6298 C CA  . GLN B 1 405 ? 8.706   17.267 140.644 1.00 49.51 ? 406  GLN B CA  1 
ATOM   6299 C C   . GLN B 1 405 ? 9.826   18.286 140.443 1.00 48.69 ? 406  GLN B C   1 
ATOM   6300 O O   . GLN B 1 405 ? 10.995  17.920 140.291 1.00 46.13 ? 406  GLN B O   1 
ATOM   6301 C CB  . GLN B 1 405 ? 7.800   17.187 139.405 1.00 51.90 ? 406  GLN B CB  1 
ATOM   6302 C CG  . GLN B 1 405 ? 6.748   16.074 139.449 1.00 61.09 ? 406  GLN B CG  1 
ATOM   6303 C CD  . GLN B 1 405 ? 5.563   16.399 140.355 1.00 70.93 ? 406  GLN B CD  1 
ATOM   6304 O OE1 . GLN B 1 405 ? 4.915   17.438 140.210 1.00 75.41 ? 406  GLN B OE1 1 
ATOM   6305 N NE2 . GLN B 1 405 ? 5.279   15.508 141.294 1.00 76.83 ? 406  GLN B NE2 1 
ATOM   6306 N N   . SER B 1 406 ? 9.466   19.565 140.465 1.00 45.24 ? 407  SER B N   1 
ATOM   6307 C CA  . SER B 1 406 ? 10.461  20.619 140.364 1.00 45.29 ? 407  SER B CA  1 
ATOM   6308 C C   . SER B 1 406 ? 11.429  20.571 141.541 1.00 47.84 ? 407  SER B C   1 
ATOM   6309 O O   . SER B 1 406 ? 12.632  20.760 141.368 1.00 46.96 ? 407  SER B O   1 
ATOM   6310 C CB  . SER B 1 406 ? 9.796   21.990 140.287 1.00 46.84 ? 407  SER B CB  1 
ATOM   6311 O OG  . SER B 1 406 ? 10.734  23.000 140.586 1.00 39.79 ? 407  SER B OG  1 
ATOM   6312 N N   . PHE B 1 407 ? 10.900  20.316 142.735 1.00 50.21 ? 408  PHE B N   1 
ATOM   6313 C CA  . PHE B 1 407 ? 11.740  20.187 143.919 1.00 51.51 ? 408  PHE B CA  1 
ATOM   6314 C C   . PHE B 1 407 ? 12.780  19.087 143.732 1.00 52.21 ? 408  PHE B C   1 
ATOM   6315 O O   . PHE B 1 407 ? 13.961  19.281 144.036 1.00 50.00 ? 408  PHE B O   1 
ATOM   6316 C CB  . PHE B 1 407 ? 10.894  19.882 145.163 1.00 54.67 ? 408  PHE B CB  1 
ATOM   6317 C CG  . PHE B 1 407 ? 11.704  19.760 146.431 1.00 56.36 ? 408  PHE B CG  1 
ATOM   6318 C CD1 . PHE B 1 407 ? 12.267  18.542 146.806 1.00 61.10 ? 408  PHE B CD1 1 
ATOM   6319 C CD2 . PHE B 1 407 ? 11.901  20.864 147.247 1.00 48.94 ? 408  PHE B CD2 1 
ATOM   6320 C CE1 . PHE B 1 407 ? 13.018  18.430 147.965 1.00 62.00 ? 408  PHE B CE1 1 
ATOM   6321 C CE2 . PHE B 1 407 ? 12.647  20.765 148.406 1.00 62.98 ? 408  PHE B CE2 1 
ATOM   6322 C CZ  . PHE B 1 407 ? 13.208  19.539 148.770 1.00 64.78 ? 408  PHE B CZ  1 
ATOM   6323 N N   . ASP B 1 408 ? 12.333  17.928 143.252 1.00 49.27 ? 409  ASP B N   1 
ATOM   6324 C CA  . ASP B 1 408 ? 13.229  16.787 143.074 1.00 52.31 ? 409  ASP B CA  1 
ATOM   6325 C C   . ASP B 1 408 ? 14.267  17.066 141.986 1.00 49.57 ? 409  ASP B C   1 
ATOM   6326 O O   . ASP B 1 408 ? 15.422  16.685 142.124 1.00 46.99 ? 409  ASP B O   1 
ATOM   6327 C CB  . ASP B 1 408 ? 12.449  15.504 142.755 1.00 53.21 ? 409  ASP B CB  1 
ATOM   6328 C CG  . ASP B 1 408 ? 11.552  15.050 143.906 1.00 55.62 ? 409  ASP B CG  1 
ATOM   6329 O OD1 . ASP B 1 408 ? 11.895  15.292 145.087 1.00 52.18 ? 409  ASP B OD1 1 
ATOM   6330 O OD2 . ASP B 1 408 ? 10.495  14.446 143.621 1.00 57.26 ? 409  ASP B OD2 1 
ATOM   6331 N N   . LYS B 1 409 ? 13.859  17.742 140.913 1.00 49.24 ? 410  LYS B N   1 
ATOM   6332 C CA  . LYS B 1 409 ? 14.792  18.074 139.834 1.00 47.12 ? 410  LYS B CA  1 
ATOM   6333 C C   . LYS B 1 409 ? 15.924  18.967 140.346 1.00 44.78 ? 410  LYS B C   1 
ATOM   6334 O O   . LYS B 1 409 ? 17.088  18.785 139.992 1.00 45.70 ? 410  LYS B O   1 
ATOM   6335 C CB  . LYS B 1 409 ? 14.069  18.747 138.661 1.00 41.44 ? 410  LYS B CB  1 
ATOM   6336 N N   . LEU B 1 410 ? 15.563  19.930 141.185 1.00 44.41 ? 411  LEU B N   1 
ATOM   6337 C CA  . LEU B 1 410 ? 16.515  20.881 141.739 1.00 44.36 ? 411  LEU B CA  1 
ATOM   6338 C C   . LEU B 1 410 ? 17.454  20.184 142.718 1.00 50.94 ? 411  LEU B C   1 
ATOM   6339 O O   . LEU B 1 410 ? 18.641  20.514 142.797 1.00 54.47 ? 411  LEU B O   1 
ATOM   6340 C CB  . LEU B 1 410 ? 15.767  22.028 142.422 1.00 41.74 ? 411  LEU B CB  1 
ATOM   6341 C CG  . LEU B 1 410 ? 14.935  22.907 141.473 1.00 42.76 ? 411  LEU B CG  1 
ATOM   6342 C CD1 . LEU B 1 410 ? 13.932  23.785 142.222 1.00 42.95 ? 411  LEU B CD1 1 
ATOM   6343 C CD2 . LEU B 1 410 ? 15.834  23.769 140.606 1.00 41.60 ? 411  LEU B CD2 1 
ATOM   6344 N N   . VAL B 1 411 ? 16.924  19.217 143.459 1.00 51.73 ? 412  VAL B N   1 
ATOM   6345 C CA  . VAL B 1 411 ? 17.754  18.437 144.376 1.00 55.69 ? 412  VAL B CA  1 
ATOM   6346 C C   . VAL B 1 411 ? 18.822  17.663 143.600 1.00 55.52 ? 412  VAL B C   1 
ATOM   6347 O O   . VAL B 1 411 ? 20.002  17.695 143.957 1.00 51.86 ? 412  VAL B O   1 
ATOM   6348 C CB  . VAL B 1 411 ? 16.912  17.481 145.252 1.00 54.30 ? 412  VAL B CB  1 
ATOM   6349 C CG1 . VAL B 1 411 ? 17.818  16.534 146.061 1.00 51.93 ? 412  VAL B CG1 1 
ATOM   6350 C CG2 . VAL B 1 411 ? 16.020  18.284 146.183 1.00 53.55 ? 412  VAL B CG2 1 
ATOM   6351 N N   . LYS B 1 412 ? 18.399  16.992 142.529 1.00 55.93 ? 413  LYS B N   1 
ATOM   6352 C CA  . LYS B 1 412 ? 19.328  16.304 141.642 1.00 57.73 ? 413  LYS B CA  1 
ATOM   6353 C C   . LYS B 1 412 ? 20.411  17.268 141.146 1.00 54.98 ? 413  LYS B C   1 
ATOM   6354 O O   . LYS B 1 412 ? 21.593  16.939 141.173 1.00 49.83 ? 413  LYS B O   1 
ATOM   6355 C CB  . LYS B 1 412 ? 18.585  15.675 140.459 1.00 58.83 ? 413  LYS B CB  1 
ATOM   6356 C CG  . LYS B 1 412 ? 19.507  15.238 139.320 1.00 59.42 ? 413  LYS B CG  1 
ATOM   6357 C CD  . LYS B 1 412 ? 18.754  14.527 138.206 1.00 61.35 ? 413  LYS B CD  1 
ATOM   6358 C CE  . LYS B 1 412 ? 19.672  14.223 137.024 1.00 62.89 ? 413  LYS B CE  1 
ATOM   6359 N NZ  . LYS B 1 412 ? 20.834  13.357 137.392 1.00 65.81 ? 413  LYS B NZ  1 
ATOM   6360 N N   . VAL B 1 413 ? 20.000  18.461 140.714 1.00 50.78 ? 414  VAL B N   1 
ATOM   6361 C CA  . VAL B 1 413 ? 20.942  19.495 140.261 1.00 47.82 ? 414  VAL B CA  1 
ATOM   6362 C C   . VAL B 1 413 ? 21.981  19.859 141.328 1.00 47.97 ? 414  VAL B C   1 
ATOM   6363 O O   . VAL B 1 413 ? 23.182  19.940 141.055 1.00 48.59 ? 414  VAL B O   1 
ATOM   6364 C CB  . VAL B 1 413 ? 20.201  20.783 139.841 1.00 44.31 ? 414  VAL B CB  1 
ATOM   6365 C CG1 . VAL B 1 413 ? 21.186  21.926 139.645 1.00 43.76 ? 414  VAL B CG1 1 
ATOM   6366 C CG2 . VAL B 1 413 ? 19.396  20.543 138.577 1.00 41.25 ? 414  VAL B CG2 1 
ATOM   6367 N N   . ILE B 1 414 ? 21.498  20.078 142.543 1.00 45.37 ? 415  ILE B N   1 
ATOM   6368 C CA  . ILE B 1 414 ? 22.346  20.445 143.661 1.00 46.43 ? 415  ILE B CA  1 
ATOM   6369 C C   . ILE B 1 414 ? 23.259  19.288 144.042 1.00 48.53 ? 415  ILE B C   1 
ATOM   6370 O O   . ILE B 1 414 ? 24.465  19.464 144.208 1.00 47.43 ? 415  ILE B O   1 
ATOM   6371 C CB  . ILE B 1 414 ? 21.486  20.843 144.873 1.00 51.35 ? 415  ILE B CB  1 
ATOM   6372 C CG1 . ILE B 1 414 ? 20.836  22.205 144.619 1.00 43.56 ? 415  ILE B CG1 1 
ATOM   6373 C CG2 . ILE B 1 414 ? 22.314  20.845 146.162 1.00 46.33 ? 415  ILE B CG2 1 
ATOM   6374 C CD1 . ILE B 1 414 ? 19.545  22.410 145.355 1.00 44.25 ? 415  ILE B CD1 1 
ATOM   6375 N N   . GLU B 1 415 ? 22.678  18.100 144.164 1.00 51.83 ? 416  GLU B N   1 
ATOM   6376 C CA  . GLU B 1 415 ? 23.437  16.919 144.571 1.00 56.78 ? 416  GLU B CA  1 
ATOM   6377 C C   . GLU B 1 415 ? 24.469  16.484 143.533 1.00 57.30 ? 416  GLU B C   1 
ATOM   6378 O O   . GLU B 1 415 ? 25.561  16.057 143.898 1.00 48.34 ? 416  GLU B O   1 
ATOM   6379 C CB  . GLU B 1 415 ? 22.497  15.762 144.913 1.00 57.09 ? 416  GLU B CB  1 
ATOM   6380 C CG  . GLU B 1 415 ? 21.805  15.943 146.238 1.00 57.15 ? 416  GLU B CG  1 
ATOM   6381 C CD  . GLU B 1 415 ? 22.795  16.108 147.373 1.00 63.23 ? 416  GLU B CD  1 
ATOM   6382 O OE1 . GLU B 1 415 ? 23.810  15.373 147.388 1.00 66.88 ? 416  GLU B OE1 1 
ATOM   6383 O OE2 . GLU B 1 415 ? 22.563  16.977 148.242 1.00 63.86 ? 416  GLU B OE2 1 
ATOM   6384 N N   . ASP B 1 416 ? 24.118  16.604 142.249 1.00 52.74 ? 417  ASP B N   1 
ATOM   6385 C CA  . ASP B 1 416 ? 25.031  16.272 141.158 1.00 56.23 ? 417  ASP B CA  1 
ATOM   6386 C C   . ASP B 1 416 ? 26.203  17.240 141.115 1.00 55.25 ? 417  ASP B C   1 
ATOM   6387 O O   . ASP B 1 416 ? 27.306  16.869 140.723 1.00 52.68 ? 417  ASP B O   1 
ATOM   6388 C CB  . ASP B 1 416 ? 24.317  16.288 139.799 1.00 60.16 ? 417  ASP B CB  1 
ATOM   6389 C CG  . ASP B 1 416 ? 23.478  15.045 139.556 1.00 66.84 ? 417  ASP B CG  1 
ATOM   6390 O OD1 . ASP B 1 416 ? 23.627  14.053 140.302 1.00 75.44 ? 417  ASP B OD1 1 
ATOM   6391 O OD2 . ASP B 1 416 ? 22.674  15.056 138.601 1.00 66.39 ? 417  ASP B OD2 1 
ATOM   6392 N N   . ALA B 1 417 ? 25.956  18.488 141.504 1.00 53.62 ? 418  ALA B N   1 
ATOM   6393 C CA  . ALA B 1 417 ? 27.008  19.494 141.491 1.00 49.39 ? 418  ALA B CA  1 
ATOM   6394 C C   . ALA B 1 417 ? 28.099  19.121 142.485 1.00 51.59 ? 418  ALA B C   1 
ATOM   6395 O O   . ALA B 1 417 ? 29.271  19.437 142.294 1.00 53.68 ? 418  ALA B O   1 
ATOM   6396 C CB  . ALA B 1 417 ? 26.441  20.864 141.800 1.00 47.65 ? 418  ALA B CB  1 
ATOM   6397 N N   . LYS B 1 418 ? 27.710  18.421 143.539 1.00 54.61 ? 419  LYS B N   1 
ATOM   6398 C CA  . LYS B 1 418 ? 28.654  18.023 144.570 1.00 56.31 ? 419  LYS B CA  1 
ATOM   6399 C C   . LYS B 1 418 ? 29.612  16.940 144.082 1.00 60.12 ? 419  LYS B C   1 
ATOM   6400 O O   . LYS B 1 418 ? 30.783  16.932 144.449 1.00 60.82 ? 419  LYS B O   1 
ATOM   6401 C CB  . LYS B 1 418 ? 27.903  17.557 145.818 1.00 54.93 ? 419  LYS B CB  1 
ATOM   6402 C CG  . LYS B 1 418 ? 27.171  18.677 146.530 1.00 57.48 ? 419  LYS B CG  1 
ATOM   6403 C CD  . LYS B 1 418 ? 26.202  18.149 147.567 1.00 61.16 ? 419  LYS B CD  1 
ATOM   6404 C CE  . LYS B 1 418 ? 25.656  19.291 148.413 1.00 60.45 ? 419  LYS B CE  1 
ATOM   6405 N NZ  . LYS B 1 418 ? 24.491  18.878 149.240 1.00 61.04 ? 419  LYS B NZ  1 
ATOM   6406 N N   . LYS B 1 419 ? 29.117  16.031 143.250 1.00 63.00 ? 420  LYS B N   1 
ATOM   6407 C CA  . LYS B 1 419 ? 29.950  14.943 142.746 1.00 63.35 ? 420  LYS B CA  1 
ATOM   6408 C C   . LYS B 1 419 ? 30.690  15.349 141.468 1.00 62.86 ? 420  LYS B C   1 
ATOM   6409 O O   . LYS B 1 419 ? 31.601  14.653 141.028 1.00 65.77 ? 420  LYS B O   1 
ATOM   6410 C CB  . LYS B 1 419 ? 29.106  13.693 142.495 1.00 63.48 ? 420  LYS B CB  1 
ATOM   6411 C CG  . LYS B 1 419 ? 28.205  13.311 143.651 1.00 69.12 ? 420  LYS B CG  1 
ATOM   6412 C CD  . LYS B 1 419 ? 27.024  12.470 143.182 1.00 75.98 ? 420  LYS B CD  1 
ATOM   6413 C CE  . LYS B 1 419 ? 25.915  12.435 144.234 1.00 82.19 ? 420  LYS B CE  1 
ATOM   6414 N NZ  . LYS B 1 419 ? 24.634  11.865 143.718 1.00 85.26 ? 420  LYS B NZ  1 
ATOM   6415 N N   . ASP B 1 420 ? 30.294  16.472 140.873 1.00 56.53 ? 421  ASP B N   1 
ATOM   6416 C CA  . ASP B 1 420 ? 30.921  16.953 139.641 1.00 58.37 ? 421  ASP B CA  1 
ATOM   6417 C C   . ASP B 1 420 ? 32.185  17.747 139.960 1.00 64.23 ? 421  ASP B C   1 
ATOM   6418 O O   . ASP B 1 420 ? 32.127  18.778 140.642 1.00 62.76 ? 421  ASP B O   1 
ATOM   6419 C CB  . ASP B 1 420 ? 29.940  17.809 138.824 1.00 56.04 ? 421  ASP B CB  1 
ATOM   6420 C CG  . ASP B 1 420 ? 30.356  17.963 137.356 1.00 52.35 ? 421  ASP B CG  1 
ATOM   6421 O OD1 . ASP B 1 420 ? 31.564  18.113 137.071 1.00 50.83 ? 421  ASP B OD1 1 
ATOM   6422 O OD2 . ASP B 1 420 ? 29.461  17.940 136.481 1.00 50.15 ? 421  ASP B OD2 1 
ATOM   6423 N N   . PRO B 1 421 ? 33.338  17.262 139.467 1.00 68.21 ? 422  PRO B N   1 
ATOM   6424 C CA  . PRO B 1 421 ? 34.631  17.890 139.743 1.00 62.95 ? 422  PRO B CA  1 
ATOM   6425 C C   . PRO B 1 421 ? 34.806  19.165 138.940 1.00 59.02 ? 422  PRO B C   1 
ATOM   6426 O O   . PRO B 1 421 ? 35.683  19.959 139.261 1.00 59.97 ? 422  PRO B O   1 
ATOM   6427 C CB  . PRO B 1 421 ? 35.638  16.831 139.288 1.00 63.35 ? 422  PRO B CB  1 
ATOM   6428 C CG  . PRO B 1 421 ? 34.931  16.092 138.212 1.00 66.86 ? 422  PRO B CG  1 
ATOM   6429 C CD  . PRO B 1 421 ? 33.479  16.063 138.619 1.00 70.19 ? 422  PRO B CD  1 
ATOM   6430 N N   . GLU B 1 422 ? 33.984  19.363 137.915 1.00 60.65 ? 423  GLU B N   1 
ATOM   6431 C CA  . GLU B 1 422 ? 34.033  20.602 137.140 1.00 59.15 ? 423  GLU B CA  1 
ATOM   6432 C C   . GLU B 1 422 ? 33.067  21.654 137.672 1.00 54.72 ? 423  GLU B C   1 
ATOM   6433 O O   . GLU B 1 422 ? 32.969  22.750 137.124 1.00 51.29 ? 423  GLU B O   1 
ATOM   6434 C CB  . GLU B 1 422 ? 33.764  20.336 135.663 1.00 66.13 ? 423  GLU B CB  1 
ATOM   6435 C CG  . GLU B 1 422 ? 34.955  19.766 134.916 1.00 75.81 ? 423  GLU B CG  1 
ATOM   6436 C CD  . GLU B 1 422 ? 34.755  19.791 133.413 1.00 83.86 ? 423  GLU B CD  1 
ATOM   6437 O OE1 . GLU B 1 422 ? 33.671  19.375 132.942 1.00 85.38 ? 423  GLU B OE1 1 
ATOM   6438 O OE2 . GLU B 1 422 ? 35.681  20.241 132.704 1.00 86.87 ? 423  GLU B OE2 1 
ATOM   6439 N N   . LEU B 1 423 ? 32.352  21.314 138.740 1.00 57.10 ? 424  LEU B N   1 
ATOM   6440 C CA  . LEU B 1 423 ? 31.494  22.276 139.429 1.00 55.96 ? 424  LEU B CA  1 
ATOM   6441 C C   . LEU B 1 423 ? 31.975  22.459 140.863 1.00 55.84 ? 424  LEU B C   1 
ATOM   6442 O O   . LEU B 1 423 ? 32.596  21.562 141.440 1.00 56.96 ? 424  LEU B O   1 
ATOM   6443 C CB  . LEU B 1 423 ? 30.036  21.808 139.435 1.00 49.17 ? 424  LEU B CB  1 
ATOM   6444 C CG  . LEU B 1 423 ? 29.405  21.544 138.071 1.00 48.74 ? 424  LEU B CG  1 
ATOM   6445 C CD1 . LEU B 1 423 ? 27.989  21.032 138.235 1.00 48.49 ? 424  LEU B CD1 1 
ATOM   6446 C CD2 . LEU B 1 423 ? 29.426  22.802 137.230 1.00 50.10 ? 424  LEU B CD2 1 
ATOM   6447 N N   . GLU B 1 424 ? 31.683  23.625 141.426 1.00 50.51 ? 425  GLU B N   1 
ATOM   6448 C CA  . GLU B 1 424 ? 31.928  23.895 142.836 1.00 51.21 ? 425  GLU B CA  1 
ATOM   6449 C C   . GLU B 1 424 ? 30.779  24.746 143.377 1.00 53.14 ? 425  GLU B C   1 
ATOM   6450 O O   . GLU B 1 424 ? 30.534  25.841 142.878 1.00 51.28 ? 425  GLU B O   1 
ATOM   6451 C CB  . GLU B 1 424 ? 33.247  24.641 143.011 1.00 56.88 ? 425  GLU B CB  1 
ATOM   6452 C CG  . GLU B 1 424 ? 33.554  25.029 144.451 1.00 63.86 ? 425  GLU B CG  1 
ATOM   6453 C CD  . GLU B 1 424 ? 34.735  25.980 144.578 1.00 69.64 ? 425  GLU B CD  1 
ATOM   6454 O OE1 . GLU B 1 424 ? 35.215  26.511 143.548 1.00 69.48 ? 425  GLU B OE1 1 
ATOM   6455 O OE2 . GLU B 1 424 ? 35.185  26.199 145.721 1.00 74.36 ? 425  GLU B OE2 1 
ATOM   6456 N N   . ILE B 1 425 ? 30.061  24.248 144.380 1.00 52.35 ? 426  ILE B N   1 
ATOM   6457 C CA  . ILE B 1 425 ? 28.975  25.032 144.955 1.00 50.99 ? 426  ILE B CA  1 
ATOM   6458 C C   . ILE B 1 425 ? 29.544  26.109 145.866 1.00 50.63 ? 426  ILE B C   1 
ATOM   6459 O O   . ILE B 1 425 ? 30.151  25.800 146.885 1.00 51.94 ? 426  ILE B O   1 
ATOM   6460 C CB  . ILE B 1 425 ? 27.984  24.173 145.753 1.00 50.77 ? 426  ILE B CB  1 
ATOM   6461 C CG1 . ILE B 1 425 ? 27.354  23.108 144.861 1.00 45.81 ? 426  ILE B CG1 1 
ATOM   6462 C CG2 . ILE B 1 425 ? 26.892  25.050 146.352 1.00 48.86 ? 426  ILE B CG2 1 
ATOM   6463 C CD1 . ILE B 1 425 ? 26.315  22.288 145.579 1.00 45.32 ? 426  ILE B CD1 1 
ATOM   6464 N N   . LEU B 1 426 ? 29.342  27.372 145.495 1.00 48.21 ? 427  LEU B N   1 
ATOM   6465 C CA  . LEU B 1 426 ? 29.918  28.493 146.234 1.00 50.35 ? 427  LEU B CA  1 
ATOM   6466 C C   . LEU B 1 426 ? 29.023  28.939 147.379 1.00 52.74 ? 427  LEU B C   1 
ATOM   6467 O O   . LEU B 1 426 ? 29.499  29.483 148.377 1.00 54.17 ? 427  LEU B O   1 
ATOM   6468 C CB  . LEU B 1 426 ? 30.186  29.679 145.299 1.00 48.66 ? 427  LEU B CB  1 
ATOM   6469 C CG  . LEU B 1 426 ? 31.094  29.428 144.093 1.00 44.39 ? 427  LEU B CG  1 
ATOM   6470 C CD1 . LEU B 1 426 ? 31.540  30.745 143.472 1.00 38.97 ? 427  LEU B CD1 1 
ATOM   6471 C CD2 . LEU B 1 426 ? 32.299  28.586 144.494 1.00 40.95 ? 427  LEU B CD2 1 
ATOM   6472 N N   . TYR B 1 427 ? 27.725  28.700 147.236 1.00 49.04 ? 428  TYR B N   1 
ATOM   6473 C CA  . TYR B 1 427 ? 26.766  29.154 148.228 1.00 48.12 ? 428  TYR B CA  1 
ATOM   6474 C C   . TYR B 1 427 ? 25.450  28.405 148.117 1.00 48.18 ? 428  TYR B C   1 
ATOM   6475 O O   . TYR B 1 427 ? 24.948  28.179 147.015 1.00 43.83 ? 428  TYR B O   1 
ATOM   6476 C CB  . TYR B 1 427 ? 26.496  30.651 148.043 1.00 48.28 ? 428  TYR B CB  1 
ATOM   6477 C CG  . TYR B 1 427 ? 25.481  31.229 149.013 1.00 47.98 ? 428  TYR B CG  1 
ATOM   6478 C CD1 . TYR B 1 427 ? 25.890  31.865 150.179 1.00 44.81 ? 428  TYR B CD1 1 
ATOM   6479 C CD2 . TYR B 1 427 ? 24.115  31.150 148.753 1.00 45.56 ? 428  TYR B CD2 1 
ATOM   6480 C CE1 . TYR B 1 427 ? 24.962  32.399 151.069 1.00 55.95 ? 428  TYR B CE1 1 
ATOM   6481 C CE2 . TYR B 1 427 ? 23.185  31.677 149.633 1.00 51.29 ? 428  TYR B CE2 1 
ATOM   6482 C CZ  . TYR B 1 427 ? 23.614  32.301 150.788 1.00 55.88 ? 428  TYR B CZ  1 
ATOM   6483 O OH  . TYR B 1 427 ? 22.683  32.825 151.656 1.00 59.52 ? 428  TYR B OH  1 
ATOM   6484 N N   . GLY B 1 428 ? 24.875  28.058 149.265 1.00 48.79 ? 429  GLY B N   1 
ATOM   6485 C CA  . GLY B 1 428 ? 23.511  27.566 149.305 1.00 45.43 ? 429  GLY B CA  1 
ATOM   6486 C C   . GLY B 1 428 ? 23.382  26.078 149.070 1.00 55.69 ? 429  GLY B C   1 
ATOM   6487 O O   . GLY B 1 428 ? 24.137  25.280 149.628 1.00 55.03 ? 429  GLY B O   1 
ATOM   6488 N N   . GLY B 1 429 ? 22.418  25.698 148.240 1.00 53.39 ? 430  GLY B N   1 
ATOM   6489 C CA  . GLY B 1 429 ? 22.141  24.294 148.011 1.00 55.05 ? 430  GLY B CA  1 
ATOM   6490 C C   . GLY B 1 429 ? 21.276  23.705 149.109 1.00 54.88 ? 430  GLY B C   1 
ATOM   6491 O O   . GLY B 1 429 ? 21.097  22.491 149.190 1.00 55.62 ? 430  GLY B O   1 
ATOM   6492 N N   . GLN B 1 430 ? 20.731  24.565 149.962 1.00 53.66 ? 431  GLN B N   1 
ATOM   6493 C CA  . GLN B 1 430 ? 19.833  24.100 151.009 1.00 53.68 ? 431  GLN B CA  1 
ATOM   6494 C C   . GLN B 1 430 ? 18.507  23.691 150.385 1.00 56.81 ? 431  GLN B C   1 
ATOM   6495 O O   . GLN B 1 430 ? 18.046  24.315 149.412 1.00 47.81 ? 431  GLN B O   1 
ATOM   6496 C CB  . GLN B 1 430 ? 19.610  25.186 152.067 1.00 54.64 ? 431  GLN B CB  1 
ATOM   6497 N N   . TYR B 1 431 ? 17.909  22.635 150.932 1.00 54.12 ? 432  TYR B N   1 
ATOM   6498 C CA  . TYR B 1 431 ? 16.560  22.235 150.547 1.00 57.75 ? 432  TYR B CA  1 
ATOM   6499 C C   . TYR B 1 431 ? 15.824  21.495 151.667 1.00 64.81 ? 432  TYR B C   1 
ATOM   6500 O O   . TYR B 1 431 ? 16.439  20.832 152.512 1.00 55.17 ? 432  TYR B O   1 
ATOM   6501 C CB  . TYR B 1 431 ? 16.544  21.432 149.237 1.00 50.08 ? 432  TYR B CB  1 
ATOM   6502 C CG  . TYR B 1 431 ? 17.451  20.221 149.194 1.00 50.97 ? 432  TYR B CG  1 
ATOM   6503 C CD1 . TYR B 1 431 ? 17.098  19.038 149.833 1.00 52.98 ? 432  TYR B CD1 1 
ATOM   6504 C CD2 . TYR B 1 431 ? 18.651  20.253 148.491 1.00 49.88 ? 432  TYR B CD2 1 
ATOM   6505 C CE1 . TYR B 1 431 ? 17.922  17.927 149.789 1.00 53.87 ? 432  TYR B CE1 1 
ATOM   6506 C CE2 . TYR B 1 431 ? 19.485  19.143 148.441 1.00 52.95 ? 432  TYR B CE2 1 
ATOM   6507 C CZ  . TYR B 1 431 ? 19.111  17.982 149.090 1.00 61.00 ? 432  TYR B CZ  1 
ATOM   6508 O OH  . TYR B 1 431 ? 19.931  16.876 149.048 1.00 63.56 ? 432  TYR B OH  1 
ATOM   6509 N N   . ASP B 1 432 ? 14.499  21.618 151.656 1.00 65.95 ? 433  ASP B N   1 
ATOM   6510 C CA  . ASP B 1 432 ? 13.662  21.081 152.719 1.00 65.67 ? 433  ASP B CA  1 
ATOM   6511 C C   . ASP B 1 432 ? 12.243  20.887 152.185 1.00 65.99 ? 433  ASP B C   1 
ATOM   6512 O O   . ASP B 1 432 ? 11.569  21.852 151.827 1.00 65.69 ? 433  ASP B O   1 
ATOM   6513 C CB  . ASP B 1 432 ? 13.669  22.052 153.900 1.00 56.78 ? 433  ASP B CB  1 
ATOM   6514 C CG  . ASP B 1 432 ? 13.044  21.470 155.154 1.00 63.81 ? 433  ASP B CG  1 
ATOM   6515 O OD1 . ASP B 1 432 ? 12.348  20.430 155.074 1.00 64.59 ? 433  ASP B OD1 1 
ATOM   6516 O OD2 . ASP B 1 432 ? 13.249  22.073 156.231 1.00 62.09 ? 433  ASP B OD2 1 
ATOM   6517 N N   . LYS B 1 433 ? 11.801  19.634 152.121 1.00 56.84 ? 434  LYS B N   1 
ATOM   6518 C CA  . LYS B 1 433 ? 10.465  19.319 151.632 1.00 56.84 ? 434  LYS B CA  1 
ATOM   6519 C C   . LYS B 1 433 ? 9.515   18.938 152.766 1.00 65.47 ? 434  LYS B C   1 
ATOM   6520 O O   . LYS B 1 433 ? 8.395   18.487 152.516 1.00 64.59 ? 434  LYS B O   1 
ATOM   6521 C CB  . LYS B 1 433 ? 10.514  18.180 150.608 1.00 56.52 ? 434  LYS B CB  1 
ATOM   6522 C CG  . LYS B 1 433 ? 10.978  16.842 151.176 1.00 60.47 ? 434  LYS B CG  1 
ATOM   6523 C CD  . LYS B 1 433 ? 10.566  15.666 150.284 1.00 65.60 ? 434  LYS B CD  1 
ATOM   6524 C CE  . LYS B 1 433 ? 11.108  15.810 148.864 1.00 66.29 ? 434  LYS B CE  1 
ATOM   6525 N NZ  . LYS B 1 433 ? 10.813  14.639 147.981 1.00 66.89 ? 434  LYS B NZ  1 
ATOM   6526 N N   . SER B 1 434 ? 9.956   19.111 154.010 1.00 60.85 ? 435  SER B N   1 
ATOM   6527 C CA  . SER B 1 434 ? 9.161   18.658 155.150 1.00 67.69 ? 435  SER B CA  1 
ATOM   6528 C C   . SER B 1 434 ? 7.834   19.403 155.259 1.00 67.46 ? 435  SER B C   1 
ATOM   6529 O O   . SER B 1 434 ? 6.826   18.817 155.644 1.00 65.03 ? 435  SER B O   1 
ATOM   6530 C CB  . SER B 1 434 ? 9.949   18.771 156.460 1.00 69.21 ? 435  SER B CB  1 
ATOM   6531 O OG  . SER B 1 434 ? 10.060  20.118 156.888 1.00 71.09 ? 435  SER B OG  1 
ATOM   6532 N N   . GLN B 1 435 ? 7.838   20.687 154.903 1.00 65.75 ? 436  GLN B N   1 
ATOM   6533 C CA  . GLN B 1 435 ? 6.642   21.522 155.004 1.00 66.00 ? 436  GLN B CA  1 
ATOM   6534 C C   . GLN B 1 435 ? 6.147   22.001 153.636 1.00 66.74 ? 436  GLN B C   1 
ATOM   6535 O O   . GLN B 1 435 ? 4.952   21.961 153.345 1.00 58.86 ? 436  GLN B O   1 
ATOM   6536 C CB  . GLN B 1 435 ? 6.897   22.729 155.912 1.00 64.23 ? 436  GLN B CB  1 
ATOM   6537 C CG  . GLN B 1 435 ? 5.739   23.719 155.940 1.00 68.17 ? 436  GLN B CG  1 
ATOM   6538 C CD  . GLN B 1 435 ? 6.117   25.074 156.512 1.00 72.16 ? 436  GLN B CD  1 
ATOM   6539 O OE1 . GLN B 1 435 ? 6.849   25.168 157.494 1.00 77.11 ? 436  GLN B OE1 1 
ATOM   6540 N NE2 . GLN B 1 435 ? 5.616   26.134 155.892 1.00 73.65 ? 436  GLN B NE2 1 
ATOM   6541 N N   . GLY B 1 436 ? 7.071   22.467 152.807 1.00 64.19 ? 437  GLY B N   1 
ATOM   6542 C CA  . GLY B 1 436 ? 6.741   22.917 151.465 1.00 62.64 ? 437  GLY B CA  1 
ATOM   6543 C C   . GLY B 1 436 ? 7.900   22.588 150.553 1.00 61.45 ? 437  GLY B C   1 
ATOM   6544 O O   . GLY B 1 436 ? 8.865   21.962 150.996 1.00 60.71 ? 437  GLY B O   1 
ATOM   6545 N N   . TRP B 1 437 ? 7.822   22.997 149.290 1.00 50.81 ? 438  TRP B N   1 
ATOM   6546 C CA  . TRP B 1 437 ? 8.899   22.713 148.360 1.00 49.48 ? 438  TRP B CA  1 
ATOM   6547 C C   . TRP B 1 437 ? 9.892   23.859 148.405 1.00 61.20 ? 438  TRP B C   1 
ATOM   6548 O O   . TRP B 1 437 ? 9.883   24.752 147.555 1.00 59.68 ? 438  TRP B O   1 
ATOM   6549 C CB  . TRP B 1 437 ? 8.357   22.486 146.950 1.00 47.99 ? 438  TRP B CB  1 
ATOM   6550 C CG  . TRP B 1 437 ? 7.146   21.622 146.946 1.00 49.15 ? 438  TRP B CG  1 
ATOM   6551 C CD1 . TRP B 1 437 ? 5.874   21.994 146.617 1.00 54.59 ? 438  TRP B CD1 1 
ATOM   6552 C CD2 . TRP B 1 437 ? 7.076   20.240 147.319 1.00 51.01 ? 438  TRP B CD2 1 
ATOM   6553 N NE1 . TRP B 1 437 ? 5.021   20.926 146.743 1.00 57.64 ? 438  TRP B NE1 1 
ATOM   6554 C CE2 . TRP B 1 437 ? 5.732   19.837 147.178 1.00 59.80 ? 438  TRP B CE2 1 
ATOM   6555 C CE3 . TRP B 1 437 ? 8.020   19.303 147.756 1.00 56.78 ? 438  TRP B CE3 1 
ATOM   6556 C CZ2 . TRP B 1 437 ? 5.306   18.533 147.462 1.00 56.74 ? 438  TRP B CZ2 1 
ATOM   6557 C CZ3 . TRP B 1 437 ? 7.598   18.011 148.034 1.00 58.58 ? 438  TRP B CZ3 1 
ATOM   6558 C CH2 . TRP B 1 437 ? 6.250   17.640 147.887 1.00 57.44 ? 438  TRP B CH2 1 
ATOM   6559 N N   . PHE B 1 438 ? 10.755  23.823 149.410 1.00 49.45 ? 439  PHE B N   1 
ATOM   6560 C CA  . PHE B 1 438 ? 11.688  24.911 149.646 1.00 57.44 ? 439  PHE B CA  1 
ATOM   6561 C C   . PHE B 1 438 ? 13.120  24.569 149.224 1.00 48.09 ? 439  PHE B C   1 
ATOM   6562 O O   . PHE B 1 438 ? 13.766  23.687 149.798 1.00 49.43 ? 439  PHE B O   1 
ATOM   6563 C CB  . PHE B 1 438 ? 11.619  25.366 151.113 1.00 50.42 ? 439  PHE B CB  1 
ATOM   6564 C CG  . PHE B 1 438 ? 10.329  26.048 151.468 1.00 50.74 ? 439  PHE B CG  1 
ATOM   6565 C CD1 . PHE B 1 438 ? 10.127  27.384 151.152 1.00 49.38 ? 439  PHE B CD1 1 
ATOM   6566 C CD2 . PHE B 1 438 ? 9.311   25.353 152.098 1.00 54.33 ? 439  PHE B CD2 1 
ATOM   6567 C CE1 . PHE B 1 438 ? 8.948   28.013 151.462 1.00 49.70 ? 439  PHE B CE1 1 
ATOM   6568 C CE2 . PHE B 1 438 ? 8.115   25.980 152.415 1.00 52.82 ? 439  PHE B CE2 1 
ATOM   6569 C CZ  . PHE B 1 438 ? 7.936   27.308 152.106 1.00 51.43 ? 439  PHE B CZ  1 
ATOM   6570 N N   . VAL B 1 439 ? 13.584  25.271 148.196 1.00 46.12 ? 440  VAL B N   1 
ATOM   6571 C CA  . VAL B 1 439 ? 14.960  25.203 147.724 1.00 45.36 ? 440  VAL B CA  1 
ATOM   6572 C C   . VAL B 1 439 ? 15.550  26.601 147.878 1.00 49.95 ? 440  VAL B C   1 
ATOM   6573 O O   . VAL B 1 439 ? 14.953  27.592 147.438 1.00 52.01 ? 440  VAL B O   1 
ATOM   6574 C CB  . VAL B 1 439 ? 15.032  24.778 146.242 1.00 48.09 ? 440  VAL B CB  1 
ATOM   6575 C CG1 . VAL B 1 439 ? 16.477  24.722 145.762 1.00 45.84 ? 440  VAL B CG1 1 
ATOM   6576 C CG2 . VAL B 1 439 ? 14.348  23.436 146.039 1.00 47.12 ? 440  VAL B CG2 1 
ATOM   6577 N N   . GLY B 1 440 ? 16.704  26.683 148.525 1.00 45.16 ? 441  GLY B N   1 
ATOM   6578 C CA  . GLY B 1 440 ? 17.313  27.959 148.836 1.00 44.72 ? 441  GLY B CA  1 
ATOM   6579 C C   . GLY B 1 440 ? 18.116  28.500 147.674 1.00 53.49 ? 441  GLY B C   1 
ATOM   6580 O O   . GLY B 1 440 ? 18.396  27.778 146.713 1.00 49.80 ? 441  GLY B O   1 
ATOM   6581 N N   . PRO B 1 441 ? 18.474  29.787 147.740 1.00 42.29 ? 442  PRO B N   1 
ATOM   6582 C CA  . PRO B 1 441 ? 19.329  30.336 146.691 1.00 40.76 ? 442  PRO B CA  1 
ATOM   6583 C C   . PRO B 1 441 ? 20.654  29.552 146.624 1.00 44.85 ? 442  PRO B C   1 
ATOM   6584 O O   . PRO B 1 441 ? 21.233  29.215 147.655 1.00 46.71 ? 442  PRO B O   1 
ATOM   6585 C CB  . PRO B 1 441 ? 19.542  31.780 147.147 1.00 41.78 ? 442  PRO B CB  1 
ATOM   6586 C CG  . PRO B 1 441 ? 18.321  32.092 147.981 1.00 41.54 ? 442  PRO B CG  1 
ATOM   6587 C CD  . PRO B 1 441 ? 18.057  30.808 148.714 1.00 43.02 ? 442  PRO B CD  1 
ATOM   6588 N N   . THR B 1 442 ? 21.101  29.240 145.414 1.00 41.18 ? 443  THR B N   1 
ATOM   6589 C CA  . THR B 1 442 ? 22.306  28.449 145.223 1.00 41.79 ? 443  THR B CA  1 
ATOM   6590 C C   . THR B 1 442 ? 23.158  29.078 144.130 1.00 41.06 ? 443  THR B C   1 
ATOM   6591 O O   . THR B 1 442 ? 22.636  29.522 143.105 1.00 39.48 ? 443  THR B O   1 
ATOM   6592 C CB  . THR B 1 442 ? 21.960  27.001 144.811 1.00 45.26 ? 443  THR B CB  1 
ATOM   6593 O OG1 . THR B 1 442 ? 20.991  26.452 145.717 1.00 49.58 ? 443  THR B OG1 1 
ATOM   6594 C CG2 . THR B 1 442 ? 23.208  26.123 144.798 1.00 44.85 ? 443  THR B CG2 1 
ATOM   6595 N N   . VAL B 1 443 ? 24.466  29.129 144.351 1.00 43.68 ? 444  VAL B N   1 
ATOM   6596 C CA  . VAL B 1 443 ? 25.387  29.672 143.355 1.00 42.52 ? 444  VAL B CA  1 
ATOM   6597 C C   . VAL B 1 443 ? 26.484  28.660 143.065 1.00 44.87 ? 444  VAL B C   1 
ATOM   6598 O O   . VAL B 1 443 ? 27.161  28.190 143.978 1.00 51.35 ? 444  VAL B O   1 
ATOM   6599 C CB  . VAL B 1 443 ? 26.008  31.003 143.813 1.00 37.96 ? 444  VAL B CB  1 
ATOM   6600 C CG1 . VAL B 1 443 ? 26.958  31.533 142.761 1.00 36.93 ? 444  VAL B CG1 1 
ATOM   6601 C CG2 . VAL B 1 443 ? 24.905  32.035 144.104 1.00 37.79 ? 444  VAL B CG2 1 
ATOM   6602 N N   . ILE B 1 444 ? 26.636  28.312 141.792 1.00 41.84 ? 445  ILE B N   1 
ATOM   6603 C CA  . ILE B 1 444 ? 27.525  27.223 141.393 1.00 44.35 ? 445  ILE B CA  1 
ATOM   6604 C C   . ILE B 1 444 ? 28.541  27.706 140.367 1.00 42.94 ? 445  ILE B C   1 
ATOM   6605 O O   . ILE B 1 444 ? 28.180  28.292 139.348 1.00 39.19 ? 445  ILE B O   1 
ATOM   6606 C CB  . ILE B 1 444 ? 26.731  26.027 140.819 1.00 44.38 ? 445  ILE B CB  1 
ATOM   6607 C CG1 . ILE B 1 444 ? 25.621  25.607 141.790 1.00 38.64 ? 445  ILE B CG1 1 
ATOM   6608 C CG2 . ILE B 1 444 ? 27.664  24.860 140.501 1.00 44.64 ? 445  ILE B CG2 1 
ATOM   6609 C CD1 . ILE B 1 444 ? 24.921  24.325 141.416 1.00 40.52 ? 445  ILE B CD1 1 
ATOM   6610 N N   . LYS B 1 445 ? 29.817  27.477 140.653 1.00 44.94 ? 446  LYS B N   1 
ATOM   6611 C CA  . LYS B 1 445 ? 30.877  27.895 139.752 1.00 45.62 ? 446  LYS B CA  1 
ATOM   6612 C C   . LYS B 1 445 ? 31.244  26.739 138.835 1.00 48.13 ? 446  LYS B C   1 
ATOM   6613 O O   . LYS B 1 445 ? 31.302  25.586 139.263 1.00 46.66 ? 446  LYS B O   1 
ATOM   6614 C CB  . LYS B 1 445 ? 32.094  28.372 140.547 1.00 50.29 ? 446  LYS B CB  1 
ATOM   6615 C CG  . LYS B 1 445 ? 33.310  28.741 139.703 1.00 54.29 ? 446  LYS B CG  1 
ATOM   6616 C CD  . LYS B 1 445 ? 34.466  29.165 140.598 1.00 58.34 ? 446  LYS B CD  1 
ATOM   6617 C CE  . LYS B 1 445 ? 35.782  29.254 139.838 1.00 61.14 ? 446  LYS B CE  1 
ATOM   6618 N NZ  . LYS B 1 445 ? 36.941  29.159 140.777 1.00 64.66 ? 446  LYS B NZ  1 
ATOM   6619 N N   . ALA B 1 446 ? 31.463  27.050 137.564 1.00 51.04 ? 447  ALA B N   1 
ATOM   6620 C CA  . ALA B 1 446 ? 31.834  26.039 136.587 1.00 48.00 ? 447  ALA B CA  1 
ATOM   6621 C C   . ALA B 1 446 ? 33.247  26.284 136.087 1.00 48.12 ? 447  ALA B C   1 
ATOM   6622 O O   . ALA B 1 446 ? 33.632  27.425 135.821 1.00 47.57 ? 447  ALA B O   1 
ATOM   6623 C CB  . ALA B 1 446 ? 30.852  26.034 135.430 1.00 44.81 ? 447  ALA B CB  1 
ATOM   6624 N N   . LYS B 1 447 ? 34.018  25.209 135.970 1.00 52.50 ? 448  LYS B N   1 
ATOM   6625 C CA  . LYS B 1 447 ? 35.400  25.305 135.512 1.00 55.00 ? 448  LYS B CA  1 
ATOM   6626 C C   . LYS B 1 447 ? 35.462  25.721 134.041 1.00 51.47 ? 448  LYS B C   1 
ATOM   6627 O O   . LYS B 1 447 ? 36.386  26.411 133.619 1.00 53.15 ? 448  LYS B O   1 
ATOM   6628 C CB  . LYS B 1 447 ? 36.141  23.979 135.735 1.00 54.77 ? 448  LYS B CB  1 
ATOM   6629 N N   . ARG B 1 448 ? 34.472  25.307 133.262 1.00 50.03 ? 449  ARG B N   1 
ATOM   6630 C CA  . ARG B 1 448 ? 34.454  25.646 131.845 1.00 53.32 ? 449  ARG B CA  1 
ATOM   6631 C C   . ARG B 1 448 ? 33.107  26.233 131.416 1.00 54.42 ? 449  ARG B C   1 
ATOM   6632 O O   . ARG B 1 448 ? 32.054  25.842 131.926 1.00 56.77 ? 449  ARG B O   1 
ATOM   6633 C CB  . ARG B 1 448 ? 34.845  24.436 130.994 1.00 55.85 ? 449  ARG B CB  1 
ATOM   6634 C CG  . ARG B 1 448 ? 34.039  23.189 131.281 1.00 61.09 ? 449  ARG B CG  1 
ATOM   6635 C CD  . ARG B 1 448 ? 34.479  22.026 130.408 1.00 62.48 ? 449  ARG B CD  1 
ATOM   6636 N NE  . ARG B 1 448 ? 33.621  20.861 130.612 1.00 63.32 ? 449  ARG B NE  1 
ATOM   6637 C CZ  . ARG B 1 448 ? 32.562  20.572 129.861 1.00 64.27 ? 449  ARG B CZ  1 
ATOM   6638 N NH1 . ARG B 1 448 ? 32.229  21.363 128.850 1.00 64.54 ? 449  ARG B NH1 1 
ATOM   6639 N NH2 . ARG B 1 448 ? 31.838  19.491 130.117 1.00 65.71 ? 449  ARG B NH2 1 
ATOM   6640 N N   . PRO B 1 449 ? 33.144  27.191 130.480 1.00 51.97 ? 450  PRO B N   1 
ATOM   6641 C CA  . PRO B 1 449 ? 31.944  27.918 130.060 1.00 42.30 ? 450  PRO B CA  1 
ATOM   6642 C C   . PRO B 1 449 ? 30.974  27.044 129.292 1.00 42.45 ? 450  PRO B C   1 
ATOM   6643 O O   . PRO B 1 449 ? 29.809  27.417 129.150 1.00 46.74 ? 450  PRO B O   1 
ATOM   6644 C CB  . PRO B 1 449 ? 32.504  29.000 129.136 1.00 43.62 ? 450  PRO B CB  1 
ATOM   6645 C CG  . PRO B 1 449 ? 33.783  28.426 128.623 1.00 46.43 ? 450  PRO B CG  1 
ATOM   6646 C CD  . PRO B 1 449 ? 34.348  27.664 129.772 1.00 51.47 ? 450  PRO B CD  1 
ATOM   6647 N N   . ASP B 1 450 ? 31.430  25.902 128.796 1.00 39.01 ? 451  ASP B N   1 
ATOM   6648 C CA  . ASP B 1 450 ? 30.548  25.043 128.009 1.00 43.98 ? 451  ASP B CA  1 
ATOM   6649 C C   . ASP B 1 450 ? 30.055  23.835 128.819 1.00 48.79 ? 451  ASP B C   1 
ATOM   6650 O O   . ASP B 1 450 ? 29.524  22.869 128.271 1.00 55.80 ? 451  ASP B O   1 
ATOM   6651 C CB  . ASP B 1 450 ? 31.207  24.632 126.684 1.00 46.54 ? 451  ASP B CB  1 
ATOM   6652 C CG  . ASP B 1 450 ? 32.479  23.826 126.877 1.00 56.42 ? 451  ASP B CG  1 
ATOM   6653 O OD1 . ASP B 1 450 ? 33.021  23.785 128.007 1.00 56.96 ? 451  ASP B OD1 1 
ATOM   6654 O OD2 . ASP B 1 450 ? 32.945  23.232 125.881 1.00 65.65 ? 451  ASP B OD2 1 
ATOM   6655 N N   . HIS B 1 451 ? 30.224  23.902 130.133 1.00 43.37 ? 452  HIS B N   1 
ATOM   6656 C CA  . HIS B 1 451 ? 29.654  22.890 131.008 1.00 47.09 ? 452  HIS B CA  1 
ATOM   6657 C C   . HIS B 1 451 ? 28.123  22.930 130.901 1.00 45.04 ? 452  HIS B C   1 
ATOM   6658 O O   . HIS B 1 451 ? 27.534  24.013 130.847 1.00 40.80 ? 452  HIS B O   1 
ATOM   6659 C CB  . HIS B 1 451 ? 30.101  23.134 132.454 1.00 48.97 ? 452  HIS B CB  1 
ATOM   6660 C CG  . HIS B 1 451 ? 29.663  22.068 133.408 1.00 48.09 ? 452  HIS B CG  1 
ATOM   6661 N ND1 . HIS B 1 451 ? 28.352  21.919 133.805 1.00 44.10 ? 452  HIS B ND1 1 
ATOM   6662 C CD2 . HIS B 1 451 ? 30.359  21.089 134.032 1.00 48.65 ? 452  HIS B CD2 1 
ATOM   6663 C CE1 . HIS B 1 451 ? 28.261  20.896 134.637 1.00 46.40 ? 452  HIS B CE1 1 
ATOM   6664 N NE2 . HIS B 1 451 ? 29.463  20.374 134.789 1.00 48.49 ? 452  HIS B NE2 1 
ATOM   6665 N N   . PRO B 1 452 ? 27.477  21.752 130.866 1.00 41.70 ? 453  PRO B N   1 
ATOM   6666 C CA  . PRO B 1 452 ? 26.014  21.632 130.743 1.00 40.13 ? 453  PRO B CA  1 
ATOM   6667 C C   . PRO B 1 452 ? 25.212  22.568 131.671 1.00 38.39 ? 453  PRO B C   1 
ATOM   6668 O O   . PRO B 1 452 ? 24.118  22.990 131.301 1.00 36.46 ? 453  PRO B O   1 
ATOM   6669 C CB  . PRO B 1 452 ? 25.747  20.168 131.129 1.00 41.84 ? 453  PRO B CB  1 
ATOM   6670 C CG  . PRO B 1 452 ? 27.005  19.444 130.787 1.00 40.44 ? 453  PRO B CG  1 
ATOM   6671 C CD  . PRO B 1 452 ? 28.140  20.436 130.961 1.00 40.83 ? 453  PRO B CD  1 
ATOM   6672 N N   . TYR B 1 453 ? 25.746  22.878 132.850 1.00 37.07 ? 454  TYR B N   1 
ATOM   6673 C CA  . TYR B 1 453 ? 25.066  23.760 133.795 1.00 36.69 ? 454  TYR B CA  1 
ATOM   6674 C C   . TYR B 1 453 ? 24.951  25.186 133.266 1.00 44.01 ? 454  TYR B C   1 
ATOM   6675 O O   . TYR B 1 453 ? 24.080  25.946 133.703 1.00 52.76 ? 454  TYR B O   1 
ATOM   6676 C CB  . TYR B 1 453 ? 25.785  23.765 135.150 1.00 38.40 ? 454  TYR B CB  1 
ATOM   6677 C CG  . TYR B 1 453 ? 25.318  22.678 136.092 1.00 42.90 ? 454  TYR B CG  1 
ATOM   6678 C CD1 . TYR B 1 453 ? 25.181  21.365 135.654 1.00 45.54 ? 454  TYR B CD1 1 
ATOM   6679 C CD2 . TYR B 1 453 ? 25.021  22.961 137.419 1.00 40.47 ? 454  TYR B CD2 1 
ATOM   6680 C CE1 . TYR B 1 453 ? 24.760  20.372 136.508 1.00 46.07 ? 454  TYR B CE1 1 
ATOM   6681 C CE2 . TYR B 1 453 ? 24.594  21.975 138.278 1.00 42.12 ? 454  TYR B CE2 1 
ATOM   6682 C CZ  . TYR B 1 453 ? 24.468  20.680 137.817 1.00 45.10 ? 454  TYR B CZ  1 
ATOM   6683 O OH  . TYR B 1 453 ? 24.045  19.687 138.665 1.00 46.93 ? 454  TYR B OH  1 
ATOM   6684 N N   . MET B 1 454 ? 25.832  25.558 132.340 1.00 35.82 ? 455  MET B N   1 
ATOM   6685 C CA  . MET B 1 454 ? 25.746  26.867 131.708 1.00 40.23 ? 455  MET B CA  1 
ATOM   6686 C C   . MET B 1 454 ? 24.687  26.893 130.610 1.00 41.58 ? 455  MET B C   1 
ATOM   6687 O O   . MET B 1 454 ? 24.417  27.943 130.038 1.00 45.25 ? 455  MET B O   1 
ATOM   6688 C CB  . MET B 1 454 ? 27.100  27.303 131.139 1.00 42.17 ? 455  MET B CB  1 
ATOM   6689 C CG  . MET B 1 454 ? 28.201  27.485 132.182 1.00 44.14 ? 455  MET B CG  1 
ATOM   6690 S SD  . MET B 1 454 ? 27.979  28.953 133.210 1.00 47.58 ? 455  MET B SD  1 
ATOM   6691 C CE  . MET B 1 454 ? 28.229  30.259 132.017 1.00 37.68 ? 455  MET B CE  1 
ATOM   6692 N N   . SER B 1 455 ? 24.068  25.753 130.319 1.00 42.87 ? 456  SER B N   1 
ATOM   6693 C CA  . SER B 1 455 ? 23.082  25.732 129.240 1.00 42.83 ? 456  SER B CA  1 
ATOM   6694 C C   . SER B 1 455 ? 21.764  25.002 129.553 1.00 39.18 ? 456  SER B C   1 
ATOM   6695 O O   . SER B 1 455 ? 20.776  25.177 128.849 1.00 43.34 ? 456  SER B O   1 
ATOM   6696 C CB  . SER B 1 455 ? 23.714  25.170 127.958 1.00 42.22 ? 456  SER B CB  1 
ATOM   6697 O OG  . SER B 1 455 ? 24.151  23.838 128.147 1.00 49.04 ? 456  SER B OG  1 
ATOM   6698 N N   . THR B 1 456 ? 21.744  24.184 130.595 1.00 35.22 ? 457  THR B N   1 
ATOM   6699 C CA  . THR B 1 456 ? 20.538  23.416 130.918 1.00 37.92 ? 457  THR B CA  1 
ATOM   6700 C C   . THR B 1 456 ? 19.578  24.265 131.763 1.00 42.22 ? 457  THR B C   1 
ATOM   6701 O O   . THR B 1 456 ? 19.976  24.823 132.788 1.00 42.06 ? 457  THR B O   1 
ATOM   6702 C CB  . THR B 1 456 ? 20.890  22.081 131.647 1.00 44.84 ? 457  THR B CB  1 
ATOM   6703 O OG1 . THR B 1 456 ? 21.636  21.236 130.760 1.00 49.17 ? 457  THR B OG1 1 
ATOM   6704 C CG2 . THR B 1 456 ? 19.629  21.336 132.100 1.00 38.51 ? 457  THR B CG2 1 
ATOM   6705 N N   . GLU B 1 457 ? 18.328  24.384 131.318 1.00 44.36 ? 458  GLU B N   1 
ATOM   6706 C CA  . GLU B 1 457 ? 17.339  25.194 132.038 1.00 46.19 ? 458  GLU B CA  1 
ATOM   6707 C C   . GLU B 1 457 ? 16.849  24.483 133.309 1.00 45.42 ? 458  GLU B C   1 
ATOM   6708 O O   . GLU B 1 457 ? 16.331  23.375 133.239 1.00 47.87 ? 458  GLU B O   1 
ATOM   6709 C CB  . GLU B 1 457 ? 16.165  25.581 131.128 1.00 44.79 ? 458  GLU B CB  1 
ATOM   6710 C CG  . GLU B 1 457 ? 15.081  26.384 131.857 1.00 57.03 ? 458  GLU B CG  1 
ATOM   6711 C CD  . GLU B 1 457 ? 14.357  27.396 130.975 1.00 60.79 ? 458  GLU B CD  1 
ATOM   6712 O OE1 . GLU B 1 457 ? 14.017  28.489 131.488 1.00 62.20 ? 458  GLU B OE1 1 
ATOM   6713 O OE2 . GLU B 1 457 ? 14.120  27.102 129.781 1.00 62.77 ? 458  GLU B OE2 1 
ATOM   6714 N N   . PHE B 1 458 ? 17.024  25.128 134.463 1.00 42.88 ? 459  PHE B N   1 
ATOM   6715 C CA  . PHE B 1 458 ? 16.697  24.532 135.768 1.00 44.47 ? 459  PHE B CA  1 
ATOM   6716 C C   . PHE B 1 458 ? 15.370  25.016 136.368 1.00 44.81 ? 459  PHE B C   1 
ATOM   6717 O O   . PHE B 1 458 ? 14.781  24.332 137.209 1.00 47.11 ? 459  PHE B O   1 
ATOM   6718 C CB  . PHE B 1 458 ? 17.815  24.813 136.773 1.00 42.83 ? 459  PHE B CB  1 
ATOM   6719 C CG  . PHE B 1 458 ? 19.124  24.143 136.445 1.00 38.69 ? 459  PHE B CG  1 
ATOM   6720 C CD1 . PHE B 1 458 ? 19.158  22.859 135.924 1.00 38.55 ? 459  PHE B CD1 1 
ATOM   6721 C CD2 . PHE B 1 458 ? 20.326  24.808 136.661 1.00 42.01 ? 459  PHE B CD2 1 
ATOM   6722 C CE1 . PHE B 1 458 ? 20.372  22.245 135.630 1.00 43.18 ? 459  PHE B CE1 1 
ATOM   6723 C CE2 . PHE B 1 458 ? 21.542  24.206 136.373 1.00 42.00 ? 459  PHE B CE2 1 
ATOM   6724 C CZ  . PHE B 1 458 ? 21.566  22.920 135.855 1.00 44.71 ? 459  PHE B CZ  1 
ATOM   6725 N N   . PHE B 1 459 ? 14.917  26.194 135.941 1.00 44.35 ? 460  PHE B N   1 
ATOM   6726 C CA  . PHE B 1 459 ? 13.712  26.831 136.479 1.00 43.40 ? 460  PHE B CA  1 
ATOM   6727 C C   . PHE B 1 459 ? 13.645  26.753 137.999 1.00 43.92 ? 460  PHE B C   1 
ATOM   6728 O O   . PHE B 1 459 ? 12.700  26.203 138.555 1.00 41.79 ? 460  PHE B O   1 
ATOM   6729 C CB  . PHE B 1 459 ? 12.439  26.241 135.863 1.00 32.94 ? 460  PHE B CB  1 
ATOM   6730 C CG  . PHE B 1 459 ? 11.432  27.286 135.450 1.00 33.18 ? 460  PHE B CG  1 
ATOM   6731 C CD1 . PHE B 1 459 ? 11.763  28.246 134.498 1.00 32.48 ? 460  PHE B CD1 1 
ATOM   6732 C CD2 . PHE B 1 459 ? 10.157  27.313 136.007 1.00 37.33 ? 460  PHE B CD2 1 
ATOM   6733 C CE1 . PHE B 1 459 ? 10.831  29.224 134.100 1.00 37.07 ? 460  PHE B CE1 1 
ATOM   6734 C CE2 . PHE B 1 459 ? 9.222   28.280 135.609 1.00 38.11 ? 460  PHE B CE2 1 
ATOM   6735 C CZ  . PHE B 1 459 ? 9.561   29.231 134.651 1.00 33.82 ? 460  PHE B CZ  1 
ATOM   6736 N N   . GLY B 1 460 ? 14.671  27.292 138.651 1.00 44.16 ? 461  GLY B N   1 
ATOM   6737 C CA  . GLY B 1 460 ? 14.796  27.268 140.095 1.00 39.61 ? 461  GLY B CA  1 
ATOM   6738 C C   . GLY B 1 460 ? 15.791  28.332 140.522 1.00 42.67 ? 461  GLY B C   1 
ATOM   6739 O O   . GLY B 1 460 ? 16.379  29.015 139.674 1.00 40.56 ? 461  GLY B O   1 
ATOM   6740 N N   . PRO B 1 461 ? 15.975  28.497 141.841 1.00 36.52 ? 462  PRO B N   1 
ATOM   6741 C CA  . PRO B 1 461 ? 16.881  29.519 142.377 1.00 36.47 ? 462  PRO B CA  1 
ATOM   6742 C C   . PRO B 1 461 ? 18.346  29.080 142.310 1.00 37.44 ? 462  PRO B C   1 
ATOM   6743 O O   . PRO B 1 461 ? 19.038  29.060 143.335 1.00 37.69 ? 462  PRO B O   1 
ATOM   6744 C CB  . PRO B 1 461 ? 16.430  29.639 143.834 1.00 37.93 ? 462  PRO B CB  1 
ATOM   6745 C CG  . PRO B 1 461 ? 15.940  28.267 144.175 1.00 39.09 ? 462  PRO B CG  1 
ATOM   6746 C CD  . PRO B 1 461 ? 15.299  27.735 142.910 1.00 38.09 ? 462  PRO B CD  1 
ATOM   6747 N N   . ILE B 1 462 ? 18.808  28.738 141.108 1.00 37.85 ? 463  ILE B N   1 
ATOM   6748 C CA  . ILE B 1 462 ? 20.148  28.193 140.914 1.00 35.85 ? 463  ILE B CA  1 
ATOM   6749 C C   . ILE B 1 462 ? 20.922  28.955 139.855 1.00 41.78 ? 463  ILE B C   1 
ATOM   6750 O O   . ILE B 1 462 ? 20.546  28.966 138.686 1.00 44.47 ? 463  ILE B O   1 
ATOM   6751 C CB  . ILE B 1 462 ? 20.090  26.722 140.503 1.00 42.46 ? 463  ILE B CB  1 
ATOM   6752 C CG1 . ILE B 1 462 ? 19.320  25.927 141.566 1.00 41.73 ? 463  ILE B CG1 1 
ATOM   6753 C CG2 . ILE B 1 462 ? 21.507  26.182 140.280 1.00 36.55 ? 463  ILE B CG2 1 
ATOM   6754 C CD1 . ILE B 1 462 ? 19.565  24.465 141.536 1.00 48.87 ? 463  ILE B CD1 1 
ATOM   6755 N N   . LEU B 1 463 ? 22.007  29.592 140.268 1.00 39.76 ? 464  LEU B N   1 
ATOM   6756 C CA  . LEU B 1 463 ? 22.799  30.407 139.367 1.00 42.35 ? 464  LEU B CA  1 
ATOM   6757 C C   . LEU B 1 463 ? 24.115  29.695 139.072 1.00 43.48 ? 464  LEU B C   1 
ATOM   6758 O O   . LEU B 1 463 ? 24.796  29.269 139.999 1.00 39.38 ? 464  LEU B O   1 
ATOM   6759 C CB  . LEU B 1 463 ? 23.081  31.757 140.014 1.00 33.72 ? 464  LEU B CB  1 
ATOM   6760 C CG  . LEU B 1 463 ? 23.894  32.711 139.148 1.00 49.85 ? 464  LEU B CG  1 
ATOM   6761 C CD1 . LEU B 1 463 ? 23.065  33.126 137.946 1.00 31.59 ? 464  LEU B CD1 1 
ATOM   6762 C CD2 . LEU B 1 463 ? 24.355  33.917 139.941 1.00 33.19 ? 464  LEU B CD2 1 
ATOM   6763 N N   . THR B 1 464 ? 24.464  29.540 137.794 1.00 39.78 ? 465  THR B N   1 
ATOM   6764 C CA  . THR B 1 464 ? 25.766  28.974 137.433 1.00 36.99 ? 465  THR B CA  1 
ATOM   6765 C C   . THR B 1 464 ? 26.676  30.123 137.020 1.00 39.85 ? 465  THR B C   1 
ATOM   6766 O O   . THR B 1 464 ? 26.279  30.970 136.217 1.00 35.90 ? 465  THR B O   1 
ATOM   6767 C CB  . THR B 1 464 ? 25.688  27.933 136.276 1.00 37.30 ? 465  THR B CB  1 
ATOM   6768 O OG1 . THR B 1 464 ? 24.618  27.010 136.512 1.00 40.79 ? 465  THR B OG1 1 
ATOM   6769 C CG2 . THR B 1 464 ? 27.014  27.149 136.155 1.00 35.68 ? 465  THR B CG2 1 
ATOM   6770 N N   . VAL B 1 465 ? 27.889  30.158 137.567 1.00 41.22 ? 466  VAL B N   1 
ATOM   6771 C CA  . VAL B 1 465 ? 28.796  31.273 137.305 1.00 42.89 ? 466  VAL B CA  1 
ATOM   6772 C C   . VAL B 1 465 ? 30.114  30.823 136.677 1.00 45.17 ? 466  VAL B C   1 
ATOM   6773 O O   . VAL B 1 465 ? 30.731  29.851 137.110 1.00 42.90 ? 466  VAL B O   1 
ATOM   6774 C CB  . VAL B 1 465 ? 29.049  32.128 138.582 1.00 44.09 ? 466  VAL B CB  1 
ATOM   6775 C CG1 . VAL B 1 465 ? 29.458  31.254 139.734 1.00 49.24 ? 466  VAL B CG1 1 
ATOM   6776 C CG2 . VAL B 1 465 ? 30.094  33.206 138.328 1.00 40.12 ? 466  VAL B CG2 1 
ATOM   6777 N N   . TYR B 1 466 ? 30.523  31.522 135.624 1.00 43.13 ? 467  TYR B N   1 
ATOM   6778 C CA  . TYR B 1 466 ? 31.816  31.279 135.022 1.00 38.58 ? 467  TYR B CA  1 
ATOM   6779 C C   . TYR B 1 466 ? 32.662  32.538 135.104 1.00 43.27 ? 467  TYR B C   1 
ATOM   6780 O O   . TYR B 1 466 ? 32.230  33.626 134.699 1.00 43.29 ? 467  TYR B O   1 
ATOM   6781 C CB  . TYR B 1 466 ? 31.676  30.841 133.566 1.00 41.65 ? 467  TYR B CB  1 
ATOM   6782 C CG  . TYR B 1 466 ? 33.017  30.692 132.879 1.00 45.43 ? 467  TYR B CG  1 
ATOM   6783 C CD1 . TYR B 1 466 ? 33.897  29.683 133.256 1.00 49.22 ? 467  TYR B CD1 1 
ATOM   6784 C CD2 . TYR B 1 466 ? 33.411  31.569 131.873 1.00 44.24 ? 467  TYR B CD2 1 
ATOM   6785 C CE1 . TYR B 1 466 ? 35.125  29.546 132.646 1.00 53.99 ? 467  TYR B CE1 1 
ATOM   6786 C CE2 . TYR B 1 466 ? 34.638  31.439 131.252 1.00 47.09 ? 467  TYR B CE2 1 
ATOM   6787 C CZ  . TYR B 1 466 ? 35.490  30.422 131.646 1.00 52.84 ? 467  TYR B CZ  1 
ATOM   6788 O OH  . TYR B 1 466 ? 36.714  30.275 131.049 1.00 56.99 ? 467  TYR B OH  1 
ATOM   6789 N N   . GLU B 1 467 ? 33.870  32.380 135.630 1.00 47.39 ? 468  GLU B N   1 
ATOM   6790 C CA  . GLU B 1 467 ? 34.814  33.478 135.757 1.00 51.32 ? 468  GLU B CA  1 
ATOM   6791 C C   . GLU B 1 467 ? 35.778  33.496 134.570 1.00 49.48 ? 468  GLU B C   1 
ATOM   6792 O O   . GLU B 1 467 ? 36.414  32.489 134.259 1.00 51.52 ? 468  GLU B O   1 
ATOM   6793 C CB  . GLU B 1 467 ? 35.571  33.345 137.072 1.00 55.02 ? 468  GLU B CB  1 
ATOM   6794 C CG  . GLU B 1 467 ? 34.668  32.910 138.209 1.00 60.27 ? 468  GLU B CG  1 
ATOM   6795 C CD  . GLU B 1 467 ? 35.306  33.068 139.574 1.00 63.62 ? 468  GLU B CD  1 
ATOM   6796 O OE1 . GLU B 1 467 ? 36.553  33.097 139.657 1.00 63.36 ? 468  GLU B OE1 1 
ATOM   6797 O OE2 . GLU B 1 467 ? 34.549  33.171 140.563 1.00 64.57 ? 468  GLU B OE2 1 
ATOM   6798 N N   . TYR B 1 468 ? 35.867  34.644 133.904 1.00 41.91 ? 469  TYR B N   1 
ATOM   6799 C CA  . TYR B 1 468 ? 36.678  34.775 132.702 1.00 40.91 ? 469  TYR B CA  1 
ATOM   6800 C C   . TYR B 1 468 ? 37.745  35.835 132.937 1.00 51.87 ? 469  TYR B C   1 
ATOM   6801 O O   . TYR B 1 468 ? 37.489  36.831 133.623 1.00 54.47 ? 469  TYR B O   1 
ATOM   6802 C CB  . TYR B 1 468 ? 35.800  35.152 131.501 1.00 38.84 ? 469  TYR B CB  1 
ATOM   6803 C CG  . TYR B 1 468 ? 35.253  36.573 131.528 1.00 37.96 ? 469  TYR B CG  1 
ATOM   6804 C CD1 . TYR B 1 468 ? 34.055  36.872 132.168 1.00 41.19 ? 469  TYR B CD1 1 
ATOM   6805 C CD2 . TYR B 1 468 ? 35.930  37.612 130.899 1.00 39.94 ? 469  TYR B CD2 1 
ATOM   6806 C CE1 . TYR B 1 468 ? 33.555  38.174 132.196 1.00 38.85 ? 469  TYR B CE1 1 
ATOM   6807 C CE2 . TYR B 1 468 ? 35.440  38.907 130.916 1.00 40.72 ? 469  TYR B CE2 1 
ATOM   6808 C CZ  . TYR B 1 468 ? 34.258  39.183 131.571 1.00 40.43 ? 469  TYR B CZ  1 
ATOM   6809 O OH  . TYR B 1 468 ? 33.779  40.467 131.582 1.00 37.65 ? 469  TYR B OH  1 
ATOM   6810 N N   . PRO B 1 469 ? 38.953  35.621 132.378 1.00 53.97 ? 470  PRO B N   1 
ATOM   6811 C CA  . PRO B 1 469 ? 40.048  36.589 132.508 1.00 52.43 ? 470  PRO B CA  1 
ATOM   6812 C C   . PRO B 1 469 ? 39.684  37.879 131.795 1.00 49.94 ? 470  PRO B C   1 
ATOM   6813 O O   . PRO B 1 469 ? 39.255  37.815 130.637 1.00 48.79 ? 470  PRO B O   1 
ATOM   6814 C CB  . PRO B 1 469 ? 41.211  35.902 131.782 1.00 53.04 ? 470  PRO B CB  1 
ATOM   6815 C CG  . PRO B 1 469 ? 40.846  34.451 131.762 1.00 53.72 ? 470  PRO B CG  1 
ATOM   6816 C CD  . PRO B 1 469 ? 39.363  34.433 131.611 1.00 50.97 ? 470  PRO B CD  1 
ATOM   6817 N N   . ASP B 1 470 ? 39.851  39.010 132.481 1.00 44.57 ? 471  ASP B N   1 
ATOM   6818 C CA  . ASP B 1 470 ? 39.397  40.323 132.013 1.00 48.05 ? 471  ASP B CA  1 
ATOM   6819 C C   . ASP B 1 470 ? 39.661  40.624 130.540 1.00 52.60 ? 471  ASP B C   1 
ATOM   6820 O O   . ASP B 1 470 ? 38.793  41.151 129.841 1.00 57.80 ? 471  ASP B O   1 
ATOM   6821 C CB  . ASP B 1 470 ? 40.018  41.435 132.865 1.00 49.66 ? 471  ASP B CB  1 
ATOM   6822 C CG  . ASP B 1 470 ? 39.510  41.431 134.294 1.00 50.79 ? 471  ASP B CG  1 
ATOM   6823 O OD1 . ASP B 1 470 ? 39.352  40.330 134.866 1.00 48.18 ? 471  ASP B OD1 1 
ATOM   6824 O OD2 . ASP B 1 470 ? 39.263  42.532 134.842 1.00 52.36 ? 471  ASP B OD2 1 
ATOM   6825 N N   . THR B 1 471 ? 40.855  40.288 130.072 1.00 50.29 ? 472  THR B N   1 
ATOM   6826 C CA  . THR B 1 471 ? 41.251  40.617 128.712 1.00 51.88 ? 472  THR B CA  1 
ATOM   6827 C C   . THR B 1 471 ? 40.452  39.846 127.674 1.00 53.28 ? 472  THR B C   1 
ATOM   6828 O O   . THR B 1 471 ? 40.370  40.253 126.520 1.00 55.90 ? 472  THR B O   1 
ATOM   6829 C CB  . THR B 1 471 ? 42.752  40.357 128.480 1.00 50.14 ? 472  THR B CB  1 
ATOM   6830 O OG1 . THR B 1 471 ? 43.048  38.987 128.773 1.00 52.60 ? 472  THR B OG1 1 
ATOM   6831 C CG2 . THR B 1 471 ? 43.583  41.250 129.377 1.00 47.55 ? 472  THR B CG2 1 
ATOM   6832 N N   . GLU B 1 472 ? 39.859  38.734 128.083 1.00 56.53 ? 473  GLU B N   1 
ATOM   6833 C CA  . GLU B 1 472 ? 39.101  37.905 127.151 1.00 54.82 ? 473  GLU B CA  1 
ATOM   6834 C C   . GLU B 1 472 ? 37.599  38.200 127.118 1.00 48.27 ? 473  GLU B C   1 
ATOM   6835 O O   . GLU B 1 472 ? 36.808  37.325 126.792 1.00 48.05 ? 473  GLU B O   1 
ATOM   6836 C CB  . GLU B 1 472 ? 39.352  36.429 127.437 1.00 55.71 ? 473  GLU B CB  1 
ATOM   6837 C CG  . GLU B 1 472 ? 40.752  35.990 127.043 1.00 67.28 ? 473  GLU B CG  1 
ATOM   6838 C CD  . GLU B 1 472 ? 41.160  34.691 127.703 1.00 76.08 ? 473  GLU B CD  1 
ATOM   6839 O OE1 . GLU B 1 472 ? 40.269  33.852 127.973 1.00 75.86 ? 473  GLU B OE1 1 
ATOM   6840 O OE2 . GLU B 1 472 ? 42.372  34.514 127.959 1.00 81.91 ? 473  GLU B OE2 1 
ATOM   6841 N N   . PHE B 1 473 ? 37.218  39.431 127.442 1.00 47.38 ? 474  PHE B N   1 
ATOM   6842 C CA  . PHE B 1 473 ? 35.817  39.840 127.403 1.00 45.24 ? 474  PHE B CA  1 
ATOM   6843 C C   . PHE B 1 473 ? 35.209  39.655 126.015 1.00 44.89 ? 474  PHE B C   1 
ATOM   6844 O O   . PHE B 1 473 ? 34.105  39.126 125.877 1.00 43.84 ? 474  PHE B O   1 
ATOM   6845 C CB  . PHE B 1 473 ? 35.657  41.302 127.844 1.00 45.91 ? 474  PHE B CB  1 
ATOM   6846 C CG  . PHE B 1 473 ? 34.279  41.866 127.586 1.00 45.82 ? 474  PHE B CG  1 
ATOM   6847 C CD1 . PHE B 1 473 ? 33.196  41.479 128.371 1.00 44.60 ? 474  PHE B CD1 1 
ATOM   6848 C CD2 . PHE B 1 473 ? 34.066  42.777 126.565 1.00 41.96 ? 474  PHE B CD2 1 
ATOM   6849 C CE1 . PHE B 1 473 ? 31.928  41.987 128.138 1.00 42.32 ? 474  PHE B CE1 1 
ATOM   6850 C CE2 . PHE B 1 473 ? 32.803  43.287 126.326 1.00 43.98 ? 474  PHE B CE2 1 
ATOM   6851 C CZ  . PHE B 1 473 ? 31.731  42.896 127.113 1.00 43.20 ? 474  PHE B CZ  1 
ATOM   6852 N N   . ASN B 1 474 ? 35.929  40.099 124.988 1.00 44.44 ? 475  ASN B N   1 
ATOM   6853 C CA  . ASN B 1 474 ? 35.439  39.959 123.626 1.00 39.16 ? 475  ASN B CA  1 
ATOM   6854 C C   . ASN B 1 474 ? 35.221  38.500 123.267 1.00 39.80 ? 475  ASN B C   1 
ATOM   6855 O O   . ASN B 1 474 ? 34.175  38.149 122.717 1.00 38.27 ? 475  ASN B O   1 
ATOM   6856 C CB  . ASN B 1 474 ? 36.365  40.644 122.625 1.00 40.01 ? 475  ASN B CB  1 
ATOM   6857 C CG  . ASN B 1 474 ? 36.300  42.158 122.720 1.00 46.31 ? 475  ASN B CG  1 
ATOM   6858 O OD1 . ASN B 1 474 ? 35.553  42.709 123.531 1.00 44.58 ? 475  ASN B OD1 1 
ATOM   6859 N ND2 . ASN B 1 474 ? 37.097  42.840 121.903 1.00 48.84 ? 475  ASN B ND2 1 
ATOM   6860 N N   . GLU B 1 475 ? 36.196  37.657 123.609 1.00 39.36 ? 476  GLU B N   1 
ATOM   6861 C CA  . GLU B 1 475 ? 36.085  36.208 123.402 1.00 38.30 ? 476  GLU B CA  1 
ATOM   6862 C C   . GLU B 1 475 ? 34.878  35.632 124.142 1.00 37.40 ? 476  GLU B C   1 
ATOM   6863 O O   . GLU B 1 475 ? 34.166  34.775 123.617 1.00 33.42 ? 476  GLU B O   1 
ATOM   6864 C CB  . GLU B 1 475 ? 37.362  35.494 123.859 1.00 39.13 ? 476  GLU B CB  1 
ATOM   6865 N N   . ILE B 1 476 ? 34.644  36.105 125.365 1.00 37.93 ? 477  ILE B N   1 
ATOM   6866 C CA  . ILE B 1 476 ? 33.532  35.589 126.148 1.00 37.60 ? 477  ILE B CA  1 
ATOM   6867 C C   . ILE B 1 476 ? 32.202  35.953 125.476 1.00 37.76 ? 477  ILE B C   1 
ATOM   6868 O O   . ILE B 1 476 ? 31.266  35.163 125.503 1.00 38.46 ? 477  ILE B O   1 
ATOM   6869 C CB  . ILE B 1 476 ? 33.600  36.006 127.647 1.00 56.59 ? 477  ILE B CB  1 
ATOM   6870 C CG1 . ILE B 1 476 ? 33.102  34.870 128.542 1.00 58.29 ? 477  ILE B CG1 1 
ATOM   6871 C CG2 . ILE B 1 476 ? 32.796  37.265 127.921 1.00 55.94 ? 477  ILE B CG2 1 
ATOM   6872 C CD1 . ILE B 1 476 ? 33.841  33.570 128.361 1.00 57.86 ? 477  ILE B CD1 1 
ATOM   6873 N N   . CYS B 1 477 ? 32.137  37.120 124.835 1.00 39.05 ? 478  CYS B N   1 
ATOM   6874 C CA  . CYS B 1 477 ? 30.957  37.474 124.052 1.00 38.95 ? 478  CYS B CA  1 
ATOM   6875 C C   . CYS B 1 477 ? 30.782  36.489 122.909 1.00 40.83 ? 478  CYS B C   1 
ATOM   6876 O O   . CYS B 1 477 ? 29.665  36.061 122.626 1.00 41.50 ? 478  CYS B O   1 
ATOM   6877 C CB  . CYS B 1 477 ? 31.051  38.892 123.485 1.00 41.94 ? 478  CYS B CB  1 
ATOM   6878 S SG  . CYS B 1 477 ? 30.967  40.237 124.703 1.00 36.12 ? 478  CYS B SG  1 
ATOM   6879 N N   . ASP B 1 478 ? 31.887  36.136 122.255 1.00 42.16 ? 479  ASP B N   1 
ATOM   6880 C CA  . ASP B 1 478 ? 31.854  35.215 121.121 1.00 46.69 ? 479  ASP B CA  1 
ATOM   6881 C C   . ASP B 1 478 ? 31.385  33.842 121.577 1.00 46.32 ? 479  ASP B C   1 
ATOM   6882 O O   . ASP B 1 478 ? 30.625  33.174 120.885 1.00 46.50 ? 479  ASP B O   1 
ATOM   6883 C CB  . ASP B 1 478 ? 33.235  35.092 120.465 1.00 56.91 ? 479  ASP B CB  1 
ATOM   6884 C CG  . ASP B 1 478 ? 33.823  36.443 120.052 1.00 66.54 ? 479  ASP B CG  1 
ATOM   6885 O OD1 . ASP B 1 478 ? 33.045  37.401 119.834 1.00 67.97 ? 479  ASP B OD1 1 
ATOM   6886 O OD2 . ASP B 1 478 ? 35.068  36.547 119.940 1.00 67.52 ? 479  ASP B OD2 1 
ATOM   6887 N N   . ILE B 1 479 ? 31.841  33.423 122.750 1.00 46.11 ? 480  ILE B N   1 
ATOM   6888 C CA  . ILE B 1 479 ? 31.462  32.121 123.270 1.00 47.79 ? 480  ILE B CA  1 
ATOM   6889 C C   . ILE B 1 479 ? 29.961  32.070 123.512 1.00 56.43 ? 480  ILE B C   1 
ATOM   6890 O O   . ILE B 1 479 ? 29.296  31.143 123.069 1.00 62.20 ? 480  ILE B O   1 
ATOM   6891 C CB  . ILE B 1 479 ? 32.242  31.770 124.546 1.00 44.51 ? 480  ILE B CB  1 
ATOM   6892 C CG1 . ILE B 1 479 ? 33.711  31.490 124.197 1.00 43.94 ? 480  ILE B CG1 1 
ATOM   6893 C CG2 . ILE B 1 479 ? 31.620  30.568 125.240 1.00 42.45 ? 480  ILE B CG2 1 
ATOM   6894 C CD1 . ILE B 1 479 ? 34.618  31.266 125.403 1.00 38.96 ? 480  ILE B CD1 1 
ATOM   6895 N N   . ILE B 1 480 ? 29.429  33.084 124.190 1.00 56.48 ? 481  ILE B N   1 
ATOM   6896 C CA  . ILE B 1 480 ? 27.994  33.182 124.422 1.00 52.70 ? 481  ILE B CA  1 
ATOM   6897 C C   . ILE B 1 480 ? 27.222  33.146 123.105 1.00 58.78 ? 481  ILE B C   1 
ATOM   6898 O O   . ILE B 1 480 ? 26.252  32.400 122.965 1.00 65.64 ? 481  ILE B O   1 
ATOM   6899 C CB  . ILE B 1 480 ? 27.641  34.456 125.213 1.00 46.87 ? 481  ILE B CB  1 
ATOM   6900 C CG1 . ILE B 1 480 ? 28.355  34.454 126.566 1.00 41.85 ? 481  ILE B CG1 1 
ATOM   6901 C CG2 . ILE B 1 480 ? 26.155  34.552 125.431 1.00 41.27 ? 481  ILE B CG2 1 
ATOM   6902 C CD1 . ILE B 1 480 ? 28.157  35.728 127.341 1.00 40.56 ? 481  ILE B CD1 1 
ATOM   6903 N N   . ASP B 1 481 ? 27.665  33.927 122.129 1.00 60.18 ? 482  ASP B N   1 
ATOM   6904 C CA  . ASP B 1 481 ? 27.028  33.907 120.818 1.00 68.82 ? 482  ASP B CA  1 
ATOM   6905 C C   . ASP B 1 481 ? 27.077  32.523 120.178 1.00 79.19 ? 482  ASP B C   1 
ATOM   6906 O O   . ASP B 1 481 ? 26.037  31.948 119.860 1.00 86.04 ? 482  ASP B O   1 
ATOM   6907 C CB  . ASP B 1 481 ? 27.670  34.913 119.874 1.00 70.73 ? 482  ASP B CB  1 
ATOM   6908 C CG  . ASP B 1 481 ? 27.110  34.818 118.470 1.00 76.60 ? 482  ASP B CG  1 
ATOM   6909 O OD1 . ASP B 1 481 ? 27.891  34.976 117.507 1.00 79.16 ? 482  ASP B OD1 1 
ATOM   6910 O OD2 . ASP B 1 481 ? 25.888  34.581 118.329 1.00 78.30 ? 482  ASP B OD2 1 
ATOM   6911 N N   . ASN B 1 482 ? 28.288  32.002 119.987 1.00 78.55 ? 483  ASN B N   1 
ATOM   6912 C CA  . ASN B 1 482 ? 28.491  30.685 119.382 1.00 72.60 ? 483  ASN B CA  1 
ATOM   6913 C C   . ASN B 1 482 ? 27.815  29.551 120.154 1.00 75.55 ? 483  ASN B C   1 
ATOM   6914 O O   . ASN B 1 482 ? 27.263  28.639 119.542 1.00 79.14 ? 483  ASN B O   1 
ATOM   6915 C CB  . ASN B 1 482 ? 29.984  30.389 119.200 1.00 65.77 ? 483  ASN B CB  1 
ATOM   6916 N N   . THR B 1 483 ? 27.855  29.613 121.486 1.00 73.08 ? 484  THR B N   1 
ATOM   6917 C CA  . THR B 1 483 ? 27.199  28.613 122.332 1.00 70.62 ? 484  THR B CA  1 
ATOM   6918 C C   . THR B 1 483 ? 25.733  28.440 121.963 1.00 75.84 ? 484  THR B C   1 
ATOM   6919 O O   . THR B 1 483 ? 24.911  28.104 122.813 1.00 81.70 ? 484  THR B O   1 
ATOM   6920 C CB  . THR B 1 483 ? 27.259  28.991 123.823 1.00 66.16 ? 484  THR B CB  1 
ATOM   6921 N N   . TYR B 1 486 ? 20.913  30.321 122.790 1.00 56.90 ? 487  TYR B N   1 
ATOM   6922 C CA  . TYR B 1 486 ? 19.503  29.942 122.741 1.00 58.93 ? 487  TYR B CA  1 
ATOM   6923 C C   . TYR B 1 486 ? 18.723  30.598 123.878 1.00 63.69 ? 487  TYR B C   1 
ATOM   6924 O O   . TYR B 1 486 ? 18.039  29.913 124.644 1.00 69.04 ? 487  TYR B O   1 
ATOM   6925 C CB  . TYR B 1 486 ? 19.362  28.415 122.818 1.00 53.06 ? 487  TYR B CB  1 
ATOM   6926 N N   . ALA B 1 487 ? 18.827  31.921 123.996 1.00 61.13 ? 488  ALA B N   1 
ATOM   6927 C CA  . ALA B 1 487 ? 18.258  32.625 125.152 1.00 54.76 ? 488  ALA B CA  1 
ATOM   6928 C C   . ALA B 1 487 ? 17.146  33.612 124.820 1.00 47.37 ? 488  ALA B C   1 
