data_4OE5
# 
_entry.id   4OE5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OE5         
RCSB  RCSB084378   
WWPDB D_1000084378 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OE4 . unspecified 
PDB 4OE6 . unspecified 
# 
_pdbx_database_status.entry_id                        4OE5 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-11 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Tanner, J.J.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   ? 
# 
_citation.id                        primary 
_citation.title                     
;Structural Studies of Yeast Delta (1)-Pyrroline-5-carboxylate Dehydrogenase (ALDH4A1): Active Site Flexibility and Oligomeric State.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            53 
_citation.page_first                1350 
_citation.page_last                 1359 
_citation.year                      2014 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24502590 
_citation.pdbx_database_id_DOI      10.1021/bi500048b 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pemberton, T.A.' 1 ? 
primary 'Srivastava, D.'  2 ? 
primary 'Sanyal, N.'      3 ? 
primary 'Henzl, M.T.'     4 ? 
primary 'Becker, D.F.'    5 ? 
primary 'Tanner, J.J.'    6 ? 
# 
_cell.length_a           91.960 
_cell.length_b           121.335 
_cell.length_c           93.397 
_cell.angle_alpha        90.000 
_cell.angle_beta         104.230 
_cell.angle_gamma        90.000 
_cell.entry_id           4OE5 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4OE5 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial' 60130.094 4   1.2.1.88 ? ? ? 
2 non-polymer syn 'PENTAETHYLENE GLYCOL'                                         238.278   3   ?        ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                                                24.305    1   ?        ? ? ? 
4 water       nat water                                                          18.015    241 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'P5C dehydrogenase, Aldehyde dehydrogenase family 4 member A1, L-glutamate gamma-semialdehyde dehydrogenase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKF
CYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNA
KYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGL
PPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVS
GTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLT
ILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEAT
KVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKF
CYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNA
KYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGL
PPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVS
GTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLT
ILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEAT
KVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   THR n 
1 5   GLY n 
1 6   ALA n 
1 7   GLY n 
1 8   LEU n 
1 9   ARG n 
1 10  TRP n 
1 11  LYS n 
1 12  HIS n 
1 13  THR n 
1 14  SER n 
1 15  SER n 
1 16  LEU n 
1 17  LYS n 
1 18  VAL n 
1 19  ALA n 
1 20  ASN n 
1 21  GLU n 
1 22  PRO n 
1 23  VAL n 
1 24  LEU n 
1 25  ALA n 
1 26  PHE n 
1 27  THR n 