ATOM   6929 O O   . ALA B 1 487 ? 17.062  34.153 123.724 1.00 48.36 ? 488  ALA B O   1 
ATOM   6930 C CB  . ALA B 1 487 ? 19.356  33.315 125.982 1.00 49.57 ? 488  ALA B CB  1 
ATOM   6931 N N   . LEU B 1 488 ? 16.290  33.827 125.804 1.00 41.16 ? 489  LEU B N   1 
ATOM   6932 C CA  . LEU B 1 488 ? 15.199  34.763 125.697 1.00 38.11 ? 489  LEU B CA  1 
ATOM   6933 C C   . LEU B 1 488 ? 15.695  36.159 126.102 1.00 39.89 ? 489  LEU B C   1 
ATOM   6934 O O   . LEU B 1 488 ? 15.419  37.153 125.433 1.00 35.53 ? 489  LEU B O   1 
ATOM   6935 C CB  . LEU B 1 488 ? 14.061  34.291 126.605 1.00 37.47 ? 489  LEU B CB  1 
ATOM   6936 C CG  . LEU B 1 488 ? 12.753  35.077 126.588 1.00 44.42 ? 489  LEU B CG  1 
ATOM   6937 C CD1 . LEU B 1 488 ? 12.143  35.100 125.189 1.00 41.89 ? 489  LEU B CD1 1 
ATOM   6938 C CD2 . LEU B 1 488 ? 11.778  34.480 127.594 1.00 46.38 ? 489  LEU B CD2 1 
ATOM   6939 N N   . THR B 1 489 ? 16.442  36.237 127.200 1.00 34.70 ? 490  THR B N   1 
ATOM   6940 C CA  . THR B 1 489 ? 16.928  37.527 127.663 1.00 32.09 ? 490  THR B CA  1 
ATOM   6941 C C   . THR B 1 489 ? 18.406  37.471 128.047 1.00 31.23 ? 490  THR B C   1 
ATOM   6942 O O   . THR B 1 489 ? 18.960  36.406 128.289 1.00 26.99 ? 490  THR B O   1 
ATOM   6943 C CB  . THR B 1 489 ? 16.125  38.058 128.862 1.00 35.14 ? 490  THR B CB  1 
ATOM   6944 O OG1 . THR B 1 489 ? 16.381  37.246 130.018 1.00 28.95 ? 490  THR B OG1 1 
ATOM   6945 C CG2 . THR B 1 489 ? 14.633  38.087 128.555 1.00 37.46 ? 490  THR B CG2 1 
ATOM   6946 N N   . GLY B 1 490 ? 19.030  38.638 128.096 1.00 28.38 ? 491  GLY B N   1 
ATOM   6947 C CA  . GLY B 1 490 ? 20.434  38.744 128.410 1.00 31.91 ? 491  GLY B CA  1 
ATOM   6948 C C   . GLY B 1 490 ? 20.689  40.170 128.825 1.00 31.79 ? 491  GLY B C   1 
ATOM   6949 O O   . GLY B 1 490 ? 19.948  41.078 128.434 1.00 34.22 ? 491  GLY B O   1 
ATOM   6950 N N   . ALA B 1 491 ? 21.733  40.363 129.619 1.00 28.59 ? 492  ALA B N   1 
ATOM   6951 C CA  . ALA B 1 491 ? 22.094  41.682 130.099 1.00 31.89 ? 492  ALA B CA  1 
ATOM   6952 C C   . ALA B 1 491 ? 23.603  41.839 130.175 1.00 31.11 ? 492  ALA B C   1 
ATOM   6953 O O   . ALA B 1 491 ? 24.328  40.881 130.467 1.00 35.20 ? 492  ALA B O   1 
ATOM   6954 C CB  . ALA B 1 491 ? 21.475  41.935 131.457 1.00 29.29 ? 492  ALA B CB  1 
ATOM   6955 N N   . ILE B 1 492 ? 24.068  43.051 129.893 1.00 26.56 ? 493  ILE B N   1 
ATOM   6956 C CA  . ILE B 1 492 ? 25.452  43.423 130.155 1.00 28.97 ? 493  ILE B CA  1 
ATOM   6957 C C   . ILE B 1 492 ? 25.512  44.497 131.240 1.00 29.76 ? 493  ILE B C   1 
ATOM   6958 O O   . ILE B 1 492 ? 24.714  45.441 131.251 1.00 31.27 ? 493  ILE B O   1 
ATOM   6959 C CB  . ILE B 1 492 ? 26.175  43.914 128.882 1.00 29.87 ? 493  ILE B CB  1 
ATOM   6960 C CG1 . ILE B 1 492 ? 27.613  44.289 129.215 1.00 36.49 ? 493  ILE B CG1 1 
ATOM   6961 C CG2 . ILE B 1 492 ? 25.456  45.104 128.261 1.00 26.58 ? 493  ILE B CG2 1 
ATOM   6962 C CD1 . ILE B 1 492 ? 28.482  44.429 128.014 1.00 39.28 ? 493  ILE B CD1 1 
ATOM   6963 N N   . PHE B 1 493 ? 26.430  44.329 132.179 1.00 28.46 ? 494  PHE B N   1 
ATOM   6964 C CA  . PHE B 1 493 ? 26.678  45.351 133.177 1.00 30.37 ? 494  PHE B CA  1 
ATOM   6965 C C   . PHE B 1 493 ? 28.041  45.939 132.886 1.00 36.74 ? 494  PHE B C   1 
ATOM   6966 O O   . PHE B 1 493 ? 29.046  45.231 132.880 1.00 41.70 ? 494  PHE B O   1 
ATOM   6967 C CB  . PHE B 1 493 ? 26.574  44.773 134.590 1.00 34.63 ? 494  PHE B CB  1 
ATOM   6968 C CG  . PHE B 1 493 ? 25.191  44.271 134.922 1.00 37.81 ? 494  PHE B CG  1 
ATOM   6969 C CD1 . PHE B 1 493 ? 24.267  45.104 135.547 1.00 33.82 ? 494  PHE B CD1 1 
ATOM   6970 C CD2 . PHE B 1 493 ? 24.800  42.981 134.564 1.00 35.24 ? 494  PHE B CD2 1 
ATOM   6971 C CE1 . PHE B 1 493 ? 22.994  44.653 135.830 1.00 33.76 ? 494  PHE B CE1 1 
ATOM   6972 C CE2 . PHE B 1 493 ? 23.531  42.520 134.847 1.00 33.84 ? 494  PHE B CE2 1 
ATOM   6973 C CZ  . PHE B 1 493 ? 22.620  43.354 135.481 1.00 35.86 ? 494  PHE B CZ  1 
ATOM   6974 N N   . ALA B 1 494 ? 28.057  47.238 132.611 1.00 37.61 ? 495  ALA B N   1 
ATOM   6975 C CA  . ALA B 1 494 ? 29.249  47.917 132.123 1.00 35.97 ? 495  ALA B CA  1 
ATOM   6976 C C   . ALA B 1 494 ? 29.039  49.418 132.182 1.00 39.60 ? 495  ALA B C   1 
ATOM   6977 O O   . ALA B 1 494 ? 27.903  49.897 132.124 1.00 37.94 ? 495  ALA B O   1 
ATOM   6978 C CB  . ALA B 1 494 ? 29.537  47.493 130.675 1.00 31.46 ? 495  ALA B CB  1 
ATOM   6979 N N   . LYS B 1 495 ? 30.139  50.157 132.278 1.00 43.84 ? 496  LYS B N   1 
ATOM   6980 C CA  . LYS B 1 495 ? 30.100  51.598 132.083 1.00 46.61 ? 496  LYS B CA  1 
ATOM   6981 C C   . LYS B 1 495 ? 30.708  51.954 130.726 1.00 45.59 ? 496  LYS B C   1 
ATOM   6982 O O   . LYS B 1 495 ? 30.193  52.827 130.018 1.00 43.40 ? 496  LYS B O   1 
ATOM   6983 C CB  . LYS B 1 495 ? 30.816  52.331 133.220 1.00 49.98 ? 496  LYS B CB  1 
ATOM   6984 C CG  . LYS B 1 495 ? 30.207  52.078 134.600 1.00 55.35 ? 496  LYS B CG  1 
ATOM   6985 C CD  . LYS B 1 495 ? 30.822  52.978 135.668 1.00 58.99 ? 496  LYS B CD  1 
ATOM   6986 C CE  . LYS B 1 495 ? 30.806  52.317 137.043 1.00 60.25 ? 496  LYS B CE  1 
ATOM   6987 N NZ  . LYS B 1 495 ? 31.081  53.286 138.156 1.00 60.50 ? 496  LYS B NZ  1 
ATOM   6988 N N   . ASP B 1 496 ? 31.783  51.251 130.364 1.00 40.62 ? 497  ASP B N   1 
ATOM   6989 C CA  . ASP B 1 496 ? 32.511  51.485 129.110 1.00 36.22 ? 497  ASP B CA  1 
ATOM   6990 C C   . ASP B 1 496 ? 31.667  51.289 127.844 1.00 34.71 ? 497  ASP B C   1 
ATOM   6991 O O   . ASP B 1 496 ? 31.292  50.167 127.512 1.00 39.36 ? 497  ASP B O   1 
ATOM   6992 C CB  . ASP B 1 496 ? 33.732  50.568 129.045 1.00 42.49 ? 497  ASP B CB  1 
ATOM   6993 C CG  . ASP B 1 496 ? 34.554  50.788 127.795 1.00 48.44 ? 497  ASP B CG  1 
ATOM   6994 O OD1 . ASP B 1 496 ? 34.094  50.423 126.694 1.00 53.09 ? 497  ASP B OD1 1 
ATOM   6995 O OD2 . ASP B 1 496 ? 35.668  51.327 127.911 1.00 57.79 ? 497  ASP B OD2 1 
ATOM   6996 N N   . ARG B 1 497 ? 31.412  52.378 127.119 1.00 32.29 ? 498  ARG B N   1 
ATOM   6997 C CA  . ARG B 1 497 ? 30.531  52.356 125.950 1.00 41.81 ? 498  ARG B CA  1 
ATOM   6998 C C   . ARG B 1 497 ? 31.018  51.495 124.785 1.00 43.36 ? 498  ARG B C   1 
ATOM   6999 O O   . ARG B 1 497 ? 30.207  51.025 123.981 1.00 36.62 ? 498  ARG B O   1 
ATOM   7000 C CB  . ARG B 1 497 ? 30.287  53.778 125.436 1.00 44.22 ? 498  ARG B CB  1 
ATOM   7001 C CG  . ARG B 1 497 ? 29.104  54.475 126.054 1.00 43.62 ? 498  ARG B CG  1 
ATOM   7002 C CD  . ARG B 1 497 ? 27.804  53.801 125.641 1.00 46.36 ? 498  ARG B CD  1 
ATOM   7003 N NE  . ARG B 1 497 ? 27.017  53.551 126.832 1.00 46.51 ? 498  ARG B NE  1 
ATOM   7004 C CZ  . ARG B 1 497 ? 25.804  53.020 126.871 1.00 42.16 ? 498  ARG B CZ  1 
ATOM   7005 N NH1 . ARG B 1 497 ? 25.151  52.649 125.767 1.00 38.25 ? 498  ARG B NH1 1 
ATOM   7006 N NH2 . ARG B 1 497 ? 25.247  52.867 128.054 1.00 45.19 ? 498  ARG B NH2 1 
ATOM   7007 N N   . LYS B 1 498 ? 32.335  51.319 124.675 1.00 45.63 ? 499  LYS B N   1 
ATOM   7008 C CA  . LYS B 1 498 ? 32.902  50.515 123.596 1.00 49.82 ? 499  LYS B CA  1 
ATOM   7009 C C   . LYS B 1 498 ? 32.574  49.036 123.819 1.00 48.99 ? 499  LYS B C   1 
ATOM   7010 O O   . LYS B 1 498 ? 32.221  48.307 122.887 1.00 43.85 ? 499  LYS B O   1 
ATOM   7011 C CB  . LYS B 1 498 ? 34.418  50.722 123.498 1.00 46.79 ? 499  LYS B CB  1 
ATOM   7012 N N   . ALA B 1 499 ? 32.688  48.605 125.069 1.00 44.76 ? 500  ALA B N   1 
ATOM   7013 C CA  . ALA B 1 499 ? 32.343  47.246 125.443 1.00 41.65 ? 500  ALA B CA  1 
ATOM   7014 C C   . ALA B 1 499 ? 30.842  46.994 125.317 1.00 38.28 ? 500  ALA B C   1 
ATOM   7015 O O   . ALA B 1 499 ? 30.425  45.919 124.893 1.00 41.16 ? 500  ALA B O   1 
ATOM   7016 C CB  . ALA B 1 499 ? 32.808  46.972 126.852 1.00 39.52 ? 500  ALA B CB  1 
ATOM   7017 N N   . ILE B 1 500 ? 30.036  47.984 125.687 1.00 36.74 ? 501  ILE B N   1 
ATOM   7018 C CA  . ILE B 1 500 ? 28.586  47.858 125.584 1.00 34.89 ? 501  ILE B CA  1 
ATOM   7019 C C   . ILE B 1 500 ? 28.174  47.727 124.135 1.00 40.61 ? 501  ILE B C   1 
ATOM   7020 O O   . ILE B 1 500 ? 27.399  46.831 123.792 1.00 36.85 ? 501  ILE B O   1 
ATOM   7021 C CB  . ILE B 1 500 ? 27.829  49.049 126.198 1.00 34.23 ? 501  ILE B CB  1 
ATOM   7022 C CG1 . ILE B 1 500 ? 28.001  49.075 127.712 1.00 36.31 ? 501  ILE B CG1 1 
ATOM   7023 C CG2 . ILE B 1 500 ? 26.340  48.958 125.869 1.00 27.55 ? 501  ILE B CG2 1 
ATOM   7024 C CD1 . ILE B 1 500 ? 27.501  50.342 128.362 1.00 35.38 ? 501  ILE B CD1 1 
ATOM   7025 N N   . GLU B 1 501 ? 28.695  48.616 123.288 1.00 46.40 ? 502  GLU B N   1 
ATOM   7026 C CA  . GLU B 1 501 ? 28.383  48.572 121.862 1.00 47.53 ? 502  GLU B CA  1 
ATOM   7027 C C   . GLU B 1 501 ? 28.748  47.210 121.310 1.00 39.13 ? 502  GLU B C   1 
ATOM   7028 O O   . GLU B 1 501 ? 27.981  46.615 120.569 1.00 35.77 ? 502  GLU B O   1 
ATOM   7029 C CB  . GLU B 1 501 ? 29.120  49.661 121.070 1.00 53.09 ? 502  GLU B CB  1 
ATOM   7030 C CG  . GLU B 1 501 ? 28.692  49.733 119.592 1.00 53.06 ? 502  GLU B CG  1 
ATOM   7031 C CD  . GLU B 1 501 ? 29.589  50.626 118.731 1.00 58.72 ? 502  GLU B CD  1 
ATOM   7032 O OE1 . GLU B 1 501 ? 30.563  51.206 119.263 1.00 61.86 ? 502  GLU B OE1 1 
ATOM   7033 O OE2 . GLU B 1 501 ? 29.325  50.745 117.513 1.00 57.96 ? 502  GLU B OE2 1 
ATOM   7034 N N   . TYR B 1 502 ? 29.919  46.720 121.702 1.00 39.64 ? 503  TYR B N   1 
ATOM   7035 C CA  . TYR B 1 502 ? 30.449  45.472 121.178 1.00 40.33 ? 503  TYR B CA  1 
ATOM   7036 C C   . TYR B 1 502 ? 29.568  44.286 121.555 1.00 40.90 ? 503  TYR B C   1 
ATOM   7037 O O   . TYR B 1 502 ? 29.247  43.461 120.711 1.00 42.20 ? 503  TYR B O   1 
ATOM   7038 C CB  . TYR B 1 502 ? 31.871  45.229 121.684 1.00 39.73 ? 503  TYR B CB  1 
ATOM   7039 C CG  . TYR B 1 502 ? 32.493  43.972 121.118 1.00 44.21 ? 503  TYR B CG  1 
ATOM   7040 C CD1 . TYR B 1 502 ? 32.408  42.761 121.797 1.00 46.98 ? 503  TYR B CD1 1 
ATOM   7041 C CD2 . TYR B 1 502 ? 33.157  43.992 119.895 1.00 45.58 ? 503  TYR B CD2 1 
ATOM   7042 C CE1 . TYR B 1 502 ? 32.970  41.601 121.273 1.00 49.78 ? 503  TYR B CE1 1 
ATOM   7043 C CE2 . TYR B 1 502 ? 33.722  42.843 119.369 1.00 49.08 ? 503  TYR B CE2 1 
ATOM   7044 C CZ  . TYR B 1 502 ? 33.625  41.650 120.060 1.00 50.22 ? 503  TYR B CZ  1 
ATOM   7045 O OH  . TYR B 1 502 ? 34.184  40.509 119.537 1.00 50.92 ? 503  TYR B OH  1 
ATOM   7046 N N   . ALA B 1 503 ? 29.192  44.193 122.824 1.00 36.31 ? 504  ALA B N   1 
ATOM   7047 C CA  . ALA B 1 503 ? 28.340  43.099 123.256 1.00 34.86 ? 504  ALA B CA  1 
ATOM   7048 C C   . ALA B 1 503 ? 26.954  43.247 122.647 1.00 34.38 ? 504  ALA B C   1 
ATOM   7049 O O   . ALA B 1 503 ? 26.341  42.259 122.231 1.00 33.73 ? 504  ALA B O   1 
ATOM   7050 C CB  . ALA B 1 503 ? 28.265  43.034 124.768 1.00 36.20 ? 504  ALA B CB  1 
ATOM   7051 N N   . ASP B 1 504 ? 26.470  44.482 122.586 1.00 38.14 ? 505  ASP B N   1 
ATOM   7052 C CA  . ASP B 1 504 ? 25.183  44.771 121.963 1.00 43.44 ? 505  ASP B CA  1 
ATOM   7053 C C   . ASP B 1 504 ? 25.133  44.161 120.563 1.00 45.20 ? 505  ASP B C   1 
ATOM   7054 O O   . ASP B 1 504 ? 24.179  43.469 120.222 1.00 44.32 ? 505  ASP B O   1 
ATOM   7055 C CB  . ASP B 1 504 ? 24.940  46.282 121.896 1.00 50.09 ? 505  ASP B CB  1 
ATOM   7056 C CG  . ASP B 1 504 ? 23.456  46.643 121.855 1.00 56.26 ? 505  ASP B CG  1 
ATOM   7057 O OD1 . ASP B 1 504 ? 23.123  47.841 122.019 1.00 57.99 ? 505  ASP B OD1 1 
ATOM   7058 O OD2 . ASP B 1 504 ? 22.623  45.734 121.669 1.00 53.30 ? 505  ASP B OD2 1 
ATOM   7059 N N   . GLU B 1 505 ? 26.180  44.380 119.769 1.00 42.75 ? 506  GLU B N   1 
ATOM   7060 C CA  . GLU B 1 505 ? 26.216  43.839 118.412 1.00 45.50 ? 506  GLU B CA  1 
ATOM   7061 C C   . GLU B 1 505 ? 26.507  42.338 118.388 1.00 43.51 ? 506  GLU B C   1 
ATOM   7062 O O   . GLU B 1 505 ? 25.797  41.584 117.735 1.00 46.43 ? 506  GLU B O   1 
ATOM   7063 C CB  . GLU B 1 505 ? 27.220  44.595 117.523 1.00 47.81 ? 506  GLU B CB  1 
ATOM   7064 N N   . LYS B 1 506 ? 27.540  41.908 119.102 1.00 39.67 ? 507  LYS B N   1 
ATOM   7065 C CA  . LYS B 1 506 ? 27.951  40.504 119.073 1.00 40.54 ? 507  LYS B CA  1 
ATOM   7066 C C   . LYS B 1 506 ? 26.886  39.537 119.582 1.00 41.49 ? 507  LYS B C   1 
ATOM   7067 O O   . LYS B 1 506 ? 26.877  38.373 119.202 1.00 50.81 ? 507  LYS B O   1 
ATOM   7068 C CB  . LYS B 1 506 ? 29.254  40.292 119.854 1.00 40.66 ? 507  LYS B CB  1 
ATOM   7069 N N   . LEU B 1 507 ? 25.996  40.014 120.443 1.00 36.18 ? 508  LEU B N   1 
ATOM   7070 C CA  . LEU B 1 507 ? 25.018  39.141 121.084 1.00 30.48 ? 508  LEU B CA  1 
ATOM   7071 C C   . LEU B 1 507 ? 23.621  39.393 120.515 1.00 31.59 ? 508  LEU B C   1 
ATOM   7072 O O   . LEU B 1 507 ? 22.613  39.063 121.144 1.00 32.05 ? 508  LEU B O   1 
ATOM   7073 C CB  . LEU B 1 507 ? 25.041  39.348 122.606 1.00 28.06 ? 508  LEU B CB  1 
ATOM   7074 C CG  . LEU B 1 507 ? 26.362  39.040 123.320 1.00 35.70 ? 508  LEU B CG  1 
ATOM   7075 C CD1 . LEU B 1 507 ? 26.283  39.414 124.792 1.00 39.32 ? 508  LEU B CD1 1 
ATOM   7076 C CD2 . LEU B 1 507 ? 26.716  37.576 123.160 1.00 35.69 ? 508  LEU B CD2 1 
ATOM   7077 N N   . LYS B 1 508 ? 23.578  39.989 119.324 1.00 30.95 ? 509  LYS B N   1 
ATOM   7078 C CA  . LYS B 1 508 ? 22.325  40.343 118.664 1.00 35.44 ? 509  LYS B CA  1 
ATOM   7079 C C   . LYS B 1 508 ? 21.391  39.146 118.489 1.00 33.17 ? 509  LYS B C   1 
ATOM   7080 O O   . LYS B 1 508 ? 20.182  39.286 118.621 1.00 33.99 ? 509  LYS B O   1 
ATOM   7081 C CB  . LYS B 1 508 ? 22.591  40.982 117.290 1.00 41.78 ? 509  LYS B CB  1 
ATOM   7082 N N   . PHE B 1 509 ? 21.952  37.982 118.165 1.00 32.11 ? 510  PHE B N   1 
ATOM   7083 C CA  . PHE B 1 509 ? 21.153  36.768 118.015 1.00 39.34 ? 510  PHE B CA  1 
ATOM   7084 C C   . PHE B 1 509 ? 21.065  35.940 119.312 1.00 39.60 ? 510  PHE B C   1 
ATOM   7085 O O   . PHE B 1 509 ? 20.487  34.852 119.319 1.00 37.46 ? 510  PHE B O   1 
ATOM   7086 C CB  . PHE B 1 509 ? 21.699  35.891 116.875 1.00 36.35 ? 510  PHE B CB  1 
ATOM   7087 C CG  . PHE B 1 509 ? 21.711  36.574 115.531 1.00 40.15 ? 510  PHE B CG  1 
ATOM   7088 C CD1 . PHE B 1 509 ? 20.582  36.568 114.724 1.00 42.71 ? 510  PHE B CD1 1 
ATOM   7089 C CD2 . PHE B 1 509 ? 22.850  37.229 115.078 1.00 41.18 ? 510  PHE B CD2 1 
ATOM   7090 C CE1 . PHE B 1 509 ? 20.585  37.200 113.488 1.00 38.28 ? 510  PHE B CE1 1 
ATOM   7091 C CE2 . PHE B 1 509 ? 22.861  37.866 113.845 1.00 40.77 ? 510  PHE B CE2 1 
ATOM   7092 C CZ  . PHE B 1 509 ? 21.731  37.849 113.051 1.00 40.42 ? 510  PHE B CZ  1 
ATOM   7093 N N   . SER B 1 510 ? 21.621  36.446 120.406 1.00 35.46 ? 511  SER B N   1 
ATOM   7094 C CA  . SER B 1 510 ? 21.710  35.643 121.627 1.00 37.09 ? 511  SER B CA  1 
ATOM   7095 C C   . SER B 1 510 ? 20.545  35.862 122.587 1.00 39.40 ? 511  SER B C   1 
ATOM   7096 O O   . SER B 1 510 ? 20.384  35.126 123.560 1.00 41.77 ? 511  SER B O   1 
ATOM   7097 C CB  . SER B 1 510 ? 23.029  35.912 122.339 1.00 36.14 ? 511  SER B CB  1 
ATOM   7098 O OG  . SER B 1 510 ? 24.103  35.621 121.470 1.00 43.09 ? 511  SER B OG  1 
ATOM   7099 N N   . ALA B 1 511 ? 19.742  36.879 122.310 1.00 34.74 ? 512  ALA B N   1 
ATOM   7100 C CA  . ALA B 1 511 ? 18.616  37.218 123.159 1.00 34.51 ? 512  ALA B CA  1 
ATOM   7101 C C   . ALA B 1 511 ? 17.651  38.080 122.370 1.00 33.28 ? 512  ALA B C   1 
ATOM   7102 O O   . ALA B 1 511 ? 18.064  38.913 121.575 1.00 34.32 ? 512  ALA B O   1 
ATOM   7103 C CB  . ALA B 1 511 ? 19.093  37.963 124.410 1.00 35.30 ? 512  ALA B CB  1 
ATOM   7104 N N   . GLY B 1 512 ? 16.361  37.867 122.579 1.00 31.54 ? 513  GLY B N   1 
ATOM   7105 C CA  . GLY B 1 512 ? 15.364  38.700 121.947 1.00 31.07 ? 513  GLY B CA  1 
ATOM   7106 C C   . GLY B 1 512 ? 15.267  39.998 122.717 1.00 31.85 ? 513  GLY B C   1 
ATOM   7107 O O   . GLY B 1 512 ? 14.860  41.023 122.179 1.00 37.44 ? 513  GLY B O   1 
ATOM   7108 N N   . ASN B 1 513 ? 15.626  39.951 123.993 1.00 31.08 ? 514  ASN B N   1 
ATOM   7109 C CA  . ASN B 1 513 ? 15.615  41.156 124.813 1.00 33.87 ? 514  ASN B CA  1 
ATOM   7110 C C   . ASN B 1 513 ? 16.944  41.317 125.523 1.00 33.87 ? 514  ASN B C   1 
ATOM   7111 O O   . ASN B 1 513 ? 17.375  40.442 126.276 1.00 35.41 ? 514  ASN B O   1 
ATOM   7112 C CB  . ASN B 1 513 ? 14.456  41.152 125.815 1.00 39.00 ? 514  ASN B CB  1 
ATOM   7113 C CG  . ASN B 1 513 ? 13.106  41.305 125.141 1.00 44.09 ? 514  ASN B CG  1 
ATOM   7114 O OD1 . ASN B 1 513 ? 12.546  42.400 125.089 1.00 47.38 ? 514  ASN B OD1 1 
ATOM   7115 N ND2 . ASN B 1 513 ? 12.576  40.201 124.617 1.00 44.02 ? 514  ASN B ND2 1 
ATOM   7116 N N   . PHE B 1 514 ? 17.589  42.440 125.253 1.00 27.76 ? 515  PHE B N   1 
ATOM   7117 C CA  . PHE B 1 514 ? 18.918  42.710 125.749 1.00 30.69 ? 515  PHE B CA  1 
ATOM   7118 C C   . PHE B 1 514 ? 18.843  43.908 126.677 1.00 31.72 ? 515  PHE B C   1 
ATOM   7119 O O   . PHE B 1 514 ? 18.187  44.903 126.374 1.00 34.65 ? 515  PHE B O   1 
ATOM   7120 C CB  . PHE B 1 514 ? 19.882  42.972 124.581 1.00 31.30 ? 515  PHE B CB  1 
ATOM   7121 C CG  . PHE B 1 514 ? 21.325  42.996 124.986 1.00 33.52 ? 515  PHE B CG  1 
ATOM   7122 C CD1 . PHE B 1 514 ? 21.938  41.855 125.474 1.00 33.65 ? 515  PHE B CD1 1 
ATOM   7123 C CD2 . PHE B 1 514 ? 22.078  44.163 124.873 1.00 35.52 ? 515  PHE B CD2 1 
ATOM   7124 C CE1 . PHE B 1 514 ? 23.276  41.873 125.857 1.00 35.44 ? 515  PHE B CE1 1 
ATOM   7125 C CE2 . PHE B 1 514 ? 23.419  44.188 125.254 1.00 32.56 ? 515  PHE B CE2 1 
ATOM   7126 C CZ  . PHE B 1 514 ? 24.019  43.043 125.743 1.00 33.35 ? 515  PHE B CZ  1 
ATOM   7127 N N   . TYR B 1 515 ? 19.506  43.800 127.818 1.00 28.11 ? 516  TYR B N   1 
ATOM   7128 C CA  . TYR B 1 515 ? 19.448  44.840 128.831 1.00 27.51 ? 516  TYR B CA  1 
ATOM   7129 C C   . TYR B 1 515 ? 20.838  45.403 129.107 1.00 30.72 ? 516  TYR B C   1 
ATOM   7130 O O   . TYR B 1 515 ? 21.831  44.672 129.082 1.00 33.31 ? 516  TYR B O   1 
ATOM   7131 C CB  . TYR B 1 515 ? 18.802  44.284 130.106 1.00 29.34 ? 516  TYR B CB  1 
ATOM   7132 C CG  . TYR B 1 515 ? 17.350  43.923 129.878 1.00 30.71 ? 516  TYR B CG  1 
ATOM   7133 C CD1 . TYR B 1 515 ? 16.994  42.679 129.366 1.00 28.97 ? 516  TYR B CD1 1 
ATOM   7134 C CD2 . TYR B 1 515 ? 16.341  44.841 130.132 1.00 28.07 ? 516  TYR B CD2 1 
ATOM   7135 C CE1 . TYR B 1 515 ? 15.680  42.349 129.137 1.00 25.89 ? 516  TYR B CE1 1 
ATOM   7136 C CE2 . TYR B 1 515 ? 15.020  44.520 129.912 1.00 31.01 ? 516  TYR B CE2 1 
ATOM   7137 C CZ  . TYR B 1 515 ? 14.694  43.276 129.412 1.00 30.74 ? 516  TYR B CZ  1 
ATOM   7138 O OH  . TYR B 1 515 ? 13.376  42.968 129.186 1.00 35.30 ? 516  TYR B OH  1 
ATOM   7139 N N   . ILE B 1 516 ? 20.906  46.713 129.327 1.00 30.84 ? 517  ILE B N   1 
ATOM   7140 C CA  . ILE B 1 516 ? 22.160  47.365 129.676 1.00 27.68 ? 517  ILE B CA  1 
ATOM   7141 C C   . ILE B 1 516 ? 22.005  47.924 131.089 1.00 27.99 ? 517  ILE B C   1 
ATOM   7142 O O   . ILE B 1 516 ? 21.182  48.815 131.320 1.00 29.01 ? 517  ILE B O   1 
ATOM   7143 C CB  . ILE B 1 516 ? 22.517  48.491 128.672 1.00 30.98 ? 517  ILE B CB  1 
ATOM   7144 C CG1 . ILE B 1 516 ? 22.641  47.930 127.245 1.00 29.79 ? 517  ILE B CG1 1 
ATOM   7145 C CG2 . ILE B 1 516 ? 23.810  49.186 129.073 1.00 31.92 ? 517  ILE B CG2 1 
ATOM   7146 C CD1 . ILE B 1 516 ? 22.728  49.032 126.163 1.00 28.71 ? 517  ILE B CD1 1 
ATOM   7147 N N   . ASN B 1 517 ? 22.772  47.372 132.027 1.00 27.57 ? 518  ASN B N   1 
ATOM   7148 C CA  . ASN B 1 517 ? 22.731  47.790 133.427 1.00 38.03 ? 518  ASN B CA  1 
ATOM   7149 C C   . ASN B 1 517 ? 21.340  47.640 134.036 1.00 37.34 ? 518  ASN B C   1 
ATOM   7150 O O   . ASN B 1 517 ? 20.885  48.480 134.825 1.00 34.21 ? 518  ASN B O   1 
ATOM   7151 C CB  . ASN B 1 517 ? 23.256  49.218 133.585 1.00 37.12 ? 518  ASN B CB  1 
ATOM   7152 C CG  . ASN B 1 517 ? 24.725  49.337 133.211 1.00 36.56 ? 518  ASN B CG  1 
ATOM   7153 O OD1 . ASN B 1 517 ? 25.512  48.426 133.461 1.00 36.75 ? 518  ASN B OD1 1 
ATOM   7154 N ND2 . ASN B 1 517 ? 25.093  50.451 132.593 1.00 32.52 ? 518  ASN B ND2 1 
ATOM   7155 N N   . ASP B 1 518 ? 20.675  46.557 133.650 1.00 32.98 ? 519  ASP B N   1 
ATOM   7156 C CA  . ASP B 1 518 ? 19.365  46.213 134.180 1.00 39.20 ? 519  ASP B CA  1 
ATOM   7157 C C   . ASP B 1 518 ? 19.276  44.693 134.223 1.00 41.16 ? 519  ASP B C   1 
ATOM   7158 O O   . ASP B 1 518 ? 19.833  44.015 133.354 1.00 36.73 ? 519  ASP B O   1 
ATOM   7159 C CB  . ASP B 1 518 ? 18.271  46.778 133.268 1.00 44.75 ? 519  ASP B CB  1 
ATOM   7160 C CG  . ASP B 1 518 ? 16.943  46.978 133.987 1.00 52.42 ? 519  ASP B CG  1 
ATOM   7161 O OD1 . ASP B 1 518 ? 16.908  46.856 135.235 1.00 51.74 ? 519  ASP B OD1 1 
ATOM   7162 O OD2 . ASP B 1 518 ? 15.936  47.274 133.296 1.00 55.04 ? 519  ASP B OD2 1 
ATOM   7163 N N   . LYS B 1 519 ? 18.579  44.154 135.221 1.00 39.29 ? 520  LYS B N   1 
ATOM   7164 C CA  . LYS B 1 519 ? 18.366  42.712 135.288 1.00 36.81 ? 520  LYS B CA  1 
ATOM   7165 C C   . LYS B 1 519 ? 17.667  42.210 134.013 1.00 36.85 ? 520  LYS B C   1 
ATOM   7166 O O   . LYS B 1 519 ? 16.882  42.942 133.395 1.00 30.42 ? 520  LYS B O   1 
ATOM   7167 C CB  . LYS B 1 519 ? 17.576  42.342 136.545 1.00 37.10 ? 520  LYS B CB  1 
ATOM   7168 C CG  . LYS B 1 519 ? 16.215  43.042 136.683 1.00 42.03 ? 520  LYS B CG  1 
ATOM   7169 C CD  . LYS B 1 519 ? 15.538  42.622 137.986 1.00 45.40 ? 520  LYS B CD  1 
ATOM   7170 C CE  . LYS B 1 519 ? 14.068  43.013 138.019 1.00 47.01 ? 520  LYS B CE  1 
ATOM   7171 N NZ  . LYS B 1 519 ? 13.889  44.449 138.344 1.00 51.29 ? 520  LYS B NZ  1 
ATOM   7172 N N   . CYS B 1 520 ? 17.968  40.977 133.598 1.00 34.11 ? 521  CYS B N   1 
ATOM   7173 C CA  . CYS B 1 520 ? 17.424  40.476 132.336 1.00 29.53 ? 521  CYS B CA  1 
ATOM   7174 C C   . CYS B 1 520 ? 15.961  40.057 132.464 1.00 32.36 ? 521  CYS B C   1 
ATOM   7175 O O   . CYS B 1 520 ? 15.362  39.599 131.499 1.00 33.85 ? 521  CYS B O   1 
ATOM   7176 C CB  . CYS B 1 520 ? 18.241  39.304 131.815 1.00 32.06 ? 521  CYS B CB  1 
ATOM   7177 S SG  . CYS B 1 520 ? 18.226  37.917 132.952 1.00 36.92 ? 521  CYS B SG  1 
ATOM   7178 N N   . THR B 1 521 ? 15.392  40.193 133.653 1.00 33.97 ? 522  THR B N   1 
ATOM   7179 C CA  . THR B 1 521 ? 13.956  39.988 133.818 1.00 46.37 ? 522  THR B CA  1 
ATOM   7180 C C   . THR B 1 521 ? 13.207  41.303 133.569 1.00 46.75 ? 522  THR B C   1 
ATOM   7181 O O   . THR B 1 521 ? 11.983  41.323 133.498 1.00 52.25 ? 522  THR B O   1 
ATOM   7182 C CB  . THR B 1 521 ? 13.589  39.448 135.230 1.00 40.25 ? 522  THR B CB  1 
ATOM   7183 O OG1 . THR B 1 521 ? 14.002  40.392 136.225 1.00 42.43 ? 522  THR B OG1 1 
ATOM   7184 C CG2 . THR B 1 521 ? 14.259  38.101 135.498 1.00 38.43 ? 522  THR B CG2 1 
ATOM   7185 N N   . GLY B 1 522 ? 13.952  42.398 133.448 1.00 49.07 ? 523  GLY B N   1 
ATOM   7186 C CA  . GLY B 1 522 ? 13.372  43.701 133.162 1.00 51.53 ? 523  GLY B CA  1 
ATOM   7187 C C   . GLY B 1 522 ? 12.843  44.409 134.391 1.00 56.59 ? 523  GLY B C   1 
ATOM   7188 O O   . GLY B 1 522 ? 11.831  45.108 134.320 1.00 59.38 ? 523  GLY B O   1 
ATOM   7189 N N   . ASN B 1 546 ? 0.398   43.261 117.699 1.00 52.70 ? 547  ASN B N   1 
ATOM   7190 C CA  . ASN B 1 546 ? 1.663   42.545 117.845 1.00 57.78 ? 547  ASN B CA  1 
ATOM   7191 C C   . ASN B 1 546 ? 1.481   41.040 117.651 1.00 58.33 ? 547  ASN B C   1 
ATOM   7192 O O   . ASN B 1 546 ? 1.626   40.507 116.549 1.00 57.17 ? 547  ASN B O   1 
ATOM   7193 C CB  . ASN B 1 546 ? 2.265   42.824 119.231 1.00 60.62 ? 547  ASN B CB  1 
ATOM   7194 N N   . ILE B 1 547 ? 1.153   40.365 118.748 1.00 53.90 ? 548  ILE B N   1 
ATOM   7195 C CA  . ILE B 1 547 ? 0.821   38.952 118.735 1.00 46.42 ? 548  ILE B CA  1 
ATOM   7196 C C   . ILE B 1 547 ? -0.621  38.717 118.248 1.00 44.94 ? 548  ILE B C   1 
ATOM   7197 O O   . ILE B 1 547 ? -0.967  37.618 117.802 1.00 44.84 ? 548  ILE B O   1 
ATOM   7198 C CB  . ILE B 1 547 ? 0.999   38.350 120.146 1.00 51.31 ? 548  ILE B CB  1 
ATOM   7199 C CG1 . ILE B 1 547 ? 1.190   36.839 120.067 1.00 52.38 ? 548  ILE B CG1 1 
ATOM   7200 C CG2 . ILE B 1 547 ? -0.164  38.719 121.047 1.00 54.26 ? 548  ILE B CG2 1 
ATOM   7201 C CD1 . ILE B 1 547 ? 2.457   36.450 119.361 1.00 52.16 ? 548  ILE B CD1 1 
ATOM   7202 N N   . LEU B 1 548 ? -1.458  39.753 118.324 1.00 39.41 ? 549  LEU B N   1 
ATOM   7203 C CA  . LEU B 1 548 ? -2.851  39.640 117.897 1.00 32.83 ? 549  LEU B CA  1 
ATOM   7204 C C   . LEU B 1 548 ? -2.951  39.236 116.429 1.00 32.64 ? 549  LEU B C   1 
ATOM   7205 O O   . LEU B 1 548 ? -3.838  38.478 116.032 1.00 31.17 ? 549  LEU B O   1 
ATOM   7206 C CB  . LEU B 1 548 ? -3.586  40.952 118.112 1.00 28.88 ? 549  LEU B CB  1 
ATOM   7207 C CG  . LEU B 1 548 ? -3.644  41.412 119.562 1.00 29.51 ? 549  LEU B CG  1 
ATOM   7208 C CD1 . LEU B 1 548 ? -4.340  42.759 119.650 1.00 31.54 ? 549  LEU B CD1 1 
ATOM   7209 C CD2 . LEU B 1 548 ? -4.341  40.380 120.424 1.00 27.46 ? 549  LEU B CD2 1 
ATOM   7210 N N   . SER B 1 549 ? -2.018  39.729 115.631 1.00 29.27 ? 550  SER B N   1 
ATOM   7211 C CA  . SER B 1 549 ? -2.042  39.474 114.202 1.00 36.53 ? 550  SER B CA  1 
ATOM   7212 C C   . SER B 1 549 ? -1.869  37.995 113.873 1.00 38.87 ? 550  SER B C   1 
ATOM   7213 O O   . SER B 1 549 ? -2.262  37.561 112.801 1.00 40.97 ? 550  SER B O   1 
ATOM   7214 C CB  . SER B 1 549 ? -0.957  40.286 113.510 1.00 40.67 ? 550  SER B CB  1 
ATOM   7215 O OG  . SER B 1 549 ? 0.316   39.864 113.961 1.00 55.67 ? 550  SER B OG  1 
ATOM   7216 N N   . ARG B 1 550 ? -1.288  37.219 114.789 1.00 37.26 ? 551  ARG B N   1 
ATOM   7217 C CA  . ARG B 1 550 ? -1.114  35.785 114.550 1.00 34.66 ? 551  ARG B CA  1 
ATOM   7218 C C   . ARG B 1 550 ? -2.433  35.015 114.683 1.00 32.39 ? 551  ARG B C   1 
ATOM   7219 O O   . ARG B 1 550 ? -2.512  33.848 114.330 1.00 33.92 ? 551  ARG B O   1 
ATOM   7220 C CB  . ARG B 1 550 ? -0.055  35.184 115.486 1.00 39.01 ? 551  ARG B CB  1 
ATOM   7221 C CG  . ARG B 1 550 ? 1.386   35.615 115.193 1.00 45.22 ? 551  ARG B CG  1 
ATOM   7222 C CD  . ARG B 1 550 ? 2.150   34.569 114.359 1.00 55.03 ? 551  ARG B CD  1 
ATOM   7223 N NE  . ARG B 1 550 ? 1.826   34.617 112.931 1.00 63.06 ? 551  ARG B NE  1 
ATOM   7224 C CZ  . ARG B 1 550 ? 2.242   33.724 112.031 1.00 65.01 ? 551  ARG B CZ  1 
ATOM   7225 N NH1 . ARG B 1 550 ? 3.001   32.698 112.403 1.00 63.91 ? 551  ARG B NH1 1 
ATOM   7226 N NH2 . ARG B 1 550 ? 1.897   33.856 110.754 1.00 64.74 ? 551  ARG B NH2 1 
ATOM   7227 N N   . PHE B 1 551 ? -3.467  35.663 115.201 1.00 32.91 ? 552  PHE B N   1 
ATOM   7228 C CA  . PHE B 1 551 ? -4.752  34.989 115.353 1.00 39.38 ? 552  PHE B CA  1 
ATOM   7229 C C   . PHE B 1 551 ? -5.818  35.504 114.384 1.00 37.39 ? 552  PHE B C   1 
ATOM   7230 O O   . PHE B 1 551 ? -7.012  35.266 114.578 1.00 37.71 ? 552  PHE B O   1 
ATOM   7231 C CB  . PHE B 1 551 ? -5.237  35.084 116.801 1.00 40.44 ? 552  PHE B CB  1 
ATOM   7232 C CG  . PHE B 1 551 ? -4.353  34.367 117.770 1.00 39.80 ? 552  PHE B CG  1 
ATOM   7233 C CD1 . PHE B 1 551 ? -4.381  32.979 117.853 1.00 35.63 ? 552  PHE B CD1 1 
ATOM   7234 C CD2 . PHE B 1 551 ? -3.473  35.071 118.579 1.00 40.96 ? 552  PHE B CD2 1 
ATOM   7235 C CE1 . PHE B 1 551 ? -3.560  32.303 118.742 1.00 34.77 ? 552  PHE B CE1 1 
ATOM   7236 C CE2 . PHE B 1 551 ? -2.645  34.399 119.477 1.00 40.30 ? 552  PHE B CE2 1 
ATOM   7237 C CZ  . PHE B 1 551 ? -2.693  33.018 119.562 1.00 35.60 ? 552  PHE B CZ  1 
ATOM   7238 N N   . VAL B 1 552 ? -5.378  36.209 113.345 1.00 39.12 ? 553  VAL B N   1 
ATOM   7239 C CA  . VAL B 1 552 ? -6.275  36.652 112.280 1.00 37.33 ? 553  VAL B CA  1 
ATOM   7240 C C   . VAL B 1 552 ? -5.657  36.404 110.908 1.00 39.37 ? 553  VAL B C   1 
ATOM   7241 O O   . VAL B 1 552 ? -4.445  36.211 110.798 1.00 37.59 ? 553  VAL B O   1 
ATOM   7242 C CB  . VAL B 1 552 ? -6.623  38.157 112.403 1.00 32.94 ? 553  VAL B CB  1 
ATOM   7243 C CG1 . VAL B 1 552 ? -7.353  38.444 113.705 1.00 35.43 ? 553  VAL B CG1 1 
ATOM   7244 C CG2 . VAL B 1 552 ? -5.381  39.001 112.298 1.00 24.84 ? 553  VAL B CG2 1 
ATOM   7245 N N   . SER B 1 553 ? -6.493  36.391 109.868 1.00 35.54 ? 554  SER B N   1 
ATOM   7246 C CA  . SER B 1 553 ? -5.999  36.500 108.500 1.00 36.43 ? 554  SER B CA  1 
ATOM   7247 C C   . SER B 1 553 ? -6.674  37.663 107.767 1.00 40.37 ? 554  SER B C   1 
ATOM   7248 O O   . SER B 1 553 ? -7.847  37.954 107.991 1.00 38.94 ? 554  SER B O   1 
ATOM   7249 C CB  . SER B 1 553 ? -6.178  35.196 107.720 1.00 36.78 ? 554  SER B CB  1 
ATOM   7250 O OG  . SER B 1 553 ? -7.484  34.685 107.866 1.00 48.55 ? 554  SER B OG  1 
ATOM   7251 N N   . ILE B 1 554 ? -5.929  38.331 106.894 1.00 40.26 ? 555  ILE B N   1 
ATOM   7252 C CA  . ILE B 1 554 ? -6.497  39.429 106.128 1.00 39.85 ? 555  ILE B CA  1 
ATOM   7253 C C   . ILE B 1 554 ? -7.295  38.899 104.947 1.00 35.66 ? 555  ILE B C   1 
ATOM   7254 O O   . ILE B 1 554 ? -6.889  37.980 104.239 1.00 33.58 ? 555  ILE B O   1 
ATOM   7255 C CB  . ILE B 1 554 ? -5.443  40.450 105.635 1.00 43.17 ? 555  ILE B CB  1 
ATOM   7256 C CG1 . ILE B 1 554 ? -6.133  41.715 105.122 1.00 47.49 ? 555  ILE B CG1 1 
ATOM   7257 C CG2 . ILE B 1 554 ? -4.579  39.876 104.536 1.00 40.98 ? 555  ILE B CG2 1 
ATOM   7258 C CD1 . ILE B 1 554 ? -6.649  42.605 106.235 1.00 50.71 ? 555  ILE B CD1 1 
ATOM   7259 N N   . ARG B 1 555 ? -8.467  39.468 104.762 1.00 31.53 ? 556  ARG B N   1 
ATOM   7260 C CA  . ARG B 1 555 ? -9.236  39.168 103.582 1.00 33.62 ? 556  ARG B CA  1 
ATOM   7261 C C   . ARG B 1 555 ? -9.535  40.499 102.880 1.00 37.13 ? 556  ARG B C   1 
ATOM   7262 O O   . ARG B 1 555 ? -10.069 41.432 103.491 1.00 31.83 ? 556  ARG B O   1 
ATOM   7263 C CB  . ARG B 1 555 ? -10.501 38.430 103.982 1.00 27.66 ? 556  ARG B CB  1 
ATOM   7264 C CG  . ARG B 1 555 ? -11.284 37.895 102.827 1.00 38.78 ? 556  ARG B CG  1 
ATOM   7265 C CD  . ARG B 1 555 ? -12.508 38.730 102.677 1.00 46.44 ? 556  ARG B CD  1 
ATOM   7266 N NE  . ARG B 1 555 ? -13.513 38.015 101.922 1.00 51.06 ? 556  ARG B NE  1 
ATOM   7267 C CZ  . ARG B 1 555 ? -14.805 38.267 102.013 1.00 43.16 ? 556  ARG B CZ  1 
ATOM   7268 N NH1 . ARG B 1 555 ? -15.240 39.213 102.838 1.00 41.04 ? 556  ARG B NH1 1 
ATOM   7269 N NH2 . ARG B 1 555 ? -15.649 37.567 101.284 1.00 42.77 ? 556  ARG B NH2 1 
ATOM   7270 N N   . ASN B 1 556 ? -9.155  40.598 101.608 1.00 33.40 ? 557  ASN B N   1 
ATOM   7271 C CA  . ASN B 1 556 ? -9.414  41.816 100.859 1.00 29.41 ? 557  ASN B CA  1 
ATOM   7272 C C   . ASN B 1 556 ? -10.573 41.600 99.939  1.00 32.95 ? 557  ASN B C   1 
ATOM   7273 O O   . ASN B 1 556 ? -10.690 40.543 99.302  1.00 30.19 ? 557  ASN B O   1 
ATOM   7274 C CB  . ASN B 1 556 ? -8.198  42.231 100.030 1.00 33.93 ? 557  ASN B CB  1 
ATOM   7275 C CG  . ASN B 1 556 ? -6.946  42.419 100.875 1.00 43.41 ? 557  ASN B CG  1 
ATOM   7276 O OD1 . ASN B 1 556 ? -6.821  43.398 101.615 1.00 45.79 ? 557  ASN B OD1 1 
ATOM   7277 N ND2 . ASN B 1 556 ? -6.013  41.469 100.772 1.00 46.90 ? 557  ASN B ND2 1 
ATOM   7278 N N   . THR B 1 557 ? -11.428 42.605 99.859  1.00 24.69 ? 558  THR B N   1 
ATOM   7279 C CA  . THR B 1 557 ? -12.488 42.600 98.876  1.00 27.76 ? 558  THR B CA  1 
ATOM   7280 C C   . THR B 1 557 ? -12.272 43.773 97.932  1.00 32.48 ? 558  THR B C   1 
ATOM   7281 O O   . THR B 1 557 ? -12.085 44.914 98.371  1.00 29.59 ? 558  THR B O   1 
ATOM   7282 C CB  . THR B 1 557 ? -13.853 42.760 99.543  1.00 28.14 ? 558  THR B CB  1 
ATOM   7283 O OG1 . THR B 1 557 ? -14.049 41.695 100.472 1.00 30.10 ? 558  THR B OG1 1 
ATOM   7284 C CG2 . THR B 1 557 ? -14.975 42.742 98.493  1.00 26.15 ? 558  THR B CG2 1 
ATOM   7285 N N   . LYS B 1 558 ? -12.305 43.498 96.637  1.00 35.10 ? 559  LYS B N   1 
ATOM   7286 C CA  . LYS B 1 558 ? -12.119 44.547 95.656  1.00 27.36 ? 559  LYS B CA  1 
ATOM   7287 C C   . LYS B 1 558 ? -13.281 44.537 94.703  1.00 28.19 ? 559  LYS B C   1 
ATOM   7288 O O   . LYS B 1 558 ? -13.567 43.531 94.065  1.00 31.12 ? 559  LYS B O   1 
ATOM   7289 C CB  . LYS B 1 558 ? -10.799 44.366 94.899  1.00 28.00 ? 559  LYS B CB  1 
ATOM   7290 C CG  . LYS B 1 558 ? -10.700 45.222 93.646  1.00 36.57 ? 559  LYS B CG  1 
ATOM   7291 C CD  . LYS B 1 558 ? -9.525  44.815 92.764  1.00 42.59 ? 559  LYS B CD  1 
ATOM   7292 C CE  . LYS B 1 558 ? -8.354  45.771 92.892  1.00 43.09 ? 559  LYS B CE  1 
ATOM   7293 N NZ  . LYS B 1 558 ? -7.849  45.890 94.261  1.00 35.67 ? 559  LYS B NZ  1 
ATOM   7294 N N   . GLU B 1 559 ? -13.965 45.662 94.602  1.00 28.13 ? 560  GLU B N   1 
ATOM   7295 C CA  . GLU B 1 559 ? -15.042 45.765 93.650  1.00 28.99 ? 560  GLU B CA  1 
ATOM   7296 C C   . GLU B 1 559 ? -14.612 46.591 92.454  1.00 29.95 ? 560  GLU B C   1 
ATOM   7297 O O   . GLU B 1 559 ? -14.002 47.645 92.604  1.00 29.71 ? 560  GLU B O   1 
ATOM   7298 C CB  . GLU B 1 559 ? -16.285 46.382 94.297  1.00 28.44 ? 560  GLU B CB  1 
ATOM   7299 C CG  . GLU B 1 559 ? -17.433 46.511 93.314  1.00 29.92 ? 560  GLU B CG  1 
ATOM   7300 C CD  . GLU B 1 559 ? -18.795 46.683 93.979  1.00 28.93 ? 560  GLU B CD  1 
ATOM   7301 O OE1 . GLU B 1 559 ? -18.878 46.601 95.223  1.00 27.95 ? 560  GLU B OE1 1 
ATOM   7302 O OE2 . GLU B 1 559 ? -19.775 46.890 93.244  1.00 29.64 ? 560  GLU B OE2 1 
ATOM   7303 N N   . ASN B 1 560 ? -14.950 46.098 91.274  1.00 31.15 ? 561  ASN B N   1 
ATOM   7304 C CA  . ASN B 1 560 ? -14.767 46.817 90.033  1.00 32.31 ? 561  ASN B CA  1 
ATOM   7305 C C   . ASN B 1 560 ? -16.102 47.344 89.486  1.00 37.82 ? 561  ASN B C   1 
ATOM   7306 O O   . ASN B 1 560 ? -17.092 46.606 89.428  1.00 36.34 ? 561  ASN B O   1 
ATOM   7307 C CB  . ASN B 1 560 ? -14.143 45.896 88.989  1.00 33.52 ? 561  ASN B CB  1 
ATOM   7308 C CG  . ASN B 1 560 ? -14.205 46.479 87.605  1.00 37.82 ? 561  ASN B CG  1 
ATOM   7309 O OD1 . ASN B 1 560 ? -13.384 47.307 87.240  1.00 41.88 ? 561  ASN B OD1 1 
ATOM   7310 N ND2 . ASN B 1 560 ? -15.195 46.064 86.824  1.00 42.38 ? 561  ASN B ND2 1 
ATOM   7311 N N   . PHE B 1 561 ? -16.117 48.595 89.031  1.00 33.27 ? 562  PHE B N   1 
ATOM   7312 C CA  . PHE B 1 561 ? -17.345 49.195 88.490  1.00 33.86 ? 562  PHE B CA  1 
ATOM   7313 C C   . PHE B 1 561 ? -17.467 49.213 86.969  1.00 35.56 ? 562  PHE B C   1 
ATOM   7314 O O   . PHE B 1 561 ? -18.572 49.341 86.431  1.00 42.18 ? 562  PHE B O   1 
ATOM   7315 C CB  . PHE B 1 561 ? -17.516 50.586 89.059  1.00 33.27 ? 562  PHE B CB  1 
ATOM   7316 C CG  . PHE B 1 561 ? -17.448 50.620 90.545  1.00 31.75 ? 562  PHE B CG  1 
ATOM   7317 C CD1 . PHE B 1 561 ? -18.414 49.972 91.302  1.00 31.04 ? 562  PHE B CD1 1 
ATOM   7318 C CD2 . PHE B 1 561 ? -16.424 51.274 91.188  1.00 31.13 ? 562  PHE B CD2 1 
ATOM   7319 C CE1 . PHE B 1 561 ? -18.364 49.983 92.656  1.00 29.79 ? 562  PHE B CE1 1 
ATOM   7320 C CE2 . PHE B 1 561 ? -16.368 51.297 92.548  1.00 29.85 ? 562  PHE B CE2 1 
ATOM   7321 C CZ  . PHE B 1 561 ? -17.341 50.648 93.293  1.00 37.26 ? 562  PHE B CZ  1 
ATOM   7322 N N   . TYR B 1 562 ? -16.351 49.051 86.266  1.00 37.80 ? 563  TYR B N   1 
ATOM   7323 C CA  . TYR B 1 562 ? -16.380 49.098 84.805  1.00 39.49 ? 563  TYR B CA  1 
ATOM   7324 C C   . TYR B 1 562 ? -16.852 47.775 84.179  1.00 44.66 ? 563  TYR B C   1 
ATOM   7325 O O   . TYR B 1 562 ? -16.541 46.699 84.685  1.00 46.85 ? 563  TYR B O   1 
ATOM   7326 C CB  . TYR B 1 562 ? -14.997 49.479 84.270  1.00 43.13 ? 563  TYR B CB  1 
ATOM   7327 N N   . GLU B 1 563 ? -17.591 47.857 83.078  1.00 40.43 ? 564  GLU B N   1 
ATOM   7328 C CA  . GLU B 1 563 ? -18.078 46.663 82.396  1.00 46.49 ? 564  GLU B CA  1 
ATOM   7329 C C   . GLU B 1 563 ? -17.399 46.495 81.049  1.00 50.72 ? 564  GLU B C   1 
ATOM   7330 O O   . GLU B 1 563 ? -17.541 47.345 80.179  1.00 52.13 ? 564  GLU B O   1 
ATOM   7331 C CB  . GLU B 1 563 ? -19.604 46.716 82.205  1.00 41.76 ? 564  GLU B CB  1 
ATOM   7332 C CG  . GLU B 1 563 ? -20.360 46.821 83.528  1.00 40.05 ? 564  GLU B CG  1 
ATOM   7333 C CD  . GLU B 1 563 ? -21.877 46.881 83.377  1.00 54.77 ? 564  GLU B CD  1 
ATOM   7334 O OE1 . GLU B 1 563 ? -22.388 46.978 82.228  1.00 41.87 ? 564  GLU B OE1 1 
ATOM   7335 O OE2 . GLU B 1 563 ? -22.554 46.831 84.430  1.00 52.25 ? 564  GLU B OE2 1 
ATOM   7336 N N   . LEU B 1 564 ? -16.679 45.386 80.884  1.00 52.79 ? 565  LEU B N   1 
ATOM   7337 C CA  . LEU B 1 564 ? -15.965 45.078 79.639  1.00 54.30 ? 565  LEU B CA  1 
ATOM   7338 C C   . LEU B 1 564 ? -16.864 44.992 78.396  1.00 55.65 ? 565  LEU B C   1 
ATOM   7339 O O   . LEU B 1 564 ? -18.037 44.625 78.478  1.00 57.01 ? 565  LEU B O   1 
ATOM   7340 C CB  . LEU B 1 564 ? -15.151 43.784 79.802  1.00 53.81 ? 565  LEU B CB  1 
ATOM   7341 C CG  . LEU B 1 564 ? -14.119 43.816 80.935  1.00 56.62 ? 565  LEU B CG  1 
ATOM   7342 C CD1 . LEU B 1 564 ? -13.454 42.452 81.179  1.00 44.08 ? 565  LEU B CD1 1 
ATOM   7343 C CD2 . LEU B 1 564 ? -13.074 44.884 80.652  1.00 55.28 ? 565  LEU B CD2 1 
HETATM 7344 P PA  . NAD C 2 .   ? 5.613   23.208 91.195  1.00 33.51 ? 1000 NAD A PA  1 
HETATM 7345 O O1A . NAD C 2 .   ? 5.100   22.794 92.607  1.00 33.79 ? 1000 NAD A O1A 1 
HETATM 7346 O O2A . NAD C 2 .   ? 5.662   22.184 90.157  1.00 38.04 ? 1000 NAD A O2A 1 
HETATM 7347 O O5B . NAD C 2 .   ? 7.016   23.712 91.055  1.00 32.09 ? 1000 NAD A O5B 1 
HETATM 7348 C C5B . NAD C 2 .   ? 7.461   24.843 91.785  1.00 23.06 ? 1000 NAD A C5B 1 
HETATM 7349 C C4B . NAD C 2 .   ? 8.886   24.724 92.287  1.00 23.32 ? 1000 NAD A C4B 1 
HETATM 7350 O O4B . NAD C 2 .   ? 9.056   23.600 93.131  1.00 25.50 ? 1000 NAD A O4B 1 
HETATM 7351 C C3B . NAD C 2 .   ? 9.937   24.664 91.212  1.00 23.13 ? 1000 NAD A C3B 1 
HETATM 7352 O O3B . NAD C 2 .   ? 11.068  25.371 91.622  1.00 20.39 ? 1000 NAD A O3B 1 
HETATM 7353 C C2B . NAD C 2 .   ? 10.140  23.192 91.131  1.00 24.44 ? 1000 NAD A C2B 1 
HETATM 7354 O O2B . NAD C 2 .   ? 11.286  22.761 90.510  1.00 25.96 ? 1000 NAD A O2B 1 
HETATM 7355 C C1B . NAD C 2 .   ? 10.087  22.816 92.562  1.00 23.58 ? 1000 NAD A C1B 1 
HETATM 7356 N N9A . NAD C 2 .   ? 9.766   21.413 92.767  1.00 29.73 ? 1000 NAD A N9A 1 
HETATM 7357 C C8A . NAD C 2 .   ? 9.009   20.595 91.944  1.00 28.51 ? 1000 NAD A C8A 1 
HETATM 7358 N N7A . NAD C 2 .   ? 8.911   19.371 92.495  1.00 30.21 ? 1000 NAD A N7A 1 
HETATM 7359 C C5A . NAD C 2 .   ? 9.593   19.344 93.694  1.00 27.88 ? 1000 NAD A C5A 1 
HETATM 7360 C C6A . NAD C 2 .   ? 9.812   18.387 94.658  1.00 32.11 ? 1000 NAD A C6A 1 
HETATM 7361 N N6A . NAD C 2 .   ? 9.269   17.070 94.501  1.00 35.32 ? 1000 NAD A N6A 1 
HETATM 7362 N N1A . NAD C 2 .   ? 10.534  18.682 95.740  1.00 29.43 ? 1000 NAD A N1A 1 
HETATM 7363 C C2A . NAD C 2 .   ? 11.058  19.914 95.922  1.00 28.37 ? 1000 NAD A C2A 1 
HETATM 7364 N N3A . NAD C 2 .   ? 10.858  20.886 94.997  1.00 24.86 ? 1000 NAD A N3A 1 
HETATM 7365 C C4A . NAD C 2 .   ? 10.148  20.640 93.891  1.00 24.75 ? 1000 NAD A C4A 1 
HETATM 7366 O O3  . NAD C 2 .   ? 4.740   24.190 90.502  1.00 33.68 ? 1000 NAD A O3  1 
HETATM 7367 P PN  . NAD C 2 .   ? 4.933   25.027 89.164  1.00 44.49 ? 1000 NAD A PN  1 
HETATM 7368 O O1N . NAD C 2 .   ? 4.305   24.291 88.023  1.00 53.63 ? 1000 NAD A O1N 1 
HETATM 7369 O O2N . NAD C 2 .   ? 6.368   25.372 88.844  1.00 45.85 ? 1000 NAD A O2N 1 
HETATM 7370 O O5D . NAD C 2 .   ? 4.134   26.343 89.447  1.00 51.85 ? 1000 NAD A O5D 1 
HETATM 7371 C C5D . NAD C 2 .   ? 2.749   26.310 89.353  1.00 62.55 ? 1000 NAD A C5D 1 
HETATM 7372 C C4D . NAD C 2 .   ? 2.071   26.447 90.698  1.00 65.42 ? 1000 NAD A C4D 1 
HETATM 7373 O O4D . NAD C 2 .   ? 1.968   27.783 91.133  1.00 69.87 ? 1000 NAD A O4D 1 
HETATM 7374 C C3D . NAD C 2 .   ? 0.691   25.909 90.602  1.00 64.24 ? 1000 NAD A C3D 1 
HETATM 7375 O O3D . NAD C 2 .   ? 0.584   24.604 91.025  1.00 64.40 ? 1000 NAD A O3D 1 
HETATM 7376 C C2D . NAD C 2 .   ? -0.129  26.833 91.410  1.00 64.47 ? 1000 NAD A C2D 1 
HETATM 7377 O O2D . NAD C 2 .   ? -0.823  26.126 92.366  1.00 64.26 ? 1000 NAD A O2D 1 
HETATM 7378 C C1D . NAD C 2 .   ? 0.833   27.846 91.958  1.00 63.86 ? 1000 NAD A C1D 1 
HETATM 7379 P PA  . NAD D 2 .   ? 5.531   23.114 131.390 1.00 55.44 ? 1000 NAD B PA  1 
HETATM 7380 O O1A . NAD D 2 .   ? 6.095   22.733 129.988 1.00 50.84 ? 1000 NAD B O1A 1 
HETATM 7381 O O2A . NAD D 2 .   ? 5.777   22.244 132.530 1.00 55.86 ? 1000 NAD B O2A 1 
HETATM 7382 O O5B . NAD D 2 .   ? 4.061   23.258 131.547 1.00 46.32 ? 1000 NAD B O5B 1 
HETATM 7383 C C5B . NAD D 2 .   ? 3.386   24.171 130.713 1.00 41.37 ? 1000 NAD B C5B 1 
HETATM 7384 C C4B . NAD D 2 .   ? 2.009   23.674 130.320 1.00 39.76 ? 1000 NAD B C4B 1 
HETATM 7385 O O4B . NAD D 2 .   ? 2.081   22.563 129.453 1.00 41.62 ? 1000 NAD B O4B 1 
HETATM 7386 C C3B . NAD D 2 .   ? 1.175   23.308 131.502 1.00 42.87 ? 1000 NAD B C3B 1 
HETATM 7387 O O3B . NAD D 2 .   ? -0.094  23.811 131.362 1.00 45.86 ? 1000 NAD B O3B 1 
HETATM 7388 C C2B . NAD D 2 .   ? 1.222   21.829 131.493 1.00 44.19 ? 1000 NAD B C2B 1 
HETATM 7389 O O2B . NAD D 2 .   ? 0.150   21.188 132.091 1.00 40.27 ? 1000 NAD B O2B 1 
HETATM 7390 C C1B . NAD D 2 .   ? 1.317   21.544 130.050 1.00 41.04 ? 1000 NAD B C1B 1 
HETATM 7391 N N9A . NAD D 2 .   ? 2.023   20.316 129.848 1.00 35.87 ? 1000 NAD B N9A 1 
HETATM 7392 C C8A . NAD D 2 .   ? 2.995   19.779 130.672 1.00 33.80 ? 1000 NAD B C8A 1 
HETATM 7393 N N7A . NAD D 2 .   ? 3.440   18.646 130.120 1.00 37.17 ? 1000 NAD B N7A 1 
HETATM 7394 C C5A . NAD D 2 .   ? 2.785   18.419 128.920 1.00 37.63 ? 1000 NAD B C5A 1 
HETATM 7395 C C6A . NAD D 2 .   ? 2.838   17.434 127.955 1.00 42.14 ? 1000 NAD B C6A 1 
HETATM 7396 N N6A . NAD D 2 .   ? 3.739   16.330 128.100 1.00 41.63 ? 1000 NAD B N6A 1 
HETATM 7397 N N1A . NAD D 2 .   ? 2.046   17.511 126.882 1.00 43.99 ? 1000 NAD B N1A 1 
HETATM 7398 C C2A . NAD D 2 .   ? 1.177   18.541 126.702 1.00 41.14 ? 1000 NAD B C2A 1 
HETATM 7399 N N3A . NAD D 2 .   ? 1.090   19.525 127.629 1.00 38.46 ? 1000 NAD B N3A 1 
HETATM 7400 C C4A . NAD D 2 .   ? 1.870   19.486 128.725 1.00 35.99 ? 1000 NAD B C4A 1 
HETATM 7401 O O3  . NAD D 2 .   ? 6.061   24.377 131.945 1.00 47.01 ? 1000 NAD B O3  1 
HETATM 7402 P PN  . NAD D 2 .   ? 5.717   25.033 133.345 1.00 52.55 ? 1000 NAD B PN  1 
HETATM 7403 O O1N . NAD D 2 .   ? 6.386   24.249 134.435 1.00 65.68 ? 1000 NAD B O1N 1 
HETATM 7404 O O2N . NAD D 2 .   ? 4.244   25.113 133.619 1.00 45.44 ? 1000 NAD B O2N 1 
HETATM 7405 O O5D . NAD D 2 .   ? 6.382   26.463 133.283 1.00 62.38 ? 1000 NAD B O5D 1 
HETATM 7406 O O   . HOH E 3 .   ? 11.635  29.876 88.869  1.00 15.35 ? 1101 HOH A O   1 
HETATM 7407 O O   . HOH E 3 .   ? 11.192  22.526 87.907  1.00 22.78 ? 1102 HOH A O   1 
HETATM 7408 O O   . HOH E 3 .   ? -6.009  26.939 85.713  1.00 16.90 ? 1103 HOH A O   1 
HETATM 7409 O O   . HOH E 3 .   ? 0.604   24.010 83.192  1.00 22.54 ? 1104 HOH A O   1 
HETATM 7410 O O   . HOH E 3 .   ? 2.367   37.216 82.554  1.00 28.83 ? 1105 HOH A O   1 
HETATM 7411 O O   . HOH E 3 .   ? 19.391  34.693 106.337 1.00 29.74 ? 1106 HOH A O   1 
HETATM 7412 O O   . HOH E 3 .   ? 12.776  31.517 80.808  1.00 24.70 ? 1107 HOH A O   1 
HETATM 7413 O O   . HOH E 3 .   ? -11.479 23.223 85.800  1.00 24.27 ? 1108 HOH A O   1 
HETATM 7414 O O   . HOH E 3 .   ? 21.977  33.196 106.364 1.00 22.32 ? 1109 HOH A O   1 
HETATM 7415 O O   . HOH E 3 .   ? 8.320   24.264 88.184  1.00 24.87 ? 1110 HOH A O   1 
HETATM 7416 O O   . HOH E 3 .   ? 9.977   32.423 87.332  1.00 20.71 ? 1111 HOH A O   1 
HETATM 7417 O O   . HOH E 3 .   ? -7.890  23.874 87.682  1.00 22.69 ? 1112 HOH A O   1 
HETATM 7418 O O   . HOH E 3 .   ? 3.364   28.182 79.168  1.00 19.60 ? 1113 HOH A O   1 
HETATM 7419 O O   . HOH E 3 .   ? 30.414  33.899 100.520 1.00 28.82 ? 1114 HOH A O   1 
HETATM 7420 O O   . HOH E 3 .   ? -7.965  27.672 89.879  1.00 20.27 ? 1115 HOH A O   1 
HETATM 7421 O O   . HOH E 3 .   ? 10.749  17.412 98.318  1.00 29.59 ? 1116 HOH A O   1 
HETATM 7422 O O   . HOH E 3 .   ? 30.381  38.047 105.742 1.00 31.33 ? 1117 HOH A O   1 
HETATM 7423 O O   . HOH E 3 .   ? 10.690  25.949 78.911  1.00 26.18 ? 1118 HOH A O   1 
HETATM 7424 O O   . HOH E 3 .   ? 16.187  24.013 88.188  1.00 29.93 ? 1119 HOH A O   1 
HETATM 7425 O O   . HOH E 3 .   ? 22.092  17.526 93.323  1.00 31.11 ? 1120 HOH A O   1 
HETATM 7426 O O   . HOH E 3 .   ? -18.922 23.267 94.264  1.00 25.68 ? 1121 HOH A O   1 
HETATM 7427 O O   . HOH E 3 .   ? -16.369 31.002 103.759 1.00 35.57 ? 1122 HOH A O   1 
HETATM 7428 O O   . HOH E 3 .   ? 21.020  52.602 105.364 1.00 29.51 ? 1123 HOH A O   1 
HETATM 7429 O O   . HOH E 3 .   ? 28.163  39.804 101.710 1.00 25.74 ? 1124 HOH A O   1 
HETATM 7430 O O   . HOH E 3 .   ? -8.070  27.888 84.641  1.00 23.70 ? 1125 HOH A O   1 
HETATM 7431 O O   . HOH E 3 .   ? 17.318  43.298 108.874 1.00 27.83 ? 1126 HOH A O   1 
HETATM 7432 O O   . HOH E 3 .   ? 26.669  34.503 94.407  1.00 27.26 ? 1127 HOH A O   1 
HETATM 7433 O O   . HOH E 3 .   ? 14.661  22.484 89.784  1.00 22.46 ? 1128 HOH A O   1 
HETATM 7434 O O   . HOH E 3 .   ? 9.392   23.045 85.471  1.00 30.41 ? 1129 HOH A O   1 
HETATM 7435 O O   . HOH E 3 .   ? 0.901   32.428 76.463  1.00 28.23 ? 1130 HOH A O   1 
HETATM 7436 O O   . HOH E 3 .   ? -1.241  20.810 83.932  1.00 28.80 ? 1131 HOH A O   1 
HETATM 7437 O O   . HOH E 3 .   ? -7.999  24.626 85.145  1.00 28.15 ? 1132 HOH A O   1 
HETATM 7438 O O   . HOH E 3 .   ? -4.700  14.340 84.686  1.00 33.96 ? 1133 HOH A O   1 
HETATM 7439 O O   . HOH E 3 .   ? 14.695  53.630 107.277 1.00 35.84 ? 1134 HOH A O   1 
HETATM 7440 O O   . HOH E 3 .   ? 20.936  18.310 90.192  1.00 31.24 ? 1135 HOH A O   1 
HETATM 7441 O O   . HOH E 3 .   ? 19.301  28.803 112.077 1.00 27.47 ? 1136 HOH A O   1 
HETATM 7442 O O   . HOH E 3 .   ? 7.265   30.436 73.770  1.00 30.24 ? 1137 HOH A O   1 
HETATM 7443 O O   . HOH E 3 .   ? -2.210  25.614 75.550  1.00 25.27 ? 1138 HOH A O   1 
HETATM 7444 O O   . HOH E 3 .   ? 29.838  38.650 100.176 1.00 24.38 ? 1139 HOH A O   1 
HETATM 7445 O O   . HOH E 3 .   ? 3.780   38.213 71.429  1.00 31.73 ? 1140 HOH A O   1 
HETATM 7446 O O   . HOH E 3 .   ? 18.412  26.276 111.528 1.00 30.34 ? 1141 HOH A O   1 
HETATM 7447 O O   . HOH E 3 .   ? 23.386  52.510 131.917 1.00 40.71 ? 1142 HOH A O   1 
HETATM 7448 O O   . HOH E 3 .   ? 8.757   21.900 67.856  1.00 34.17 ? 1143 HOH A O   1 
HETATM 7449 O O   . HOH E 3 .   ? -24.462 21.861 85.852  1.00 25.87 ? 1144 HOH A O   1 
HETATM 7450 O O   . HOH E 3 .   ? -24.536 46.880 92.813  1.00 31.37 ? 1145 HOH A O   1 
HETATM 7451 O O   . HOH E 3 .   ? 24.374  17.287 87.980  1.00 33.51 ? 1146 HOH A O   1 
HETATM 7452 O O   . HOH E 3 .   ? 1.639   21.571 68.685  1.00 31.39 ? 1147 HOH A O   1 
HETATM 7453 O O   . HOH E 3 .   ? -30.421 29.603 80.394  1.00 33.37 ? 1148 HOH A O   1 
HETATM 7454 O O   . HOH E 3 .   ? -29.534 45.799 95.470  1.00 32.89 ? 1149 HOH A O   1 
HETATM 7455 O O   . HOH E 3 .   ? -31.267 31.819 96.996  1.00 33.69 ? 1150 HOH A O   1 
HETATM 7456 O O   . HOH E 3 .   ? -11.677 9.384  76.238  1.00 41.61 ? 1151 HOH A O   1 
HETATM 7457 O O   . HOH E 3 .   ? -22.614 42.420 87.351  1.00 37.40 ? 1152 HOH A O   1 
HETATM 7458 O O   . HOH E 3 .   ? 15.632  16.520 87.231  1.00 34.35 ? 1153 HOH A O   1 
HETATM 7459 O O   . HOH E 3 .   ? -21.050 40.984 85.708  1.00 30.97 ? 1154 HOH A O   1 
HETATM 7460 O O   . HOH E 3 .   ? 9.292   23.842 78.909  1.00 26.70 ? 1155 HOH A O   1 
HETATM 7461 O O   . HOH E 3 .   ? 21.171  50.743 107.599 1.00 40.99 ? 1156 HOH A O   1 
HETATM 7462 O O   . HOH E 3 .   ? -0.477  37.436 82.911  1.00 37.12 ? 1157 HOH A O   1 
HETATM 7463 O O   . HOH E 3 .   ? 27.797  42.672 101.716 1.00 26.81 ? 1158 HOH A O   1 
HETATM 7464 O O   . HOH E 3 .   ? -12.860 41.770 84.965  1.00 36.79 ? 1159 HOH A O   1 
HETATM 7465 O O   . HOH E 3 .   ? 28.066  42.125 92.135  1.00 32.40 ? 1160 HOH A O   1 
HETATM 7466 O O   . HOH E 3 .   ? 14.127  30.514 111.343 1.00 32.57 ? 1161 HOH A O   1 
HETATM 7467 O O   . HOH E 3 .   ? -34.753 28.461 90.305  1.00 37.55 ? 1162 HOH A O   1 
HETATM 7468 O O   . HOH E 3 .   ? -2.642  33.402 76.867  1.00 30.14 ? 1163 HOH A O   1 
HETATM 7469 O O   . HOH E 3 .   ? -30.106 31.951 79.452  1.00 30.80 ? 1164 HOH A O   1 
HETATM 7470 O O   . HOH E 3 .   ? -27.011 41.135 81.530  1.00 34.11 ? 1165 HOH A O   1 
HETATM 7471 O O   . HOH E 3 .   ? 16.613  47.303 112.349 1.00 43.23 ? 1166 HOH A O   1 
HETATM 7472 O O   . HOH E 3 .   ? 27.496  24.081 80.655  1.00 41.68 ? 1167 HOH A O   1 
HETATM 7473 O O   . HOH E 3 .   ? 29.178  35.706 107.393 1.00 33.80 ? 1168 HOH A O   1 
HETATM 7474 O O   . HOH E 3 .   ? 29.650  45.156 104.792 1.00 35.83 ? 1169 HOH A O   1 
HETATM 7475 O O   . HOH E 3 .   ? 30.580  24.147 93.532  1.00 36.01 ? 1170 HOH A O   1 
HETATM 7476 O O   . HOH E 3 .   ? -24.914 10.802 88.541  1.00 30.16 ? 1171 HOH A O   1 
HETATM 7477 O O   . HOH E 3 .   ? 5.800   35.043 99.383  1.00 37.20 ? 1172 HOH A O   1 
HETATM 7478 O O   . HOH E 3 .   ? 7.705   21.542 88.679  1.00 37.33 ? 1173 HOH A O   1 
HETATM 7479 O O   . HOH E 3 .   ? -5.422  32.893 84.083  1.00 33.44 ? 1174 HOH A O   1 
HETATM 7480 O O   . HOH E 3 .   ? -0.656  13.123 75.875  1.00 38.49 ? 1175 HOH A O   1 
HETATM 7481 O O   . HOH E 3 .   ? -24.938 11.991 81.123  1.00 41.93 ? 1176 HOH A O   1 
HETATM 7482 O O   . HOH E 3 .   ? 26.730  31.437 79.751  1.00 34.07 ? 1177 HOH A O   1 
HETATM 7483 O O   . HOH E 3 .   ? -30.547 34.502 79.683  1.00 38.07 ? 1178 HOH A O   1 
HETATM 7484 O O   . HOH E 3 .   ? 17.287  23.722 69.022  1.00 39.22 ? 1179 HOH A O   1 
HETATM 7485 O O   . HOH E 3 .   ? -11.017 16.441 72.456  1.00 43.26 ? 1180 HOH A O   1 
HETATM 7486 O O   . HOH E 3 .   ? 16.902  54.393 133.426 1.00 41.19 ? 1181 HOH A O   1 
HETATM 7487 O O   . HOH E 3 .   ? 10.035  20.402 84.599  1.00 31.47 ? 1182 HOH A O   1 
HETATM 7488 O O   . HOH E 3 .   ? 15.057  61.497 126.145 1.00 39.58 ? 1183 HOH A O   1 
HETATM 7489 O O   . HOH E 3 .   ? -19.126 10.914 87.836  1.00 47.20 ? 1184 HOH A O   1 
HETATM 7490 O O   . HOH E 3 .   ? 5.497   34.530 95.987  1.00 41.18 ? 1185 HOH A O   1 
HETATM 7491 O O   . HOH E 3 .   ? 17.686  44.418 76.312  1.00 32.48 ? 1186 HOH A O   1 
HETATM 7492 O O   . HOH E 3 .   ? -9.065  29.540 101.317 1.00 40.29 ? 1187 HOH A O   1 
HETATM 7493 O O   . HOH E 3 .   ? -9.383  13.292 85.206  1.00 36.98 ? 1188 HOH A O   1 
HETATM 7494 O O   . HOH E 3 .   ? 17.540  43.552 71.345  1.00 38.82 ? 1189 HOH A O   1 
HETATM 7495 O O   . HOH E 3 .   ? 26.451  40.427 85.567  1.00 32.50 ? 1190 HOH A O   1 
HETATM 7496 O O   . HOH E 3 .   ? 25.635  14.882 93.541  1.00 37.89 ? 1191 HOH A O   1 
HETATM 7497 O O   . HOH E 3 .   ? -2.229  11.851 78.954  1.00 34.61 ? 1192 HOH A O   1 
HETATM 7498 O O   . HOH E 3 .   ? 27.798  23.718 103.373 1.00 32.79 ? 1193 HOH A O   1 
HETATM 7499 O O   . HOH E 3 .   ? 27.876  25.294 105.360 1.00 36.85 ? 1194 HOH A O   1 
HETATM 7500 O O   . HOH E 3 .   ? 18.105  46.534 119.840 1.00 42.15 ? 1195 HOH A O   1 
HETATM 7501 O O   . HOH E 3 .   ? 16.819  30.961 111.410 1.00 39.60 ? 1196 HOH A O   1 
HETATM 7502 O O   . HOH E 3 .   ? 22.849  47.044 108.260 1.00 40.93 ? 1197 HOH A O   1 
HETATM 7503 O O   . HOH E 3 .   ? -5.621  29.620 76.557  1.00 43.16 ? 1198 HOH A O   1 
HETATM 7504 O O   . HOH E 3 .   ? -5.987  25.463 88.063  1.00 36.98 ? 1199 HOH A O   1 
HETATM 7505 O O   . HOH E 3 .   ? 9.049   22.900 76.363  1.00 31.71 ? 1200 HOH A O   1 
HETATM 7506 O O   . HOH E 3 .   ? 6.511   28.617 109.753 1.00 44.71 ? 1201 HOH A O   1 
HETATM 7507 O O   . HOH E 3 .   ? 8.550   18.989 78.360  1.00 36.62 ? 1202 HOH A O   1 
HETATM 7508 O O   . HOH E 3 .   ? 28.273  38.666 92.885  1.00 36.63 ? 1203 HOH A O   1 
HETATM 7509 O O   . HOH E 3 .   ? 23.085  34.905 110.780 1.00 35.28 ? 1204 HOH A O   1 
HETATM 7510 O O   . HOH E 3 .   ? -5.053  27.920 89.994  1.00 41.13 ? 1205 HOH A O   1 
HETATM 7511 O O   . HOH E 3 .   ? 29.758  43.538 100.377 1.00 30.26 ? 1206 HOH A O   1 
HETATM 7512 O O   . HOH E 3 .   ? -5.038  11.405 73.477  1.00 38.29 ? 1207 HOH A O   1 
HETATM 7513 O O   . HOH E 3 .   ? 19.524  52.056 82.149  1.00 36.61 ? 1208 HOH A O   1 
HETATM 7514 O O   . HOH E 3 .   ? 32.056  29.442 93.924  1.00 38.33 ? 1209 HOH A O   1 
HETATM 7515 O O   . HOH E 3 .   ? -30.660 44.968 97.972  1.00 37.79 ? 1210 HOH A O   1 
HETATM 7516 O O   . HOH E 3 .   ? -23.525 9.139  87.158  1.00 33.05 ? 1211 HOH A O   1 
HETATM 7517 O O   . HOH E 3 .   ? -18.935 12.811 79.396  1.00 36.00 ? 1212 HOH A O   1 
HETATM 7518 O O   . HOH E 3 .   ? 25.054  15.118 89.424  1.00 39.25 ? 1213 HOH A O   1 
HETATM 7519 O O   . HOH E 3 .   ? 25.581  22.060 104.104 1.00 32.41 ? 1214 HOH A O   1 
HETATM 7520 O O   . HOH E 3 .   ? 2.183   22.744 85.546  1.00 35.12 ? 1215 HOH A O   1 
HETATM 7521 O O   . HOH E 3 .   ? -6.246  36.877 83.954  1.00 42.25 ? 1216 HOH A O   1 
HETATM 7522 O O   . HOH E 3 .   ? 10.195  20.885 79.473  1.00 31.98 ? 1217 HOH A O   1 
HETATM 7523 O O   . HOH E 3 .   ? 22.996  54.379 105.126 1.00 41.92 ? 1218 HOH A O   1 
HETATM 7524 O O   . HOH E 3 .   ? -20.416 43.249 100.554 1.00 46.77 ? 1219 HOH A O   1 
HETATM 7525 O O   . HOH F 3 .   ? -2.065  27.930 133.889 1.00 29.08 ? 1101 HOH B O   1 
HETATM 7526 O O   . HOH F 3 .   ? -10.944 30.286 116.481 1.00 35.35 ? 1102 HOH B O   1 
HETATM 7527 O O   . HOH F 3 .   ? -14.021 50.290 89.394  1.00 30.54 ? 1103 HOH B O   1 
HETATM 7528 O O   . HOH F 3 .   ? 24.476  37.048 118.775 1.00 35.45 ? 1104 HOH B O   1 
HETATM 7529 O O   . HOH F 3 .   ? -19.666 46.608 91.013  1.00 30.82 ? 1105 HOH B O   1 
HETATM 7530 O O   . HOH F 3 .   ? 22.046  27.611 136.565 1.00 32.43 ? 1106 HOH B O   1 
HETATM 7531 O O   . HOH F 3 .   ? 6.185   28.407 143.290 1.00 31.82 ? 1107 HOH B O   1 
HETATM 7532 O O   . HOH F 3 .   ? -13.558 35.779 100.678 1.00 35.61 ? 1108 HOH B O   1 
HETATM 7533 O O   . HOH F 3 .   ? 0.405   20.986 134.622 1.00 35.32 ? 1109 HOH B O   1 
HETATM 7534 O O   . HOH F 3 .   ? 20.655  40.560 121.919 1.00 35.91 ? 1110 HOH B O   1 
HETATM 7535 O O   . HOH F 3 .   ? 4.826   37.320 140.165 1.00 35.32 ? 1111 HOH B O   1 
HETATM 7536 O O   . HOH F 3 .   ? -1.301  30.623 135.356 1.00 34.80 ? 1112 HOH B O   1 
HETATM 7537 O O   . HOH F 3 .   ? -18.712 46.053 87.025  1.00 28.61 ? 1113 HOH B O   1 
HETATM 7538 O O   . HOH F 3 .   ? -11.739 43.857 110.095 1.00 37.00 ? 1114 HOH B O   1 
HETATM 7539 O O   . HOH F 3 .   ? 7.339   33.328 146.110 1.00 32.45 ? 1115 HOH B O   1 
HETATM 7540 O O   . HOH F 3 .   ? -11.341 39.197 113.740 1.00 27.71 ? 1116 HOH B O   1 
HETATM 7541 O O   . HOH F 3 .   ? 15.639  29.730 136.561 1.00 31.94 ? 1117 HOH B O   1 
HETATM 7542 O O   . HOH F 3 .   ? 17.375  31.299 132.638 1.00 34.83 ? 1118 HOH B O   1 
HETATM 7543 O O   . HOH F 3 .   ? 9.678   22.571 153.951 1.00 44.24 ? 1119 HOH B O   1 
HETATM 7544 O O   . HOH F 3 .   ? -4.824  20.851 134.420 1.00 47.94 ? 1120 HOH B O   1 
HETATM 7545 O O   . HOH F 3 .   ? -3.757  29.130 141.951 1.00 43.60 ? 1121 HOH B O   1 
HETATM 7546 O O   . HOH F 3 .   ? -9.214  32.888 108.540 1.00 43.23 ? 1122 HOH B O   1 
HETATM 7547 O O   . HOH F 3 .   ? -21.056 44.878 86.295  1.00 36.94 ? 1123 HOH B O   1 
HETATM 7548 O O   . HOH F 3 .   ? -11.518 49.968 115.569 1.00 40.66 ? 1124 HOH B O   1 
HETATM 7549 O O   . HOH F 3 .   ? 12.582  22.702 138.573 1.00 39.24 ? 1125 HOH B O   1 
HETATM 7550 O O   . HOH F 3 .   ? 10.190  25.305 139.340 1.00 38.47 ? 1126 HOH B O   1 
HETATM 7551 O O   . HOH F 3 .   ? -12.007 56.305 101.227 1.00 29.84 ? 1127 HOH B O   1 
HETATM 7552 O O   . HOH F 3 .   ? 14.238  32.135 145.731 1.00 33.72 ? 1128 HOH B O   1 
HETATM 7553 O O   . HOH F 3 .   ? 18.301  28.031 137.406 1.00 35.09 ? 1129 HOH B O   1 
HETATM 7554 O O   . HOH F 3 .   ? -21.733 47.274 119.584 1.00 41.11 ? 1130 HOH B O   1 
HETATM 7555 O O   . HOH F 3 .   ? -21.355 34.832 130.680 1.00 39.28 ? 1131 HOH B O   1 
HETATM 7556 O O   . HOH F 3 .   ? -22.343 30.315 117.002 1.00 41.30 ? 1132 HOH B O   1 
HETATM 7557 O O   . HOH F 3 .   ? 10.830  34.942 145.723 1.00 44.36 ? 1133 HOH B O   1 
HETATM 7558 O O   . HOH F 3 .   ? -11.888 40.331 146.670 1.00 40.05 ? 1134 HOH B O   1 
HETATM 7559 O O   . HOH F 3 .   ? -17.483 47.203 117.188 1.00 37.10 ? 1135 HOH B O   1 