1 28  GLN n 
1 29  GLY n 
1 30  SER n 
1 31  PRO n 
1 32  GLU n 
1 33  ARG n 
1 34  ASP n 
1 35  ALA n 
1 36  LEU n 
1 37  GLN n 
1 38  LYS n 
1 39  ALA n 
1 40  LEU n 
1 41  LYS n 
1 42  ASP n 
1 43  LEU n 
1 44  LYS n 
1 45  GLY n 
1 46  ARG n 
1 47  MET n 
1 48  GLU n 
1 49  ALA n 
1 50  ILE n 
1 51  PRO n 
1 52  CYS n 
1 53  VAL n 
1 54  VAL n 
1 55  GLY n 
1 56  ASP n 
1 57  GLU n 
1 58  GLU n 
1 59  VAL n 
1 60  TRP n 
1 61  THR n 
1 62  SER n 
1 63  ASP n 
1 64  VAL n 
1 65  GLN n 
1 66  TYR n 
1 67  GLN n 
1 68  VAL n 
1 69  SER n 
1 70  PRO n 
1 71  PHE n 
1 72  ASN n 
1 73  HIS n 
1 74  GLY n 
1 75  HIS n 
1 76  LYS n 
1 77  VAL n 
1 78  ALA n 
1 79  LYS n 
1 80  PHE n 
1 81  CYS n 
1 82  TYR n 
1 83  ALA n 
1 84  ASP n 
1 85  LYS n 
1 86  SER n 
1 87  LEU n 
1 88  LEU n 
1 89  ASN n 
1 90  LYS n 
1 91  ALA n 
1 92  ILE n 
1 93  GLU n 
1 94  ALA n 
1 95  ALA n 
1 96  LEU n 
1 97  ALA n 
1 98  ALA n 
1 99  ARG n 
1 100 LYS n 
1 101 GLU n 
1 102 TRP n 
1 103 ASP n 
1 104 LEU n 
1 105 LYS n 
1 106 PRO n 
1 107 ILE n 
1 108 ALA n 
1 109 ASP n 
1 110 ARG n 
1 111 ALA n 
1 112 GLN n 
1 113 ILE n 
1 114 PHE n 
1 115 LEU n 
1 116 LYS n 
1 117 ALA n 
1 118 ALA n 
1 119 ASP n 
1 120 MET n 
1 121 LEU n 
1 122 SER n 
1 123 GLY n 
1 124 PRO n 
1 125 ARG n 
1 126 ARG n 
1 127 ALA n 
1 128 GLU n 
1 129 ILE n 
1 130 LEU n 
1 131 ALA n 
1 132 LYS n 
1 133 THR n 
1 134 MET n 
1 135 VAL n 
1 136 GLY n 
1 137 GLN n 
1 138 GLY n 
1 139 LYS n 
1 140 THR n 
1 141 VAL n 
1 142 ILE n 
1 143 GLN n 
1 144 ALA n 
1 145 GLU n 
1 146 ILE n 
1 147 ASP n 
1 148 ALA n 
1 149 ALA n 
1 150 ALA n 
1 151 GLU n 
1 152 LEU n 
1 153 ILE n 
1 154 ASP n 
1 155 PHE n 
1 156 PHE n 
1 157 ARG n 
1 158 PHE n 
1 159 ASN n 
1 160 ALA n 
1 161 LYS n 
1 162 TYR n 
1 163 ALA n 
1 164 VAL n 
1 165 GLU n 
1 166 LEU n 
1 167 GLU n 
1 168 GLY n 
1 169 GLN n 
1 170 GLN n 
1 171 PRO n 
1 172 ILE n 
1 173 SER n 
1 174 VAL n 
1 175 PRO n 
1 176 PRO n 
1 177 SER n 
1 178 THR n 
1 179 ASN n 
1 180 SER n 
1 181 THR n 
1 182 VAL n 
1 183 TYR n 
1 184 ARG n 
1 185 GLY n 
1 186 LEU n 
1 187 GLU n 
1 188 GLY n 
1 189 PHE n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 ILE n 
1 194 SER n 
1 195 PRO n 
1 196 PHE n 
1 197 ASN n 
1 198 PHE n 
1 199 THR n 
1 200 ALA n 
1 201 ILE n 
1 202 GLY n 
1 203 GLY n 
1 204 ASN n 
1 205 LEU n 
1 206 ALA n 
1 207 GLY n 
1 208 ALA n 
1 209 PRO n 
1 210 ALA n 
1 211 LEU n 
1 212 MET n 
1 213 GLY n 
1 214 ASN n 
1 215 VAL n 
1 216 VAL n 
1 217 LEU n 
1 218 TRP n 
1 219 LYS n 
1 220 PRO n 
1 221 SER n 
1 222 ASP n 
1 223 THR n 
1 224 ALA n 
1 225 MET n 
1 226 LEU n 
1 227 ALA n 
1 228 SER n 
1 229 TYR n 
1 230 ALA n 
1 231 VAL n 
1 232 TYR n 
1 233 ARG n 
1 234 ILE n 
1 235 LEU n 
1 236 ARG n 
1 237 GLU n 
1 238 ALA n 
1 239 GLY n 
1 240 LEU n 
1 241 PRO n 
1 242 PRO n 
1 243 ASN n 
1 244 ILE n 
1 245 ILE n 
1 246 GLN n 
1 247 PHE n 
1 248 VAL n 
1 249 PRO n 
1 250 ALA n 
1 251 ASP n 
1 252 GLY n 
1 253 PRO n 
1 254 LEU n 
1 255 PHE n 
1 256 GLY n 
1 257 ASP n 
1 258 THR n 
1 259 VAL n 
1 260 THR n 
1 261 SER n 
1 262 SER n 
1 263 GLU n 
1 264 HIS n 
1 265 LEU n 
1 266 CYS n 
1 267 GLY n 
1 268 ILE n 
1 269 ASN n 