HETATM 7560 O O   . HOH F 3 .   ? -7.786  30.446 109.027 1.00 37.48 ? 1136 HOH B O   1 
HETATM 7561 O O   . HOH F 3 .   ? 3.219   37.981 151.348 1.00 41.97 ? 1137 HOH B O   1 
HETATM 7562 O O   . HOH F 3 .   ? 17.243  31.391 137.926 1.00 35.26 ? 1138 HOH B O   1 
HETATM 7563 O O   . HOH F 3 .   ? -0.134  24.612 143.538 1.00 38.44 ? 1139 HOH B O   1 
HETATM 7564 O O   . HOH F 3 .   ? -20.773 32.742 121.003 1.00 41.18 ? 1140 HOH B O   1 
HETATM 7565 O O   . HOH F 3 .   ? 18.181  27.544 134.748 1.00 37.85 ? 1141 HOH B O   1 
HETATM 7566 O O   . HOH F 3 .   ? 28.032  54.158 130.198 1.00 40.47 ? 1142 HOH B O   1 
HETATM 7567 O O   . HOH F 3 .   ? 14.513  30.452 147.817 1.00 37.78 ? 1143 HOH B O   1 
HETATM 7568 O O   . HOH F 3 .   ? 29.081  29.786 128.227 1.00 30.73 ? 1144 HOH B O   1 
HETATM 7569 O O   . HOH F 3 .   ? -13.238 28.162 116.089 1.00 43.79 ? 1145 HOH B O   1 
HETATM 7570 O O   . HOH F 3 .   ? -21.323 35.685 120.997 1.00 32.45 ? 1146 HOH B O   1 
HETATM 7571 O O   . HOH F 3 .   ? -8.401  45.309 100.388 1.00 41.23 ? 1147 HOH B O   1 
HETATM 7572 O O   . HOH F 3 .   ? 15.781  28.721 134.087 1.00 40.34 ? 1148 HOH B O   1 
HETATM 7573 O O   . HOH F 3 .   ? 27.465  49.689 135.303 1.00 42.83 ? 1149 HOH B O   1 
HETATM 7574 O O   . HOH F 3 .   ? -8.589  31.909 102.542 1.00 40.82 ? 1150 HOH B O   1 
HETATM 7575 O O   . HOH F 3 .   ? 2.236   29.955 148.880 1.00 45.34 ? 1151 HOH B O   1 
HETATM 7576 O O   . HOH F 3 .   ? 34.637  29.781 136.725 1.00 41.13 ? 1152 HOH B O   1 
HETATM 7577 O O   . HOH F 3 .   ? -7.748  22.533 110.991 1.00 39.61 ? 1153 HOH B O   1 
HETATM 7578 O O   . HOH F 3 .   ? 22.918  32.366 124.178 1.00 38.53 ? 1154 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 42  ? 0.8137 1.0058 0.7261 -0.2229 -0.0793 0.1765  43  ASP A N   
2    C CA  . ASP A 42  ? 0.8094 0.9822 0.7236 -0.2089 -0.0716 0.1655  43  ASP A CA  
3    C C   . ASP A 42  ? 0.8146 0.9991 0.7117 -0.2102 -0.0576 0.1495  43  ASP A C   
4    O O   . ASP A 42  ? 0.7808 0.9651 0.6744 -0.2037 -0.0434 0.1354  43  ASP A O   
5    C CB  . ASP A 42  ? 0.7539 0.9049 0.6814 -0.2018 -0.0844 0.1736  43  ASP A CB  
6    N N   . TRP A 43  ? 0.8059 1.0012 0.6942 -0.2188 -0.0620 0.1514  44  TRP A N   
7    C CA  . TRP A 43  ? 0.7917 0.9994 0.6641 -0.2214 -0.0500 0.1358  44  TRP A CA  
8    C C   . TRP A 43  ? 0.7303 0.9611 0.5926 -0.2281 -0.0370 0.1240  44  TRP A C   
9    O O   . TRP A 43  ? 0.7518 0.9887 0.6066 -0.2248 -0.0227 0.1059  44  TRP A O   
10   C CB  . TRP A 43  ? 0.8577 1.0732 0.7243 -0.2311 -0.0592 0.1420  44  TRP A CB  
11   C CG  . TRP A 43  ? 0.9164 1.1102 0.7938 -0.2236 -0.0701 0.1506  44  TRP A CG  
12   C CD1 . TRP A 43  ? 0.9444 1.1302 0.8362 -0.2259 -0.0870 0.1680  44  TRP A CD1 
13   C CD2 . TRP A 43  ? 0.9177 1.0953 0.7944 -0.2124 -0.0650 0.1416  44  TRP A CD2 
14   N NE1 . TRP A 43  ? 0.9391 1.1050 0.8399 -0.2164 -0.0922 0.1696  44  TRP A NE1 
15   C CE2 . TRP A 43  ? 0.9380 1.0987 0.8287 -0.2082 -0.0791 0.1542  44  TRP A CE2 
16   C CE3 . TRP A 43  ? 0.8876 1.0640 0.7547 -0.2056 -0.0501 0.1238  44  TRP A CE3 
17   C CZ2 . TRP A 43  ? 0.9425 1.0856 0.8363 -0.1977 -0.0785 0.1500  44  TRP A CZ2 
18   C CZ3 . TRP A 43  ? 0.8932 1.0519 0.7626 -0.1958 -0.0499 0.1203  44  TRP A CZ3 
19   C CH2 . TRP A 43  ? 0.9260 1.0685 0.8079 -0.1920 -0.0640 0.1337  44  TRP A CH2 
20   N N   . ASP A 44  ? 0.6122 0.8561 0.4762 -0.2372 -0.0419 0.1336  45  ASP A N   
21   C CA  . ASP A 44  ? 0.6242 0.8909 0.4802 -0.2438 -0.0300 0.1231  45  ASP A CA  
22   C C   . ASP A 44  ? 0.6033 0.8627 0.4670 -0.2324 -0.0179 0.1127  45  ASP A C   
23   O O   . ASP A 44  ? 0.6257 0.8985 0.4846 -0.2319 -0.0032 0.0955  45  ASP A O   
24   C CB  . ASP A 44  ? 0.6781 0.9617 0.5337 -0.2577 -0.0394 0.1377  45  ASP A CB  
25   C CG  . ASP A 44  ? 0.8412 1.1369 0.6894 -0.2713 -0.0503 0.1470  45  ASP A CG  
26   O OD1 . ASP A 44  ? 0.9338 1.2310 0.7886 -0.2792 -0.0653 0.1657  45  ASP A OD1 
27   O OD2 . ASP A 44  ? 0.8788 1.1827 0.7160 -0.2744 -0.0443 0.1358  45  ASP A OD2 
28   N N   . LEU A 45  ? 0.5577 0.7962 0.4352 -0.2235 -0.0244 0.1224  46  LEU A N   
29   C CA  . LEU A 45  ? 0.5607 0.7911 0.4475 -0.2131 -0.0141 0.1137  46  LEU A CA  
30   C C   . LEU A 45  ? 0.5064 0.7298 0.3910 -0.2034 -0.0019 0.0961  46  LEU A C   
31   O O   . LEU A 45  ? 0.5158 0.7444 0.4043 -0.1982 0.0117  0.0817  46  LEU A O   
32   C CB  . LEU A 45  ? 0.5717 0.7795 0.4744 -0.2058 -0.0248 0.1274  46  LEU A CB  
33   C CG  . LEU A 45  ? 0.6436 0.8552 0.5546 -0.2117 -0.0340 0.1418  46  LEU A CG  
34   C CD1 . LEU A 45  ? 0.6217 0.8570 0.5283 -0.2182 -0.0225 0.1340  46  LEU A CD1 
35   C CD2 . LEU A 45  ? 0.7461 0.9606 0.6559 -0.2211 -0.0503 0.1581  46  LEU A CD2 
36   N N   . LEU A 46  ? 0.4461 0.6581 0.3263 -0.2009 -0.0071 0.0974  47  LEU A N   
37   C CA  . LEU A 46  ? 0.4551 0.6591 0.3333 -0.1920 0.0029  0.0822  47  LEU A CA  
38   C C   . LEU A 46  ? 0.4885 0.7137 0.3562 -0.1967 0.0157  0.0636  47  LEU A C   
39   O O   . LEU A 46  ? 0.4349 0.6613 0.3061 -0.1894 0.0290  0.0462  47  LEU A O   
40   C CB  . LEU A 46  ? 0.4019 0.5890 0.2784 -0.1890 -0.0069 0.0895  47  LEU A CB  
41   C CG  . LEU A 46  ? 0.4591 0.6358 0.3345 -0.1785 0.0008  0.0736  47  LEU A CG  
42   C CD1 . LEU A 46  ? 0.4336 0.5919 0.3253 -0.1609 0.0062  0.0624  47  LEU A CD1 
43   C CD2 . LEU A 46  ? 0.4587 0.6204 0.3338 -0.1763 -0.0107 0.0824  47  LEU A CD2 
44   N N   . ARG A 47  ? 0.5642 0.8064 0.4209 -0.2090 0.0112  0.0668  48  ARG A N   
45   C CA  . ARG A 47  ? 0.6019 0.8652 0.4490 -0.2150 0.0220  0.0491  48  ARG A CA  
46   C C   . ARG A 47  ? 0.5753 0.8515 0.4287 -0.2128 0.0354  0.0357  48  ARG A C   
47   O O   . ARG A 47  ? 0.6446 0.9270 0.4995 -0.2082 0.0484  0.0150  48  ARG A O   
48   C CB  . ARG A 47  ? 0.6428 0.9241 0.4784 -0.2307 0.0136  0.0576  48  ARG A CB  
49   N N   . ALA A 48  ? 0.4575 0.7369 0.3170 -0.2155 0.0316  0.0473  49  ALA A N   
50   C CA  . ALA A 48  ? 0.4862 0.7778 0.3539 -0.2136 0.0434  0.0365  49  ALA A CA  
51   C C   . ALA A 48  ? 0.4495 0.7278 0.3309 -0.1989 0.0535  0.0233  49  ALA A C   
52   O O   . ALA A 48  ? 0.4670 0.7561 0.3550 -0.1950 0.0666  0.0046  49  ALA A O   
53   C CB  . ALA A 48  ? 0.5558 0.8500 0.4288 -0.2186 0.0358  0.0537  49  ALA A CB  
54   N N   . SER A 49  ? 0.4144 0.6695 0.3019 -0.1907 0.0468  0.0329  50  SER A N   
55   C CA  . SER A 49  ? 0.3779 0.6208 0.2787 -0.1778 0.0555  0.0214  50  SER A CA  
56   C C   . SER A 49  ? 0.3640 0.6086 0.2613 -0.1730 0.0647  0.0010  50  SER A C   
57   O O   . SER A 49  ? 0.3373 0.5836 0.2470 -0.1642 0.0753  -0.0172 50  SER A O   
58   C CB  . SER A 49  ? 0.4507 0.6621 0.3602 -0.1662 0.0422  0.0339  50  SER A CB  
59   O OG  . SER A 49  ? 0.4834 0.6909 0.4033 -0.1661 0.0367  0.0460  50  SER A OG  
60   N N   . LEU A 50  ? 0.3377 0.5805 0.2206 -0.1781 0.0590  0.0039  51  LEU A N   
61   C CA  . LEU A 50  ? 0.4251 0.6696 0.3039 -0.1750 0.0665  -0.0148 51  LEU A CA  
62   C C   . LEU A 50  ? 0.4935 0.7596 0.3748 -0.1780 0.0782  -0.0345 51  LEU A C   
63   O O   . LEU A 50  ? 0.4293 0.6942 0.3206 -0.1696 0.0883  -0.0544 51  LEU A O   
64   C CB  . LEU A 50  ? 0.4260 0.6677 0.2895 -0.1819 0.0568  -0.0067 51  LEU A CB  
65   C CG  . LEU A 50  ? 0.4332 0.6498 0.2978 -0.1755 0.0450  0.0080  51  LEU A CG  
66   C CD1 . LEU A 50  ? 0.3399 0.5594 0.1894 -0.1855 0.0356  0.0173  51  LEU A CD1 
67   C CD2 . LEU A 50  ? 0.3479 0.5415 0.2271 -0.1573 0.0478  -0.0051 51  LEU A CD2 
68   N N   . MET A 51  ? 0.4583 0.7435 0.3323 -0.1899 0.0762  -0.0291 52  MET A N   
69   C CA  . MET A 51  ? 0.5275 0.8352 0.4021 -0.1950 0.0865  -0.0471 52  MET A CA  
70   C C   . MET A 51  ? 0.5402 0.8515 0.4338 -0.1864 0.0974  -0.0594 52  MET A C   
71   O O   . MET A 51  ? 0.5693 0.8923 0.4708 -0.1845 0.1081  -0.0800 52  MET A O   
72   C CB  . MET A 51  ? 0.6003 0.9287 0.4616 -0.2112 0.0809  -0.0364 52  MET A CB  
73   C CG  . MET A 51  ? 0.6760 1.0075 0.5204 -0.2219 0.0715  -0.0287 52  MET A CG  
74   S SD  . MET A 51  ? 1.2025 1.5368 1.0443 -0.2200 0.0798  -0.0527 52  MET A SD  
75   C CE  . MET A 51  ? 0.9985 1.3589 0.8469 -0.2237 0.0944  -0.0751 52  MET A CE  
76   N N   . LYS A 52  ? 0.4949 0.7963 0.3977 -0.1815 0.0941  -0.0463 53  LYS A N   
77   C CA  . LYS A 52  ? 0.5567 0.8595 0.4803 -0.1726 0.1029  -0.0554 53  LYS A CA  
78   C C   . LYS A 52  ? 0.5665 0.8578 0.5049 -0.1590 0.1108  -0.0745 53  LYS A C   
79   O O   . LYS A 52  ? 0.5024 0.8034 0.4528 -0.1552 0.1206  -0.0945 53  LYS A O   
80   C CB  . LYS A 52  ? 0.6588 0.9502 0.5892 -0.1705 0.0954  -0.0357 53  LYS A CB  
81   C CG  . LYS A 52  ? 0.7300 1.0244 0.6832 -0.1629 0.1027  -0.0419 53  LYS A CG  
82   C CD  . LYS A 52  ? 0.7610 1.0520 0.7171 -0.1669 0.0939  -0.0206 53  LYS A CD  
83   C CE  . LYS A 52  ? 0.7420 1.0061 0.6936 -0.1627 0.0798  -0.0034 53  LYS A CE  
84   N NZ  . LYS A 52  ? 0.7354 0.9967 0.6874 -0.1691 0.0692  0.0183  53  LYS A NZ  
85   N N   . PHE A 53  ? 0.6074 0.8778 0.5459 -0.1520 0.1058  -0.0681 54  PHE A N   
86   C CA  . PHE A 53  ? 0.5427 0.7952 0.4966 -0.1369 0.1088  -0.0834 54  PHE A CA  
87   C C   . PHE A 53  ? 0.5638 0.8268 0.5131 -0.1395 0.1169  -0.1034 54  PHE A C   
88   O O   . PHE A 53  ? 0.5579 0.8154 0.5247 -0.1292 0.1234  -0.1211 54  PHE A O   
89   C CB  . PHE A 53  ? 0.3480 0.5685 0.3008 -0.1270 0.0957  -0.0706 54  PHE A CB  
90   C CG  . PHE A 53  ? 0.4312 0.6348 0.3939 -0.1197 0.0868  -0.0552 54  PHE A CG  
91   C CD1 . PHE A 53  ? 0.5110 0.7091 0.4953 -0.1091 0.0900  -0.0616 54  PHE A CD1 
92   C CD2 . PHE A 53  ? 0.5614 0.7542 0.5130 -0.1235 0.0747  -0.0347 54  PHE A CD2 
93   C CE1 . PHE A 53  ? 0.6520 0.8347 0.6443 -0.1031 0.0814  -0.0479 54  PHE A CE1 
94   C CE2 . PHE A 53  ? 0.6394 0.8161 0.6003 -0.1168 0.0664  -0.0221 54  PHE A CE2 
95   C CZ  . PHE A 53  ? 0.6590 0.8309 0.6391 -0.1069 0.0699  -0.0288 54  PHE A CZ  
96   N N   . LYS A 54  ? 0.6697 0.9434 0.5984 -0.1518 0.1127  -0.0990 55  LYS A N   
97   C CA  . LYS A 54  ? 0.7232 1.0036 0.6475 -0.1546 0.1164  -0.1159 55  LYS A CA  
98   C C   . LYS A 54  ? 0.7428 1.0432 0.6774 -0.1570 0.1261  -0.1339 55  LYS A C   
99   O O   . LYS A 54  ? 0.7890 1.0894 0.7352 -0.1518 0.1324  -0.1539 55  LYS A O   
100  C CB  . LYS A 54  ? 0.7023 0.9883 0.6021 -0.1679 0.1078  -0.1043 55  LYS A CB  
101  C CG  . LYS A 54  ? 0.6351 0.9014 0.5260 -0.1649 0.0996  -0.0946 55  LYS A CG  
102  C CD  . LYS A 54  ? 0.7111 0.9852 0.5808 -0.1788 0.0900  -0.0816 55  LYS A CD  
103  C CE  . LYS A 54  ? 0.7583 1.0160 0.6207 -0.1761 0.0837  -0.0786 55  LYS A CE  
104  N NZ  . LYS A 54  ? 0.7913 1.0533 0.6362 -0.1885 0.0716  -0.0605 55  LYS A NZ  
105  N N   . SER A 55  ? 0.8000 1.1171 0.7312 -0.1651 0.1268  -0.1265 56  SER A N   
106  C CA  . SER A 55  ? 0.7873 1.1267 0.7258 -0.1697 0.1358  -0.1420 56  SER A CA  
107  C C   . SER A 55  ? 0.7905 1.1260 0.7568 -0.1565 0.1454  -0.1637 56  SER A C   
108  O O   . SER A 55  ? 0.8299 1.1773 0.8030 -0.1580 0.1524  -0.1832 56  SER A O   
109  C CB  . SER A 55  ? 0.7251 1.0793 0.6599 -0.1776 0.1349  -0.1287 56  SER A CB  
110  N N   . SER A 56  ? 0.7285 1.0474 0.7122 -0.1438 0.1449  -0.1598 57  SER A N   
111  C CA  . SER A 56  ? 0.6482 0.9610 0.6616 -0.1303 0.1518  -0.1775 57  SER A CA  
112  C C   . SER A 56  ? 0.5971 0.8844 0.6238 -0.1165 0.1477  -0.1724 57  SER A C   
113  O O   . SER A 56  ? 0.5715 0.8460 0.5831 -0.1175 0.1407  -0.1580 57  SER A O   
114  C CB  . SER A 56  ? 0.5919 0.9199 0.6204 -0.1304 0.1576  -0.1798 57  SER A CB  
115  O OG  . SER A 56  ? 0.5773 0.9037 0.6001 -0.1326 0.1525  -0.1589 57  SER A OG  
116  N N   . SER A 57  ? 0.5305 0.8107 0.5867 -0.1040 0.1516  -0.1841 58  SER A N   
117  C CA  . SER A 57  ? 0.4492 0.7058 0.5212 -0.0906 0.1476  -0.1811 58  SER A CA  
118  C C   . SER A 57  ? 0.4600 0.7154 0.5496 -0.0847 0.1470  -0.1717 58  SER A C   
119  O O   . SER A 57  ? 0.4811 0.7497 0.5866 -0.0843 0.1516  -0.1776 58  SER A O   
120  C CB  . SER A 57  ? 0.4715 0.7174 0.5670 -0.0800 0.1498  -0.2001 58  SER A CB  
121  O OG  . SER A 57  ? 0.5122 0.7624 0.5942 -0.0866 0.1509  -0.2103 58  SER A OG  
122  N N   . LEU A 58  ? 0.4035 0.6355 0.4881 -0.0792 0.1355  -0.1532 59  LEU A N   
123  C CA  . LEU A 58  ? 0.3878 0.6106 0.4866 -0.0727 0.1291  -0.1406 59  LEU A CA  
124  C C   . LEU A 58  ? 0.3984 0.6046 0.5274 -0.0577 0.1273  -0.1488 59  LEU A C   
125  O O   . LEU A 58  ? 0.4045 0.5914 0.5356 -0.0505 0.1231  -0.1517 59  LEU A O   
126  C CB  . LEU A 58  ? 0.3456 0.5483 0.4250 -0.0734 0.1154  -0.1167 59  LEU A CB  
127  C CG  . LEU A 58  ? 0.3798 0.5742 0.4708 -0.0685 0.1083  -0.1034 59  LEU A CG  
128  C CD1 . LEU A 58  ? 0.3292 0.5503 0.4208 -0.0788 0.1146  -0.1018 59  LEU A CD1 
129  C CD2 . LEU A 58  ? 0.3496 0.5201 0.4256 -0.0663 0.0945  -0.0832 59  LEU A CD2 
130  N N   . GLU A 59  ? 0.3286 0.5425 0.4819 -0.0533 0.1298  -0.1517 60  GLU A N   
131  C CA  . GLU A 59  ? 0.3357 0.5320 0.5180 -0.0394 0.1249  -0.1544 60  GLU A CA  
132  C C   . GLU A 59  ? 0.2671 0.4392 0.4408 -0.0350 0.1105  -0.1322 60  GLU A C   
133  O O   . GLU A 59  ? 0.3004 0.4768 0.4673 -0.0393 0.1069  -0.1193 60  GLU A O   
134  C CB  . GLU A 59  ? 0.4322 0.6469 0.6460 -0.0366 0.1325  -0.1660 60  GLU A CB  
135  C CG  . GLU A 59  ? 0.6084 0.8497 0.8293 -0.0421 0.1475  -0.1890 60  GLU A CG  
136  C CD  . GLU A 59  ? 0.7557 0.9839 0.9799 -0.0372 0.1473  -0.2030 60  GLU A CD  
137  O OE1 . GLU A 59  ? 0.7512 0.9606 0.9998 -0.0254 0.1417  -0.2053 60  GLU A OE1 
138  O OE2 . GLU A 59  ? 0.8202 1.0570 1.0233 -0.0458 0.1516  -0.2105 60  GLU A OE2 
139  N N   . VAL A 60  ? 0.2558 0.4030 0.4288 -0.0272 0.1022  -0.1277 61  VAL A N   
140  C CA  . VAL A 60  ? 0.2563 0.3811 0.4207 -0.0230 0.0891  -0.1084 61  VAL A CA  
141  C C   . VAL A 60  ? 0.2627 0.3756 0.4551 -0.0123 0.0835  -0.1079 61  VAL A C   
142  O O   . VAL A 60  ? 0.3316 0.4364 0.5410 -0.0054 0.0838  -0.1170 61  VAL A O   
143  C CB  . VAL A 60  ? 0.2894 0.3956 0.4319 -0.0228 0.0831  -0.1015 61  VAL A CB  
144  C CG1 . VAL A 60  ? 0.2171 0.2995 0.3561 -0.0165 0.0705  -0.0853 61  VAL A CG1 
145  C CG2 . VAL A 60  ? 0.2877 0.4042 0.4022 -0.0339 0.0857  -0.0975 61  VAL A CG2 
146  N N   . PRO A 61  ? 0.2498 0.3621 0.4483 -0.0112 0.0777  -0.0970 62  PRO A N   
147  C CA  . PRO A 61  ? 0.2340 0.3374 0.4604 -0.0021 0.0715  -0.0957 62  PRO A CA  
148  C C   . PRO A 61  ? 0.2633 0.3411 0.4800 0.0028  0.0582  -0.0802 62  PRO A C   
149  O O   . PRO A 61  ? 0.2078 0.2760 0.3973 -0.0008 0.0540  -0.0704 62  PRO A O   
150  C CB  . PRO A 61  ? 0.2234 0.3418 0.4581 -0.0054 0.0722  -0.0913 62  PRO A CB  
151  C CG  . PRO A 61  ? 0.2116 0.3308 0.4137 -0.0146 0.0701  -0.0791 62  PRO A CG  
152  C CD  . PRO A 61  ? 0.2156 0.3364 0.3972 -0.0192 0.0761  -0.0855 62  PRO A CD  
153  N N   . LEU A 62  ? 0.2322 0.2999 0.4720 0.0106  0.0513  -0.0780 63  LEU A N   
154  C CA  . LEU A 62  ? 0.2262 0.2744 0.4573 0.0135  0.0384  -0.0619 63  LEU A CA  
155  C C   . LEU A 62  ? 0.2666 0.3200 0.4895 0.0093  0.0344  -0.0517 63  LEU A C   
156  O O   . LEU A 62  ? 0.2051 0.2763 0.4404 0.0066  0.0398  -0.0564 63  LEU A O   
157  C CB  . LEU A 62  ? 0.2130 0.2518 0.4728 0.0215  0.0312  -0.0610 63  LEU A CB  
158  C CG  . LEU A 62  ? 0.2120 0.2490 0.4931 0.0265  0.0353  -0.0737 63  LEU A CG  
159  C CD1 . LEU A 62  ? 0.2145 0.2417 0.5261 0.0338  0.0256  -0.0692 63  LEU A CD1 
160  C CD2 . LEU A 62  ? 0.2130 0.2376 0.4721 0.0252  0.0356  -0.0732 63  LEU A CD2 
161  N N   . VAL A 63  ? 0.2248 0.2634 0.4279 0.0086  0.0250  -0.0382 64  VAL A N   
162  C CA  . VAL A 63  ? 0.2546 0.2948 0.4546 0.0060  0.0187  -0.0284 64  VAL A CA  
163  C C   . VAL A 63  ? 0.2332 0.2572 0.4372 0.0107  0.0063  -0.0183 64  VAL A C   
164  O O   . VAL A 63  ? 0.2365 0.2452 0.4213 0.0111  0.0006  -0.0113 64  VAL A O   
165  C CB  . VAL A 63  ? 0.2386 0.2780 0.4103 -0.0009 0.0184  -0.0218 64  VAL A CB  
166  C CG1 . VAL A 63  ? 0.2377 0.2795 0.4099 -0.0039 0.0120  -0.0129 64  VAL A CG1 
167  C CG2 . VAL A 63  ? 0.1993 0.2548 0.3645 -0.0069 0.0298  -0.0303 64  VAL A CG2 
168  N N   . ILE A 64  ? 0.2568 0.2853 0.4862 0.0139  0.0023  -0.0176 65  ILE A N   
169  C CA  . ILE A 64  ? 0.2647 0.2799 0.5002 0.0176  -0.0103 -0.0075 65  ILE A CA  
170  C C   . ILE A 64  ? 0.2835 0.3041 0.5252 0.0153  -0.0167 -0.0005 65  ILE A C   
171  O O   . ILE A 64  ? 0.2922 0.3282 0.5557 0.0151  -0.0124 -0.0057 65  ILE A O   
172  C CB  . ILE A 64  ? 0.3006 0.3139 0.5659 0.0241  -0.0118 -0.0118 65  ILE A CB  
173  C CG1 . ILE A 64  ? 0.2442 0.2496 0.5026 0.0261  -0.0071 -0.0176 65  ILE A CG1 
174  C CG2 . ILE A 64  ? 0.2113 0.2141 0.4869 0.0267  -0.0262 0.0004  65  ILE A CG2 
175  C CD1 . ILE A 64  ? 0.2121 0.2150 0.5022 0.0324  -0.0084 -0.0229 65  ILE A CD1 
176  N N   . ASN A 65  ? 0.2453 0.2541 0.4682 0.0133  -0.0266 0.0103  66  ASN A N   
177  C CA  . ASN A 65  ? 0.2964 0.3086 0.5218 0.0104  -0.0338 0.0172  66  ASN A CA  
178  C C   . ASN A 65  ? 0.3490 0.3770 0.5749 0.0052  -0.0259 0.0130  66  ASN A C   
179  O O   . ASN A 65  ? 0.3635 0.4023 0.6072 0.0039  -0.0276 0.0142  66  ASN A O   
180  C CB  . ASN A 65  ? 0.2500 0.2646 0.5048 0.0142  -0.0415 0.0203  66  ASN A CB  
181  C CG  . ASN A 65  ? 0.3172 0.3272 0.5679 0.0116  -0.0541 0.0309  66  ASN A CG  
182  O OD1 . ASN A 65  ? 0.2941 0.2936 0.5181 0.0083  -0.0593 0.0366  66  ASN A OD1 
183  N ND2 . ASN A 65  ? 0.3588 0.3770 0.6371 0.0130  -0.0592 0.0330  66  ASN A ND2 
184  N N   . GLY A 66  ? 0.3853 0.4155 0.5927 0.0018  -0.0176 0.0089  67  GLY A N   
185  C CA  . GLY A 66  ? 0.2855 0.3304 0.4897 -0.0048 -0.0109 0.0071  67  GLY A CA  
186  C C   . GLY A 66  ? 0.2747 0.3405 0.4996 -0.0055 0.0008  -0.0033 67  GLY A C   
187  O O   . GLY A 66  ? 0.3540 0.4346 0.5758 -0.0122 0.0072  -0.0047 67  GLY A O   
188  N N   . GLU A 67  ? 0.3071 0.3749 0.5538 0.0008  0.0035  -0.0108 68  GLU A N   
189  C CA  . GLU A 67  ? 0.3141 0.4024 0.5827 0.0008  0.0156  -0.0236 68  GLU A CA  
190  C C   . GLU A 67  ? 0.3167 0.4050 0.5793 0.0023  0.0250  -0.0347 68  GLU A C   
191  O O   . GLU A 67  ? 0.3076 0.3799 0.5670 0.0075  0.0208  -0.0342 68  GLU A O   
192  C CB  . GLU A 67  ? 0.1987 0.2923 0.5035 0.0070  0.0125  -0.0265 68  GLU A CB  
193  N N   . ARG A 68  ? 0.2659 0.3732 0.5267 -0.0032 0.0374  -0.0443 69  ARG A N   
194  C CA  . ARG A 68  ? 0.2080 0.3197 0.4658 -0.0029 0.0474  -0.0570 69  ARG A CA  
195  C C   . ARG A 68  ? 0.2716 0.3881 0.5633 0.0048  0.0513  -0.0699 69  ARG A C   
196  O O   . ARG A 68  ? 0.2713 0.4036 0.5892 0.0056  0.0549  -0.0755 69  ARG A O   
197  C CB  . ARG A 68  ? 0.2937 0.4274 0.5400 -0.0125 0.0592  -0.0633 69  ARG A CB  
198  C CG  . ARG A 68  ? 0.3839 0.5119 0.5963 -0.0203 0.0560  -0.0521 69  ARG A CG  
199  C CD  . ARG A 68  ? 0.5967 0.7399 0.8058 -0.0290 0.0566  -0.0450 69  ARG A CD  
200  N NE  . ARG A 68  ? 0.7360 0.8963 0.9277 -0.0396 0.0655  -0.0475 69  ARG A NE  
201  C CZ  . ARG A 68  ? 0.7788 0.9662 0.9803 -0.0461 0.0769  -0.0564 69  ARG A CZ  
202  N NH1 . ARG A 68  ? 0.7678 0.9704 0.9501 -0.0570 0.0838  -0.0569 69  ARG A NH1 
203  N NH2 . ARG A 68  ? 0.7912 0.9915 1.0221 -0.0422 0.0813  -0.0646 69  ARG A NH2 
204  N N   . ILE A 69  ? 0.3309 0.4336 0.6241 0.0103  0.0501  -0.0744 70  ILE A N   
205  C CA  . ILE A 69  ? 0.2907 0.3962 0.6182 0.0178  0.0532  -0.0873 70  ILE A CA  
206  C C   . ILE A 69  ? 0.2828 0.3952 0.6085 0.0169  0.0648  -0.1040 70  ILE A C   
207  O O   . ILE A 69  ? 0.2477 0.3465 0.5528 0.0165  0.0632  -0.1022 70  ILE A O   
208  C CB  . ILE A 69  ? 0.3072 0.3899 0.6465 0.0258  0.0397  -0.0780 70  ILE A CB  
209  C CG1 . ILE A 69  ? 0.4608 0.5383 0.8024 0.0260  0.0279  -0.0624 70  ILE A CG1 
210  C CG2 . ILE A 69  ? 0.2603 0.3456 0.6390 0.0335  0.0419  -0.0909 70  ILE A CG2 
211  C CD1 . ILE A 69  ? 0.5279 0.5884 0.8877 0.0329  0.0144  -0.0535 70  ILE A CD1 
212  N N   . TYR A 70  ? 0.2971 0.4317 0.6453 0.0164  0.0766  -0.1210 71  TYR A N   
213  C CA  . TYR A 70  ? 0.3161 0.4617 0.6626 0.0141  0.0892  -0.1395 71  TYR A CA  
214  C C   . TYR A 70  ? 0.3152 0.4534 0.6949 0.0235  0.0891  -0.1527 71  TYR A C   
215  O O   . TYR A 70  ? 0.2863 0.4125 0.6917 0.0314  0.0792  -0.1464 71  TYR A O   
216  C CB  . TYR A 70  ? 0.3191 0.4960 0.6670 0.0061  0.1036  -0.1517 71  TYR A CB  
217  C CG  . TYR A 70  ? 0.2854 0.4685 0.5961 -0.0050 0.1039  -0.1390 71  TYR A CG  
218  C CD1 . TYR A 70  ? 0.2808 0.4642 0.5595 -0.0123 0.1080  -0.1400 71  TYR A CD1 
219  C CD2 . TYR A 70  ? 0.2213 0.4086 0.5302 -0.0082 0.0987  -0.1252 71  TYR A CD2 
220  C CE1 . TYR A 70  ? 0.2711 0.4593 0.5183 -0.0226 0.1069  -0.1272 71  TYR A CE1 
221  C CE2 . TYR A 70  ? 0.2758 0.4673 0.5528 -0.0185 0.0977  -0.1127 71  TYR A CE2 
222  C CZ  . TYR A 70  ? 0.2895 0.4814 0.5366 -0.0255 0.1017  -0.1136 71  TYR A CZ  
223  O OH  . TYR A 70  ? 0.2749 0.4703 0.4935 -0.0357 0.0995  -0.1006 71  TYR A OH  
224  N N   . ASP A 71  ? 0.2800 0.4247 0.6597 0.0224  0.0991  -0.1704 72  ASP A N   
225  C CA  . ASP A 71  ? 0.3128 0.4434 0.7145 0.0291  0.0953  -0.1791 72  ASP A CA  
226  C C   . ASP A 71  ? 0.3752 0.5113 0.8108 0.0328  0.0939  -0.1857 72  ASP A C   
227  O O   . ASP A 71  ? 0.2785 0.3988 0.7377 0.0390  0.0849  -0.1850 72  ASP A O   
228  C CB  . ASP A 71  ? 0.3627 0.4960 0.7482 0.0240  0.1032  -0.1938 72  ASP A CB  
229  C CG  . ASP A 71  ? 0.4748 0.6312 0.8640 0.0179  0.1148  -0.2119 72  ASP A CG  
230  O OD1 . ASP A 71  ? 0.5473 0.7035 0.9640 0.0215  0.1142  -0.2224 72  ASP A OD1 
231  O OD2 . ASP A 71  ? 0.4966 0.6716 0.8612 0.0089  0.1242  -0.2151 72  ASP A OD2 
232  N N   . ASN A 72  ? 0.3891 0.5482 0.8271 0.0282  0.1025  -0.1916 73  ASN A N   
233  C CA  . ASN A 72  ? 0.4338 0.5998 0.9038 0.0317  0.1014  -0.1963 73  ASN A CA  
234  C C   . ASN A 72  ? 0.4907 0.6486 0.9863 0.0358  0.0998  -0.2100 73  ASN A C   
235  O O   . ASN A 72  ? 0.5434 0.6974 1.0705 0.0411  0.0938  -0.2100 73  ASN A O   
236  C CB  . ASN A 72  ? 0.4649 0.6210 0.9487 0.0371  0.0889  -0.1774 73  ASN A CB  
237  C CG  . ASN A 72  ? 0.5495 0.7116 1.0666 0.0407  0.0862  -0.1799 73  ASN A CG  
238  O OD1 . ASN A 72  ? 0.5514 0.7344 1.0718 0.0369  0.0934  -0.1830 73  ASN A OD1 
239  N ND2 . ASN A 72  ? 0.6009 0.7451 1.1439 0.0474  0.0753  -0.1777 73  ASN A ND2 
240  N N   . ASN A 73  ? 0.5050 0.6606 0.9872 0.0328  0.1047  -0.2210 74  ASN A N   
241  C CA  . ASN A 73  ? 0.5888 0.7384 1.0934 0.0351  0.1040  -0.2353 74  ASN A CA  
242  C C   . ASN A 73  ? 0.5515 0.6763 1.0790 0.0427  0.0889  -0.2242 74  ASN A C   
243  O O   . ASN A 73  ? 0.5753 0.6962 1.1328 0.0456  0.0857  -0.2328 74  ASN A O   
244  C CB  . ASN A 73  ? 0.6995 0.8687 1.2277 0.0338  0.1124  -0.2529 74  ASN A CB  
245  C CG  . ASN A 73  ? 0.7889 0.9704 1.3112 0.0280  0.1232  -0.2744 74  ASN A CG  
246  O OD1 . ASN A 73  ? 0.8328 1.0055 1.3741 0.0304  0.1202  -0.2840 74  ASN A OD1 
247  N ND2 . ASN A 73  ? 0.8264 1.0292 1.3224 0.0195  0.1351  -0.2813 74  ASN A ND2 
248  N N   . GLU A 74  ? 0.5191 0.6279 1.0321 0.0450  0.0794  -0.2047 75  GLU A N   
249  C CA  . GLU A 74  ? 0.4585 0.5447 0.9882 0.0507  0.0639  -0.1900 75  GLU A CA  
250  C C   . GLU A 74  ? 0.4226 0.4921 0.9267 0.0501  0.0592  -0.1800 75  GLU A C   
251  O O   . GLU A 74  ? 0.4722 0.5258 0.9856 0.0521  0.0508  -0.1763 75  GLU A O   
252  C CB  . GLU A 74  ? 0.4554 0.5386 0.9950 0.0540  0.0548  -0.1733 75  GLU A CB  
253  C CG  . GLU A 74  ? 0.5343 0.6306 1.1046 0.0554  0.0569  -0.1815 75  GLU A CG  
254  C CD  . GLU A 74  ? 0.5104 0.6064 1.0876 0.0576  0.0487  -0.1653 75  GLU A CD  
255  O OE1 . GLU A 74  ? 0.4936 0.5871 1.0469 0.0566  0.0462  -0.1518 75  GLU A OE1 
256  O OE2 . GLU A 74  ? 0.5215 0.6202 1.1290 0.0601  0.0445  -0.1665 75  GLU A OE2 
257  N N   . ARG A 75  ? 0.3013 0.3755 0.7737 0.0470  0.0647  -0.1757 76  ARG A N   
258  C CA  . ARG A 75  ? 0.2597 0.3184 0.7067 0.0466  0.0604  -0.1652 76  ARG A CA  
259  C C   . ARG A 75  ? 0.2938 0.3563 0.7229 0.0418  0.0695  -0.1790 76  ARG A C   
260  O O   . ARG A 75  ? 0.2722 0.3534 0.6993 0.0372  0.0810  -0.1957 76  ARG A O   
261  C CB  . ARG A 75  ? 0.2449 0.3053 0.6696 0.0459  0.0602  -0.1523 76  ARG A CB  
262  C CG  . ARG A 75  ? 0.2404 0.3000 0.6834 0.0497  0.0513  -0.1395 76  ARG A CG  
263  C CD  . ARG A 75  ? 0.2488 0.3099 0.6659 0.0468  0.0491  -0.1248 76  ARG A CD  
264  N NE  . ARG A 75  ? 0.2261 0.2814 0.6575 0.0500  0.0370  -0.1094 76  ARG A NE  
265  C CZ  . ARG A 75  ? 0.2567 0.3269 0.7143 0.0518  0.0385  -0.1130 76  ARG A CZ  
266  N NH1 . ARG A 75  ? 0.2292 0.3208 0.6978 0.0495  0.0519  -0.1309 76  ARG A NH1 
267  N NH2 . ARG A 75  ? 0.2239 0.2871 0.6926 0.0542  0.0258  -0.0977 76  ARG A NH2 
268  N N   . ALA A 76  ? 0.2638 0.3090 0.6797 0.0423  0.0636  -0.1717 77  ALA A N   
269  C CA  . ALA A 76  ? 0.2677 0.3156 0.6634 0.0373  0.0710  -0.1823 77  ALA A CA  
270  C C   . ALA A 76  ? 0.2849 0.3441 0.6479 0.0320  0.0799  -0.1824 77  ALA A C   
271  O O   . ALA A 76  ? 0.2478 0.3085 0.6036 0.0331  0.0786  -0.1714 77  ALA A O   
272  C CB  . ALA A 76  ? 0.2685 0.2950 0.6596 0.0390  0.0619  -0.1731 77  ALA A CB  
273  N N   . LEU A 77  ? 0.2816 0.3490 0.6257 0.0257  0.0882  -0.1940 78  LEU A N   
274  C CA  . LEU A 77  ? 0.3016 0.3804 0.6127 0.0187  0.0962  -0.1940 78  LEU A CA  
275  C C   . LEU A 77  ? 0.3300 0.3980 0.6184 0.0155  0.0952  -0.1933 78  LEU A C   
276  O O   . LEU A 77  ? 0.3505 0.4127 0.6474 0.0156  0.0935  -0.2008 78  LEU A O   
277  C CB  . LEU A 77  ? 0.3116 0.4170 0.6179 0.0109  0.1081  -0.2092 78  LEU A CB  
278  C CG  . LEU A 77  ? 0.3528 0.4735 0.6739 0.0115  0.1114  -0.2094 78  LEU A CG  
279  C CD1 . LEU A 77  ? 0.4490 0.5945 0.7660 0.0033  0.1226  -0.2258 78  LEU A CD1 
280  C CD2 . LEU A 77  ? 0.3285 0.4522 0.6339 0.0105  0.1108  -0.1946 78  LEU A CD2 
281  N N   . PHE A 78  ? 0.3312 0.3962 0.5872 0.0107  0.0933  -0.1798 79  PHE A N   
282  C CA  . PHE A 78  ? 0.2877 0.3458 0.5180 0.0057  0.0925  -0.1779 79  PHE A CA  
283  C C   . PHE A 78  ? 0.3298 0.4090 0.5332 -0.0050 0.1014  -0.1833 79  PHE A C   
284  O O   . PHE A 78  ? 0.3502 0.4376 0.5372 -0.0094 0.1011  -0.1723 79  PHE A O   
285  C CB  . PHE A 78  ? 0.2459 0.2837 0.4570 0.0070  0.0809  -0.1548 79  PHE A CB  
286  C CG  . PHE A 78  ? 0.3782 0.4099 0.5636 0.0018  0.0798  -0.1517 79  PHE A CG  
287  C CD1 . PHE A 78  ? 0.2451 0.2856 0.3996 -0.0064 0.0816  -0.1450 79  PHE A CD1 
288  C CD2 . PHE A 78  ? 0.3678 0.3855 0.5622 0.0047  0.0766  -0.1555 79  PHE A CD2 
289  C CE1 . PHE A 78  ? 0.3003 0.3358 0.4335 -0.0112 0.0801  -0.1423 79  PHE A CE1 
290  C CE2 . PHE A 78  ? 0.3383 0.3513 0.5103 -0.0003 0.0756  -0.1528 79  PHE A CE2 
291  C CZ  . PHE A 78  ? 0.2966 0.3187 0.4386 -0.0080 0.0773  -0.1464 79  PHE A CZ  
292  N N   . PRO A 79  ? 0.3505 0.4387 0.5493 -0.0099 0.1086  -0.1997 80  PRO A N   
293  C CA  . PRO A 79  ? 0.3297 0.4382 0.4999 -0.0217 0.1157  -0.2024 80  PRO A CA  
294  C C   . PRO A 79  ? 0.3369 0.4342 0.4751 -0.0267 0.1081  -0.1851 80  PRO A C   
295  O O   . PRO A 79  ? 0.3131 0.3994 0.4463 -0.0266 0.1053  -0.1869 80  PRO A O   
296  C CB  . PRO A 79  ? 0.2879 0.4080 0.4641 -0.0261 0.1215  -0.2216 80  PRO A CB  
297  C CG  . PRO A 79  ? 0.3835 0.4825 0.5800 -0.0180 0.1147  -0.2236 80  PRO A CG  
298  C CD  . PRO A 79  ? 0.4077 0.4896 0.6248 -0.0073 0.1078  -0.2124 80  PRO A CD  
299  N N   . GLN A 80  ? 0.3138 0.4138 0.4324 -0.0309 0.1045  -0.1682 81  GLN A N   
300  C CA  . GLN A 80  ? 0.2585 0.3500 0.3492 -0.0358 0.0978  -0.1530 81  GLN A CA  
301  C C   . GLN A 80  ? 0.2686 0.3801 0.3378 -0.0482 0.1040  -0.1598 81  GLN A C   
302  O O   . GLN A 80  ? 0.2729 0.4047 0.3351 -0.0556 0.1096  -0.1614 81  GLN A O   
303  C CB  . GLN A 80  ? 0.3031 0.3875 0.3835 -0.0350 0.0902  -0.1323 81  GLN A CB  
304  C CG  . GLN A 80  ? 0.3104 0.3860 0.3655 -0.0394 0.0831  -0.1178 81  GLN A CG  
305  C CD  . GLN A 80  ? 0.2713 0.3428 0.3160 -0.0401 0.0764  -0.0996 81  GLN A CD  
306  O OE1 . GLN A 80  ? 0.2795 0.3566 0.3330 -0.0388 0.0774  -0.0975 81  GLN A OE1 
307  N NE2 . GLN A 80  ? 0.2355 0.2970 0.2631 -0.0420 0.0694  -0.0869 81  GLN A NE2 
308  N N   . THR A 81  ? 0.3159 0.4225 0.3744 -0.0512 0.1026  -0.1633 82  THR A N   
309  C CA  . THR A 81  ? 0.3045 0.4302 0.3427 -0.0636 0.1077  -0.1705 82  THR A CA  
310  C C   . THR A 81  ? 0.3350 0.4557 0.3467 -0.0701 0.0993  -0.1522 82  THR A C   
311  O O   . THR A 81  ? 0.3422 0.4429 0.3532 -0.0639 0.0905  -0.1376 82  THR A O   
312  C CB  . THR A 81  ? 0.3180 0.4455 0.3648 -0.0638 0.1129  -0.1914 82  THR A CB  
313  O OG1 . THR A 81  ? 0.3349 0.4379 0.3887 -0.0561 0.1051  -0.1860 82  THR A OG1 
314  C CG2 . THR A 81  ? 0.3015 0.4383 0.3757 -0.0591 0.1214  -0.2109 82  THR A CG2 
315  N N   . ASN A 82  ? 0.3258 0.4661 0.3167 -0.0830 0.1022  -0.1533 83  ASN A N   
316  C CA  . ASN A 82  ? 0.3221 0.4601 0.2896 -0.0905 0.0940  -0.1373 83  ASN A CA  
317  C C   . ASN A 82  ? 0.3174 0.4420 0.2836 -0.0884 0.0900  -0.1407 83  ASN A C   
318  O O   . ASN A 82  ? 0.3536 0.4876 0.3190 -0.0930 0.0955  -0.1573 83  ASN A O   
319  C CB  . ASN A 82  ? 0.3336 0.4985 0.2805 -0.1063 0.0981  -0.1383 83  ASN A CB  
320  C CG  . ASN A 82  ? 0.4019 0.5656 0.3266 -0.1149 0.0880  -0.1187 83  ASN A CG  
321  O OD1 . ASN A 82  ? 0.3019 0.4466 0.2256 -0.1099 0.0795  -0.1092 83  ASN A OD1 
322  N ND2 . ASN A 82  ? 0.3591 0.5440 0.2669 -0.1283 0.0888  -0.1125 83  ASN A ND2 
323  N N   . PRO A 83  ? 0.2842 0.3877 0.2503 -0.0819 0.0806  -0.1256 84  PRO A N   
324  C CA  . PRO A 83  ? 0.2857 0.3775 0.2515 -0.0804 0.0769  -0.1283 84  PRO A CA  
325  C C   . PRO A 83  ? 0.3329 0.4379 0.2782 -0.0931 0.0754  -0.1289 84  PRO A C   
326  O O   . PRO A 83  ? 0.3054 0.4050 0.2513 -0.0935 0.0741  -0.1356 84  PRO A O   
327  C CB  . PRO A 83  ? 0.3072 0.3775 0.2755 -0.0722 0.0678  -0.1105 84  PRO A CB  
328  C CG  . PRO A 83  ? 0.3195 0.3927 0.2822 -0.0729 0.0651  -0.0966 84  PRO A CG  
329  C CD  . PRO A 83  ? 0.2717 0.3624 0.2386 -0.0762 0.0735  -0.1070 84  PRO A CD  
330  N N   . ALA A 84  ? 0.3483 0.4703 0.2764 -0.1038 0.0749  -0.1214 85  ALA A N   
331  C CA  . ALA A 84  ? 0.3172 0.4547 0.2250 -0.1177 0.0732  -0.1216 85  ALA A CA  
332  C C   . ALA A 84  ? 0.3333 0.4939 0.2370 -0.1265 0.0839  -0.1426 85  ALA A C   
333  O O   . ALA A 84  ? 0.3599 0.5346 0.2473 -0.1384 0.0838  -0.1474 85  ALA A O   
334  C CB  . ALA A 84  ? 0.3199 0.4648 0.2113 -0.1262 0.0658  -0.1011 85  ALA A CB  
335  N N   . ASN A 85  ? 0.3321 0.4975 0.2508 -0.1211 0.0931  -0.1554 86  ASN A N   
336  C CA  . ASN A 85  ? 0.4246 0.6110 0.3473 -0.1271 0.1021  -0.1733 86  ASN A CA  
337  C C   . ASN A 85  ? 0.3412 0.5215 0.2919 -0.1148 0.1093  -0.1875 86  ASN A C   
338  O O   . ASN A 85  ? 0.3749 0.5637 0.3326 -0.1135 0.1138  -0.1871 86  ASN A O   
339  C CB  . ASN A 85  ? 0.4294 0.6383 0.3370 -0.1394 0.1024  -0.1639 86  ASN A CB  
340  C CG  . ASN A 85  ? 0.5087 0.7393 0.4230 -0.1454 0.1102  -0.1798 86  ASN A CG  
341  O OD1 . ASN A 85  ? 0.5234 0.7544 0.4497 -0.1429 0.1144  -0.1971 86  ASN A OD1 
342  N ND2 . ASN A 85  ? 0.5019 0.7507 0.4090 -0.1536 0.1120  -0.1737 86  ASN A ND2 
343  N N   . HIS A 86  ? 0.4397 0.6044 0.4076 -0.1059 0.1093  -0.1985 87  HIS A N   
344  C CA  . HIS A 86  ? 0.4899 0.6411 0.4861 -0.0922 0.1123  -0.2061 87  HIS A CA  
345  C C   . HIS A 86  ? 0.4642 0.6287 0.4814 -0.0907 0.1197  -0.2222 87  HIS A C   
346  O O   . HIS A 86  ? 0.4985 0.6526 0.5419 -0.0796 0.1211  -0.2283 87  HIS A O   
347  C CB  . HIS A 86  ? 0.4920 0.6189 0.5008 -0.0830 0.1074  -0.2082 87  HIS A CB  
348  C CG  . HIS A 86  ? 0.4647 0.5937 0.4724 -0.0877 0.1063  -0.2179 87  HIS A CG  
349  N ND1 . HIS A 86  ? 0.4931 0.6366 0.5120 -0.0907 0.1118  -0.2341 87  HIS A ND1 
350  C CD2 . HIS A 86  ? 0.4986 0.6176 0.4958 -0.0903 0.1003  -0.2142 87  HIS A CD2 
351  C CE1 . HIS A 86  ? 0.4948 0.6371 0.5098 -0.0948 0.1095  -0.2398 87  HIS A CE1 
352  N NE2 . HIS A 86  ? 0.5128 0.6403 0.5148 -0.0946 0.1023  -0.2277 87  HIS A NE2 
353  N N   . GLN A 87  ? 0.4439 0.6317 0.4505 -0.1021 0.1239  -0.2287 88  GLN A N   
354  C CA  . GLN A 87  ? 0.5168 0.7201 0.5415 -0.1020 0.1315  -0.2437 88  GLN A CA  
355  C C   . GLN A 87  ? 0.4991 0.7127 0.5202 -0.1035 0.1341  -0.2350 88  GLN A C   
356  O O   . GLN A 87  ? 0.5399 0.7627 0.5792 -0.1005 0.1399  -0.2444 88  GLN A O   
357  C CB  . GLN A 87  ? 0.5673 0.7922 0.5833 -0.1140 0.1355  -0.2561 88  GLN A CB  
358  C CG  . GLN A 87  ? 0.6440 0.8872 0.6286 -0.1292 0.1338  -0.2446 88  GLN A CG  
359  C CD  . GLN A 87  ? 0.7731 1.0414 0.7519 -0.1415 0.1391  -0.2580 88  GLN A CD  
360  O OE1 . GLN A 87  ? 0.8178 1.0950 0.8165 -0.1392 0.1463  -0.2762 88  GLN A OE1 
361  N NE2 . GLN A 87  ? 0.7840 1.0642 0.7363 -0.1550 0.1353  -0.2489 88  GLN A NE2 
362  N N   . GLN A 88  ? 0.4469 0.6590 0.4454 -0.1081 0.1294  -0.2166 89  GLN A N   
363  C CA  . GLN A 88  ? 0.3469 0.5690 0.3404 -0.1108 0.1309  -0.2060 89  GLN A CA  
364  C C   . GLN A 88  ? 0.4063 0.6109 0.4175 -0.0975 0.1301  -0.2004 89  GLN A C   
365  O O   . GLN A 88  ? 0.3907 0.5778 0.3958 -0.0927 0.1246  -0.1886 89  GLN A O   
366  C CB  . GLN A 88  ? 0.3806 0.6100 0.3438 -0.1228 0.1252  -0.1873 89  GLN A CB  
367  C CG  . GLN A 88  ? 0.3952 0.6347 0.3534 -0.1265 0.1255  -0.1745 89  GLN A CG  
368  C CD  . GLN A 88  ? 0.5580 0.7960 0.4919 -0.1346 0.1170  -0.1518 89  GLN A CD  
369  O OE1 . GLN A 88  ? 0.5664 0.7962 0.4866 -0.1376 0.1107  -0.1457 89  GLN A OE1 
370  N NE2 . GLN A 88  ? 0.6662 0.9119 0.5964 -0.1384 0.1160  -0.1385 89  GLN A NE2 
371  N N   . VAL A 89  ? 0.3521 0.5626 0.3859 -0.0919 0.1356  -0.2093 90  VAL A N   
372  C CA  . VAL A 89  ? 0.3125 0.5098 0.3669 -0.0797 0.1351  -0.2050 90  VAL A CA  
373  C C   . VAL A 89  ? 0.3049 0.5111 0.3472 -0.0844 0.1348  -0.1890 90  VAL A C   
374  O O   . VAL A 89  ? 0.3459 0.5721 0.3856 -0.0918 0.1389  -0.1898 90  VAL A O   
375  C CB  . VAL A 89  ? 0.3171 0.5175 0.4037 -0.0720 0.1400  -0.2209 90  VAL A CB  
376  C CG1 . VAL A 89  ? 0.3009 0.4860 0.4108 -0.0591 0.1375  -0.2150 90  VAL A CG1 
377  C CG2 . VAL A 89  ? 0.3316 0.5263 0.4317 -0.0693 0.1402  -0.2370 90  VAL A CG2 
378  N N   . LEU A 90  ? 0.2918 0.4777 0.3281 -0.0796 0.1248  -0.1696 91  LEU A N   
379  C CA  . LEU A 90  ? 0.3444 0.5315 0.3709 -0.0830 0.1192  -0.1496 91  LEU A CA  
380  C C   . LEU A 90  ? 0.3604 0.5436 0.4106 -0.0739 0.1194  -0.1481 91  LEU A C   
381  O O   . LEU A 90  ? 0.3665 0.5602 0.4141 -0.0783 0.1194  -0.1389 91  LEU A O   
382  C CB  . LEU A 90  ? 0.3227 0.4874 0.3342 -0.0810 0.1063  -0.1293 91  LEU A CB  
383  C CG  . LEU A 90  ? 0.3591 0.5261 0.3485 -0.0897 0.1041  -0.1283 91  LEU A CG  
384  C CD1 . LEU A 90  ? 0.3281 0.4704 0.3104 -0.0845 0.0921  -0.1121 91  LEU A CD1 
385  C CD2 . LEU A 90  ? 0.3383 0.5297 0.3063 -0.1056 0.1063  -0.1225 91  LEU A CD2 
386  N N   . ALA A 91  ? 0.3596 0.5269 0.4334 -0.0614 0.1185  -0.1560 92  ALA A N   
387  C CA  . ALA A 91  ? 0.3269 0.4877 0.4244 -0.0521 0.1166  -0.1529 92  ALA A CA  
388  C C   . ALA A 91  ? 0.3064 0.4586 0.4338 -0.0411 0.1189  -0.1681 92  ALA A C   
389  O O   . ALA A 91  ? 0.2664 0.4051 0.3954 -0.0373 0.1167  -0.1734 92  ALA A O   
390  C CB  . ALA A 91  ? 0.2509 0.3903 0.3410 -0.0476 0.1040  -0.1309 92  ALA A CB  
391  N N   . ASN A 92  ? 0.2819 0.4422 0.4347 -0.0363 0.1229  -0.1748 93  ASN A N   
392  C CA  . ASN A 92  ? 0.2959 0.4451 0.4816 -0.0247 0.1222  -0.1850 93  ASN A CA  
393  C C   . ASN A 92  ? 0.2662 0.3967 0.4605 -0.0168 0.1108  -0.1668 93  ASN A C   
394  O O   . ASN A 92  ? 0.2572 0.3959 0.4546 -0.0180 0.1103  -0.1594 93  ASN A O   
395  C CB  . ASN A 92  ? 0.2927 0.4646 0.5039 -0.0247 0.1340  -0.2059 93  ASN A CB  
396  C CG  . ASN A 92  ? 0.3636 0.5477 0.5612 -0.0334 0.1395  -0.2198 93  ASN A CG  
397  O OD1 . ASN A 92  ? 0.4943 0.7007 0.6825 -0.0427 0.1463  -0.2252 93  ASN A OD1 
398  N ND2 . ASN A 92  ? 0.3248 0.4948 0.5209 -0.0313 0.1363  -0.2249 93  ASN A ND2 
399  N N   . VAL A 93  ? 0.2901 0.3961 0.4875 -0.0096 0.1015  -0.1594 94  VAL A N   
400  C CA  . VAL A 93  ? 0.2995 0.3869 0.4971 -0.0041 0.0898  -0.1403 94  VAL A CA  
401  C C   . VAL A 93  ? 0.3124 0.3901 0.5441 0.0061  0.0853  -0.1425 94  VAL A C   
402  O O   . VAL A 93  ? 0.2538 0.3190 0.5004 0.0116  0.0829  -0.1482 94  VAL A O   
403  C CB  . VAL A 93  ? 0.2861 0.3536 0.4607 -0.0042 0.0814  -0.1270 94  VAL A CB  
404  C CG1 . VAL A 93  ? 0.2233 0.2744 0.3940 -0.0001 0.0700  -0.1076 94  VAL A CG1 
405  C CG2 . VAL A 93  ? 0.2339 0.3113 0.3779 -0.0144 0.0852  -0.1256 94  VAL A CG2 
406  N N   . THR A 94  ? 0.3091 0.3929 0.5539 0.0080  0.0835  -0.1373 95  THR A N   
407  C CA  . THR A 94  ? 0.2675 0.3426 0.5449 0.0171  0.0772  -0.1358 95  THR A CA  
408  C C   . THR A 94  ? 0.2587 0.3079 0.5328 0.0222  0.0648  -0.1221 95  THR A C   
409  O O   . THR A 94  ? 0.2340 0.2724 0.4795 0.0191  0.0590  -0.1078 95  THR A O   
410  C CB  . THR A 94  ? 0.2607 0.3446 0.5459 0.0169  0.0748  -0.1276 95  THR A CB  
411  O OG1 . THR A 94  ? 0.2768 0.3868 0.5650 0.0112  0.0870  -0.1402 95  THR A OG1 
412  C CG2 . THR A 94  ? 0.2417 0.3183 0.5631 0.0260  0.0677  -0.1264 95  THR A CG2 
413  N N   . GLN A 95  ? 0.2448 0.2847 0.5492 0.0296  0.0610  -0.1270 96  GLN A N   
414  C CA  . GLN A 95  ? 0.2846 0.3015 0.5894 0.0337  0.0496  -0.1149 96  GLN A CA  
415  C C   . GLN A 95  ? 0.3005 0.3090 0.6290 0.0396  0.0387  -0.1038 96  GLN A C   
416  O O   . GLN A 95  ? 0.2328 0.2475 0.5969 0.0446  0.0396  -0.1128 96  GLN A O   
417  C CB  . GLN A 95  ? 0.2372 0.2483 0.5573 0.0362  0.0523  -0.1281 96  GLN A CB  
418  C CG  . GLN A 95  ? 0.2580 0.2783 0.5548 0.0298  0.0625  -0.1394 96  GLN A CG  
419  C CD  . GLN A 95  ? 0.3015 0.3097 0.5630 0.0254  0.0576  -0.1252 96  GLN A CD  
420  O OE1 . GLN A 95  ? 0.3576 0.3497 0.6193 0.0275  0.0515  -0.1200 96  GLN A OE1 
421  N NE2 . GLN A 95  ? 0.3323 0.3485 0.5651 0.0193  0.0598  -0.1182 96  GLN A NE2 
422  N N   . ALA A 96  ? 0.2260 0.2212 0.5351 0.0386  0.0284  -0.0846 97  ALA A N   
423  C CA  . ALA A 96  ? 0.2460 0.2339 0.5709 0.0423  0.0168  -0.0714 97  ALA A CA  
424  C C   . ALA A 96  ? 0.2330 0.2099 0.5928 0.0486  0.0090  -0.0713 97  ALA A C   
425  O O   . ALA A 96  ? 0.3149 0.2796 0.6737 0.0492  0.0065  -0.0705 97  ALA A O   
426  C CB  . ALA A 96  ? 0.2232 0.1993 0.5169 0.0389  0.0081  -0.0526 97  ALA A CB  
427  N N   . THR A 97  ? 0.3037 0.2850 0.6957 0.0530  0.0044  -0.0709 98  THR A N   
428  C CA  . THR A 97  ? 0.3172 0.2890 0.7356 0.0556  -0.0063 -0.0653 98  THR A CA  
429  C C   . THR A 97  ? 0.3084 0.2652 0.7148 0.0544  -0.0213 -0.0425 98  THR A C   
430  O O   . THR A 97  ? 0.2729 0.2270 0.6546 0.0526  -0.0233 -0.0326 98  THR A O   
431  C CB  . THR A 97  ? 0.2624 0.2460 0.7140 0.0576  -0.0069 -0.0715 98  THR A CB  
432  O OG1 . THR A 97  ? 0.2608 0.2487 0.7111 0.0582  -0.0115 -0.0614 98  THR A OG1 
433  C CG2 . THR A 97  ? 0.2505 0.2515 0.7136 0.0575  0.0081  -0.0945 98  THR A CG2 
434  N N   . GLU A 98  ? 0.3182 0.2673 0.7404 0.0538  -0.0319 -0.0342 99  GLU A N   
435  C CA  . GLU A 98  ? 0.3490 0.2871 0.7611 0.0511  -0.0464 -0.0128 99  GLU A CA  
436  C C   . GLU A 98  ? 0.3324 0.2761 0.7468 0.0514  -0.0517 -0.0050 99  GLU A C   
437  O O   . GLU A 98  ? 0.3440 0.2816 0.7348 0.0487  -0.0587 0.0094  99  GLU A O   
438  C CB  . GLU A 98  ? 0.4292 0.3619 0.8637 0.0500  -0.0562 -0.0070 99  GLU A CB  
439  C CG  . GLU A 98  ? 0.5777 0.5053 1.0129 0.0469  -0.0717 0.0131  99  GLU A CG  
440  C CD  . GLU A 98  ? 0.6403 0.5637 1.1009 0.0452  -0.0819 0.0192  99  GLU A CD  
441  O OE1 . GLU A 98  ? 0.7270 0.6503 1.1995 0.0430  -0.0937 0.0316  99  GLU A OE1 
442  O OE2 . GLU A 98  ? 0.5856 0.5060 1.0547 0.0457  -0.0786 0.0118  99  GLU A OE2 
443  N N   . LYS A 99  ? 0.2878 0.2437 0.7300 0.0542  -0.0480 -0.0154 100 LYS A N   
444  C CA  . LYS A 99  ? 0.2883 0.2513 0.7361 0.0545  -0.0524 -0.0093 100 LYS A CA  
445  C C   . LYS A 99  ? 0.2706 0.2380 0.6936 0.0545  -0.0460 -0.0098 100 LYS A C   
446  O O   . LYS A 99  ? 0.2705 0.2354 0.6785 0.0521  -0.0543 0.0037  100 LYS A O   
447  C CB  . LYS A 99  ? 0.3502 0.3266 0.8342 0.0571  -0.0483 -0.0218 100 LYS A CB  
448  C CG  . LYS A 99  ? 0.5301 0.5120 1.0255 0.0567  -0.0565 -0.0125 100 LYS A CG  
449  C CD  . LYS A 99  ? 0.6232 0.5930 1.1162 0.0531  -0.0740 0.0077  100 LYS A CD  
450  C CE  . LYS A 99  ? 0.6606 0.6360 1.1655 0.0519  -0.0827 0.0165  100 LYS A CE  
451  N NZ  . LYS A 99  ? 0.6756 0.6454 1.1496 0.0479  -0.0916 0.0330  100 LYS A NZ  
452  N N   . ASP A 100 ? 0.2509 0.2267 0.6638 0.0545  -0.0312 -0.0252 101 ASP A N   
453  C CA  . ASP A 100 ? 0.2581 0.2403 0.6325 0.0485  -0.0239 -0.0251 101 ASP A CA  
454  C C   . ASP A 100 ? 0.2290 0.1969 0.5672 0.0441  -0.0319 -0.0093 101 ASP A C   
455  O O   . ASP A 100 ? 0.3430 0.3122 0.6599 0.0402  -0.0351 -0.0011 101 ASP A O   
456  C CB  . ASP A 100 ? 0.2245 0.2159 0.5881 0.0469  -0.0083 -0.0420 101 ASP A CB  
457  C CG  . ASP A 100 ? 0.3162 0.3256 0.7119 0.0500  0.0021  -0.0602 101 ASP A CG  
458  O OD1 . ASP A 100 ? 0.3179 0.3378 0.7326 0.0511  0.0006  -0.0596 101 ASP A OD1 
459  O OD2 . ASP A 100 ? 0.2265 0.2401 0.6288 0.0510  0.0119  -0.0756 101 ASP A OD2 
460  N N   . VAL A 101 ? 0.2704 0.2253 0.6027 0.0445  -0.0348 -0.0059 102 VAL A N   
461  C CA  . VAL A 101 ? 0.2911 0.2340 0.5903 0.0401  -0.0414 0.0079  102 VAL A CA  
462  C C   . VAL A 101 ? 0.2850 0.2234 0.5831 0.0384  -0.0553 0.0242  102 VAL A C   
463  O O   . VAL A 101 ? 0.2635 0.2004 0.5323 0.0340  -0.0577 0.0317  102 VAL A O   
464  C CB  . VAL A 101 ? 0.3223 0.2529 0.6204 0.0405  -0.0432 0.0101  102 VAL A CB  
465  C CG1 . VAL A 101 ? 0.2436 0.1642 0.5081 0.0354  -0.0494 0.0244  102 VAL A CG1 
466  C CG2 . VAL A 101 ? 0.2611 0.1963 0.5577 0.0413  -0.0298 -0.0064 102 VAL A CG2 
467  N N   . MET A 102 ? 0.2467 0.1829 0.5777 0.0418  -0.0648 0.0294  103 MET A N   
468  C CA  . MET A 102 ? 0.3759 0.3097 0.7102 0.0400  -0.0789 0.0445  103 MET A CA  
469  C C   . MET A 102 ? 0.3531 0.2977 0.6787 0.0381  -0.0770 0.0431  103 MET A C   
470  O O   . MET A 102 ? 0.3531 0.2947 0.6579 0.0336  -0.0852 0.0544  103 MET A O   
471  C CB  . MET A 102 ? 0.3137 0.2497 0.6822 0.0412  -0.0864 0.0466  103 MET A CB  
472  C CG  . MET A 102 ? 0.4440 0.3715 0.8137 0.0390  -0.0905 0.0513  103 MET A CG  
473  S SD  . MET A 102 ? 0.5317 0.4618 0.9414 0.0387  -0.1005 0.0546  103 MET A SD  
474  C CE  . MET A 102 ? 0.4265 0.3600 0.8336 0.0348  -0.1133 0.0690  103 MET A CE  
475  N N   . ASN A 103 ? 0.2395 0.1972 0.5808 0.0408  -0.0662 0.0289  104 ASN A N   
476  C CA  . ASN A 103 ? 0.2696 0.2385 0.6025 0.0382  -0.0631 0.0271  104 ASN A CA  
477  C C   . ASN A 103 ? 0.3113 0.2781 0.6019 0.0327  -0.0582 0.0280  104 ASN A C   
478  O O   . ASN A 103 ? 0.2609 0.2299 0.5368 0.0290  -0.0621 0.0336  104 ASN A O   
479  C CB  . ASN A 103 ? 0.2279 0.2134 0.5871 0.0414  -0.0516 0.0115  104 ASN A CB  
480  C CG  . ASN A 103 ? 0.3543 0.3442 0.7596 0.0471  -0.0571 0.0100  104 ASN A CG  
481  O OD1 . ASN A 103 ? 0.3508 0.3327 0.7682 0.0479  -0.0715 0.0231  104 ASN A OD1 
482  N ND2 . ASN A 103 ? 0.3746 0.3782 0.8066 0.0509  -0.0458 -0.0063 104 ASN A ND2 
483  N N   . ALA A 104 ? 0.2755 0.2376 0.5484 0.0322  -0.0502 0.0225  105 ALA A N   
484  C CA  . ALA A 104 ? 0.2649 0.2240 0.5005 0.0275  -0.0464 0.0237  105 ALA A CA  
485  C C   . ALA A 104 ? 0.2315 0.1795 0.4465 0.0244  -0.0579 0.0375  105 ALA A C   
486  O O   . ALA A 104 ? 0.3383 0.2864 0.5321 0.0206  -0.0599 0.0409  105 ALA A O   
487  C CB  . ALA A 104 ? 0.2220 0.1786 0.4456 0.0277  -0.0367 0.0156  105 ALA A CB  
488  N N   . VAL A 105 ? 0.2747 0.2136 0.4964 0.0254  -0.0656 0.0451  106 VAL A N   
489  C CA  . VAL A 105 ? 0.2478 0.1779 0.4497 0.0213  -0.0765 0.0584  106 VAL A CA  
490  C C   . VAL A 105 ? 0.3456 0.2794 0.5516 0.0193  -0.0864 0.0657  106 VAL A C   
491  O O   . VAL A 105 ? 0.3013 0.2326 0.4824 0.0146  -0.0912 0.0713  106 VAL A O   
492  C CB  . VAL A 105 ? 0.2811 0.2022 0.4932 0.0219  -0.0839 0.0669  106 VAL A CB  
493  C CG1 . VAL A 105 ? 0.2686 0.1840 0.4644 0.0165  -0.0969 0.0822  106 VAL A CG1 
494  C CG2 . VAL A 105 ? 0.2977 0.2139 0.4989 0.0224  -0.0752 0.0613  106 VAL A CG2 
495  N N   . LYS A 106 ? 0.2962 0.2367 0.5347 0.0227  -0.0890 0.0643  107 LYS A N   
496  C CA  . LYS A 106 ? 0.3427 0.2879 0.5884 0.0208  -0.0984 0.0708  107 LYS A CA  
497  C C   . LYS A 106 ? 0.3465 0.2979 0.5737 0.0179  -0.0928 0.0654  107 LYS A C   
498  O O   . LYS A 106 ? 0.3351 0.2851 0.5470 0.0135  -0.1008 0.0721  107 LYS A O   
499  C CB  . LYS A 106 ? 0.3840 0.3367 0.6722 0.0256  -0.1013 0.0692  107 LYS A CB  
500  C CG  . LYS A 106 ? 0.3893 0.3468 0.6882 0.0235  -0.1128 0.0775  107 LYS A CG  
501  C CD  . LYS A 106 ? 0.4199 0.3858 0.7646 0.0289  -0.1153 0.0752  107 LYS A CD  
502  C CE  . LYS A 106 ? 0.4035 0.3722 0.7615 0.0265  -0.1303 0.0868  107 LYS A CE  
503  N NZ  . LYS A 106 ? 0.3714 0.3442 0.7059 0.0212  -0.1312 0.0880  107 LYS A NZ  
504  N N   . ALA A 107 ? 0.2715 0.2302 0.5006 0.0196  -0.0796 0.0535  108 ALA A N   
505  C CA  . ALA A 107 ? 0.2533 0.2182 0.4675 0.0163  -0.0745 0.0493  108 ALA A CA  
506  C C   . ALA A 107 ? 0.2651 0.2207 0.4437 0.0118  -0.0772 0.0534  108 ALA A C   
507  O O   . ALA A 107 ? 0.3210 0.2775 0.4887 0.0082  -0.0815 0.0559  108 ALA A O   
508  C CB  . ALA A 107 ? 0.2231 0.1974 0.4419 0.0176  -0.0600 0.0370  108 ALA A CB  
509  N N   . ALA A 108 ? 0.2567 0.2038 0.4192 0.0121  -0.0748 0.0537  109 ALA A N   
510  C CA  . ALA A 108 ? 0.2668 0.2063 0.3973 0.0084  -0.0758 0.0557  109 ALA A CA  
511  C C   . ALA A 108 ? 0.3278 0.2630 0.4490 0.0048  -0.0886 0.0652  109 ALA A C   
512  O O   . ALA A 108 ? 0.3484 0.2816 0.4495 0.0011  -0.0907 0.0650  109 ALA A O   
513  C CB  . ALA A 108 ? 0.2417 0.1744 0.3602 0.0095  -0.0706 0.0543  109 ALA A CB  
514  N N   . LYS A 109 ? 0.3674 0.3011 0.5034 0.0053  -0.0974 0.0734  110 LYS A N   
515  C CA  . LYS A 109 ? 0.3803 0.3111 0.5076 0.0008  -0.1106 0.0835  110 LYS A CA  
516  C C   . LYS A 109 ? 0.3391 0.2758 0.4735 -0.0010 -0.1162 0.0838  110 LYS A C   
517  O O   . LYS A 109 ? 0.3550 0.2896 0.4708 -0.0060 -0.1233 0.0870  110 LYS A O   
518  C CB  . LYS A 109 ? 0.3995 0.3278 0.5440 0.0012  -0.1201 0.0940  110 LYS A CB  
519  N N   . ASP A 110 ? 0.2845 0.2291 0.4455 0.0026  -0.1124 0.0796  111 ASP A N   
520  C CA  . ASP A 110 ? 0.3348 0.2863 0.5065 0.0007  -0.1176 0.0804  111 ASP A CA  
521  C C   . ASP A 110 ? 0.4189 0.3710 0.5707 -0.0025 -0.1129 0.0745  111 ASP A C   
522  O O   . ASP A 110 ? 0.3908 0.3450 0.5418 -0.0060 -0.1199 0.0768  111 ASP A O   
523  C CB  . ASP A 110 ? 0.3520 0.3141 0.5596 0.0052  -0.1138 0.0770  111 ASP A CB  
524  C CG  . ASP A 110 ? 0.4569 0.4190 0.6915 0.0081  -0.1224 0.0842  111 ASP A CG  
525  O OD1 . ASP A 110 ? 0.5013 0.4558 0.7256 0.0053  -0.1337 0.0944  111 ASP A OD1 
526  O OD2 . ASP A 110 ? 0.4187 0.3888 0.6852 0.0130  -0.1180 0.0796  111 ASP A OD2 
527  N N   . ALA A 111 ? 0.4317 0.3815 0.5689 -0.0015 -0.1018 0.0672  112 ALA A N   
528  C CA  . ALA A 111 ? 0.3857 0.3356 0.5073 -0.0043 -0.0976 0.0619  112 ALA A CA  
529  C C   . ALA A 111 ? 0.3088 0.2491 0.4015 -0.0077 -0.1020 0.0626  112 ALA A C   
530  O O   . ALA A 111 ? 0.3225 0.2611 0.4032 -0.0105 -0.1017 0.0590  112 ALA A O   
531  C CB  . ALA A 111 ? 0.2987 0.2522 0.4206 -0.0021 -0.0840 0.0541  112 ALA A CB  
532  N N   . LYS A 112 ? 0.2957 0.2305 0.3786 -0.0079 -0.1059 0.0670  113 LYS A N   
533  C CA  . LYS A 112 ? 0.3225 0.2501 0.3773 -0.0110 -0.1072 0.0659  113 LYS A CA  
534  C C   . LYS A 112 ? 0.3337 0.2597 0.3752 -0.0158 -0.1146 0.0645  113 LYS A C   
535  O O   . LYS A 112 ? 0.3724 0.2952 0.3997 -0.0167 -0.1105 0.0575  113 LYS A O   
536  C CB  . LYS A 112 ? 0.3391 0.2636 0.3878 -0.0120 -0.1120 0.0731  113 LYS A CB  
537  C CG  . LYS A 112 ? 0.2949 0.2146 0.3143 -0.0158 -0.1122 0.0716  113 LYS A CG  
538  C CD  . LYS A 112 ? 0.3076 0.2245 0.3151 -0.0135 -0.1004 0.0623  113 LYS A CD  
539  C CE  . LYS A 112 ? 0.3182 0.2321 0.3020 -0.0164 -0.0993 0.0619  113 LYS A CE  
540  N NZ  . LYS A 112 ? 0.3986 0.3123 0.3866 -0.0166 -0.1010 0.0707  113 LYS A NZ  
541  N N   . LYS A 113 ? 0.3464 0.2747 0.3943 -0.0189 -0.1259 0.0709  114 LYS A N   
542  C CA  . LYS A 113 ? 0.3870 0.3140 0.4234 -0.0240 -0.1341 0.0693  114 LYS A CA  
543  C C   . LYS A 113 ? 0.3130 0.2407 0.3548 -0.0239 -0.1306 0.0626  114 LYS A C   
544  O O   . LYS A 113 ? 0.3172 0.2402 0.3433 -0.0264 -0.1311 0.0563  114 LYS A O   
545  C CB  . LYS A 113 ? 0.4564 0.3869 0.5024 -0.0275 -0.1477 0.0784  114 LYS A CB  
546  N N   . ASP A 114 ? 0.3088 0.2429 0.3737 -0.0214 -0.1273 0.0638  115 ASP A N   
547  C CA  . ASP A 114 ? 0.3556 0.2914 0.4258 -0.0226 -0.1242 0.0593  115 ASP A CA  
548  C C   . ASP A 114 ? 0.3914 0.3227 0.4488 -0.0211 -0.1144 0.0524  115 ASP A C   
549  O O   . ASP A 114 ? 0.3682 0.2976 0.4238 -0.0232 -0.1140 0.0488  115 ASP A O   
550  C CB  . ASP A 114 ? 0.3494 0.2958 0.4467 -0.0211 -0.1212 0.0620  115 ASP A CB  
551  C CG  . ASP A 114 ? 0.4706 0.4223 0.5842 -0.0233 -0.1321 0.0683  115 ASP A CG  
552  O OD1 . ASP A 114 ? 0.4394 0.3861 0.5413 -0.0263 -0.1424 0.0712  115 ASP A OD1 
553  O OD2 . ASP A 114 ? 0.4823 0.4442 0.6201 -0.0224 -0.1304 0.0701  115 ASP A OD2 
554  N N   . TRP A 115 ? 0.3465 0.2757 0.3965 -0.0177 -0.1074 0.0513  116 TRP A N   
555  C CA  . TRP A 115 ? 0.2890 0.2144 0.3279 -0.0162 -0.0985 0.0454  116 TRP A CA  
556  C C   . TRP A 115 ? 0.2828 0.2000 0.3000 -0.0181 -0.1013 0.0405  116 TRP A C   
557  O O   . TRP A 115 ? 0.3179 0.2313 0.3302 -0.0188 -0.0996 0.0352  116 TRP A O   
558  C CB  . TRP A 115 ? 0.2713 0.1984 0.3126 -0.0121 -0.0896 0.0454  116 TRP A CB  
559  C CG  . TRP A 115 ? 0.3083 0.2319 0.3384 -0.0108 -0.0811 0.0400  116 TRP A CG  
560  C CD1 . TRP A 115 ? 0.2597 0.1788 0.2764 -0.0091 -0.0770 0.0380  116 TRP A CD1 
561  C CD2 . TRP A 115 ? 0.3189 0.2439 0.3513 -0.0116 -0.0763 0.0369  116 TRP A CD2 
562  N NE1 . TRP A 115 ? 0.2815 0.1990 0.2928 -0.0082 -0.0701 0.0333  116 TRP A NE1 
563  C CE2 . TRP A 115 ? 0.2847 0.2055 0.3054 -0.0098 -0.0699 0.0330  116 TRP A CE2 
564  C CE3 . TRP A 115 ? 0.2536 0.1836 0.2975 -0.0142 -0.0773 0.0380  116 TRP A CE3 
565  C CZ2 . TRP A 115 ? 0.2513 0.1724 0.2719 -0.0105 -0.0653 0.0306  116 TRP A CZ2 
566  C CZ3 . TRP A 115 ? 0.2491 0.1795 0.2918 -0.0156 -0.0726 0.0362  116 TRP A CZ3 
567  C CH2 . TRP A 115 ? 0.2778 0.2035 0.3091 -0.0136 -0.0671 0.0327  116 TRP A CH2 
568  N N   . TYR A 116 ? 0.2984 0.2134 0.3034 -0.0192 -0.1057 0.0422  117 TYR A N   
569  C CA  . TYR A 116 ? 0.3403 0.2497 0.3243 -0.0212 -0.1064 0.0356  117 TYR A CA  
570  C C   . TYR A 116 ? 0.3773 0.2845 0.3588 -0.0252 -0.1149 0.0320  117 TYR A C   
571  O O   . TYR A 116 ? 0.4326 0.3350 0.4018 -0.0264 -0.1147 0.0236  117 TYR A O   
572  C CB  . TYR A 116 ? 0.3191 0.2284 0.2875 -0.0223 -0.1068 0.0378  117 TYR A CB  
573  C CG  . TYR A 116 ? 0.3910 0.3031 0.3574 -0.0264 -0.1173 0.0454  117 TYR A CG  
574  C CD1 . TYR A 116 ? 0.4611 0.3730 0.4193 -0.0316 -0.1267 0.0435  117 TYR A CD1 
575  C CD2 . TYR A 116 ? 0.4487 0.3635 0.4214 -0.0257 -0.1185 0.0547  117 TYR A CD2 
576  C CE1 . TYR A 116 ? 0.4485 0.3636 0.4037 -0.0363 -0.1373 0.0515  117 TYR A CE1 
577  C CE2 . TYR A 116 ? 0.4692 0.3866 0.4410 -0.0300 -0.1293 0.0634  117 TYR A CE2 
578  C CZ  . TYR A 116 ? 0.5038 0.4218 0.4661 -0.0355 -0.1388 0.0622  117 TYR A CZ  
579  O OH  . TYR A 116 ? 0.4931 0.4144 0.4541 -0.0407 -0.1506 0.0719  117 TYR A OH  
580  N N   . ASN A 117 ? 0.3820 0.2929 0.3774 -0.0272 -0.1223 0.0376  118 ASN A N   
581  C CA  . ASN A 117 ? 0.4476 0.3565 0.4446 -0.0313 -0.1308 0.0346  118 ASN A CA  
582  C C   . ASN A 117 ? 0.4188 0.3262 0.4281 -0.0306 -0.1278 0.0317  118 ASN A C   
583  O O   . ASN A 117 ? 0.3930 0.2970 0.4039 -0.0339 -0.1344 0.0282  118 ASN A O   
584  C CB  . ASN A 117 ? 0.4039 0.3179 0.4118 -0.0344 -0.1410 0.0424  118 ASN A CB  
585  C CG  . ASN A 117 ? 0.4402 0.3545 0.4326 -0.0381 -0.1488 0.0447  118 ASN A CG  
586  O OD1 . ASN A 117 ? 0.4999 0.4105 0.4710 -0.0401 -0.1481 0.0380  118 ASN A OD1 
587  N ND2 . ASN A 117 ? 0.4319 0.3514 0.4353 -0.0396 -0.1565 0.0543  118 ASN A ND2 
588  N N   . LEU A 118 ? 0.4014 0.3117 0.4199 -0.0272 -0.1188 0.0337  119 LEU A N   
589  C CA  . LEU A 118 ? 0.3565 0.2659 0.3844 -0.0277 -0.1161 0.0322  119 LEU A CA  
590  C C   . LEU A 118 ? 0.3764 0.2770 0.3914 -0.0271 -0.1143 0.0237  119 LEU A C   
591  O O   . LEU A 118 ? 0.3848 0.2835 0.3879 -0.0241 -0.1083 0.0203  119 LEU A O   
592  C CB  . LEU A 118 ? 0.3172 0.2338 0.3560 -0.0252 -0.1067 0.0363  119 LEU A CB  
593  C CG  . LEU A 118 ? 0.3418 0.2602 0.3906 -0.0273 -0.1041 0.0373  119 LEU A CG  
594  C CD1 . LEU A 118 ? 0.3682 0.2908 0.4317 -0.0319 -0.1117 0.0416  119 LEU A CD1 
595  C CD2 . LEU A 118 ? 0.3019 0.2284 0.3568 -0.0253 -0.0939 0.0399  119 LEU A CD2 
596  N N   . PRO A 119 ? 0.3094 0.2046 0.3285 -0.0298 -0.1200 0.0199  120 PRO A N   
597  C CA  . PRO A 119 ? 0.3181 0.2047 0.3278 -0.0289 -0.1195 0.0102  120 PRO A CA  
598  C C   . PRO A 119 ? 0.3524 0.2382 0.3609 -0.0251 -0.1100 0.0094  120 PRO A C   
599  O O   . PRO A 119 ? 0.3405 0.2313 0.3588 -0.0248 -0.1055 0.0162  120 PRO A O   
600  C CB  . PRO A 119 ? 0.3438 0.2253 0.3656 -0.0325 -0.1273 0.0087  120 PRO A CB  
601  C CG  . PRO A 119 ? 0.3386 0.2259 0.3697 -0.0362 -0.1340 0.0159  120 PRO A CG  
602  C CD  . PRO A 119 ? 0.3083 0.2053 0.3425 -0.0341 -0.1273 0.0241  120 PRO A CD  
603  N N   . PHE A 120 ? 0.3367 0.2176 0.3334 -0.0227 -0.1069 0.0007  121 PHE A N   
604  C CA  . PHE A 120 ? 0.3297 0.2097 0.3252 -0.0191 -0.0987 -0.0009 121 PHE A CA  
605  C C   . PHE A 120 ? 0.3694 0.2476 0.3800 -0.0199 -0.0990 0.0030  121 PHE A C   
606  O O   . PHE A 120 ? 0.3726 0.2545 0.3859 -0.0185 -0.0926 0.0077  121 PHE A O   
607  C CB  . PHE A 120 ? 0.3405 0.2154 0.3244 -0.0171 -0.0969 -0.0126 121 PHE A CB  
608  C CG  . PHE A 120 ? 0.3685 0.2414 0.3553 -0.0136 -0.0902 -0.0151 121 PHE A CG  
609  C CD1 . PHE A 120 ? 0.3760 0.2538 0.3581 -0.0112 -0.0820 -0.0106 121 PHE A CD1 
610  C CD2 . PHE A 120 ? 0.3898 0.2557 0.3860 -0.0129 -0.0930 -0.0217 121 PHE A CD2 
611  C CE1 . PHE A 120 ? 0.3972 0.2736 0.3823 -0.0084 -0.0765 -0.0125 121 PHE A CE1 
612  C CE2 . PHE A 120 ? 0.3666 0.2309 0.3675 -0.0098 -0.0879 -0.0232 121 PHE A CE2 
613  C CZ  . PHE A 120 ? 0.3207 0.1906 0.3154 -0.0077 -0.0796 -0.0184 121 PHE A CZ  
614  N N   . TYR A 121 ? 0.3485 0.2215 0.3687 -0.0229 -0.1072 0.0015  122 TYR A N   
615  C CA  . TYR A 121 ? 0.3716 0.2430 0.4072 -0.0252 -0.1096 0.0071  122 TYR A CA  
616  C C   . TYR A 121 ? 0.3394 0.2213 0.3806 -0.0273 -0.1051 0.0187  122 TYR A C   
617  O O   . TYR A 121 ? 0.2872 0.1717 0.3331 -0.0278 -0.1012 0.0235  122 TYR A O   
618  C CB  . TYR A 121 ? 0.3324 0.1975 0.3792 -0.0293 -0.1204 0.0058  122 TYR A CB  
619  C CG  . TYR A 121 ? 0.3306 0.1940 0.3945 -0.0329 -0.1243 0.0134  122 TYR A CG  
620  C CD1 . TYR A 121 ? 0.3329 0.1886 0.4036 -0.0313 -0.1254 0.0104  122 TYR A CD1 
621  C CD2 . TYR A 121 ? 0.2936 0.1642 0.3678 -0.0383 -0.1271 0.0245  122 TYR A CD2 
622  C CE1 . TYR A 121 ? 0.3463 0.2005 0.4333 -0.0357 -0.1304 0.0196  122 TYR A CE1 
623  C CE2 . TYR A 121 ? 0.3447 0.2152 0.4336 -0.0431 -0.1310 0.0332  122 TYR A CE2 
624  C CZ  . TYR A 121 ? 0.3522 0.2141 0.4472 -0.0421 -0.1333 0.0315  122 TYR A CZ  
625  O OH  . TYR A 121 ? 0.3203 0.1823 0.4305 -0.0480 -0.1386 0.0421  122 TYR A OH  
626  N N   . ASP A 122 ? 0.3401 0.2289 0.3812 -0.0286 -0.1057 0.0225  123 ASP A N   
627  C CA  . ASP A 122 ? 0.3289 0.2291 0.3778 -0.0307 -0.1014 0.0315  123 ASP A CA  
628  C C   . ASP A 122 ? 0.3178 0.2238 0.3595 -0.0269 -0.0913 0.0318  123 ASP A C   
629  O O   . ASP A 122 ? 0.3327 0.2464 0.3793 -0.0283 -0.0856 0.0366  123 ASP A O   
630  C CB  . ASP A 122 ? 0.3129 0.2189 0.3684 -0.0331 -0.1062 0.0349  123 ASP A CB  
631  C CG  . ASP A 122 ? 0.3735 0.2747 0.4383 -0.0378 -0.1165 0.0356  123 ASP A CG  
632  O OD1 . ASP A 122 ? 0.3768 0.2714 0.4365 -0.0377 -0.1234 0.0299  123 ASP A OD1 
633  O OD2 . ASP A 122 ? 0.4365 0.3406 0.5132 -0.0423 -0.1181 0.0418  123 ASP A OD2 
634  N N   . ARG A 123 ? 0.2724 0.1754 0.3023 -0.0229 -0.0892 0.0267  124 ARG A N   