1 270 PHE n 
1 271 THR n 
1 272 GLY n 
1 273 SER n 
1 274 VAL n 
1 275 PRO n 
1 276 THR n 
1 277 PHE n 
1 278 LYS n 
1 279 HIS n 
1 280 LEU n 
1 281 TRP n 
1 282 LYS n 
1 283 GLN n 
1 284 VAL n 
1 285 ALA n 
1 286 GLN n 
1 287 ASN n 
1 288 LEU n 
1 289 ASP n 
1 290 ARG n 
1 291 PHE n 
1 292 HIS n 
1 293 THR n 
1 294 PHE n 
1 295 PRO n 
1 296 ARG n 
1 297 LEU n 
1 298 ALA n 
1 299 GLY n 
1 300 GLU n 
1 301 CYS n 
1 302 GLY n 
1 303 GLY n 
1 304 LYS n 
1 305 ASN n 
1 306 PHE n 
1 307 HIS n 
1 308 PHE n 
1 309 VAL n 
1 310 HIS n 
1 311 ARG n 
1 312 SER n 
1 313 ALA n 
1 314 ASP n 
1 315 VAL n 
1 316 GLU n 
1 317 SER n 
1 318 VAL n 
1 319 VAL n 
1 320 SER n 
1 321 GLY n 
1 322 THR n 
1 323 LEU n 
1 324 ARG n 
1 325 SER n 
1 326 ALA n 
1 327 PHE n 
1 328 GLU n 
1 329 TYR n 
1 330 GLY n 
1 331 GLY n 
1 332 GLN n 
1 333 LYS n 
1 334 CYS n 
1 335 SER n 
1 336 ALA n 
1 337 CYS n 
1 338 SER n 
1 339 ARG n 
1 340 LEU n 
1 341 TYR n 
1 342 VAL n 
1 343 PRO n 
1 344 HIS n 
1 345 SER n 
1 346 LEU n 
1 347 TRP n 
1 348 PRO n 
1 349 GLN n 
1 350 ILE n 
1 351 LYS n 
1 352 GLY n 
1 353 ARG n 
1 354 LEU n 
1 355 LEU n 
1 356 GLU n 
1 357 GLU n 
1 358 HIS n 
1 359 SER n 
1 360 ARG n 
1 361 ILE n 
1 362 LYS n 
1 363 VAL n 
1 364 GLY n 
1 365 ASP n 
1 366 PRO n 
1 367 ALA n 
1 368 GLU n 
1 369 ASP n 
1 370 PHE n 
1 371 GLY n 
1 372 THR n 
1 373 PHE n 
1 374 PHE n 
1 375 SER n 
1 376 ALA n 
1 377 VAL n 
1 378 ILE n 
1 379 ASP n 
1 380 ALA n 
1 381 LYS n 
1 382 SER n 
1 383 PHE n 
1 384 ALA n 
1 385 ARG n 
1 386 ILE n 
1 387 LYS n 
1 388 LYS n 
1 389 TRP n 
1 390 LEU n 
1 391 GLU n 
1 392 HIS n 
1 393 ALA n 
1 394 ARG n 
1 395 SER n 
1 396 SER n 
1 397 PRO n 
1 398 SER n 
1 399 LEU n 
1 400 THR n 
1 401 ILE n 
1 402 LEU n 
1 403 ALA n 
1 404 GLY n 
1 405 GLY n 
1 406 LYS n 
1 407 CYS n 
1 408 ASP n 
1 409 ASP n 
1 410 SER n 
1 411 VAL n 
1 412 GLY n 
1 413 TYR n 
1 414 PHE n 
1 415 VAL n 
1 416 GLU n 
1 417 PRO n 
1 418 CYS n 
1 419 ILE n 
1 420 VAL n 
1 421 GLU n 
1 422 SER n 
1 423 LYS n 
1 424 ASP n 
1 425 PRO n 
1 426 GLN n 
1 427 GLU n 
1 428 PRO n 
1 429 ILE n 
1 430 MET n 
1 431 LYS n 
1 432 GLU n 
1 433 GLU n 
1 434 ILE n 
1 435 PHE n 
1 436 GLY n 
1 437 PRO n 
1 438 VAL n 
1 439 LEU n 
1 440 SER n 
1 441 VAL n 
1 442 TYR n 
1 443 VAL n 
1 444 TYR n 
1 445 PRO n 
1 446 ASP n 
1 447 ASP n 
1 448 LYS n 
1 449 TYR n 
1 450 LYS n 
1 451 GLU n 
1 452 THR n 
1 453 LEU n 
1 454 GLN n 
1 455 LEU n 
1 456 VAL n 
1 457 ASP n 
1 458 SER n 
1 459 THR n 
1 460 THR n 
1 461 SER n 
1 462 TYR n 
1 463 GLY n 
1 464 LEU n 
1 465 THR n 
1 466 GLY n 
1 467 ALA n 
1 468 VAL n 
1 469 PHE n 
1 470 SER n 
1 471 GLN n 
1 472 ASP n 
1 473 LYS n 
1 474 ASP n 
1 475 VAL n 
1 476 VAL n 
1 477 GLN n 
1 478 GLU n 
1 479 ALA n 
1 480 THR n 
1 481 LYS n 
1 482 VAL n 
1 483 LEU n 
1 484 ARG n 
1 485 ASN n 
1 486 ALA n 
1 487 ALA n 
1 488 GLY n 
1 489 ASN n 
1 490 PHE n 
1 491 TYR n 
1 492 ILE n 
1 493 ASN n 
1 494 ASP n 
1 495 LYS n 
1 496 SER n 
1 497 THR n 
1 498 GLY n 
1 499 SER n 
1 500 ILE n 
1 501 VAL n 
1 502 GLY n 
1 503 GLN n 
1 504 GLN n 
1 505 PRO n 
1 506 PHE n 
1 507 GLY n 
1 508 GLY n 
1 509 ALA n 
1 510 ARG n 
1 511 ALA n 
1 512 SER n 
1 513 GLY n 
1 514 THR n 
1 515 ASN n 
1 516 ASP n 
1 517 LYS n 
1 518 PRO n 
1 519 GLY n 
1 520 GLY n 
1 521 PRO n 
1 522 HIS n 
1 523 TYR n 
1 524 ILE n 
1 525 LEU n 
1 526 ARG n 
1 527 TRP n 
1 528 THR n 
1 529 SER n 
1 530 PRO n 
1 531 GLN n 
1 532 VAL n 
1 533 ILE n 
1 534 LYS n 
1 535 GLU n 
1 536 THR n 
1 537 HIS n 
1 538 LYS n 
1 539 PRO n 
1 540 LEU n 
1 541 GLY n 
1 542 ASP n 
1 543 TRP n 
1 544 SER n 
1 545 TYR n 
1 546 ALA n 
1 547 TYR n 
1 548 MET n 
1 549 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ALDH4, ALDH4A1, P5CDH' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmd 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AL4A1_HUMAN 
_struct_ref.pdbx_db_accession          P30038 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYA
DKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYA
VELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPN
IIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTL
RSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILA
GGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVL
RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ
;
_struct_ref.pdbx_align_begin           18 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4OE5 A 4 ? 549 ? P30038 18 ? 563 ? 18 563 
2 1 4OE5 B 4 ? 549 ? P30038 18 ? 563 ? 18 563 
3 1 4OE5 C 4 ? 549 ? P30038 18 ? 563 ? 18 563 
4 1 4OE5 D 4 ? 549 ? P30038 18 ? 563 ? 18 563 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4OE5 GLY A 1 ? UNP P30038 ? ? 'expression tag' 15 1  
1 4OE5 SER A 2 ? UNP P30038 ? ? 'expression tag' 16 2  
1 4OE5 HIS A 3 ? UNP P30038 ? ? 'expression tag' 17 3  
2 4OE5 GLY B 1 ? UNP P30038 ? ? 'expression tag' 15 4  
2 4OE5 SER B 2 ? UNP P30038 ? ? 'expression tag' 16 5  
2 4OE5 HIS B 3 ? UNP P30038 ? ? 'expression tag' 17 6  
3 4OE5 GLY C 1 ? UNP P30038 ? ? 'expression tag' 15 7  
3 4OE5 SER C 2 ? UNP P30038 ? ? 'expression tag' 16 8  
3 4OE5 HIS C 3 ? UNP P30038 ? ? 'expression tag' 17 9  
4 4OE5 GLY D 1 ? UNP P30038 ? ? 'expression tag' 15 10 
4 4OE5 SER D 2 ? UNP P30038 ? ? 'expression tag' 16 11 
4 4OE5 HIS D 3 ? UNP P30038 ? ? 'expression tag' 17 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL' PEG400 'C10 H22 O6'     238.278 
ALA 'L-peptide linking' y ALANINE                ?      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ?      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ?      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ?      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?      'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'        ?      'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE          ?      'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?      'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4OE5 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   41.43 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'20 - 25 % (w/v) PEG 3350, 0.2 M MgCl2, and 0.1 M HEPES at pH 7.0 - 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-10-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     4OE5 
_reflns.d_resolution_high            1.950 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   139296 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_netI_over_sigmaI        11.100 