635  C CA  . ARG A 123 ? 0.3404 0.2472 0.3638 -0.0193 -0.0802 0.0265  124 ARG A CA  
636  C C   . ARG A 123 ? 0.3533 0.2586 0.3758 -0.0187 -0.0754 0.0258  124 ARG A C   
637  O O   . ARG A 123 ? 0.3906 0.3030 0.4157 -0.0190 -0.0690 0.0292  124 ARG A O   
638  C CB  . ARG A 123 ? 0.3195 0.2225 0.3298 -0.0161 -0.0797 0.0218  124 ARG A CB  
639  C CG  . ARG A 123 ? 0.3545 0.2588 0.3646 -0.0173 -0.0861 0.0235  124 ARG A CG  
640  C CD  . ARG A 123 ? 0.3347 0.2392 0.3337 -0.0151 -0.0840 0.0229  124 ARG A CD  
641  N NE  . ARG A 123 ? 0.3706 0.2693 0.3546 -0.0139 -0.0821 0.0161  124 ARG A NE  
642  C CZ  . ARG A 123 ? 0.3916 0.2865 0.3649 -0.0157 -0.0873 0.0107  124 ARG A CZ  
643  N NH1 . ARG A 123 ? 0.3607 0.2558 0.3359 -0.0189 -0.0959 0.0121  124 ARG A NH1 
644  N NH2 . ARG A 123 ? 0.3663 0.2581 0.3270 -0.0145 -0.0838 0.0034  124 ARG A NH2 
645  N N   . SER A 124 ? 0.3626 0.2591 0.3824 -0.0182 -0.0789 0.0209  125 SER A N   
646  C CA  . SER A 124 ? 0.3344 0.2286 0.3564 -0.0179 -0.0765 0.0210  125 SER A CA  
647  C C   . SER A 124 ? 0.3440 0.2446 0.3767 -0.0228 -0.0769 0.0297  125 SER A C   
648  O O   . SER A 124 ? 0.3053 0.2109 0.3374 -0.0234 -0.0715 0.0328  125 SER A O   
649  C CB  . SER A 124 ? 0.3741 0.2579 0.3979 -0.0171 -0.0823 0.0145  125 SER A CB  
650  O OG  . SER A 124 ? 0.3964 0.2763 0.4088 -0.0133 -0.0806 0.0055  125 SER A OG  
651  N N   . ALA A 125 ? 0.3302 0.2315 0.3723 -0.0272 -0.0836 0.0337  126 ALA A N   
652  C CA  . ALA A 125 ? 0.3157 0.2241 0.3683 -0.0335 -0.0851 0.0429  126 ALA A CA  
653  C C   . ALA A 125 ? 0.2649 0.1871 0.3159 -0.0350 -0.0760 0.0472  126 ALA A C   
654  O O   . ALA A 125 ? 0.3056 0.2342 0.3589 -0.0394 -0.0739 0.0530  126 ALA A O   
655  C CB  . ALA A 125 ? 0.2537 0.1626 0.3168 -0.0381 -0.0930 0.0467  126 ALA A CB  
656  N N   . ILE A 126 ? 0.2596 0.1868 0.3073 -0.0319 -0.0713 0.0442  127 ILE A N   
657  C CA  . ILE A 126 ? 0.2481 0.1880 0.2962 -0.0323 -0.0624 0.0455  127 ILE A CA  
658  C C   . ILE A 126 ? 0.2777 0.2177 0.3177 -0.0308 -0.0561 0.0438  127 ILE A C   
659  O O   . ILE A 126 ? 0.3139 0.2643 0.3551 -0.0348 -0.0510 0.0470  127 ILE A O   
660  C CB  . ILE A 126 ? 0.2261 0.1678 0.2740 -0.0278 -0.0600 0.0417  127 ILE A CB  
661  C CG1 . ILE A 126 ? 0.2472 0.1931 0.3059 -0.0305 -0.0655 0.0447  127 ILE A CG1 
662  C CG2 . ILE A 126 ? 0.2693 0.2210 0.3172 -0.0262 -0.0501 0.0399  127 ILE A CG2 
663  C CD1 . ILE A 126 ? 0.2477 0.1914 0.3065 -0.0262 -0.0675 0.0419  127 ILE A CD1 
664  N N   . PHE A 127 ? 0.3234 0.2528 0.3550 -0.0256 -0.0566 0.0386  128 PHE A N   
665  C CA  . PHE A 127 ? 0.3437 0.2725 0.3685 -0.0239 -0.0512 0.0369  128 PHE A CA  
666  C C   . PHE A 127 ? 0.3408 0.2684 0.3682 -0.0279 -0.0545 0.0414  128 PHE A C   
667  O O   . PHE A 127 ? 0.3459 0.2791 0.3706 -0.0298 -0.0501 0.0434  128 PHE A O   
668  C CB  . PHE A 127 ? 0.3082 0.2282 0.3242 -0.0176 -0.0499 0.0301  128 PHE A CB  
669  C CG  . PHE A 127 ? 0.3325 0.2555 0.3460 -0.0146 -0.0461 0.0278  128 PHE A CG  
670  C CD1 . PHE A 127 ? 0.3002 0.2290 0.3121 -0.0132 -0.0386 0.0268  128 PHE A CD1 
671  C CD2 . PHE A 127 ? 0.3558 0.2759 0.3702 -0.0135 -0.0508 0.0271  128 PHE A CD2 
672  C CE1 . PHE A 127 ? 0.3419 0.2728 0.3551 -0.0105 -0.0362 0.0254  128 PHE A CE1 
673  C CE2 . PHE A 127 ? 0.3019 0.2248 0.3164 -0.0112 -0.0487 0.0266  128 PHE A CE2 
674  C CZ  . PHE A 127 ? 0.3804 0.3084 0.3954 -0.0094 -0.0415 0.0259  128 PHE A CZ  
675  N N   . LEU A 128 ? 0.3267 0.2468 0.3605 -0.0296 -0.0630 0.0434  129 LEU A N   
676  C CA  . LEU A 128 ? 0.2357 0.1542 0.2757 -0.0342 -0.0681 0.0497  129 LEU A CA  
677  C C   . LEU A 128 ? 0.3436 0.2758 0.3873 -0.0426 -0.0668 0.0591  129 LEU A C   
678  O O   . LEU A 128 ? 0.3425 0.2801 0.3852 -0.0469 -0.0658 0.0646  129 LEU A O   
679  C CB  . LEU A 128 ? 0.2813 0.1881 0.3305 -0.0342 -0.0783 0.0491  129 LEU A CB  
680  C CG  . LEU A 128 ? 0.3491 0.2438 0.3948 -0.0268 -0.0793 0.0383  129 LEU A CG  
681  C CD1 . LEU A 128 ? 0.2891 0.1728 0.3451 -0.0269 -0.0892 0.0355  129 LEU A CD1 
682  C CD2 . LEU A 128 ? 0.3302 0.2229 0.3729 -0.0236 -0.0757 0.0359  129 LEU A CD2 
683  N N   . LYS A 129 ? 0.3169 0.2559 0.3650 -0.0454 -0.0668 0.0611  130 LYS A N   
684  C CA  . LYS A 129 ? 0.3185 0.2734 0.3699 -0.0538 -0.0640 0.0687  130 LYS A CA  
685  C C   . LYS A 129 ? 0.2745 0.2414 0.3177 -0.0543 -0.0537 0.0666  130 LYS A C   
686  O O   . LYS A 129 ? 0.2964 0.2737 0.3381 -0.0618 -0.0522 0.0730  130 LYS A O   
687  C CB  . LYS A 129 ? 0.3164 0.2780 0.3750 -0.0553 -0.0642 0.0691  130 LYS A CB  
688  C CG  . LYS A 129 ? 0.4141 0.3933 0.4784 -0.0653 -0.0620 0.0775  130 LYS A CG  
689  C CD  . LYS A 129 ? 0.5488 0.5289 0.6249 -0.0697 -0.0691 0.0828  130 LYS A CD  
690  C CE  . LYS A 129 ? 0.6066 0.6057 0.6883 -0.0810 -0.0669 0.0923  130 LYS A CE  
691  N NZ  . LYS A 129 ? 0.5371 0.5432 0.6117 -0.0876 -0.0649 0.0986  130 LYS A NZ  
692  N N   . ALA A 130 ? 0.2430 0.2085 0.2810 -0.0471 -0.0471 0.0577  131 ALA A N   
693  C CA  . ALA A 130 ? 0.2845 0.2601 0.3162 -0.0471 -0.0375 0.0540  131 ALA A CA  
694  C C   . ALA A 130 ? 0.2875 0.2609 0.3123 -0.0490 -0.0379 0.0564  131 ALA A C   
695  O O   . ALA A 130 ? 0.3000 0.2857 0.3209 -0.0549 -0.0333 0.0586  131 ALA A O   
696  C CB  . ALA A 130 ? 0.2142 0.1860 0.2438 -0.0388 -0.0322 0.0450  131 ALA A CB  
697  N N   . ALA A 131 ? 0.3076 0.2665 0.3316 -0.0445 -0.0436 0.0557  132 ALA A N   
698  C CA  . ALA A 131 ? 0.3874 0.3438 0.4081 -0.0461 -0.0455 0.0587  132 ALA A CA  
699  C C   . ALA A 131 ? 0.3727 0.3367 0.3974 -0.0563 -0.0510 0.0701  132 ALA A C   
700  O O   . ALA A 131 ? 0.3560 0.3280 0.3758 -0.0616 -0.0493 0.0743  132 ALA A O   
701  C CB  . ALA A 131 ? 0.3447 0.2850 0.3672 -0.0394 -0.0508 0.0551  132 ALA A CB  
702  N N   . ASP A 132 ? 0.3210 0.2829 0.3545 -0.0598 -0.0580 0.0760  133 ASP A N   
703  C CA  . ASP A 132 ? 0.3433 0.3124 0.3815 -0.0704 -0.0642 0.0886  133 ASP A CA  
704  C C   . ASP A 132 ? 0.3604 0.3506 0.3928 -0.0795 -0.0569 0.0924  133 ASP A C   
705  O O   . ASP A 132 ? 0.3856 0.3858 0.4149 -0.0887 -0.0585 0.1014  133 ASP A O   
706  C CB  . ASP A 132 ? 0.4868 0.4475 0.5376 -0.0724 -0.0747 0.0945  133 ASP A CB  
707  C CG  . ASP A 132 ? 0.6794 0.6425 0.7376 -0.0827 -0.0843 0.1091  133 ASP A CG  
708  O OD1 . ASP A 132 ? 0.7429 0.6960 0.8056 -0.0814 -0.0911 0.1121  133 ASP A OD1 
709  O OD2 . ASP A 132 ? 0.7093 0.6850 0.7697 -0.0925 -0.0852 0.1182  133 ASP A OD2 
710  N N   . LEU A 133 ? 0.2378 0.2360 0.2696 -0.0772 -0.0490 0.0854  134 LEU A N   
711  C CA  . LEU A 133 ? 0.2753 0.2949 0.3033 -0.0848 -0.0403 0.0857  134 LEU A CA  
712  C C   . LEU A 133 ? 0.2933 0.3202 0.3099 -0.0859 -0.0333 0.0816  134 LEU A C   
713  O O   . LEU A 133 ? 0.3094 0.3531 0.3203 -0.0960 -0.0302 0.0864  134 LEU A O   
714  C CB  . LEU A 133 ? 0.2689 0.2940 0.3019 -0.0800 -0.0331 0.0769  134 LEU A CB  
715  C CG  . LEU A 133 ? 0.2968 0.3218 0.3413 -0.0820 -0.0384 0.0814  134 LEU A CG  
716  C CD1 . LEU A 133 ? 0.2850 0.3125 0.3359 -0.0752 -0.0327 0.0722  134 LEU A CD1 
717  C CD2 . LEU A 133 ? 0.3658 0.4091 0.4129 -0.0954 -0.0388 0.0920  134 LEU A CD2 
718  N N   . ILE A 134 ? 0.2863 0.3013 0.2993 -0.0760 -0.0310 0.0728  135 ILE A N   
719  C CA  . ILE A 134 ? 0.2528 0.2727 0.2560 -0.0763 -0.0251 0.0683  135 ILE A CA  
720  C C   . ILE A 134 ? 0.3849 0.4044 0.3842 -0.0833 -0.0324 0.0787  135 ILE A C   
721  O O   . ILE A 134 ? 0.4015 0.4339 0.3921 -0.0905 -0.0287 0.0799  135 ILE A O   
722  C CB  . ILE A 134 ? 0.3346 0.3417 0.3360 -0.0645 -0.0214 0.0574  135 ILE A CB  
723  C CG1 . ILE A 134 ? 0.3017 0.3139 0.3066 -0.0597 -0.0131 0.0476  135 ILE A CG1 
724  C CG2 . ILE A 134 ? 0.2519 0.2603 0.2443 -0.0651 -0.0185 0.0550  135 ILE A CG2 
725  C CD1 . ILE A 134 ? 0.2557 0.2533 0.2617 -0.0484 -0.0121 0.0397  135 ILE A CD1 
726  N N   . SER A 135 ? 0.2967 0.3021 0.3034 -0.0819 -0.0432 0.0860  136 SER A N   
727  C CA  . SER A 135 ? 0.3197 0.3230 0.3268 -0.0878 -0.0519 0.0967  136 SER A CA  
728  C C   . SER A 135 ? 0.3759 0.3951 0.3818 -0.1023 -0.0557 0.1102  136 SER A C   
729  O O   . SER A 135 ? 0.4125 0.4358 0.4154 -0.1099 -0.0613 0.1197  136 SER A O   
730  C CB  . SER A 135 ? 0.3629 0.3467 0.3820 -0.0816 -0.0625 0.0995  136 SER A CB  
731  O OG  . SER A 135 ? 0.4207 0.3919 0.4393 -0.0695 -0.0588 0.0875  136 SER A OG  
732  N N   . THR A 136 ? 0.3024 0.3313 0.3110 -0.1069 -0.0531 0.1117  137 THR A N   
733  C CA  . THR A 136 ? 0.3178 0.3620 0.3263 -0.1215 -0.0573 0.1258  137 THR A CA  
734  C C   . THR A 136 ? 0.3135 0.3816 0.3142 -0.1288 -0.0454 0.1215  137 THR A C   
735  O O   . THR A 136 ? 0.3418 0.4259 0.3305 -0.1363 -0.0396 0.1209  137 THR A O   
736  C CB  . THR A 136 ? 0.3323 0.3665 0.3558 -0.1229 -0.0684 0.1355  137 THR A CB  
737  O OG1 . THR A 136 ? 0.3523 0.3821 0.3814 -0.1149 -0.0636 0.1256  137 THR A OG1 
738  C CG2 . THR A 136 ? 0.2976 0.3101 0.3308 -0.1169 -0.0804 0.1393  137 THR A CG2 
739  N N   . LYS A 137 ? 0.3554 0.4262 0.3637 -0.1266 -0.0420 0.1178  138 LYS A N   
740  C CA  . LYS A 137 ? 0.3592 0.4533 0.3647 -0.1331 -0.0308 0.1132  138 LYS A CA  
741  C C   . LYS A 137 ? 0.3819 0.4874 0.3770 -0.1306 -0.0176 0.0988  138 LYS A C   
742  O O   . LYS A 137 ? 0.3857 0.5145 0.3732 -0.1409 -0.0097 0.0977  138 LYS A O   
743  C CB  . LYS A 137 ? 0.3604 0.4506 0.3787 -0.1267 -0.0293 0.1082  138 LYS A CB  
744  C CG  . LYS A 137 ? 0.4009 0.5155 0.4213 -0.1330 -0.0185 0.1038  138 LYS A CG  
745  C CD  . LYS A 137 ? 0.4292 0.5386 0.4647 -0.1286 -0.0212 0.1036  138 LYS A CD  
746  C CE  . LYS A 137 ? 0.4563 0.5892 0.4979 -0.1325 -0.0098 0.0970  138 LYS A CE  
747  N NZ  . LYS A 137 ? 0.4725 0.6012 0.5298 -0.1301 -0.0144 0.0997  138 LYS A NZ  
748  N N   . TYR A 138 ? 0.3246 0.4145 0.3199 -0.1174 -0.0152 0.0874  139 TYR A N   
749  C CA  . TYR A 138 ? 0.3181 0.4163 0.3070 -0.1138 -0.0033 0.0728  139 TYR A CA  
750  C C   . TYR A 138 ? 0.3111 0.4019 0.2899 -0.1123 -0.0052 0.0719  139 TYR A C   
751  O O   . TYR A 138 ? 0.3521 0.4420 0.3274 -0.1062 0.0022  0.0596  139 TYR A O   
752  C CB  . TYR A 138 ? 0.3157 0.4041 0.3144 -0.1004 0.0018  0.0600  139 TYR A CB  
753  C CG  . TYR A 138 ? 0.4084 0.5069 0.4185 -0.1019 0.0048  0.0593  139 TYR A CG  
754  C CD1 . TYR A 138 ? 0.5502 0.6742 0.5601 -0.1116 0.0136  0.0570  139 TYR A CD1 
755  C CD2 . TYR A 138 ? 0.4024 0.4862 0.4237 -0.0942 -0.0011 0.0607  139 TYR A CD2 
756  C CE1 . TYR A 138 ? 0.5531 0.6878 0.5754 -0.1131 0.0165  0.0565  139 TYR A CE1 
757  C CE2 . TYR A 138 ? 0.4140 0.5074 0.4470 -0.0958 0.0009  0.0606  139 TYR A CE2 
758  C CZ  . TYR A 138 ? 0.5099 0.6287 0.5443 -0.1050 0.0097  0.0588  139 TYR A CZ  
759  O OH  . TYR A 138 ? 0.5755 0.7049 0.6233 -0.1066 0.0119  0.0586  139 TYR A OH  
760  N N   . ARG A 139 ? 0.3854 0.4708 0.3613 -0.1183 -0.0159 0.0856  140 ARG A N   
761  C CA  . ARG A 139 ? 0.4089 0.4864 0.3775 -0.1168 -0.0194 0.0862  140 ARG A CA  
762  C C   . ARG A 139 ? 0.3854 0.4807 0.3410 -0.1231 -0.0100 0.0786  140 ARG A C   
763  O O   . ARG A 139 ? 0.2927 0.3820 0.2447 -0.1164 -0.0060 0.0687  140 ARG A O   
764  C CB  . ARG A 139 ? 0.4473 0.5198 0.4174 -0.1243 -0.0330 0.1036  140 ARG A CB  
765  C CG  . ARG A 139 ? 0.4470 0.5083 0.4143 -0.1208 -0.0384 0.1048  140 ARG A CG  
766  C CD  . ARG A 139 ? 0.4725 0.5342 0.4418 -0.1311 -0.0517 0.1229  140 ARG A CD  
767  N NE  . ARG A 139 ? 0.5281 0.5756 0.5004 -0.1251 -0.0581 0.1236  140 ARG A NE  
768  C CZ  . ARG A 139 ? 0.6014 0.6285 0.5876 -0.1153 -0.0658 0.1245  140 ARG A CZ  
769  N NH1 . ARG A 139 ? 0.6573 0.6741 0.6472 -0.1101 -0.0704 0.1240  140 ARG A NH1 
770  N NH2 . ARG A 139 ? 0.5254 0.5432 0.5226 -0.1109 -0.0687 0.1250  140 ARG A NH2 
771  N N   . TYR A 140 ? 0.3643 0.4827 0.3128 -0.1367 -0.0063 0.0826  141 TYR A N   
772  C CA  . TYR A 140 ? 0.4017 0.5385 0.3364 -0.1445 0.0017  0.0754  141 TYR A CA  
773  C C   . TYR A 140 ? 0.3410 0.4828 0.2778 -0.1367 0.0157  0.0549  141 TYR A C   
774  O O   . TYR A 140 ? 0.3521 0.4961 0.2817 -0.1355 0.0208  0.0448  141 TYR A O   
775  C CB  . TYR A 140 ? 0.3896 0.5513 0.3142 -0.1631 0.0011  0.0866  141 TYR A CB  
776  C CG  . TYR A 140 ? 0.4809 0.6349 0.4051 -0.1703 -0.0146 0.1075  141 TYR A CG  
777  C CD1 . TYR A 140 ? 0.5471 0.6946 0.4645 -0.1719 -0.0217 0.1126  141 TYR A CD1 
778  C CD2 . TYR A 140 ? 0.5819 0.7335 0.5155 -0.1748 -0.0231 0.1222  141 TYR A CD2 
779  C CE1 . TYR A 140 ? 0.6419 0.7809 0.5637 -0.1762 -0.0374 0.1304  141 TYR A CE1 
780  C CE2 . TYR A 140 ? 0.6447 0.7862 0.5831 -0.1774 -0.0393 0.1382  141 TYR A CE2 
781  C CZ  . TYR A 140 ? 0.7119 0.8474 0.6455 -0.1776 -0.0464 0.1418  141 TYR A CZ  
782  O OH  . TYR A 140 ? 0.7973 0.9238 0.7398 -0.1793 -0.0628 0.1562  141 TYR A OH  
783  N N   . ASP A 141 ? 0.3419 0.4843 0.2905 -0.1310 0.0208  0.0490  142 ASP A N   
784  C CA  . ASP A 141 ? 0.3244 0.4697 0.2796 -0.1225 0.0325  0.0303  142 ASP A CA  
785  C C   . ASP A 141 ? 0.3295 0.4517 0.2886 -0.1085 0.0306  0.0234  142 ASP A C   
786  O O   . ASP A 141 ? 0.3079 0.4321 0.2665 -0.1045 0.0382  0.0097  142 ASP A O   
787  C CB  . ASP A 141 ? 0.3194 0.4686 0.2891 -0.1188 0.0364  0.0273  142 ASP A CB  
788  C CG  . ASP A 141 ? 0.4045 0.5808 0.3719 -0.1325 0.0419  0.0301  142 ASP A CG  
789  O OD1 . ASP A 141 ? 0.4658 0.6624 0.4208 -0.1435 0.0479  0.0267  142 ASP A OD1 
790  O OD2 . ASP A 141 ? 0.4815 0.6599 0.4595 -0.1328 0.0402  0.0356  142 ASP A OD2 
791  N N   . MET A 142 ? 0.2486 0.3497 0.2126 -0.1013 0.0208  0.0323  143 MET A N   
792  C CA  . MET A 142 ? 0.2524 0.3333 0.2195 -0.0890 0.0192  0.0267  143 MET A CA  
793  C C   . MET A 142 ? 0.2881 0.3679 0.2445 -0.0915 0.0183  0.0257  143 MET A C   
794  O O   . MET A 142 ? 0.2949 0.3691 0.2519 -0.0849 0.0230  0.0151  143 MET A O   
795  C CB  . MET A 142 ? 0.2785 0.3392 0.2523 -0.0819 0.0093  0.0354  143 MET A CB  
796  C CG  . MET A 142 ? 0.2343 0.2763 0.2098 -0.0706 0.0081  0.0301  143 MET A CG  
797  S SD  . MET A 142 ? 0.3661 0.4062 0.3501 -0.0607 0.0173  0.0149  143 MET A SD  
798  C CE  . MET A 142 ? 0.2905 0.3196 0.2857 -0.0540 0.0123  0.0188  143 MET A CE  
799  N N   . LEU A 143 ? 0.3043 0.3896 0.2520 -0.1014 0.0117  0.0375  144 LEU A N   
800  C CA  . LEU A 143 ? 0.3392 0.4257 0.2768 -0.1052 0.0101  0.0376  144 LEU A CA  
801  C C   . LEU A 143 ? 0.2808 0.3829 0.2119 -0.1087 0.0213  0.0230  144 LEU A C   
802  O O   . LEU A 143 ? 0.3347 0.4307 0.2641 -0.1040 0.0236  0.0147  144 LEU A O   
803  C CB  . LEU A 143 ? 0.3761 0.4701 0.3059 -0.1177 0.0008  0.0535  144 LEU A CB  
804  C CG  . LEU A 143 ? 0.3893 0.4665 0.3272 -0.1146 -0.0121 0.0678  144 LEU A CG  
805  C CD1 . LEU A 143 ? 0.3632 0.4512 0.2962 -0.1289 -0.0213 0.0847  144 LEU A CD1 
806  C CD2 . LEU A 143 ? 0.2990 0.3586 0.2399 -0.1052 -0.0160 0.0655  144 LEU A CD2 
807  N N   . ALA A 144 ? 0.2777 0.4004 0.2065 -0.1170 0.0283  0.0194  145 ALA A N   
808  C CA  . ALA A 144 ? 0.3431 0.4836 0.2664 -0.1216 0.0397  0.0039  145 ALA A CA  
809  C C   . ALA A 144 ? 0.2657 0.3965 0.2014 -0.1086 0.0472  -0.0128 145 ALA A C   
810  O O   . ALA A 144 ? 0.3399 0.4720 0.2727 -0.1075 0.0520  -0.0244 145 ALA A O   
811  C CB  . ALA A 144 ? 0.2844 0.4507 0.2040 -0.1334 0.0464  0.0029  145 ALA A CB  
812  N N   . ALA A 145 ? 0.2564 0.3770 0.2063 -0.0991 0.0473  -0.0132 146 ALA A N   
813  C CA  . ALA A 145 ? 0.2851 0.3955 0.2487 -0.0869 0.0526  -0.0265 146 ALA A CA  
814  C C   . ALA A 145 ? 0.2696 0.3608 0.2317 -0.0794 0.0482  -0.0271 146 ALA A C   
815  O O   . ALA A 145 ? 0.2981 0.3861 0.2660 -0.0741 0.0534  -0.0395 146 ALA A O   
816  C CB  . ALA A 145 ? 0.2404 0.3423 0.2187 -0.0789 0.0509  -0.0237 146 ALA A CB  
817  N N   . THR A 146 ? 0.3255 0.4044 0.2817 -0.0790 0.0386  -0.0137 147 THR A N   
818  C CA  . THR A 146 ? 0.2776 0.3390 0.2335 -0.0719 0.0345  -0.0134 147 THR A CA  
819  C C   . THR A 146 ? 0.3366 0.4058 0.2819 -0.0787 0.0360  -0.0176 147 THR A C   
820  O O   . THR A 146 ? 0.2940 0.3558 0.2417 -0.0737 0.0382  -0.0256 147 THR A O   
821  C CB  . THR A 146 ? 0.2766 0.3232 0.2322 -0.0688 0.0243  0.0006  147 THR A CB  
822  O OG1 . THR A 146 ? 0.3122 0.3497 0.2778 -0.0614 0.0230  0.0021  147 THR A OG1 
823  C CG2 . THR A 146 ? 0.2727 0.3053 0.2272 -0.0634 0.0207  0.0011  147 THR A CG2 
824  N N   . MET A 147 ? 0.3339 0.4186 0.2677 -0.0909 0.0344  -0.0116 148 MET A N   
825  C CA  . MET A 147 ? 0.3523 0.4462 0.2742 -0.0991 0.0347  -0.0143 148 MET A CA  
826  C C   . MET A 147 ? 0.3984 0.5023 0.3219 -0.0993 0.0455  -0.0330 148 MET A C   
827  O O   . MET A 147 ? 0.3058 0.4046 0.2288 -0.0970 0.0466  -0.0406 148 MET A O   
828  C CB  . MET A 147 ? 0.3039 0.4155 0.2127 -0.1139 0.0309  -0.0036 148 MET A CB  
829  C CG  . MET A 147 ? 0.3565 0.4581 0.2645 -0.1153 0.0182  0.0154  148 MET A CG  
830  S SD  . MET A 147 ? 0.3671 0.4892 0.2629 -0.1332 0.0125  0.0308  148 MET A SD  
831  C CE  . MET A 147 ? 0.3008 0.4413 0.1793 -0.1457 0.0154  0.0245  148 MET A CE  
832  N N   . LEU A 148 ? 0.2699 0.3887 0.1970 -0.1021 0.0535  -0.0408 149 LEU A N   
833  C CA  . LEU A 148 ? 0.2970 0.4280 0.2276 -0.1030 0.0644  -0.0603 149 LEU A CA  
834  C C   . LEU A 148 ? 0.3319 0.4458 0.2802 -0.0891 0.0671  -0.0710 149 LEU A C   
835  O O   . LEU A 148 ? 0.3339 0.4483 0.2853 -0.0878 0.0718  -0.0847 149 LEU A O   
836  C CB  . LEU A 148 ? 0.2826 0.4353 0.2150 -0.1095 0.0726  -0.0661 149 LEU A CB  
837  C CG  . LEU A 148 ? 0.2957 0.4712 0.2099 -0.1260 0.0723  -0.0583 149 LEU A CG  
838  C CD1 . LEU A 148 ? 0.3397 0.5345 0.2594 -0.1304 0.0803  -0.0623 149 LEU A CD1 
839  C CD2 . LEU A 148 ? 0.3099 0.5007 0.2092 -0.1364 0.0762  -0.0684 149 LEU A CD2 
840  N N   . GLY A 149 ? 0.3106 0.4097 0.2708 -0.0793 0.0636  -0.0644 150 GLY A N   
841  C CA  . GLY A 149 ? 0.2601 0.3455 0.2380 -0.0674 0.0659  -0.0732 150 GLY A CA  
842  C C   . GLY A 149 ? 0.2963 0.3624 0.2741 -0.0612 0.0604  -0.0701 150 GLY A C   
843  O O   . GLY A 149 ? 0.2538 0.3124 0.2430 -0.0551 0.0630  -0.0801 150 GLY A O   
844  N N   . GLN A 150 ? 0.3086 0.3672 0.2753 -0.0630 0.0524  -0.0561 151 GLN A N   
845  C CA  . GLN A 150 ? 0.2911 0.3326 0.2589 -0.0569 0.0474  -0.0524 151 GLN A CA  
846  C C   . GLN A 150 ? 0.3309 0.3760 0.2864 -0.0640 0.0448  -0.0510 151 GLN A C   
847  O O   . GLN A 150 ? 0.3125 0.3452 0.2684 -0.0601 0.0405  -0.0472 151 GLN A O   
848  C CB  . GLN A 150 ? 0.2394 0.2659 0.2094 -0.0503 0.0404  -0.0394 151 GLN A CB  
849  C CG  . GLN A 150 ? 0.2220 0.2422 0.2054 -0.0424 0.0420  -0.0414 151 GLN A CG  
850  C CD  . GLN A 150 ? 0.3828 0.3996 0.3648 -0.0414 0.0368  -0.0300 151 GLN A CD  
851  O OE1 . GLN A 150 ? 0.3093 0.3370 0.2921 -0.0454 0.0385  -0.0293 151 GLN A OE1 
852  N NE2 . GLN A 150 ? 0.2849 0.2875 0.2656 -0.0365 0.0305  -0.0216 151 GLN A NE2 
853  N N   . GLY A 151 ? 0.2760 0.3393 0.2207 -0.0749 0.0474  -0.0542 152 GLY A N   
854  C CA  . GLY A 151 ? 0.2601 0.3295 0.1926 -0.0831 0.0446  -0.0532 152 GLY A CA  
855  C C   . GLY A 151 ? 0.3871 0.4505 0.3121 -0.0855 0.0344  -0.0362 152 GLY A C   
856  O O   . GLY A 151 ? 0.3362 0.3947 0.2582 -0.0864 0.0301  -0.0340 152 GLY A O   
857  N N   . LYS A 152 ? 0.3569 0.4206 0.2810 -0.0864 0.0302  -0.0245 153 LYS A N   
858  C CA  . LYS A 152 ? 0.3596 0.4175 0.2804 -0.0883 0.0200  -0.0087 153 LYS A CA  
859  C C   . LYS A 152 ? 0.3641 0.4391 0.2725 -0.1022 0.0163  -0.0005 153 LYS A C   
860  O O   . LYS A 152 ? 0.3692 0.4595 0.2727 -0.1089 0.0217  -0.0045 153 LYS A O   
861  C CB  . LYS A 152 ? 0.3482 0.3934 0.2780 -0.0802 0.0164  -0.0006 153 LYS A CB  
862  C CG  . LYS A 152 ? 0.3247 0.3531 0.2649 -0.0678 0.0182  -0.0056 153 LYS A CG  
863  C CD  . LYS A 152 ? 0.3063 0.3217 0.2533 -0.0607 0.0131  0.0029  153 LYS A CD  
864  C CE  . LYS A 152 ? 0.3181 0.3186 0.2727 -0.0500 0.0148  -0.0016 153 LYS A CE  
865  N NZ  . LYS A 152 ? 0.2850 0.2731 0.2446 -0.0435 0.0096  0.0056  153 LYS A NZ  
866  N N   . ASN A 153 ? 0.3320 0.4055 0.2363 -0.1069 0.0069  0.0112  154 ASN A N   
867  C CA  . ASN A 153 ? 0.3965 0.4838 0.2912 -0.1200 0.0001  0.0240  154 ASN A CA  
868  C C   . ASN A 153 ? 0.3630 0.4436 0.2654 -0.1175 -0.0058 0.0367  154 ASN A C   
869  O O   . ASN A 153 ? 0.3424 0.4073 0.2563 -0.1057 -0.0052 0.0352  154 ASN A O   
870  C CB  . ASN A 153 ? 0.3680 0.4564 0.2578 -0.1265 -0.0092 0.0327  154 ASN A CB  
871  C CG  . ASN A 153 ? 0.4257 0.4948 0.3289 -0.1167 -0.0177 0.0414  154 ASN A CG  
872  O OD1 . ASN A 153 ? 0.4317 0.4917 0.3440 -0.1119 -0.0224 0.0500  154 ASN A OD1 
873  N ND2 . ASN A 153 ? 0.3443 0.4080 0.2496 -0.1140 -0.0192 0.0381  154 ASN A ND2 
874  N N   . VAL A 154 ? 0.3611 0.4539 0.2570 -0.1294 -0.0119 0.0494  155 VAL A N   
875  C CA  . VAL A 154 ? 0.3419 0.4301 0.2453 -0.1286 -0.0172 0.0607  155 VAL A CA  
876  C C   . VAL A 154 ? 0.3597 0.4264 0.2778 -0.1180 -0.0261 0.0683  155 VAL A C   
877  O O   . VAL A 154 ? 0.3585 0.4143 0.2865 -0.1099 -0.0260 0.0686  155 VAL A O   
878  C CB  . VAL A 154 ? 0.3908 0.4968 0.2849 -0.1451 -0.0235 0.0751  155 VAL A CB  
879  C CG1 . VAL A 154 ? 0.3939 0.5011 0.2846 -0.1529 -0.0353 0.0880  155 VAL A CG1 
880  C CG2 . VAL A 154 ? 0.4127 0.5142 0.3160 -0.1446 -0.0284 0.0859  155 VAL A CG2 
881  N N   . TYR A 155 ? 0.3746 0.4358 0.2947 -0.1179 -0.0333 0.0733  156 TYR A N   
882  C CA  . TYR A 155 ? 0.3933 0.4361 0.3285 -0.1080 -0.0408 0.0786  156 TYR A CA  
883  C C   . TYR A 155 ? 0.3694 0.3978 0.3119 -0.0934 -0.0331 0.0658  156 TYR A C   
884  O O   . TYR A 155 ? 0.3289 0.3444 0.2826 -0.0852 -0.0360 0.0677  156 TYR A O   
885  C CB  . TYR A 155 ? 0.4331 0.4755 0.3702 -0.1114 -0.0494 0.0854  156 TYR A CB  
886  C CG  . TYR A 155 ? 0.5687 0.6262 0.4976 -0.1272 -0.0581 0.0995  156 TYR A CG  
887  C CD1 . TYR A 155 ? 0.5995 0.6576 0.5343 -0.1328 -0.0674 0.1143  156 TYR A CD1 
888  C CD2 . TYR A 155 ? 0.6093 0.6811 0.5244 -0.1374 -0.0575 0.0983  156 TYR A CD2 
889  C CE1 . TYR A 155 ? 0.6685 0.7413 0.5957 -0.1485 -0.0762 0.1291  156 TYR A CE1 
890  C CE2 . TYR A 155 ? 0.6656 0.7530 0.5714 -0.1534 -0.0660 0.1122  156 TYR A CE2 
891  C CZ  . TYR A 155 ? 0.7378 0.8258 0.6497 -0.1591 -0.0755 0.1283  156 TYR A CZ  
892  O OH  . TYR A 155 ? 0.8286 0.9326 0.7312 -0.1762 -0.0850 0.1442  156 TYR A OH  
893  N N   . GLN A 156 ? 0.3356 0.3664 0.2720 -0.0907 -0.0238 0.0529  157 GLN A N   
894  C CA  . GLN A 156 ? 0.2954 0.3137 0.2382 -0.0782 -0.0170 0.0421  157 GLN A CA  
895  C C   . GLN A 156 ? 0.2968 0.3137 0.2418 -0.0746 -0.0125 0.0390  157 GLN A C   
896  O O   . GLN A 156 ? 0.3208 0.3252 0.2736 -0.0651 -0.0120 0.0368  157 GLN A O   
897  C CB  . GLN A 156 ? 0.3563 0.3782 0.2936 -0.0775 -0.0090 0.0298  157 GLN A CB  
898  C CG  . GLN A 156 ? 0.4044 0.4263 0.3407 -0.0799 -0.0132 0.0316  157 GLN A CG  
899  C CD  . GLN A 156 ? 0.4141 0.4446 0.3424 -0.0841 -0.0066 0.0206  157 GLN A CD  
900  O OE1 . GLN A 156 ? 0.3896 0.4299 0.3115 -0.0879 0.0005  0.0122  157 GLN A OE1 
901  N NE2 . GLN A 156 ? 0.3568 0.3842 0.2867 -0.0836 -0.0090 0.0199  157 GLN A NE2 
902  N N   . ALA A 157 ? 0.2540 0.2851 0.1920 -0.0829 -0.0092 0.0387  158 ALA A N   
903  C CA  . ALA A 157 ? 0.3034 0.3351 0.2449 -0.0800 -0.0047 0.0355  158 ALA A CA  
904  C C   . ALA A 157 ? 0.3602 0.3831 0.3095 -0.0781 -0.0131 0.0465  158 ALA A C   
905  O O   . ALA A 157 ? 0.3657 0.3787 0.3221 -0.0701 -0.0121 0.0438  158 ALA A O   
906  C CB  . ALA A 157 ? 0.2473 0.2986 0.1806 -0.0900 0.0013  0.0322  158 ALA A CB  
907  N N   . GLU A 158 ? 0.3120 0.3380 0.2608 -0.0858 -0.0223 0.0591  159 GLU A N   
908  C CA  . GLU A 158 ? 0.3738 0.3917 0.3322 -0.0850 -0.0312 0.0696  159 GLU A CA  
909  C C   . GLU A 158 ? 0.4003 0.3994 0.3695 -0.0726 -0.0337 0.0663  159 GLU A C   
910  O O   . GLU A 158 ? 0.3298 0.3205 0.3060 -0.0673 -0.0350 0.0660  159 GLU A O   
911  C CB  . GLU A 158 ? 0.4240 0.4479 0.3824 -0.0957 -0.0420 0.0846  159 GLU A CB  
912  C CG  . GLU A 158 ? 0.6445 0.6634 0.6130 -0.0977 -0.0510 0.0960  159 GLU A CG  
913  C CD  . GLU A 158 ? 0.8862 0.9165 0.8523 -0.1120 -0.0605 0.1121  159 GLU A CD  
914  O OE1 . GLU A 158 ? 0.9773 1.0130 0.9453 -0.1189 -0.0641 0.1208  159 GLU A OE1 
915  O OE2 . GLU A 158 ? 0.9306 0.9651 0.8930 -0.1170 -0.0649 0.1168  159 GLU A OE2 
916  N N   . ILE A 159 ? 0.3794 0.3733 0.3494 -0.0685 -0.0338 0.0632  160 ILE A N   
917  C CA  . ILE A 159 ? 0.3819 0.3606 0.3613 -0.0577 -0.0351 0.0593  160 ILE A CA  
918  C C   . ILE A 159 ? 0.3763 0.3488 0.3548 -0.0492 -0.0271 0.0489  160 ILE A C   
919  O O   . ILE A 159 ? 0.3369 0.2985 0.3224 -0.0419 -0.0288 0.0469  160 ILE A O   
920  C CB  . ILE A 159 ? 0.4473 0.4248 0.4275 -0.0561 -0.0356 0.0576  160 ILE A CB  
921  C CG1 . ILE A 159 ? 0.5900 0.5583 0.5840 -0.0527 -0.0446 0.0635  160 ILE A CG1 
922  C CG2 . ILE A 159 ? 0.4615 0.4348 0.4384 -0.0486 -0.0265 0.0460  160 ILE A CG2 
923  C CD1 . ILE A 159 ? 0.6527 0.6275 0.6500 -0.0621 -0.0547 0.0762  160 ILE A CD1 
924  N N   . ASP A 160 ? 0.3221 0.3024 0.2929 -0.0507 -0.0189 0.0421  161 ASP A N   
925  C CA  . ASP A 160 ? 0.3074 0.2825 0.2786 -0.0432 -0.0121 0.0331  161 ASP A CA  
926  C C   . ASP A 160 ? 0.3698 0.3463 0.3434 -0.0438 -0.0123 0.0345  161 ASP A C   
927  O O   . ASP A 160 ? 0.3177 0.2847 0.2966 -0.0381 -0.0149 0.0347  161 ASP A O   
928  C CB  . ASP A 160 ? 0.3357 0.3181 0.3012 -0.0445 -0.0041 0.0249  161 ASP A CB  
929  C CG  . ASP A 160 ? 0.3012 0.2811 0.2692 -0.0387 0.0024  0.0167  161 ASP A CG  
930  O OD1 . ASP A 160 ? 0.2800 0.2515 0.2524 -0.0331 0.0008  0.0173  161 ASP A OD1 
931  O OD2 . ASP A 160 ? 0.3299 0.3164 0.2962 -0.0400 0.0088  0.0093  161 ASP A OD2 
932  N N   . CYS A 161 ? 0.3730 0.3628 0.3428 -0.0511 -0.0094 0.0352  162 CYS A N   
933  C CA  . CYS A 161 ? 0.3673 0.3607 0.3403 -0.0511 -0.0071 0.0340  162 CYS A CA  
934  C C   . CYS A 161 ? 0.3281 0.3210 0.3052 -0.0553 -0.0149 0.0441  162 CYS A C   
935  O O   . CYS A 161 ? 0.3996 0.3934 0.3811 -0.0547 -0.0145 0.0441  162 CYS A O   
936  C CB  . CYS A 161 ? 0.3042 0.3133 0.2734 -0.0564 0.0011  0.0278  162 CYS A CB  
937  S SG  . CYS A 161 ? 0.4137 0.4405 0.3745 -0.0702 -0.0001 0.0346  162 CYS A SG  
938  N N   . ILE A 162 ? 0.3878 0.3787 0.3656 -0.0594 -0.0226 0.0529  163 ILE A N   
939  C CA  . ILE A 162 ? 0.4144 0.4013 0.3995 -0.0623 -0.0317 0.0627  163 ILE A CA  
940  C C   . ILE A 162 ? 0.4402 0.4101 0.4338 -0.0541 -0.0380 0.0625  163 ILE A C   
941  O O   . ILE A 162 ? 0.4915 0.4528 0.4907 -0.0488 -0.0395 0.0599  163 ILE A O   
942  C CB  . ILE A 162 ? 0.4390 0.4364 0.4221 -0.0742 -0.0379 0.0748  163 ILE A CB  
943  C CG1 . ILE A 162 ? 0.4000 0.4171 0.3723 -0.0833 -0.0303 0.0732  163 ILE A CG1 
944  C CG2 . ILE A 162 ? 0.4403 0.4338 0.4330 -0.0779 -0.0475 0.0855  163 ILE A CG2 
945  C CD1 . ILE A 162 ? 0.4104 0.4352 0.3837 -0.0838 -0.0238 0.0686  163 ILE A CD1 
946  N N   . THR A 163 ? 0.4026 0.3687 0.3977 -0.0535 -0.0415 0.0645  164 THR A N   
947  C CA  . THR A 163 ? 0.3967 0.3489 0.4024 -0.0466 -0.0477 0.0641  164 THR A CA  
948  C C   . THR A 163 ? 0.3261 0.2687 0.3313 -0.0361 -0.0422 0.0527  164 THR A C   
949  O O   . THR A 163 ? 0.4272 0.3608 0.4388 -0.0315 -0.0453 0.0504  164 THR A O   
950  C CB  . THR A 163 ? 0.3609 0.3129 0.3706 -0.0484 -0.0528 0.0688  164 THR A CB  
951  O OG1 . THR A 163 ? 0.4545 0.4158 0.4639 -0.0594 -0.0593 0.0810  164 THR A OG1 
952  C CG2 . THR A 163 ? 0.3452 0.2840 0.3697 -0.0415 -0.0594 0.0678  164 THR A CG2 
953  N N   . GLU A 164 ? 0.2921 0.2368 0.2899 -0.0330 -0.0344 0.0459  165 GLU A N   
954  C CA  . GLU A 164 ? 0.3285 0.2653 0.3253 -0.0245 -0.0298 0.0370  165 GLU A CA  
955  C C   . GLU A 164 ? 0.3159 0.2516 0.3106 -0.0226 -0.0274 0.0339  165 GLU A C   
956  O O   . GLU A 164 ? 0.2819 0.2097 0.2784 -0.0172 -0.0281 0.0297  165 GLU A O   
957  C CB  . GLU A 164 ? 0.2992 0.2385 0.2897 -0.0223 -0.0226 0.0315  165 GLU A CB  
958  C CG  . GLU A 164 ? 0.5219 0.4602 0.5158 -0.0219 -0.0246 0.0326  165 GLU A CG  
959  C CD  . GLU A 164 ? 0.6846 0.6260 0.6725 -0.0209 -0.0179 0.0277  165 GLU A CD  
960  O OE1 . GLU A 164 ? 0.6845 0.6254 0.6674 -0.0182 -0.0118 0.0223  165 GLU A OE1 
961  O OE2 . GLU A 164 ? 0.7267 0.6709 0.7163 -0.0231 -0.0195 0.0299  165 GLU A OE2 
962  N N   . LEU A 165 ? 0.3320 0.2769 0.3232 -0.0274 -0.0244 0.0355  166 LEU A N   
963  C CA  . LEU A 165 ? 0.3287 0.2739 0.3202 -0.0258 -0.0224 0.0330  166 LEU A CA  
964  C C   . LEU A 165 ? 0.3810 0.3196 0.3790 -0.0255 -0.0298 0.0365  166 LEU A C   
965  O O   . LEU A 165 ? 0.3618 0.2933 0.3604 -0.0205 -0.0303 0.0323  166 LEU A O   
966  C CB  . LEU A 165 ? 0.2841 0.2423 0.2736 -0.0317 -0.0179 0.0339  166 LEU A CB  
967  C CG  . LEU A 165 ? 0.3372 0.2978 0.3298 -0.0300 -0.0153 0.0310  166 LEU A CG  
968  C CD1 . LEU A 165 ? 0.3432 0.3159 0.3346 -0.0326 -0.0074 0.0265  166 LEU A CD1 
969  C CD2 . LEU A 165 ? 0.3338 0.2960 0.3317 -0.0343 -0.0212 0.0375  166 LEU A CD2 
970  N N   . SER A 166 ? 0.3293 0.2701 0.3322 -0.0314 -0.0361 0.0443  167 SER A N   
971  C CA  . SER A 166 ? 0.3611 0.2949 0.3726 -0.0317 -0.0443 0.0479  167 SER A CA  
972  C C   . SER A 166 ? 0.4366 0.3576 0.4523 -0.0245 -0.0473 0.0421  167 SER A C   
973  O O   . SER A 166 ? 0.4411 0.3554 0.4602 -0.0217 -0.0504 0.0390  167 SER A O   
974  C CB  . SER A 166 ? 0.3765 0.3144 0.3943 -0.0399 -0.0517 0.0589  167 SER A CB  
975  O OG  . SER A 166 ? 0.5278 0.4793 0.5414 -0.0478 -0.0488 0.0640  167 SER A OG  
976  N N   . ASP A 167 ? 0.4282 0.3470 0.4439 -0.0219 -0.0463 0.0401  168 ASP A N   
977  C CA  . ASP A 167 ? 0.4463 0.3554 0.4664 -0.0152 -0.0475 0.0330  168 ASP A CA  
978  C C   . ASP A 167 ? 0.4028 0.3091 0.4149 -0.0097 -0.0419 0.0242  168 ASP A C   
979  O O   . ASP A 167 ? 0.4033 0.3024 0.4181 -0.0057 -0.0440 0.0182  168 ASP A O   
980  C CB  . ASP A 167 ? 0.4591 0.3687 0.4814 -0.0136 -0.0463 0.0324  168 ASP A CB  
981  C CG  . ASP A 167 ? 0.5431 0.4525 0.5775 -0.0180 -0.0549 0.0409  168 ASP A CG  
982  O OD1 . ASP A 167 ? 0.6091 0.5191 0.6485 -0.0233 -0.0613 0.0484  168 ASP A OD1 
983  O OD2 . ASP A 167 ? 0.5994 0.5085 0.6392 -0.0167 -0.0559 0.0410  168 ASP A OD2 
984  N N   . PHE A 168 ? 0.3273 0.2393 0.3300 -0.0099 -0.0351 0.0233  169 PHE A N   
985  C CA  . PHE A 168 ? 0.3850 0.2946 0.3809 -0.0057 -0.0311 0.0173  169 PHE A CA  
986  C C   . PHE A 168 ? 0.3554 0.2615 0.3533 -0.0059 -0.0358 0.0169  169 PHE A C   
987  O O   . PHE A 168 ? 0.3919 0.2922 0.3882 -0.0027 -0.0373 0.0114  169 PHE A O   
988  C CB  . PHE A 168 ? 0.4391 0.3551 0.4287 -0.0064 -0.0246 0.0176  169 PHE A CB  
989  C CG  . PHE A 168 ? 0.4142 0.3307 0.3994 -0.0040 -0.0192 0.0146  169 PHE A CG  
990  C CD1 . PHE A 168 ? 0.4041 0.3157 0.3866 0.0000  -0.0180 0.0098  169 PHE A CD1 
991  C CD2 . PHE A 168 ? 0.4364 0.3593 0.4201 -0.0065 -0.0150 0.0160  169 PHE A CD2 
992  C CE1 . PHE A 168 ? 0.4107 0.3236 0.3899 0.0016  -0.0130 0.0077  169 PHE A CE1 
993  C CE2 . PHE A 168 ? 0.4028 0.3258 0.3835 -0.0047 -0.0106 0.0134  169 PHE A CE2 
994  C CZ  . PHE A 168 ? 0.4202 0.3381 0.3991 -0.0007 -0.0097 0.0098  169 PHE A CZ  
995  N N   . PHE A 169 ? 0.3202 0.2308 0.3215 -0.0103 -0.0381 0.0225  170 PHE A N   
996  C CA  . PHE A 169 ? 0.3662 0.2745 0.3708 -0.0113 -0.0429 0.0231  170 PHE A CA  
997  C C   . PHE A 169 ? 0.4150 0.3147 0.4267 -0.0105 -0.0504 0.0213  170 PHE A C   
998  O O   . PHE A 169 ? 0.3847 0.2790 0.3953 -0.0082 -0.0530 0.0161  170 PHE A O   
999  C CB  . PHE A 169 ? 0.3003 0.2173 0.3089 -0.0169 -0.0433 0.0300  170 PHE A CB  
1000 C CG  . PHE A 169 ? 0.3117 0.2368 0.3162 -0.0167 -0.0362 0.0290  170 PHE A CG  
1001 C CD1 . PHE A 169 ? 0.3224 0.2450 0.3208 -0.0118 -0.0316 0.0237  170 PHE A CD1 
1002 C CD2 . PHE A 169 ? 0.3253 0.2612 0.3334 -0.0217 -0.0341 0.0331  170 PHE A CD2 
1003 C CE1 . PHE A 169 ? 0.2936 0.2225 0.2915 -0.0112 -0.0260 0.0226  170 PHE A CE1 
1004 C CE2 . PHE A 169 ? 0.3093 0.2530 0.3168 -0.0208 -0.0272 0.0302  170 PHE A CE2 
1005 C CZ  . PHE A 169 ? 0.3138 0.2529 0.3172 -0.0152 -0.0236 0.0250  170 PHE A CZ  
1006 N N   . ARG A 170 ? 0.4018 0.3002 0.4216 -0.0127 -0.0542 0.0252  171 ARG A N   
1007 C CA  . ARG A 170 ? 0.4245 0.3140 0.4554 -0.0119 -0.0622 0.0234  171 ARG A CA  
1008 C C   . ARG A 170 ? 0.4137 0.2965 0.4431 -0.0056 -0.0606 0.0121  171 ARG A C   
1009 O O   . ARG A 170 ? 0.3660 0.2423 0.3998 -0.0039 -0.0650 0.0060  171 ARG A O   
1010 C CB  . ARG A 170 ? 0.4254 0.3150 0.4678 -0.0160 -0.0680 0.0316  171 ARG A CB  
1011 C CG  . ARG A 170 ? 0.5461 0.4444 0.5887 -0.0238 -0.0696 0.0428  171 ARG A CG  
1012 C CD  . ARG A 170 ? 0.6902 0.5871 0.7462 -0.0296 -0.0790 0.0528  171 ARG A CD  
1013 N NE  . ARG A 170 ? 0.8285 0.7361 0.8827 -0.0383 -0.0796 0.0634  171 ARG A NE  
1014 C CZ  . ARG A 170 ? 0.9482 0.8663 0.9982 -0.0445 -0.0777 0.0715  171 ARG A CZ  
1015 N NH1 . ARG A 170 ? 1.0072 0.9253 1.0554 -0.0428 -0.0761 0.0709  171 ARG A NH1 
1016 N NH2 . ARG A 170 ? 0.9332 0.8630 0.9810 -0.0530 -0.0773 0.0800  171 ARG A NH2 
1017 N N   . TYR A 171 ? 0.4284 0.3140 0.4515 -0.0025 -0.0538 0.0087  172 TYR A N   
1018 C CA  . TYR A 171 ? 0.4259 0.3078 0.4468 0.0027  -0.0509 -0.0021 172 TYR A CA  
1019 C C   . TYR A 171 ? 0.4418 0.3242 0.4500 0.0041  -0.0476 -0.0080 172 TYR A C   
1020 O O   . TYR A 171 ? 0.4120 0.2909 0.4190 0.0066  -0.0480 -0.0175 172 TYR A O   
1021 C CB  . TYR A 171 ? 0.5145 0.3998 0.5344 0.0050  -0.0452 -0.0033 172 TYR A CB  
1022 C CG  . TYR A 171 ? 0.7416 0.6242 0.7777 0.0051  -0.0504 -0.0013 172 TYR A CG  
1023 C CD1 . TYR A 171 ? 0.8442 0.7224 0.8908 0.0096  -0.0514 -0.0106 172 TYR A CD1 
1024 C CD2 . TYR A 171 ? 0.8423 0.7273 0.8842 0.0003  -0.0547 0.0099  172 TYR A CD2 
1025 C CE1 . TYR A 171 ? 0.9210 0.7962 0.9861 0.0101  -0.0574 -0.0083 172 TYR A CE1 
1026 C CE2 . TYR A 171 ? 0.9024 0.7848 0.9603 -0.0003 -0.0612 0.0136  172 TYR A CE2 
1027 C CZ  . TYR A 171 ? 0.9448 0.8217 1.0156 0.0050  -0.0629 0.0047  172 TYR A CZ  
1028 O OH  . TYR A 171 ? 1.0017 0.8756 1.0919 0.0048  -0.0703 0.0088  172 TYR A OH  
1029 N N   . TYR A 172 ? 0.3841 0.2713 0.3833 0.0021  -0.0446 -0.0027 173 TYR A N   
1030 C CA  . TYR A 172 ? 0.3851 0.2728 0.3735 0.0027  -0.0432 -0.0062 173 TYR A CA  
1031 C C   . TYR A 172 ? 0.3830 0.2661 0.3751 0.0013  -0.0504 -0.0085 173 TYR A C   
1032 O O   . TYR A 172 ? 0.4119 0.2930 0.3975 0.0023  -0.0512 -0.0158 173 TYR A O   
1033 C CB  . TYR A 172 ? 0.3354 0.2288 0.3177 0.0013  -0.0395 0.0000  173 TYR A CB  
1034 C CG  . TYR A 172 ? 0.3906 0.2874 0.3670 0.0030  -0.0323 -0.0001 173 TYR A CG  
1035 C CD1 . TYR A 172 ? 0.4462 0.3421 0.4185 0.0054  -0.0290 -0.0062 173 TYR A CD1 
1036 C CD2 . TYR A 172 ? 0.4163 0.3181 0.3925 0.0018  -0.0287 0.0052  173 TYR A CD2 
1037 C CE1 . TYR A 172 ? 0.4354 0.3347 0.4032 0.0063  -0.0229 -0.0056 173 TYR A CE1 
1038 C CE2 . TYR A 172 ? 0.4647 0.3689 0.4368 0.0030  -0.0229 0.0049  173 TYR A CE2 
1039 C CZ  . TYR A 172 ? 0.4900 0.3927 0.4578 0.0051  -0.0202 0.0002  173 TYR A CZ  
1040 O OH  . TYR A 172 ? 0.4890 0.3944 0.4536 0.0058  -0.0147 0.0005  173 TYR A OH  
1041 N N   . VAL A 173 ? 0.3421 0.2244 0.3443 -0.0017 -0.0558 -0.0021 174 VAL A N   
1042 C CA  . VAL A 173 ? 0.3663 0.2438 0.3739 -0.0036 -0.0635 -0.0036 174 VAL A CA  
1043 C C   . VAL A 173 ? 0.4052 0.2755 0.4174 -0.0010 -0.0667 -0.0143 174 VAL A C   
1044 O O   . VAL A 173 ? 0.3963 0.2637 0.4043 -0.0009 -0.0695 -0.0217 174 VAL A O   
1045 C CB  . VAL A 173 ? 0.3491 0.2278 0.3684 -0.0082 -0.0690 0.0059  174 VAL A CB  
1046 C CG1 . VAL A 173 ? 0.3459 0.2175 0.3745 -0.0100 -0.0782 0.0036  174 VAL A CG1 
1047 C CG2 . VAL A 173 ? 0.2474 0.1345 0.2626 -0.0108 -0.0661 0.0132  174 VAL A CG2 
1048 N N   . LYS A 174 ? 0.3914 0.2595 0.4126 0.0011  -0.0661 -0.0160 175 LYS A N   
1049 C CA  . LYS A 174 ? 0.4241 0.2859 0.4533 0.0043  -0.0684 -0.0277 175 LYS A CA  
1050 C C   . LYS A 174 ? 0.4122 0.2768 0.4277 0.0072  -0.0619 -0.0396 175 LYS A C   
1051 O O   . LYS A 174 ? 0.4459 0.3073 0.4612 0.0079  -0.0642 -0.0507 175 LYS A O   
1052 C CB  . LYS A 174 ? 0.4627 0.3223 0.5074 0.0060  -0.0696 -0.0261 175 LYS A CB  
1053 C CG  . LYS A 174 ? 0.6073 0.4604 0.6652 0.0099  -0.0724 -0.0394 175 LYS A CG  
1054 C CD  . LYS A 174 ? 0.7163 0.5657 0.7955 0.0113  -0.0769 -0.0359 175 LYS A CD  
1055 C CE  . LYS A 174 ? 0.7721 0.6159 0.8670 0.0163  -0.0785 -0.0515 175 LYS A CE  
1056 N NZ  . LYS A 174 ? 0.7910 0.6272 0.9134 0.0168  -0.0881 -0.0475 175 LYS A NZ  
1057 N N   . TYR A 175 ? 0.3951 0.2664 0.3991 0.0082  -0.0538 -0.0375 176 TYR A N   
1058 C CA  . TYR A 175 ? 0.4377 0.3133 0.4275 0.0095  -0.0475 -0.0466 176 TYR A CA  
1059 C C   . TYR A 175 ? 0.4742 0.3506 0.4511 0.0065  -0.0501 -0.0479 176 TYR A C   
1060 O O   . TYR A 175 ? 0.5690 0.4463 0.5387 0.0063  -0.0496 -0.0589 176 TYR A O   
1061 C CB  . TYR A 175 ? 0.4380 0.3203 0.4189 0.0102  -0.0393 -0.0418 176 TYR A CB  
1062 N N   . ALA A 176 ? 0.4158 0.2928 0.3904 0.0038  -0.0532 -0.0371 177 ALA A N   
1063 C CA  . ALA A 176 ? 0.4046 0.2830 0.3684 0.0008  -0.0564 -0.0365 177 ALA A CA  
1064 C C   . ALA A 176 ? 0.4524 0.3254 0.4211 -0.0004 -0.0637 -0.0447 177 ALA A C   
1065 O O   . ALA A 176 ? 0.5047 0.3791 0.4621 -0.0024 -0.0653 -0.0513 177 ALA A O   
1066 C CB  . ALA A 176 ? 0.3307 0.2114 0.2959 -0.0013 -0.0583 -0.0239 177 ALA A CB  
1067 N N   . SER A 177 ? 0.4542 0.3211 0.4399 0.0002  -0.0688 -0.0440 178 SER A N   
1068 C CA  . SER A 177 ? 0.5242 0.3845 0.5181 -0.0011 -0.0767 -0.0517 178 SER A CA  
1069 C C   . SER A 177 ? 0.4959 0.3557 0.4852 0.0009  -0.0741 -0.0686 178 SER A C   
1070 O O   . SER A 177 ? 0.5058 0.3639 0.4911 -0.0011 -0.0785 -0.0777 178 SER A O   
1071 C CB  . SER A 177 ? 0.5873 0.4409 0.6023 -0.0011 -0.0828 -0.0469 178 SER A CB  
1072 O OG  . SER A 177 ? 0.7884 0.6357 0.8155 0.0016  -0.0852 -0.0591 178 SER A OG  
1073 N N   . ASP A 178 ? 0.4600 0.3227 0.4499 0.0045  -0.0667 -0.0734 179 ASP A N   
1074 C CA  . ASP A 178 ? 0.5658 0.4315 0.5503 0.0062  -0.0619 -0.0902 179 ASP A CA  
1075 C C   . ASP A 178 ? 0.5834 0.4571 0.5436 0.0024  -0.0588 -0.0928 179 ASP A C   
1076 O O   . ASP A 178 ? 0.6345 0.5090 0.5880 0.0003  -0.0608 -0.1052 179 ASP A O   
1077 C CB  . ASP A 178 ? 0.6326 0.5018 0.6228 0.0105  -0.0539 -0.0933 179 ASP A CB  
1078 C CG  . ASP A 178 ? 0.7148 0.5763 0.7306 0.0140  -0.0582 -0.0921 179 ASP A CG  
1079 O OD1 . ASP A 178 ? 0.7164 0.5696 0.7470 0.0139  -0.0666 -0.0959 179 ASP A OD1 
1080 O OD2 . ASP A 178 ? 0.7579 0.6217 0.7798 0.0165  -0.0540 -0.0865 179 ASP A OD2 
1081 N N   . LEU A 179 ? 0.5647 0.4443 0.5121 0.0009  -0.0546 -0.0810 180 LEU A N   
1082 C CA  . LEU A 179 ? 0.5596 0.4466 0.4852 -0.0036 -0.0533 -0.0799 180 LEU A CA  
1083 C C   . LEU A 179 ? 0.5866 0.4712 0.5073 -0.0079 -0.0622 -0.0812 180 LEU A C   
1084 O O   . LEU A 179 ? 0.6476 0.5372 0.5532 -0.0117 -0.0624 -0.0900 180 LEU A O   
1085 C CB  . LEU A 179 ? 0.5541 0.4450 0.4728 -0.0044 -0.0504 -0.0643 180 LEU A CB  
1086 C CG  . LEU A 179 ? 0.6555 0.5522 0.5704 -0.0024 -0.0409 -0.0638 180 LEU A CG  
1087 C CD1 . LEU A 179 ? 0.7053 0.6041 0.6165 -0.0032 -0.0396 -0.0487 180 LEU A CD1 
1088 C CD2 . LEU A 179 ? 0.6621 0.5673 0.5608 -0.0050 -0.0355 -0.0744 180 LEU A CD2 
1089 N N   . TYR A 180 ? 0.5051 0.3831 0.4383 -0.0080 -0.0695 -0.0725 181 TYR A N   
1090 C CA  . TYR A 180 ? 0.4938 0.3698 0.4241 -0.0123 -0.0786 -0.0721 181 TYR A CA  
1091 C C   . TYR A 180 ? 0.5410 0.4119 0.4767 -0.0129 -0.0835 -0.0878 181 TYR A C   
1092 O O   . TYR A 180 ? 0.5526 0.4226 0.4837 -0.0172 -0.0910 -0.0903 181 TYR A O   
1093 C CB  . TYR A 180 ? 0.4914 0.3639 0.4341 -0.0128 -0.0843 -0.0576 181 TYR A CB  
1094 C CG  . TYR A 180 ? 0.5074 0.3859 0.4435 -0.0133 -0.0811 -0.0439 181 TYR A CG  
1095 C CD1 . TYR A 180 ? 0.4595 0.3438 0.3798 -0.0169 -0.0824 -0.0407 181 TYR A CD1 
1096 C CD2 . TYR A 180 ? 0.4591 0.3377 0.4055 -0.0105 -0.0771 -0.0343 181 TYR A CD2 
1097 C CE1 . TYR A 180 ? 0.4296 0.3184 0.3472 -0.0171 -0.0804 -0.0283 181 TYR A CE1 
1098 C CE2 . TYR A 180 ? 0.4416 0.3253 0.3840 -0.0106 -0.0741 -0.0236 181 TYR A CE2 
1099 C CZ  . TYR A 180 ? 0.4506 0.3388 0.3801 -0.0135 -0.0759 -0.0207 181 TYR A CZ  
1100 O OH  . TYR A 180 ? 0.4995 0.3919 0.4285 -0.0134 -0.0739 -0.0102 181 TYR A OH  
1101 N N   . ALA A 181 ? 0.6114 0.4790 0.5585 -0.0087 -0.0796 -0.0988 182 ALA A N   
1102 C CA  . ALA A 181 ? 0.6720 0.5341 0.6286 -0.0084 -0.0840 -0.1158 182 ALA A CA  
1103 C C   . ALA A 181 ? 0.7830 0.6534 0.7199 -0.0113 -0.0798 -0.1317 182 ALA A C   
1104 O O   . ALA A 181 ? 0.8488 0.7222 0.7879 -0.0085 -0.0730 -0.1467 182 ALA A O   
1105 C CB  . ALA A 181 ? 0.5890 0.4447 0.5683 -0.0025 -0.0820 -0.1217 182 ALA A CB  
1106 N N   . GLN A 182 ? 0.8214 0.6969 0.7395 -0.0175 -0.0837 -0.1281 183 GLN A N   
1107 C CA  . GLN A 182 ? 0.8469 0.7323 0.7428 -0.0224 -0.0805 -0.1414 183 GLN A CA  
1108 C C   . GLN A 182 ? 0.7817 0.6639 0.6753 -0.0273 -0.0903 -0.1509 183 GLN A C   
1109 O O   . GLN A 182 ? 0.8974 0.7770 0.7888 -0.0311 -0.0992 -0.1392 183 GLN A O   
1110 C CB  . GLN A 182 ? 0.8827 0.7789 0.7552 -0.0269 -0.0770 -0.1283 183 GLN A CB  
1111 N N   . GLN A 183 ? 0.6510 0.5335 0.5465 -0.0272 -0.0887 -0.1731 184 GLN A N   
1112 C CA  . GLN A 183 ? 0.6054 0.4859 0.4970 -0.0325 -0.0975 -0.1851 184 GLN A CA  
1113 C C   . GLN A 183 ? 0.5918 0.4869 0.4526 -0.0405 -0.0943 -0.1955 184 GLN A C   
1114 O O   . GLN A 183 ? 0.5906 0.4969 0.4385 -0.0407 -0.0834 -0.2031 184 GLN A O   
1115 C CB  . GLN A 183 ? 0.6143 0.4842 0.5310 -0.0280 -0.1003 -0.2039 184 GLN A CB  
1116 C CG  . GLN A 183 ? 0.6939 0.5691 0.6160 -0.0234 -0.0885 -0.2220 184 GLN A CG  
1117 C CD  . GLN A 183 ? 0.7929 0.6590 0.7442 -0.0188 -0.0891 -0.2311 184 GLN A CD  
1118 O OE1 . GLN A 183 ? 0.8136 0.6736 0.7894 -0.0115 -0.0868 -0.2280 184 GLN A OE1 
1119 N NE2 . GLN A 183 ? 0.5313 0.3969 0.4802 -0.0232 -0.0932 -0.2417 184 GLN A NE2 
1120 N N   . PRO A 184 ? 0.5547 0.4507 0.4032 -0.0480 -0.1042 -0.1950 185 PRO A N   
1121 C CA  . PRO A 184 ? 0.6154 0.5261 0.4333 -0.0573 -0.1028 -0.2042 185 PRO A CA  
1122 C C   . PRO A 184 ? 0.6795 0.5945 0.4960 -0.0577 -0.0960 -0.2316 185 PRO A C   
1123 O O   . PRO A 184 ? 0.6659 0.5693 0.5069 -0.0525 -0.0965 -0.2404 185 PRO A O   
1124 C CB  . PRO A 184 ? 0.5640 0.4720 0.3756 -0.0644 -0.1171 -0.1957 185 PRO A CB  
1125 C CG  . PRO A 184 ? 0.5535 0.4445 0.3959 -0.0586 -0.1251 -0.1932 185 PRO A CG  
1126 C CD  . PRO A 184 ? 0.5589 0.4439 0.4209 -0.0491 -0.1174 -0.1841 185 PRO A CD  
1127 N N   . VAL A 185 ? 0.5896 0.5200 0.3793 -0.0637 -0.0877 -0.2369 186 VAL A N   
1128 C CA  . VAL A 185 ? 0.6126 0.5475 0.4011 -0.0626 -0.0779 -0.2556 186 VAL A CA  
1129 C C   . VAL A 185 ? 0.6430 0.5909 0.4008 -0.0724 -0.0789 -0.2602 186 VAL A C   
1130 O O   . VAL A 185 ? 0.6887 0.6486 0.4220 -0.0793 -0.0807 -0.2474 186 VAL A O   
1131 C CB  . VAL A 185 ? 0.6041 0.5468 0.3983 -0.0560 -0.0627 -0.2596 186 VAL A CB  
1132 C CG1 . VAL A 185 ? 0.6375 0.5922 0.4112 -0.0599 -0.0591 -0.2443 186 VAL A CG1 
1133 C CG2 . VAL A 185 ? 0.8935 0.8467 0.6829 -0.0563 -0.0521 -0.2782 186 VAL A CG2 
1134 N N   . GLU A 186 ? 0.6674 0.6137 0.4280 -0.0731 -0.0782 -0.2776 187 GLU A N   
1135 C CA  . GLU A 186 ? 0.7493 0.7098 0.4826 -0.0814 -0.0770 -0.2852 187 GLU A CA  
1136 C C   . GLU A 186 ? 0.7768 0.7534 0.5042 -0.0796 -0.0605 -0.2953 187 GLU A C   
1137 O O   . GLU A 186 ? 0.8153 0.7901 0.5617 -0.0733 -0.0523 -0.3121 187 GLU A O   
1138 C CB  . GLU A 186 ? 0.7233 0.6756 0.4619 -0.0836 -0.0836 -0.3006 187 GLU A CB  
1139 C CG  . GLU A 186 ? 0.8934 0.8604 0.6025 -0.0931 -0.0842 -0.3078 187 GLU A CG  
1140 C CD  . GLU A 186 ? 0.9467 0.9053 0.6608 -0.0956 -0.0910 -0.3238 187 GLU A CD  
1141 O OE1 . GLU A 186 ? 0.9752 0.9169 0.7175 -0.0898 -0.0945 -0.3292 187 GLU A OE1 
1142 O OE2 . GLU A 186 ? 0.9094 0.8792 0.6002 -0.1037 -0.0930 -0.3304 187 GLU A OE2 
1143 N N   . SER A 187 ? 0.8160 0.8094 0.5191 -0.0855 -0.0560 -0.2840 188 SER A N   
1144 C CA  . SER A 187 ? 0.7868 0.7984 0.4821 -0.0858 -0.0404 -0.2911 188 SER A CA  
1145 C C   . SER A 187 ? 0.7558 0.7784 0.4430 -0.0898 -0.0349 -0.3118 188 SER A C   
1146 O O   . SER A 187 ? 0.7744 0.7911 0.4580 -0.0933 -0.0437 -0.3196 188 SER A O   
1147 C CB  . SER A 187 ? 0.7181 0.7456 0.3878 -0.0936 -0.0386 -0.2719 188 SER A CB  
1148 O OG  . SER A 187 ? 0.7914 0.8106 0.4689 -0.0899 -0.0419 -0.2538 188 SER A OG  
1149 N N   . ALA A 188 ? 0.9077 0.9474 0.5923 -0.0898 -0.0201 -0.3208 189 ALA A N   
1150 C CA  . ALA A 188 ? 0.9278 0.9815 0.6053 -0.0940 -0.0129 -0.3416 189 ALA A CA  
1151 C C   . ALA A 188 ? 0.9066 0.9723 0.5508 -0.1070 -0.0194 -0.3364 189 ALA A C   
1152 O O   . ALA A 188 ? 0.8560 0.9249 0.4941 -0.1112 -0.0211 -0.3522 189 ALA A O   
1153 C CB  . ALA A 188 ? 0.9388 1.0110 0.6201 -0.0923 0.0043  -0.3498 189 ALA A CB  
1154 N N   . ASP A 189 ? 0.9091 0.9812 0.5332 -0.1137 -0.0238 -0.3135 190 ASP A N   
1155 C CA  . ASP A 189 ? 0.9386 1.0234 0.5321 -0.1267 -0.0308 -0.3045 190 ASP A CA  
1156 C C   . ASP A 189 ? 0.8936 0.9636 0.4854 -0.1286 -0.0479 -0.3026 190 ASP A C   
1157 O O   . ASP A 189 ? 0.9375 1.0163 0.5067 -0.1389 -0.0558 -0.2954 190 ASP A O   
1158 C CB  . ASP A 189 ? 0.9673 1.0627 0.5439 -0.1331 -0.0312 -0.2784 190 ASP A CB  
1159 C CG  . ASP A 189 ? 1.0006 1.0788 0.5908 -0.1266 -0.0396 -0.2596 190 ASP A CG  
1160 O OD1 . ASP A 189 ? 1.0148 1.0736 0.6228 -0.1197 -0.0483 -0.2642 190 ASP A OD1 
1161 O OD2 . ASP A 189 ? 1.0235 1.1078 0.6073 -0.1290 -0.0378 -0.2400 190 ASP A OD2 
1162 N N   . GLY A 190 ? 0.8295 0.8775 0.4465 -0.1191 -0.0538 -0.3083 191 GLY A N   
1163 C CA  . GLY A 190 ? 0.8323 0.8651 0.4514 -0.1206 -0.0703 -0.3063 191 GLY A CA  
1164 C C   . GLY A 190 ? 0.8064 0.8308 0.4254 -0.1213 -0.0832 -0.2814 191 GLY A C   
1165 O O   . GLY A 190 ? 0.8509 0.8636 0.4735 -0.1227 -0.0977 -0.2779 191 GLY A O   
1166 N N   . THR A 191 ? 0.7849 0.8158 0.4012 -0.1206 -0.0783 -0.2642 192 THR A N   
1167 C CA  . THR A 191 ? 0.7602 0.7844 0.3787 -0.1212 -0.0897 -0.2407 192 THR A CA  
1168 C C   . THR A 191 ? 0.9150 0.9186 0.5624 -0.1108 -0.0926 -0.2413 192 THR A C   
1169 O O   . THR A 191 ? 0.7244 0.7205 0.3899 -0.1028 -0.0837 -0.2566 192 THR A O   
1170 C CB  . THR A 191 ? 0.7506 0.7889 0.3548 -0.1257 -0.0845 -0.2196 192 THR A CB  
1171 O OG1 . THR A 191 ? 0.7367 0.7770 0.3505 -0.1191 -0.0698 -0.2251 192 THR A OG1 
1172 C CG2 . THR A 191 ? 0.7813 0.8400 0.3573 -0.1379 -0.0837 -0.2148 192 THR A CG2 
1173 N N   . TRP A 192 ? 0.7099 0.7059 0.3631 -0.1114 -0.1049 -0.2235 193 TRP A N   
1174 C CA  . TRP A 192 ? 0.6841 0.6611 0.3640 -0.1040 -0.1107 -0.2228 193 TRP A CA  
1175 C C   . TRP A 192 ? 0.6552 0.6327 0.3383 -0.1030 -0.1108 -0.2013 193 TRP A C   
1176 O O   . TRP A 192 ? 0.6846 0.6669 0.3579 -0.1093 -0.1195 -0.1813 193 TRP A O   
1177 C CB  . TRP A 192 ? 0.6916 0.6594 0.3772 -0.1071 -0.1268 -0.2233 193 TRP A CB  
1178 C CG  . TRP A 192 ? 0.7043 0.6534 0.4174 -0.1018 -0.1353 -0.2205 193 TRP A CG  
1179 C CD1 . TRP A 192 ? 0.6807 0.6276 0.4023 -0.1047 -0.1487 -0.2056 193 TRP A CD1 
1180 C CD2 . TRP A 192 ? 0.6551 0.5881 0.3939 -0.0941 -0.1295 -0.2312 193 TRP A CD2 
1181 N NE1 . TRP A 192 ? 0.6340 0.5662 0.3839 -0.0998 -0.1514 -0.2075 193 TRP A NE1 
1182 C CE2 . TRP A 192 ? 0.6570 0.5786 0.4172 -0.0936 -0.1398 -0.2215 193 TRP A CE2 
1183 C CE3 . TRP A 192 ? 0.6576 0.5884 0.4078 -0.0872 -0.1157 -0.2469 193 TRP A CE3 
1184 C CZ2 . TRP A 192 ? 0.6422 0.5505 0.4366 -0.0839 -0.1375 -0.2253 193 TRP A CZ2 
1185 C CZ3 . TRP A 192 ? 0.6400 0.5567 0.4232 -0.0788 -0.1140 -0.2512 193 TRP A CZ3 
1186 C CH2 . TRP A 192 ? 0.6200 0.5255 0.4246 -0.0771 -0.1250 -0.2399 193 TRP A CH2 
1187 N N   . ASN A 193 ? 0.6357 0.6078 0.3335 -0.0953 -0.1008 -0.2048 194 ASN A N   
1188 C CA  . ASN A 193 ? 0.6128 0.5868 0.3100 -0.0947 -0.0970 -0.1871 194 ASN A CA  
1189 C C   . ASN A 193 ? 0.6717 0.6276 0.3993 -0.0846 -0.0994 -0.1797 194 ASN A C   
1190 O O   . ASN A 193 ? 0.6578 0.6034 0.4070 -0.0775 -0.0983 -0.1947 194 ASN A O   
1191 C CB  . ASN A 193 ? 0.6149 0.6002 0.3059 -0.0919 -0.0807 -0.1931 194 ASN A CB  
1192 C CG  . ASN A 193 ? 0.6448 0.6475 0.3117 -0.0991 -0.0759 -0.1977 194 ASN A CG  
1193 O OD1 . ASN A 193 ? 0.8996 0.9144 0.5471 -0.1067 -0.0767 -0.1813 194 ASN A OD1 
1194 N ND2 . ASN A 193 ? 0.7551 0.7587 0.4241 -0.0974 -0.0713 -0.2192 194 ASN A ND2 
1195 N N   . LYS A 194 ? 0.5639 0.5161 0.2965 -0.0827 -0.1029 -0.1545 195 LYS A N   
1196 C CA  . LYS A 194 ? 0.5350 0.4732 0.2962 -0.0717 -0.1017 -0.1439 195 LYS A CA  
1197 C C   . LYS A 194 ? 0.5203 0.4633 0.2770 -0.0704 -0.0956 -0.1252 195 LYS A C   
1198 O O   . LYS A 194 ? 0.6087 0.5620 0.3448 -0.0782 -0.0977 -0.1140 195 LYS A O   
1199 C CB  . LYS A 194 ? 0.6156 0.5421 0.3930 -0.0707 -0.1147 -0.1323 195 LYS A CB  
1200 C CG  . LYS A 194 ? 0.6897 0.6216 0.4539 -0.0783 -0.1246 -0.1131 195 LYS A CG  
1201 C CD  . LYS A 194 ? 0.6976 0.6190 0.4846 -0.0737 -0.1326 -0.0953 195 LYS A CD  
1202 C CE  . LYS A 194 ? 0.7214 0.6471 0.4995 -0.0819 -0.1457 -0.0814 195 LYS A CE  
1203 N NZ  . LYS A 194 ? 0.8006 0.7203 0.5995 -0.0774 -0.1507 -0.0614 195 LYS A NZ  
1204 N N   . ALA A 195 ? 0.4982 0.4339 0.2748 -0.0609 -0.0886 -0.1218 196 ALA A N   
1205 C CA  . ALA A 195 ? 0.4830 0.4214 0.2588 -0.0590 -0.0834 -0.1045 196 ALA A CA  
1206 C C   . ALA A 195 ? 0.5577 0.4836 0.3575 -0.0520 -0.0880 -0.0903 196 ALA A C   
1207 O O   . ALA A 195 ? 0.5911 0.5070 0.4106 -0.0463 -0.0894 -0.0971 196 ALA A O   
1208 C CB  . ALA A 195 ? 0.5442 0.4877 0.3202 -0.0549 -0.0697 -0.1141 196 ALA A CB  
1209 N N   . GLU A 196 ? 0.5235 0.4505 0.3226 -0.0531 -0.0910 -0.0707 197 GLU A N   
1210 C CA  . GLU A 196 ? 0.5575 0.4752 0.3789 -0.0468 -0.0934 -0.0580 197 GLU A CA  
1211 C C   . GLU A 196 ? 0.5840 0.5040 0.4073 -0.0440 -0.0871 -0.0445 197 GLU A C   
1212 O O   . GLU A 196 ? 0.5921 0.5202 0.3995 -0.0490 -0.0860 -0.0376 197 GLU A O   
1213 C CB  . GLU A 196 ? 0.6135 0.5280 0.4406 -0.0499 -0.1060 -0.0484 197 GLU A CB  
1214 C CG  . GLU A 196 ? 0.7640 0.6850 0.5808 -0.0557 -0.1121 -0.0323 197 GLU A CG  
1215 C CD  . GLU A 196 ? 0.9329 0.8511 0.7590 -0.0583 -0.1249 -0.0238 197 GLU A CD  
1216 O OE1 . GLU A 196 ? 0.9520 0.8717 0.7689 -0.0641 -0.1325 -0.0314 197 GLU A OE1 
1217 O OE2 . GLU A 196 ? 0.9609 0.8761 0.8044 -0.0546 -0.1271 -0.0104 197 GLU A OE2 
1218 N N   . TYR A 197 ? 0.5195 0.4324 0.3624 -0.0366 -0.0832 -0.0410 198 TYR A N   
1219 C CA  . TYR A 197 ? 0.5264 0.4400 0.3746 -0.0335 -0.0780 -0.0288 198 TYR A CA  
1220 C C   . TYR A 197 ? 0.5281 0.4394 0.3873 -0.0335 -0.0855 -0.0139 198 TYR A C   
1221 O O   . TYR A 197 ? 0.6858 0.5916 0.5602 -0.0310 -0.0897 -0.0132 198 TYR A O   
1222 C CB  . TYR A 197 ? 0.5170 0.4255 0.3802 -0.0262 -0.0702 -0.0334 198 TYR A CB  
1223 C CG  . TYR A 197 ? 0.5629 0.4751 0.4186 -0.0253 -0.0616 -0.0466 198 TYR A CG  
1224 C CD1 . TYR A 197 ? 0.6385 0.5573 0.4852 -0.0259 -0.0538 -0.0437 198 TYR A CD1 
1225 C CD2 . TYR A 197 ? 0.6472 0.5564 0.5069 -0.0238 -0.0614 -0.0622 198 TYR A CD2 
1226 C CE1 . TYR A 197 ? 0.7208 0.6446 0.5622 -0.0251 -0.0452 -0.0561 198 TYR A CE1 
1227 C CE2 . TYR A 197 ? 0.7774 0.6910 0.6332 -0.0224 -0.0530 -0.0755 198 TYR A CE2 
1228 C CZ  . TYR A 197 ? 0.7997 0.7212 0.6461 -0.0231 -0.0446 -0.0724 198 TYR A CZ  
1229 O OH  . TYR A 197 ? 0.8533 0.7807 0.6974 -0.0218 -0.0358 -0.0860 198 TYR A OH  
1230 N N   . ARG A 198 ? 0.3985 0.3144 0.2515 -0.0366 -0.0874 -0.0019 199 ARG A N   
1231 C CA  . ARG A 198 ? 0.4506 0.3647 0.3180 -0.0358 -0.0939 0.0117  199 ARG A CA  
1232 C C   . ARG A 198 ? 0.3894 0.3022 0.2683 -0.0306 -0.0866 0.0185  199 ARG A C   
1233 O O   . ARG A 198 ? 0.4505 0.3651 0.3217 -0.0299 -0.0788 0.0158  199 ARG A O   
1234 C CB  . ARG A 198 ? 0.5213 0.4406 0.3781 -0.0431 -0.1037 0.0214  199 ARG A CB  
1235 C CG  . ARG A 198 ? 0.5745 0.4995 0.4178 -0.0469 -0.1009 0.0284  199 ARG A CG  
1236 C CD  . ARG A 198 ? 0.5837 0.5160 0.4081 -0.0568 -0.1102 0.0345  199 ARG A CD  
1237 N NE  . ARG A 198 ? 0.6408 0.5799 0.4474 -0.0612 -0.1041 0.0357  199 ARG A NE  
1238 C CZ  . ARG A 198 ? 0.6130 0.5610 0.3990 -0.0710 -0.1091 0.0416  199 ARG A CZ  
1239 N NH1 . ARG A 198 ? 0.5533 0.5043 0.3327 -0.0780 -0.1214 0.0476  199 ARG A NH1 
1240 N NH2 . ARG A 198 ? 0.6097 0.5645 0.3815 -0.0746 -0.1017 0.0421  199 ARG A NH2 
1241 N N   . PRO A 199 ? 0.3860 0.2964 0.2841 -0.0271 -0.0889 0.0263  200 PRO A N   
1242 C CA  . PRO A 199 ? 0.4009 0.3107 0.3093 -0.0229 -0.0823 0.0317  200 PRO A CA  
1243 C C   . PRO A 199 ? 0.4393 0.3523 0.3413 -0.0264 -0.0847 0.0418  200 PRO A C   
1244 O O   . PRO A 199 ? 0.4541 0.3704 0.3442 -0.0324 -0.0923 0.0459  200 PRO A O   
1245 C CB  . PRO A 199 ? 0.3329 0.2414 0.2630 -0.0196 -0.0852 0.0365  200 PRO A CB  
1246 C CG  . PRO A 199 ? 0.3582 0.2682 0.2878 -0.0239 -0.0962 0.0404  200 PRO A CG  
1247 C CD  . PRO A 199 ? 0.4153 0.3249 0.3267 -0.0276 -0.0975 0.0309  200 PRO A CD  
1248 N N   . LEU A 200 ? 0.4351 0.3474 0.3452 -0.0233 -0.0792 0.0464  201 LEU A N   
1249 C CA  . LEU A 200 ? 0.4131 0.3273 0.3231 -0.0264 -0.0830 0.0581  201 LEU A CA  
1250 C C   . LEU A 200 ? 0.3820 0.2961 0.3062 -0.0273 -0.0937 0.0674  201 LEU A C   
1251 O O   . LEU A 200 ? 0.3856 0.2983 0.3255 -0.0236 -0.0949 0.0650  201 LEU A O   
1252 C CB  . LEU A 200 ? 0.3733 0.2854 0.2941 -0.0222 -0.0757 0.0603  201 LEU A CB  
1253 C CG  . LEU A 200 ? 0.4178 0.3300 0.3291 -0.0204 -0.0649 0.0512  201 LEU A CG  
1254 C CD1 . LEU A 200 ? 0.4005 0.3107 0.3236 -0.0168 -0.0588 0.0538  201 LEU A CD1 
1255 C CD2 . LEU A 200 ? 0.4018 0.3190 0.2900 -0.0263 -0.0638 0.0493  201 LEU A CD2 
1256 N N   . GLU A 201 ? 0.3832 0.2995 0.3033 -0.0327 -0.1018 0.0788  202 GLU A N   
1257 C CA  . GLU A 201 ? 0.4569 0.3736 0.3921 -0.0338 -0.1133 0.0884  202 GLU A CA  
1258 C C   . GLU A 201 ? 0.4256 0.3395 0.3896 -0.0277 -0.1125 0.0934  202 GLU A C   
1259 O O   . GLU A 201 ? 0.4310 0.3451 0.4150 -0.0250 -0.1177 0.0955  202 GLU A O   
1260 C CB  . GLU A 201 ? 0.4477 0.3682 0.3692 -0.0427 -0.1239 0.1003  202 GLU A CB  
1261 C CG  . GLU A 201 ? 0.5613 0.4827 0.4980 -0.0445 -0.1374 0.1105  202 GLU A CG  
1262 C CD  . GLU A 201 ? 0.6527 0.5792 0.5707 -0.0550 -0.1492 0.1209  202 GLU A CD  
1263 O OE1 . GLU A 201 ? 0.6910 0.6208 0.5879 -0.0610 -0.1469 0.1234  202 GLU A OE1 
1264 O OE2 . GLU A 201 ? 0.6668 0.5949 0.5912 -0.0578 -0.1608 0.1266  202 GLU A OE2 
1265 N N   . GLY A 202 ? 0.3786 0.2904 0.3456 -0.0256 -0.1061 0.0947  203 GLY A N   
1266 C CA  . GLY A 202 ? 0.3868 0.2959 0.3812 -0.0196 -0.1042 0.0968  203 GLY A CA  
1267 C C   . GLY A 202 ? 0.4334 0.3420 0.4348 -0.0132 -0.0927 0.0841  203 GLY A C   
1268 O O   . GLY A 202 ? 0.4107 0.3198 0.3961 -0.0134 -0.0868 0.0754  203 GLY A O   
1269 N N   . PHE A 203 ? 0.3700 0.2780 0.3959 -0.0079 -0.0897 0.0829  204 PHE A N   
1270 C CA  . PHE A 203 ? 0.2873 0.1966 0.3198 -0.0030 -0.0792 0.0717  204 PHE A CA  
1271 C C   . PHE A 203 ? 0.3100 0.2169 0.3332 -0.0019 -0.0698 0.0671  204 PHE A C   
1272 O O   . PHE A 203 ? 0.3215 0.2258 0.3388 -0.0042 -0.0711 0.0729  204 PHE A O   
1273 C CB  . PHE A 203 ? 0.2661 0.1781 0.3285 0.0017  -0.0788 0.0704  204 PHE A CB  
1274 C CG  . PHE A 203 ? 0.3165 0.2257 0.3967 0.0039  -0.0798 0.0748  204 PHE A CG  
1275 C CD1 . PHE A 203 ? 0.3242 0.2323 0.4092 0.0070  -0.0703 0.0679  204 PHE A CD1 
1276 C CD2 . PHE A 203 ? 0.3277 0.2352 0.4212 0.0024  -0.0911 0.0860  204 PHE A CD2 
1277 C CE1 . PHE A 203 ? 0.2970 0.2016 0.4002 0.0089  -0.0716 0.0710  204 PHE A CE1 
1278 C CE2 . PHE A 203 ? 0.3494 0.2532 0.4623 0.0043  -0.0930 0.0904  204 PHE A CE2 
1279 C CZ  . PHE A 203 ? 0.3352 0.2373 0.4535 0.0078  -0.0831 0.0824  204 PHE A CZ  
1280 N N   . VAL A 204 ? 0.3057 0.2142 0.3283 0.0009  -0.0608 0.0575  205 VAL A N   
1281 C CA  . VAL A 204 ? 0.2537 0.1608 0.2691 0.0020  -0.0520 0.0524  205 VAL A CA  
1282 C C   . VAL A 204 ? 0.2875 0.1959 0.3226 0.0059  -0.0463 0.0480  205 VAL A C   
1283 O O   . VAL A 204 ? 0.2541 0.1669 0.3033 0.0080  -0.0449 0.0440  205 VAL A O   
1284 C CB  . VAL A 204 ? 0.2969 0.2050 0.2974 0.0016  -0.0467 0.0449  205 VAL A CB  
1285 C CG1 . VAL A 204 ? 0.2888 0.1960 0.2833 0.0026  -0.0381 0.0400  205 VAL A CG1 
1286 C CG2 . VAL A 204 ? 0.2672 0.1745 0.2494 -0.0021 -0.0518 0.0465  205 VAL A CG2 
1287 N N   . TYR A 205 ? 0.2452 0.1508 0.2817 0.0063  -0.0429 0.0484  206 TYR A N   
1288 C CA  . TYR A 205 ? 0.3014 0.2081 0.3550 0.0096  -0.0370 0.0425  206 TYR A CA  
1289 C C   . TYR A 205 ? 0.3054 0.2132 0.3463 0.0094  -0.0282 0.0353  206 TYR A C   
1290 O O   . TYR A 205 ? 0.2863 0.1909 0.3148 0.0077  -0.0268 0.0372  206 TYR A O   
1291 C CB  . TYR A 205 ? 0.2582 0.1600 0.3250 0.0100  -0.0407 0.0483  206 TYR A CB  
1292 C CG  . TYR A 205 ? 0.2554 0.1576 0.3421 0.0133  -0.0352 0.0410  206 TYR A CG  
1293 C CD1 . TYR A 205 ? 0.2509 0.1597 0.3495 0.0160  -0.0292 0.0308  206 TYR A CD1 
1294 C CD2 . TYR A 205 ? 0.2444 0.1410 0.3379 0.0130  -0.0360 0.0440  206 TYR A CD2 
1295 C CE1 . TYR A 205 ? 0.2398 0.1502 0.3561 0.0186  -0.0236 0.0223  206 TYR A CE1 
1296 C CE2 . TYR A 205 ? 0.3038 0.2002 0.4162 0.0160  -0.0312 0.0360  206 TYR A CE2 
1297 C CZ  . TYR A 205 ? 0.3132 0.2167 0.4365 0.0188  -0.0248 0.0244  206 TYR A CZ  
1298 O OH  . TYR A 205 ? 0.2329 0.1375 0.3739 0.0211  -0.0196 0.0146  206 TYR A OH  
1299 N N   . ALA A 206 ? 0.3254 0.2386 0.3693 0.0104  -0.0228 0.0277  207 ALA A N   
1300 C CA  . ALA A 206 ? 0.2189 0.1340 0.2528 0.0097  -0.0156 0.0217  207 ALA A CA  
1301 C C   . ALA A 206 ? 0.2983 0.2156 0.3448 0.0110  -0.0099 0.0156  207 ALA A C   
1302 O O   . ALA A 206 ? 0.2393 0.1618 0.3020 0.0125  -0.0080 0.0108  207 ALA A O   
1303 C CB  . ALA A 206 ? 0.2221 0.1424 0.2505 0.0085  -0.0139 0.0183  207 ALA A CB  
1304 N N   . VAL A 207 ? 0.2757 0.1896 0.3153 0.0103  -0.0070 0.0150  208 VAL A N   
1305 C CA  . VAL A 207 ? 0.2666 0.1821 0.3160 0.0109  -0.0017 0.0083  208 VAL A CA  
1306 C C   . VAL A 207 ? 0.2874 0.2059 0.3232 0.0087  0.0037  0.0041  208 VAL A C   
1307 O O   . VAL A 207 ? 0.2755 0.1903 0.2990 0.0076  0.0035  0.0074  208 VAL A O   
1308 C CB  . VAL A 207 ? 0.2531 0.1616 0.3100 0.0115  -0.0044 0.0124  208 VAL A CB  
1309 C CG1 . VAL A 207 ? 0.2192 0.1284 0.2855 0.0118  0.0009  0.0045  208 VAL A CG1 
1310 C CG2 . VAL A 207 ? 0.2251 0.1309 0.2986 0.0134  -0.0112 0.0176  208 VAL A CG2 
1311 N N   . SER A 208 ? 0.2640 0.1902 0.3024 0.0076  0.0084  -0.0029 209 SER A N   
1312 C CA  . SER A 208 ? 0.2578 0.1879 0.2830 0.0047  0.0116  -0.0048 209 SER A CA  
1313 C C   . SER A 208 ? 0.2684 0.2025 0.2967 0.0030  0.0169  -0.0120 209 SER A C   
1314 O O   . SER A 208 ? 0.2279 0.1647 0.2697 0.0039  0.0195  -0.0183 209 SER A O   
1315 C CB  . SER A 208 ? 0.2011 0.1383 0.2236 0.0028  0.0114  -0.0049 209 SER A CB  
1316 O OG  . SER A 208 ? 0.2337 0.1792 0.2688 0.0025  0.0146  -0.0106 209 SER A OG  
1317 N N   . PRO A 209 ? 0.2367 0.1714 0.2535 0.0005  0.0183  -0.0117 210 PRO A N   
1318 C CA  . PRO A 209 ? 0.2331 0.1710 0.2505 -0.0019 0.0224  -0.0179 210 PRO A CA  
1319 C C   . PRO A 209 ? 0.2960 0.2457 0.3112 -0.0062 0.0261  -0.0236 210 PRO A C   
1320 O O   . PRO A 209 ? 0.2953 0.2497 0.3074 -0.0075 0.0251  -0.0210 210 PRO A O   
1321 C CB  . PRO A 209 ? 0.2026 0.1364 0.2089 -0.0028 0.0209  -0.0131 210 PRO A CB  
1322 C CG  . PRO A 209 ? 0.2533 0.1874 0.2510 -0.0029 0.0178  -0.0076 210 PRO A CG  
1323 C CD  . PRO A 209 ? 0.2314 0.1632 0.2353 -0.0001 0.0154  -0.0057 210 PRO A CD  
1324 N N   . PHE A 210 ? 0.2908 0.2457 0.3068 -0.0092 0.0300  -0.0308 211 PHE A N   
1325 C CA  . PHE A 210 ? 0.2496 0.2177 0.2617 -0.0148 0.0339  -0.0364 211 PHE A CA  
1326 C C   . PHE A 210 ? 0.2777 0.2493 0.2752 -0.0196 0.0314  -0.0300 211 PHE A C   
1327 O O   . PHE A 210 ? 0.3129 0.2955 0.3053 -0.0251 0.0326  -0.0304 211 PHE A O   
1328 C CB  . PHE A 210 ? 0.2718 0.2450 0.2890 -0.0172 0.0388  -0.0476 211 PHE A CB  
1329 C CG  . PHE A 210 ? 0.2314 0.2017 0.2404 -0.0198 0.0376  -0.0465 211 PHE A CG  
1330 C CD1 . PHE A 210 ? 0.2750 0.2543 0.2715 -0.0266 0.0377  -0.0459 211 PHE A CD1 
1331 C CD2 . PHE A 210 ? 0.2141 0.1731 0.2285 -0.0161 0.0357  -0.0450 211 PHE A CD2 
1332 C CE1 . PHE A 210 ? 0.2805 0.2574 0.2711 -0.0291 0.0358  -0.0445 211 PHE A CE1 
1333 C CE2 . PHE A 210 ? 0.3405 0.2975 0.3487 -0.0187 0.0346  -0.0438 211 PHE A CE2 
1334 C CZ  . PHE A 210 ? 0.3147 0.2806 0.3115 -0.0249 0.0346  -0.0438 211 PHE A CZ  
1335 N N   . ASN A 211 ? 0.2248 0.1882 0.2170 -0.0182 0.0278  -0.0242 212 ASN A N   
1336 C CA  . ASN A 211 ? 0.2443 0.2116 0.2266 -0.0231 0.0256  -0.0202 212 ASN A CA  
1337 C C   . ASN A 211 ? 0.2806 0.2498 0.2570 -0.0252 0.0212  -0.0121 212 ASN A C   
1338 O O   . ASN A 211 ? 0.3634 0.3399 0.3338 -0.0311 0.0194  -0.0093 212 ASN A O   
1339 C CB  . ASN A 211 ? 0.3107 0.2707 0.2918 -0.0215 0.0241  -0.0184 212 ASN A CB  
1340 C CG  . ASN A 211 ? 0.2607 0.2105 0.2425 -0.0160 0.0211  -0.0122 212 ASN A CG  
1341 O OD1 . ASN A 211 ? 0.3770 0.3231 0.3617 -0.0125 0.0204  -0.0107 212 ASN A OD1 
1342 N ND2 . ASN A 211 ? 0.3183 0.2647 0.2979 -0.0157 0.0194  -0.0091 212 ASN A ND2 
1343 N N   . PHE A 212 ? 0.2861 0.2491 0.2651 -0.0208 0.0187  -0.0080 213 PHE A N   
1344 C CA  . PHE A 212 ? 0.2713 0.2359 0.2473 -0.0230 0.0143  -0.0013 213 PHE A CA  
1345 C C   . PHE A 212 ? 0.2372 0.2032 0.2177 -0.0216 0.0146  -0.0014 213 PHE A C   
1346 O O   . PHE A 212 ? 0.2674 0.2265 0.2528 -0.0162 0.0146  -0.0025 213 PHE A O   
1347 C CB  . PHE A 212 ? 0.2766 0.2318 0.2514 -0.0196 0.0093  0.0043  213 PHE A CB  
1348 C CG  . PHE A 212 ? 0.3393 0.2955 0.3114 -0.0221 0.0076  0.0062  213 PHE A CG  
1349 C CD1 . PHE A 212 ? 0.3875 0.3409 0.3599 -0.0203 0.0102  0.0028  213 PHE A CD1 
1350 C CD2 . PHE A 212 ? 0.3655 0.3256 0.3361 -0.0268 0.0025  0.0123  213 PHE A CD2 
1351 C CE1 . PHE A 212 ? 0.4559 0.4111 0.4273 -0.0228 0.0082  0.0047  213 PHE A CE1 
1352 C CE2 . PHE A 212 ? 0.3823 0.3437 0.3524 -0.0293 -0.0001 0.0149  213 PHE A CE2 
1353 C CZ  . PHE A 212 ? 0.4488 0.4080 0.4191 -0.0272 0.0029  0.0108  213 PHE A CZ  
1354 N N   . THR A 213 ? 0.2783 0.2543 0.2576 -0.0272 0.0145  0.0004  214 THR A N   
1355 C CA  . THR A 213 ? 0.3085 0.2871 0.2928 -0.0269 0.0140  0.0015  214 THR A CA  
1356 C C   . THR A 213 ? 0.3394 0.3064 0.3244 -0.0224 0.0079  0.0073  214 THR A C   
1357 O O   . THR A 213 ? 0.2870 0.2503 0.2772 -0.0186 0.0072  0.0068  214 THR A O   
1358 C CB  . THR A 213 ? 0.2986 0.2908 0.2801 -0.0353 0.0142  0.0044  214 THR A CB  
1359 O OG1 . THR A 213 ? 0.2971 0.3013 0.2767 -0.0399 0.0208  -0.0029 214 THR A OG1 
1360 C CG2 . THR A 213 ? 0.2836 0.2798 0.2716 -0.0355 0.0138  0.0061  214 THR A CG2 
1361 N N   . ALA A 214 ? 0.2923 0.2539 0.2732 -0.0228 0.0032  0.0121  215 ALA A N   
1362 C CA  . ALA A 214 ? 0.2629 0.2144 0.2449 -0.0189 -0.0023 0.0157  215 ALA A CA  
1363 C C   . ALA A 214 ? 0.2971 0.2400 0.2794 -0.0123 -0.0010 0.0122  215 ALA A C   
1364 O O   . ALA A 214 ? 0.2774 0.2142 0.2605 -0.0094 -0.0043 0.0132  215 ALA A O   
1365 C CB  . ALA A 214 ? 0.2374 0.1858 0.2181 -0.0203 -0.0070 0.0200  215 ALA A CB  
1366 N N   . ILE A 215 ? 0.2594 0.2020 0.2408 -0.0107 0.0033  0.0084  216 ILE A N   
1367 C CA  . ILE A 215 ? 0.2641 0.1992 0.2456 -0.0057 0.0040  0.0068  216 ILE A CA  
1368 C C   . ILE A 215 ? 0.2661 0.2015 0.2531 -0.0041 0.0040  0.0060  216 ILE A C   
1369 O O   . ILE A 215 ? 0.2590 0.1885 0.2454 -0.0012 0.0014  0.0075  216 ILE A O   
1370 C CB  . ILE A 215 ? 0.2793 0.2135 0.2601 -0.0050 0.0078  0.0040  216 ILE A CB  
1371 C CG1 . ILE A 215 ? 0.2490 0.1822 0.2260 -0.0058 0.0067  0.0054  216 ILE A CG1 
1372 C CG2 . ILE A 215 ? 0.2638 0.1918 0.2457 -0.0013 0.0082  0.0039  216 ILE A CG2 
1373 C CD1 . ILE A 215 ? 0.4624 0.3955 0.4392 -0.0058 0.0101  0.0031  216 ILE A CD1 
1374 N N   . ALA A 216 ? 0.1977 0.1409 0.1903 -0.0063 0.0069  0.0035  217 ALA A N   
1375 C CA  . ALA A 216 ? 0.2682 0.2131 0.2693 -0.0047 0.0065  0.0029  217 ALA A CA  
1376 C C   . ALA A 216 ? 0.3116 0.2543 0.3114 -0.0049 0.0010  0.0075  217 ALA A C   
1377 O O   . ALA A 216 ? 0.2745 0.2127 0.2772 -0.0022 -0.0022 0.0090  217 ALA A O   
1378 C CB  . ALA A 216 ? 0.2209 0.1772 0.2294 -0.0076 0.0114  -0.0020 217 ALA A CB  
1379 N N   . ALA A 217 ? 0.2481 0.1935 0.2440 -0.0085 -0.0009 0.0101  218 ALA A N   
1380 C CA  . ALA A 217 ? 0.2940 0.2363 0.2900 -0.0090 -0.0068 0.0141  218 ALA A CA  
1381 C C   . ALA A 217 ? 0.2907 0.2224 0.2818 -0.0051 -0.0107 0.0145  218 ALA A C   
1382 O O   . ALA A 217 ? 0.2926 0.2211 0.2849 -0.0040 -0.0149 0.0157  218 ALA A O   
1383 C CB  . ALA A 217 ? 0.2636 0.2097 0.2580 -0.0140 -0.0092 0.0179  218 ALA A CB  
1384 N N   . ASN A 218 ? 0.2610 0.1887 0.2465 -0.0036 -0.0093 0.0132  219 ASN A N   
1385 C CA  . ASN A 218 ? 0.2925 0.2127 0.2725 -0.0005 -0.0112 0.0122  219 ASN A CA  
1386 C C   . ASN A 218 ? 0.3116 0.2296 0.2912 0.0016  -0.0114 0.0124  219 ASN A C   
1387 O O   . ASN A 218 ? 0.2947 0.2089 0.2708 0.0024  -0.0153 0.0129  219 ASN A O   
1388 C CB  . ASN A 218 ? 0.4166 0.3355 0.3927 0.0004  -0.0080 0.0104  219 ASN A CB  
1389 C CG  . ASN A 218 ? 0.4660 0.3798 0.4362 0.0029  -0.0084 0.0087  219 ASN A CG  
1390 O OD1 . ASN A 218 ? 0.5018 0.4125 0.4702 0.0035  -0.0119 0.0074  219 ASN A OD1 
1391 N ND2 . ASN A 218 ? 0.4619 0.3756 0.4294 0.0038  -0.0047 0.0081  219 ASN A ND2 
1392 N N   . LEU A 219 ? 0.2997 0.2203 0.2835 0.0021  -0.0077 0.0119  220 LEU A N   
1393 C CA  . LEU A 219 ? 0.3121 0.2300 0.2977 0.0038  -0.0088 0.0135  220 LEU A CA  
1394 C C   . LEU A 219 ? 0.3047 0.2232 0.2959 0.0039  -0.0135 0.0159  220 LEU A C   
1395 O O   . LEU A 219 ? 0.2607 0.1758 0.2500 0.0045  -0.0174 0.0188  220 LEU A O   
1396 C CB  . LEU A 219 ? 0.2440 0.1639 0.2368 0.0044  -0.0045 0.0120  220 LEU A CB  
1397 C CG  . LEU A 219 ? 0.2673 0.1856 0.2547 0.0043  -0.0009 0.0106  220 LEU A CG  
1398 C CD1 . LEU A 219 ? 0.2535 0.1738 0.2501 0.0045  0.0029  0.0080  220 LEU A CD1 
1399 C CD2 . LEU A 219 ? 0.2575 0.1708 0.2373 0.0049  -0.0027 0.0136  220 LEU A CD2 
1400 N N   . ILE A 220 ? 0.2478 0.1717 0.2461 0.0025  -0.0135 0.0152  221 ILE A N   
1401 C CA  . ILE A 220 ? 0.2727 0.1981 0.2779 0.0024  -0.0181 0.0175  221 ILE A CA  
1402 C C   . ILE A 220 ? 0.3073 0.2295 0.3060 0.0009  -0.0236 0.0189  221 ILE A C   
1403 O O   . ILE A 220 ? 0.2966 0.2169 0.2960 0.0009  -0.0291 0.0211  221 ILE A O   
1404 C CB  . ILE A 220 ? 0.2509 0.1854 0.2692 0.0013  -0.0150 0.0159  221 ILE A CB  
1405 C CG1 . ILE A 220 ? 0.2034 0.1433 0.2188 -0.0024 -0.0129 0.0151  221 ILE A CG1 
1406 C CG2 . ILE A 220 ? 0.2158 0.1532 0.2428 0.0030  -0.0097 0.0123  221 ILE A CG2 
1407 C CD1 . ILE A 220 ? 0.2006 0.1523 0.2264 -0.0049 -0.0083 0.0128  221 ILE A CD1 
1408 N N   . GLY A 221 ? 0.3336 0.2551 0.3271 -0.0005 -0.0227 0.0175  222 GLY A N   
1409 C CA  . GLY A 221 ? 0.2947 0.2131 0.2860 -0.0020 -0.0281 0.0180  222 GLY A CA  
1410 C C   . GLY A 221 ? 0.2979 0.2093 0.2799 -0.0006 -0.0316 0.0160  222 GLY A C   
1411 O O   . GLY A 221 ? 0.3643 0.2732 0.3457 -0.0015 -0.0373 0.0159  222 GLY A O   
1412 N N   . ALA A 222 ? 0.2645 0.1737 0.2392 0.0010  -0.0280 0.0137  223 ALA A N   
1413 C CA  . ALA A 222 ? 0.3087 0.2137 0.2734 0.0017  -0.0297 0.0108  223 ALA A CA  
1414 C C   . ALA A 222 ? 0.3635 0.2681 0.3248 0.0008  -0.0343 0.0133  223 ALA A C   
1415 O O   . ALA A 222 ? 0.3847 0.2871 0.3416 -0.0004 -0.0392 0.0112  223 ALA A O   
1416 C CB  . ALA A 222 ? 0.2319 0.1368 0.1904 0.0030  -0.0241 0.0088  223 ALA A CB  
1417 N N   . PRO A 223 ? 0.3330 0.2397 0.2977 0.0010  -0.0336 0.0178  224 PRO A N   
1418 C CA  . PRO A 223 ? 0.3084 0.2148 0.2715 -0.0004 -0.0398 0.0216  224 PRO A CA  
1419 C C   . PRO A 223 ? 0.3008 0.2080 0.2717 -0.0015 -0.0455 0.0227  224 PRO A C   
1420 O O   . PRO A 223 ? 0.3592 0.2651 0.3248 -0.0035 -0.0517 0.0231  224 PRO A O   
1421 C CB  . PRO A 223 ? 0.2941 0.2021 0.2647 0.0005  -0.0385 0.0268  224 PRO A CB  
1422 C CG  . PRO A 223 ? 0.3645 0.2747 0.3439 0.0024  -0.0319 0.0244  224 PRO A CG  
1423 C CD  . PRO A 223 ? 0.2996 0.2085 0.2708 0.0024  -0.0284 0.0195  224 PRO A CD  
1424 N N   . ALA A 224 ? 0.2480 0.1586 0.2311 -0.0010 -0.0435 0.0231  225 ALA A N   
1425 C CA  . ALA A 224 ? 0.3133 0.2264 0.3056 -0.0025 -0.0488 0.0252  225 ALA A CA  
1426 C C   . ALA A 224 ? 0.3079 0.2172 0.2948 -0.0045 -0.0538 0.0224  225 ALA A C   
1427 O O   . ALA A 224 ? 0.3405 0.2495 0.3292 -0.0063 -0.0606 0.0238  225 ALA A O   
1428 C CB  . ALA A 224 ? 0.2594 0.1792 0.2655 -0.0025 -0.0447 0.0259  225 ALA A CB  
1429 N N   . LEU A 225 ? 0.3242 0.2305 0.3061 -0.0041 -0.0509 0.0182  226 LEU A N   
1430 C CA  . LEU A 225 ? 0.3452 0.2469 0.3250 -0.0055 -0.0556 0.0143  226 LEU A CA  
1431 C C   . LEU A 225 ? 0.3804 0.2788 0.3498 -0.0064 -0.0607 0.0110  226 LEU A C   
1432 O O   . LEU A 225 ? 0.3329 0.2285 0.3033 -0.0084 -0.0670 0.0084  226 LEU A O   
1433 C CB  . LEU A 225 ? 0.3808 0.2798 0.3585 -0.0041 -0.0515 0.0102  226 LEU A CB  
1434 C CG  . LEU A 225 ? 0.4041 0.2979 0.3851 -0.0050 -0.0562 0.0060  226 LEU A CG  
1435 C CD1 . LEU A 225 ? 0.3567 0.2520 0.3497 -0.0081 -0.0608 0.0111  226 LEU A CD1 
1436 C CD2 . LEU A 225 ? 0.4431 0.3348 0.4242 -0.0031 -0.0521 0.0026  226 LEU A CD2 
1437 N N   . MET A 226 ? 0.2949 0.1942 0.2543 -0.0058 -0.0583 0.0112  227 MET A N   
1438 C CA  . MET A 226 ? 0.3287 0.2269 0.2751 -0.0080 -0.0623 0.0081  227 MET A CA  
1439 C C   . MET A 226 ? 0.3346 0.2352 0.2823 -0.0104 -0.0692 0.0148  227 MET A C   
1440 O O   . MET A 226 ? 0.3788 0.2805 0.3148 -0.0132 -0.0726 0.0154  227 MET A O   
1441 C CB  . MET A 226 ? 0.3600 0.2595 0.2941 -0.0074 -0.0566 0.0060  227 MET A CB  
1442 C CG  . MET A 226 ? 0.3317 0.2298 0.2667 -0.0046 -0.0496 0.0001  227 MET A CG  
1443 S SD  . MET A 226 ? 0.3700 0.2632 0.3094 -0.0042 -0.0527 -0.0094 227 MET A SD  
1444 C CE  . MET A 226 ? 0.3493 0.2434 0.2725 -0.0069 -0.0547 -0.0187 227 MET A CE  
1445 N N   . GLY A 227 ? 0.3219 0.2245 0.2846 -0.0100 -0.0712 0.0201  228 GLY A N   
1446 C CA  . GLY A 227 ? 0.2959 0.2014 0.2648 -0.0118 -0.0781 0.0267  228 GLY A CA  
1447 C C   . GLY A 227 ? 0.3713 0.2797 0.3441 -0.0108 -0.0773 0.0338  228 GLY A C   
1448 O O   . GLY A 227 ? 0.3068 0.2171 0.2837 -0.0126 -0.0845 0.0398  228 GLY A O   
1449 N N   . ASN A 228 ? 0.3290 0.2375 0.3020 -0.0081 -0.0696 0.0335  229 ASN A N   
1450 C CA  . ASN A 228 ? 0.3174 0.2278 0.2986 -0.0068 -0.0691 0.0399  229 ASN A CA  
1451 C C   . ASN A 228 ? 0.2995 0.2140 0.3018 -0.0041 -0.0667 0.0411  229 ASN A C   
1452 O O   . ASN A 228 ? 0.3135 0.2299 0.3206 -0.0035 -0.0627 0.0370  229 ASN A O   
1453 C CB  . ASN A 228 ? 0.2912 0.2001 0.2643 -0.0055 -0.0620 0.0386  229 ASN A CB  
1454 C CG  . ASN A 228 ? 0.2972 0.2045 0.2504 -0.0086 -0.0633 0.0376  229 ASN A CG  
1455 O OD1 . ASN A 228 ? 0.3280 0.2362 0.2755 -0.0118 -0.0690 0.0438  229 ASN A OD1 
1456 N ND2 . ASN A 228 ? 0.2883 0.1943 0.2315 -0.0082 -0.0584 0.0297  229 ASN A ND2 
1457 N N   . THR A 229 ? 0.2853 0.2019 0.3011 -0.0029 -0.0691 0.0466  230 THR A N   
1458 C CA  . THR A 229 ? 0.3024 0.2243 0.3392 0.0001  -0.0645 0.0454  230 THR A CA  
1459 C C   . THR A 229 ? 0.3233 0.2443 0.3648 0.0028  -0.0583 0.0446  230 THR A C   
1460 O O   . THR A 229 ? 0.3005 0.2169 0.3323 0.0022  -0.0597 0.0479  230 THR A O   
1461 C CB  . THR A 229 ? 0.2760 0.2024 0.3320 0.0002  -0.0714 0.0500  230 THR A CB  
1462 O OG1 . THR A 229 ? 0.2948 0.2182 0.3524 -0.0004 -0.0792 0.0576  230 THR A OG1 
1463 C CG2 . THR A 229 ? 0.3061 0.2340 0.3590 -0.0028 -0.0769 0.0499  230 THR A CG2 
1464 N N   . VAL A 230 ? 0.2912 0.2175 0.3476 0.0053  -0.0515 0.0400  231 VAL A N   
1465 C CA  . VAL A 230 ? 0.2443 0.1698 0.3007 0.0072  -0.0436 0.0360  231 VAL A CA  
1466 C C   . VAL A 230 ? 0.2616 0.1925 0.3410 0.0101  -0.0398 0.0328  231 VAL A C   
1467 O O   . VAL A 230 ? 0.2773 0.2164 0.3705 0.0105  -0.0376 0.0294  231 VAL A O   
1468 C CB  . VAL A 230 ? 0.2619 0.1888 0.3060 0.0061  -0.0364 0.0301  231 VAL A CB  
1469 C CG1 . VAL A 230 ? 0.2198 0.1468 0.2647 0.0076  -0.0285 0.0257  231 VAL A CG1 
1470 C CG2 . VAL A 230 ? 0.2493 0.1705 0.2729 0.0039  -0.0395 0.0312  231 VAL A CG2 
1471 N N   . VAL A 231 ? 0.2510 0.1780 0.3352 0.0119  -0.0386 0.0333  232 VAL A N   
1472 C CA  . VAL A 231 ? 0.2385 0.1695 0.3448 0.0151  -0.0341 0.0280  232 VAL A CA  
1473 C C   . VAL A 231 ? 0.2650 0.1951 0.3612 0.0149  -0.0255 0.0217  232 VAL A C   
1474 O O   . VAL A 231 ? 0.2479 0.1708 0.3314 0.0141  -0.0264 0.0250  232 VAL A O   
1475 C CB  . VAL A 231 ? 0.2984 0.2242 0.4214 0.0170  -0.0419 0.0347  232 VAL A CB  
1476 C CG1 . VAL A 231 ? 0.3278 0.2537 0.4697 0.0202  -0.0373 0.0290  232 VAL A CG1 
1477 C CG2 . VAL A 231 ? 0.2319 0.1616 0.3714 0.0176  -0.0496 0.0392  232 VAL A CG2 
1478 N N   . TRP A 232 ? 0.2304 0.1690 0.3316 0.0148  -0.0173 0.0129  233 TRP A N   
1479 C CA  . TRP A 232 ? 0.2398 0.1793 0.3283 0.0132  -0.0098 0.0073  233 TRP A CA  
1480 C C   . TRP A 232 ? 0.2253 0.1703 0.3295 0.0148  -0.0027 -0.0022 233 TRP A C   
1481 O O   . TRP A 232 ? 0.2395 0.1951 0.3572 0.0148  0.0017  -0.0089 233 TRP A O   
1482 C CB  . TRP A 232 ? 0.2391 0.1845 0.3141 0.0097  -0.0072 0.0062  233 TRP A CB  
1483 C CG  . TRP A 232 ? 0.2025 0.1517 0.2672 0.0072  0.0000  0.0008  233 TRP A CG  
1484 C CD1 . TRP A 232 ? 0.2028 0.1475 0.2608 0.0075  0.0029  -0.0012 233 TRP A CD1 
1485 C CD2 . TRP A 232 ? 0.2196 0.1787 0.2800 0.0032  0.0043  -0.0022 233 TRP A CD2 
1486 N NE1 . TRP A 232 ? 0.2382 0.1892 0.2878 0.0041  0.0084  -0.0055 233 TRP A NE1 
1487 C CE2 . TRP A 232 ? 0.2432 0.2032 0.2937 0.0012  0.0092  -0.0057 233 TRP A CE2 
1488 C CE3 . TRP A 232 ? 0.2048 0.1724 0.2686 0.0005  0.0039  -0.0012 233 TRP A CE3 
1489 C CZ2 . TRP A 232 ? 0.2245 0.1938 0.2681 -0.0039 0.0131  -0.0076 233 TRP A CZ2 
1490 C CZ3 . TRP A 232 ? 0.2662 0.2431 0.3233 -0.0046 0.0082  -0.0029 233 TRP A CZ3 
1491 C CH2 . TRP A 232 ? 0.2611 0.2388 0.3078 -0.0069 0.0125  -0.0058 233 TRP A CH2 
1492 N N   . LYS A 233 ? 0.2460 0.1845 0.3494 0.0157  -0.0016 -0.0033 234 LYS A N   
1493 C CA  . LYS A 233 ? 0.2278 0.1706 0.3440 0.0167  0.0053  -0.0138 234 LYS A CA  
1494 C C   . LYS A 233 ? 0.2205 0.1661 0.3189 0.0132  0.0117  -0.0184 234 LYS A C   
1495 O O   . LYS A 233 ? 0.2324 0.1704 0.3198 0.0126  0.0107  -0.0153 234 LYS A O   
1496 C CB  . LYS A 233 ? 0.2800 0.2136 0.4115 0.0198  0.0015  -0.0122 234 LYS A CB  
1497 C CG  . LYS A 233 ? 0.2171 0.1550 0.3679 0.0215  0.0078  -0.0250 234 LYS A CG  
1498 C CD  . LYS A 233 ? 0.2221 0.1491 0.3793 0.0227  0.0052  -0.0236 234 LYS A CD  
1499 C CE  . LYS A 233 ? 0.2207 0.1433 0.3528 0.0191  0.0069  -0.0202 234 LYS A CE  
1500 N NZ  . LYS A 233 ? 0.2910 0.2235 0.4086 0.0159  0.0151  -0.0286 234 LYS A NZ  
1501 N N   . PRO A 234 ? 0.2319 0.1894 0.3277 0.0102  0.0180  -0.0254 235 PRO A N   
1502 C CA  . PRO A 234 ? 0.2320 0.1925 0.3110 0.0061  0.0226  -0.0284 235 PRO A CA  
1503 C C   . PRO A 234 ? 0.2347 0.1951 0.3206 0.0064  0.0273  -0.0373 235 PRO A C   
1504 O O   . PRO A 234 ? 0.2244 0.1846 0.3304 0.0096  0.0282  -0.0435 235 PRO A O   
1505 C CB  . PRO A 234 ? 0.2337 0.2087 0.3103 0.0018  0.0274  -0.0325 235 PRO A CB  
1506 C CG  . PRO A 234 ? 0.2565 0.2388 0.3561 0.0045  0.0296  -0.0390 235 PRO A CG  
1507 C CD  . PRO A 234 ? 0.2363 0.2064 0.3447 0.0096  0.0213  -0.0307 235 PRO A CD  
1508 N N   . SER A 235 ? 0.2590 0.2195 0.3295 0.0029  0.0295  -0.0379 236 SER A N   
1509 C CA  . SER A 235 ? 0.2912 0.2534 0.3655 0.0017  0.0341  -0.0472 236 SER A CA  
1510 C C   . SER A 235 ? 0.2773 0.2540 0.3622 -0.0003 0.0414  -0.0602 236 SER A C   
1511 O O   . SER A 235 ? 0.2858 0.2742 0.3641 -0.0042 0.0441  -0.0605 236 SER A O   
1512 C CB  . SER A 235 ? 0.2813 0.2434 0.3357 -0.0027 0.0347  -0.0446 236 SER A CB  
1513 O OG  . SER A 235 ? 0.2828 0.2478 0.3397 -0.0049 0.0390  -0.0541 236 SER A OG  
1514 N N   . GLN A 236 ? 0.2424 0.2192 0.3445 0.0018  0.0446  -0.0711 237 GLN A N   
1515 C CA  . GLN A 236 ? 0.2225 0.2145 0.3355 -0.0004 0.0528  -0.0865 237 GLN A CA  
1516 C C   . GLN A 236 ? 0.2690 0.2744 0.3612 -0.0086 0.0581  -0.0898 237 GLN A C   
1517 O O   . GLN A 236 ? 0.2284 0.2500 0.3205 -0.0127 0.0639  -0.0964 237 GLN A O   
1518 C CB  . GLN A 236 ? 0.2569 0.2451 0.3893 0.0026  0.0551  -0.0988 237 GLN A CB  
1519 C CG  . GLN A 236 ? 0.2294 0.2045 0.3861 0.0100  0.0491  -0.0956 237 GLN A CG  
1520 C CD  . GLN A 236 ? 0.2882 0.2719 0.4704 0.0138  0.0518  -0.1039 237 GLN A CD  
1521 O OE1 . GLN A 236 ? 0.2512 0.2447 0.4297 0.0125  0.0532  -0.1011 237 GLN A OE1 
1522 N NE2 . GLN A 236 ? 0.2440 0.2242 0.4543 0.0183  0.0522  -0.1145 237 GLN A NE2 
1523 N N   . THR A 237 ? 0.2416 0.2411 0.3161 -0.0116 0.0555  -0.0842 238 THR A N   
1524 C CA  . THR A 237 ? 0.2272 0.2391 0.2840 -0.0200 0.0593  -0.0874 238 THR A CA  
1525 C C   . THR A 237 ? 0.2689 0.2832 0.3070 -0.0242 0.0554  -0.0739 238 THR A C   
1526 O O   . THR A 237 ? 0.2658 0.2870 0.2879 -0.0312 0.0557  -0.0720 238 THR A O   
1527 C CB  . THR A 237 ? 0.2837 0.2903 0.3350 -0.0218 0.0591  -0.0913 238 THR A CB  
1528 O OG1 . THR A 237 ? 0.2552 0.2454 0.3026 -0.0179 0.0520  -0.0792 238 THR A OG1 
1529 C CG2 . THR A 237 ? 0.2426 0.2488 0.3140 -0.0188 0.0633  -0.1066 238 THR A CG2 
1530 N N   . ALA A 238 ? 0.2183 0.2271 0.2597 -0.0203 0.0512  -0.0648 239 ALA A N   
1531 C CA  . ALA A 238 ? 0.2151 0.2286 0.2438 -0.0245 0.0482  -0.0546 239 ALA A CA  
1532 C C   . ALA A 238 ? 0.2934 0.3137 0.3328 -0.0233 0.0494  -0.0546 239 ALA A C   
1533 O O   . ALA A 238 ? 0.2983 0.3172 0.3322 -0.0242 0.0449  -0.0446 239 ALA A O   
1534 C CB  . ALA A 238 ? 0.2180 0.2168 0.2374 -0.0218 0.0405  -0.0420 239 ALA A CB  
1535 N N   . ALA A 239 ? 0.2374 0.2648 0.2940 -0.0210 0.0552  -0.0663 240 ALA A N   
1536 C CA  . ALA A 239 ? 0.3070 0.3415 0.3778 -0.0191 0.0564  -0.0672 240 ALA A CA  
1537 C C   . ALA A 239 ? 0.2607 0.3107 0.3216 -0.0271 0.0583  -0.0631 240 ALA A C   
1538 O O   . ALA A 239 ? 0.3029 0.3521 0.3667 -0.0262 0.0545  -0.0551 240 ALA A O   
1539 C CB  . ALA A 239 ? 0.2304 0.2723 0.3244 -0.0157 0.0632  -0.0827 240 ALA A CB  
1540 N N   . LEU A 240 ? 0.2225 0.2866 0.2713 -0.0355 0.0636  -0.0678 241 LEU A N   
1541 C CA  . LEU A 240 ? 0.2699 0.3509 0.3096 -0.0447 0.0656  -0.0633 241 LEU A CA  
1542 C C   . LEU A 240 ? 0.2937 0.3654 0.3213 -0.0464 0.0562  -0.0461 241 LEU A C   
1543 O O   . LEU A 240 ? 0.3252 0.4019 0.3564 -0.0482 0.0544  -0.0398 241 LEU A O   
1544 C CB  . LEU A 240 ? 0.3134 0.4113 0.3398 -0.0548 0.0719  -0.0703 241 LEU A CB  
1545 C CG  . LEU A 240 ? 0.3697 0.4877 0.3854 -0.0664 0.0740  -0.0649 241 LEU A CG  
1546 C CD1 . LEU A 240 ? 0.3960 0.5292 0.4278 -0.0664 0.0809  -0.0720 241 LEU A CD1 
1547 C CD2 . LEU A 240 ? 0.4113 0.5450 0.4106 -0.0773 0.0788  -0.0703 241 LEU A CD2 
1548 N N   . SER A 241 ? 0.2201 0.2787 0.2352 -0.0458 0.0503  -0.0391 242 SER A N   
1549 C CA  . SER A 241 ? 0.2691 0.3184 0.2752 -0.0469 0.0414  -0.0245 242 SER A CA  
1550 C C   . SER A 241 ? 0.2571 0.2924 0.2731 -0.0385 0.0360  -0.0198 242 SER A C   
1551 O O   . SER A 241 ? 0.2776 0.3109 0.2925 -0.0400 0.0306  -0.0108 242 SER A O   
1552 C CB  . SER A 241 ? 0.2170 0.2560 0.2109 -0.0473 0.0367  -0.0196 242 SER A CB  
1553 O OG  . SER A 241 ? 0.2356 0.2581 0.2344 -0.0382 0.0347  -0.0216 242 SER A OG  
1554 N N   . ASN A 242 ? 0.2135 0.2392 0.2393 -0.0305 0.0370  -0.0258 243 ASN A N   
1555 C CA  . ASN A 242 ? 0.2617 0.2748 0.2956 -0.0233 0.0315  -0.0212 243 ASN A CA  
1556 C C   . ASN A 242 ? 0.2515 0.2739 0.2981 -0.0237 0.0325  -0.0218 243 ASN A C   
1557 O O   . ASN A 242 ? 0.2719 0.2883 0.3202 -0.0220 0.0264  -0.0142 243 ASN A O   
1558 C CB  . ASN A 242 ? 0.2531 0.2549 0.2948 -0.0160 0.0315  -0.0259 243 ASN A CB  
1559 C CG  . ASN A 242 ? 0.2101 0.1996 0.2396 -0.0147 0.0283  -0.0221 243 ASN A CG  
1560 O OD1 . ASN A 242 ? 0.2478 0.2251 0.2801 -0.0092 0.0252  -0.0206 243 ASN A OD1 
1561 N ND2 . ASN A 242 ? 0.2196 0.2132 0.2361 -0.0203 0.0286  -0.0200 243 ASN A ND2 
1562 N N   . TYR A 243 ? 0.2062 0.2445 0.2624 -0.0263 0.0405  -0.0313 244 TYR A N   
1563 C CA  . TYR A 243 ? 0.2609 0.3106 0.3308 -0.0272 0.0425  -0.0324 244 TYR A CA  
1564 C C   . TYR A 243 ? 0.3152 0.3719 0.3758 -0.0347 0.0392  -0.0225 244 TYR A C   
1565 O O   . TYR A 243 ? 0.2568 0.3123 0.3246 -0.0338 0.0348  -0.0166 244 TYR A O   
1566 C CB  . TYR A 243 ? 0.2105 0.2786 0.2931 -0.0292 0.0530  -0.0464 244 TYR A CB  
1567 C CG  . TYR A 243 ? 0.2110 0.2940 0.3087 -0.0310 0.0560  -0.0478 244 TYR A CG  
1568 C CD1 . TYR A 243 ? 0.2070 0.2822 0.3203 -0.0245 0.0503  -0.0438 244 TYR A CD1 
1569 C CD2 . TYR A 243 ? 0.2297 0.3356 0.3257 -0.0399 0.0642  -0.0529 244 TYR A CD2 
1570 C CE1 . TYR A 243 ? 0.2073 0.2965 0.3359 -0.0261 0.0526  -0.0449 244 TYR A CE1 
1571 C CE2 . TYR A 243 ? 0.2325 0.3538 0.3434 -0.0420 0.0675  -0.0542 244 TYR A CE2 
1572 C CZ  . TYR A 243 ? 0.2829 0.3952 0.4109 -0.0347 0.0616  -0.0504 244 TYR A CZ  
1573 O OH  . TYR A 243 ? 0.2841 0.4120 0.4285 -0.0367 0.0645  -0.0515 244 TYR A OH  
1574 N N   . LEU A 244 ? 0.2573 0.3210 0.3025 -0.0426 0.0407  -0.0200 245 LEU A N   
1575 C CA  . LEU A 244 ? 0.2798 0.3487 0.3159 -0.0507 0.0363  -0.0089 245 LEU A CA  
1576 C C   . LEU A 244 ? 0.2263 0.2763 0.2605 -0.0461 0.0256  0.0017  245 LEU A C   
1577 O O   . LEU A 244 ? 0.2447 0.2960 0.2832 -0.0483 0.0211  0.0085  245 LEU A O   
1578 C CB  . LEU A 244 ? 0.3613 0.4367 0.3809 -0.0590 0.0373  -0.0065 245 LEU A CB  
1579 C CG  . LEU A 244 ? 0.5552 0.6488 0.5683 -0.0714 0.0380  0.0004  245 LEU A CG  
1580 C CD1 . LEU A 244 ? 0.6363 0.7502 0.6434 -0.0791 0.0479  -0.0092 245 LEU A CD1 
1581 C CD2 . LEU A 244 ? 0.5348 0.6188 0.5364 -0.0757 0.0278  0.0148  245 LEU A CD2 
1582 N N   . LEU A 245 ? 0.2068 0.2400 0.2354 -0.0399 0.0217  0.0020  246 LEU A N   
1583 C CA  . LEU A 245 ? 0.2041 0.2204 0.2310 -0.0352 0.0127  0.0094  246 LEU A CA  
1584 C C   . LEU A 245 ? 0.2836 0.2978 0.3233 -0.0310 0.0102  0.0096  246 LEU A C   
1585 O O   . LEU A 245 ? 0.2586 0.2686 0.2989 -0.0322 0.0036  0.0165  246 LEU A O   
1586 C CB  . LEU A 245 ? 0.2020 0.2034 0.2227 -0.0291 0.0110  0.0076  246 LEU A CB  
1587 C CG  . LEU A 245 ? 0.2680 0.2530 0.2873 -0.0233 0.0035  0.0121  246 LEU A CG  
1588 C CD1 . LEU A 245 ? 0.2946 0.2755 0.3093 -0.0269 -0.0039 0.0203  246 LEU A CD1 
1589 C CD2 . LEU A 245 ? 0.2262 0.2002 0.2396 -0.0183 0.0038  0.0095  246 LEU A CD2 
1590 N N   . MET A 246 ? 0.2648 0.2821 0.3161 -0.0264 0.0150  0.0018  247 MET A N   
1591 C CA  . MET A 246 ? 0.2453 0.2619 0.3112 -0.0224 0.0123  0.0021  247 MET A CA  
1592 C C   . MET A 246 ? 0.2750 0.3051 0.3478 -0.0284 0.0124  0.0054  247 MET A C   
1593 O O   . MET A 246 ? 0.2783 0.3034 0.3551 -0.0277 0.0055  0.0114  247 MET A O   
1594 C CB  . MET A 246 ? 0.2374 0.2576 0.3187 -0.0171 0.0176  -0.0071 247 MET A CB  
1595 C CG  . MET A 246 ? 0.1977 0.2159 0.2960 -0.0126 0.0131  -0.0056 247 MET A CG  
1596 S SD  . MET A 246 ? 0.2719 0.2683 0.3614 -0.0074 0.0018  0.0028  247 MET A SD  
1597 C CE  . MET A 246 ? 0.2929 0.2920 0.3998 -0.0060 -0.0046 0.0068  247 MET A CE  
1598 N N   . THR A 247 ? 0.2032 0.2512 0.2769 -0.0349 0.0201  0.0016  248 THR A N   
1599 C CA  . THR A 247 ? 0.2933 0.3565 0.3740 -0.0416 0.0211  0.0051  248 THR A CA  
1600 C C   . THR A 247 ? 0.3171 0.3745 0.3874 -0.0472 0.0126  0.0173  248 THR A C   
1601 O O   . THR A 247 ? 0.2435 0.3059 0.3213 -0.0506 0.0091  0.0229  248 THR A O   
1602 C CB  . THR A 247 ? 0.3611 0.4472 0.4426 -0.0492 0.0319  -0.0016 248 THR A CB  
1603 O OG1 . THR A 247 ? 0.5019 0.5887 0.5648 -0.0556 0.0322  0.0019  248 THR A OG1 
1604 C CG2 . THR A 247 ? 0.3194 0.4114 0.4132 -0.0437 0.0405  -0.0156 248 THR A CG2 
1605 N N   . VAL A 248 ? 0.2950 0.3419 0.3501 -0.0482 0.0090  0.0214  249 VAL A N   
1606 C CA  . VAL A 248 ? 0.2925 0.3320 0.3408 -0.0526 0.0001  0.0323  249 VAL A CA  
1607 C C   . VAL A 248 ? 0.2800 0.3029 0.3327 -0.0463 -0.0088 0.0352  249 VAL A C   
1608 O O   . VAL A 248 ? 0.2337 0.2552 0.2902 -0.0498 -0.0155 0.0422  249 VAL A O   
1609 C CB  . VAL A 248 ? 0.3278 0.3608 0.3619 -0.0548 -0.0019 0.0354  249 VAL A CB  
1610 C CG1 . VAL A 248 ? 0.2560 0.2766 0.2873 -0.0566 -0.0127 0.0454  249 VAL A CG1 
1611 C CG2 . VAL A 248 ? 0.2831 0.3347 0.3111 -0.0642 0.0050  0.0351  249 VAL A CG2 
1612 N N   . LEU A 249 ? 0.2265 0.2375 0.2784 -0.0377 -0.0091 0.0298  250 LEU A N   
1613 C CA  . LEU A 249 ? 0.2441 0.2416 0.2990 -0.0323 -0.0168 0.0314  250 LEU A CA  
1614 C C   . LEU A 249 ? 0.2832 0.2881 0.3524 -0.0334 -0.0188 0.0329  250 LEU A C   
1615 O O   . LEU A 249 ? 0.3140 0.3119 0.3848 -0.0339 -0.0270 0.0377  250 LEU A O   
1616 C CB  . LEU A 249 ? 0.2263 0.2138 0.2788 -0.0243 -0.0156 0.0260  250 LEU A CB  
1617 C CG  . LEU A 249 ? 0.2722 0.2483 0.3110 -0.0222 -0.0164 0.0255  250 LEU A CG  
1618 C CD1 . LEU A 249 ? 0.2910 0.2611 0.3292 -0.0157 -0.0136 0.0204  250 LEU A CD1 
1619 C CD2 . LEU A 249 ? 0.2526 0.2164 0.2854 -0.0219 -0.0251 0.0298  250 LEU A CD2 
1620 N N   . GLU A 250 ? 0.3349 0.3546 0.4156 -0.0338 -0.0113 0.0282  251 GLU A N   
1621 C CA  . GLU A 250 ? 0.3502 0.3798 0.4473 -0.0353 -0.0123 0.0294  251 GLU A CA  
1622 C C   . GLU A 250 ? 0.3484 0.3863 0.4463 -0.0441 -0.0152 0.0369  251 GLU A C   
1623 O O   . GLU A 250 ? 0.3592 0.3946 0.4644 -0.0451 -0.0224 0.0419  251 GLU A O   
1624 C CB  . GLU A 250 ? 0.3161 0.3620 0.4274 -0.0343 -0.0024 0.0211  251 GLU A CB  
1625 C CG  . GLU A 250 ? 0.4624 0.5006 0.5794 -0.0256 -0.0010 0.0145  251 GLU A CG  
1626 C CD  . GLU A 250 ? 0.6757 0.7299 0.8115 -0.0242 0.0081  0.0052  251 GLU A CD  
1627 O OE1 . GLU A 250 ? 0.7736 0.8413 0.9068 -0.0285 0.0175  -0.0007 251 GLU A OE1 
1628 O OE2 . GLU A 250 ? 0.7670 0.8212 0.9212 -0.0191 0.0056  0.0037  251 GLU A OE2 
1629 N N   . GLU A 251 ? 0.2948 0.3431 0.3854 -0.0512 -0.0101 0.0385  252 GLU A N   
1630 C CA  . GLU A 251 ? 0.2880 0.3441 0.3784 -0.0609 -0.0136 0.0476  252 GLU A CA  
1631 C C   . GLU A 251 ? 0.2949 0.3322 0.3804 -0.0604 -0.0260 0.0553  252 GLU A C   
1632 O O   . GLU A 251 ? 0.3394 0.3783 0.4318 -0.0654 -0.0322 0.0623  252 GLU A O   
1633 C CB  . GLU A 251 ? 0.2790 0.3480 0.3594 -0.0693 -0.0075 0.0494  252 GLU A CB  
1634 C CG  . GLU A 251 ? 0.3744 0.4507 0.4546 -0.0806 -0.0127 0.0615  252 GLU A CG  
1635 C CD  . GLU A 251 ? 0.3790 0.4716 0.4494 -0.0909 -0.0070 0.0647  252 GLU A CD  
1636 O OE1 . GLU A 251 ? 0.3849 0.4913 0.4530 -0.0911 0.0038  0.0557  252 GLU A OE1 
1637 O OE2 . GLU A 251 ? 0.4364 0.5282 0.5020 -0.0992 -0.0139 0.0764  252 GLU A OE2 
1638 N N   . ALA A 252 ? 0.3055 0.3257 0.3802 -0.0544 -0.0293 0.0532  253 ALA A N   
1639 C CA  . ALA A 252 ? 0.2796 0.2823 0.3505 -0.0531 -0.0400 0.0576  253 ALA A CA  
1640 C C   . ALA A 252 ? 0.3571 0.3516 0.4351 -0.0483 -0.0463 0.0559  253 ALA A C   
1641 O O   . ALA A 252 ? 0.3143 0.2947 0.3898 -0.0470 -0.0551 0.0575  253 ALA A O   
1642 C CB  . ALA A 252 ? 0.2670 0.2563 0.3253 -0.0483 -0.0404 0.0545  253 ALA A CB  
1643 N N   . GLY A 253 ? 0.3252 0.3285 0.4127 -0.0458 -0.0420 0.0522  254 GLY A N   
1644 C CA  . GLY A 253 ? 0.3108 0.3086 0.4063 -0.0425 -0.0487 0.0520  254 GLY A CA  
1645 C C   . GLY A 253 ? 0.3432 0.3305 0.4350 -0.0342 -0.0500 0.0467  254 GLY A C   
1646 O O   . GLY A 253 ? 0.3309 0.3114 0.4257 -0.0324 -0.0577 0.0476  254 GLY A O   
1647 N N   . LEU A 254 ? 0.2129 0.1991 0.2981 -0.0299 -0.0432 0.0419  255 LEU A N   
1648 C CA  . LEU A 254 ? 0.2942 0.2713 0.3766 -0.0231 -0.0447 0.0384  255 LEU A CA  
1649 C C   . LEU A 254 ? 0.2444 0.2285 0.3435 -0.0213 -0.0464 0.0386  255 LEU A C   
1650 O O   . LEU A 254 ? 0.2740 0.2719 0.3868 -0.0221 -0.0398 0.0365  255 LEU A O   
1651 C CB  . LEU A 254 ? 0.2809 0.2582 0.3574 -0.0197 -0.0366 0.0335  255 LEU A CB  
1652 C CG  . LEU A 254 ? 0.2797 0.2473 0.3526 -0.0135 -0.0383 0.0313  255 LEU A CG  
1653 C CD1 . LEU A 254 ? 0.2548 0.2083 0.3111 -0.0125 -0.0438 0.0321  255 LEU A CD1 
1654 C CD2 . LEU A 254 ? 0.2386 0.2104 0.3134 -0.0107 -0.0296 0.0264  255 LEU A CD2 
1655 N N   . PRO A 255 ? 0.2728 0.2483 0.3719 -0.0194 -0.0553 0.0407  256 PRO A N   
1656 C CA  . PRO A 255 ? 0.2735 0.2560 0.3908 -0.0179 -0.0583 0.0421  256 PRO A CA  
1657 C C   . PRO A 255 ? 0.2767 0.2624 0.4031 -0.0126 -0.0529 0.0385  256 PRO A C   
1658 O O   . PRO A 255 ? 0.3231 0.3010 0.4379 -0.0095 -0.0501 0.0361  256 PRO A O   
1659 C CB  . PRO A 255 ? 0.3275 0.2987 0.4383 -0.0177 -0.0701 0.0455  256 PRO A CB  
1660 C CG  . PRO A 255 ? 0.3148 0.2759 0.4077 -0.0205 -0.0729 0.0452  256 PRO A CG  
1661 C CD  . PRO A 255 ? 0.3113 0.2723 0.3952 -0.0191 -0.0635 0.0417  256 PRO A CD  
1662 N N   . LYS A 256 ? 0.2401 0.2372 0.3890 -0.0116 -0.0517 0.0380  257 LYS A N   
1663 C CA  . LYS A 256 ? 0.2700 0.2713 0.4335 -0.0064 -0.0467 0.0336  257 LYS A CA  
1664 C C   . LYS A 256 ? 0.2592 0.2467 0.4160 -0.0021 -0.0530 0.0362  257 LYS A C   
1665 O O   . LYS A 256 ? 0.2580 0.2373 0.4089 -0.0027 -0.0634 0.0422  257 LYS A O   
1666 C CB  . LYS A 256 ? 0.3098 0.3254 0.5021 -0.0058 -0.0463 0.0328  257 LYS A CB  
1667 C CG  . LYS A 256 ? 0.3911 0.4037 0.5922 -0.0063 -0.0586 0.0400  257 LYS A CG  
1668 C CD  . LYS A 256 ? 0.4205 0.4499 0.6521 -0.0063 -0.0571 0.0387  257 LYS A CD  
1669 C CE  . LYS A 256 ? 0.4173 0.4437 0.6629 -0.0052 -0.0701 0.0458  257 LYS A CE  
1670 N N   . GLY A 257 ? 0.2291 0.2146 0.3860 0.0015  -0.0467 0.0318  258 GLY A N   
1671 C CA  . GLY A 257 ? 0.2319 0.2062 0.3855 0.0051  -0.0520 0.0349  258 GLY A CA  
1672 C C   . GLY A 257 ? 0.2201 0.1815 0.3457 0.0037  -0.0546 0.0375  258 GLY A C   
1673 O O   . GLY A 257 ? 0.2745 0.2276 0.3947 0.0055  -0.0584 0.0405  258 GLY A O   
1674 N N   . VAL A 258 ? 0.2189 0.1792 0.3282 0.0003  -0.0530 0.0364  259 VAL A N   
1675 C CA  . VAL A 258 ? 0.2294 0.1786 0.3147 -0.0006 -0.0549 0.0373  259 VAL A CA  
1676 C C   . VAL A 258 ? 0.3114 0.2583 0.3902 0.0016  -0.0469 0.0332  259 VAL A C   
1677 O O   . VAL A 258 ? 0.2953 0.2339 0.3617 0.0026  -0.0484 0.0346  259 VAL A O   
1678 C CB  . VAL A 258 ? 0.2482 0.1962 0.3218 -0.0044 -0.0559 0.0367  259 VAL A CB  
1679 C CG1 . VAL A 258 ? 0.2613 0.1993 0.3134 -0.0045 -0.0559 0.0353  259 VAL A CG1 
1680 C CG2 . VAL A 258 ? 0.2282 0.1768 0.3071 -0.0070 -0.0653 0.0408  259 VAL A CG2 
1681 N N   . ILE A 259 ? 0.2536 0.2089 0.3406 0.0017  -0.0382 0.0281  260 ILE A N   
1682 C CA  . ILE A 259 ? 0.2101 0.1645 0.2939 0.0036  -0.0308 0.0236  260 ILE A CA  
1683 C C   . ILE A 259 ? 0.2854 0.2500 0.3911 0.0055  -0.0251 0.0185  260 ILE A C   
1684 O O   . ILE A 259 ? 0.2693 0.2452 0.3858 0.0035  -0.0223 0.0163  260 ILE A O   
1685 C CB  . ILE A 259 ? 0.2104 0.1656 0.2795 0.0007  -0.0252 0.0208  260 ILE A CB  
1686 C CG1 . ILE A 259 ? 0.2107 0.1555 0.2609 -0.0003 -0.0303 0.0240  260 ILE A CG1 
1687 C CG2 . ILE A 259 ? 0.2198 0.1763 0.2883 0.0021  -0.0173 0.0154  260 ILE A CG2 
1688 C CD1 . ILE A 259 ? 0.2085 0.1540 0.2481 -0.0033 -0.0271 0.0225  260 ILE A CD1 
1689 N N   . ASN A 260 ? 0.2079 0.1693 0.3218 0.0091  -0.0236 0.0165  261 ASN A N   
1690 C CA  . ASN A 260 ? 0.2062 0.1767 0.3437 0.0117  -0.0183 0.0097  261 ASN A CA  
1691 C C   . ASN A 260 ? 0.2820 0.2532 0.4167 0.0124  -0.0097 0.0019  261 ASN A C   
1692 O O   . ASN A 260 ? 0.3043 0.2654 0.4295 0.0136  -0.0110 0.0038  261 ASN A O   
1693 C CB  . ASN A 260 ? 0.2105 0.1771 0.3680 0.0156  -0.0259 0.0139  261 ASN A CB  
1694 C CG  . ASN A 260 ? 0.2977 0.2644 0.4574 0.0142  -0.0352 0.0217  261 ASN A CG  
1695 O OD1 . ASN A 260 ? 0.3010 0.2781 0.4786 0.0141  -0.0347 0.0199  261 ASN A OD1 
1696 N ND2 . ASN A 260 ? 0.2179 0.1741 0.3589 0.0124  -0.0432 0.0298  261 ASN A ND2 
1697 N N   . PHE A 261 ? 0.2715 0.2560 0.4144 0.0108  -0.0008 -0.0069 262 PHE A N   
1698 C CA  . PHE A 261 ? 0.2295 0.2176 0.3677 0.0098  0.0080  -0.0155 262 PHE A CA  
1699 C C   . PHE A 261 ? 0.2554 0.2458 0.4181 0.0144  0.0112  -0.0239 262 PHE A C   
1700 O O   . PHE A 261 ? 0.2077 0.2109 0.3907 0.0150  0.0157  -0.0312 262 PHE A O   
1701 C CB  . PHE A 261 ? 0.2542 0.2576 0.3873 0.0042  0.0155  -0.0203 262 PHE A CB  
1702 C CG  . PHE A 261 ? 0.1999 0.2093 0.3243 0.0012  0.0242  -0.0286 262 PHE A CG  
1703 C CD1 . PHE A 261 ? 0.2688 0.2698 0.3714 -0.0009 0.0231  -0.0249 262 PHE A CD1 
1704 C CD2 . PHE A 261 ? 0.2017 0.2268 0.3398 -0.0001 0.0335  -0.0405 262 PHE A CD2 
1705 C CE1 . PHE A 261 ? 0.2703 0.2775 0.3646 -0.0044 0.0301  -0.0317 262 PHE A CE1 
1706 C CE2 . PHE A 261 ? 0.2403 0.2723 0.3686 -0.0041 0.0411  -0.0485 262 PHE A CE2 
1707 C CZ  . PHE A 261 ? 0.2309 0.2535 0.3369 -0.0064 0.0389  -0.0434 262 PHE A CZ  
1708 N N   . ILE A 262 ? 0.2136 0.1921 0.3763 0.0174  0.0086  -0.0229 263 ILE A N   
1709 C CA  . ILE A 262 ? 0.2160 0.1941 0.4046 0.0220  0.0100  -0.0303 263 ILE A CA  
1710 C C   . ILE A 262 ? 0.2426 0.2171 0.4270 0.0220  0.0154  -0.0379 263 ILE A C   
1711 O O   . ILE A 262 ? 0.2454 0.2075 0.4325 0.0244  0.0105  -0.0338 263 ILE A O   
1712 C CB  . ILE A 262 ? 0.2827 0.2494 0.4863 0.0262  -0.0012 -0.0206 263 ILE A CB  
1713 C CG1 . ILE A 262 ? 0.2447 0.1975 0.4244 0.0245  -0.0088 -0.0079 263 ILE A CG1 
1714 C CG2 . ILE A 262 ? 0.3175 0.2908 0.5352 0.0270  -0.0057 -0.0168 263 ILE A CG2 
1715 C CD1 . ILE A 262 ? 0.2208 0.1628 0.4130 0.0272  -0.0191 0.0014  263 ILE A CD1 
1716 N N   . PRO A 263 ? 0.2405 0.2269 0.4189 0.0186  0.0253  -0.0487 264 PRO A N   
1717 C CA  . PRO A 263 ? 0.2438 0.2288 0.4229 0.0185  0.0307  -0.0583 264 PRO A CA  
1718 C C   . PRO A 263 ? 0.2586 0.2409 0.4698 0.0242  0.0301  -0.0661 264 PRO A C   
1719 O O   . PRO A 263 ? 0.2183 0.2065 0.4535 0.0275  0.0293  -0.0689 264 PRO A O   
1720 C CB  . PRO A 263 ? 0.2127 0.2152 0.3842 0.0131  0.0412  -0.0695 264 PRO A CB  
1721 C CG  . PRO A 263 ? 0.2111 0.2262 0.3941 0.0127  0.0425  -0.0699 264 PRO A CG  
1722 C CD  . PRO A 263 ? 0.2160 0.2196 0.3925 0.0144  0.0320  -0.0541 264 PRO A CD  
1723 N N   . GLY A 264 ? 0.2655 0.2387 0.4795 0.0255  0.0298  -0.0694 265 GLY A N   
1724 C CA  . GLY A 264 ? 0.2878 0.2575 0.5343 0.0307  0.0289  -0.0777 265 GLY A CA  
1725 C C   . GLY A 264 ? 0.2611 0.2166 0.5042 0.0310  0.0255  -0.0752 265 GLY A C   
1726 O O   . GLY A 264 ? 0.2531 0.2047 0.4687 0.0270  0.0258  -0.0695 265 GLY A O   
1727 N N   . ASP A 265 ? 0.2370 0.1851 0.5097 0.0356  0.0218  -0.0792 266 ASP A N   
1728 C CA  . ASP A 265 ? 0.2418 0.1764 0.5156 0.0356  0.0179  -0.0767 266 ASP A CA  
1729 C C   . ASP A 265 ? 0.2816 0.2037 0.5337 0.0335  0.0088  -0.0563 266 ASP A C   
1730 O O   . ASP A 265 ? 0.2540 0.1714 0.5114 0.0351  0.0003  -0.0436 266 ASP A O   
1731 C CB  . ASP A 265 ? 0.3900 0.3188 0.7024 0.0406  0.0135  -0.0823 266 ASP A CB  
1732 C CG  . ASP A 265 ? 0.4119 0.3291 0.7222 0.0387  0.0082  -0.0767 266 ASP A CG  
1733 O OD1 . ASP A 265 ? 0.4505 0.3702 0.7550 0.0364  0.0149  -0.0884 266 ASP A OD1 
1734 O OD2 . ASP A 265 ? 0.3953 0.3018 0.7080 0.0386  -0.0027 -0.0600 266 ASP A OD2 
1735 N N   . PRO A 266 ? 0.3096 0.2275 0.5372 0.0295  0.0105  -0.0534 267 PRO A N   
1736 C CA  . PRO A 266 ? 0.3637 0.2739 0.5668 0.0267  0.0043  -0.0361 267 PRO A CA  
1737 C C   . PRO A 266 ? 0.3624 0.2600 0.5791 0.0282  -0.0069 -0.0222 267 PRO A C   
1738 O O   . PRO A 266 ? 0.3584 0.2534 0.5634 0.0271  -0.0133 -0.0087 267 PRO A O   
1739 C CB  . PRO A 266 ? 0.2935 0.2022 0.4759 0.0228  0.0089  -0.0385 267 PRO A CB  
1740 C CG  . PRO A 266 ? 0.3119 0.2307 0.5003 0.0223  0.0182  -0.0565 267 PRO A CG  
1741 C CD  . PRO A 266 ? 0.2403 0.1613 0.4622 0.0270  0.0182  -0.0661 267 PRO A CD  
1742 N N   . VAL A 267 ? 0.2679 0.1582 0.5094 0.0302  -0.0097 -0.0255 268 VAL A N   
1743 C CA  . VAL A 267 ? 0.2951 0.1736 0.5539 0.0309  -0.0215 -0.0116 268 VAL A CA  
1744 C C   . VAL A 267 ? 0.3380 0.2207 0.6149 0.0336  -0.0283 -0.0065 268 VAL A C   
1745 O O   . VAL A 267 ? 0.3516 0.2301 0.6226 0.0316  -0.0377 0.0099  268 VAL A O   
1746 C CB  . VAL A 267 ? 0.3929 0.2694 0.6693 0.0304  -0.0227 -0.0166 268 VAL A CB  
1747 C CG1 . VAL A 267 ? 0.3685 0.2398 0.6576 0.0290  -0.0350 -0.0009 268 VAL A CG1 
1748 C CG2 . VAL A 267 ? 0.3442 0.2158 0.6029 0.0270  -0.0180 -0.0188 268 VAL A CG2 
1749 N N   . GLN A 268 ? 0.2607 0.1528 0.5598 0.0374  -0.0236 -0.0206 269 GLN A N   
1750 C CA  . GLN A 268 ? 0.3470 0.2440 0.6666 0.0398  -0.0300 -0.0165 269 GLN A CA  
1751 C C   . GLN A 268 ? 0.3436 0.2411 0.6468 0.0396  -0.0324 -0.0071 269 GLN A C   
1752 O O   . GLN A 268 ? 0.3376 0.2333 0.6446 0.0387  -0.0427 0.0066  269 GLN A O   
1753 C CB  . GLN A 268 ? 0.4033 0.3122 0.7497 0.0435  -0.0228 -0.0350 269 GLN A CB  
1754 C CG  . GLN A 268 ? 0.4148 0.3245 0.7815 0.0437  -0.0211 -0.0459 269 GLN A CG  
1755 C CD  . GLN A 268 ? 0.4001 0.3228 0.7943 0.0467  -0.0147 -0.0637 269 GLN A CD  
1756 O OE1 . GLN A 268 ? 0.5295 0.4580 0.9401 0.0488  -0.0177 -0.0621 269 GLN A OE1 
1757 N NE2 . GLN A 268 ? 0.3471 0.2755 0.7463 0.0463  -0.0059 -0.0811 269 GLN A NE2 
1758 N N   . VAL A 269 ? 0.3431 0.2472 0.6240 0.0385  -0.0229 -0.0143 270 VAL A N   
1759 C CA  . VAL A 269 ? 0.3230 0.2322 0.5818 0.0361  -0.0245 -0.0062 270 VAL A CA  
1760 C C   . VAL A 269 ? 0.3096 0.2091 0.5461 0.0321  -0.0334 0.0117  270 VAL A C   
1761 O O   . VAL A 269 ? 0.3116 0.2097 0.5477 0.0314  -0.0422 0.0234  270 VAL A O   
1762 C CB  . VAL A 269 ? 0.2745 0.1951 0.5100 0.0337  -0.0130 -0.0163 270 VAL A CB  
1763 C CG1 . VAL A 269 ? 0.2304 0.1533 0.4411 0.0306  -0.0160 -0.0063 270 VAL A CG1 
1764 C CG2 . VAL A 269 ? 0.2809 0.2145 0.5382 0.0365  -0.0046 -0.0328 270 VAL A CG2 
1765 N N   . THR A 270 ? 0.3145 0.2083 0.5335 0.0292  -0.0312 0.0135  271 THR A N   
1766 C CA  . THR A 270 ? 0.3226 0.2094 0.5197 0.0247  -0.0379 0.0289  271 THR A CA  
1767 C C   . THR A 270 ? 0.3764 0.2554 0.5911 0.0243  -0.0510 0.0434  271 THR A C   
1768 O O   . THR A 270 ? 0.3817 0.2597 0.5822 0.0209  -0.0584 0.0564  271 THR A O   
1769 C CB  . THR A 270 ? 0.2922 0.1748 0.4742 0.0219  -0.0333 0.0276  271 THR A CB  
1770 O OG1 . THR A 270 ? 0.2611 0.1509 0.4213 0.0209  -0.0233 0.0183  271 THR A OG1 
1771 C CG2 . THR A 270 ? 0.2812 0.1574 0.4459 0.0170  -0.0405 0.0437  271 THR A CG2 
1772 N N   . ASP A 271 ? 0.3210 0.1966 0.5654 0.0269  -0.0539 0.0407  272 ASP A N   
1773 C CA  . ASP A 271 ? 0.3275 0.2023 0.5842 0.0244  -0.0657 0.0537  272 ASP A CA  
1774 C C   . ASP A 271 ? 0.3592 0.2392 0.6242 0.0253  -0.0724 0.0589  272 ASP A C   
1775 O O   . ASP A 271 ? 0.4239 0.3032 0.6849 0.0211  -0.0830 0.0737  272 ASP A O   
1776 C CB  . ASP A 271 ? 0.4052 0.2802 0.6913 0.0261  -0.0670 0.0478  272 ASP A CB  
1777 C CG  . ASP A 271 ? 0.4647 0.3338 0.7432 0.0236  -0.0637 0.0467  272 ASP A CG  
1778 O OD1 . ASP A 271 ? 0.4766 0.3415 0.7274 0.0202  -0.0607 0.0517  272 ASP A OD1 
1779 O OD2 . ASP A 271 ? 0.5051 0.3742 0.8071 0.0250  -0.0642 0.0403  272 ASP A OD2 
1780 N N   . GLN A 272 ? 0.3009 0.1872 0.5777 0.0302  -0.0666 0.0471  273 GLN A N   
1781 C CA  . GLN A 272 ? 0.3057 0.1974 0.5929 0.0308  -0.0735 0.0523  273 GLN A CA  
1782 C C   . GLN A 272 ? 0.3069 0.1972 0.5646 0.0275  -0.0767 0.0623  273 GLN A C   
1783 O O   . GLN A 272 ? 0.3373 0.2288 0.5927 0.0243  -0.0868 0.0743  273 GLN A O   
1784 C CB  . GLN A 272 ? 0.3040 0.2048 0.6170 0.0366  -0.0666 0.0368  273 GLN A CB  
1785 C CG  . GLN A 272 ? 0.3740 0.2811 0.7009 0.0373  -0.0738 0.0420  273 GLN A CG  
1786 C CD  . GLN A 272 ? 0.4737 0.3802 0.8219 0.0351  -0.0860 0.0521  273 GLN A CD  
1787 O OE1 . GLN A 272 ? 0.5183 0.4242 0.8886 0.0361  -0.0861 0.0474  273 GLN A OE1 
1788 N NE2 . GLN A 272 ? 0.4884 0.3953 0.8303 0.0314  -0.0968 0.0661  273 GLN A NE2 
1789 N N   . VAL A 273 ? 0.3376 0.2287 0.5696 0.0267  -0.0672 0.0558  274 VAL A N   
1790 C CA  . VAL A 273 ? 0.3657 0.2593 0.5646 0.0221  -0.0681 0.0620  274 VAL A CA  
1791 C C   . VAL A 273 ? 0.3252 0.2118 0.5087 0.0164  -0.0783 0.0788  274 VAL A C   
1792 O O   . VAL A 273 ? 0.3343 0.2221 0.5077 0.0129  -0.0865 0.0886  274 VAL A O   
1793 C CB  . VAL A 273 ? 0.3108 0.2081 0.4834 0.0211  -0.0557 0.0516  274 VAL A CB  
1794 C CG1 . VAL A 273 ? 0.3489 0.2475 0.4899 0.0166  -0.0571 0.0573  274 VAL A CG1 
1795 C CG2 . VAL A 273 ? 0.3066 0.2129 0.4910 0.0249  -0.0462 0.0367  274 VAL A CG2 
1796 N N   . LEU A 274 ? 0.3148 0.1951 0.4971 0.0147  -0.0779 0.0819  275 LEU A N   
1797 C CA  . LEU A 274 ? 0.4121 0.2876 0.5783 0.0080  -0.0861 0.0977  275 LEU A CA  
1798 C C   . LEU A 274 ? 0.4186 0.2966 0.5998 0.0050  -0.0982 0.1090  275 LEU A C   
1799 O O   . LEU A 274 ? 0.4725 0.3510 0.6370 -0.0020 -0.1054 0.1220  275 LEU A O   
1800 C CB  . LEU A 274 ? 0.3870 0.2573 0.5498 0.0064  -0.0816 0.0973  275 LEU A CB  
1801 C CG  . LEU A 274 ? 0.3704 0.2446 0.5100 0.0069  -0.0682 0.0848  275 LEU A CG  
1802 C CD1 . LEU A 274 ? 0.3004 0.1698 0.4400 0.0053  -0.0646 0.0847  275 LEU A CD1 
1803 C CD2 . LEU A 274 ? 0.3957 0.2749 0.5017 0.0026  -0.0668 0.0876  275 LEU A CD2 
1804 N N   . ALA A 275 ? 0.4081 0.2892 0.6209 0.0097  -0.1002 0.1036  276 ALA A N   
1805 C CA  . ALA A 275 ? 0.3991 0.2835 0.6296 0.0068  -0.1122 0.1137  276 ALA A CA  
1806 C C   . ALA A 275 ? 0.4668 0.3553 0.6841 0.0034  -0.1195 0.1216  276 ALA A C   
1807 O O   . ALA A 275 ? 0.3892 0.2803 0.6122 -0.0015 -0.1306 0.1330  276 ALA A O   
1808 C CB  . ALA A 275 ? 0.4066 0.2939 0.6762 0.0128  -0.1118 0.1044  276 ALA A CB  
1809 N N   . ASP A 276 ? 0.4385 0.3277 0.6386 0.0054  -0.1138 0.1158  277 ASP A N   
1810 C CA  . ASP A 276 ? 0.4143 0.3079 0.6054 0.0027  -0.1210 0.1217  277 ASP A CA  
1811 C C   . ASP A 276 ? 0.3819 0.2751 0.5387 -0.0059 -0.1268 0.1333  277 ASP A C   
1812 O O   . ASP A 276 ? 0.4110 0.3010 0.5416 -0.0078 -0.1209 0.1322  277 ASP A O   
1813 C CB  . ASP A 276 ? 0.4055 0.3013 0.5972 0.0081  -0.1144 0.1109  277 ASP A CB  
1814 C CG  . ASP A 276 ? 0.4544 0.3557 0.6481 0.0062  -0.1228 0.1158  277 ASP A CG  
1815 O OD1 . ASP A 276 ? 0.4163 0.3173 0.5822 0.0014  -0.1263 0.1211  277 ASP A OD1 
1816 O OD2 . ASP A 276 ? 0.4281 0.3343 0.6517 0.0092  -0.1263 0.1141  277 ASP A OD2 
1817 N N   . LYS A 277 ? 0.3945 0.2920 0.5518 -0.0115 -0.1383 0.1438  278 LYS A N   
1818 C CA  . LYS A 277 ? 0.3981 0.2974 0.5242 -0.0210 -0.1445 0.1548  278 LYS A CA  
1819 C C   . LYS A 277 ? 0.4412 0.3405 0.5360 -0.0221 -0.1401 0.1503  278 LYS A C   
1820 O O   . LYS A 277 ? 0.4323 0.3327 0.4965 -0.0292 -0.1409 0.1553  278 LYS A O   
1821 C CB  . LYS A 277 ? 0.4357 0.3403 0.5712 -0.0270 -0.1579 0.1658  278 LYS A CB  
1822 C CG  . LYS A 277 ? 0.5373 0.4455 0.6781 -0.0250 -0.1618 0.1627  278 LYS A CG  
1823 C CD  . LYS A 277 ? 0.6139 0.5269 0.7700 -0.0306 -0.1752 0.1733  278 LYS A CD  
1824 C CE  . LYS A 277 ? 0.6225 0.5395 0.7802 -0.0301 -0.1796 0.1711  278 LYS A CE  
1825 N NZ  . LYS A 277 ? 0.6945 0.6127 0.8143 -0.0354 -0.1797 0.1712  278 LYS A NZ  
1826 N N   . ASP A 278 ? 0.4510 0.3496 0.5541 -0.0153 -0.1354 0.1404  279 ASP A N   
1827 C CA  . ASP A 278 ? 0.4214 0.3229 0.4978 -0.0164 -0.1294 0.1319  279 ASP A CA  
1828 C C   . ASP A 278 ? 0.3794 0.2800 0.4416 -0.0134 -0.1141 0.1187  279 ASP A C   
1829 O O   . ASP A 278 ? 0.4033 0.3066 0.4477 -0.0132 -0.1075 0.1092  279 ASP A O   
1830 C CB  . ASP A 278 ? 0.4658 0.3711 0.5562 -0.0126 -0.1309 0.1260  279 ASP A CB  
1831 C CG  . ASP A 278 ? 0.5541 0.4615 0.6519 -0.0171 -0.1467 0.1388  279 ASP A CG  
1832 O OD1 . ASP A 278 ? 0.5264 0.4351 0.6008 -0.0254 -0.1536 0.1474  279 ASP A OD1 
1833 O OD2 . ASP A 278 ? 0.6245 0.5350 0.7505 -0.0132 -0.1500 0.1378  279 ASP A OD2 
1834 N N   . PHE A 279 ? 0.3770 0.2736 0.4482 -0.0113 -0.1094 0.1186  280 PHE A N   
1835 C CA  . PHE A 279 ? 0.3566 0.2528 0.4143 -0.0092 -0.0961 0.1076  280 PHE A CA  
1836 C C   . PHE A 279 ? 0.4101 0.3088 0.4335 -0.0153 -0.0937 0.1078  280 PHE A C   
1837 O O   . PHE A 279 ? 0.4170 0.3161 0.4279 -0.0220 -0.0998 0.1185  280 PHE A O   
1838 C CB  . PHE A 279 ? 0.3858 0.2771 0.4585 -0.0074 -0.0936 0.1095  280 PHE A CB  
1839 C CG  . PHE A 279 ? 0.3460 0.2369 0.4038 -0.0066 -0.0815 0.1005  280 PHE A CG  
1840 C CD1 . PHE A 279 ? 0.3509 0.2439 0.4091 -0.0017 -0.0710 0.0864  280 PHE A CD1 
1841 C CD2 . PHE A 279 ? 0.4280 0.3173 0.4723 -0.0116 -0.0811 0.1070  280 PHE A CD2 
1842 C CE1 . PHE A 279 ? 0.2759 0.1689 0.3217 -0.0012 -0.0611 0.0790  280 PHE A CE1 
1843 C CE2 . PHE A 279 ? 0.3590 0.2486 0.3916 -0.0108 -0.0704 0.0989  280 PHE A CE2 
1844 C CZ  . PHE A 279 ? 0.3190 0.2101 0.3526 -0.0055 -0.0607 0.0849  280 PHE A CZ  
1845 N N   . GLY A 280 ? 0.4118 0.3129 0.4212 -0.0134 -0.0851 0.0958  281 GLY A N   
1846 C CA  . GLY A 280 ? 0.3922 0.2963 0.3724 -0.0182 -0.0825 0.0931  281 GLY A CA  
1847 C C   . GLY A 280 ? 0.4234 0.3275 0.3914 -0.0169 -0.0709 0.0843  281 GLY A C   
1848 O O   . GLY A 280 ? 0.4510 0.3581 0.3980 -0.0216 -0.0688 0.0843  281 GLY A O   
1849 N N   . ALA A 281 ? 0.3609 0.2630 0.3422 -0.0109 -0.0633 0.0764  282 ALA A N   
1850 C CA  . ALA A 281 ? 0.3641 0.2664 0.3362 -0.0098 -0.0532 0.0690  282 ALA A CA  
1851 C C   . ALA A 281 ? 0.3756 0.2758 0.3656 -0.0045 -0.0469 0.0635  282 ALA A C   
1852 O O   . ALA A 281 ? 0.3476 0.2480 0.3540 -0.0008 -0.0473 0.0602  282 ALA A O   
1853 C CB  . ALA A 281 ? 0.2800 0.1849 0.2360 -0.0097 -0.0488 0.0597  282 ALA A CB  
1854 N N   . LEU A 282 ? 0.3676 0.2670 0.3538 -0.0048 -0.0410 0.0620  283 LEU A N   
1855 C CA  . LEU A 282 ? 0.3322 0.2307 0.3298 -0.0008 -0.0338 0.0546  283 LEU A CA  
1856 C C   . LEU A 282 ? 0.3612 0.2623 0.3455 -0.0001 -0.0266 0.0460  283 LEU A C   
1857 O O   . LEU A 282 ? 0.3578 0.2602 0.3265 -0.0027 -0.0245 0.0461  283 LEU A O   
1858 C CB  . LEU A 282 ? 0.2815 0.1769 0.2853 -0.0019 -0.0327 0.0586  283 LEU A CB  
1859 C CG  . LEU A 282 ? 0.3259 0.2210 0.3399 0.0014  -0.0252 0.0499  283 LEU A CG  
1860 C CD1 . LEU A 282 ? 0.2445 0.1395 0.2801 0.0055  -0.0255 0.0449  283 LEU A CD1 
1861 C CD2 . LEU A 282 ? 0.3058 0.1978 0.3225 -0.0006 -0.0238 0.0534  283 LEU A CD2 
1862 N N   . HIS A 283 ? 0.2847 0.1874 0.2759 0.0030  -0.0229 0.0386  284 HIS A N   
1863 C CA  . HIS A 283 ? 0.2752 0.1800 0.2574 0.0035  -0.0169 0.0317  284 HIS A CA  
1864 C C   . HIS A 283 ? 0.2805 0.1861 0.2727 0.0051  -0.0113 0.0270  284 HIS A C   
1865 O O   . HIS A 283 ? 0.2651 0.1728 0.2691 0.0067  -0.0102 0.0235  284 HIS A O   
1866 C CB  . HIS A 283 ? 0.2911 0.1978 0.2706 0.0041  -0.0182 0.0281  284 HIS A CB  
1867 C CG  . HIS A 283 ? 0.2855 0.1930 0.2541 0.0038  -0.0149 0.0232  284 HIS A CG  
1868 N ND1 . HIS A 283 ? 0.2689 0.1777 0.2374 0.0041  -0.0155 0.0197  284 HIS A ND1 
1869 C CD2 . HIS A 283 ? 0.3363 0.2438 0.2961 0.0032  -0.0112 0.0214  284 HIS A CD2 
1870 C CE1 . HIS A 283 ? 0.3041 0.2127 0.2653 0.0041  -0.0130 0.0160  284 HIS A CE1 
1871 N NE2 . HIS A 283 ? 0.3122 0.2205 0.2682 0.0037  -0.0099 0.0165  284 HIS A NE2 
1872 N N   . PHE A 284 ? 0.3098 0.2146 0.2972 0.0042  -0.0075 0.0265  285 PHE A N   
1873 C CA  . PHE A 284 ? 0.2889 0.1939 0.2857 0.0049  -0.0032 0.0227  285 PHE A CA  
1874 C C   . PHE A 284 ? 0.3811 0.2884 0.3700 0.0042  0.0019  0.0182  285 PHE A C   
1875 O O   . PHE A 284 ? 0.4100 0.3175 0.3880 0.0031  0.0026  0.0196  285 PHE A O   
1876 C CB  . PHE A 284 ? 0.2613 0.1623 0.2648 0.0039  -0.0051 0.0280  285 PHE A CB  
1877 C CG  . PHE A 284 ? 0.3279 0.2283 0.3403 0.0041  -0.0009 0.0236  285 PHE A CG  
1878 C CD1 . PHE A 284 ? 0.3090 0.2098 0.3138 0.0022  0.0025  0.0234  285 PHE A CD1 
1879 C CD2 . PHE A 284 ? 0.3246 0.2247 0.3543 0.0060  -0.0004 0.0189  285 PHE A CD2 
1880 C CE1 . PHE A 284 ? 0.3896 0.2897 0.4027 0.0019  0.0056  0.0193  285 PHE A CE1 
1881 C CE2 . PHE A 284 ? 0.3225 0.2221 0.3605 0.0058  0.0032  0.0135  285 PHE A CE2 
1882 C CZ  . PHE A 284 ? 0.3488 0.2480 0.3779 0.0035  0.0058  0.0141  285 PHE A CZ  
1883 N N   . THR A 285 ? 0.3774 0.2875 0.3725 0.0045  0.0055  0.0126  286 THR A N   
1884 C CA  . THR A 285 ? 0.3642 0.2765 0.3548 0.0033  0.0094  0.0094  286 THR A CA  
1885 C C   . THR A 285 ? 0.3846 0.2979 0.3852 0.0028  0.0122  0.0049  286 THR A C   
1886 O O   . THR A 285 ? 0.3592 0.2752 0.3684 0.0033  0.0130  0.0007  286 THR A O   
1887 C CB  . THR A 285 ? 0.3372 0.2535 0.3219 0.0028  0.0100  0.0067  286 THR A CB  
1888 O OG1 . THR A 285 ? 0.3967 0.3114 0.3738 0.0034  0.0072  0.0093  286 THR A OG1 
1889 C CG2 . THR A 285 ? 0.3485 0.2673 0.3304 0.0012  0.0129  0.0045  286 THR A CG2 
1890 N N   . GLY A 286 ? 0.3489 0.2607 0.3491 0.0015  0.0140  0.0051  287 GLY A N   
1891 C CA  . GLY A 286 ? 0.3603 0.2724 0.3702 0.0006  0.0163  0.0000  287 GLY A CA  
1892 C C   . GLY A 286 ? 0.3904 0.2989 0.4013 -0.0008 0.0165  0.0031  287 GLY A C   
1893 O O   . GLY A 286 ? 0.3867 0.2956 0.3884 -0.0017 0.0166  0.0073  287 GLY A O   
1894 N N   . SER A 287 ? 0.3776 0.2831 0.4010 -0.0011 0.0165  0.0006  288 SER A N   
1895 C CA  . SER A 287 ? 0.4596 0.3619 0.4858 -0.0033 0.0166  0.0030  288 SER A CA  
1896 C C   . SER A 287 ? 0.4444 0.3420 0.4704 -0.0040 0.0131  0.0132  288 SER A C   
1897 O O   . SER A 287 ? 0.4481 0.3428 0.4774 -0.0027 0.0094  0.0178  288 SER A O   
1898 C CB  . SER A 287 ? 0.4321 0.3322 0.4735 -0.0037 0.0173  -0.0042 288 SER A CB  
1899 O OG  . SER A 287 ? 0.4494 0.3435 0.5057 -0.0019 0.0137  -0.0019 288 SER A OG  
1900 N N   . THR A 288 ? 0.4172 0.3150 0.4394 -0.0068 0.0140  0.0172  289 THR A N   
1901 C CA  . THR A 288 ? 0.4252 0.3205 0.4463 -0.0094 0.0113  0.0275  289 THR A CA  
1902 C C   . THR A 288 ? 0.4115 0.2995 0.4481 -0.0097 0.0060  0.0322  289 THR A C   
1903 O O   . THR A 288 ? 0.4841 0.3701 0.5197 -0.0109 0.0016  0.0414  289 THR A O   
1904 C CB  . THR A 288 ? 0.4377 0.3356 0.4558 -0.0130 0.0139  0.0296  289 THR A CB  
1905 O OG1 . THR A 288 ? 0.4525 0.3573 0.4582 -0.0123 0.0179  0.0262  289 THR A OG1 
1906 C CG2 . THR A 288 ? 0.4236 0.3207 0.4405 -0.0171 0.0114  0.0410  289 THR A CG2 
1907 N N   . ASN A 289 ? 0.4796 0.3638 0.5317 -0.0090 0.0060  0.0257  290 ASN A N   
1908 C CA  . ASN A 289 ? 0.4750 0.3514 0.5467 -0.0089 0.0005  0.0293  290 ASN A CA  
1909 C C   . ASN A 289 ? 0.4672 0.3418 0.5462 -0.0052 -0.0032 0.0296  290 ASN A C   
1910 O O   . ASN A 289 ? 0.4331 0.3025 0.5217 -0.0059 -0.0098 0.0390  290 ASN A O   
1911 C CB  . ASN A 289 ? 0.5725 0.4453 0.6608 -0.0088 0.0016  0.0200  290 ASN A CB  
1912 C CG  . ASN A 289 ? 0.6967 0.5689 0.7835 -0.0134 0.0024  0.0237  290 ASN A CG  
1913 O OD1 . ASN A 289 ? 0.7127 0.5843 0.7946 -0.0171 -0.0002 0.0359  290 ASN A OD1 
1914 N ND2 . ASN A 289 ? 0.7331 0.6068 0.8236 -0.0139 0.0059  0.0132  290 ASN A ND2 
1915 N N   . VAL A 290 ? 0.4475 0.3270 0.5225 -0.0019 0.0006  0.0202  291 VAL A N   
1916 C CA  . VAL A 290 ? 0.4370 0.3162 0.5189 0.0013  -0.0026 0.0206  291 VAL A CA  
1917 C C   . VAL A 290 ? 0.2857 0.1654 0.3538 -0.0002 -0.0068 0.0326  291 VAL A C   
1918 O O   . VAL A 290 ? 0.3613 0.2373 0.4385 0.0001  -0.0133 0.0401  291 VAL A O   
1919 C CB  . VAL A 290 ? 0.4119 0.2979 0.4924 0.0042  0.0026  0.0085  291 VAL A CB  
1920 C CG1 . VAL A 290 ? 0.3448 0.2317 0.4312 0.0071  -0.0007 0.0103  291 VAL A CG1 
1921 C CG2 . VAL A 290 ? 0.3648 0.2512 0.4608 0.0050  0.0062  -0.0040 291 VAL A CG2 
1922 N N   . PHE A 291 ? 0.3463 0.2308 0.3935 -0.0022 -0.0034 0.0341  292 PHE A N   
1923 C CA  . PHE A 291 ? 0.3723 0.2587 0.4048 -0.0044 -0.0064 0.0433  292 PHE A CA  
1924 C C   . PHE A 291 ? 0.4149 0.2972 0.4519 -0.0084 -0.0127 0.0560  292 PHE A C   
1925 O O   . PHE A 291 ? 0.4241 0.3053 0.4610 -0.0093 -0.0189 0.0640  292 PHE A O   
1926 C CB  . PHE A 291 ? 0.3927 0.2850 0.4056 -0.0060 -0.0011 0.0415  292 PHE A CB  
1927 C CG  . PHE A 291 ? 0.4805 0.3760 0.4778 -0.0082 -0.0032 0.0480  292 PHE A CG  
1928 C CD1 . PHE A 291 ? 0.5104 0.4069 0.5035 -0.0062 -0.0056 0.0468  292 PHE A CD1 
1929 C CD2 . PHE A 291 ? 0.4845 0.3831 0.4713 -0.0130 -0.0025 0.0547  292 PHE A CD2 
1930 C CE1 . PHE A 291 ? 0.5110 0.4107 0.4893 -0.0087 -0.0077 0.0514  292 PHE A CE1 
1931 C CE2 . PHE A 291 ? 0.4585 0.3617 0.4298 -0.0158 -0.0038 0.0590  292 PHE A CE2 
1932 C CZ  . PHE A 291 ? 0.4693 0.3727 0.4362 -0.0135 -0.0065 0.0569  292 PHE A CZ  
1933 N N   . LYS A 292 ? 0.4155 0.2958 0.4570 -0.0114 -0.0118 0.0586  293 LYS A N   
1934 C CA  . LYS A 292 ? 0.4157 0.2921 0.4633 -0.0164 -0.0183 0.0720  293 LYS A CA  
1935 C C   . LYS A 292 ? 0.4171 0.2860 0.4869 -0.0145 -0.0266 0.0764  293 LYS A C   
1936 O O   . LYS A 292 ? 0.4145 0.2814 0.4860 -0.0183 -0.0345 0.0897  293 LYS A O   
1937 C CB  . LYS A 292 ? 0.4655 0.3405 0.5181 -0.0197 -0.0160 0.0731  293 LYS A CB  
1938 C CG  . LYS A 292 ? 0.5625 0.4458 0.5956 -0.0224 -0.0088 0.0712  293 LYS A CG  
1939 C CD  . LYS A 292 ? 0.6560 0.5390 0.6935 -0.0277 -0.0084 0.0770  293 LYS A CD  
1940 C CE  . LYS A 292 ? 0.6969 0.5902 0.7158 -0.0309 -0.0015 0.0768  293 LYS A CE  
1941 N NZ  . LYS A 292 ? 0.7303 0.6248 0.7537 -0.0369 -0.0011 0.0838  293 LYS A NZ  
1942 N N   . SER A 293 ? 0.4430 0.3085 0.5308 -0.0091 -0.0251 0.0652  294 SER A N   
1943 C CA  . SER A 293 ? 0.3874 0.2468 0.4996 -0.0062 -0.0324 0.0670  294 SER A CA  
1944 C C   . SER A 293 ? 0.4359 0.2983 0.5408 -0.0054 -0.0367 0.0725  294 SER A C   
1945 O O   . SER A 293 ? 0.3559 0.2147 0.4702 -0.0074 -0.0462 0.0846  294 SER A O   
1946 C CB  . SER A 293 ? 0.3633 0.2215 0.4945 -0.0004 -0.0279 0.0509  294 SER A CB  
1947 O OG  . SER A 293 ? 0.4204 0.2739 0.5778 0.0030  -0.0346 0.0516  294 SER A OG  
1948 N N   . LEU A 294 ? 0.4337 0.3028 0.5225 -0.0030 -0.0307 0.0642  295 LEU A N   
1949 C CA  . LEU A 294 ? 0.4337 0.3058 0.5157 -0.0023 -0.0348 0.0681  295 LEU A CA  
1950 C C   . LEU A 294 ? 0.4128 0.2861 0.4782 -0.0086 -0.0406 0.0828  295 LEU A C   
1951 O O   . LEU A 294 ? 0.4420 0.3141 0.5118 -0.0101 -0.0493 0.0924  295 LEU A O   
1952 C CB  . LEU A 294 ? 0.4100 0.2887 0.4766 0.0004  -0.0273 0.0573  295 LEU A CB  
1953 C CG  . LEU A 294 ? 0.4082 0.2887 0.4899 0.0056  -0.0226 0.0441  295 LEU A CG  
1954 C CD1 . LEU A 294 ? 0.3284 0.2153 0.3932 0.0062  -0.0144 0.0345  295 LEU A CD1 
1955 C CD2 . LEU A 294 ? 0.4036 0.2844 0.4997 0.0084  -0.0280 0.0453  295 LEU A CD2 
1956 N N   . TYR A 295 ? 0.3927 0.2693 0.4396 -0.0128 -0.0358 0.0843  296 TYR A N   
1957 C CA  . TYR A 295 ? 0.4321 0.3130 0.4596 -0.0198 -0.0390 0.0961  296 TYR A CA  
1958 C C   . TYR A 295 ? 0.4354 0.3115 0.4756 -0.0247 -0.0495 0.1118  296 TYR A C   
1959 O O   . TYR A 295 ? 0.4206 0.2987 0.4539 -0.0291 -0.0572 0.1229  296 TYR A O   
1960 C CB  . TYR A 295 ? 0.4742 0.3605 0.4849 -0.0229 -0.0308 0.0933  296 TYR A CB  
1961 C CG  . TYR A 295 ? 0.4807 0.3745 0.4690 -0.0302 -0.0315 0.1020  296 TYR A CG  
1962 C CD1 . TYR A 295 ? 0.5228 0.4170 0.5111 -0.0379 -0.0375 0.1169  296 TYR A CD1 
1963 C CD2 . TYR A 295 ? 0.4117 0.3131 0.3794 -0.0300 -0.0260 0.0949  296 TYR A CD2 
1964 C CE1 . TYR A 295 ? 0.5960 0.4995 0.5624 -0.0457 -0.0374 0.1243  296 TYR A CE1 
1965 C CE2 . TYR A 295 ? 0.3723 0.2823 0.3196 -0.0370 -0.0255 0.1005  296 TYR A CE2 
1966 C CZ  . TYR A 295 ? 0.5333 0.4451 0.4788 -0.0451 -0.0308 0.1151  296 TYR A CZ  
1967 O OH  . TYR A 295 ? 0.5801 0.5027 0.5040 -0.0533 -0.0299 0.1206  296 TYR A OH  
1968 N N   . GLY A 296 ? 0.4245 0.2942 0.4843 -0.0243 -0.0505 0.1129  297 GLY A N   
1969 C CA  . GLY A 296 ? 0.4010 0.2642 0.4792 -0.0284 -0.0615 0.1277  297 GLY A CA  
1970 C C   . GLY A 296 ? 0.4899 0.3502 0.5837 -0.0257 -0.0710 0.1320  297 GLY A C   
1971 O O   . GLY A 296 ? 0.4372 0.3019 0.5280 -0.0311 -0.0795 0.1442  297 GLY A O   
1972 N N   . LYS A 297 ? 0.4689 0.3264 0.5784 -0.0175 -0.0683 0.1192  298 LYS A N   
1973 C CA  . LYS A 297 ? 0.5030 0.3615 0.6297 -0.0142 -0.0759 0.1201  298 LYS A CA  
1974 C C   . LYS A 297 ? 0.4004 0.2638 0.5072 -0.0180 -0.0810 0.1291  298 LYS A C   
1975 O O   . LYS A 297 ? 0.4212 0.2877 0.5358 -0.0202 -0.0903 0.1374  298 LYS A O   
1976 C CB  . LYS A 297 ? 0.4661 0.3227 0.6124 -0.0052 -0.0706 0.1040  298 LYS A CB  
1977 C CG  . LYS A 297 ? 0.4473 0.3010 0.6189 -0.0018 -0.0683 0.0949  298 LYS A CG  
1978 C CD  . LYS A 297 ? 0.4729 0.3273 0.6602 0.0060  -0.0612 0.0772  298 LYS A CD  
1979 C CE  . LYS A 297 ? 0.4846 0.3376 0.6981 0.0088  -0.0595 0.0671  298 LYS A CE  
1980 N NZ  . LYS A 297 ? 0.4418 0.2976 0.6673 0.0151  -0.0507 0.0481  298 LYS A NZ  
1981 N N   . ILE A 298 ? 0.4324 0.3010 0.5118 -0.0190 -0.0736 0.1239  299 ILE A N   
1982 C CA  . ILE A 298 ? 0.3848 0.2595 0.4430 -0.0229 -0.0774 0.1294  299 ILE A CA  
1983 C C   . ILE A 298 ? 0.5102 0.3874 0.5547 -0.0331 -0.0857 0.1474  299 ILE A C   
1984 O O   . ILE A 298 ? 0.5608 0.4409 0.6058 -0.0367 -0.0954 0.1567  299 ILE A O   
1985 C CB  . ILE A 298 ? 0.3442 0.2255 0.3782 -0.0210 -0.0663 0.1162  299 ILE A CB  
1986 C CG1 . ILE A 298 ? 0.3230 0.2032 0.3710 -0.0124 -0.0606 0.1013  299 ILE A CG1 
1987 C CG2 . ILE A 298 ? 0.3620 0.2498 0.3730 -0.0257 -0.0699 0.1205  299 ILE A CG2 
1988 C CD1 . ILE A 298 ? 0.2873 0.1726 0.3161 -0.0103 -0.0501 0.0885  299 ILE A CD1 
1989 N N   . GLN A 299 ? 0.5820 0.4613 0.6146 -0.0381 -0.0809 0.1503  300 GLN A N   
1990 C CA  . GLN A 299 ? 0.6022 0.4878 0.6189 -0.0489 -0.0864 0.1655  300 GLN A CA  
1991 C C   . GLN A 299 ? 0.5975 0.4837 0.6359 -0.0512 -0.0973 0.1750  300 GLN A C   
1992 O O   . GLN A 299 ? 0.6174 0.5108 0.6462 -0.0586 -0.1050 0.1857  300 GLN A O   
1993 C CB  . GLN A 299 ? 0.6140 0.5026 0.6169 -0.0536 -0.0782 0.1659  300 GLN A CB  
1994 C CG  . GLN A 299 ? 0.5792 0.4750 0.5609 -0.0501 -0.0646 0.1492  300 GLN A CG  
1995 C CD  . GLN A 299 ? 0.6153 0.5198 0.5722 -0.0531 -0.0646 0.1474  300 GLN A CD  
1996 O OE1 . GLN A 299 ? 0.6900 0.5979 0.6394 -0.0603 -0.0739 0.1601  300 GLN A OE1 
1997 N NE2 . GLN A 299 ? 0.6560 0.5644 0.6008 -0.0481 -0.0547 0.1316  300 GLN A NE2 
1998 N N   . SER A 300 ? 0.5672 0.4463 0.6355 -0.0452 -0.0982 0.1707  301 SER A N   
1999 C CA  . SER A 300 ? 0.5902 0.4695 0.6829 -0.0468 -0.1093 0.1789  301 SER A CA  
2000 C C   . SER A 300 ? 0.5950 0.4768 0.6932 -0.0456 -0.1174 0.1811  301 SER A C   
2001 O O   . SER A 300 ? 0.6351 0.5218 0.7371 -0.0520 -0.1280 0.1931  301 SER A O   
2002 C CB  . SER A 300 ? 0.6392 0.5111 0.7637 -0.0403 -0.1082 0.1714  301 SER A CB  
2003 O OG  . SER A 300 ? 0.7207 0.5893 0.8691 -0.0317 -0.1096 0.1619  301 SER A OG  
2004 N N   . GLY A 301 ? 0.6001 0.4793 0.6982 -0.0383 -0.1126 0.1701  302 GLY A N   
2005 C CA  . GLY A 301 ? 0.5742 0.4565 0.6759 -0.0373 -0.1197 0.1717  302 GLY A CA  
2006 C C   . GLY A 301 ? 0.5099 0.4000 0.5823 -0.0469 -0.1246 0.1823  302 GLY A C   
2007 O O   . GLY A 301 ? 0.5307 0.4251 0.6079 -0.0506 -0.1347 0.1901  302 GLY A O   
2008 N N   . VAL A 302 ? 0.6033 0.4963 0.6455 -0.0513 -0.1172 0.1818  303 VAL A N   
2009 C CA  . VAL A 302 ? 0.6548 0.5571 0.6663 -0.0607 -0.1199 0.1891  303 VAL A CA  
2010 C C   . VAL A 302 ? 0.7818 0.6910 0.7944 -0.0708 -0.1292 0.2037  303 VAL A C   
2011 O O   . VAL A 302 ? 0.8658 0.7812 0.8721 -0.0768 -0.1380 0.2111  303 VAL A O   
2012 C CB  . VAL A 302 ? 0.6411 0.5466 0.6215 -0.0636 -0.1089 0.1841  303 VAL A CB  
2013 C CG1 . VAL A 302 ? 0.6560 0.5734 0.6050 -0.0740 -0.1110 0.1896  303 VAL A CG1 
2014 C CG2 . VAL A 302 ? 0.5413 0.4403 0.5198 -0.0549 -0.1010 0.1708  303 VAL A CG2 
2015 N N   . VAL A 303 ? 0.8446 0.7526 0.8661 -0.0730 -0.1280 0.2081  304 VAL A N   
2016 C CA  . VAL A 303 ? 0.8979 0.8130 0.9202 -0.0836 -0.1368 0.2229  304 VAL A CA  
2017 C C   . VAL A 303 ? 0.8990 0.8123 0.9511 -0.0835 -0.1505 0.2308  304 VAL A C   
2018 O O   . VAL A 303 ? 0.9523 0.8731 1.0005 -0.0932 -0.1605 0.2435  304 VAL A O   
2019 C CB  . VAL A 303 ? 0.7056 0.6206 0.7295 -0.0867 -0.1320 0.2260  304 VAL A CB  
2020 C CG1 . VAL A 303 ? 0.7040 0.6211 0.7011 -0.0863 -0.1179 0.2172  304 VAL A CG1 
2021 C CG2 . VAL A 303 ? 0.6550 0.5594 0.7147 -0.0786 -0.1336 0.2225  304 VAL A CG2 
2022 N N   . GLU A 304 ? 0.8505 0.7547 0.9325 -0.0728 -0.1508 0.2226  305 GLU A N   
2023 C CA  . GLU A 304 ? 0.7596 0.6626 0.8724 -0.0716 -0.1629 0.2277  305 GLU A CA  
2024 C C   . GLU A 304 ? 0.7117 0.6188 0.8155 -0.0725 -0.1679 0.2282  305 GLU A C   
2025 O O   . GLU A 304 ? 0.6405 0.5484 0.7664 -0.0730 -0.1786 0.2336  305 GLU A O   
2026 C CB  . GLU A 304 ? 0.7025 0.5965 0.8502 -0.0600 -0.1602 0.2166  305 GLU A CB  
2027 N N   . GLY A 305 ? 0.7087 0.6185 0.7813 -0.0728 -0.1602 0.2221  306 GLY A N   
2028 C CA  . GLY A 305 ? 0.6892 0.6037 0.7481 -0.0753 -0.1647 0.2227  306 GLY A CA  
2029 C C   . GLY A 305 ? 0.6271 0.5369 0.7057 -0.0654 -0.1654 0.2135  306 GLY A C   
2030 O O   . GLY A 305 ? 0.6065 0.5201 0.6850 -0.0681 -0.1732 0.2171  306 GLY A O   
2031 N N   . LYS A 306 ? 0.6433 0.5457 0.7381 -0.0546 -0.1569 0.2012  307 LYS A N   
2032 C CA  . LYS A 306 ? 0.6227 0.5225 0.7404 -0.0459 -0.1577 0.1928  307 LYS A CA  
2033 C C   . LYS A 306 ? 0.5690 0.4691 0.6673 -0.0422 -0.1516 0.1835  307 LYS A C   
2034 O O   . LYS A 306 ? 0.6053 0.5042 0.7215 -0.0351 -0.1512 0.1759  307 LYS A O   
2035 C CB  . LYS A 306 ? 0.5680 0.4617 0.7192 -0.0365 -0.1532 0.1837  307 LYS A CB  
2036 C CG  . LYS A 306 ? 0.5052 0.3937 0.6485 -0.0305 -0.1398 0.1719  307 LYS A CG  
2037 C CD  . LYS A 306 ? 0.5723 0.4561 0.7487 -0.0239 -0.1371 0.1648  307 LYS A CD  
2038 N N   . TYR A 307 ? 0.5657 0.4682 0.6287 -0.0474 -0.1471 0.1839  308 TYR A N   
2039 C CA  . TYR A 307 ? 0.5477 0.4503 0.5906 -0.0447 -0.1418 0.1752  308 TYR A CA  
2040 C C   . TYR A 307 ? 0.5880 0.4980 0.6042 -0.0537 -0.1485 0.1812  308 TYR A C   
2041 O O   . TYR A 307 ? 0.5222 0.4381 0.5213 -0.0633 -0.1519 0.1901  308 TYR A O   
2042 C CB  . TYR A 307 ? 0.4834 0.3824 0.5070 -0.0426 -0.1297 0.1675  308 TYR A CB  
2043 C CG  . TYR A 307 ? 0.4197 0.3115 0.4665 -0.0343 -0.1222 0.1599  308 TYR A CG  
2044 C CD1 . TYR A 307 ? 0.4075 0.2961 0.4831 -0.0255 -0.1215 0.1520  308 TYR A CD1 
2045 C CD2 . TYR A 307 ? 0.4018 0.2913 0.4423 -0.0358 -0.1156 0.1601  308 TYR A CD2 
2046 C CE1 . TYR A 307 ? 0.3711 0.2546 0.4671 -0.0185 -0.1142 0.1433  308 TYR A CE1 
2047 C CE2 . TYR A 307 ? 0.3874 0.2707 0.4491 -0.0287 -0.1090 0.1522  308 TYR A CE2 
2048 C CZ  . TYR A 307 ? 0.4144 0.2947 0.5031 -0.0202 -0.1082 0.1434  308 TYR A CZ  
2049 O OH  . TYR A 307 ? 0.5024 0.3780 0.6113 -0.0137 -0.1012 0.1338  308 TYR A OH  
2050 N N   . ARG A 308 ? 0.5602 0.4707 0.5729 -0.0510 -0.1502 0.1755  309 ARG A N   
2051 C CA  . ARG A 308 ? 0.5882 0.5057 0.5755 -0.0592 -0.1563 0.1787  309 ARG A CA  
2052 C C   . ARG A 308 ? 0.6268 0.5477 0.5764 -0.0646 -0.1490 0.1748  309 ARG A C   
2053 O O   . ARG A 308 ? 0.6940 0.6233 0.6195 -0.0745 -0.1525 0.1791  309 ARG A O   
2054 C CB  . ARG A 308 ? 0.6262 0.5427 0.6209 -0.0542 -0.1593 0.1722  309 ARG A CB  
2055 C CG  . ARG A 308 ? 0.6996 0.6233 0.6774 -0.0626 -0.1688 0.1764  309 ARG A CG  
2056 C CD  . ARG A 308 ? 0.6899 0.6153 0.6365 -0.0644 -0.1651 0.1670  309 ARG A CD  
2057 N NE  . ARG A 308 ? 0.7204 0.6425 0.6792 -0.0571 -0.1652 0.1583  309 ARG A NE  
2058 N N   . ASP A 309 ? 0.5371 0.4530 0.4830 -0.0584 -0.1377 0.1650  310 ASP A N   
2059 C CA  . ASP A 309 ? 0.6108 0.5324 0.5268 -0.0616 -0.1263 0.1549  310 ASP A CA  
2060 C C   . ASP A 309 ? 0.5969 0.5160 0.5163 -0.0596 -0.1168 0.1536  310 ASP A C   
2061 O O   . ASP A 309 ? 0.5864 0.4982 0.5319 -0.0534 -0.1166 0.1557  310 ASP A O   
2062 C CB  . ASP A 309 ? 0.7365 0.6579 0.6476 -0.0548 -0.1170 0.1360  310 ASP A CB  
2063 C CG  . ASP A 309 ? 0.8941 0.8196 0.7935 -0.0586 -0.1244 0.1342  310 ASP A CG  
2064 O OD1 . ASP A 309 ? 0.9226 0.8547 0.7950 -0.0641 -0.1211 0.1274  310 ASP A OD1 
2065 O OD2 . ASP A 309 ? 0.9528 0.8755 0.8709 -0.0560 -0.1332 0.1386  310 ASP A OD2 
2066 N N   . TYR A 310 ? 0.6094 0.5354 0.5033 -0.0647 -0.1085 0.1491  311 TYR A N   
2067 C CA  . TYR A 310 ? 0.5687 0.4933 0.4641 -0.0619 -0.0971 0.1440  311 TYR A CA  
2068 C C   . TYR A 310 ? 0.5544 0.4741 0.4597 -0.0509 -0.0866 0.1265  311 TYR A C   
2069 O O   . TYR A 310 ? 0.5695 0.4927 0.4605 -0.0494 -0.0805 0.1139  311 TYR A O   
2070 C CB  . TYR A 310 ? 0.5544 0.4898 0.4205 -0.0703 -0.0905 0.1422  311 TYR A CB  
2071 C CG  . TYR A 310 ? 0.6141 0.5555 0.4708 -0.0823 -0.0992 0.1611  311 TYR A CG  
2072 C CD1 . TYR A 310 ? 0.6562 0.5936 0.5274 -0.0838 -0.1008 0.1729  311 TYR A CD1 
2073 C CD2 . TYR A 310 ? 0.6046 0.5558 0.4383 -0.0930 -0.1065 0.1676  311 TYR A CD2 
2074 C CE1 . TYR A 310 ? 0.6949 0.6401 0.5645 -0.0933 -0.1067 0.1856  311 TYR A CE1 
2075 C CE2 . TYR A 310 ? 0.6302 0.5902 0.4618 -0.1027 -0.1117 0.1800  311 TYR A CE2 
2076 C CZ  . TYR A 310 ? 0.6887 0.6455 0.5387 -0.1027 -0.1118 0.1891  311 TYR A CZ  
2077 O OH  . TYR A 310 ? 0.7207 0.6861 0.5705 -0.1126 -0.1174 0.2015  311 TYR A OH  
2078 N N   . PRO A 311 ? 0.5115 0.4234 0.4420 -0.0436 -0.0847 0.1256  312 PRO A N   
2079 C CA  . PRO A 311 ? 0.4842 0.3930 0.4228 -0.0344 -0.0754 0.1100  312 PRO A CA  
2080 C C   . PRO A 311 ? 0.4588 0.3710 0.3818 -0.0339 -0.0632 0.0993  312 PRO A C   
2081 O O   . PRO A 311 ? 0.4902 0.4057 0.4037 -0.0387 -0.0603 0.1037  312 PRO A O   
2082 C CB  . PRO A 311 ? 0.5085 0.4099 0.4762 -0.0284 -0.0761 0.1118  312 PRO A CB  
2083 C CG  . PRO A 311 ? 0.5858 0.4856 0.5592 -0.0341 -0.0832 0.1270  312 PRO A CG  
2084 C CD  . PRO A 311 ? 0.5426 0.4486 0.4960 -0.0435 -0.0915 0.1380  312 PRO A CD  
2085 N N   . ARG A 312 ? 0.3933 0.3053 0.3143 -0.0285 -0.0567 0.0859  313 ARG A N   
2086 C CA  . ARG A 312 ? 0.4393 0.3540 0.3504 -0.0269 -0.0460 0.0755  313 ARG A CA  
2087 C C   . ARG A 312 ? 0.4602 0.3699 0.3889 -0.0207 -0.0402 0.0715  313 ARG A C   
2088 O O   . ARG A 312 ? 0.4371 0.3423 0.3833 -0.0160 -0.0423 0.0705  313 ARG A O   
2089 C CB  . ARG A 312 ? 0.4731 0.3900 0.3735 -0.0251 -0.0433 0.0638  313 ARG A CB  
2090 C CG  . ARG A 312 ? 0.5750 0.4980 0.4558 -0.0319 -0.0482 0.0654  313 ARG A CG  
2091 C CD  . ARG A 312 ? 0.6161 0.5413 0.4867 -0.0302 -0.0441 0.0516  313 ARG A CD  
2092 N NE  . ARG A 312 ? 0.6678 0.5982 0.5216 -0.0365 -0.0498 0.0516  313 ARG A NE  
2093 C CZ  . ARG A 312 ? 0.6974 0.6296 0.5427 -0.0361 -0.0487 0.0399  313 ARG A CZ  
2094 N NH1 . ARG A 312 ? 0.6380 0.5665 0.4912 -0.0297 -0.0425 0.0286  313 ARG A NH1 
2095 N NH2 . ARG A 312 ? 0.6921 0.6296 0.5216 -0.0427 -0.0543 0.0397  313 ARG A NH2 
2096 N N   . ILE A 313 ? 0.4626 0.3742 0.3867 -0.0213 -0.0330 0.0689  314 ILE A N   
2097 C CA  . ILE A 313 ? 0.4637 0.3713 0.4026 -0.0168 -0.0279 0.0653  314 ILE A CA  
2098 C C   . ILE A 313 ? 0.5324 0.4428 0.4641 -0.0142 -0.0191 0.0542  314 ILE A C   
2099 O O   . ILE A 313 ? 0.5093 0.4245 0.4300 -0.0171 -0.0144 0.0531  314 ILE A O   
2100 C CB  . ILE A 313 ? 0.4593 0.3655 0.4041 -0.0202 -0.0289 0.0744  314 ILE A CB  
2101 C CG1 . ILE A 313 ? 0.4273 0.3304 0.3812 -0.0231 -0.0394 0.0870  314 ILE A CG1 
2102 C CG2 . ILE A 313 ? 0.5339 0.4360 0.4943 -0.0157 -0.0239 0.0693  314 ILE A CG2 
2103 C CD1 . ILE A 313 ? 0.5034 0.4043 0.4652 -0.0273 -0.0423 0.0978  314 ILE A CD1 
2104 N N   . ILE A 314 ? 0.5129 0.4212 0.4518 -0.0092 -0.0174 0.0465  315 ILE A N   
2105 C CA  . ILE A 314 ? 0.4537 0.3639 0.3889 -0.0066 -0.0110 0.0369  315 ILE A CA  
2106 C C   . ILE A 314 ? 0.5197 0.4275 0.4679 -0.0035 -0.0071 0.0341  315 ILE A C   
2107 O O   . ILE A 314 ? 0.4915 0.3975 0.4502 -0.0007 -0.0082 0.0319  315 ILE A O   
2108 C CB  . ILE A 314 ? 0.4638 0.3738 0.3967 -0.0046 -0.0129 0.0312  315 ILE A CB  
2109 C CG1 . ILE A 314 ? 0.5278 0.4403 0.4470 -0.0081 -0.0169 0.0324  315 ILE A CG1 
2110 C CG2 . ILE A 314 ? 0.4636 0.3747 0.3961 -0.0020 -0.0076 0.0227  315 ILE A CG2 
2111 C CD1 . ILE A 314 ? 0.4651 0.3757 0.3876 -0.0093 -0.0251 0.0385  315 ILE A CD1 
2112 N N   . GLY A 315 ? 0.4706 0.3799 0.4181 -0.0045 -0.0025 0.0339  316 GLY A N   
2113 C CA  . GLY A 315 ? 0.4540 0.3616 0.4127 -0.0026 0.0008  0.0312  316 GLY A CA  
2114 C C   . GLY A 315 ? 0.5479 0.4587 0.5034 -0.0020 0.0065  0.0254  316 GLY A C   
2115 O O   . GLY A 315 ? 0.5992 0.5135 0.5466 -0.0039 0.0091  0.0256  316 GLY A O   
2116 N N   . GLU A 316 ? 0.5150 0.4256 0.4773 0.0002  0.0082  0.0204  317 GLU A N   
2117 C CA  . GLU A 316 ? 0.5177 0.4311 0.4800 0.0004  0.0123  0.0161  317 GLU A CA  
2118 C C   . GLU A 316 ? 0.5523 0.4647 0.5235 -0.0003 0.0140  0.0157  317 GLU A C   
2119 O O   . GLU A 316 ? 0.4812 0.3926 0.4597 0.0005  0.0133  0.0134  317 GLU A O   
2120 C CB  . GLU A 316 ? 0.4623 0.3770 0.4244 0.0021  0.0119  0.0115  317 GLU A CB  
2121 N N   . THR A 317 ? 0.5058 0.4193 0.4770 -0.0022 0.0164  0.0174  318 THR A N   
2122 C CA  . THR A 317 ? 0.5499 0.4620 0.5300 -0.0033 0.0175  0.0167  318 THR A CA  
2123 C C   . THR A 317 ? 0.6259 0.5420 0.6060 -0.0039 0.0205  0.0125  318 THR A C   
2124 O O   . THR A 317 ? 0.6833 0.6025 0.6590 -0.0028 0.0209  0.0102  318 THR A O   
2125 C CB  . THR A 317 ? 0.6056 0.5155 0.5887 -0.0060 0.0168  0.0230  318 THR A CB  
2126 O OG1 . THR A 317 ? 0.6840 0.5982 0.6581 -0.0080 0.0189  0.0261  318 THR A OG1 
2127 C CG2 . THR A 317 ? 0.5807 0.4860 0.5673 -0.0058 0.0123  0.0280  318 THR A CG2 
2128 N N   . GLY A 318 ? 0.7199 0.6357 0.7065 -0.0057 0.0217  0.0118  319 GLY A N   
2129 C CA  . GLY A 318 ? 0.7418 0.6616 0.7293 -0.0068 0.0234  0.0084  319 GLY A CA  
2130 C C   . GLY A 318 ? 0.6407 0.5637 0.6272 -0.0084 0.0256  0.0111  319 GLY A C   
2131 O O   . GLY A 318 ? 0.5934 0.5174 0.5753 -0.0085 0.0265  0.0148  319 GLY A O   
2132 N N   . GLY A 319 ? 0.5527 0.4788 0.5435 -0.0101 0.0265  0.0089  320 GLY A N   
2133 C CA  . GLY A 319 ? 0.4941 0.4246 0.4866 -0.0117 0.0288  0.0109  320 GLY A CA  
2134 C C   . GLY A 319 ? 0.4284 0.3608 0.4275 -0.0143 0.0284  0.0086  320 GLY A C   
2135 O O   . GLY A 319 ? 0.4623 0.3936 0.4625 -0.0149 0.0265  0.0048  320 GLY A O   
2136 N N   . LYS A 320 ? 0.3619 0.2981 0.3652 -0.0165 0.0302  0.0107  321 LYS A N   
2137 C CA  . LYS A 320 ? 0.3104 0.2498 0.3199 -0.0191 0.0292  0.0086  321 LYS A CA  
2138 C C   . LYS A 320 ? 0.2778 0.2243 0.2884 -0.0174 0.0300  0.0085  321 LYS A C   
2139 O O   . LYS A 320 ? 0.2679 0.2193 0.2815 -0.0177 0.0331  0.0104  321 LYS A O   
2140 C CB  . LYS A 320 ? 0.3212 0.2602 0.3374 -0.0228 0.0302  0.0115  321 LYS A CB  
2141 C CG  . LYS A 320 ? 0.3504 0.2917 0.3735 -0.0262 0.0285  0.0090  321 LYS A CG  
2142 C CD  . LYS A 320 ? 0.3541 0.2902 0.3783 -0.0278 0.0259  0.0038  321 LYS A CD  
2143 C CE  . LYS A 320 ? 0.2975 0.2372 0.3267 -0.0321 0.0238  0.0004  321 LYS A CE  
2144 N NZ  . LYS A 320 ? 0.3023 0.2387 0.3307 -0.0338 0.0220  -0.0070 321 LYS A NZ  
2145 N N   . ASN A 321 ? 0.2747 0.2220 0.2837 -0.0157 0.0272  0.0062  322 ASN A N   
2146 C CA  . ASN A 321 ? 0.2638 0.2163 0.2764 -0.0132 0.0268  0.0059  322 ASN A CA  
2147 C C   . ASN A 321 ? 0.2879 0.2463 0.3099 -0.0156 0.0250  0.0064  322 ASN A C   
2148 O O   . ASN A 321 ? 0.2551 0.2132 0.2778 -0.0193 0.0222  0.0063  322 ASN A O   
2149 C CB  . ASN A 321 ? 0.2445 0.1946 0.2530 -0.0111 0.0233  0.0048  322 ASN A CB  
2150 C CG  . ASN A 321 ? 0.3098 0.2541 0.3098 -0.0094 0.0244  0.0045  322 ASN A CG  
2151 O OD1 . ASN A 321 ? 0.2497 0.1933 0.2468 -0.0078 0.0276  0.0050  322 ASN A OD1 
2152 N ND2 . ASN A 321 ? 0.2726 0.2139 0.2685 -0.0104 0.0220  0.0037  322 ASN A ND2 
2153 N N   . PHE A 322 ? 0.2463 0.2108 0.2765 -0.0135 0.0265  0.0062  323 PHE A N   
2154 C CA  . PHE A 322 ? 0.2970 0.2682 0.3390 -0.0157 0.0250  0.0072  323 PHE A CA  
2155 C C   . PHE A 322 ? 0.2597 0.2351 0.3120 -0.0135 0.0205  0.0071  323 PHE A C   
2156 O O   . PHE A 322 ? 0.2343 0.2091 0.2881 -0.0091 0.0209  0.0051  323 PHE A O   
2157 C CB  . PHE A 322 ? 0.2273 0.2044 0.2750 -0.0162 0.0311  0.0075  323 PHE A CB  
2158 C CG  . PHE A 322 ? 0.2471 0.2287 0.2961 -0.0120 0.0361  0.0047  323 PHE A CG  
2159 C CD1 . PHE A 322 ? 0.2345 0.2134 0.2722 -0.0115 0.0404  0.0045  323 PHE A CD1 
2160 C CD2 . PHE A 322 ? 0.2031 0.1921 0.2657 -0.0090 0.0362  0.0019  323 PHE A CD2 
2161 C CE1 . PHE A 322 ? 0.2893 0.2735 0.3266 -0.0085 0.0453  0.0006  323 PHE A CE1 
2162 C CE2 . PHE A 322 ? 0.3054 0.2994 0.3701 -0.0051 0.0415  -0.0031 323 PHE A CE2 
2163 C CZ  . PHE A 322 ? 0.2889 0.2808 0.3396 -0.0052 0.0463  -0.0040 323 PHE A CZ  
2164 N N   . HIS A 323 ? 0.2360 0.2153 0.2964 -0.0168 0.0155  0.0094  324 HIS A N   
2165 C CA  . HIS A 323 ? 0.2336 0.2185 0.3092 -0.0152 0.0108  0.0107  324 HIS A CA  
2166 C C   . HIS A 323 ? 0.2662 0.2595 0.3557 -0.0161 0.0135  0.0107  324 HIS A C   
2167 O O   . HIS A 323 ? 0.2567 0.2513 0.3449 -0.0210 0.0133  0.0124  324 HIS A O   
2168 C CB  . HIS A 323 ? 0.1992 0.1839 0.2745 -0.0194 0.0015  0.0150  324 HIS A CB  
2169 C CG  . HIS A 323 ? 0.2065 0.1859 0.2738 -0.0185 -0.0023 0.0161  324 HIS A CG  
2170 N ND1 . HIS A 323 ? 0.2018 0.1824 0.2696 -0.0224 -0.0112 0.0212  324 HIS A ND1 
2171 C CD2 . HIS A 323 ? 0.1985 0.1721 0.2569 -0.0148 0.0012  0.0135  324 HIS A CD2 
2172 C CE1 . HIS A 323 ? 0.3155 0.2913 0.3759 -0.0211 -0.0127 0.0217  324 HIS A CE1 
2173 N NE2 . HIS A 323 ? 0.2843 0.2556 0.3395 -0.0162 -0.0053 0.0168  324 HIS A NE2 
2174 N N   . LEU A 324 ? 0.2302 0.2295 0.3339 -0.0115 0.0163  0.0080  325 LEU A N   
2175 C CA  . LEU A 324 ? 0.2184 0.2279 0.3385 -0.0119 0.0193  0.0075  325 LEU A CA  
2176 C C   . LEU A 324 ? 0.2578 0.2726 0.3993 -0.0097 0.0120  0.0087  325 LEU A C   
2177 O O   . LEU A 324 ? 0.2853 0.2992 0.4351 -0.0045 0.0105  0.0060  325 LEU A O   
2178 C CB  . LEU A 324 ? 0.1996 0.2145 0.3203 -0.0087 0.0298  0.0022  325 LEU A CB  
2179 C CG  . LEU A 324 ? 0.2607 0.2890 0.4013 -0.0076 0.0348  -0.0006 325 LEU A CG  
2180 C CD1 . LEU A 324 ? 0.2192 0.2523 0.3631 -0.0137 0.0350  0.0040  325 LEU A CD1 
2181 C CD2 . LEU A 324 ? 0.2158 0.2502 0.3534 -0.0048 0.0455  -0.0071 325 LEU A CD2 
2182 N N   . VAL A 325 ? 0.1978 0.2173 0.3489 -0.0141 0.0065  0.0132  326 VAL A N   
2183 C CA  . VAL A 325 ? 0.2782 0.3032 0.4515 -0.0132 -0.0021 0.0163  326 VAL A CA  
2184 C C   . VAL A 325 ? 0.2539 0.2911 0.4499 -0.0112 0.0026  0.0135  326 VAL A C   
2185 O O   . VAL A 325 ? 0.1979 0.2401 0.3931 -0.0154 0.0064  0.0144  326 VAL A O   
2186 C CB  . VAL A 325 ? 0.2766 0.3006 0.4460 -0.0205 -0.0129 0.0238  326 VAL A CB  
2187 C CG1 . VAL A 325 ? 0.2391 0.2691 0.4326 -0.0204 -0.0236 0.0290  326 VAL A CG1 
2188 C CG2 . VAL A 325 ? 0.2376 0.2519 0.3842 -0.0235 -0.0164 0.0258  326 VAL A CG2 
2189 N N   . HIS A 326 ? 0.2289 0.2711 0.4465 -0.0048 0.0026  0.0095  327 HIS A N   
2190 C CA  . HIS A 326 ? 0.2341 0.2897 0.4783 -0.0021 0.0065  0.0059  327 HIS A CA  
2191 C C   . HIS A 326 ? 0.2211 0.2805 0.4865 -0.0044 -0.0060 0.0132  327 HIS A C   
2192 O O   . HIS A 326 ? 0.2550 0.3073 0.5180 -0.0061 -0.0174 0.0196  327 HIS A O   
2193 C CB  . HIS A 326 ? 0.2460 0.3050 0.5050 0.0063  0.0123  -0.0037 327 HIS A CB  
2194 C CG  . HIS A 326 ? 0.2750 0.3497 0.5622 0.0097  0.0188  -0.0102 327 HIS A CG  
2195 N ND1 . HIS A 326 ? 0.2744 0.3553 0.5950 0.0138  0.0115  -0.0104 327 HIS A ND1 
2196 C CD2 . HIS A 326 ? 0.2119 0.2985 0.4997 0.0093  0.0319  -0.0166 327 HIS A CD2 
2197 C CE1 . HIS A 326 ? 0.2762 0.3724 0.6180 0.0164  0.0206  -0.0180 327 HIS A CE1 
2198 N NE2 . HIS A 326 ? 0.3160 0.4165 0.6374 0.0133  0.0334  -0.0217 327 HIS A NE2 
2199 N N   . PRO A 327 ? 0.2479 0.3196 0.5341 -0.0054 -0.0045 0.0131  328 PRO A N   
2200 C CA  . PRO A 327 ? 0.2734 0.3490 0.5797 -0.0084 -0.0179 0.0213  328 PRO A CA  
2201 C C   . PRO A 327 ? 0.2917 0.3664 0.6227 -0.0029 -0.0277 0.0227  328 PRO A C   
2202 O O   . PRO A 327 ? 0.2982 0.3727 0.6398 -0.0066 -0.0418 0.0322  328 PRO A O   
2203 C CB  . PRO A 327 ? 0.2780 0.3683 0.6045 -0.0097 -0.0126 0.0196  328 PRO A CB  
2204 C CG  . PRO A 327 ? 0.3378 0.4329 0.6559 -0.0070 0.0041  0.0104  328 PRO A CG  
2205 C CD  . PRO A 327 ? 0.2895 0.3715 0.5768 -0.0063 0.0082  0.0081  328 PRO A CD  
2206 N N   . SER A 328 ? 0.2009 0.2747 0.5403 0.0053  -0.0212 0.0137  329 SER A N   
2207 C CA  . SER A 328 ? 0.2378 0.3094 0.6029 0.0111  -0.0307 0.0141  329 SER A CA  
2208 C C   . SER A 328 ? 0.3384 0.3955 0.6851 0.0092  -0.0402 0.0208  329 SER A C   
2209 O O   . SER A 328 ? 0.3633 0.4164 0.7294 0.0133  -0.0492 0.0225  329 SER A O   
2210 C CB  . SER A 328 ? 0.2037 0.2810 0.5875 0.0206  -0.0195 -0.0003 329 SER A CB  
2211 O OG  . SER A 328 ? 0.2309 0.2989 0.5895 0.0228  -0.0122 -0.0066 329 SER A OG  
2212 N N   . ALA A 329 ? 0.2854 0.3350 0.5967 0.0029  -0.0385 0.0245  330 ALA A N   
2213 C CA  . ALA A 329 ? 0.2777 0.3151 0.5701 0.0011  -0.0450 0.0294  330 ALA A CA  
2214 C C   . ALA A 329 ? 0.2838 0.3191 0.5849 -0.0043 -0.0629 0.0428  330 ALA A C   
2215 O O   . ALA A 329 ? 0.3071 0.3491 0.6168 -0.0097 -0.0701 0.0500  330 ALA A O   
2216 C CB  . ALA A 329 ? 0.2751 0.3064 0.5298 -0.0040 -0.0379 0.0288  330 ALA A CB  
2217 N N   . ASN A 330 ? 0.2365 0.2632 0.5353 -0.0038 -0.0705 0.0471  331 ASN A N   
2218 C CA  . ASN A 330 ? 0.2886 0.3134 0.5843 -0.0121 -0.0865 0.0617  331 ASN A CA  
2219 C C   . ASN A 330 ? 0.2713 0.2949 0.5301 -0.0214 -0.0839 0.0647  331 ASN A C   
2220 O O   . ASN A 330 ? 0.2810 0.2980 0.5147 -0.0213 -0.0762 0.0601  331 ASN A O   
2221 C CB  . ASN A 330 ? 0.3440 0.3601 0.6459 -0.0103 -0.0953 0.0665  331 ASN A CB  
2222 C CG  . ASN A 330 ? 0.4174 0.4335 0.7187 -0.0200 -0.1130 0.0833  331 ASN A CG  
2223 O OD1 . ASN A 330 ? 0.3946 0.4075 0.6675 -0.0277 -0.1151 0.0891  331 ASN A OD1 
2224 N ND2 . ASN A 330 ? 0.4762 0.4974 0.8095 -0.0202 -0.1259 0.0915  331 ASN A ND2 
2225 N N   . ILE A 331 ? 0.2737 0.3042 0.5307 -0.0294 -0.0902 0.0715  332 ILE A N   
2226 C CA  . ILE A 331 ? 0.2951 0.3260 0.5210 -0.0376 -0.0860 0.0710  332 ILE A CA  
2227 C C   . ILE A 331 ? 0.3763 0.4023 0.5768 -0.0448 -0.0915 0.0771  332 ILE A C   
2228 O O   . ILE A 331 ? 0.3402 0.3623 0.5141 -0.0468 -0.0829 0.0715  332 ILE A O   
2229 C CB  . ILE A 331 ? 0.3672 0.4073 0.5993 -0.0448 -0.0924 0.0761  332 ILE A CB  
2230 C CG1 . ILE A 331 ? 0.3814 0.4280 0.6382 -0.0382 -0.0854 0.0696  332 ILE A CG1 
2231 C CG2 . ILE A 331 ? 0.3458 0.3859 0.5468 -0.0536 -0.0886 0.0742  332 ILE A CG2 
2232 C CD1 . ILE A 331 ? 0.3993 0.4433 0.6430 -0.0330 -0.0677 0.0572  332 ILE A CD1 
2233 N N   . SER A 332 ? 0.3028 0.3297 0.5132 -0.0491 -0.1060 0.0889  333 SER A N   
2234 C CA  . SER A 332 ? 0.3763 0.4013 0.5642 -0.0576 -0.1123 0.0964  333 SER A CA  
2235 C C   . SER A 332 ? 0.3249 0.3407 0.4989 -0.0520 -0.1031 0.0896  333 SER A C   
2236 O O   . SER A 332 ? 0.2965 0.3109 0.4430 -0.0567 -0.0977 0.0869  333 SER A O   
2237 C CB  . SER A 332 ? 0.4737 0.5015 0.6788 -0.0630 -0.1306 0.1120  333 SER A CB  
2238 O OG  . SER A 332 ? 0.5868 0.6136 0.7701 -0.0716 -0.1361 0.1198  333 SER A OG  
2239 N N   . HIS A 333 ? 0.2995 0.3097 0.4940 -0.0420 -0.1014 0.0861  334 HIS A N   
2240 C CA  . HIS A 333 ? 0.2932 0.2949 0.4765 -0.0362 -0.0925 0.0787  334 HIS A CA  
2241 C C   . HIS A 333 ? 0.2913 0.2917 0.4523 -0.0340 -0.0768 0.0668  334 HIS A C   
2242 O O   . HIS A 333 ? 0.2533 0.2492 0.3924 -0.0353 -0.0714 0.0640  334 HIS A O   
2243 C CB  . HIS A 333 ? 0.2602 0.2572 0.4710 -0.0255 -0.0924 0.0742  334 HIS A CB  
2244 C CG  . HIS A 333 ? 0.2539 0.2426 0.4543 -0.0193 -0.0833 0.0656  334 HIS A CG  
2245 N ND1 . HIS A 333 ? 0.2507 0.2337 0.4381 -0.0228 -0.0876 0.0708  334 HIS A ND1 
2246 C CD2 . HIS A 333 ? 0.3006 0.2868 0.5010 -0.0108 -0.0704 0.0525  334 HIS A CD2 
2247 C CE1 . HIS A 333 ? 0.2404 0.2169 0.4210 -0.0162 -0.0781 0.0611  334 HIS A CE1 
2248 N NE2 . HIS A 333 ? 0.3240 0.3024 0.5116 -0.0091 -0.0677 0.0500  334 HIS A NE2 
2249 N N   . ALA A 334 ? 0.3054 0.3101 0.4736 -0.0311 -0.0701 0.0607  335 ALA A N   
2250 C CA  . ALA A 334 ? 0.2730 0.2763 0.4233 -0.0295 -0.0565 0.0509  335 ALA A CA  
2251 C C   . ALA A 334 ? 0.3089 0.3128 0.4332 -0.0385 -0.0564 0.0525  335 ALA A C   
2252 O O   . ALA A 334 ? 0.3407 0.3403 0.4464 -0.0378 -0.0475 0.0463  335 ALA A O   
2253 C CB  . ALA A 334 ? 0.2112 0.2203 0.3763 -0.0260 -0.0504 0.0458  335 ALA A CB  
2254 N N   . VAL A 335 ? 0.3076 0.3178 0.4317 -0.0472 -0.0665 0.0605  336 VAL A N   
2255 C CA  . VAL A 335 ? 0.2749 0.2877 0.3752 -0.0568 -0.0671 0.0609  336 VAL A CA  
2256 C C   . VAL A 335 ? 0.3017 0.3108 0.3840 -0.0591 -0.0668 0.0619  336 VAL A C   
2257 O O   . VAL A 335 ? 0.2768 0.2835 0.3401 -0.0602 -0.0586 0.0550  336 VAL A O   
2258 C CB  . VAL A 335 ? 0.2944 0.3161 0.3979 -0.0668 -0.0793 0.0698  336 VAL A CB  
2259 C CG1 . VAL A 335 ? 0.2514 0.2771 0.3287 -0.0775 -0.0801 0.0694  336 VAL A CG1 
2260 C CG2 . VAL A 335 ? 0.2923 0.3185 0.4106 -0.0657 -0.0784 0.0676  336 VAL A CG2 
2261 N N   . LEU A 336 ? 0.2715 0.2801 0.3617 -0.0599 -0.0760 0.0709  337 LEU A N   
2262 C CA  . LEU A 336 ? 0.2959 0.3025 0.3705 -0.0634 -0.0768 0.0735  337 LEU A CA  
2263 C C   . LEU A 336 ? 0.3282 0.3261 0.3965 -0.0548 -0.0653 0.0640  337 LEU A C   
2264 O O   . LEU A 336 ? 0.3173 0.3145 0.3669 -0.0576 -0.0605 0.0610  337 LEU A O   
2265 C CB  . LEU A 336 ? 0.3701 0.3774 0.4578 -0.0662 -0.0903 0.0864  337 LEU A CB  
2266 C CG  . LEU A 336 ? 0.3714 0.3886 0.4597 -0.0778 -0.1033 0.0981  337 LEU A CG  
2267 C CD1 . LEU A 336 ? 0.3784 0.3952 0.4899 -0.0784 -0.1183 0.1119  337 LEU A CD1 
2268 C CD2 . LEU A 336 ? 0.3779 0.4023 0.4380 -0.0896 -0.1032 0.0997  337 LEU A CD2 
2269 N N   . SER A 337 ? 0.2388 0.2314 0.3231 -0.0447 -0.0607 0.0591  338 SER A N   
2270 C CA  . SER A 337 ? 0.2545 0.2397 0.3330 -0.0371 -0.0504 0.0505  338 SER A CA  
2271 C C   . SER A 337 ? 0.2821 0.2671 0.3435 -0.0379 -0.0401 0.0424  338 SER A C   
2272 O O   . SER A 337 ? 0.2176 0.1981 0.2661 -0.0362 -0.0338 0.0378  338 SER A O   
2273 C CB  . SER A 337 ? 0.3202 0.3025 0.4189 -0.0275 -0.0473 0.0459  338 SER A CB  
2274 O OG  . SER A 337 ? 0.3555 0.3372 0.4741 -0.0260 -0.0574 0.0524  338 SER A OG  
2275 N N   . THR A 338 ? 0.2550 0.2446 0.3185 -0.0405 -0.0391 0.0410  339 THR A N   
2276 C CA  . THR A 338 ? 0.2674 0.2562 0.3179 -0.0419 -0.0307 0.0338  339 THR A CA  
2277 C C   . THR A 338 ? 0.3148 0.3059 0.3466 -0.0496 -0.0315 0.0331  339 THR A C   
2278 O O   . THR A 338 ? 0.3003 0.2879 0.3207 -0.0486 -0.0241 0.0265  339 THR A O   
2279 C CB  . THR A 338 ? 0.2144 0.2075 0.2736 -0.0432 -0.0301 0.0326  339 THR A CB  
2280 O OG1 . THR A 338 ? 0.2387 0.2314 0.3153 -0.0358 -0.0273 0.0316  339 THR A OG1 
2281 C CG2 . THR A 338 ? 0.2189 0.2099 0.2665 -0.0448 -0.0222 0.0254  339 THR A CG2 
2282 N N   . ILE A 339 ? 0.3152 0.3131 0.3445 -0.0577 -0.0406 0.0400  340 ILE A N   
2283 C CA  . ILE A 339 ? 0.3542 0.3569 0.3651 -0.0660 -0.0408 0.0387  340 ILE A CA  
2284 C C   . ILE A 339 ? 0.3867 0.3849 0.3896 -0.0628 -0.0365 0.0371  340 ILE A C   
2285 O O   . ILE A 339 ? 0.3344 0.3318 0.3253 -0.0634 -0.0293 0.0294  340 ILE A O   
2286 C CB  . ILE A 339 ? 0.3539 0.3663 0.3623 -0.0766 -0.0521 0.0481  340 ILE A CB  
2287 C CG1 . ILE A 339 ? 0.3214 0.3399 0.3310 -0.0823 -0.0549 0.0469  340 ILE A CG1 
2288 C CG2 . ILE A 339 ? 0.2510 0.2694 0.2404 -0.0847 -0.0518 0.0478  340 ILE A CG2 
2289 C CD1 . ILE A 339 ? 0.3720 0.3994 0.3859 -0.0911 -0.0684 0.0587  340 ILE A CD1 
2290 N N   . ARG A 340 ? 0.3363 0.3310 0.3481 -0.0590 -0.0410 0.0436  341 ARG A N   
2291 C CA  . ARG A 340 ? 0.3541 0.3444 0.3601 -0.0561 -0.0380 0.0428  341 ARG A CA  
2292 C C   . ARG A 340 ? 0.3493 0.3317 0.3537 -0.0476 -0.0274 0.0333  341 ARG A C   
2293 O O   . ARG A 340 ? 0.3326 0.3139 0.3263 -0.0478 -0.0222 0.0288  341 ARG A O   
2294 C CB  . ARG A 340 ? 0.3522 0.3396 0.3706 -0.0539 -0.0460 0.0515  341 ARG A CB  
2295 C CG  . ARG A 340 ? 0.4705 0.4656 0.4875 -0.0638 -0.0572 0.0630  341 ARG A CG  
2296 C CD  . ARG A 340 ? 0.5581 0.5485 0.5914 -0.0609 -0.0661 0.0720  341 ARG A CD  
2297 N N   . GLY A 341 ? 0.2860 0.2640 0.3014 -0.0408 -0.0245 0.0307  342 GLY A N   
2298 C CA  . GLY A 341 ? 0.2994 0.2707 0.3131 -0.0337 -0.0156 0.0236  342 GLY A CA  
2299 C C   . GLY A 341 ? 0.3363 0.3074 0.3398 -0.0358 -0.0091 0.0170  342 GLY A C   
2300 O O   . GLY A 341 ? 0.3471 0.3130 0.3462 -0.0319 -0.0032 0.0126  342 GLY A O   
2301 N N   . THR A 342 ? 0.2876 0.2643 0.2884 -0.0421 -0.0110 0.0164  343 THR A N   
2302 C CA  . THR A 342 ? 0.2585 0.2347 0.2533 -0.0441 -0.0055 0.0091  343 THR A CA  
2303 C C   . THR A 342 ? 0.2711 0.2516 0.2539 -0.0498 -0.0046 0.0050  343 THR A C   
2304 O O   . THR A 342 ? 0.2612 0.2386 0.2406 -0.0483 0.0013  -0.0021 343 THR A O   
2305 C CB  . THR A 342 ? 0.2711 0.2513 0.2709 -0.0482 -0.0077 0.0087  343 THR A CB  
2306 O OG1 . THR A 342 ? 0.3396 0.3184 0.3522 -0.0436 -0.0085 0.0126  343 THR A OG1 
2307 C CG2 . THR A 342 ? 0.2492 0.2271 0.2463 -0.0495 -0.0022 0.0006  343 THR A CG2 
2308 N N   . PHE A 343 ? 0.2364 0.2251 0.2139 -0.0569 -0.0105 0.0096  344 PHE A N   
2309 C CA  . PHE A 343 ? 0.3184 0.3151 0.2839 -0.0647 -0.0093 0.0047  344 PHE A CA  
2310 C C   . PHE A 343 ? 0.3746 0.3745 0.3329 -0.0663 -0.0093 0.0072  344 PHE A C   
2311 O O   . PHE A 343 ? 0.3634 0.3708 0.3121 -0.0719 -0.0062 0.0015  344 PHE A O   
2312 C CB  . PHE A 343 ? 0.2425 0.2490 0.2039 -0.0744 -0.0154 0.0069  344 PHE A CB  
2313 C CG  . PHE A 343 ? 0.2870 0.2913 0.2555 -0.0738 -0.0152 0.0035  344 PHE A CG  
2314 C CD1 . PHE A 343 ? 0.3087 0.3088 0.2776 -0.0719 -0.0083 -0.0072 344 PHE A CD1 
2315 C CD2 . PHE A 343 ? 0.2757 0.2821 0.2525 -0.0754 -0.0225 0.0113  344 PHE A CD2 
2316 C CE1 . PHE A 343 ? 0.2869 0.2848 0.2633 -0.0720 -0.0085 -0.0096 344 PHE A CE1 
2317 C CE2 . PHE A 343 ? 0.2756 0.2808 0.2599 -0.0753 -0.0224 0.0086  344 PHE A CE2 
2318 C CZ  . PHE A 343 ? 0.3251 0.3260 0.3086 -0.0739 -0.0154 -0.0017 344 PHE A CZ  
2319 N N   . GLU A 344 ? 0.3510 0.3461 0.3151 -0.0617 -0.0127 0.0150  345 GLU A N   
2320 C CA  . GLU A 344 ? 0.3036 0.3006 0.2631 -0.0628 -0.0133 0.0183  345 GLU A CA  
2321 C C   . GLU A 344 ? 0.3284 0.3228 0.2842 -0.0591 -0.0046 0.0089  345 GLU A C   
2322 O O   . GLU A 344 ? 0.2629 0.2485 0.2244 -0.0515 0.0001  0.0040  345 GLU A O   
2323 C CB  . GLU A 344 ? 0.3599 0.3496 0.3293 -0.0570 -0.0183 0.0265  345 GLU A CB  
2324 C CG  . GLU A 344 ? 0.5920 0.5824 0.5587 -0.0580 -0.0200 0.0309  345 GLU A CG  
2325 C CD  . GLU A 344 ? 0.6832 0.6857 0.6412 -0.0695 -0.0254 0.0375  345 GLU A CD  
2326 O OE1 . GLU A 344 ? 0.7091 0.7191 0.6640 -0.0767 -0.0297 0.0405  345 GLU A OE1 
2327 O OE2 . GLU A 344 ? 0.6909 0.6964 0.6451 -0.0720 -0.0255 0.0404  345 GLU A OE2 
2328 N N   . PHE A 345 ? 0.2963 0.2995 0.2434 -0.0650 -0.0026 0.0067  346 PHE A N   
2329 C CA  . PHE A 345 ? 0.2491 0.2520 0.1950 -0.0622 0.0055  -0.0030 346 PHE A CA  
2330 C C   . PHE A 345 ? 0.2763 0.2754 0.2257 -0.0593 0.0110  -0.0136 346 PHE A C   
2331 O O   . PHE A 345 ? 0.2825 0.2744 0.2378 -0.0526 0.0160  -0.0192 346 PHE A O   
2332 C CB  . PHE A 345 ? 0.2243 0.2183 0.1759 -0.0542 0.0065  -0.0004 346 PHE A CB  
2333 C CG  . PHE A 345 ? 0.2690 0.2649 0.2205 -0.0525 0.0134  -0.0086 346 PHE A CG  
2334 C CD1 . PHE A 345 ? 0.2781 0.2872 0.2231 -0.0600 0.0169  -0.0143 346 PHE A CD1 
2335 C CD2 . PHE A 345 ? 0.3043 0.2901 0.2630 -0.0439 0.0163  -0.0110 346 PHE A CD2 
2336 C CE1 . PHE A 345 ? 0.2730 0.2850 0.2209 -0.0581 0.0236  -0.0231 346 PHE A CE1 
2337 C CE2 . PHE A 345 ? 0.2860 0.2737 0.2475 -0.0422 0.0218  -0.0182 346 PHE A CE2 
2338 C CZ  . PHE A 345 ? 0.3055 0.3063 0.2629 -0.0489 0.0256  -0.0247 346 PHE A CZ  
2339 N N   . GLN A 346 ? 0.2849 0.2886 0.2317 -0.0647 0.0091  -0.0155 347 GLN A N   
2340 C CA  . GLN A 346 ? 0.2385 0.2389 0.1895 -0.0633 0.0133  -0.0254 347 GLN A CA  
2341 C C   . GLN A 346 ? 0.2745 0.2612 0.2365 -0.0539 0.0146  -0.0244 347 GLN A C   
2342 O O   . GLN A 346 ? 0.3134 0.2951 0.2812 -0.0512 0.0188  -0.0322 347 GLN A O   
2343 C CB  . GLN A 346 ? 0.2924 0.2986 0.2417 -0.0654 0.0202  -0.0383 347 GLN A CB  
2344 C CG  . GLN A 346 ? 0.3402 0.3629 0.2775 -0.0768 0.0203  -0.0427 347 GLN A CG  
2345 C CD  . GLN A 346 ? 0.3853 0.4163 0.3139 -0.0819 0.0162  -0.0321 347 GLN A CD  
2346 O OE1 . GLN A 346 ? 0.3571 0.3919 0.2806 -0.0874 0.0088  -0.0219 347 GLN A OE1 
2347 N NE2 . GLN A 346 ? 0.3241 0.3573 0.2531 -0.0798 0.0202  -0.0334 347 GLN A NE2 
2348 N N   . GLY A 347 ? 0.2700 0.2511 0.2354 -0.0496 0.0108  -0.0150 348 GLY A N   
2349 C CA  . GLY A 347 ? 0.2380 0.2086 0.2118 -0.0420 0.0124  -0.0136 348 GLY A CA  
2350 C C   . GLY A 347 ? 0.2790 0.2427 0.2552 -0.0359 0.0167  -0.0161 348 GLY A C   
2351 O O   . GLY A 347 ? 0.3361 0.2920 0.3181 -0.0308 0.0184  -0.0156 348 GLY A O   
2352 N N   . GLN A 348 ? 0.2347 0.2023 0.2069 -0.0369 0.0179  -0.0178 349 GLN A N   
2353 C CA  . GLN A 348 ? 0.3009 0.2632 0.2769 -0.0317 0.0213  -0.0205 349 GLN A CA  
2354 C C   . GLN A 348 ? 0.3754 0.3327 0.3511 -0.0270 0.0190  -0.0132 349 GLN A C   
2355 O O   . GLN A 348 ? 0.3585 0.3169 0.3331 -0.0261 0.0194  -0.0129 349 GLN A O   
2356 C CB  . GLN A 348 ? 0.2381 0.2081 0.2124 -0.0350 0.0247  -0.0279 349 GLN A CB  
2357 C CG  . GLN A 348 ? 0.2233 0.1973 0.1999 -0.0388 0.0280  -0.0383 349 GLN A CG  
2358 C CD  . GLN A 348 ? 0.2878 0.2721 0.2631 -0.0426 0.0324  -0.0476 349 GLN A CD  
2359 O OE1 . GLN A 348 ? 0.2531 0.2364 0.2372 -0.0408 0.0367  -0.0579 349 GLN A OE1 
2360 N NE2 . GLN A 348 ? 0.2309 0.2256 0.1965 -0.0482 0.0312  -0.0441 349 GLN A NE2 
2361 N N   . LYS A 349 ? 0.4690 0.4216 0.4464 -0.0242 0.0168  -0.0082 350 LYS A N   
2362 C CA  . LYS A 349 ? 0.3990 0.3468 0.3769 -0.0196 0.0150  -0.0032 350 LYS A CA  
2363 C C   . LYS A 349 ? 0.4144 0.3557 0.3959 -0.0153 0.0170  -0.0027 350 LYS A C   
2364 O O   . LYS A 349 ? 0.3574 0.2990 0.3416 -0.0164 0.0177  -0.0031 350 LYS A O   
2365 C CB  . LYS A 349 ? 0.3706 0.3212 0.3485 -0.0212 0.0102  0.0021  350 LYS A CB  
2366 C CG  . LYS A 349 ? 0.3235 0.2814 0.2974 -0.0271 0.0070  0.0043  350 LYS A CG  
2367 C CD  . LYS A 349 ? 0.3986 0.3578 0.3760 -0.0283 0.0007  0.0110  350 LYS A CD  
2368 C CE  . LYS A 349 ? 0.4915 0.4588 0.4649 -0.0358 -0.0042 0.0158  350 LYS A CE  
2369 N NZ  . LYS A 349 ? 0.5665 0.5326 0.5467 -0.0358 -0.0118 0.0239  350 LYS A NZ  
2370 N N   . CYS A 350 ? 0.3913 0.3277 0.3723 -0.0112 0.0175  -0.0013 351 CYS A N   
2371 C CA  . CYS A 350 ? 0.4109 0.3429 0.3932 -0.0083 0.0191  0.0002  351 CYS A CA  
2372 C C   . CYS A 350 ? 0.3186 0.2529 0.3028 -0.0081 0.0188  0.0020  351 CYS A C   
2373 O O   . CYS A 350 ? 0.3469 0.2805 0.3328 -0.0076 0.0211  0.0027  351 CYS A O   
2374 C CB  . CYS A 350 ? 0.5607 0.4889 0.5402 -0.0050 0.0186  0.0019  351 CYS A CB  
2375 S SG  . CYS A 350 ? 1.1867 1.1161 1.1639 -0.0048 0.0154  0.0021  351 CYS A SG  
2376 N N   . SER A 351 ? 0.2832 0.2206 0.2684 -0.0088 0.0157  0.0030  352 SER A N   
2377 C CA  . SER A 351 ? 0.3777 0.3175 0.3682 -0.0079 0.0147  0.0042  352 SER A CA  
2378 C C   . SER A 351 ? 0.3752 0.3200 0.3699 -0.0119 0.0128  0.0050  352 SER A C   
2379 O O   . SER A 351 ? 0.3361 0.2837 0.3378 -0.0113 0.0113  0.0063  352 SER A O   
2380 C CB  . SER A 351 ? 0.3987 0.3382 0.3915 -0.0059 0.0110  0.0053  352 SER A CB  
2381 O OG  . SER A 351 ? 0.4665 0.4081 0.4584 -0.0094 0.0066  0.0077  352 SER A OG  
2382 N N   . ALA A 352 ? 0.3120 0.2583 0.3032 -0.0160 0.0127  0.0037  353 ALA A N   
2383 C CA  . ALA A 352 ? 0.2960 0.2475 0.2892 -0.0209 0.0106  0.0038  353 ALA A CA  
2384 C C   . ALA A 352 ? 0.2686 0.2210 0.2688 -0.0204 0.0120  0.0042  353 ALA A C   
2385 O O   . ALA A 352 ? 0.3306 0.2798 0.3316 -0.0183 0.0161  0.0029  353 ALA A O   
2386 C CB  . ALA A 352 ? 0.2487 0.2015 0.2371 -0.0249 0.0123  -0.0007 353 ALA A CB  
2387 N N   . ALA A 353 ? 0.2589 0.2164 0.2648 -0.0229 0.0080  0.0067  354 ALA A N   
2388 C CA  . ALA A 353 ? 0.3231 0.2830 0.3365 -0.0237 0.0092  0.0068  354 ALA A CA  
2389 C C   . ALA A 353 ? 0.2831 0.2429 0.2935 -0.0281 0.0106  0.0035  354 ALA A C   
2390 O O   . ALA A 353 ? 0.2795 0.2415 0.2843 -0.0327 0.0083  0.0015  354 ALA A O   
2391 C CB  . ALA A 353 ? 0.2931 0.2590 0.3152 -0.0255 0.0035  0.0105  354 ALA A CB  
2392 N N   . SER A 354 ? 0.2053 0.1630 0.2198 -0.0275 0.0144  0.0026  355 SER A N   
2393 C CA  . SER A 354 ? 0.2574 0.2143 0.2723 -0.0320 0.0147  -0.0008 355 SER A CA  
2394 C C   . SER A 354 ? 0.2571 0.2163 0.2813 -0.0337 0.0153  0.0008  355 SER A C   
2395 O O   . SER A 354 ? 0.2451 0.2037 0.2717 -0.0379 0.0147  -0.0019 355 SER A O   
2396 C CB  . SER A 354 ? 0.3221 0.2722 0.3337 -0.0306 0.0181  -0.0044 355 SER A CB  
2397 O OG  . SER A 354 ? 0.3314 0.2774 0.3447 -0.0266 0.0213  -0.0012 355 SER A OG  
2398 N N   . ARG A 355 ? 0.2383 0.2005 0.2685 -0.0308 0.0167  0.0046  356 ARG A N   
2399 C CA  . ARG A 355 ? 0.2288 0.1956 0.2691 -0.0331 0.0171  0.0065  356 ARG A CA  
2400 C C   . ARG A 355 ? 0.2200 0.1944 0.2689 -0.0317 0.0146  0.0091  356 ARG A C   
2401 O O   . ARG A 355 ? 0.2502 0.2250 0.2989 -0.0272 0.0150  0.0097  356 ARG A O   
2402 C CB  . ARG A 355 ? 0.2339 0.1988 0.2768 -0.0320 0.0226  0.0083  356 ARG A CB  
2403 C CG  . ARG A 355 ? 0.2707 0.2348 0.3092 -0.0270 0.0267  0.0095  356 ARG A CG  
2404 C CD  . ARG A 355 ? 0.2716 0.2365 0.3117 -0.0278 0.0317  0.0126  356 ARG A CD  
2405 N NE  . ARG A 355 ? 0.2621 0.2253 0.2944 -0.0243 0.0350  0.0132  356 ARG A NE  
2406 C CZ  . ARG A 355 ? 0.2897 0.2583 0.3219 -0.0241 0.0399  0.0154  356 ARG A CZ  
2407 N NH1 . ARG A 355 ? 0.2895 0.2662 0.3302 -0.0271 0.0428  0.0174  356 ARG A NH1 
2408 N NH2 . ARG A 355 ? 0.2721 0.2392 0.2954 -0.0217 0.0421  0.0154  356 ARG A NH2 
2409 N N   . LEU A 356 ? 0.2085 0.1886 0.2667 -0.0354 0.0116  0.0105  357 LEU A N   
2410 C CA  . LEU A 356 ? 0.2055 0.1932 0.2753 -0.0346 0.0076  0.0133  357 LEU A CA  
2411 C C   . LEU A 356 ? 0.2759 0.2706 0.3599 -0.0359 0.0097  0.0148  357 LEU A C   
2412 O O   . LEU A 356 ? 0.2696 0.2641 0.3543 -0.0408 0.0094  0.0146  357 LEU A O   
2413 C CB  . LEU A 356 ? 0.2344 0.2241 0.3017 -0.0396 -0.0009 0.0148  357 LEU A CB  
2414 C CG  . LEU A 356 ? 0.2650 0.2626 0.3464 -0.0407 -0.0079 0.0193  357 LEU A CG  
2415 C CD1 . LEU A 356 ? 0.2053 0.2032 0.2933 -0.0347 -0.0093 0.0213  357 LEU A CD1 
2416 C CD2 . LEU A 356 ? 0.2177 0.2181 0.2933 -0.0485 -0.0165 0.0213  357 LEU A CD2 
2417 N N   . TYR A 357 ? 0.2276 0.2288 0.3240 -0.0317 0.0119  0.0155  358 TYR A N   
2418 C CA  . TYR A 357 ? 0.2209 0.2311 0.3328 -0.0329 0.0144  0.0166  358 TYR A CA  
2419 C C   . TYR A 357 ? 0.2614 0.2789 0.3898 -0.0325 0.0073  0.0188  358 TYR A C   
2420 O O   . TYR A 357 ? 0.2540 0.2726 0.3887 -0.0276 0.0057  0.0183  358 TYR A O   
2421 C CB  . TYR A 357 ? 0.2029 0.2173 0.3178 -0.0289 0.0239  0.0147  358 TYR A CB  
2422 C CG  . TYR A 357 ? 0.2791 0.2862 0.3782 -0.0297 0.0295  0.0144  358 TYR A CG  
2423 C CD1 . TYR A 357 ? 0.2787 0.2774 0.3637 -0.0266 0.0297  0.0127  358 TYR A CD1 
2424 C CD2 . TYR A 357 ? 0.2259 0.2348 0.3258 -0.0341 0.0337  0.0168  358 TYR A CD2 
2425 C CE1 . TYR A 357 ? 0.2727 0.2650 0.3453 -0.0274 0.0336  0.0132  358 TYR A CE1 
2426 C CE2 . TYR A 357 ? 0.2508 0.2528 0.3384 -0.0353 0.0372  0.0180  358 TYR A CE2 
2427 C CZ  . TYR A 357 ? 0.2624 0.2560 0.3365 -0.0317 0.0370  0.0161  358 TYR A CZ  
2428 O OH  . TYR A 357 ? 0.2635 0.2503 0.3273 -0.0327 0.0394  0.0180  358 TYR A OH  
2429 N N   . LEU A 358 ? 0.2732 0.2954 0.4095 -0.0381 0.0022  0.0215  359 LEU A N   
2430 C CA  . LEU A 358 ? 0.2950 0.3246 0.4481 -0.0391 -0.0063 0.0251  359 LEU A CA  
2431 C C   . LEU A 358 ? 0.3117 0.3521 0.4855 -0.0396 -0.0038 0.0259  359 LEU A C   
2432 O O   . LEU A 358 ? 0.2310 0.2725 0.4030 -0.0438 0.0000  0.0257  359 LEU A O   
2433 C CB  . LEU A 358 ? 0.2211 0.2489 0.3664 -0.0467 -0.0160 0.0282  359 LEU A CB  
2434 C CG  . LEU A 358 ? 0.2893 0.3102 0.4171 -0.0482 -0.0208 0.0285  359 LEU A CG  
2435 C CD1 . LEU A 358 ? 0.2653 0.2887 0.3876 -0.0572 -0.0298 0.0309  359 LEU A CD1 
2436 C CD2 . LEU A 358 ? 0.2425 0.2639 0.3780 -0.0429 -0.0248 0.0314  359 LEU A CD2 
2437 N N   . PRO A 359 ? 0.2029 0.2518 0.3985 -0.0357 -0.0065 0.0269  360 PRO A N   
2438 C CA  . PRO A 359 ? 0.2457 0.3067 0.4636 -0.0369 -0.0051 0.0278  360 PRO A CA  
2439 C C   . PRO A 359 ? 0.2495 0.3123 0.4700 -0.0450 -0.0152 0.0330  360 PRO A C   
2440 O O   . PRO A 359 ? 0.2777 0.3367 0.4924 -0.0480 -0.0256 0.0367  360 PRO A O   
2441 C CB  . PRO A 359 ? 0.2569 0.3254 0.4990 -0.0301 -0.0070 0.0268  360 PRO A CB  
2442 C CG  . PRO A 359 ? 0.2925 0.3519 0.5262 -0.0284 -0.0156 0.0291  360 PRO A CG  
2443 C CD  . PRO A 359 ? 0.2407 0.2884 0.4440 -0.0303 -0.0116 0.0273  360 PRO A CD  
2444 N N   . GLU A 360 ? 0.2291 0.2984 0.4578 -0.0493 -0.0124 0.0336  361 GLU A N   
2445 C CA  . GLU A 360 ? 0.3155 0.3874 0.5481 -0.0575 -0.0221 0.0379  361 GLU A CA  
2446 C C   . GLU A 360 ? 0.3555 0.4336 0.6048 -0.0583 -0.0349 0.0433  361 GLU A C   
2447 O O   . GLU A 360 ? 0.3939 0.4695 0.6342 -0.0651 -0.0454 0.0469  361 GLU A O   
2448 C CB  . GLU A 360 ? 0.3248 0.4041 0.5686 -0.0615 -0.0170 0.0380  361 GLU A CB  
2449 C CG  . GLU A 360 ? 0.4058 0.4769 0.6313 -0.0634 -0.0080 0.0350  361 GLU A CG  
2450 C CD  . GLU A 360 ? 0.4792 0.5559 0.7142 -0.0694 -0.0050 0.0367  361 GLU A CD  
2451 O OE1 . GLU A 360 ? 0.5059 0.5957 0.7637 -0.0701 -0.0054 0.0391  361 GLU A OE1 
2452 O OE2 . GLU A 360 ? 0.5291 0.5972 0.7502 -0.0734 -0.0025 0.0358  361 GLU A OE2 
2453 N N   . SER A 361 ? 0.2644 0.3509 0.5381 -0.0517 -0.0343 0.0437  362 SER A N   
2454 C CA  . SER A 361 ? 0.2993 0.3918 0.5933 -0.0525 -0.0476 0.0501  362 SER A CA  
2455 C C   . SER A 361 ? 0.3662 0.4499 0.6453 -0.0538 -0.0578 0.0544  362 SER A C   
2456 O O   . SER A 361 ? 0.3944 0.4816 0.6823 -0.0583 -0.0716 0.0621  362 SER A O   
2457 C CB  . SER A 361 ? 0.2611 0.3641 0.5878 -0.0442 -0.0446 0.0483  362 SER A CB  
2458 O OG  . SER A 361 ? 0.3700 0.4673 0.6939 -0.0359 -0.0399 0.0438  362 SER A OG  
2459 N N   . LYS A 362 ? 0.3813 0.4548 0.6382 -0.0507 -0.0516 0.0503  363 LYS A N   
2460 C CA  . LYS A 362 ? 0.3281 0.3944 0.5721 -0.0517 -0.0600 0.0544  363 LYS A CA  
2461 C C   . LYS A 362 ? 0.3273 0.3858 0.5392 -0.0591 -0.0606 0.0535  363 LYS A C   
2462 O O   . LYS A 362 ? 0.3060 0.3600 0.5039 -0.0618 -0.0671 0.0569  363 LYS A O   
2463 C CB  . LYS A 362 ? 0.3191 0.3802 0.5652 -0.0422 -0.0538 0.0503  363 LYS A CB  
2464 C CG  . LYS A 362 ? 0.3194 0.3884 0.5983 -0.0341 -0.0521 0.0484  363 LYS A CG  
2465 C CD  . LYS A 362 ? 0.3711 0.4456 0.6745 -0.0358 -0.0676 0.0574  363 LYS A CD  
2466 C CE  . LYS A 362 ? 0.4405 0.5235 0.7809 -0.0270 -0.0656 0.0540  363 LYS A CE  
2467 N NZ  . LYS A 362 ? 0.5592 0.6491 0.9283 -0.0293 -0.0814 0.0636  363 LYS A NZ  
2468 N N   . SER A 363 ? 0.3441 0.4018 0.5461 -0.0626 -0.0539 0.0488  364 SER A N   
2469 C CA  . SER A 363 ? 0.3471 0.3970 0.5215 -0.0680 -0.0519 0.0449  364 SER A CA  
2470 C C   . SER A 363 ? 0.3525 0.4040 0.5148 -0.0775 -0.0638 0.0491  364 SER A C   
2471 O O   . SER A 363 ? 0.3557 0.4020 0.4980 -0.0796 -0.0646 0.0480  364 SER A O   
2472 C CB  . SER A 363 ? 0.3656 0.4147 0.5377 -0.0705 -0.0443 0.0399  364 SER A CB  
2473 O OG  . SER A 363 ? 0.5060 0.5538 0.6839 -0.0629 -0.0328 0.0365  364 SER A OG  
2474 N N   . GLU A 364 ? 0.3543 0.4142 0.5287 -0.0840 -0.0729 0.0538  365 GLU A N   
2475 C CA  . GLU A 364 ? 0.3390 0.4026 0.5013 -0.0948 -0.0849 0.0580  365 GLU A CA  
2476 C C   . GLU A 364 ? 0.3804 0.4442 0.5387 -0.0951 -0.0931 0.0654  365 GLU A C   
2477 O O   . GLU A 364 ? 0.3785 0.4412 0.5143 -0.1019 -0.0966 0.0655  365 GLU A O   
2478 C CB  . GLU A 364 ? 0.3286 0.4022 0.5084 -0.1013 -0.0946 0.0632  365 GLU A CB  
2479 N N   . GLU A 365 ? 0.3645 0.4300 0.5455 -0.0878 -0.0958 0.0712  366 GLU A N   
2480 C CA  . GLU A 365 ? 0.2947 0.3598 0.4762 -0.0880 -0.1049 0.0796  366 GLU A CA  
2481 C C   . GLU A 365 ? 0.3592 0.4152 0.5186 -0.0848 -0.0972 0.0749  366 GLU A C   
2482 O O   . GLU A 365 ? 0.3873 0.4435 0.5304 -0.0913 -0.1038 0.0797  366 GLU A O   
2483 C CB  . GLU A 365 ? 0.2991 0.3671 0.5140 -0.0798 -0.1093 0.0852  366 GLU A CB  
2484 C CG  . GLU A 365 ? 0.3947 0.4601 0.6134 -0.0789 -0.1187 0.0940  366 GLU A CG  
2485 C CD  . GLU A 365 ? 0.4514 0.5175 0.7052 -0.0686 -0.1208 0.0963  366 GLU A CD  
2486 O OE1 . GLU A 365 ? 0.5011 0.5721 0.7769 -0.0630 -0.1155 0.0916  366 GLU A OE1 
2487 O OE2 . GLU A 365 ? 0.4783 0.5406 0.7389 -0.0663 -0.1277 0.1023  366 GLU A OE2 
2488 N N   . PHE A 366 ? 0.3561 0.4053 0.5152 -0.0754 -0.0836 0.0661  367 PHE A N   
2489 C CA  . PHE A 366 ? 0.2778 0.3183 0.4182 -0.0717 -0.0759 0.0613  367 PHE A CA  
2490 C C   . PHE A 366 ? 0.3103 0.3497 0.4225 -0.0804 -0.0750 0.0576  367 PHE A C   
2491 O O   . PHE A 366 ? 0.2877 0.3260 0.3844 -0.0841 -0.0781 0.0599  367 PHE A O   
2492 C CB  . PHE A 366 ? 0.2270 0.2620 0.3716 -0.0617 -0.0618 0.0525  367 PHE A CB  
2493 C CG  . PHE A 366 ? 0.2641 0.2901 0.3920 -0.0570 -0.0540 0.0477  367 PHE A CG  
2494 C CD1 . PHE A 366 ? 0.2920 0.3136 0.3960 -0.0611 -0.0494 0.0427  367 PHE A CD1 
2495 C CD2 . PHE A 366 ? 0.2718 0.2944 0.4099 -0.0483 -0.0511 0.0473  367 PHE A CD2 
2496 C CE1 . PHE A 366 ? 0.2226 0.2366 0.3133 -0.0567 -0.0426 0.0387  367 PHE A CE1 
2497 C CE2 . PHE A 366 ? 0.2156 0.2303 0.3390 -0.0444 -0.0446 0.0431  367 PHE A CE2 
2498 C CZ  . PHE A 366 ? 0.2174 0.2280 0.3173 -0.0485 -0.0406 0.0394  367 PHE A CZ  
2499 N N   . LEU A 367 ? 0.3060 0.3463 0.4129 -0.0841 -0.0708 0.0513  368 LEU A N   
2500 C CA  . LEU A 367 ? 0.2896 0.3286 0.3725 -0.0913 -0.0684 0.0447  368 LEU A CA  
2501 C C   . LEU A 367 ? 0.3807 0.4279 0.4520 -0.1030 -0.0801 0.0504  368 LEU A C   
2502 O O   . LEU A 367 ? 0.4007 0.4479 0.4515 -0.1077 -0.0790 0.0475  368 LEU A O   
2503 C CB  . LEU A 367 ? 0.2923 0.3297 0.3759 -0.0926 -0.0622 0.0365  368 LEU A CB  
2504 C CG  . LEU A 367 ? 0.3097 0.3391 0.3994 -0.0826 -0.0500 0.0313  368 LEU A CG  
2505 C CD1 . LEU A 367 ? 0.2917 0.3202 0.3867 -0.0845 -0.0456 0.0260  368 LEU A CD1 
2506 C CD2 . LEU A 367 ? 0.2735 0.2947 0.3464 -0.0788 -0.0425 0.0259  368 LEU A CD2 
2507 N N   . SER A 368 ? 0.4074 0.4628 0.4921 -0.1082 -0.0914 0.0590  369 SER A N   
2508 C CA  . SER A 368 ? 0.4081 0.4726 0.4821 -0.1204 -0.1042 0.0669  369 SER A CA  
2509 C C   . SER A 368 ? 0.4188 0.4830 0.4846 -0.1209 -0.1081 0.0741  369 SER A C   
2510 O O   . SER A 368 ? 0.4513 0.5202 0.4947 -0.1301 -0.1101 0.0736  369 SER A O   
2511 C CB  . SER A 368 ? 0.4209 0.4938 0.5148 -0.1248 -0.1174 0.0772  369 SER A CB  
2512 O OG  . SER A 368 ? 0.4532 0.5291 0.5473 -0.1294 -0.1162 0.0708  369 SER A OG  
2513 N N   . ASP A 369 ? 0.3860 0.4456 0.4709 -0.1115 -0.1092 0.0804  370 ASP A N   
2514 C CA  . ASP A 369 ? 0.3791 0.4368 0.4589 -0.1113 -0.1129 0.0875  370 ASP A CA  
2515 C C   . ASP A 369 ? 0.4510 0.5039 0.5063 -0.1108 -0.1015 0.0777  370 ASP A C   
2516 O O   . ASP A 369 ? 0.4529 0.5100 0.4906 -0.1186 -0.1050 0.0814  370 ASP A O   
2517 C CB  . ASP A 369 ? 0.5186 0.5697 0.6239 -0.0993 -0.1129 0.0916  370 ASP A CB  
2518 C CG  . ASP A 369 ? 0.6656 0.7219 0.7999 -0.0987 -0.1245 0.1012  370 ASP A CG  
2519 O OD1 . ASP A 369 ? 0.7698 0.8351 0.9035 -0.1091 -0.1358 0.1086  370 ASP A OD1 
2520 O OD2 . ASP A 369 ? 0.6758 0.7278 0.8346 -0.0879 -0.1225 0.1009  370 ASP A OD2 
2521 N N   . MET A 370 ? 0.3832 0.4281 0.4380 -0.1020 -0.0881 0.0658  371 MET A N   
2522 C CA  . MET A 370 ? 0.3679 0.4074 0.4039 -0.1000 -0.0773 0.0565  371 MET A CA  
2523 C C   . MET A 370 ? 0.3255 0.3721 0.3385 -0.1115 -0.0775 0.0513  371 MET A C   
2524 O O   . MET A 370 ? 0.4130 0.4619 0.4100 -0.1154 -0.0761 0.0508  371 MET A O   
2525 C CB  . MET A 370 ? 0.3775 0.4079 0.4180 -0.0900 -0.0644 0.0458  371 MET A CB  
2526 C CG  . MET A 370 ? 0.3368 0.3618 0.3596 -0.0882 -0.0543 0.0363  371 MET A CG  
2527 S SD  . MET A 370 ? 0.3603 0.3741 0.3896 -0.0767 -0.0411 0.0271  371 MET A SD  
2528 C CE  . MET A 370 ? 0.4139 0.4226 0.4544 -0.0668 -0.0405 0.0329  371 MET A CE  
2529 N N   . PHE A 371 ? 0.3194 0.3705 0.3314 -0.1172 -0.0788 0.0468  372 PHE A N   
2530 C CA  . PHE A 371 ? 0.4193 0.4777 0.4100 -0.1282 -0.0782 0.0391  372 PHE A CA  
2531 C C   . PHE A 371 ? 0.4600 0.5307 0.4382 -0.1407 -0.0894 0.0492  372 PHE A C   
2532 O O   . PHE A 371 ? 0.4811 0.5581 0.4387 -0.1481 -0.0866 0.0442  372 PHE A O   
2533 C CB  . PHE A 371 ? 0.3650 0.4251 0.3593 -0.1319 -0.0782 0.0318  372 PHE A CB  
2534 C CG  . PHE A 371 ? 0.4052 0.4540 0.4114 -0.1213 -0.0678 0.0234  372 PHE A CG  
2535 C CD1 . PHE A 371 ? 0.4096 0.4486 0.4156 -0.1113 -0.0576 0.0190  372 PHE A CD1 
2536 C CD2 . PHE A 371 ? 0.4257 0.4743 0.4434 -0.1221 -0.0688 0.0208  372 PHE A CD2 
2537 C CE1 . PHE A 371 ? 0.4012 0.4309 0.4173 -0.1028 -0.0490 0.0129  372 PHE A CE1 
2538 C CE2 . PHE A 371 ? 0.4085 0.4476 0.4370 -0.1136 -0.0597 0.0146  372 PHE A CE2 
2539 C CZ  . PHE A 371 ? 0.3589 0.3888 0.3860 -0.1042 -0.0499 0.0111  372 PHE A CZ  
2540 N N   . GLY A 372 ? 0.4157 0.4907 0.4073 -0.1433 -0.1022 0.0637  373 GLY A N   
2541 C CA  . GLY A 372 ? 0.4522 0.5389 0.4337 -0.1558 -0.1146 0.0763  373 GLY A CA  
2542 C C   . GLY A 372 ? 0.5202 0.6053 0.4929 -0.1544 -0.1121 0.0802  373 GLY A C   
2543 O O   . GLY A 372 ? 0.5592 0.6548 0.5113 -0.1660 -0.1147 0.0825  373 GLY A O   
2544 N N   . ILE A 373 ? 0.4708 0.5438 0.4586 -0.1408 -0.1066 0.0805  374 ILE A N   
2545 C CA  . ILE A 373 ? 0.4515 0.5216 0.4333 -0.1386 -0.1042 0.0839  374 ILE A CA  
2546 C C   . ILE A 373 ? 0.5136 0.5848 0.4733 -0.1401 -0.0915 0.0702  374 ILE A C   
2547 O O   . ILE A 373 ? 0.5175 0.5955 0.4624 -0.1472 -0.0921 0.0733  374 ILE A O   
2548 C CB  . ILE A 373 ? 0.4241 0.4810 0.4276 -0.1238 -0.1015 0.0861  374 ILE A CB  
2549 C CG1 . ILE A 373 ? 0.4370 0.4942 0.4648 -0.1229 -0.1152 0.1005  374 ILE A CG1 
2550 C CG2 . ILE A 373 ? 0.3956 0.4489 0.3910 -0.1216 -0.0975 0.0871  374 ILE A CG2 
2551 C CD1 . ILE A 373 ? 0.4436 0.4890 0.4958 -0.1079 -0.1117 0.0994  374 ILE A CD1 
2552 N N   . LEU A 374 ? 0.4978 0.5628 0.4571 -0.1336 -0.0802 0.0553  375 LEU A N   
2553 C CA  . LEU A 374 ? 0.4693 0.5354 0.4114 -0.1348 -0.0687 0.0411  375 LEU A CA  
2554 C C   . LEU A 374 ? 0.5070 0.5892 0.4283 -0.1506 -0.0721 0.0387  375 LEU A C   
2555 O O   . LEU A 374 ? 0.5163 0.6055 0.4213 -0.1558 -0.0669 0.0335  375 LEU A O   
2556 C CB  . LEU A 374 ? 0.4456 0.5020 0.3942 -0.1260 -0.0583 0.0271  375 LEU A CB  
2557 C CG  . LEU A 374 ? 0.3774 0.4194 0.3422 -0.1112 -0.0522 0.0268  375 LEU A CG  
2558 C CD1 . LEU A 374 ? 0.3153 0.3494 0.2857 -0.1051 -0.0435 0.0149  375 LEU A CD1 
2559 C CD2 . LEU A 374 ? 0.2780 0.3162 0.2374 -0.1065 -0.0470 0.0268  375 LEU A CD2 
2560 N N   . GLN A 375 ? 0.6242 0.7133 0.5462 -0.1587 -0.0810 0.0425  376 GLN A N   
2561 C CA  . GLN A 375 ? 0.6731 0.7790 0.5744 -0.1752 -0.0855 0.0405  376 GLN A CA  
2562 C C   . GLN A 375 ? 0.6936 0.8117 0.5819 -0.1860 -0.0932 0.0539  376 GLN A C   
2563 O O   . GLN A 375 ? 0.6965 0.8272 0.5635 -0.1961 -0.0889 0.0475  376 GLN A O   
2564 C CB  . GLN A 375 ? 0.7316 0.8423 0.6385 -0.1817 -0.0956 0.0444  376 GLN A CB  
2565 C CG  . GLN A 375 ? 0.7698 0.8968 0.6544 -0.1980 -0.0978 0.0369  376 GLN A CG  
2566 C CD  . GLN A 375 ? 0.8023 0.9285 0.6758 -0.1965 -0.0830 0.0142  376 GLN A CD  
2567 O OE1 . GLN A 375 ? 0.8492 0.9879 0.7020 -0.2060 -0.0786 0.0064  376 GLN A OE1 
2568 N NE2 . GLN A 375 ? 0.7449 0.8570 0.6333 -0.1848 -0.0754 0.0035  376 GLN A NE2 
2569 N N   . SER A 376 ? 0.7017 0.8165 0.6043 -0.1842 -0.1046 0.0725  377 SER A N   
2570 C CA  . SER A 376 ? 0.6829 0.8083 0.5770 -0.1949 -0.1145 0.0888  377 SER A CA  
2571 C C   . SER A 376 ? 0.7198 0.8468 0.6015 -0.1945 -0.1054 0.0850  377 SER A C   
2572 O O   . SER A 376 ? 0.7955 0.9360 0.6624 -0.2073 -0.1109 0.0946  377 SER A O   
2573 C CB  . SER A 376 ? 0.6676 0.7858 0.5858 -0.1903 -0.1283 0.1083  377 SER A CB  
2574 N N   . GLN A 377 ? 0.7129 0.8272 0.6007 -0.1806 -0.0919 0.0720  378 GLN A N   
2575 C CA  . GLN A 377 ? 0.7014 0.8166 0.5802 -0.1789 -0.0830 0.0680  378 GLN A CA  
2576 C C   . GLN A 377 ? 0.7761 0.9076 0.6304 -0.1906 -0.0748 0.0549  378 GLN A C   
2577 O O   . GLN A 377 ? 0.8230 0.9605 0.6695 -0.1955 -0.0721 0.0431  378 GLN A O   
2578 C CB  . GLN A 377 ? 0.6254 0.7228 0.5182 -0.1612 -0.0717 0.0579  378 GLN A CB  
2579 N N   . PHE A 397 ? 0.7842 0.8859 0.6514 -0.1483 -0.0028 -0.0494 398 PHE A N   
2580 C CA  . PHE A 397 ? 0.7656 0.8596 0.6408 -0.1381 0.0053  -0.0529 398 PHE A CA  
2581 C C   . PHE A 397 ? 0.7598 0.8548 0.6329 -0.1380 0.0004  -0.0358 398 PHE A C   
2582 O O   . PHE A 397 ? 0.7669 0.8775 0.6260 -0.1495 -0.0027 -0.0297 398 PHE A O   
2583 C CB  . PHE A 397 ? 0.7393 0.8448 0.6087 -0.1417 0.0163  -0.0718 398 PHE A CB  
2584 C CG  . PHE A 397 ? 0.7676 0.8727 0.6403 -0.1425 0.0209  -0.0905 398 PHE A CG  
2585 C CD1 . PHE A 397 ? 0.6989 0.7862 0.5876 -0.1328 0.0198  -0.0925 398 PHE A CD1 
2586 C CD2 . PHE A 397 ? 0.7310 0.8544 0.5914 -0.1536 0.0263  -0.1065 398 PHE A CD2 
2587 C CE1 . PHE A 397 ? 0.6287 0.7148 0.5224 -0.1340 0.0232  -0.1094 398 PHE A CE1 
2588 C CE2 . PHE A 397 ? 0.6725 0.7949 0.5378 -0.1543 0.0302  -0.1252 398 PHE A CE2 
2589 C CZ  . PHE A 397 ? 0.5894 0.6923 0.4722 -0.1443 0.0282  -0.1261 398 PHE A CZ  
2590 N N   . MET A 398 ? 0.7574 0.8360 0.6443 -0.1257 -0.0006 -0.0282 399 MET A N   
2591 C CA  . MET A 398 ? 0.7551 0.8324 0.6429 -0.1246 -0.0057 -0.0129 399 MET A CA  
2592 C C   . MET A 398 ? 0.6849 0.7645 0.5720 -0.1216 0.0024  -0.0183 399 MET A C   
2593 O O   . MET A 398 ? 0.7281 0.8117 0.6124 -0.1243 -0.0007 -0.0077 399 MET A O   
2594 C CB  . MET A 398 ? 0.7891 0.8489 0.6922 -0.1135 -0.0110 -0.0029 399 MET A CB  
2595 C CG  . MET A 398 ? 0.7935 0.8504 0.7013 -0.1148 -0.0181 0.0013  399 MET A CG  
2596 S SD  . MET A 398 ? 0.9543 0.9962 0.8800 -0.1042 -0.0253 0.0150  399 MET A SD  
2597 C CE  . MET A 398 ? 0.5034 0.5501 0.4320 -0.1111 -0.0354 0.0218  399 MET A CE  
2598 N N   . GLY A 399 ? 0.5741 0.6512 0.4656 -0.1164 0.0123  -0.0346 400 GLY A N   
2599 C CA  . GLY A 399 ? 0.4301 0.5078 0.3255 -0.1115 0.0206  -0.0417 400 GLY A CA  
2600 C C   . GLY A 399 ? 0.3556 0.4246 0.2623 -0.1032 0.0283  -0.0579 400 GLY A C   
2601 O O   . GLY A 399 ? 0.3626 0.4232 0.2743 -0.1006 0.0263  -0.0605 400 GLY A O   
2602 N N   . PRO A 400 ? 0.3305 0.4015 0.2433 -0.0992 0.0366  -0.0683 401 PRO A N   
2603 C CA  . PRO A 400 ? 0.2921 0.3544 0.2188 -0.0915 0.0430  -0.0833 401 PRO A CA  
2604 C C   . PRO A 400 ? 0.2906 0.3327 0.2321 -0.0785 0.0412  -0.0771 401 PRO A C   
2605 O O   . PRO A 400 ? 0.2855 0.3218 0.2264 -0.0749 0.0370  -0.0638 401 PRO A O   
2606 C CB  . PRO A 400 ? 0.3032 0.3782 0.2318 -0.0932 0.0520  -0.0960 401 PRO A CB  
2607 C CG  . PRO A 400 ? 0.2988 0.3789 0.2210 -0.0949 0.0496  -0.0823 401 PRO A CG  
2608 C CD  . PRO A 400 ? 0.3311 0.4118 0.2407 -0.1014 0.0398  -0.0658 401 PRO A CD  
2609 N N   . VAL A 401 ? 0.2981 0.3300 0.2527 -0.0722 0.0440  -0.0866 402 VAL A N   
2610 C CA  . VAL A 401 ? 0.2907 0.3060 0.2595 -0.0609 0.0435  -0.0824 402 VAL A CA  
2611 C C   . VAL A 401 ? 0.3266 0.3455 0.3044 -0.0575 0.0498  -0.0909 402 VAL A C   
2612 O O   . VAL A 401 ? 0.3180 0.3515 0.2925 -0.0634 0.0551  -0.1020 402 VAL A O   
2613 C CB  . VAL A 401 ? 0.2554 0.2579 0.2358 -0.0564 0.0426  -0.0865 402 VAL A CB  
2614 C CG1 . VAL A 401 ? 0.3048 0.3033 0.2790 -0.0586 0.0364  -0.0765 402 VAL A CG1 
2615 C CG2 . VAL A 401 ? 0.2661 0.2741 0.2527 -0.0598 0.0475  -0.1043 402 VAL A CG2 
2616 N N   . ILE A 402 ? 0.2475 0.2542 0.2368 -0.0484 0.0490  -0.0861 403 ILE A N   
2617 C CA  . ILE A 402 ? 0.2659 0.2762 0.2628 -0.0450 0.0529  -0.0891 403 ILE A CA  
2618 C C   . ILE A 402 ? 0.3266 0.3422 0.3383 -0.0438 0.0598  -0.1066 403 ILE A C   
2619 O O   . ILE A 402 ? 0.3817 0.4095 0.3952 -0.0457 0.0649  -0.1132 403 ILE A O   
2620 C CB  . ILE A 402 ? 0.2807 0.2766 0.2849 -0.0362 0.0488  -0.0777 403 ILE A CB  
2621 C CG1 . ILE A 402 ? 0.2335 0.2336 0.2460 -0.0331 0.0518  -0.0798 403 ILE A CG1 
2622 C CG2 . ILE A 402 ? 0.2775 0.2580 0.2941 -0.0299 0.0466  -0.0776 403 ILE A CG2 
2623 C CD1 . ILE A 402 ? 0.2497 0.2641 0.2502 -0.0395 0.0530  -0.0766 403 ILE A CD1 
2624 N N   . HIS A 403 ? 0.3228 0.3296 0.3469 -0.0408 0.0599  -0.1146 404 HIS A N   
2625 C CA  . HIS A 403 ? 0.2994 0.3097 0.3420 -0.0387 0.0659  -0.1324 404 HIS A CA  
2626 C C   . HIS A 403 ? 0.3211 0.3250 0.3723 -0.0393 0.0655  -0.1424 404 HIS A C   
2627 O O   . HIS A 403 ? 0.3180 0.3145 0.3609 -0.0411 0.0605  -0.1346 404 HIS A O   
2628 C CB  . HIS A 403 ? 0.2572 0.2584 0.3201 -0.0295 0.0654  -0.1306 404 HIS A CB  
2629 C CG  . HIS A 403 ? 0.3861 0.3686 0.4531 -0.0231 0.0580  -0.1156 404 HIS A CG  
2630 N ND1 . HIS A 403 ? 0.3392 0.3101 0.4090 -0.0224 0.0540  -0.1131 404 HIS A ND1 
2631 C CD2 . HIS A 403 ? 0.4023 0.3769 0.4708 -0.0179 0.0539  -0.1026 404 HIS A CD2 
2632 C CE1 . HIS A 403 ? 0.3236 0.2813 0.3959 -0.0174 0.0484  -0.0991 404 HIS A CE1 
2633 N NE2 . HIS A 403 ? 0.3299 0.2895 0.4009 -0.0145 0.0481  -0.0928 404 HIS A NE2 
2634 N N   . GLU A 404 ? 0.2975 0.3042 0.3675 -0.0375 0.0706  -0.1602 405 GLU A N   
2635 C CA  . GLU A 404 ? 0.3223 0.3252 0.4022 -0.0391 0.0710  -0.1734 405 GLU A CA  
2636 C C   . GLU A 404 ? 0.3105 0.2926 0.4023 -0.0333 0.0636  -0.1633 405 GLU A C   
2637 O O   . GLU A 404 ? 0.3336 0.3107 0.4244 -0.0365 0.0611  -0.1657 405 GLU A O   
2638 C CB  . GLU A 404 ? 0.3256 0.3352 0.4275 -0.0371 0.0781  -0.1956 405 GLU A CB  
2639 C CG  . GLU A 404 ? 0.3663 0.3730 0.4803 -0.0386 0.0774  -0.2083 405 GLU A CG  
2640 C CD  . GLU A 404 ? 0.4078 0.4286 0.5393 -0.0381 0.0828  -0.2241 405 GLU A CD  
2641 O OE1 . GLU A 404 ? 0.5108 0.5381 0.6532 -0.0342 0.0864  -0.2261 405 GLU A OE1 
2642 O OE2 . GLU A 404 ? 0.4738 0.5000 0.6086 -0.0419 0.0836  -0.2350 405 GLU A OE2 
2643 N N   . GLN A 405 ? 0.2779 0.2487 0.3809 -0.0256 0.0601  -0.1518 406 GLN A N   
2644 C CA  . GLN A 405 ? 0.3314 0.2837 0.4459 -0.0208 0.0531  -0.1407 406 GLN A CA  
2645 C C   . GLN A 405 ? 0.3759 0.3247 0.4698 -0.0244 0.0486  -0.1259 406 GLN A C   
2646 O O   . GLN A 405 ? 0.3705 0.3096 0.4693 -0.0249 0.0448  -0.1228 406 GLN A O   
2647 C CB  . GLN A 405 ? 0.3284 0.2717 0.4561 -0.0132 0.0499  -0.1305 406 GLN A CB  
2648 C CG  . GLN A 405 ? 0.4951 0.4382 0.6514 -0.0082 0.0523  -0.1439 406 GLN A CG  
2649 C CD  . GLN A 405 ? 0.6122 0.5736 0.7662 -0.0103 0.0608  -0.1587 406 GLN A CD  
2650 O OE1 . GLN A 405 ? 0.5245 0.4959 0.6593 -0.0128 0.0629  -0.1520 406 GLN A OE1 
2651 N NE2 . GLN A 405 ? 0.6750 0.6420 0.8493 -0.0097 0.0657  -0.1787 406 GLN A NE2 
2652 N N   . SER A 406 ? 0.3447 0.3017 0.4175 -0.0271 0.0491  -0.1171 407 SER A N   
2653 C CA  . SER A 406 ? 0.3171 0.2732 0.3723 -0.0307 0.0453  -0.1052 407 SER A CA  
2654 C C   . SER A 406 ? 0.3351 0.2985 0.3828 -0.0383 0.0461  -0.1141 407 SER A C   
2655 O O   . SER A 406 ? 0.3645 0.3221 0.4097 -0.0401 0.0422  -0.1082 407 SER A O   
2656 C CB  . SER A 406 ? 0.2809 0.2439 0.3185 -0.0318 0.0448  -0.0945 407 SER A CB  
2657 O OG  . SER A 406 ? 0.2793 0.2431 0.3024 -0.0358 0.0413  -0.0855 407 SER A OG  
2658 N N   . PHE A 407 ? 0.3278 0.3051 0.3714 -0.0434 0.0512  -0.1282 408 PHE A N   
2659 C CA  . PHE A 407 ? 0.3106 0.2963 0.3464 -0.0516 0.0520  -0.1384 408 PHE A CA  
2660 C C   . PHE A 407 ? 0.3153 0.2894 0.3681 -0.0501 0.0499  -0.1454 408 PHE A C   
2661 O O   . PHE A 407 ? 0.2897 0.2621 0.3368 -0.0546 0.0461  -0.1427 408 PHE A O   
2662 C CB  . PHE A 407 ? 0.2915 0.2947 0.3231 -0.0572 0.0590  -0.1553 408 PHE A CB  
2663 C CG  . PHE A 407 ? 0.3040 0.3179 0.3252 -0.0670 0.0597  -0.1665 408 PHE A CG  
2664 C CD1 . PHE A 407 ? 0.3146 0.3256 0.3505 -0.0676 0.0616  -0.1838 408 PHE A CD1 
2665 C CD2 . PHE A 407 ? 0.3062 0.3329 0.3036 -0.0761 0.0576  -0.1595 408 PHE A CD2 
2666 C CE1 . PHE A 407 ? 0.3275 0.3489 0.3527 -0.0773 0.0620  -0.1949 408 PHE A CE1 
2667 C CE2 . PHE A 407 ? 0.3191 0.3567 0.3058 -0.0862 0.0574  -0.1691 408 PHE A CE2 
2668 C CZ  . PHE A 407 ? 0.3298 0.3650 0.3296 -0.0869 0.0598  -0.1874 408 PHE A CZ  
2669 N N   . ASP A 408 ? 0.3004 0.2666 0.3760 -0.0440 0.0517  -0.1540 409 ASP A N   
2670 C CA  . ASP A 408 ? 0.3480 0.3025 0.4432 -0.0427 0.0491  -0.1612 409 ASP A CA  
2671 C C   . ASP A 408 ? 0.3634 0.3034 0.4602 -0.0406 0.0420  -0.1434 409 ASP A C   
2672 O O   . ASP A 408 ? 0.3761 0.3111 0.4775 -0.0439 0.0389  -0.1455 409 ASP A O   
2673 C CB  . ASP A 408 ? 0.3302 0.2785 0.4530 -0.0363 0.0514  -0.1733 409 ASP A CB  
2674 C CG  . ASP A 408 ? 0.4237 0.3882 0.5493 -0.0390 0.0591  -0.1946 409 ASP A CG  
2675 O OD1 . ASP A 408 ? 0.4231 0.4015 0.5319 -0.0472 0.0621  -0.2034 409 ASP A OD1 
2676 O OD2 . ASP A 408 ? 0.4991 0.4652 0.6432 -0.0327 0.0611  -0.1986 409 ASP A OD2 
2677 N N   . LYS A 409 ? 0.2943 0.2288 0.3872 -0.0358 0.0397  -0.1266 410 LYS A N   
2678 C CA  . LYS A 409 ? 0.3180 0.2418 0.4106 -0.0346 0.0342  -0.1101 410 LYS A CA  
2679 C C   . LYS A 409 ? 0.2730 0.2030 0.3485 -0.0410 0.0325  -0.1057 410 LYS A C   
2680 O O   . LYS A 409 ? 0.3900 0.3139 0.4702 -0.0430 0.0290  -0.1014 410 LYS A O   
2681 C CB  . LYS A 409 ? 0.3204 0.2402 0.4083 -0.0292 0.0327  -0.0943 410 LYS A CB  
2682 N N   . LEU A 410 ? 0.3001 0.2428 0.3571 -0.0446 0.0346  -0.1061 411 LEU A N   
2683 C CA  . LEU A 410 ? 0.3447 0.2945 0.3862 -0.0508 0.0321  -0.1011 411 LEU A CA  
2684 C C   . LEU A 410 ? 0.4037 0.3571 0.4473 -0.0577 0.0314  -0.1134 411 LEU A C   
2685 O O   . LEU A 410 ? 0.3761 0.3298 0.4157 -0.0618 0.0274  -0.1078 411 LEU A O   
2686 C CB  . LEU A 410 ? 0.2673 0.2298 0.2906 -0.0536 0.0336  -0.0984 411 LEU A CB  
2687 C CG  . LEU A 410 ? 0.2562 0.2149 0.2760 -0.0476 0.0330  -0.0849 411 LEU A CG  
2688 C CD1 . LEU A 410 ? 0.2550 0.2258 0.2601 -0.0506 0.0344  -0.0839 411 LEU A CD1 
2689 C CD2 . LEU A 410 ? 0.2673 0.2204 0.2850 -0.0465 0.0286  -0.0710 411 LEU A CD2 
2690 N N   . VAL A 411 ? 0.3615 0.3187 0.4122 -0.0592 0.0353  -0.1309 412 VAL A N   
2691 C CA  . VAL A 411 ? 0.3442 0.3043 0.3987 -0.0657 0.0348  -0.1451 412 VAL A CA  
2692 C C   . VAL A 411 ? 0.3377 0.2827 0.4100 -0.0635 0.0303  -0.1414 412 VAL A C   
2693 O O   . VAL A 411 ? 0.3967 0.3422 0.4675 -0.0691 0.0267  -0.1419 412 VAL A O   
2694 C CB  . VAL A 411 ? 0.3533 0.3200 0.4153 -0.0667 0.0408  -0.1667 412 VAL A CB  
2695 C CG1 . VAL A 411 ? 0.3810 0.3443 0.4560 -0.0707 0.0398  -0.1826 412 VAL A CG1 
2696 C CG2 . VAL A 411 ? 0.3188 0.3046 0.3594 -0.0733 0.0449  -0.1718 412 VAL A CG2 
2697 N N   . LYS A 412 ? 0.3295 0.2618 0.4189 -0.0559 0.0299  -0.1362 413 LYS A N   
2698 C CA  . LYS A 412 ? 0.3869 0.3050 0.4941 -0.0542 0.0252  -0.1303 413 LYS A CA  
2699 C C   . LYS A 412 ? 0.3662 0.2837 0.4633 -0.0564 0.0212  -0.1130 413 LYS A C   
2700 O O   . LYS A 412 ? 0.3791 0.2921 0.4834 -0.0601 0.0174  -0.1116 413 LYS A O   
2701 C CB  . LYS A 412 ? 0.4256 0.3315 0.5511 -0.0464 0.0246  -0.1250 413 LYS A CB  
2702 C CG  . LYS A 412 ? 0.4826 0.3740 0.6289 -0.0459 0.0191  -0.1193 413 LYS A CG  
2703 C CD  . LYS A 412 ? 0.5187 0.3985 0.6830 -0.0392 0.0170  -0.1120 413 LYS A CD  
2704 C CE  . LYS A 412 ? 0.5126 0.3780 0.7027 -0.0397 0.0110  -0.1103 413 LYS A CE  
2705 N NZ  . LYS A 412 ? 0.4743 0.3387 0.6592 -0.0456 0.0076  -0.1013 413 LYS A NZ  
2706 N N   . VAL A 413 ? 0.3538 0.2762 0.4357 -0.0542 0.0221  -0.1007 414 VAL A N   
2707 C CA  . VAL A 413 ? 0.3272 0.2508 0.4006 -0.0556 0.0192  -0.0856 414 VAL A CA  
2708 C C   . VAL A 413 ? 0.3589 0.2906 0.4251 -0.0633 0.0167  -0.0898 414 VAL A C   
2709 O O   . VAL A 413 ? 0.3042 0.2334 0.3754 -0.0659 0.0133  -0.0831 414 VAL A O   
2710 C CB  . VAL A 413 ? 0.2766 0.2058 0.3350 -0.0523 0.0207  -0.0753 414 VAL A CB  
2711 C CG1 . VAL A 413 ? 0.2700 0.2029 0.3207 -0.0542 0.0181  -0.0629 414 VAL A CG1 
2712 C CG2 . VAL A 413 ? 0.3576 0.2785 0.4228 -0.0452 0.0221  -0.0691 414 VAL A CG2 
2713 N N   . ILE A 414 ? 0.3373 0.2800 0.3918 -0.0677 0.0184  -0.1004 415 ILE A N   
2714 C CA  . ILE A 414 ? 0.2937 0.2463 0.3385 -0.0763 0.0153  -0.1039 415 ILE A CA  
2715 C C   . ILE A 414 ? 0.3748 0.3226 0.4326 -0.0806 0.0131  -0.1150 415 ILE A C   
2716 O O   . ILE A 414 ? 0.3803 0.3289 0.4395 -0.0854 0.0085  -0.1107 415 ILE A O   
2717 C CB  . ILE A 414 ? 0.2988 0.2655 0.3266 -0.0811 0.0176  -0.1125 415 ILE A CB  
2718 C CG1 . ILE A 414 ? 0.2882 0.2604 0.3026 -0.0788 0.0175  -0.0990 415 ILE A CG1 
2719 C CG2 . ILE A 414 ? 0.3107 0.2879 0.3300 -0.0916 0.0144  -0.1207 415 ILE A CG2 
2720 C CD1 . ILE A 414 ? 0.2927 0.2779 0.2923 -0.0829 0.0203  -0.1055 415 ILE A CD1 
2721 N N   . GLU A 415 ? 0.3877 0.3305 0.4575 -0.0788 0.0162  -0.1295 416 GLU A N   
2722 C CA  . GLU A 415 ? 0.4003 0.3375 0.4852 -0.0827 0.0140  -0.1424 416 GLU A CA  
2723 C C   . GLU A 415 ? 0.3767 0.3008 0.4784 -0.0808 0.0095  -0.1309 416 GLU A C   
2724 O O   . GLU A 415 ? 0.4044 0.3274 0.5115 -0.0865 0.0052  -0.1331 416 GLU A O   
2725 C CB  . GLU A 415 ? 0.3783 0.3125 0.4761 -0.0801 0.0184  -0.1611 416 GLU A CB  
2726 C CG  . GLU A 415 ? 0.4542 0.4046 0.5355 -0.0848 0.0234  -0.1757 416 GLU A CG  
2727 C CD  . GLU A 415 ? 0.4674 0.4285 0.5371 -0.0956 0.0207  -0.1848 416 GLU A CD  
2728 O OE1 . GLU A 415 ? 0.5192 0.4729 0.6025 -0.0984 0.0168  -0.1905 416 GLU A OE1 
2729 O OE2 . GLU A 415 ? 0.5092 0.4861 0.5567 -0.1019 0.0217  -0.1855 416 GLU A OE2 
2730 N N   . ASP A 416 ? 0.3722 0.2873 0.4813 -0.0736 0.0101  -0.1180 417 ASP A N   
2731 C CA  . ASP A 416 ? 0.4014 0.3061 0.5242 -0.0726 0.0062  -0.1047 417 ASP A CA  
2732 C C   . ASP A 416 ? 0.4759 0.3877 0.5887 -0.0772 0.0033  -0.0932 417 ASP A C   
2733 O O   . ASP A 416 ? 0.4849 0.3923 0.6090 -0.0807 -0.0005 -0.0889 417 ASP A O   
2734 C CB  . ASP A 416 ? 0.4070 0.3039 0.5349 -0.0652 0.0074  -0.0918 417 ASP A CB  
2735 C CG  . ASP A 416 ? 0.4834 0.3698 0.6299 -0.0608 0.0078  -0.1004 417 ASP A CG  
2736 O OD1 . ASP A 416 ? 0.4604 0.3442 0.6194 -0.0631 0.0071  -0.1166 417 ASP A OD1 
2737 O OD2 . ASP A 416 ? 0.5153 0.3964 0.6654 -0.0550 0.0084  -0.0911 417 ASP A OD2 
2738 N N   . ALA A 417 ? 0.4049 0.3280 0.4986 -0.0774 0.0049  -0.0885 418 ALA A N   
2739 C CA  . ALA A 417 ? 0.3755 0.3062 0.4621 -0.0811 0.0019  -0.0779 418 ALA A CA  
2740 C C   . ALA A 417 ? 0.4739 0.4082 0.5640 -0.0895 -0.0027 -0.0861 418 ALA A C   
2741 O O   . ALA A 417 ? 0.4914 0.4272 0.5864 -0.0927 -0.0063 -0.0777 418 ALA A O   
2742 C CB  . ALA A 417 ? 0.2863 0.2280 0.3543 -0.0802 0.0031  -0.0729 418 ALA A CB  
2743 N N   . LYS A 418 ? 0.4772 0.4134 0.5655 -0.0933 -0.0023 -0.1031 419 LYS A N   
2744 C CA  . LYS A 418 ? 0.4696 0.4103 0.5591 -0.1022 -0.0068 -0.1126 419 LYS A CA  
2745 C C   . LYS A 418 ? 0.4273 0.3561 0.5386 -0.1034 -0.0101 -0.1133 419 LYS A C   
2746 O O   . LYS A 418 ? 0.5090 0.4403 0.6241 -0.1106 -0.0150 -0.1162 419 LYS A O   
2747 C CB  . LYS A 418 ? 0.4097 0.3575 0.4901 -0.1068 -0.0048 -0.1324 419 LYS A CB  
2748 C CG  . LYS A 418 ? 0.4264 0.3891 0.4833 -0.1093 -0.0033 -0.1309 419 LYS A CG  
2749 C CD  . LYS A 418 ? 0.5077 0.4780 0.5565 -0.1135 0.0006  -0.1513 419 LYS A CD  
2750 C CE  . LYS A 418 ? 0.5258 0.5111 0.5516 -0.1163 0.0025  -0.1489 419 LYS A CE  
2751 N NZ  . LYS A 418 ? 0.5435 0.5346 0.5647 -0.1165 0.0095  -0.1662 419 LYS A NZ  
2752 N N   . LYS A 419 ? 0.4705 0.3867 0.5970 -0.0971 -0.0082 -0.1095 420 LYS A N   
2753 C CA  . LYS A 419 ? 0.4826 0.3865 0.6320 -0.0987 -0.0120 -0.1099 420 LYS A CA  
2754 C C   . LYS A 419 ? 0.4694 0.3695 0.6265 -0.0974 -0.0137 -0.0896 420 LYS A C   
2755 O O   . LYS A 419 ? 0.5643 0.4550 0.7402 -0.0995 -0.0173 -0.0862 420 LYS A O   
2756 C CB  . LYS A 419 ? 0.5423 0.4340 0.7079 -0.0939 -0.0103 -0.1203 420 LYS A CB  
2757 C CG  . LYS A 419 ? 0.5660 0.4621 0.7276 -0.0952 -0.0074 -0.1432 420 LYS A CG  
2758 C CD  . LYS A 419 ? 0.5106 0.3989 0.6834 -0.0869 -0.0038 -0.1490 420 LYS A CD  
2759 N N   . ASP A 420 ? 0.4229 0.3309 0.5659 -0.0942 -0.0109 -0.0765 421 ASP A N   
2760 C CA  . ASP A 420 ? 0.3654 0.2728 0.5133 -0.0927 -0.0108 -0.0581 421 ASP A CA  
2761 C C   . ASP A 420 ? 0.4026 0.3210 0.5470 -0.0980 -0.0134 -0.0517 421 ASP A C   
2762 O O   . ASP A 420 ? 0.4080 0.3372 0.5377 -0.0984 -0.0131 -0.0525 421 ASP A O   
2763 C CB  . ASP A 420 ? 0.3743 0.2836 0.5107 -0.0853 -0.0058 -0.0491 421 ASP A CB  
2764 C CG  . ASP A 420 ? 0.4043 0.3120 0.5466 -0.0836 -0.0046 -0.0323 421 ASP A CG  
2765 O OD1 . ASP A 420 ? 0.4214 0.3324 0.5715 -0.0883 -0.0067 -0.0249 421 ASP A OD1 
2766 O OD2 . ASP A 420 ? 0.4279 0.3321 0.5668 -0.0782 -0.0015 -0.0264 421 ASP A OD2 
2767 N N   . PRO A 421 ? 0.4064 0.3222 0.5660 -0.1024 -0.0166 -0.0447 422 PRO A N   
2768 C CA  . PRO A 421 ? 0.3557 0.2824 0.5161 -0.1077 -0.0194 -0.0385 422 PRO A CA  
2769 C C   . PRO A 421 ? 0.3300 0.2674 0.4814 -0.1037 -0.0157 -0.0259 422 PRO A C   
2770 O O   . PRO A 421 ? 0.2961 0.2445 0.4455 -0.1068 -0.0180 -0.0230 422 PRO A O   
2771 C CB  . PRO A 421 ? 0.3604 0.2807 0.5414 -0.1126 -0.0226 -0.0323 422 PRO A CB  
2772 C CG  . PRO A 421 ? 0.3526 0.2576 0.5442 -0.1112 -0.0235 -0.0395 422 PRO A CG  
2773 C CD  . PRO A 421 ? 0.3714 0.2743 0.5503 -0.1033 -0.0184 -0.0419 422 PRO A CD  
2774 N N   . GLU A 422 ? 0.3418 0.2763 0.4894 -0.0973 -0.0104 -0.0187 423 GLU A N   
2775 C CA  . GLU A 422 ? 0.3411 0.2855 0.4807 -0.0930 -0.0063 -0.0088 423 GLU A CA  
2776 C C   . GLU A 422 ? 0.3805 0.3295 0.5033 -0.0885 -0.0050 -0.0136 423 GLU A C   
2777 O O   . GLU A 422 ? 0.3602 0.3166 0.4772 -0.0845 -0.0022 -0.0069 423 GLU A O   
2778 C CB  . GLU A 422 ? 0.3595 0.3004 0.5022 -0.0894 -0.0015 0.0017  423 GLU A CB  
2779 C CG  . GLU A 422 ? 0.4298 0.3700 0.5888 -0.0950 -0.0027 0.0103  423 GLU A CG  
2780 C CD  . GLU A 422 ? 0.4721 0.4112 0.6319 -0.0930 0.0019  0.0219  423 GLU A CD  
2781 O OE1 . GLU A 422 ? 0.5047 0.4367 0.6570 -0.0881 0.0038  0.0213  423 GLU A OE1 
2782 O OE2 . GLU A 422 ? 0.5405 0.4871 0.7083 -0.0968 0.0036  0.0318  423 GLU A OE2 
2783 N N   . LEU A 423 ? 0.3603 0.3053 0.4763 -0.0894 -0.0068 -0.0255 424 LEU A N   
2784 C CA  . LEU A 423 ? 0.3923 0.3422 0.4921 -0.0867 -0.0059 -0.0299 424 LEU A CA  
2785 C C   . LEU A 423 ? 0.3632 0.3207 0.4572 -0.0933 -0.0111 -0.0375 424 LEU A C   
2786 O O   . LEU A 423 ? 0.3840 0.3394 0.4845 -0.0993 -0.0147 -0.0450 424 LEU A O   
2787 C CB  . LEU A 423 ? 0.2747 0.2161 0.3693 -0.0824 -0.0026 -0.0374 424 LEU A CB  
2788 C CG  . LEU A 423 ? 0.3628 0.2972 0.4609 -0.0760 0.0017  -0.0292 424 LEU A CG  
2789 C CD1 . LEU A 423 ? 0.3715 0.2978 0.4672 -0.0721 0.0039  -0.0369 424 LEU A CD1 
2790 C CD2 . LEU A 423 ? 0.3042 0.2460 0.3942 -0.0717 0.0044  -0.0192 424 LEU A CD2 
2791 N N   . GLU A 424 ? 0.3677 0.3340 0.4493 -0.0928 -0.0122 -0.0357 425 GLU A N   
2792 C CA  . GLU A 424 ? 0.4155 0.3902 0.4886 -0.1001 -0.0178 -0.0421 425 GLU A CA  
2793 C C   . GLU A 424 ? 0.3470 0.3276 0.4037 -0.0987 -0.0173 -0.0426 425 GLU A C   
2794 O O   . GLU A 424 ? 0.3933 0.3771 0.4478 -0.0940 -0.0166 -0.0330 425 GLU A O   
2795 C CB  . GLU A 424 ? 0.4391 0.4224 0.5198 -0.1051 -0.0239 -0.0347 425 GLU A CB  
2796 C CG  . GLU A 424 ? 0.5349 0.5280 0.6060 -0.1137 -0.0310 -0.0394 425 GLU A CG  
2797 C CD  . GLU A 424 ? 0.6476 0.6497 0.7279 -0.1184 -0.0381 -0.0308 425 GLU A CD  
2798 O OE1 . GLU A 424 ? 0.7073 0.7079 0.8035 -0.1156 -0.0368 -0.0235 425 GLU A OE1 
2799 O OE2 . GLU A 424 ? 0.7105 0.7223 0.7826 -0.1253 -0.0453 -0.0308 425 GLU A OE2 
2800 N N   . ILE A 425 ? 0.3283 0.3108 0.3741 -0.1031 -0.0174 -0.0544 426 ILE A N   
2801 C CA  . ILE A 425 ? 0.3710 0.3609 0.4005 -0.1036 -0.0172 -0.0545 426 ILE A CA  
2802 C C   . ILE A 425 ? 0.4116 0.4138 0.4349 -0.1105 -0.0252 -0.0477 426 ILE A C   
2803 O O   . ILE A 425 ? 0.4184 0.4272 0.4376 -0.1197 -0.0302 -0.0536 426 ILE A O   
2804 C CB  . ILE A 425 ? 0.3703 0.3609 0.3900 -0.1068 -0.0139 -0.0698 426 ILE A CB  
2805 C CG1 . ILE A 425 ? 0.3849 0.3629 0.4148 -0.0996 -0.0073 -0.0761 426 ILE A CG1 
2806 C CG2 . ILE A 425 ? 0.3558 0.3551 0.3591 -0.1076 -0.0133 -0.0680 426 ILE A CG2 
2807 C CD1 . ILE A 425 ? 0.3353 0.3141 0.3596 -0.1014 -0.0032 -0.0924 426 ILE A CD1 
2808 N N   . LEU A 426 ? 0.3566 0.3619 0.3802 -0.1064 -0.0268 -0.0351 427 LEU A N   
2809 C CA  . LEU A 426 ? 0.3557 0.3718 0.3775 -0.1123 -0.0357 -0.0264 427 LEU A CA  
2810 C C   . LEU A 426 ? 0.3922 0.4173 0.3958 -0.1186 -0.0389 -0.0276 427 LEU A C   
2811 O O   . LEU A 426 ? 0.3770 0.4127 0.3751 -0.1276 -0.0474 -0.0239 427 LEU A O   
2812 C CB  . LEU A 426 ? 0.3371 0.3529 0.3709 -0.1051 -0.0367 -0.0131 427 LEU A CB  
2813 C CG  . LEU A 426 ? 0.3482 0.3590 0.4000 -0.1006 -0.0339 -0.0104 427 LEU A CG  
2814 C CD1 . LEU A 426 ? 0.3975 0.4089 0.4599 -0.0926 -0.0325 -0.0001 427 LEU A CD1 
2815 C CD2 . LEU A 426 ? 0.3803 0.3969 0.4402 -0.1085 -0.0407 -0.0104 427 LEU A CD2 
2816 N N   . TYR A 427 ? 0.3587 0.3806 0.3533 -0.1146 -0.0324 -0.0321 428 TYR A N   
2817 C CA  . TYR A 427 ? 0.3850 0.4164 0.3623 -0.1205 -0.0345 -0.0322 428 TYR A CA  
2818 C C   . TYR A 427 ? 0.3671 0.3947 0.3369 -0.1172 -0.0255 -0.0431 428 TYR A C   
2819 O O   . TYR A 427 ? 0.3463 0.3630 0.3245 -0.1074 -0.0191 -0.0436 428 TYR A O   
2820 C CB  . TYR A 427 ? 0.4026 0.4364 0.3814 -0.1172 -0.0390 -0.0171 428 TYR A CB  
2821 C CG  . TYR A 427 ? 0.4503 0.4943 0.4121 -0.1244 -0.0423 -0.0144 428 TYR A CG  
2822 C CD1 . TYR A 427 ? 0.4714 0.5282 0.4253 -0.1359 -0.0525 -0.0079 428 TYR A CD1 
2823 C CD2 . TYR A 427 ? 0.4697 0.5116 0.4236 -0.1205 -0.0356 -0.0174 428 TYR A CD2 
2824 C CE1 . TYR A 427 ? 0.5112 0.5787 0.4487 -0.1439 -0.0559 -0.0039 428 TYR A CE1 
2825 C CE2 . TYR A 427 ? 0.4726 0.5252 0.4111 -0.1279 -0.0384 -0.0142 428 TYR A CE2 
2826 C CZ  . TYR A 427 ? 0.5198 0.5854 0.4498 -0.1399 -0.0485 -0.0072 428 TYR A CZ  
2827 O OH  . TYR A 427 ? 0.5547 0.6320 0.4689 -0.1486 -0.0516 -0.0024 428 TYR A OH  
2828 N N   . GLY A 428 ? 0.4023 0.4399 0.3563 -0.1258 -0.0250 -0.0518 429 GLY A N   
2829 C CA  . GLY A 428 ? 0.3372 0.3749 0.2835 -0.1235 -0.0169 -0.0609 429 GLY A CA  
2830 C C   . GLY A 428 ? 0.3714 0.4020 0.3244 -0.1207 -0.0094 -0.0778 429 GLY A C   
2831 O O   . GLY A 428 ? 0.4129 0.4462 0.3662 -0.1271 -0.0108 -0.0880 429 GLY A O   
2832 N N   . GLY A 429 ? 0.3857 0.4070 0.3455 -0.1113 -0.0022 -0.0808 430 GLY A N   
2833 C CA  . GLY A 429 ? 0.3764 0.3898 0.3462 -0.1078 0.0041  -0.0959 430 GLY A CA  
2834 C C   . GLY A 429 ? 0.4137 0.4372 0.3745 -0.1139 0.0092  -0.1133 430 GLY A C   
2835 O O   . GLY A 429 ? 0.4766 0.4953 0.4471 -0.1126 0.0136  -0.1287 430 GLY A O   
2836 N N   . GLN A 430 ? 0.4000 0.4380 0.3432 -0.1207 0.0087  -0.1111 431 GLN A N   
2837 C CA  . GLN A 430 ? 0.4387 0.4896 0.3716 -0.1273 0.0147  -0.1276 431 GLN A CA  
2838 C C   . GLN A 430 ? 0.4204 0.4690 0.3574 -0.1197 0.0227  -0.1313 431 GLN A C   
2839 O O   . GLN A 430 ? 0.3994 0.4430 0.3372 -0.1133 0.0219  -0.1172 431 GLN A O   
2840 C CB  . GLN A 430 ? 0.5491 0.6193 0.4600 -0.1404 0.0102  -0.1231 431 GLN A CB  
2841 C CG  . GLN A 430 ? 0.7081 0.7854 0.6126 -0.1511 0.0035  -0.1264 431 GLN A CG  
2842 C CD  . GLN A 430 ? 0.8487 0.9334 0.7425 -0.1578 -0.0070 -0.1069 431 GLN A CD  
2843 O OE1 . GLN A 430 ? 0.8766 0.9545 0.7755 -0.1511 -0.0103 -0.0899 431 GLN A OE1 
2844 N NE2 . GLN A 430 ? 0.9060 1.0050 0.7859 -0.1715 -0.0130 -0.1094 431 GLN A NE2 
2845 N N   . TYR A 431 ? 0.3998 0.4531 0.3399 -0.1207 0.0303  -0.1510 432 TYR A N   
2846 C CA  . TYR A 431 ? 0.4559 0.5084 0.4024 -0.1138 0.0381  -0.1564 432 TYR A CA  
2847 C C   . TYR A 431 ? 0.4280 0.4967 0.3692 -0.1210 0.0459  -0.1782 432 TYR A C   
2848 O O   . TYR A 431 ? 0.4161 0.4907 0.3550 -0.1283 0.0460  -0.1924 432 TYR A O   
2849 C CB  . TYR A 431 ? 0.3782 0.4106 0.3485 -0.1010 0.0398  -0.1571 432 TYR A CB  
2850 C CG  . TYR A 431 ? 0.4695 0.4933 0.4548 -0.1008 0.0393  -0.1703 432 TYR A CG  
2851 C CD1 . TYR A 431 ? 0.4346 0.4617 0.4301 -0.1015 0.0457  -0.1927 432 TYR A CD1 
2852 C CD2 . TYR A 431 ? 0.4739 0.4868 0.4651 -0.1001 0.0324  -0.1607 432 TYR A CD2 
2853 C CE1 . TYR A 431 ? 0.4236 0.4417 0.4351 -0.1013 0.0445  -0.2050 432 TYR A CE1 
2854 C CE2 . TYR A 431 ? 0.4436 0.4483 0.4495 -0.1005 0.0313  -0.1718 432 TYR A CE2 
2855 C CZ  . TYR A 431 ? 0.4670 0.4736 0.4833 -0.1011 0.0369  -0.1938 432 TYR A CZ  
2856 O OH  . TYR A 431 ? 0.4773 0.4746 0.5106 -0.1015 0.0350  -0.2052 432 TYR A OH  
2857 N N   . ASP A 432 ? 0.4415 0.5182 0.3808 -0.1192 0.0526  -0.1813 433 ASP A N   
2858 C CA  . ASP A 432 ? 0.4263 0.5219 0.3611 -0.1255 0.0612  -0.2000 433 ASP A CA  
2859 C C   . ASP A 432 ? 0.4234 0.5198 0.3670 -0.1181 0.0684  -0.2016 433 ASP A C   
2860 O O   . ASP A 432 ? 0.4213 0.5199 0.3550 -0.1180 0.0666  -0.1864 433 ASP A O   
2861 C CB  . ASP A 432 ? 0.4777 0.5949 0.3869 -0.1394 0.0587  -0.1931 433 ASP A CB  
2862 C CG  . ASP A 432 ? 0.5438 0.6822 0.4517 -0.1450 0.0668  -0.2064 433 ASP A CG  
2863 O OD1 . ASP A 432 ? 0.5155 0.6548 0.4405 -0.1381 0.0751  -0.2189 433 ASP A OD1 
2864 O OD2 . ASP A 432 ? 0.6389 0.7939 0.5293 -0.1571 0.0644  -0.2036 433 ASP A OD2 
2865 N N   . LYS A 433 ? 0.4073 0.5015 0.3733 -0.1105 0.0749  -0.2156 434 LYS A N   
2866 C CA  . LYS A 433 ? 0.3571 0.4518 0.3356 -0.1029 0.0811  -0.2177 434 LYS A CA  
2867 C C   . LYS A 433 ? 0.4853 0.6031 0.4641 -0.1081 0.0892  -0.2297 434 LYS A C   
2868 O O   . LYS A 433 ? 0.4559 0.5759 0.4513 -0.1018 0.0950  -0.2361 434 LYS A O   
2869 C CB  . LYS A 433 ? 0.4963 0.5704 0.5045 -0.0896 0.0812  -0.2226 434 LYS A CB  
2870 C CG  . LYS A 433 ? 0.5139 0.5859 0.5406 -0.0880 0.0819  -0.2371 434 LYS A CG  
2871 C CD  . LYS A 433 ? 0.5136 0.5728 0.5730 -0.0758 0.0835  -0.2436 434 LYS A CD  
2872 C CE  . LYS A 433 ? 0.5402 0.5748 0.6107 -0.0668 0.0773  -0.2306 434 LYS A CE  
2873 N NZ  . LYS A 433 ? 0.4926 0.5147 0.5954 -0.0561 0.0767  -0.2342 434 LYS A NZ  
2874 N N   . SER A 434 ? 0.4117 0.5472 0.3737 -0.1201 0.0892  -0.2328 435 SER A N   
2875 C CA  . SER A 434 ? 0.4646 0.6236 0.4268 -0.1265 0.0971  -0.2450 435 SER A CA  
2876 C C   . SER A 434 ? 0.4458 0.6189 0.3993 -0.1297 0.1011  -0.2381 435 SER A C   
2877 O O   . SER A 434 ? 0.4790 0.6657 0.4433 -0.1298 0.1087  -0.2493 435 SER A O   
2878 C CB  . SER A 434 ? 0.5095 0.6846 0.4552 -0.1394 0.0961  -0.2497 435 SER A CB  
2879 O OG  . SER A 434 ? 0.5210 0.7033 0.4395 -0.1498 0.0898  -0.2327 435 SER A OG  
2880 N N   . GLN A 435 ? 0.4175 0.5875 0.3529 -0.1324 0.0956  -0.2196 436 GLN A N   
2881 C CA  . GLN A 435 ? 0.4481 0.6309 0.3749 -0.1359 0.0982  -0.2110 436 GLN A CA  
2882 C C   . GLN A 435 ? 0.4300 0.5953 0.3623 -0.1257 0.0962  -0.2000 436 GLN A C   
2883 O O   . GLN A 435 ? 0.3948 0.5629 0.3382 -0.1206 0.1014  -0.2021 436 GLN A O   
2884 C CB  . GLN A 435 ? 0.4540 0.6538 0.3532 -0.1510 0.0934  -0.1973 436 GLN A CB  
2885 N N   . GLY A 436 ? 0.3545 0.5027 0.2792 -0.1233 0.0884  -0.1884 437 GLY A N   
2886 C CA  . GLY A 436 ? 0.3741 0.5029 0.3078 -0.1122 0.0847  -0.1752 437 GLY A CA  
2887 C C   . GLY A 436 ? 0.4235 0.5288 0.3694 -0.1035 0.0782  -0.1718 437 GLY A C   
2888 O O   . GLY A 436 ? 0.4130 0.5182 0.3592 -0.1070 0.0781  -0.1832 437 GLY A O   
2889 N N   . TRP A 437 ? 0.3400 0.4264 0.2957 -0.0930 0.0729  -0.1565 438 TRP A N   
2890 C CA  . TRP A 437 ? 0.3055 0.3709 0.2727 -0.0854 0.0672  -0.1523 438 TRP A CA  
2891 C C   . TRP A 437 ? 0.3890 0.4512 0.3413 -0.0899 0.0583  -0.1358 438 TRP A C   
2892 O O   . TRP A 437 ? 0.3730 0.4246 0.3251 -0.0848 0.0528  -0.1189 438 TRP A O   
2893 C CB  . TRP A 437 ? 0.2920 0.3397 0.2774 -0.0725 0.0661  -0.1452 438 TRP A CB  
2894 C CG  . TRP A 437 ? 0.3402 0.3930 0.3402 -0.0682 0.0736  -0.1575 438 TRP A CG  
2895 C CD1 . TRP A 437 ? 0.3432 0.3987 0.3452 -0.0648 0.0753  -0.1509 438 TRP A CD1 
2896 C CD2 . TRP A 437 ? 0.3498 0.4065 0.3667 -0.0670 0.0805  -0.1793 438 TRP A CD2 
2897 N NE1 . TRP A 437 ? 0.3415 0.4029 0.3610 -0.0613 0.0828  -0.1667 438 TRP A NE1 
2898 C CE2 . TRP A 437 ? 0.3559 0.4182 0.3854 -0.0624 0.0862  -0.1848 438 TRP A CE2 
2899 C CE3 . TRP A 437 ? 0.3776 0.4334 0.4017 -0.0692 0.0821  -0.1954 438 TRP A CE3 
2900 C CZ2 . TRP A 437 ? 0.3603 0.4276 0.4109 -0.0595 0.0937  -0.2060 438 TRP A CZ2 
2901 C CZ3 . TRP A 437 ? 0.3662 0.4265 0.4113 -0.0662 0.0888  -0.2152 438 TRP A CZ3 
2902 C CH2 . TRP A 437 ? 0.3292 0.3955 0.3882 -0.0610 0.0938  -0.2184 438 TRP A CH2 
2903 N N   . PHE A 438 ? 0.3609 0.4327 0.3015 -0.0998 0.0568  -0.1415 439 PHE A N   
2904 C CA  . PHE A 438 ? 0.3530 0.4254 0.2795 -0.1058 0.0479  -0.1260 439 PHE A CA  
2905 C C   . PHE A 438 ? 0.3828 0.4414 0.3173 -0.1029 0.0426  -0.1248 439 PHE A C   
2906 O O   . PHE A 438 ? 0.3503 0.4110 0.2876 -0.1065 0.0445  -0.1390 439 PHE A O   
2907 C CB  . PHE A 438 ? 0.3394 0.4342 0.2446 -0.1209 0.0476  -0.1286 439 PHE A CB  
2908 C CG  . PHE A 438 ? 0.3572 0.4661 0.2521 -0.1255 0.0503  -0.1228 439 PHE A CG  
2909 C CD1 . PHE A 438 ? 0.3563 0.4622 0.2455 -0.1253 0.0430  -0.1017 439 PHE A CD1 
2910 C CD2 . PHE A 438 ? 0.3781 0.5033 0.2709 -0.1299 0.0601  -0.1389 439 PHE A CD2 
2911 C CE1 . PHE A 438 ? 0.3714 0.4897 0.2523 -0.1300 0.0447  -0.0954 439 PHE A CE1 
2912 C CE2 . PHE A 438 ? 0.3595 0.4988 0.2434 -0.1348 0.0627  -0.1329 439 PHE A CE2 
2913 C CZ  . PHE A 438 ? 0.3337 0.4692 0.2113 -0.1351 0.0546  -0.1105 439 PHE A CZ  
2914 N N   . VAL A 439 ? 0.3487 0.3939 0.2874 -0.0966 0.0364  -0.1082 440 VAL A N   
2915 C CA  . VAL A 439 ? 0.3054 0.3392 0.2512 -0.0943 0.0310  -0.1037 440 VAL A CA  
2916 C C   . VAL A 439 ? 0.3254 0.3623 0.2608 -0.0985 0.0227  -0.0865 440 VAL A C   
2917 O O   . VAL A 439 ? 0.3290 0.3636 0.2627 -0.0950 0.0206  -0.0737 440 VAL A O   
2918 C CB  . VAL A 439 ? 0.3156 0.3304 0.2793 -0.0819 0.0318  -0.0997 440 VAL A CB  
2919 C CG1 . VAL A 439 ? 0.2964 0.3015 0.2674 -0.0809 0.0268  -0.0952 440 VAL A CG1 
2920 C CG2 . VAL A 439 ? 0.2868 0.2975 0.2640 -0.0769 0.0387  -0.1145 440 VAL A CG2 
2921 N N   . GLY A 440 ? 0.3379 0.3796 0.2680 -0.1061 0.0175  -0.0862 441 GLY A N   
2922 C CA  . GLY A 440 ? 0.3195 0.3656 0.2421 -0.1109 0.0086  -0.0702 441 GLY A CA  
2923 C C   . GLY A 440 ? 0.3450 0.3767 0.2807 -0.1022 0.0045  -0.0588 441 GLY A C   
2924 O O   . GLY A 440 ? 0.3209 0.3407 0.2694 -0.0948 0.0079  -0.0636 441 GLY A O   
2925 N N   . PRO A 441 ? 0.3341 0.3676 0.2678 -0.1036 -0.0030 -0.0435 442 PRO A N   
2926 C CA  . PRO A 441 ? 0.3914 0.4141 0.3378 -0.0960 -0.0067 -0.0330 442 PRO A CA  
2927 C C   . PRO A 441 ? 0.3888 0.4076 0.3434 -0.0966 -0.0072 -0.0386 442 PRO A C   
2928 O O   . PRO A 441 ? 0.4842 0.5115 0.4322 -0.1057 -0.0099 -0.0443 442 PRO A O   
2929 C CB  . PRO A 441 ? 0.4009 0.4312 0.3433 -0.1016 -0.0162 -0.0190 442 PRO A CB  
2930 C CG  . PRO A 441 ? 0.4253 0.4669 0.3531 -0.1090 -0.0163 -0.0189 442 PRO A CG  
2931 C CD  . PRO A 441 ? 0.3908 0.4382 0.3108 -0.1135 -0.0089 -0.0356 442 PRO A CD  
2932 N N   . THR A 442 ? 0.3500 0.3567 0.3180 -0.0879 -0.0047 -0.0372 443 THR A N   
2933 C CA  . THR A 442 ? 0.3407 0.3430 0.3180 -0.0885 -0.0049 -0.0421 443 THR A CA  
2934 C C   . THR A 442 ? 0.3330 0.3286 0.3228 -0.0823 -0.0068 -0.0317 443 THR A C   
2935 O O   . THR A 442 ? 0.2843 0.2731 0.2785 -0.0743 -0.0035 -0.0270 443 THR A O   
2936 C CB  . THR A 442 ? 0.3108 0.3053 0.2937 -0.0849 0.0022  -0.0547 443 THR A CB  
2937 O OG1 . THR A 442 ? 0.3529 0.3552 0.3256 -0.0904 0.0051  -0.0664 443 THR A OG1 
2938 C CG2 . THR A 442 ? 0.3355 0.3246 0.3294 -0.0863 0.0012  -0.0591 443 THR A CG2 
2939 N N   . VAL A 443 ? 0.3148 0.3136 0.3105 -0.0865 -0.0120 -0.0284 444 VAL A N   
2940 C CA  . VAL A 443 ? 0.2607 0.2555 0.2700 -0.0813 -0.0132 -0.0197 444 VAL A CA  
2941 C C   . VAL A 443 ? 0.3173 0.3083 0.3365 -0.0829 -0.0123 -0.0244 444 VAL A C   
2942 O O   . VAL A 443 ? 0.3113 0.3073 0.3293 -0.0906 -0.0165 -0.0285 444 VAL A O   
2943 C CB  . VAL A 443 ? 0.2531 0.2563 0.2650 -0.0843 -0.0212 -0.0093 444 VAL A CB  
2944 C CG1 . VAL A 443 ? 0.2450 0.2456 0.2732 -0.0785 -0.0212 -0.0020 444 VAL A CG1 
2945 C CG2 . VAL A 443 ? 0.3276 0.3343 0.3307 -0.0840 -0.0235 -0.0040 444 VAL A CG2 
2946 N N   . ILE A 444 ? 0.3298 0.3119 0.3583 -0.0763 -0.0071 -0.0234 445 ILE A N   
2947 C CA  . ILE A 444 ? 0.2536 0.2306 0.2931 -0.0775 -0.0060 -0.0264 445 ILE A CA  
2948 C C   . ILE A 444 ? 0.3165 0.2939 0.3682 -0.0743 -0.0058 -0.0166 445 ILE A C   
2949 O O   . ILE A 444 ? 0.2803 0.2559 0.3332 -0.0677 -0.0022 -0.0109 445 ILE A O   
2950 C CB  . ILE A 444 ? 0.3084 0.2750 0.3498 -0.0735 -0.0003 -0.0327 445 ILE A CB  
2951 C CG1 . ILE A 444 ? 0.3071 0.2747 0.3376 -0.0752 0.0012  -0.0430 445 ILE A CG1 
2952 C CG2 . ILE A 444 ? 0.2656 0.2262 0.3198 -0.0759 -0.0004 -0.0356 445 ILE A CG2 
2953 C CD1 . ILE A 444 ? 0.2623 0.2202 0.2982 -0.0716 0.0058  -0.0509 445 ILE A CD1 
2954 N N   . LYS A 445 ? 0.2631 0.2443 0.3240 -0.0793 -0.0096 -0.0154 446 LYS A N   
2955 C CA  . LYS A 445 ? 0.2902 0.2739 0.3648 -0.0772 -0.0088 -0.0072 446 LYS A CA  
2956 C C   . LYS A 445 ? 0.2839 0.2598 0.3671 -0.0762 -0.0043 -0.0075 446 LYS A C   
2957 O O   . LYS A 445 ? 0.2702 0.2412 0.3561 -0.0806 -0.0057 -0.0136 446 LYS A O   
2958 C CB  . LYS A 445 ? 0.3512 0.3440 0.4335 -0.0836 -0.0158 -0.0047 446 LYS A CB  
2959 C CG  . LYS A 445 ? 0.3393 0.3365 0.4384 -0.0826 -0.0148 0.0025  446 LYS A CG  
2960 C CD  . LYS A 445 ? 0.4382 0.4455 0.5460 -0.0887 -0.0229 0.0055  446 LYS A CD  
2961 C CE  . LYS A 445 ? 0.3820 0.3957 0.5091 -0.0879 -0.0215 0.0122  446 LYS A CE  
2962 N NZ  . LYS A 445 ? 0.4206 0.4441 0.5578 -0.0942 -0.0303 0.0151  446 LYS A NZ  
2963 N N   . ALA A 446 ? 0.2405 0.2156 0.3282 -0.0710 0.0009  -0.0010 447 ALA A N   
2964 C CA  . ALA A 446 ? 0.2428 0.2122 0.3390 -0.0713 0.0044  0.0015  447 ALA A CA  
2965 C C   . ALA A 446 ? 0.3014 0.2791 0.4109 -0.0738 0.0045  0.0083  447 ALA A C   
2966 O O   . ALA A 446 ? 0.2644 0.2515 0.3769 -0.0715 0.0051  0.0123  447 ALA A O   
2967 C CB  . ALA A 446 ? 0.2391 0.2031 0.3299 -0.0653 0.0102  0.0046  447 ALA A CB  
2968 N N   . LYS A 447 ? 0.2831 0.2578 0.4028 -0.0787 0.0037  0.0094  448 LYS A N   
2969 C CA  . LYS A 447 ? 0.3553 0.3392 0.4892 -0.0824 0.0036  0.0155  448 LYS A CA  
2970 C C   . LYS A 447 ? 0.4231 0.4101 0.5623 -0.0807 0.0104  0.0237  448 LYS A C   
2971 O O   . LYS A 447 ? 0.5710 0.5675 0.7224 -0.0837 0.0118  0.0291  448 LYS A O   
2972 C CB  . LYS A 447 ? 0.3529 0.3343 0.4964 -0.0901 -0.0021 0.0126  448 LYS A CB  
2973 C CG  . LYS A 447 ? 0.3298 0.3127 0.4677 -0.0933 -0.0090 0.0048  448 LYS A CG  
2974 C CD  . LYS A 447 ? 0.3695 0.3537 0.5187 -0.1017 -0.0150 0.0027  448 LYS A CD  
2975 C CE  . LYS A 447 ? 0.4035 0.3880 0.5439 -0.1063 -0.0218 -0.0070 448 LYS A CE  
2976 N NZ  . LYS A 447 ? 0.3862 0.3593 0.5170 -0.1058 -0.0208 -0.0177 448 LYS A NZ  
2977 N N   . ARG A 448 ? 0.3259 0.3062 0.4559 -0.0765 0.0146  0.0247  449 ARG A N   
2978 C CA  . ARG A 448 ? 0.3605 0.3463 0.4909 -0.0747 0.0215  0.0321  449 ARG A CA  
2979 C C   . ARG A 448 ? 0.3886 0.3722 0.5049 -0.0676 0.0250  0.0304  449 ARG A C   
2980 O O   . ARG A 448 ? 0.3207 0.2950 0.4278 -0.0650 0.0225  0.0252  449 ARG A O   
2981 C CB  . ARG A 448 ? 0.3434 0.3235 0.4794 -0.0797 0.0222  0.0385  449 ARG A CB  
2982 C CG  . ARG A 448 ? 0.3928 0.3574 0.5240 -0.0791 0.0190  0.0357  449 ARG A CG  
2983 C CD  . ARG A 448 ? 0.4456 0.4050 0.5862 -0.0848 0.0183  0.0439  449 ARG A CD  
2984 N NE  . ARG A 448 ? 0.3798 0.3235 0.5213 -0.0844 0.0139  0.0406  449 ARG A NE  
2985 C CZ  . ARG A 448 ? 0.3307 0.2676 0.4672 -0.0820 0.0148  0.0449  449 ARG A CZ  
2986 N NH1 . ARG A 448 ? 0.3341 0.2788 0.4619 -0.0806 0.0201  0.0526  449 ARG A NH1 
2987 N NH2 . ARG A 448 ? 0.4057 0.3286 0.5470 -0.0814 0.0103  0.0411  449 ARG A NH2 
2988 N N   . PRO A 449 ? 0.3756 0.3688 0.4910 -0.0649 0.0312  0.0340  450 PRO A N   
2989 C CA  . PRO A 449 ? 0.3300 0.3225 0.4335 -0.0581 0.0340  0.0313  450 PRO A CA  
2990 C C   . PRO A 449 ? 0.3406 0.3233 0.4332 -0.0570 0.0354  0.0333  450 PRO A C   
2991 O O   . PRO A 449 ? 0.3317 0.3102 0.4137 -0.0518 0.0357  0.0300  450 PRO A O   
2992 C CB  . PRO A 449 ? 0.3773 0.3843 0.4861 -0.0564 0.0404  0.0332  450 PRO A CB  
2993 C CG  . PRO A 449 ? 0.3486 0.3627 0.4678 -0.0630 0.0431  0.0394  450 PRO A CG  
2994 C CD  . PRO A 449 ? 0.3612 0.3676 0.4873 -0.0681 0.0362  0.0396  450 PRO A CD  
2995 N N   . ASP A 450 ? 0.3250 0.3039 0.4214 -0.0621 0.0354  0.0393  451 ASP A N   
2996 C CA  . ASP A 450 ? 0.3169 0.2863 0.4056 -0.0617 0.0353  0.0429  451 ASP A CA  
2997 C C   . ASP A 450 ? 0.3275 0.2827 0.4201 -0.0630 0.0291  0.0400  451 ASP A C   
2998 O O   . ASP A 450 ? 0.3049 0.2515 0.3980 -0.0643 0.0273  0.0444  451 ASP A O   
2999 C CB  . ASP A 450 ? 0.3682 0.3433 0.4587 -0.0670 0.0389  0.0533  451 ASP A CB  
3000 C CG  . ASP A 450 ? 0.5343 0.5114 0.6392 -0.0746 0.0370  0.0586  451 ASP A CG  
3001 O OD1 . ASP A 450 ? 0.5588 0.5352 0.6726 -0.0754 0.0336  0.0536  451 ASP A OD1 
3002 O OD2 . ASP A 450 ? 0.6137 0.5939 0.7209 -0.0804 0.0386  0.0685  451 ASP A OD2 
3003 N N   . HIS A 451 ? 0.3197 0.2731 0.4161 -0.0630 0.0254  0.0324  452 HIS A N   
3004 C CA  . HIS A 451 ? 0.3363 0.2777 0.4355 -0.0635 0.0204  0.0261  452 HIS A CA  
3005 C C   . HIS A 451 ? 0.3506 0.2850 0.4395 -0.0579 0.0209  0.0229  452 HIS A C   
3006 O O   . HIS A 451 ? 0.3497 0.2890 0.4281 -0.0534 0.0237  0.0220  452 HIS A O   
3007 C CB  . HIS A 451 ? 0.3273 0.2710 0.4283 -0.0649 0.0171  0.0174  452 HIS A CB  
3008 C CG  . HIS A 451 ? 0.3461 0.2797 0.4522 -0.0672 0.0126  0.0093  452 HIS A CG  
3009 N ND1 . HIS A 451 ? 0.3568 0.2839 0.4563 -0.0636 0.0121  0.0014  452 HIS A ND1 
3010 C CD2 . HIS A 451 ? 0.3553 0.2847 0.4737 -0.0727 0.0087  0.0069  452 HIS A CD2 
3011 C CE1 . HIS A 451 ? 0.4158 0.3358 0.5236 -0.0666 0.0086  -0.0066 452 HIS A CE1 
3012 N NE2 . HIS A 451 ? 0.3830 0.3036 0.5023 -0.0722 0.0061  -0.0035 452 HIS A NE2 
3013 N N   . PRO A 452 ? 0.2936 0.2166 0.3878 -0.0582 0.0179  0.0211  453 PRO A N   
3014 C CA  . PRO A 452 ? 0.3384 0.2547 0.4262 -0.0532 0.0178  0.0177  453 PRO A CA  
3015 C C   . PRO A 452 ? 0.3150 0.2350 0.3921 -0.0492 0.0189  0.0085  453 PRO A C   
3016 O O   . PRO A 452 ? 0.2987 0.2179 0.3672 -0.0447 0.0204  0.0085  453 PRO A O   
3017 C CB  . PRO A 452 ? 0.3594 0.2639 0.4608 -0.0549 0.0134  0.0140  453 PRO A CB  
3018 C CG  . PRO A 452 ? 0.3412 0.2449 0.4550 -0.0612 0.0114  0.0221  453 PRO A CG  
3019 C CD  . PRO A 452 ? 0.2925 0.2084 0.4021 -0.0636 0.0140  0.0232  453 PRO A CD  
3020 N N   . TYR A 453 ? 0.3049 0.2291 0.3824 -0.0515 0.0174  0.0016  454 TYR A N   
3021 C CA  . TYR A 453 ? 0.2410 0.1697 0.3077 -0.0491 0.0177  -0.0050 454 TYR A CA  
3022 C C   . TYR A 453 ? 0.2469 0.1834 0.3050 -0.0459 0.0201  0.0005  454 TYR A C   
3023 O O   . TYR A 453 ? 0.2675 0.2067 0.3171 -0.0434 0.0200  -0.0028 454 TYR A O   
3024 C CB  . TYR A 453 ? 0.2729 0.2057 0.3406 -0.0536 0.0147  -0.0127 454 TYR A CB  
3025 C CG  . TYR A 453 ? 0.3027 0.2293 0.3747 -0.0555 0.0131  -0.0235 454 TYR A CG  
3026 C CD1 . TYR A 453 ? 0.3171 0.2335 0.4008 -0.0551 0.0126  -0.0241 454 TYR A CD1 
3027 C CD2 . TYR A 453 ? 0.2535 0.1851 0.3189 -0.0583 0.0118  -0.0333 454 TYR A CD2 
3028 C CE1 . TYR A 453 ? 0.2993 0.2102 0.3901 -0.0564 0.0113  -0.0358 454 TYR A CE1 
3029 C CE2 . TYR A 453 ? 0.2778 0.2054 0.3474 -0.0603 0.0114  -0.0454 454 TYR A CE2 
3030 C CZ  . TYR A 453 ? 0.2668 0.1839 0.3501 -0.0588 0.0113  -0.0474 454 TYR A CZ  
3031 O OH  . TYR A 453 ? 0.3369 0.2503 0.4272 -0.0603 0.0111  -0.0614 454 TYR A OH  
3032 N N   . MET A 454 ? 0.2964 0.2371 0.3580 -0.0463 0.0223  0.0083  455 MET A N   
3033 C CA  . MET A 454 ? 0.3533 0.3014 0.4091 -0.0428 0.0253  0.0119  455 MET A CA  
3034 C C   . MET A 454 ? 0.3717 0.3163 0.4201 -0.0388 0.0280  0.0150  455 MET A C   
3035 O O   . MET A 454 ? 0.3433 0.2927 0.3859 -0.0354 0.0303  0.0160  455 MET A O   
3036 C CB  . MET A 454 ? 0.3465 0.3036 0.4101 -0.0452 0.0275  0.0172  455 MET A CB  
3037 C CG  . MET A 454 ? 0.3573 0.3200 0.4293 -0.0490 0.0242  0.0152  455 MET A CG  
3038 S SD  . MET A 454 ? 0.3524 0.3211 0.4201 -0.0463 0.0212  0.0114  455 MET A SD  
3039 C CE  . MET A 454 ? 0.3143 0.2922 0.3855 -0.0419 0.0262  0.0155  455 MET A CE  
3040 N N   . SER A 455 ? 0.3801 0.3162 0.4298 -0.0394 0.0271  0.0163  456 SER A N   
3041 C CA  . SER A 455 ? 0.3951 0.3282 0.4379 -0.0363 0.0286  0.0201  456 SER A CA  
3042 C C   . SER A 455 ? 0.4184 0.3427 0.4599 -0.0337 0.0262  0.0160  456 SER A C   
3043 O O   . SER A 455 ? 0.4877 0.4105 0.5221 -0.0303 0.0267  0.0174  456 SER A O   
3044 C CB  . SER A 455 ? 0.3200 0.2534 0.3660 -0.0397 0.0298  0.0293  456 SER A CB  
3045 O OG  . SER A 455 ? 0.4731 0.3998 0.5305 -0.0438 0.0264  0.0308  456 SER A OG  
3046 N N   . THR A 456 ? 0.3451 0.2640 0.3941 -0.0353 0.0236  0.0102  457 THR A N   
3047 C CA  . THR A 456 ? 0.3504 0.2625 0.4009 -0.0326 0.0221  0.0048  457 THR A CA  
3048 C C   . THR A 456 ? 0.3981 0.3143 0.4390 -0.0298 0.0231  -0.0020 457 THR A C   
3049 O O   . THR A 456 ? 0.3861 0.3081 0.4240 -0.0316 0.0230  -0.0065 457 THR A O   
3050 C CB  . THR A 456 ? 0.3764 0.2821 0.4400 -0.0352 0.0195  -0.0013 457 THR A CB  
3051 O OG1 . THR A 456 ? 0.4153 0.3166 0.4893 -0.0386 0.0176  0.0064  457 THR A OG1 
3052 C CG2 . THR A 456 ? 0.3048 0.2044 0.3727 -0.0319 0.0186  -0.0077 457 THR A CG2 
3053 N N   . GLU A 457 ? 0.4221 0.3358 0.4590 -0.0260 0.0233  -0.0019 458 GLU A N   
3054 C CA  . GLU A 457 ? 0.3772 0.2950 0.4053 -0.0238 0.0241  -0.0067 458 GLU A CA  
3055 C C   . GLU A 457 ? 0.4433 0.3607 0.4757 -0.0249 0.0239  -0.0169 458 GLU A C   
3056 O O   . GLU A 457 ? 0.4452 0.3566 0.4869 -0.0237 0.0234  -0.0200 458 GLU A O   
3057 C CB  . GLU A 457 ? 0.4339 0.3498 0.4567 -0.0197 0.0243  -0.0024 458 GLU A CB  
3058 C CG  . GLU A 457 ? 0.6382 0.5580 0.6527 -0.0176 0.0247  -0.0057 458 GLU A CG  
3059 C CD  . GLU A 457 ? 0.8514 0.7704 0.8594 -0.0143 0.0246  -0.0003 458 GLU A CD  
3060 O OE1 . GLU A 457 ? 0.8559 0.7778 0.8577 -0.0127 0.0244  -0.0018 458 GLU A OE1 
3061 O OE2 . GLU A 457 ? 0.9670 0.8828 0.9759 -0.0140 0.0244  0.0057  458 GLU A OE2 
3062 N N   . PHE A 458 ? 0.3393 0.2637 0.3658 -0.0275 0.0241  -0.0222 459 PHE A N   
3063 C CA  . PHE A 458 ? 0.3342 0.2611 0.3628 -0.0300 0.0247  -0.0332 459 PHE A CA  
3064 C C   . PHE A 458 ? 0.2831 0.2156 0.3034 -0.0290 0.0261  -0.0366 459 PHE A C   
3065 O O   . PHE A 458 ? 0.3348 0.2701 0.3575 -0.0303 0.0278  -0.0462 459 PHE A O   
3066 C CB  . PHE A 458 ? 0.3746 0.3072 0.4014 -0.0357 0.0235  -0.0373 459 PHE A CB  
3067 C CG  . PHE A 458 ? 0.3745 0.3026 0.4107 -0.0377 0.0220  -0.0349 459 PHE A CG  
3068 C CD1 . PHE A 458 ? 0.2795 0.1988 0.3289 -0.0367 0.0218  -0.0368 459 PHE A CD1 
3069 C CD2 . PHE A 458 ? 0.3612 0.2941 0.3951 -0.0408 0.0202  -0.0301 459 PHE A CD2 
3070 C CE1 . PHE A 458 ? 0.2742 0.1894 0.3332 -0.0394 0.0199  -0.0336 459 PHE A CE1 
3071 C CE2 . PHE A 458 ? 0.3442 0.2739 0.3876 -0.0432 0.0189  -0.0276 459 PHE A CE2 
3072 C CZ  . PHE A 458 ? 0.3228 0.2437 0.3781 -0.0428 0.0188  -0.0291 459 PHE A CZ  
3073 N N   . PHE A 459 ? 0.2466 0.1817 0.2581 -0.0272 0.0254  -0.0294 460 PHE A N   
3074 C CA  . PHE A 459 ? 0.3462 0.2868 0.3502 -0.0269 0.0259  -0.0308 460 PHE A CA  
3075 C C   . PHE A 459 ? 0.3787 0.3284 0.3783 -0.0327 0.0267  -0.0392 460 PHE A C   
3076 O O   . PHE A 459 ? 0.3130 0.2658 0.3143 -0.0330 0.0295  -0.0468 460 PHE A O   
3077 C CB  . PHE A 459 ? 0.3811 0.3169 0.3899 -0.0224 0.0274  -0.0317 460 PHE A CB  
3078 C CG  . PHE A 459 ? 0.4339 0.3718 0.4355 -0.0201 0.0268  -0.0268 460 PHE A CG  
3079 C CD1 . PHE A 459 ? 0.4076 0.3503 0.4081 -0.0204 0.0283  -0.0313 460 PHE A CD1 
3080 C CD2 . PHE A 459 ? 0.4164 0.3521 0.4131 -0.0180 0.0248  -0.0184 460 PHE A CD2 
3081 C CE1 . PHE A 459 ? 0.4023 0.3465 0.3972 -0.0188 0.0271  -0.0263 460 PHE A CE1 
3082 C CE2 . PHE A 459 ? 0.5061 0.4429 0.4973 -0.0161 0.0236  -0.0147 460 PHE A CE2 
3083 C CZ  . PHE A 459 ? 0.4985 0.4392 0.4889 -0.0166 0.0244  -0.0181 460 PHE A CZ  
3084 N N   . GLY A 460 ? 0.3068 0.2619 0.3016 -0.0376 0.0244  -0.0379 461 GLY A N   
3085 C CA  . GLY A 460 ? 0.2327 0.1977 0.2214 -0.0447 0.0243  -0.0451 461 GLY A CA  
3086 C C   . GLY A 460 ? 0.3140 0.2837 0.2977 -0.0491 0.0196  -0.0386 461 GLY A C   
3087 O O   . GLY A 460 ? 0.3112 0.2761 0.2984 -0.0457 0.0175  -0.0303 461 GLY A O   
3088 N N   . PRO A 461 ? 0.2810 0.2610 0.2570 -0.0570 0.0178  -0.0423 462 PRO A N   
3089 C CA  . PRO A 461 ? 0.3225 0.3080 0.2943 -0.0616 0.0117  -0.0341 462 PRO A CA  
3090 C C   . PRO A 461 ? 0.3239 0.3069 0.3025 -0.0633 0.0097  -0.0351 462 PRO A C   
3091 O O   . PRO A 461 ? 0.3334 0.3239 0.3079 -0.0708 0.0065  -0.0375 462 PRO A O   
3092 C CB  . PRO A 461 ? 0.2496 0.2483 0.2093 -0.0708 0.0103  -0.0373 462 PRO A CB  
3093 C CG  . PRO A 461 ? 0.2562 0.2567 0.2162 -0.0724 0.0163  -0.0519 462 PRO A CG  
3094 C CD  . PRO A 461 ? 0.2931 0.2819 0.2636 -0.0627 0.0210  -0.0537 462 PRO A CD  
3095 N N   . ILE A 462 ? 0.2922 0.2655 0.2810 -0.0569 0.0115  -0.0326 463 ILE A N   
3096 C CA  . ILE A 462 ? 0.2794 0.2499 0.2765 -0.0581 0.0102  -0.0327 463 ILE A CA  
3097 C C   . ILE A 462 ? 0.3194 0.2867 0.3233 -0.0536 0.0088  -0.0225 463 ILE A C   
3098 O O   . ILE A 462 ? 0.3684 0.3294 0.3754 -0.0472 0.0118  -0.0191 463 ILE A O   
3099 C CB  . ILE A 462 ? 0.3021 0.2645 0.3075 -0.0560 0.0141  -0.0407 463 ILE A CB  
3100 C CG1 . ILE A 462 ? 0.2624 0.2292 0.2638 -0.0605 0.0162  -0.0536 463 ILE A CG1 
3101 C CG2 . ILE A 462 ? 0.3189 0.2779 0.3344 -0.0576 0.0123  -0.0393 463 ILE A CG2 
3102 C CD1 . ILE A 462 ? 0.3033 0.2619 0.3164 -0.0585 0.0192  -0.0628 463 ILE A CD1 
3103 N N   . LEU A 463 ? 0.2684 0.2411 0.2750 -0.0572 0.0042  -0.0181 464 LEU A N   
3104 C CA  . LEU A 463 ? 0.2263 0.1985 0.2416 -0.0534 0.0033  -0.0100 464 LEU A CA  
3105 C C   . LEU A 463 ? 0.2284 0.1992 0.2536 -0.0553 0.0036  -0.0107 464 LEU A C   
3106 O O   . LEU A 463 ? 0.3090 0.2836 0.3349 -0.0616 0.0003  -0.0140 464 LEU A O   
3107 C CB  . LEU A 463 ? 0.2260 0.2060 0.2412 -0.0559 -0.0030 -0.0035 464 LEU A CB  
3108 C CG  . LEU A 463 ? 0.3010 0.2822 0.3283 -0.0518 -0.0040 0.0033  464 LEU A CG  
3109 C CD1 . LEU A 463 ? 0.2759 0.2515 0.3040 -0.0439 0.0011  0.0047  464 LEU A CD1 
3110 C CD2 . LEU A 463 ? 0.2794 0.2683 0.3104 -0.0549 -0.0120 0.0097  464 LEU A CD2 
3111 N N   . THR A 464 ? 0.2268 0.1930 0.2593 -0.0506 0.0075  -0.0073 465 THR A N   
3112 C CA  . THR A 464 ? 0.2262 0.1925 0.2694 -0.0528 0.0077  -0.0060 465 THR A CA  
3113 C C   . THR A 464 ? 0.2800 0.2533 0.3315 -0.0516 0.0065  0.0008  465 THR A C   
3114 O O   . THR A 464 ? 0.2599 0.2339 0.3117 -0.0464 0.0089  0.0044  465 THR A O   
3115 C CB  . THR A 464 ? 0.2703 0.2285 0.3174 -0.0501 0.0125  -0.0057 465 THR A CB  
3116 O OG1 . THR A 464 ? 0.2656 0.2171 0.3079 -0.0501 0.0134  -0.0124 465 THR A OG1 
3117 C CG2 . THR A 464 ? 0.2488 0.2071 0.3073 -0.0540 0.0121  -0.0040 465 THR A CG2 
3118 N N   . VAL A 465 ? 0.2808 0.2598 0.3402 -0.0565 0.0025  0.0019  466 VAL A N   
3119 C CA  . VAL A 465 ? 0.2211 0.2080 0.2916 -0.0552 0.0009  0.0078  466 VAL A CA  
3120 C C   . VAL A 465 ? 0.2315 0.2212 0.3149 -0.0570 0.0032  0.0100  466 VAL A C   
3121 O O   . VAL A 465 ? 0.2443 0.2321 0.3301 -0.0623 0.0015  0.0077  466 VAL A O   
3122 C CB  . VAL A 465 ? 0.3672 0.3614 0.4383 -0.0589 -0.0073 0.0099  466 VAL A CB  
3123 C CG1 . VAL A 465 ? 0.4291 0.4251 0.4969 -0.0672 -0.0125 0.0063  466 VAL A CG1 
3124 C CG2 . VAL A 465 ? 0.3115 0.3139 0.3989 -0.0568 -0.0094 0.0157  466 VAL A CG2 
3125 N N   . TYR A 466 ? 0.2522 0.2465 0.3441 -0.0527 0.0075  0.0139  467 TYR A N   
3126 C CA  . TYR A 466 ? 0.2622 0.2624 0.3677 -0.0548 0.0101  0.0169  467 TYR A CA  
3127 C C   . TYR A 466 ? 0.2959 0.3074 0.4157 -0.0533 0.0081  0.0198  467 TYR A C   
3128 O O   . TYR A 466 ? 0.2697 0.2837 0.3908 -0.0477 0.0093  0.0200  467 TYR A O   
3129 C CB  . TYR A 466 ? 0.2713 0.2696 0.3757 -0.0522 0.0183  0.0187  467 TYR A CB  
3130 C CG  . TYR A 466 ? 0.2949 0.3017 0.4134 -0.0553 0.0215  0.0226  467 TYR A CG  
3131 C CD1 . TYR A 466 ? 0.2671 0.2718 0.3911 -0.0617 0.0192  0.0238  467 TYR A CD1 
3132 C CD2 . TYR A 466 ? 0.2755 0.2933 0.4033 -0.0521 0.0267  0.0243  467 TYR A CD2 
3133 C CE1 . TYR A 466 ? 0.2847 0.2979 0.4223 -0.0654 0.0218  0.0281  467 TYR A CE1 
3134 C CE2 . TYR A 466 ? 0.2593 0.2872 0.4008 -0.0557 0.0303  0.0277  467 TYR A CE2 
3135 C CZ  . TYR A 466 ? 0.3111 0.3365 0.4571 -0.0625 0.0276  0.0303  467 TYR A CZ  
3136 O OH  . TYR A 466 ? 0.3258 0.3616 0.4859 -0.0668 0.0309  0.0345  467 TYR A OH  
3137 N N   . GLU A 467 ? 0.2931 0.3112 0.4257 -0.0582 0.0046  0.0218  468 GLU A N   
3138 C CA  . GLU A 467 ? 0.3099 0.3395 0.4601 -0.0574 0.0015  0.0247  468 GLU A CA  
3139 C C   . GLU A 467 ? 0.2706 0.3093 0.4357 -0.0566 0.0088  0.0265  468 GLU A C   
3140 O O   . GLU A 467 ? 0.2745 0.3132 0.4418 -0.0614 0.0109  0.0278  468 GLU A O   
3141 C CB  . GLU A 467 ? 0.3301 0.3626 0.4849 -0.0643 -0.0085 0.0261  468 GLU A CB  
3142 C CG  . GLU A 467 ? 0.3562 0.3831 0.4960 -0.0660 -0.0155 0.0246  468 GLU A CG  
3143 C CD  . GLU A 467 ? 0.4866 0.5164 0.6259 -0.0745 -0.0250 0.0249  468 GLU A CD  
3144 O OE1 . GLU A 467 ? 0.4738 0.5102 0.6275 -0.0785 -0.0277 0.0271  468 GLU A OE1 
3145 O OE2 . GLU A 467 ? 0.5438 0.5701 0.6680 -0.0778 -0.0299 0.0228  468 GLU A OE2 
3146 N N   . TYR A 468 ? 0.3148 0.3616 0.4906 -0.0508 0.0129  0.0261  469 TYR A N   
3147 C CA  . TYR A 468 ? 0.2427 0.3006 0.4315 -0.0501 0.0216  0.0266  469 TYR A CA  
3148 C C   . TYR A 468 ? 0.2989 0.3706 0.5129 -0.0491 0.0188  0.0274  469 TYR A C   
3149 O O   . TYR A 468 ? 0.3118 0.3840 0.5328 -0.0456 0.0122  0.0271  469 TYR A O   
3150 C CB  . TYR A 468 ? 0.2084 0.2662 0.3893 -0.0442 0.0308  0.0233  469 TYR A CB  
3151 C CG  . TYR A 468 ? 0.2879 0.3477 0.4746 -0.0368 0.0293  0.0196  469 TYR A CG  
3152 C CD1 . TYR A 468 ? 0.2129 0.2614 0.3863 -0.0342 0.0236  0.0188  469 TYR A CD1 
3153 C CD2 . TYR A 468 ? 0.3405 0.4139 0.5482 -0.0327 0.0334  0.0167  469 TYR A CD2 
3154 C CE1 . TYR A 468 ? 0.2293 0.2788 0.4099 -0.0279 0.0213  0.0163  469 TYR A CE1 
3155 C CE2 . TYR A 468 ? 0.2011 0.2754 0.4176 -0.0258 0.0313  0.0129  469 TYR A CE2 
3156 C CZ  . TYR A 468 ? 0.2782 0.3400 0.4812 -0.0235 0.0247  0.0132  469 TYR A CZ  
3157 O OH  . TYR A 468 ? 0.2117 0.2738 0.4254 -0.0170 0.0219  0.0101  469 TYR A OH  
3158 N N   . PRO A 469 ? 0.2892 0.3724 0.5185 -0.0525 0.0234  0.0292  470 PRO A N   
3159 C CA  . PRO A 469 ? 0.2866 0.3850 0.5433 -0.0509 0.0221  0.0294  470 PRO A CA  
3160 C C   . PRO A 469 ? 0.2536 0.3583 0.5196 -0.0422 0.0272  0.0240  470 PRO A C   
3161 O O   . PRO A 469 ? 0.2397 0.3446 0.4955 -0.0391 0.0372  0.0200  470 PRO A O   
3162 C CB  . PRO A 469 ? 0.2951 0.4049 0.5620 -0.0561 0.0298  0.0315  470 PRO A CB  
3163 C CG  . PRO A 469 ? 0.2784 0.3759 0.5263 -0.0630 0.0281  0.0348  470 PRO A CG  
3164 C CD  . PRO A 469 ? 0.2810 0.3634 0.5047 -0.0590 0.0281  0.0321  470 PRO A CD  
3165 N N   . ASP A 470 ? 0.2811 0.3904 0.5667 -0.0385 0.0196  0.0239  471 ASP A N   
3166 C CA  . ASP A 470 ? 0.2868 0.3996 0.5838 -0.0297 0.0220  0.0183  471 ASP A CA  
3167 C C   . ASP A 470 ? 0.3061 0.4314 0.6107 -0.0260 0.0368  0.0109  471 ASP A C   
3168 O O   . ASP A 470 ? 0.3473 0.4704 0.6452 -0.0202 0.0425  0.0046  471 ASP A O   
3169 C CB  . ASP A 470 ? 0.2625 0.3816 0.5879 -0.0272 0.0113  0.0204  471 ASP A CB  
3170 C CG  . ASP A 470 ? 0.3267 0.4340 0.6422 -0.0306 -0.0038 0.0274  471 ASP A CG  
3171 O OD1 . ASP A 470 ? 0.2925 0.3920 0.5873 -0.0378 -0.0070 0.0313  471 ASP A OD1 
3172 O OD2 . ASP A 470 ? 0.3363 0.4425 0.6652 -0.0265 -0.0125 0.0288  471 ASP A OD2 
3173 N N   . THR A 471 ? 0.2776 0.4172 0.5956 -0.0301 0.0431  0.0117  472 THR A N   
3174 C CA  . THR A 471 ? 0.2946 0.4501 0.6210 -0.0280 0.0579  0.0047  472 THR A CA  
3175 C C   . THR A 471 ? 0.2909 0.4407 0.5879 -0.0300 0.0674  0.0034  472 THR A C   
3176 O O   . THR A 471 ? 0.2581 0.4191 0.5555 -0.0278 0.0793  -0.0036 472 THR A O   
3177 C CB  . THR A 471 ? 0.3640 0.5374 0.7108 -0.0335 0.0625  0.0072  472 THR A CB  
3178 O OG1 . THR A 471 ? 0.4364 0.6028 0.7663 -0.0427 0.0603  0.0157  472 THR A OG1 
3179 C CG2 . THR A 471 ? 0.3292 0.5101 0.7083 -0.0314 0.0529  0.0084  472 THR A CG2 
3180 N N   . GLU A 472 ? 0.2514 0.3844 0.5235 -0.0343 0.0618  0.0097  473 GLU A N   
3181 C CA  . GLU A 472 ? 0.3047 0.4318 0.5510 -0.0368 0.0691  0.0102  473 GLU A CA  
3182 C C   . GLU A 472 ? 0.3016 0.4156 0.5293 -0.0310 0.0681  0.0060  473 GLU A C   
3183 O O   . GLU A 472 ? 0.3026 0.4069 0.5070 -0.0334 0.0701  0.0083  473 GLU A O   
3184 C CB  . GLU A 472 ? 0.4211 0.5394 0.6545 -0.0453 0.0653  0.0189  473 GLU A CB  
3185 C CG  . GLU A 472 ? 0.5391 0.6715 0.7914 -0.0517 0.0673  0.0231  473 GLU A CG  
3186 C CD  . GLU A 472 ? 0.6855 0.8092 0.9280 -0.0605 0.0633  0.0313  473 GLU A CD  
3187 O OE1 . GLU A 472 ? 0.7419 0.8477 0.9651 -0.0610 0.0576  0.0331  473 GLU A OE1 
3188 O OE2 . GLU A 472 ? 0.7395 0.8744 0.9951 -0.0669 0.0660  0.0357  473 GLU A OE2 
3189 N N   . PHE A 473 ? 0.3320 0.4461 0.5721 -0.0235 0.0646  0.0001  474 PHE A N   
3190 C CA  . PHE A 473 ? 0.2672 0.3691 0.4925 -0.0179 0.0626  -0.0039 474 PHE A CA  
3191 C C   . PHE A 473 ? 0.2680 0.3732 0.4773 -0.0174 0.0739  -0.0089 474 PHE A C   
3192 O O   . PHE A 473 ? 0.3136 0.4062 0.4998 -0.0179 0.0728  -0.0073 474 PHE A O   
3193 C CB  . PHE A 473 ? 0.2606 0.3642 0.5069 -0.0102 0.0575  -0.0095 474 PHE A CB  
3194 C CG  . PHE A 473 ? 0.2870 0.3799 0.5204 -0.0046 0.0566  -0.0143 474 PHE A CG  
3195 C CD1 . PHE A 473 ? 0.2026 0.2785 0.4186 -0.0053 0.0473  -0.0089 474 PHE A CD1 
3196 C CD2 . PHE A 473 ? 0.2518 0.3523 0.4906 0.0008  0.0654  -0.0249 474 PHE A CD2 
3197 C CE1 . PHE A 473 ? 0.2229 0.2894 0.4281 -0.0007 0.0462  -0.0127 474 PHE A CE1 
3198 C CE2 . PHE A 473 ? 0.2094 0.2998 0.4371 0.0054  0.0641  -0.0294 474 PHE A CE2 
3199 C CZ  . PHE A 473 ? 0.2522 0.3253 0.4633 0.0047  0.0542  -0.0227 474 PHE A CZ  
3200 N N   . ASN A 474 ? 0.2167 0.3399 0.4382 -0.0169 0.0847  -0.0154 475 ASN A N   
3201 C CA  . ASN A 474 ? 0.2634 0.3922 0.4678 -0.0182 0.0957  -0.0200 475 ASN A CA  
3202 C C   . ASN A 474 ? 0.3217 0.4440 0.5017 -0.0264 0.0968  -0.0102 475 ASN A C   
3203 O O   . ASN A 474 ? 0.3077 0.4222 0.4656 -0.0269 0.0984  -0.0100 475 ASN A O   
3204 C CB  . ASN A 474 ? 0.2294 0.3817 0.4510 -0.0178 0.1081  -0.0288 475 ASN A CB  
3205 C CG  . ASN A 474 ? 0.3703 0.5281 0.6146 -0.0084 0.1085  -0.0414 475 ASN A CG  
3206 O OD1 . ASN A 474 ? 0.3386 0.4818 0.5839 -0.0025 0.0992  -0.0425 475 ASN A OD1 
3207 N ND2 . ASN A 474 ? 0.3931 0.5722 0.6568 -0.0073 0.1192  -0.0511 475 ASN A ND2 
3208 N N   . GLU A 475 ? 0.2272 0.3519 0.4130 -0.0328 0.0948  -0.0020 476 GLU A N   
3209 C CA  . GLU A 475 ? 0.2952 0.4131 0.4631 -0.0409 0.0943  0.0080  476 GLU A CA  
3210 C C   . GLU A 475 ? 0.2685 0.3641 0.4180 -0.0396 0.0852  0.0118  476 GLU A C   
3211 O O   . GLU A 475 ? 0.3413 0.4298 0.4720 -0.0430 0.0862  0.0162  476 GLU A O   
3212 C CB  . GLU A 475 ? 0.2313 0.3545 0.4130 -0.0476 0.0921  0.0154  476 GLU A CB  
3213 N N   . ILE A 476 ? 0.2663 0.3522 0.4222 -0.0351 0.0760  0.0102  477 ILE A N   
3214 C CA  . ILE A 476 ? 0.2185 0.2854 0.3583 -0.0339 0.0680  0.0126  477 ILE A CA  
3215 C C   . ILE A 476 ? 0.2417 0.3030 0.3654 -0.0294 0.0707  0.0083  477 ILE A C   
3216 O O   . ILE A 476 ? 0.2544 0.3027 0.3610 -0.0304 0.0675  0.0115  477 ILE A O   
3217 C CB  . ILE A 476 ? 0.4386 0.4989 0.5881 -0.0314 0.0576  0.0123  477 ILE A CB  
3218 C CG1 . ILE A 476 ? 0.5119 0.5578 0.6495 -0.0355 0.0500  0.0173  477 ILE A CG1 
3219 C CG2 . ILE A 476 ? 0.5292 0.5852 0.6784 -0.0241 0.0548  0.0068  477 ILE A CG2 
3220 C CD1 . ILE A 476 ? 0.4335 0.4804 0.5722 -0.0430 0.0510  0.0229  477 ILE A CD1 
3221 N N   . CYS A 477 ? 0.2582 0.3295 0.3884 -0.0246 0.0766  0.0005  478 CYS A N   
3222 C CA  . CYS A 477 ? 0.2970 0.3633 0.4121 -0.0209 0.0789  -0.0043 478 CYS A CA  
3223 C C   . CYS A 477 ? 0.2925 0.3609 0.3894 -0.0266 0.0851  -0.0002 478 CYS A C   
3224 O O   . CYS A 477 ? 0.2902 0.3485 0.3696 -0.0261 0.0833  0.0010  478 CYS A O   
3225 C CB  . CYS A 477 ? 0.2666 0.3433 0.3942 -0.0145 0.0838  -0.0153 478 CYS A CB  
3226 S SG  . CYS A 477 ? 0.2902 0.3630 0.4410 -0.0071 0.0747  -0.0194 478 CYS A SG  
3227 N N   . ASP A 478 ? 0.2651 0.3478 0.3672 -0.0324 0.0921  0.0024  479 ASP A N   
3228 C CA  . ASP A 478 ? 0.3490 0.4361 0.4356 -0.0398 0.0974  0.0087  479 ASP A CA  
3229 C C   . ASP A 478 ? 0.4450 0.5153 0.5210 -0.0437 0.0895  0.0191  479 ASP A C   
3230 O O   . ASP A 478 ? 0.5174 0.5817 0.5768 -0.0465 0.0891  0.0237  479 ASP A O   
3231 C CB  . ASP A 478 ? 0.3944 0.5010 0.4915 -0.0463 0.1057  0.0109  479 ASP A CB  
3232 C CG  . ASP A 478 ? 0.6031 0.7288 0.7142 -0.0424 0.1148  -0.0011 479 ASP A CG  
3233 O OD1 . ASP A 478 ? 0.7062 0.8312 0.8135 -0.0362 0.1165  -0.0109 479 ASP A OD1 
3234 O OD2 . ASP A 478 ? 0.6231 0.7648 0.7508 -0.0455 0.1201  -0.0013 479 ASP A OD2 
3235 N N   . ILE A 479 ? 0.4324 0.4956 0.5194 -0.0440 0.0828  0.0222  480 ILE A N   
3236 C CA  . ILE A 479 ? 0.4486 0.4965 0.5292 -0.0475 0.0754  0.0299  480 ILE A CA  
3237 C C   . ILE A 479 ? 0.5619 0.5946 0.6285 -0.0428 0.0705  0.0279  480 ILE A C   
3238 O O   . ILE A 479 ? 0.6241 0.6462 0.6812 -0.0456 0.0670  0.0336  480 ILE A O   
3239 C CB  . ILE A 479 ? 0.3450 0.3894 0.4403 -0.0488 0.0693  0.0312  480 ILE A CB  
3240 C CG1 . ILE A 479 ? 0.3218 0.3791 0.4293 -0.0558 0.0734  0.0363  480 ILE A CG1 
3241 C CG2 . ILE A 479 ? 0.3197 0.3469 0.4088 -0.0504 0.0612  0.0349  480 ILE A CG2 
3242 C CD1 . ILE A 479 ? 0.3416 0.4000 0.4664 -0.0569 0.0682  0.0362  480 ILE A CD1 
3243 N N   . ILE A 480 ? 0.5783 0.6104 0.6454 -0.0358 0.0699  0.0201  481 ILE A N   
3244 C CA  . ILE A 480 ? 0.5025 0.5215 0.5573 -0.0316 0.0653  0.0182  481 ILE A CA  
3245 C C   . ILE A 480 ? 0.5518 0.5725 0.5917 -0.0322 0.0698  0.0185  481 ILE A C   
3246 O O   . ILE A 480 ? 0.6085 0.6190 0.6367 -0.0332 0.0664  0.0227  481 ILE A O   
3247 C CB  . ILE A 480 ? 0.4626 0.4801 0.5241 -0.0249 0.0621  0.0110  481 ILE A CB  
3248 C CG1 . ILE A 480 ? 0.3638 0.3799 0.4381 -0.0256 0.0562  0.0121  481 ILE A CG1 
3249 C CG2 . ILE A 480 ? 0.4800 0.4856 0.5292 -0.0211 0.0579  0.0094  481 ILE A CG2 
3250 C CD1 . ILE A 480 ? 0.3486 0.3659 0.4329 -0.0204 0.0524  0.0072  481 ILE A CD1 
3251 N N   . ASP A 481 ? 0.5430 0.5779 0.5843 -0.0318 0.0773  0.0137  482 ASP A N   
3252 C CA  . ASP A 481 ? 0.6418 0.6819 0.6684 -0.0336 0.0824  0.0130  482 ASP A CA  
3253 C C   . ASP A 481 ? 0.7456 0.7851 0.7618 -0.0419 0.0825  0.0242  482 ASP A C   
3254 O O   . ASP A 481 ? 0.7814 0.8150 0.7831 -0.0433 0.0804  0.0278  482 ASP A O   
3255 C CB  . ASP A 481 ? 0.6901 0.7489 0.7229 -0.0332 0.0918  0.0047  482 ASP A CB  
3256 C CG  . ASP A 481 ? 0.7082 0.7766 0.7244 -0.0376 0.0983  0.0042  482 ASP A CG  
3257 O OD1 . ASP A 481 ? 0.7353 0.7953 0.7378 -0.0356 0.0953  0.0030  482 ASP A OD1 
3258 O OD2 . ASP A 481 ? 0.6920 0.7773 0.7087 -0.0437 0.1064  0.0051  482 ASP A OD2 
3259 N N   . ASN A 482 ? 0.7083 0.7542 0.7333 -0.0477 0.0841  0.0304  483 ASN A N   
3260 C CA  . ASN A 482 ? 0.6718 0.7177 0.6900 -0.0566 0.0834  0.0426  483 ASN A CA  
3261 C C   . ASN A 482 ? 0.7840 0.8119 0.8052 -0.0575 0.0741  0.0501  483 ASN A C   
3262 O O   . ASN A 482 ? 0.8615 0.8880 0.8837 -0.0647 0.0720  0.0605  483 ASN A O   
3263 C CB  . ASN A 482 ? 0.5339 0.5972 0.5602 -0.0638 0.0903  0.0464  483 ASN A CB  
3264 N N   . THR A 483 ? 0.7990 0.8139 0.8224 -0.0505 0.0684  0.0443  484 THR A N   
3265 C CA  . THR A 483 ? 0.7888 0.7876 0.8153 -0.0507 0.0604  0.0484  484 THR A CA  
3266 C C   . THR A 483 ? 0.8634 0.8507 0.8863 -0.0434 0.0558  0.0415  484 THR A C   
3267 O O   . THR A 483 ? 0.8876 0.8694 0.8999 -0.0414 0.0543  0.0418  484 THR A O   
3268 C CB  . THR A 483 ? 0.7059 0.7043 0.7475 -0.0535 0.0583  0.0496  484 THR A CB  
3269 N N   . TYR A 486 ? 0.6011 0.5641 0.5908 -0.0272 0.0472  0.0305  487 TYR A N   
3270 C CA  . TYR A 486 ? 0.5977 0.5515 0.5812 -0.0243 0.0428  0.0302  487 TYR A CA  
3271 C C   . TYR A 486 ? 0.7045 0.6539 0.6910 -0.0189 0.0405  0.0229  487 TYR A C   
3272 O O   . TYR A 486 ? 0.7932 0.7352 0.7840 -0.0182 0.0367  0.0224  487 TYR A O   
3273 C CB  . TYR A 486 ? 0.4403 0.3850 0.4272 -0.0271 0.0381  0.0371  487 TYR A CB  
3274 N N   . ALA A 487 ? 0.6252 0.5797 0.6101 -0.0156 0.0425  0.0172  488 ALA A N   
3275 C CA  . ALA A 487 ? 0.5900 0.5415 0.5790 -0.0117 0.0396  0.0121  488 ALA A CA  
3276 C C   . ALA A 487 ? 0.5129 0.4635 0.4967 -0.0078 0.0386  0.0081  488 ALA A C   
3277 O O   . ALA A 487 ? 0.5667 0.5221 0.5462 -0.0071 0.0416  0.0059  488 ALA A O   
3278 C CB  . ALA A 487 ? 0.6137 0.5713 0.6132 -0.0117 0.0406  0.0096  488 ALA A CB  
3279 N N   . LEU A 488 ? 0.5066 0.4514 0.4910 -0.0058 0.0343  0.0067  489 LEU A N   
3280 C CA  . LEU A 488 ? 0.4097 0.3526 0.3914 -0.0025 0.0321  0.0035  489 LEU A CA  
3281 C C   . LEU A 488 ? 0.4827 0.4301 0.4726 -0.0001 0.0319  -0.0007 489 LEU A C   
3282 O O   . LEU A 488 ? 0.4337 0.3832 0.4235 0.0025  0.0329  -0.0048 489 LEU A O   
3283 C CB  . LEU A 488 ? 0.4555 0.3922 0.4362 -0.0023 0.0278  0.0044  489 LEU A CB  
3284 C CG  . LEU A 488 ? 0.5251 0.4588 0.5021 0.0002  0.0249  0.0027  489 LEU A CG  
3285 C CD1 . LEU A 488 ? 0.4981 0.4308 0.4672 0.0006  0.0261  0.0032  489 LEU A CD1 
3286 C CD2 . LEU A 488 ? 0.5674 0.4973 0.5443 -0.0007 0.0217  0.0037  489 LEU A CD2 
3287 N N   . THR A 489 ? 0.3416 0.2905 0.3397 -0.0011 0.0299  0.0001  490 THR A N   
3288 C CA  . THR A 489 ? 0.3264 0.2791 0.3352 0.0010  0.0280  -0.0024 490 THR A CA  
3289 C C   . THR A 489 ? 0.3372 0.2961 0.3555 -0.0009 0.0294  -0.0015 490 THR A C   
3290 O O   . THR A 489 ? 0.3002 0.2590 0.3164 -0.0043 0.0305  0.0014  490 THR A O   
3291 C CB  . THR A 489 ? 0.3587 0.3074 0.3693 0.0010  0.0214  -0.0008 490 THR A CB  
3292 O OG1 . THR A 489 ? 0.3471 0.2955 0.3563 -0.0030 0.0195  0.0024  490 THR A OG1 
3293 C CG2 . THR A 489 ? 0.3526 0.2955 0.3546 0.0022  0.0197  -0.0011 490 THR A CG2 
3294 N N   . GLY A 490 ? 0.2749 0.2390 0.3057 0.0015  0.0290  -0.0042 491 GLY A N   
3295 C CA  . GLY A 490 ? 0.2434 0.2142 0.2862 -0.0001 0.0293  -0.0032 491 GLY A CA  
3296 C C   . GLY A 490 ? 0.2494 0.2237 0.3087 0.0032  0.0254  -0.0054 491 GLY A C   
3297 O O   . GLY A 490 ? 0.2432 0.2154 0.3055 0.0071  0.0242  -0.0091 491 GLY A O   
3298 N N   . ALA A 491 ? 0.2000 0.1794 0.2718 0.0015  0.0227  -0.0030 492 ALA A N   
3299 C CA  . ALA A 491 ? 0.2752 0.2575 0.3660 0.0042  0.0169  -0.0033 492 ALA A CA  
3300 C C   . ALA A 491 ? 0.1995 0.1911 0.3067 0.0036  0.0181  -0.0033 492 ALA A C   
3301 O O   . ALA A 491 ? 0.2738 0.2680 0.3770 -0.0009 0.0195  -0.0001 492 ALA A O   
3302 C CB  . ALA A 491 ? 0.2102 0.1872 0.2996 0.0015  0.0070  0.0031  492 ALA A CB  
3303 N N   . ILE A 492 ? 0.2570 0.2538 0.3848 0.0081  0.0172  -0.0073 493 ILE A N   
3304 C CA  . ILE A 492 ? 0.2002 0.2065 0.3484 0.0079  0.0164  -0.0068 493 ILE A CA  
3305 C C   . ILE A 492 ? 0.2646 0.2694 0.4315 0.0090  0.0048  -0.0025 493 ILE A C   
3306 O O   . ILE A 492 ? 0.2319 0.2316 0.4049 0.0128  0.0005  -0.0042 493 ILE A O   
3307 C CB  . ILE A 492 ? 0.2555 0.2722 0.4169 0.0121  0.0260  -0.0161 493 ILE A CB  
3308 C CG1 . ILE A 492 ? 0.2525 0.2800 0.4376 0.0118  0.0248  -0.0151 493 ILE A CG1 
3309 C CG2 . ILE A 492 ? 0.2058 0.2206 0.3764 0.0186  0.0262  -0.0242 493 ILE A CG2 
3310 C CD1 . ILE A 492 ? 0.3128 0.3538 0.5086 0.0138  0.0362  -0.0235 493 ILE A CD1 
3311 N N   . PHE A 493 ? 0.1995 0.2088 0.3759 0.0051  -0.0010 0.0038  494 PHE A N   
3312 C CA  . PHE A 493 ? 0.2412 0.2511 0.4375 0.0049  -0.0130 0.0098  494 PHE A CA  
3313 C C   . PHE A 493 ? 0.2730 0.2942 0.4969 0.0077  -0.0116 0.0069  494 PHE A C   
3314 O O   . PHE A 493 ? 0.2481 0.2764 0.4712 0.0043  -0.0073 0.0075  494 PHE A O   
3315 C CB  . PHE A 493 ? 0.2433 0.2503 0.4267 -0.0032 -0.0222 0.0201  494 PHE A CB  
3316 C CG  . PHE A 493 ? 0.2345 0.2321 0.3929 -0.0059 -0.0231 0.0222  494 PHE A CG  
3317 C CD1 . PHE A 493 ? 0.2047 0.1973 0.3649 -0.0068 -0.0327 0.0279  494 PHE A CD1 
3318 C CD2 . PHE A 493 ? 0.2265 0.2209 0.3621 -0.0075 -0.0145 0.0187  494 PHE A CD2 
3319 C CE1 . PHE A 493 ? 0.2782 0.2638 0.4166 -0.0094 -0.0329 0.0295  494 PHE A CE1 
3320 C CE2 . PHE A 493 ? 0.2645 0.2514 0.3798 -0.0096 -0.0150 0.0199  494 PHE A CE2 
3321 C CZ  . PHE A 493 ? 0.2360 0.2191 0.3525 -0.0105 -0.0238 0.0250  494 PHE A CZ  
3322 N N   . ALA A 494 ? 0.2030 0.2261 0.4530 0.0138  -0.0151 0.0033  495 ALA A N   
3323 C CA  . ALA A 494 ? 0.3005 0.3354 0.5806 0.0181  -0.0121 -0.0023 495 ALA A CA  
3324 C C   . ALA A 494 ? 0.2619 0.2952 0.5712 0.0249  -0.0192 -0.0054 495 ALA A C   
3325 O O   . ALA A 494 ? 0.2670 0.2904 0.5696 0.0271  -0.0222 -0.0065 495 ALA A O   
3326 C CB  . ALA A 494 ? 0.2032 0.2460 0.4773 0.0208  0.0041  -0.0139 495 ALA A CB  
3327 N N   . LYS A 495 ? 0.2529 0.2958 0.5963 0.0281  -0.0222 -0.0070 496 LYS A N   
3328 C CA  . LYS A 495 ? 0.3435 0.3865 0.7219 0.0360  -0.0275 -0.0127 496 LYS A CA  
3329 C C   . LYS A 495 ? 0.3293 0.3842 0.7249 0.0432  -0.0129 -0.0301 496 LYS A C   
3330 O O   . LYS A 495 ? 0.2876 0.3412 0.7006 0.0505  -0.0110 -0.0412 496 LYS A O   
3331 C CB  . LYS A 495 ? 0.4122 0.4583 0.8223 0.0348  -0.0429 -0.0020 496 LYS A CB  
3332 C CG  . LYS A 495 ? 0.5543 0.5909 0.9492 0.0266  -0.0586 0.0157  496 LYS A CG  
3333 C CD  . LYS A 495 ? 0.5888 0.6294 1.0151 0.0244  -0.0751 0.0276  496 LYS A CD  
3334 C CE  . LYS A 495 ? 0.6168 0.6568 1.0203 0.0128  -0.0845 0.0432  496 LYS A CE  
3335 N NZ  . LYS A 495 ? 0.6745 0.7107 1.0919 0.0077  -0.1050 0.0594  496 LYS A NZ  
3336 N N   . ASP A 496 ? 0.3160 0.3832 0.7065 0.0405  -0.0025 -0.0326 497 ASP A N   
3337 C CA  . ASP A 496 ? 0.2936 0.3762 0.6998 0.0453  0.0123  -0.0480 497 ASP A CA  
3338 C C   . ASP A 496 ? 0.2542 0.3352 0.6377 0.0475  0.0252  -0.0603 497 ASP A C   
3339 O O   . ASP A 496 ? 0.2818 0.3593 0.6302 0.0420  0.0312  -0.0570 497 ASP A O   
3340 C CB  . ASP A 496 ? 0.3558 0.4512 0.7574 0.0397  0.0193  -0.0446 497 ASP A CB  
3341 C CG  . ASP A 496 ? 0.4034 0.5179 0.8241 0.0436  0.0343  -0.0592 497 ASP A CG  
3342 O OD1 . ASP A 496 ? 0.3442 0.4622 0.7541 0.0463  0.0466  -0.0720 497 ASP A OD1 
3343 O OD2 . ASP A 496 ? 0.5257 0.6529 0.9724 0.0433  0.0336  -0.0578 497 ASP A OD2 
3344 N N   . ARG A 497 ? 0.2365 0.3208 0.6416 0.0553  0.0292  -0.0750 498 ARG A N   
3345 C CA  . ARG A 497 ? 0.2763 0.3587 0.6610 0.0573  0.0398  -0.0876 498 ARG A CA  
3346 C C   . ARG A 497 ? 0.2969 0.3936 0.6608 0.0535  0.0573  -0.0951 498 ARG A C   
3347 O O   . ARG A 497 ? 0.2903 0.3834 0.6244 0.0512  0.0641  -0.0986 498 ARG A O   
3348 C CB  . ARG A 497 ? 0.3168 0.4010 0.7330 0.0664  0.0403  -0.1039 498 ARG A CB  
3349 C CG  . ARG A 497 ? 0.2352 0.3014 0.6592 0.0696  0.0256  -0.0992 498 ARG A CG  
3350 C CD  . ARG A 497 ? 0.3975 0.4507 0.7819 0.0658  0.0266  -0.0962 498 ARG A CD  
3351 N NE  . ARG A 497 ? 0.3189 0.3567 0.6941 0.0618  0.0111  -0.0782 498 ARG A NE  
3352 C CZ  . ARG A 497 ? 0.3195 0.3438 0.6665 0.0587  0.0073  -0.0722 498 ARG A CZ  
3353 N NH1 . ARG A 497 ? 0.2491 0.2722 0.5736 0.0591  0.0170  -0.0821 498 ARG A NH1 
3354 N NH2 . ARG A 497 ? 0.3218 0.3351 0.6636 0.0544  -0.0064 -0.0559 498 ARG A NH2 
3355 N N   . LYS A 498 ? 0.3214 0.4353 0.7029 0.0525  0.0640  -0.0973 499 LYS A N   
3356 C CA  . LYS A 498 ? 0.3922 0.5219 0.7564 0.0477  0.0802  -0.1028 499 LYS A CA  
3357 C C   . LYS A 498 ? 0.3350 0.4557 0.6603 0.0389  0.0790  -0.0880 499 LYS A C   
3358 O O   . LYS A 498 ? 0.3882 0.5100 0.6847 0.0350  0.0880  -0.0904 499 LYS A O   
3359 C CB  . LYS A 498 ? 0.2313 0.3818 0.6253 0.0480  0.0865  -0.1067 499 LYS A CB  
3360 N N   . ALA A 499 ? 0.2692 0.3808 0.5947 0.0357  0.0671  -0.0730 500 ALA A N   
3361 C CA  . ALA A 499 ? 0.2629 0.3648 0.5554 0.0279  0.0647  -0.0600 500 ALA A CA  
3362 C C   . ALA A 499 ? 0.2961 0.3818 0.5606 0.0280  0.0620  -0.0589 500 ALA A C   
3363 O O   . ALA A 499 ? 0.2895 0.3724 0.5248 0.0230  0.0675  -0.0559 500 ALA A O   
3364 C CB  . ALA A 499 ? 0.2240 0.3203 0.5243 0.0246  0.0522  -0.0465 500 ALA A CB  
3365 N N   . ILE A 500 ? 0.3222 0.3978 0.5974 0.0334  0.0532  -0.0610 501 ILE A N   
3366 C CA  . ILE A 500 ? 0.3008 0.3619 0.5523 0.0337  0.0504  -0.0604 501 ILE A CA  
3367 C C   . ILE A 500 ? 0.3297 0.3968 0.5649 0.0340  0.0633  -0.0717 501 ILE A C   
3368 O O   . ILE A 500 ? 0.3119 0.3723 0.5173 0.0298  0.0654  -0.0676 501 ILE A O   
3369 C CB  . ILE A 500 ? 0.2846 0.3349 0.5535 0.0394  0.0390  -0.0615 501 ILE A CB  
3370 C CG1 . ILE A 500 ? 0.2435 0.2848 0.5175 0.0364  0.0243  -0.0466 501 ILE A CG1 
3371 C CG2 . ILE A 500 ? 0.2374 0.2763 0.4841 0.0401  0.0393  -0.0646 501 ILE A CG2 
3372 C CD1 . ILE A 500 ? 0.2236 0.2577 0.5230 0.0413  0.0120  -0.0457 501 ILE A CD1 
3373 N N   . GLU A 501 ? 0.3114 0.3922 0.5666 0.0385  0.0718  -0.0862 502 GLU A N   
3374 C CA  . GLU A 501 ? 0.3857 0.4749 0.6252 0.0379  0.0845  -0.0985 502 GLU A CA  
3375 C C   . GLU A 501 ? 0.3429 0.4408 0.5567 0.0297  0.0940  -0.0928 502 GLU A C   
3376 O O   . GLU A 501 ? 0.3670 0.4626 0.5534 0.0260  0.0985  -0.0931 502 GLU A O   
3377 C CB  . GLU A 501 ? 0.4601 0.5652 0.7283 0.0439  0.0929  -0.1167 502 GLU A CB  
3378 C CG  . GLU A 501 ? 0.5550 0.6705 0.8072 0.0429  0.1059  -0.1313 502 GLU A CG  
3379 C CD  . GLU A 501 ? 0.6811 0.8182 0.9606 0.0468  0.1177  -0.1502 502 GLU A CD  
3380 O OE1 . GLU A 501 ? 0.7103 0.8560 1.0202 0.0496  0.1169  -0.1501 502 GLU A OE1 
3381 O OE2 . GLU A 501 ? 0.7242 0.8708 0.9953 0.0469  0.1279  -0.1656 502 GLU A OE2 
3382 N N   . TYR A 502 ? 0.3358 0.4437 0.5600 0.0264  0.0962  -0.0871 503 TYR A N   
3383 C CA  . TYR A 502 ? 0.3051 0.4210 0.5086 0.0179  0.1038  -0.0801 503 TYR A CA  
3384 C C   . TYR A 502 ? 0.3426 0.4414 0.5164 0.0129  0.0971  -0.0666 503 TYR A C   
3385 O O   . TYR A 502 ? 0.4059 0.5062 0.5552 0.0075  0.1028  -0.0642 503 TYR A O   
3386 C CB  . TYR A 502 ? 0.2990 0.4265 0.5220 0.0153  0.1050  -0.0750 503 TYR A CB  
3387 C CG  . TYR A 502 ? 0.3698 0.5061 0.5748 0.0061  0.1125  -0.0673 503 TYR A CG  
3388 C CD1 . TYR A 502 ? 0.3829 0.5062 0.5694 0.0003  0.1056  -0.0526 503 TYR A CD1 
3389 C CD2 . TYR A 502 ? 0.3868 0.5447 0.5938 0.0026  0.1263  -0.0747 503 TYR A CD2 
3390 C CE1 . TYR A 502 ? 0.3620 0.4919 0.5344 -0.0083 0.1112  -0.0448 503 TYR A CE1 
3391 C CE2 . TYR A 502 ? 0.4307 0.5965 0.6216 -0.0069 0.1322  -0.0658 503 TYR A CE2 
3392 C CZ  . TYR A 502 ? 0.4196 0.5705 0.5942 -0.0121 0.1241  -0.0504 503 TYR A CZ  
3393 O OH  . TYR A 502 ? 0.5587 0.7161 0.7198 -0.0217 0.1287  -0.0408 503 TYR A OH  
3394 N N   . ALA A 503 ? 0.3355 0.4193 0.5126 0.0144  0.0848  -0.0577 504 ALA A N   
3395 C CA  . ALA A 503 ? 0.3253 0.3933 0.4775 0.0105  0.0782  -0.0467 504 ALA A CA  
3396 C C   . ALA A 503 ? 0.3805 0.4397 0.5138 0.0123  0.0784  -0.0509 504 ALA A C   
3397 O O   . ALA A 503 ? 0.3981 0.4522 0.5075 0.0077  0.0799  -0.0455 504 ALA A O   
3398 C CB  . ALA A 503 ? 0.2869 0.3430 0.4476 0.0114  0.0655  -0.0384 504 ALA A CB  
3399 N N   . ASP A 504 ? 0.3717 0.4288 0.5176 0.0188  0.0762  -0.0602 505 ASP A N   
3400 C CA  . ASP A 504 ? 0.4525 0.5022 0.5834 0.0207  0.0762  -0.0656 505 ASP A CA  
3401 C C   . ASP A 504 ? 0.4487 0.5080 0.5590 0.0160  0.0870  -0.0693 505 ASP A C   
3402 O O   . ASP A 504 ? 0.4996 0.5508 0.5865 0.0128  0.0857  -0.0644 505 ASP A O   
3403 C CB  . ASP A 504 ? 0.5577 0.6077 0.7106 0.0283  0.0743  -0.0778 505 ASP A CB  
3404 C CG  . ASP A 504 ? 0.6397 0.6760 0.7813 0.0307  0.0685  -0.0799 505 ASP A CG  
3405 O OD1 . ASP A 504 ? 0.5399 0.5677 0.6561 0.0267  0.0669  -0.0726 505 ASP A OD1 
3406 O OD2 . ASP A 504 ? 0.6712 0.7051 0.8316 0.0367  0.0652  -0.0890 505 ASP A OD2 
3407 N N   . GLU A 505 ? 0.4506 0.5280 0.5696 0.0148  0.0975  -0.0771 506 GLU A N   
3408 C CA  . GLU A 505 ? 0.4526 0.5421 0.5516 0.0089  0.1081  -0.0804 506 GLU A CA  
3409 C C   . GLU A 505 ? 0.4487 0.5386 0.5288 0.0002  0.1092  -0.0660 506 GLU A C   
3410 O O   . GLU A 505 ? 0.5235 0.6117 0.5797 -0.0050 0.1107  -0.0619 506 GLU A O   
3411 C CB  . GLU A 505 ? 0.5139 0.6253 0.6283 0.0098  0.1201  -0.0951 506 GLU A CB  
3412 N N   . LYS A 506 ? 0.4025 0.4947 0.4945 -0.0018 0.1078  -0.0582 507 LYS A N   
3413 C CA  . LYS A 506 ? 0.3948 0.4864 0.4727 -0.0100 0.1079  -0.0448 507 LYS A CA  
3414 C C   . LYS A 506 ? 0.4028 0.4748 0.4628 -0.0112 0.0986  -0.0344 507 LYS A C   
3415 O O   . LYS A 506 ? 0.3760 0.4460 0.4195 -0.0178 0.0989  -0.0252 507 LYS A O   
3416 C CB  . LYS A 506 ? 0.3756 0.4721 0.4719 -0.0116 0.1068  -0.0391 507 LYS A CB  
3417 C CG  . LYS A 506 ? 0.4244 0.5271 0.5108 -0.0210 0.1105  -0.0284 507 LYS A CG  
3418 C CD  . LYS A 506 ? 0.4030 0.5293 0.4910 -0.0257 0.1236  -0.0341 507 LYS A CD  
3419 N N   . LEU A 507 ? 0.3778 0.4357 0.4428 -0.0052 0.0900  -0.0356 508 LEU A N   
3420 C CA  . LEU A 507 ? 0.3734 0.4142 0.4242 -0.0060 0.0816  -0.0269 508 LEU A CA  
3421 C C   . LEU A 507 ? 0.4297 0.4639 0.4656 -0.0040 0.0805  -0.0309 508 LEU A C   
3422 O O   . LEU A 507 ? 0.4626 0.4828 0.4905 -0.0028 0.0732  -0.0263 508 LEU A O   
3423 C CB  . LEU A 507 ? 0.2748 0.3052 0.3381 -0.0024 0.0723  -0.0240 508 LEU A CB  
3424 C CG  . LEU A 507 ? 0.3566 0.3931 0.4356 -0.0046 0.0718  -0.0201 508 LEU A CG  
3425 C CD1 . LEU A 507 ? 0.2953 0.3234 0.3862 -0.0015 0.0621  -0.0180 508 LEU A CD1 
3426 C CD2 . LEU A 507 ? 0.3575 0.3932 0.4261 -0.0117 0.0730  -0.0108 508 LEU A CD2 
3427 N N   . LYS A 508 ? 0.4539 0.4991 0.4863 -0.0039 0.0879  -0.0401 509 LYS A N   
3428 C CA  . LYS A 508 ? 0.4830 0.5226 0.5025 -0.0019 0.0865  -0.0454 509 LYS A CA  
3429 C C   . LYS A 508 ? 0.4430 0.4731 0.4407 -0.0066 0.0825  -0.0351 509 LYS A C   
3430 O O   . LYS A 508 ? 0.3739 0.3933 0.3641 -0.0042 0.0770  -0.0357 509 LYS A O   
3431 C CB  . LYS A 508 ? 0.5146 0.5693 0.5336 -0.0018 0.0957  -0.0588 509 LYS A CB  
3432 C CG  . LYS A 508 ? 0.4893 0.5571 0.4898 -0.0101 0.1037  -0.0565 509 LYS A CG  
3433 C CD  . LYS A 508 ? 0.4868 0.5698 0.4850 -0.0101 0.1126  -0.0721 509 LYS A CD  
3434 N N   . PHE A 509 ? 0.5019 0.5354 0.4918 -0.0134 0.0844  -0.0252 510 PHE A N   
3435 C CA  . PHE A 509 ? 0.4918 0.5156 0.4652 -0.0177 0.0795  -0.0145 510 PHE A CA  
3436 C C   . PHE A 509 ? 0.5404 0.5507 0.5192 -0.0170 0.0719  -0.0055 510 PHE A C   
3437 O O   . PHE A 509 ? 0.5634 0.5654 0.5329 -0.0201 0.0676  0.0030  510 PHE A O   
3438 C CB  . PHE A 509 ? 0.5063 0.5411 0.4677 -0.0264 0.0847  -0.0078 510 PHE A CB  
3439 C CG  . PHE A 509 ? 0.5763 0.6250 0.5267 -0.0290 0.0919  -0.0159 510 PHE A CG  
3440 C CD1 . PHE A 509 ? 0.5814 0.6259 0.5160 -0.0296 0.0890  -0.0172 510 PHE A CD1 
3441 C CD2 . PHE A 509 ? 0.5885 0.6559 0.5447 -0.0313 0.1017  -0.0230 510 PHE A CD2 
3442 C CE1 . PHE A 509 ? 0.5924 0.6507 0.5157 -0.0328 0.0955  -0.0257 510 PHE A CE1 
3443 C CE2 . PHE A 509 ? 0.6645 0.7466 0.6100 -0.0343 0.1093  -0.0323 510 PHE A CE2 
3444 C CZ  . PHE A 509 ? 0.6331 0.7105 0.5613 -0.0352 0.1061  -0.0339 510 PHE A CZ  
3445 N N   . SER A 510 ? 0.4823 0.4909 0.4768 -0.0133 0.0701  -0.0078 511 SER A N   
3446 C CA  . SER A 510 ? 0.4184 0.4172 0.4178 -0.0140 0.0642  -0.0007 511 SER A CA  
3447 C C   . SER A 510 ? 0.4752 0.4616 0.4750 -0.0094 0.0569  -0.0019 511 SER A C   
3448 O O   . SER A 510 ? 0.5417 0.5207 0.5444 -0.0101 0.0522  0.0023  511 SER A O   
3449 C CB  . SER A 510 ? 0.4355 0.4410 0.4511 -0.0143 0.0657  -0.0012 511 SER A CB  
3450 O OG  . SER A 510 ? 0.5735 0.5921 0.5901 -0.0191 0.0729  0.0001  511 SER A OG  
3451 N N   . ALA A 511 ? 0.3926 0.3776 0.3899 -0.0053 0.0562  -0.0081 512 ALA A N   
3452 C CA  . ALA A 511 ? 0.4135 0.3880 0.4108 -0.0018 0.0494  -0.0087 512 ALA A CA  
3453 C C   . ALA A 511 ? 0.4277 0.4018 0.4204 0.0015  0.0496  -0.0152 512 ALA A C   
3454 O O   . ALA A 511 ? 0.3969 0.3795 0.3935 0.0029  0.0544  -0.0225 512 ALA A O   
3455 C CB  . ALA A 511 ? 0.4353 0.4092 0.4472 0.0005  0.0457  -0.0097 512 ALA A CB  
3456 N N   . GLY A 512 ? 0.4196 0.3844 0.4048 0.0025  0.0445  -0.0134 513 GLY A N   
3457 C CA  . GLY A 512 ? 0.4069 0.3702 0.3878 0.0051  0.0435  -0.0193 513 GLY A CA  
3458 C C   . GLY A 512 ? 0.4454 0.4066 0.4401 0.0097  0.0399  -0.0247 513 GLY A C   
3459 O O   . GLY A 512 ? 0.4982 0.4609 0.4961 0.0126  0.0404  -0.0326 513 GLY A O   
3460 N N   . ASN A 513 ? 0.3709 0.3288 0.3744 0.0099  0.0356  -0.0202 514 ASN A N   
3461 C CA  . ASN A 513 ? 0.3951 0.3516 0.4138 0.0132  0.0308  -0.0228 514 ASN A CA  
3462 C C   . ASN A 513 ? 0.4123 0.3747 0.4444 0.0128  0.0314  -0.0214 514 ASN A C   
3463 O O   . ASN A 513 ? 0.4147 0.3764 0.4445 0.0096  0.0303  -0.0152 514 ASN A O   
3464 C CB  . ASN A 513 ? 0.4562 0.4041 0.4728 0.0127  0.0232  -0.0175 514 ASN A CB  
3465 C CG  . ASN A 513 ? 0.5337 0.4761 0.5407 0.0135  0.0217  -0.0192 514 ASN A CG  
3466 O OD1 . ASN A 513 ? 0.5554 0.4955 0.5689 0.0163  0.0187  -0.0238 514 ASN A OD1 
3467 N ND2 . ASN A 513 ? 0.5300 0.4702 0.5233 0.0111  0.0231  -0.0156 514 ASN A ND2 
3468 N N   . PHE A 514 ? 0.3132 0.2815 0.3605 0.0161  0.0331  -0.0281 515 PHE A N   
3469 C CA  . PHE A 514 ? 0.3355 0.3108 0.3981 0.0160  0.0338  -0.0273 515 PHE A CA  
3470 C C   . PHE A 514 ? 0.3490 0.3213 0.4302 0.0190  0.0255  -0.0270 515 PHE A C   
3471 O O   . PHE A 514 ? 0.3966 0.3662 0.4853 0.0228  0.0233  -0.0326 515 PHE A O   
3472 C CB  . PHE A 514 ? 0.2769 0.2639 0.3454 0.0172  0.0429  -0.0354 515 PHE A CB  
3473 C CG  . PHE A 514 ? 0.3365 0.3322 0.4209 0.0166  0.0445  -0.0344 515 PHE A CG  
3474 C CD1 . PHE A 514 ? 0.3073 0.3045 0.3856 0.0117  0.0454  -0.0267 515 PHE A CD1 
3475 C CD2 . PHE A 514 ? 0.3042 0.3069 0.4118 0.0210  0.0449  -0.0416 515 PHE A CD2 
3476 C CE1 . PHE A 514 ? 0.2711 0.2768 0.3646 0.0108  0.0466  -0.0256 515 PHE A CE1 
3477 C CE2 . PHE A 514 ? 0.3113 0.3230 0.4356 0.0205  0.0461  -0.0404 515 PHE A CE2 
3478 C CZ  . PHE A 514 ? 0.3193 0.3328 0.4359 0.0151  0.0469  -0.0322 515 PHE A CZ  
3479 N N   . TYR A 515 ? 0.2830 0.2558 0.3720 0.0167  0.0202  -0.0200 516 TYR A N   
3480 C CA  . TYR A 515 ? 0.2760 0.2459 0.3819 0.0180  0.0106  -0.0168 516 TYR A CA  
3481 C C   . TYR A 515 ? 0.2935 0.2716 0.4214 0.0191  0.0095  -0.0171 516 TYR A C   
3482 O O   . TYR A 515 ? 0.3147 0.2993 0.4411 0.0163  0.0137  -0.0154 516 TYR A O   
3483 C CB  . TYR A 515 ? 0.2949 0.2587 0.3902 0.0130  0.0030  -0.0068 516 TYR A CB  
3484 C CG  . TYR A 515 ? 0.3227 0.2791 0.3999 0.0122  0.0033  -0.0064 516 TYR A CG  
3485 C CD1 . TYR A 515 ? 0.2963 0.2518 0.3546 0.0100  0.0095  -0.0065 516 TYR A CD1 
3486 C CD2 . TYR A 515 ? 0.3211 0.2714 0.4021 0.0135  -0.0033 -0.0054 516 TYR A CD2 
3487 C CE1 . TYR A 515 ? 0.3239 0.2732 0.3682 0.0095  0.0092  -0.0060 516 TYR A CE1 
3488 C CE2 . TYR A 515 ? 0.2943 0.2387 0.3603 0.0126  -0.0032 -0.0049 516 TYR A CE2 
3489 C CZ  . TYR A 515 ? 0.3197 0.2640 0.3677 0.0108  0.0031  -0.0054 516 TYR A CZ  
3490 O OH  . TYR A 515 ? 0.4344 0.3733 0.4700 0.0101  0.0026  -0.0047 516 TYR A OH  
3491 N N   . ILE A 516 ? 0.2991 0.2768 0.4496 0.0230  0.0033  -0.0189 517 ILE A N   
3492 C CA  . ILE A 516 ? 0.2488 0.2342 0.4245 0.0245  0.0007  -0.0188 517 ILE A CA  
3493 C C   . ILE A 516 ? 0.2799 0.2608 0.4657 0.0215  -0.0131 -0.0075 517 ILE A C   
3494 O O   . ILE A 516 ? 0.2114 0.1854 0.4050 0.0231  -0.0209 -0.0058 517 ILE A O   
3495 C CB  . ILE A 516 ? 0.2983 0.2889 0.4969 0.0317  0.0050  -0.0314 517 ILE A CB  
3496 C CG1 . ILE A 516 ? 0.2659 0.2640 0.4515 0.0327  0.0193  -0.0419 517 ILE A CG1 
3497 C CG2 . ILE A 516 ? 0.2699 0.2683 0.5002 0.0340  0.0006  -0.0310 517 ILE A CG2 
3498 C CD1 . ILE A 516 ? 0.2360 0.2391 0.4383 0.0393  0.0249  -0.0572 517 ILE A CD1 
3499 N N   . ASN A 517 ? 0.2062 0.1913 0.3910 0.0163  -0.0165 0.0005  518 ASN A N   
3500 C CA  . ASN A 517 ? 0.2574 0.2404 0.4487 0.0115  -0.0298 0.0124  518 ASN A CA  
3501 C C   . ASN A 517 ? 0.2724 0.2468 0.4451 0.0076  -0.0352 0.0186  518 ASN A C   
3502 O O   . ASN A 517 ? 0.2648 0.2358 0.4467 0.0055  -0.0465 0.0265  518 ASN A O   
3503 C CB  . ASN A 517 ? 0.2393 0.2243 0.4646 0.0156  -0.0386 0.0133  518 ASN A CB  
3504 C CG  . ASN A 517 ? 0.2772 0.2730 0.5230 0.0184  -0.0343 0.0085  518 ASN A CG  
3505 O OD1 . ASN A 517 ? 0.2634 0.2649 0.4994 0.0140  -0.0306 0.0110  518 ASN A OD1 
3506 N ND2 . ASN A 517 ? 0.2126 0.2114 0.4880 0.0257  -0.0344 0.0009  518 ASN A ND2 
3507 N N   . ASP A 518 ? 0.2359 0.2073 0.3836 0.0064  -0.0270 0.0152  519 ASP A N   
3508 C CA  . ASP A 518 ? 0.3203 0.2853 0.4496 0.0023  -0.0304 0.0203  519 ASP A CA  
3509 C C   . ASP A 518 ? 0.3212 0.2871 0.4264 -0.0019 -0.0233 0.0197  519 ASP A C   
3510 O O   . ASP A 518 ? 0.3388 0.3073 0.4399 0.0002  -0.0142 0.0136  519 ASP A O   
3511 C CB  . ASP A 518 ? 0.3658 0.3241 0.4948 0.0075  -0.0285 0.0144  519 ASP A CB  
3512 C CG  . ASP A 518 ? 0.4727 0.4250 0.5942 0.0036  -0.0364 0.0217  519 ASP A CG  
3513 O OD1 . ASP A 518 ? 0.4911 0.4454 0.6087 -0.0033 -0.0438 0.0317  519 ASP A OD1 
3514 O OD2 . ASP A 518 ? 0.5486 0.4949 0.6678 0.0069  -0.0352 0.0175  519 ASP A OD2 
3515 N N   . LYS A 519 ? 0.3100 0.2746 0.4007 -0.0082 -0.0274 0.0260  520 LYS A N   
3516 C CA  . LYS A 519 ? 0.2664 0.2311 0.3366 -0.0117 -0.0209 0.0240  520 LYS A CA  
3517 C C   . LYS A 519 ? 0.3222 0.2820 0.3828 -0.0069 -0.0122 0.0170  520 LYS A C   
3518 O O   . LYS A 519 ? 0.2365 0.1921 0.3005 -0.0028 -0.0128 0.0148  520 LYS A O   
3519 C CB  . LYS A 519 ? 0.2845 0.2499 0.3417 -0.0191 -0.0261 0.0301  520 LYS A CB  
3520 C CG  . LYS A 519 ? 0.3614 0.3226 0.4154 -0.0193 -0.0302 0.0332  520 LYS A CG  
3521 C CD  . LYS A 519 ? 0.4108 0.3761 0.4521 -0.0282 -0.0349 0.0395  520 LYS A CD  
3522 C CE  . LYS A 519 ? 0.4104 0.3726 0.4462 -0.0293 -0.0373 0.0423  520 LYS A CE  
3523 N NZ  . LYS A 519 ? 0.5277 0.4872 0.5801 -0.0279 -0.0466 0.0486  520 LYS A NZ  
3524 N N   . CYS A 520 ? 0.3382 0.2986 0.3880 -0.0077 -0.0049 0.0137  521 CYS A N   
3525 C CA  . CYS A 520 ? 0.3482 0.3049 0.3895 -0.0039 0.0026  0.0084  521 CYS A CA  
3526 C C   . CYS A 520 ? 0.3538 0.3051 0.3820 -0.0049 0.0020  0.0090  521 CYS A C   
3527 O O   . CYS A 520 ? 0.3803 0.3283 0.4007 -0.0026 0.0068  0.0058  521 CYS A O   
3528 C CB  . CYS A 520 ? 0.3266 0.2855 0.3633 -0.0050 0.0094  0.0063  521 CYS A CB  
3529 S SG  . CYS A 520 ? 0.3989 0.3572 0.4248 -0.0113 0.0086  0.0086  521 CYS A SG  
3530 N N   . THR A 521 ? 0.3969 0.3486 0.4229 -0.0090 -0.0041 0.0136  522 THR A N   
3531 C CA  . THR A 521 ? 0.4897 0.4379 0.5062 -0.0101 -0.0051 0.0145  522 THR A CA  
3532 C C   . THR A 521 ? 0.5490 0.4941 0.5734 -0.0077 -0.0108 0.0165  522 THR A C   
3533 O O   . THR A 521 ? 0.6291 0.5713 0.6480 -0.0081 -0.0121 0.0175  522 THR A O   
3534 C CB  . THR A 521 ? 0.4123 0.3644 0.4209 -0.0170 -0.0078 0.0180  522 THR A CB  
3535 O OG1 . THR A 521 ? 0.3974 0.3539 0.4130 -0.0212 -0.0154 0.0241  522 THR A OG1 
3536 C CG2 . THR A 521 ? 0.3496 0.3037 0.3518 -0.0192 -0.0026 0.0145  522 THR A CG2 
3537 N N   . GLY A 522 ? 0.5494 0.4955 0.5889 -0.0053 -0.0143 0.0170  523 GLY A N   
3538 C CA  . GLY A 522 ? 0.5970 0.5394 0.6482 -0.0026 -0.0203 0.0180  523 GLY A CA  
3539 C C   . GLY A 522 ? 0.7216 0.6645 0.7746 -0.0083 -0.0298 0.0272  523 GLY A C   
3540 O O   . GLY A 522 ? 0.8060 0.7446 0.8670 -0.0073 -0.0357 0.0295  523 GLY A O   
3541 N N   . ASN A 546 ? 0.8013 0.7086 0.7387 0.0087  -0.0118 -0.0407 547 ASN A N   
3542 C CA  . ASN A 546 ? 0.7723 0.6869 0.6946 0.0059  -0.0067 -0.0420 547 ASN A CA  
3543 C C   . ASN A 546 ? 0.7378 0.6534 0.6525 0.0031  -0.0070 -0.0299 547 ASN A C   
3544 O O   . ASN A 546 ? 0.7528 0.6729 0.6542 -0.0007 -0.0063 -0.0276 547 ASN A O   
3545 C CB  . ASN A 546 ? 0.8148 0.7357 0.7397 0.0075  0.0011  -0.0482 547 ASN A CB  
3546 N N   . ILE A 547 ? 0.6131 0.5248 0.5370 0.0047  -0.0083 -0.0223 548 ILE A N   
3547 C CA  . ILE A 547 ? 0.5014 0.4128 0.4228 0.0029  -0.0096 -0.0122 548 ILE A CA  
3548 C C   . ILE A 547 ? 0.4793 0.3881 0.3981 0.0011  -0.0165 -0.0093 548 ILE A C   
3549 O O   . ILE A 547 ? 0.5343 0.4439 0.4489 -0.0011 -0.0188 -0.0022 548 ILE A O   
3550 C CB  . ILE A 547 ? 0.5715 0.4810 0.5039 0.0048  -0.0084 -0.0073 548 ILE A CB  
3551 C CG1 . ILE A 547 ? 0.6896 0.6007 0.6202 0.0034  -0.0061 -0.0001 548 ILE A CG1 
3552 C CG2 . ILE A 547 ? 0.5450 0.4508 0.4858 0.0054  -0.0135 -0.0051 548 ILE A CG2 
3553 C CD1 . ILE A 547 ? 0.7733 0.6824 0.7062 0.0024  -0.0106 0.0063  548 ILE A CD1 
3554 N N   . LEU A 548 ? 0.4248 0.3303 0.3477 0.0020  -0.0206 -0.0145 549 LEU A N   
3555 C CA  . LEU A 548 ? 0.4115 0.3149 0.3330 0.0001  -0.0276 -0.0125 549 LEU A CA  
3556 C C   . LEU A 548 ? 0.4073 0.3144 0.3138 -0.0037 -0.0292 -0.0132 549 LEU A C   
3557 O O   . LEU A 548 ? 0.4689 0.3760 0.3724 -0.0063 -0.0345 -0.0069 549 LEU A O   
3558 C CB  . LEU A 548 ? 0.3999 0.2989 0.3290 0.0012  -0.0318 -0.0189 549 LEU A CB  
3559 C CG  . LEU A 548 ? 0.4346 0.3307 0.3782 0.0034  -0.0320 -0.0162 549 LEU A CG  
3560 C CD1 . LEU A 548 ? 0.4401 0.3312 0.3924 0.0039  -0.0373 -0.0217 549 LEU A CD1 
3561 C CD2 . LEU A 548 ? 0.3746 0.2716 0.3230 0.0024  -0.0336 -0.0067 549 LEU A CD2 
3562 N N   . SER A 549 ? 0.4050 0.3163 0.3024 -0.0046 -0.0245 -0.0207 550 SER A N   
3563 C CA  . SER A 549 ? 0.4781 0.3951 0.3589 -0.0097 -0.0255 -0.0220 550 SER A CA  
3564 C C   . SER A 549 ? 0.4959 0.4162 0.3700 -0.0132 -0.0260 -0.0098 550 SER A C   
3565 O O   . SER A 549 ? 0.4837 0.4076 0.3460 -0.0184 -0.0305 -0.0057 550 SER A O   
3566 C CB  . SER A 549 ? 0.5377 0.4608 0.4114 -0.0101 -0.0188 -0.0341 550 SER A CB  
3567 O OG  . SER A 549 ? 0.6506 0.5797 0.5198 -0.0112 -0.0120 -0.0303 550 SER A OG  
3568 N N   . ARG A 550 ? 0.4661 0.3851 0.3488 -0.0107 -0.0223 -0.0035 551 ARG A N   
3569 C CA  . ARG A 550 ? 0.4386 0.3587 0.3197 -0.0134 -0.0240 0.0084  551 ARG A CA  
3570 C C   . ARG A 550 ? 0.4550 0.3711 0.3431 -0.0137 -0.0323 0.0164  551 ARG A C   
3571 O O   . ARG A 550 ? 0.4779 0.3948 0.3654 -0.0166 -0.0362 0.0263  551 ARG A O   
3572 C CB  . ARG A 550 ? 0.4506 0.3697 0.3411 -0.0106 -0.0183 0.0116  551 ARG A CB  
3573 C CG  . ARG A 550 ? 0.5167 0.4406 0.4027 -0.0104 -0.0102 0.0046  551 ARG A CG  
3574 C CD  . ARG A 550 ? 0.6848 0.6149 0.5618 -0.0151 -0.0072 0.0108  551 ARG A CD  
3575 N NE  . ARG A 550 ? 0.8697 0.8058 0.7303 -0.0216 -0.0102 0.0128  551 ARG A NE  
3576 C CZ  . ARG A 550 ? 0.9562 0.8940 0.8113 -0.0270 -0.0149 0.0247  551 ARG A CZ  
3577 N NH1 . ARG A 550 ? 0.9470 0.8916 0.7856 -0.0339 -0.0182 0.0266  551 ARG A NH1 
3578 N NH2 . ARG A 550 ? 0.9341 0.8670 0.8009 -0.0258 -0.0169 0.0347  551 ARG A NH2 
3579 N N   . PHE A 551 ? 0.4427 0.3549 0.3388 -0.0111 -0.0356 0.0125  552 PHE A N   
3580 C CA  . PHE A 551 ? 0.4564 0.3661 0.3616 -0.0112 -0.0428 0.0195  552 PHE A CA  
3581 C C   . PHE A 551 ? 0.4764 0.3866 0.3747 -0.0145 -0.0505 0.0183  552 PHE A C   
3582 O O   . PHE A 551 ? 0.4215 0.3299 0.3291 -0.0144 -0.0569 0.0228  552 PHE A O   
3583 C CB  . PHE A 551 ? 0.3612 0.2677 0.2831 -0.0066 -0.0411 0.0188  552 PHE A CB  
3584 C CG  . PHE A 551 ? 0.3869 0.2935 0.3164 -0.0043 -0.0354 0.0217  552 PHE A CG  
3585 C CD1 . PHE A 551 ? 0.3675 0.2743 0.3035 -0.0047 -0.0372 0.0297  552 PHE A CD1 
3586 C CD2 . PHE A 551 ? 0.4270 0.3333 0.3583 -0.0018 -0.0288 0.0164  552 PHE A CD2 
3587 C CE1 . PHE A 551 ? 0.3682 0.2746 0.3120 -0.0027 -0.0321 0.0311  552 PHE A CE1 
3588 C CE2 . PHE A 551 ? 0.4301 0.3368 0.3679 -0.0003 -0.0239 0.0185  552 PHE A CE2 
3589 C CZ  . PHE A 551 ? 0.3941 0.3007 0.3378 -0.0007 -0.0253 0.0253  552 PHE A CZ  
3590 N N   . VAL A 552 ? 0.3981 0.3115 0.2806 -0.0179 -0.0499 0.0116  553 VAL A N   
3591 C CA  . VAL A 552 ? 0.4142 0.3291 0.2875 -0.0223 -0.0574 0.0096  553 VAL A CA  
3592 C C   . VAL A 552 ? 0.4653 0.3875 0.3184 -0.0289 -0.0573 0.0101  553 VAL A C   
3593 O O   . VAL A 552 ? 0.4615 0.3877 0.3084 -0.0296 -0.0505 0.0104  553 VAL A O   
3594 C CB  . VAL A 552 ? 0.4272 0.3395 0.3014 -0.0207 -0.0573 -0.0033 553 VAL A CB  
3595 C CG1 . VAL A 552 ? 0.4533 0.3593 0.3462 -0.0160 -0.0589 -0.0023 553 VAL A CG1 
3596 C CG2 . VAL A 552 ? 0.3879 0.3024 0.2560 -0.0192 -0.0486 -0.0143 553 VAL A CG2 
3597 N N   . SER A 553 ? 0.4330 0.3579 0.2754 -0.0344 -0.0651 0.0103  554 SER A N   
3598 C CA  . SER A 553 ? 0.5405 0.4744 0.3608 -0.0423 -0.0654 0.0096  554 SER A CA  
3599 C C   . SER A 553 ? 0.5402 0.4762 0.3496 -0.0455 -0.0685 -0.0033 554 SER A C   
3600 O O   . SER A 553 ? 0.5124 0.4432 0.3301 -0.0443 -0.0757 -0.0041 554 SER A O   
3601 C CB  . SER A 553 ? 0.6102 0.5467 0.4270 -0.0481 -0.0742 0.0261  554 SER A CB  
3602 O OG  . SER A 553 ? 0.7090 0.6556 0.5035 -0.0570 -0.0743 0.0280  554 SER A OG  
3603 N N   . ILE A 554 ? 0.5375 0.4818 0.3294 -0.0497 -0.0628 -0.0142 555 ILE A N   
3604 C CA  . ILE A 554 ? 0.4902 0.4373 0.2718 -0.0530 -0.0650 -0.0289 555 ILE A CA  
3605 C C   . ILE A 554 ? 0.5214 0.4751 0.2851 -0.0629 -0.0751 -0.0222 555 ILE A C   
3606 O O   . ILE A 554 ? 0.5639 0.5250 0.3152 -0.0696 -0.0769 -0.0099 555 ILE A O   
3607 C CB  . ILE A 554 ? 0.5999 0.5544 0.3720 -0.0531 -0.0542 -0.0465 555 ILE A CB  
3608 C CG1 . ILE A 554 ? 0.6311 0.5855 0.3995 -0.0543 -0.0565 -0.0646 555 ILE A CG1 
3609 C CG2 . ILE A 554 ? 0.6893 0.6579 0.4392 -0.0617 -0.0498 -0.0430 555 ILE A CG2 
3610 C CD1 . ILE A 554 ? 0.6625 0.6032 0.4536 -0.0466 -0.0609 -0.0684 555 ILE A CD1 
3611 N N   . ARG A 555 ? 0.4904 0.4413 0.2538 -0.0644 -0.0825 -0.0294 556 ARG A N   
3612 C CA  . ARG A 555 ? 0.5390 0.4962 0.2859 -0.0742 -0.0931 -0.0242 556 ARG A CA  
3613 C C   . ARG A 555 ? 0.5793 0.5387 0.3164 -0.0772 -0.0940 -0.0438 556 ARG A C   
3614 O O   . ARG A 555 ? 0.5570 0.5068 0.3103 -0.0712 -0.0957 -0.0528 556 ARG A O   
3615 C CB  . ARG A 555 ? 0.5520 0.5014 0.3149 -0.0727 -0.1048 -0.0088 556 ARG A CB  
3616 C CG  . ARG A 555 ? 0.6693 0.6251 0.4179 -0.0830 -0.1177 0.0009  556 ARG A CG  
3617 C CD  . ARG A 555 ? 0.7474 0.7005 0.4962 -0.0847 -0.1253 -0.0097 556 ARG A CD  
3618 N NE  . ARG A 555 ? 0.7806 0.7368 0.5252 -0.0923 -0.1399 0.0035  556 ARG A NE  
3619 C CZ  . ARG A 555 ? 0.6750 0.6257 0.4311 -0.0919 -0.1498 0.0035  556 ARG A CZ  
3620 N NH1 . ARG A 555 ? 0.6492 0.5909 0.4215 -0.0846 -0.1467 -0.0086 556 ARG A NH1 
3621 N NH2 . ARG A 555 ? 0.6825 0.6370 0.4351 -0.0992 -0.1634 0.0166  556 ARG A NH2 
3622 N N   . ASN A 556 ? 0.5907 0.5633 0.3018 -0.0870 -0.0930 -0.0506 557 ASN A N   
3623 C CA  . ASN A 556 ? 0.5319 0.5085 0.2321 -0.0907 -0.0930 -0.0718 557 ASN A CA  
3624 C C   . ASN A 556 ? 0.6170 0.5976 0.3029 -0.1006 -0.1066 -0.0678 557 ASN A C   
3625 O O   . ASN A 556 ? 0.6565 0.6453 0.3269 -0.1094 -0.1131 -0.0519 557 ASN A O   
3626 C CB  . ASN A 556 ? 0.6192 0.6104 0.2995 -0.0954 -0.0809 -0.0868 557 ASN A CB  
3627 C CG  . ASN A 556 ? 0.7030 0.6918 0.3972 -0.0863 -0.0675 -0.0904 557 ASN A CG  
3628 O OD1 . ASN A 556 ? 0.7119 0.6907 0.4271 -0.0765 -0.0634 -0.1019 557 ASN A OD1 
3629 N ND2 . ASN A 556 ? 0.7216 0.7199 0.4051 -0.0900 -0.0615 -0.0796 557 ASN A ND2 
3630 N N   . THR A 557 ? 0.5567 0.5312 0.2489 -0.0994 -0.1118 -0.0818 558 THR A N   
3631 C CA  . THR A 557 ? 0.5781 0.5570 0.2558 -0.1093 -0.1245 -0.0820 558 THR A CA  
3632 C C   . THR A 557 ? 0.6150 0.6029 0.2751 -0.1145 -0.1192 -0.1077 558 THR A C   
3633 O O   . THR A 557 ? 0.5972 0.5788 0.2705 -0.1070 -0.1117 -0.1269 558 THR A O   
3634 C CB  . THR A 557 ? 0.5657 0.5305 0.2666 -0.1043 -0.1354 -0.0781 558 THR A CB  
3635 O OG1 . THR A 557 ? 0.5485 0.5064 0.2680 -0.0986 -0.1383 -0.0561 558 THR A OG1 
3636 C CG2 . THR A 557 ? 0.5881 0.5573 0.2753 -0.1147 -0.1495 -0.0782 558 THR A CG2 
3637 N N   . LYS A 558 ? 0.6266 0.6300 0.2681 -0.1222 -0.1202 -0.1059 559 LYS A N   
3638 C CA  . LYS A 558 ? 0.6511 0.6638 0.2823 -0.1239 -0.1138 -0.1282 559 LYS A CA  
3639 C C   . LYS A 558 ? 0.6725 0.6892 0.2953 -0.1310 -0.1261 -0.1268 559 LYS A C   
3640 O O   . LYS A 558 ? 0.6810 0.7053 0.2929 -0.1385 -0.1335 -0.1075 559 LYS A O   
3641 C CB  . LYS A 558 ? 0.6653 0.6946 0.2789 -0.1275 -0.1009 -0.1298 559 LYS A CB  
3642 C CG  . LYS A 558 ? 0.6962 0.7364 0.2967 -0.1311 -0.0953 -0.1508 559 LYS A CG  
3643 C CD  . LYS A 558 ? 0.8946 0.9526 0.4781 -0.1361 -0.0822 -0.1513 559 LYS A CD  
3644 C CE  . LYS A 558 ? 0.8374 0.8934 0.4329 -0.1279 -0.0684 -0.1568 559 LYS A CE  
3645 N NZ  . LYS A 558 ? 0.7858 0.8364 0.3950 -0.1196 -0.0600 -0.1838 559 LYS A NZ  
3646 N N   . GLU A 559 ? 0.6820 0.6929 0.3115 -0.1285 -0.1288 -0.1468 560 GLU A N   
3647 C CA  . GLU A 559 ? 0.7035 0.7180 0.3255 -0.1351 -0.1404 -0.1475 560 GLU A CA  
3648 C C   . GLU A 559 ? 0.7359 0.7606 0.3412 -0.1386 -0.1339 -0.1685 560 GLU A C   
3649 O O   . GLU A 559 ? 0.7387 0.7591 0.3503 -0.1326 -0.1242 -0.1898 560 GLU A O   
3650 C CB  . GLU A 559 ? 0.6913 0.6905 0.3351 -0.1310 -0.1514 -0.1517 560 GLU A CB  
3651 C CG  . GLU A 559 ? 0.7151 0.7179 0.3530 -0.1370 -0.1626 -0.1571 560 GLU A CG  
3652 C CD  . GLU A 559 ? 0.7006 0.6914 0.3601 -0.1355 -0.1758 -0.1507 560 GLU A CD  
3653 O OE1 . GLU A 559 ? 0.6730 0.6511 0.3524 -0.1296 -0.1762 -0.1431 560 GLU A OE1 
3654 O OE2 . GLU A 559 ? 0.7181 0.7121 0.3745 -0.1407 -0.1859 -0.1526 560 GLU A OE2 
3655 N N   . ASN A 560 ? 0.7618 0.7995 0.3468 -0.1488 -0.1393 -0.1617 561 ASN A N   
3656 C CA  . ASN A 560 ? 0.7964 0.8447 0.3635 -0.1539 -0.1341 -0.1805 561 ASN A CA  
3657 C C   . ASN A 560 ? 0.8166 0.8627 0.3812 -0.1585 -0.1476 -0.1866 561 ASN A C   
3658 O O   . ASN A 560 ? 0.8115 0.8566 0.3786 -0.1625 -0.1608 -0.1688 561 ASN A O   
3659 C CB  . ASN A 560 ? 0.8152 0.8833 0.3579 -0.1635 -0.1269 -0.1699 561 ASN A CB  
3660 C CG  . ASN A 560 ? 0.8553 0.9371 0.3767 -0.1722 -0.1246 -0.1851 561 ASN A CG  
3661 O OD1 . ASN A 560 ? 0.8762 0.9671 0.3820 -0.1824 -0.1340 -0.1745 561 ASN A OD1 
3662 N ND2 . ASN A 560 ? 0.8672 0.9506 0.3888 -0.1683 -0.1121 -0.2099 561 ASN A ND2 
3663 N N   . PHE A 561 ? 0.8401 0.8850 0.4012 -0.1579 -0.1442 -0.2117 562 PHE A N   
3664 C CA  . PHE A 561 ? 0.8590 0.8990 0.4208 -0.1609 -0.1569 -0.2210 562 PHE A CA  
3665 C C   . PHE A 561 ? 0.9001 0.9565 0.4343 -0.1724 -0.1575 -0.2267 562 PHE A C   
3666 O O   . PHE A 561 ? 0.9168 0.9734 0.4468 -0.1779 -0.1704 -0.2266 562 PHE A O   
3667 C CB  . PHE A 561 ? 0.8562 0.8777 0.4383 -0.1518 -0.1557 -0.2447 562 PHE A CB  
3668 C CG  . PHE A 561 ? 0.8183 0.8237 0.4276 -0.1413 -0.1546 -0.2401 562 PHE A CG  
3669 C CD1 . PHE A 561 ? 0.7929 0.7917 0.4184 -0.1398 -0.1668 -0.2228 562 PHE A CD1 
3670 C CD2 . PHE A 561 ? 0.8085 0.8070 0.4284 -0.1334 -0.1408 -0.2524 562 PHE A CD2 
3671 C CE1 . PHE A 561 ? 0.7595 0.7450 0.4095 -0.1312 -0.1654 -0.2186 562 PHE A CE1 
3672 C CE2 . PHE A 561 ? 0.7753 0.7592 0.4195 -0.1246 -0.1400 -0.2475 562 PHE A CE2 
3673 C CZ  . PHE A 561 ? 0.7514 0.7287 0.4097 -0.1238 -0.1526 -0.2308 562 PHE A CZ  
3674 N N   . TYR A 562 ? 0.9169 0.9883 0.4331 -0.1767 -0.1437 -0.2317 563 TYR A N   
3675 C CA  . TYR A 562 ? 0.9580 1.0474 0.4471 -0.1889 -0.1427 -0.2377 563 TYR A CA  
3676 C C   . TYR A 562 ? 0.9659 1.0682 0.4382 -0.2005 -0.1526 -0.2109 563 TYR A C   
3677 O O   . TYR A 562 ? 0.9453 1.0504 0.4197 -0.2010 -0.1519 -0.1883 563 TYR A O   
3678 C CB  . TYR A 562 ? 0.9737 1.0774 0.4512 -0.1904 -0.1239 -0.2518 563 TYR A CB  
3679 N N   . GLU A 563 ? 0.9971 1.1068 0.4540 -0.2102 -0.1623 -0.2131 564 GLU A N   
3680 C CA  . GLU A 563 ? 1.1389 1.2606 0.5806 -0.2223 -0.1728 -0.1878 564 GLU A CA  
3681 C C   . GLU A 563 ? 1.1056 1.2501 0.5171 -0.2361 -0.1655 -0.1902 564 GLU A C   
3682 O O   . GLU A 563 ? 1.1167 1.2677 0.5148 -0.2406 -0.1632 -0.2118 564 GLU A O   
3683 C CB  . GLU A 563 ? 1.0148 1.1291 0.4626 -0.2245 -0.1911 -0.1844 564 GLU A CB  
3684 C CG  . GLU A 563 ? 1.0093 1.1036 0.4884 -0.2126 -0.1990 -0.1784 564 GLU A CG  
3685 C CD  . GLU A 563 ? 1.0121 1.1001 0.5000 -0.2145 -0.2162 -0.1776 564 GLU A CD  
3686 O OE1 . GLU A 563 ? 1.0441 1.1419 0.5133 -0.2244 -0.2222 -0.1832 564 GLU A OE1 
3687 O OE2 . GLU A 563 ? 1.0050 1.0791 0.5189 -0.2065 -0.2234 -0.1715 564 GLU A OE2 
3688 N N   . LEU A 564 ? 1.0950 1.2516 0.4968 -0.2431 -0.1620 -0.1678 565 LEU A N   
3689 C CA  . LEU A 564 ? 1.1177 1.2978 0.4919 -0.2574 -0.1546 -0.1664 565 LEU A CA  
3690 C C   . LEU A 564 ? 1.1418 1.3332 0.4951 -0.2716 -0.1663 -0.1646 565 LEU A C   
3691 O O   . LEU A 564 ? 1.1517 1.3348 0.5115 -0.2727 -0.1826 -0.1519 565 LEU A O   
3692 C CB  . LEU A 564 ? 1.0927 1.2806 0.4648 -0.2622 -0.1517 -0.1388 565 LEU A CB  
3693 C CG  . LEU A 564 ? 1.0812 1.2623 0.4696 -0.2506 -0.1382 -0.1405 565 LEU A CG  
3694 C CD1 . LEU A 564 ? 1.0108 1.1894 0.4073 -0.2516 -0.1426 -0.1089 565 LEU A CD1 
3695 C CD2 . LEU A 564 ? 1.1079 1.3059 0.4828 -0.2539 -0.1198 -0.1588 565 LEU A CD2 
3696 N N   . ASP B 42  ? 0.8769 1.3396 0.5483 0.2325  0.0437  0.0021  43  ASP B N   
3697 C CA  . ASP B 42  ? 0.9090 1.3353 0.5845 0.2173  0.0440  0.0081  43  ASP B CA  
3698 C C   . ASP B 42  ? 0.9121 1.3320 0.5837 0.2124  0.0482  0.0299  43  ASP B C   
3699 O O   . ASP B 42  ? 0.8956 1.2994 0.5725 0.1999  0.0565  0.0495  43  ASP B O   
3700 C CB  . ASP B 42  ? 0.8960 1.2984 0.5737 0.2168  0.0301  -0.0177 43  ASP B CB  
3701 N N   . TRP B 43  ? 0.8652 1.2975 0.5288 0.2226  0.0420  0.0260  44  TRP B N   
3702 C CA  . TRP B 43  ? 0.8304 1.2619 0.4900 0.2203  0.0459  0.0471  44  TRP B CA  
3703 C C   . TRP B 43  ? 0.8045 1.2615 0.4656 0.2214  0.0591  0.0718  44  TRP B C   
3704 O O   . TRP B 43  ? 0.8084 1.2595 0.4729 0.2137  0.0666  0.0961  44  TRP B O   
3705 C CB  . TRP B 43  ? 0.7867 1.2277 0.4376 0.2322  0.0356  0.0351  44  TRP B CB  
3706 N N   . ASP B 44  ? 0.7266 1.2121 0.3869 0.2311  0.0613  0.0655  45  ASP B N   
3707 C CA  . ASP B 44  ? 0.7486 1.2593 0.4124 0.2317  0.0739  0.0876  45  ASP B CA  
3708 C C   . ASP B 44  ? 0.7206 1.2118 0.3969 0.2154  0.0836  0.1045  45  ASP B C   
3709 O O   . ASP B 44  ? 0.7050 1.2031 0.3879 0.2100  0.0939  0.1306  45  ASP B O   
3710 C CB  . ASP B 44  ? 0.7744 1.3179 0.4355 0.2452  0.0733  0.0741  45  ASP B CB  
3711 N N   . LEU B 45  ? 0.7060 1.1731 0.3869 0.2079  0.0800  0.0894  46  LEU B N   
3712 C CA  . LEU B 45  ? 0.7195 1.1675 0.4128 0.1930  0.0883  0.1023  46  LEU B CA  
3713 C C   . LEU B 45  ? 0.7015 1.1247 0.3998 0.1812  0.0908  0.1214  46  LEU B C   
3714 O O   . LEU B 45  ? 0.6873 1.1052 0.3977 0.1709  0.1003  0.1434  46  LEU B O   
3715 C CB  . LEU B 45  ? 0.6952 1.1230 0.3913 0.1888  0.0826  0.0801  46  LEU B CB  
3716 C CG  . LEU B 45  ? 0.7701 1.2175 0.4681 0.1957  0.0832  0.0658  46  LEU B CG  
3717 C CD1 . LEU B 45  ? 0.7714 1.2384 0.4780 0.1924  0.0967  0.0875  46  LEU B CD1 
3718 C CD2 . LEU B 45  ? 0.8560 1.3279 0.5441 0.2127  0.0743  0.0467  46  LEU B CD2 
3719 N N   . LEU B 46  ? 0.6762 1.0839 0.3667 0.1829  0.0815  0.1122  47  LEU B N   
3720 C CA  . LEU B 46  ? 0.6738 1.0576 0.3684 0.1729  0.0821  0.1280  47  LEU B CA  
3721 C C   . LEU B 46  ? 0.6749 1.0763 0.3716 0.1749  0.0890  0.1532  47  LEU B C   
3722 O O   . LEU B 46  ? 0.6589 1.0487 0.3678 0.1643  0.0959  0.1756  47  LEU B O   
3723 C CB  . LEU B 46  ? 0.6576 1.0233 0.3432 0.1754  0.0699  0.1111  47  LEU B CB  
3724 C CG  . LEU B 46  ? 0.6608 1.0017 0.3507 0.1657  0.0698  0.1265  47  LEU B CG  
3725 C CD1 . LEU B 46  ? 0.5940 0.9104 0.2968 0.1511  0.0753  0.1352  47  LEU B CD1 
3726 C CD2 . LEU B 46  ? 0.7157 1.0418 0.3967 0.1692  0.0576  0.1099  47  LEU B CD2 
3727 N N   . ARG B 47  ? 0.6460 1.0756 0.3321 0.1888  0.0866  0.1492  48  ARG B N   
3728 C CA  . ARG B 47  ? 0.7851 1.2355 0.4718 0.1928  0.0927  0.1723  48  ARG B CA  
3729 C C   . ARG B 47  ? 0.7960 1.2554 0.4975 0.1853  0.1052  0.1956  48  ARG B C   
3730 O O   . ARG B 47  ? 0.6752 1.1306 0.3870 0.1785  0.1109  0.2203  48  ARG B O   
3731 C CB  . ARG B 47  ? 0.7705 1.2552 0.4437 0.2105  0.0890  0.1622  48  ARG B CB  
3732 N N   . ALA B 48  ? 0.6654 1.1358 0.3698 0.1862  0.1087  0.1873  49  ALA B N   
3733 C CA  . ALA B 48  ? 0.7175 1.1984 0.4371 0.1795  0.1202  0.2075  49  ALA B CA  
3734 C C   . ALA B 48  ? 0.6812 1.1300 0.4183 0.1621  0.1241  0.2224  49  ALA B C   
3735 O O   . ALA B 48  ? 0.6592 1.1114 0.4117 0.1553  0.1322  0.2476  49  ALA B O   
3736 C CB  . ALA B 48  ? 0.6660 1.1637 0.3847 0.1843  0.1220  0.1925  49  ALA B CB  
3737 N N   . SER B 49  ? 0.6313 1.0498 0.3674 0.1553  0.1180  0.2067  50  SER B N   
3738 C CA  . SER B 49  ? 0.6159 1.0028 0.3680 0.1397  0.1203  0.2187  50  SER B CA  
3739 C C   . SER B 49  ? 0.6231 0.9990 0.3806 0.1357  0.1197  0.2379  50  SER B C   
3740 O O   . SER B 49  ? 0.7136 1.0802 0.4903 0.1254  0.1255  0.2594  50  SER B O   
3741 C CB  . SER B 49  ? 0.5939 0.9529 0.3420 0.1347  0.1133  0.1974  50  SER B CB  
3742 O OG  . SER B 49  ? 0.7704 1.1329 0.5224 0.1331  0.1163  0.1867  50  SER B OG  
3743 N N   . LEU B 50  ? 0.6296 1.0064 0.3718 0.1439  0.1120  0.2297  51  LEU B N   
3744 C CA  . LEU B 50  ? 0.7008 1.0692 0.4466 0.1418  0.1107  0.2468  51  LEU B CA  
3745 C C   . LEU B 50  ? 0.7375 1.1284 0.4945 0.1426  0.1194  0.2733  51  LEU B C   
3746 O O   . LEU B 50  ? 0.6607 1.0382 0.4344 0.1336  0.1222  0.2941  51  LEU B O   
3747 C CB  . LEU B 50  ? 0.6442 1.0158 0.3707 0.1526  0.1012  0.2322  51  LEU B CB  
3748 C CG  . LEU B 50  ? 0.6536 0.9984 0.3722 0.1503  0.0914  0.2098  51  LEU B CG  
3749 C CD1 . LEU B 50  ? 0.6326 0.9872 0.3326 0.1630  0.0817  0.1912  51  LEU B CD1 
3750 C CD2 . LEU B 50  ? 0.6138 0.9260 0.3443 0.1380  0.0900  0.2210  51  LEU B CD2 
3751 N N   . MET B 51  ? 0.7490 1.1745 0.4983 0.1535  0.1233  0.2725  52  MET B N   
3752 C CA  . MET B 51  ? 0.7920 1.2430 0.5510 0.1556  0.1317  0.2978  52  MET B CA  
3753 C C   . MET B 51  ? 0.7641 1.2078 0.5484 0.1425  0.1403  0.3168  52  MET B C   
3754 O O   . MET B 51  ? 0.7941 1.2398 0.5949 0.1375  0.1450  0.3419  52  MET B O   
3755 C CB  . MET B 51  ? 0.8412 1.3330 0.5861 0.1712  0.1339  0.2916  52  MET B CB  
3756 C CG  . MET B 51  ? 0.8726 1.3785 0.5961 0.1856  0.1262  0.2786  52  MET B CG  
3757 S SD  . MET B 51  ? 1.1774 1.6847 0.9022 0.1870  0.1257  0.3016  52  MET B SD  
3758 C CE  . MET B 51  ? 0.8088 1.3370 0.5552 0.1820  0.1388  0.3362  52  MET B CE  
3759 N N   . LYS B 52  ? 0.7128 1.1483 0.5013 0.1373  0.1418  0.3047  53  LYS B N   
3760 C CA  . LYS B 52  ? 0.6991 1.1262 0.5127 0.1246  0.1491  0.3199  53  LYS B CA  
3761 C C   . LYS B 52  ? 0.7098 1.1072 0.5434 0.1118  0.1480  0.3368  53  LYS B C   
3762 O O   . LYS B 52  ? 0.6771 1.0805 0.5305 0.1071  0.1533  0.3612  53  LYS B O   
3763 C CB  . LYS B 52  ? 0.6473 1.0630 0.4610 0.1201  0.1488  0.3008  53  LYS B CB  
3764 N N   . PHE B 53  ? 0.7423 1.1085 0.5714 0.1070  0.1405  0.3234  54  PHE B N   
3765 C CA  . PHE B 53  ? 0.7233 1.0589 0.5699 0.0960  0.1374  0.3354  54  PHE B CA  
3766 C C   . PHE B 53  ? 0.7271 1.0684 0.5738 0.0999  0.1358  0.3519  54  PHE B C   
3767 O O   . PHE B 53  ? 0.7430 1.0669 0.6109 0.0911  0.1355  0.3688  54  PHE B O   
3768 C CB  . PHE B 53  ? 0.6838 0.9882 0.5221 0.0922  0.1292  0.3158  54  PHE B CB  
3769 C CG  . PHE B 53  ? 0.7525 1.0454 0.5947 0.0860  0.1304  0.3017  54  PHE B CG  
3770 C CD1 . PHE B 53  ? 0.7977 1.0727 0.6662 0.0730  0.1336  0.3118  54  PHE B CD1 
3771 C CD2 . PHE B 53  ? 0.8162 1.1159 0.6371 0.0934  0.1274  0.2778  54  PHE B CD2 
3772 C CE1 . PHE B 53  ? 0.8782 1.1433 0.7504 0.0676  0.1348  0.2989  54  PHE B CE1 
3773 C CE2 . PHE B 53  ? 0.8726 1.1622 0.6972 0.0880  0.1285  0.2650  54  PHE B CE2 
3774 C CZ  . PHE B 53  ? 0.8778 1.1504 0.7273 0.0751  0.1325  0.2760  54  PHE B CZ  
3775 N N   . LYS B 54  ? 0.7629 1.1279 0.5872 0.1134  0.1340  0.3462  55  LYS B N   
3776 C CA  . LYS B 54  ? 0.8129 1.1858 0.6358 0.1183  0.1326  0.3616  55  LYS B CA  
3777 C C   . LYS B 54  ? 0.7553 1.1512 0.5958 0.1177  0.1411  0.3886  55  LYS B C   
3778 O O   . LYS B 54  ? 0.7746 1.1673 0.6267 0.1156  0.1409  0.4078  55  LYS B O   
3779 C CB  . LYS B 54  ? 0.8360 1.2282 0.6301 0.1335  0.1275  0.3466  55  LYS B CB  
3780 C CG  . LYS B 54  ? 0.8165 1.1838 0.5966 0.1342  0.1171  0.3276  55  LYS B CG  
3781 C CD  . LYS B 54  ? 0.7005 1.0878 0.4567 0.1491  0.1117  0.3167  55  LYS B CD  
3782 N N   . SER B 55  ? 0.8434 1.2627 0.6866 0.1198  0.1483  0.3902  56  SER B N   
3783 C CA  . SER B 55  ? 0.9039 1.3524 0.7607 0.1218  0.1568  0.4149  56  SER B CA  
3784 C C   . SER B 55  ? 0.9236 1.3555 0.8148 0.1077  0.1603  0.4385  56  SER B C   
3785 O O   . SER B 55  ? 0.9514 1.3951 0.8563 0.1077  0.1635  0.4623  56  SER B O   
3786 C CB  . SER B 55  ? 0.9009 1.3798 0.7505 0.1286  0.1632  0.4083  56  SER B CB  
3787 O OG  . SER B 55  ? 0.9237 1.4210 0.7439 0.1431  0.1592  0.3871  56  SER B OG  
3788 N N   . SER B 56  ? 0.9050 1.3100 0.8112 0.0958  0.1594  0.4313  57  SER B N   
3789 C CA  . SER B 56  ? 0.8845 1.2709 0.8257 0.0820  0.1612  0.4498  57  SER B CA  
3790 C C   . SER B 56  ? 0.8481 1.1923 0.7978 0.0717  0.1533  0.4389  57  SER B C   
3791 O O   . SER B 56  ? 0.8379 1.1686 0.7657 0.0753  0.1472  0.4183  57  SER B O   
3792 C CB  . SER B 56  ? 0.8908 1.2902 0.8481 0.0773  0.1688  0.4543  57  SER B CB  
3793 O OG  . SER B 56  ? 0.8870 1.2856 0.8266 0.0797  0.1684  0.4299  57  SER B OG  
3794 N N   . SER B 57  ? 0.8090 1.1330 0.7916 0.0593  0.1530  0.4524  58  SER B N   
3795 C CA  . SER B 57  ? 0.7366 1.0213 0.7310 0.0495  0.1454  0.4428  58  SER B CA  
3796 C C   . SER B 57  ? 0.6610 0.9331 0.6753 0.0394  0.1475  0.4372  58  SER B C   
3797 O O   . SER B 57  ? 0.7194 0.9970 0.7618 0.0328  0.1518  0.4531  58  SER B O   
3798 C CB  . SER B 57  ? 0.6883 0.9566 0.7070 0.0439  0.1411  0.4608  58  SER B CB  
3799 O OG  . SER B 57  ? 0.8360 1.1244 0.8416 0.0533  0.1418  0.4726  58  SER B OG  
3800 N N   . LEU B 58  ? 0.6393 0.8950 0.6399 0.0381  0.1441  0.4147  59  LEU B N   
3801 C CA  . LEU B 58  ? 0.6237 0.8697 0.6400 0.0296  0.1462  0.4074  59  LEU B CA  
3802 C C   . LEU B 58  ? 0.7068 0.9207 0.7568 0.0168  0.1409  0.4123  59  LEU B C   
3803 O O   . LEU B 58  ? 0.7142 0.9034 0.7647 0.0149  0.1332  0.4075  59  LEU B O   
3804 C CB  . LEU B 58  ? 0.6042 0.8451 0.5942 0.0332  0.1444  0.3819  59  LEU B CB  
3805 C CG  . LEU B 58  ? 0.6048 0.8371 0.6071 0.0256  0.1466  0.3721  59  LEU B CG  
3806 C CD1 . LEU B 58  ? 0.6146 0.8791 0.6114 0.0305  0.1552  0.3735  59  LEU B CD1 
3807 C CD2 . LEU B 58  ? 0.5662 0.7782 0.5509 0.0256  0.1412  0.3488  59  LEU B CD2 
3808 N N   . GLU B 59  ? 0.7011 0.9158 0.7802 0.0086  0.1445  0.4210  60  GLU B N   
3809 C CA  . GLU B 59  ? 0.6721 0.8569 0.7850 -0.0033 0.1386  0.4217  60  GLU B CA  
3810 C C   . GLU B 59  ? 0.6717 0.8358 0.7779 -0.0071 0.1352  0.3990  60  GLU B C   
3811 O O   . GLU B 59  ? 0.5779 0.7526 0.6795 -0.0075 0.1402  0.3910  60  GLU B O   
3812 C CB  . GLU B 59  ? 0.6972 0.8914 0.8449 -0.0104 0.1431  0.4382  60  GLU B CB  
3813 N N   . VAL B 60  ? 0.6580 0.7935 0.7638 -0.0095 0.1265  0.3888  61  VAL B N   
3814 C CA  . VAL B 60  ? 0.5995 0.7139 0.7012 -0.0133 0.1226  0.3684  61  VAL B CA  
3815 C C   . VAL B 60  ? 0.6029 0.6932 0.7431 -0.0246 0.1172  0.3681  61  VAL B C   
3816 O O   . VAL B 60  ? 0.6259 0.6983 0.7870 -0.0282 0.1103  0.3738  61  VAL B O   
3817 C CB  . VAL B 60  ? 0.5458 0.6439 0.6235 -0.0085 0.1159  0.3555  61  VAL B CB  
3818 C CG1 . VAL B 60  ? 0.5248 0.5993 0.6035 -0.0133 0.1113  0.3365  61  VAL B CG1 
3819 C CG2 . VAL B 60  ? 0.5500 0.6721 0.5894 0.0033  0.1200  0.3519  61  VAL B CG2 
3820 N N   . PRO B 61  ? 0.6077 0.6980 0.7582 -0.0298 0.1199  0.3602  62  PRO B N   
3821 C CA  . PRO B 61  ? 0.5865 0.6569 0.7752 -0.0401 0.1146  0.3585  62  PRO B CA  
3822 C C   . PRO B 61  ? 0.5806 0.6215 0.7698 -0.0434 0.1061  0.3385  62  PRO B C   
3823 O O   . PRO B 61  ? 0.5729 0.6100 0.7325 -0.0381 0.1055  0.3266  62  PRO B O   
3824 C CB  . PRO B 61  ? 0.5795 0.6681 0.7746 -0.0426 0.1224  0.3586  62  PRO B CB  
3825 C CG  . PRO B 61  ? 0.6068 0.7098 0.7629 -0.0349 0.1279  0.3470  62  PRO B CG  
3826 C CD  . PRO B 61  ? 0.6346 0.7456 0.7628 -0.0257 0.1278  0.3520  62  PRO B CD  
3827 N N   . LEU B 62  ? 0.5570 0.5780 0.7806 -0.0515 0.0990  0.3343  63  LEU B N   
3828 C CA  . LEU B 62  ? 0.5538 0.5508 0.7809 -0.0549 0.0919  0.3136  63  LEU B CA  
3829 C C   . LEU B 62  ? 0.5697 0.5789 0.7889 -0.0563 0.0988  0.3057  63  LEU B C   
3830 O O   . LEU B 62  ? 0.6151 0.6469 0.8390 -0.0568 0.1068  0.3164  63  LEU B O   
3831 C CB  . LEU B 62  ? 0.5549 0.5301 0.8223 -0.0621 0.0816  0.3095  63  LEU B CB  
3832 C CG  . LEU B 62  ? 0.5131 0.4776 0.7991 -0.0620 0.0743  0.3187  63  LEU B CG  
3833 C CD1 . LEU B 62  ? 0.5133 0.4570 0.8382 -0.0684 0.0633  0.3090  63  LEU B CD1 
3834 C CD2 . LEU B 62  ? 0.5815 0.5352 0.8421 -0.0559 0.0704  0.3135  63  LEU B CD2 
3835 N N   . VAL B 63  ? 0.5361 0.5325 0.7391 -0.0545 0.0931  0.2799  64  VAL B N   
3836 C CA  . VAL B 63  ? 0.5408 0.5450 0.7391 -0.0554 0.0955  0.2649  64  VAL B CA  
3837 C C   . VAL B 63  ? 0.5124 0.4923 0.7273 -0.0597 0.0845  0.2429  64  VAL B C   
3838 O O   . VAL B 63  ? 0.5601 0.5255 0.7565 -0.0559 0.0771  0.2224  64  VAL B O   
3839 C CB  . VAL B 63  ? 0.5561 0.5738 0.7122 -0.0467 0.0992  0.2505  64  VAL B CB  
3840 C CG1 . VAL B 63  ? 0.5107 0.5363 0.6667 -0.0480 0.1013  0.2368  64  VAL B CG1 
3841 C CG2 . VAL B 63  ? 0.4605 0.5038 0.5965 -0.0403 0.1090  0.2694  64  VAL B CG2 
3842 N N   . ILE B 64  ? 0.5120 0.4893 0.7628 -0.0673 0.0835  0.2476  65  ILE B N   
3843 C CA  . ILE B 64  ? 0.5006 0.4567 0.7717 -0.0713 0.0725  0.2279  65  ILE B CA  
3844 C C   . ILE B 64  ? 0.4729 0.4388 0.7539 -0.0746 0.0753  0.2205  65  ILE B C   
3845 O O   . ILE B 64  ? 0.5051 0.4872 0.8058 -0.0790 0.0830  0.2384  65  ILE B O   
3846 C CB  . ILE B 64  ? 0.5174 0.4575 0.8302 -0.0777 0.0655  0.2391  65  ILE B CB  
3847 C CG1 . ILE B 64  ? 0.5162 0.4444 0.8192 -0.0737 0.0612  0.2435  65  ILE B CG1 
3848 C CG2 . ILE B 64  ? 0.4626 0.3847 0.8008 -0.0816 0.0542  0.2186  65  ILE B CG2 
3849 C CD1 . ILE B 64  ? 0.4713 0.3887 0.8098 -0.0773 0.0543  0.2546  65  ILE B CD1 
3850 N N   . ASN B 65  ? 0.4638 0.4209 0.7314 -0.0723 0.0690  0.1950  66  ASN B N   
3851 C CA  . ASN B 65  ? 0.4989 0.4643 0.7731 -0.0745 0.0705  0.1853  66  ASN B CA  
3852 C C   . ASN B 65  ? 0.4785 0.4710 0.7391 -0.0727 0.0834  0.1977  66  ASN B C   
3853 O O   . ASN B 65  ? 0.5035 0.5083 0.7850 -0.0771 0.0877  0.2038  66  ASN B O   
3854 C CB  . ASN B 65  ? 0.5111 0.4682 0.8308 -0.0826 0.0649  0.1877  66  ASN B CB  
3855 C CG  . ASN B 65  ? 0.5757 0.5285 0.9002 -0.0832 0.0588  0.1652  66  ASN B CG  
3856 O OD1 . ASN B 65  ? 0.5807 0.5280 0.8772 -0.0778 0.0547  0.1448  66  ASN B OD1 
3857 N ND2 . ASN B 65  ? 0.5918 0.5473 0.9528 -0.0900 0.0577  0.1696  66  ASN B ND2 
3858 N N   . GLY B 66  ? 0.4683 0.4714 0.6951 -0.0658 0.0890  0.2012  67  GLY B N   
3859 C CA  . GLY B 66  ? 0.4671 0.4974 0.6767 -0.0619 0.1005  0.2103  67  GLY B CA  
3860 C C   . GLY B 66  ? 0.5315 0.5817 0.7580 -0.0645 0.1107  0.2397  67  GLY B C   
3861 O O   . GLY B 66  ? 0.6109 0.6870 0.8218 -0.0600 0.1209  0.2491  67  GLY B O   
3862 N N   . GLU B 67  ? 0.5159 0.5551 0.7750 -0.0713 0.1077  0.2546  68  GLU B N   
3863 C CA  . GLU B 67  ? 0.5231 0.5804 0.8029 -0.0748 0.1171  0.2854  68  GLU B CA  
3864 C C   . GLU B 67  ? 0.5773 0.6345 0.8438 -0.0707 0.1183  0.3009  68  GLU B C   
3865 O O   . GLU B 67  ? 0.5387 0.5726 0.8043 -0.0705 0.1093  0.2940  68  GLU B O   
3866 C CB  . GLU B 67  ? 0.5286 0.5761 0.8555 -0.0841 0.1119  0.2918  68  GLU B CB  
3867 N N   . ARG B 68  ? 0.6410 0.7249 0.8939 -0.0653 0.1273  0.3172  69  ARG B N   
3868 C CA  . ARG B 68  ? 0.6522 0.7387 0.8910 -0.0599 0.1269  0.3293  69  ARG B CA  
3869 C C   . ARG B 68  ? 0.7043 0.7828 0.9785 -0.0651 0.1218  0.3437  69  ARG B C   
3870 O O   . ARG B 68  ? 0.6800 0.7730 0.9770 -0.0684 0.1257  0.3560  69  ARG B O   
3871 C CB  . ARG B 68  ? 0.5015 0.6209 0.7111 -0.0509 0.1377  0.3392  69  ARG B CB  
3872 N N   . ILE B 69  ? 0.7392 0.7947 1.0195 -0.0658 0.1126  0.3418  70  ILE B N   
3873 C CA  . ILE B 69  ? 0.6863 0.7338 1.0005 -0.0699 0.1066  0.3548  70  ILE B CA  
3874 C C   . ILE B 69  ? 0.6734 0.7276 0.9749 -0.0642 0.1077  0.3701  70  ILE B C   
3875 O O   . ILE B 69  ? 0.6914 0.7316 0.9746 -0.0604 0.1028  0.3631  70  ILE B O   
3876 C CB  . ILE B 69  ? 0.6729 0.6882 1.0127 -0.0754 0.0933  0.3398  70  ILE B CB  
3877 C CG1 . ILE B 69  ? 0.6866 0.6952 1.0432 -0.0811 0.0909  0.3244  70  ILE B CG1 
3878 C CG2 . ILE B 69  ? 0.6219 0.6303 0.9964 -0.0784 0.0867  0.3530  70  ILE B CG2 
3879 C CD1 . ILE B 69  ? 0.6850 0.6634 1.0606 -0.0845 0.0772  0.3051  70  ILE B CD1 
3880 N N   . TYR B 70  ? 0.5889 0.6650 0.9011 -0.0634 0.1138  0.3914  71  TYR B N   
3881 C CA  . TYR B 70  ? 0.6355 0.7214 0.9383 -0.0579 0.1153  0.4082  71  TYR B CA  
3882 C C   . TYR B 70  ? 0.6927 0.7613 1.0314 -0.0626 0.1062  0.4173  71  TYR B C   
3883 O O   . TYR B 70  ? 0.5868 0.6382 0.9585 -0.0698 0.0990  0.4108  71  TYR B O   
3884 C CB  . TYR B 70  ? 0.5914 0.7130 0.8850 -0.0533 0.1271  0.4267  71  TYR B CB  
3885 C CG  . TYR B 70  ? 0.6567 0.7976 0.9108 -0.0462 0.1353  0.4169  71  TYR B CG  
3886 C CD1 . TYR B 70  ? 0.6873 0.8361 0.9041 -0.0368 0.1370  0.4143  71  TYR B CD1 
3887 C CD2 . TYR B 70  ? 0.5977 0.7486 0.8524 -0.0483 0.1406  0.4089  71  TYR B CD2 
3888 C CE1 . TYR B 70  ? 0.6229 0.7894 0.8047 -0.0294 0.1433  0.4036  71  TYR B CE1 
3889 C CE2 . TYR B 70  ? 0.5621 0.7310 0.7818 -0.0411 0.1474  0.3988  71  TYR B CE2 
3890 C CZ  . TYR B 70  ? 0.6119 0.7885 0.7954 -0.0315 0.1484  0.3959  71  TYR B CZ  
3891 O OH  . TYR B 70  ? 0.5966 0.7913 0.7464 -0.0236 0.1540  0.3843  71  TYR B OH  
3892 N N   . ASP B 71  ? 0.6050 0.6785 0.9374 -0.0581 0.1060  0.4313  72  ASP B N   
3893 C CA  . ASP B 71  ? 0.7302 0.7871 1.0947 -0.0617 0.0968  0.4394  72  ASP B CA  
3894 C C   . ASP B 71  ? 0.7746 0.8377 1.1824 -0.0684 0.0967  0.4538  72  ASP B C   
3895 O O   . ASP B 71  ? 0.8177 0.8611 1.2607 -0.0738 0.0867  0.4518  72  ASP B O   
3896 C CB  . ASP B 71  ? 0.7316 0.7964 1.0809 -0.0552 0.0977  0.4539  72  ASP B CB  
3897 C CG  . ASP B 71  ? 0.8041 0.9012 1.1539 -0.0521 0.1077  0.4789  72  ASP B CG  
3898 O OD1 . ASP B 71  ? 0.7943 0.8947 1.1791 -0.0562 0.1061  0.4970  72  ASP B OD1 
3899 O OD2 . ASP B 71  ? 0.8680 0.9881 1.1837 -0.0451 0.1167  0.4802  72  ASP B OD2 
3900 N N   . ASN B 72  ? 0.6382 0.7293 1.0434 -0.0676 0.1074  0.4674  73  ASN B N   
3901 C CA  . ASN B 72  ? 0.6511 0.7524 1.0953 -0.0736 0.1090  0.4824  73  ASN B CA