_reflns.pdbx_chi_squared             0.956 
_reflns.pdbx_redundancy              3.500 
_reflns.percent_possible_obs         96.500 
_reflns.B_iso_Wilson_estimate        28.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.950 2.020  ? ? ? 0.453 ? ? 0.764 3.300 ? 13356 93.000 1  1 
2.020 2.100  ? ? ? 0.333 ? ? 0.784 3.300 ? 13434 93.300 2  1 
2.100 2.200  ? ? ? 0.219 ? ? 0.823 3.400 ? 13586 94.400 3  1 
2.200 2.310  ? ? ? 0.168 ? ? 0.866 3.400 ? 13723 95.400 4  1 
2.310 2.460  ? ? ? 0.123 ? ? 0.887 3.400 ? 13885 96.300 5  1 
2.460 2.650  ? ? ? 0.095 ? ? 0.919 3.500 ? 13994 97.200 6  1 
2.650 2.910  ? ? ? 0.066 ? ? 0.987 3.600 ? 14125 98.000 7  1 
2.910 3.330  ? ? ? 0.046 ? ? 1.118 3.700 ? 14298 98.800 8  1 
3.330 4.200  ? ? ? 0.032 ? ? 1.273 3.700 ? 14352 99.200 9  1 
4.200 50.000 ? ? ? 0.023 ? ? 1.014 3.700 ? 14543 99.300 10 1 
# 
_refine.entry_id                                 4OE5 
_refine.ls_d_res_high                            1.950 
_refine.ls_d_res_low                             42.4110 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.2100 
_refine.ls_number_reflns_obs                     139239 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1959 
_refine.ls_R_factor_R_work                       0.1938 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2347 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0100 
_refine.ls_number_reflns_R_free                  6972 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               33.1479 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2400 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      3V9G 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8145 
_refine.B_iso_max                                86.470 
_refine.B_iso_min                                10.620 
_refine.pdbx_overall_phase_error                 25.8900 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15149 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             241 
_refine_hist.number_atoms_total               15436 
_refine_hist.d_res_high                       1.950 
_refine_hist.d_res_low                        42.4110 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           15562 0.007  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          21236 1.012  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     2418  0.068  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      2771  0.005  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 5348  12.359 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.9484 2.0181  10 90.0000 12329 . 0.2279 0.3011 . 649 . 12978 . . 'X-RAY DIFFRACTION' 
2.0181 2.0988  10 93.0000 12819 . 0.2199 0.2805 . 693 . 13512 . . 'X-RAY DIFFRACTION' 
2.0988 2.1944  10 94.0000 12897 . 0.2093 0.2796 . 679 . 13576 . . 'X-RAY DIFFRACTION' 
2.1944 2.3101  10 95.0000 13074 . 0.2031 0.2619 . 715 . 13789 . . 'X-RAY DIFFRACTION' 
2.3101 2.4548  10 96.0000 13195 . 0.2033 0.2645 . 696 . 13891 . . 'X-RAY DIFFRACTION' 
2.4548 2.6443  10 97.0000 13334 . 0.2040 0.2624 . 707 . 14041 . . 'X-RAY DIFFRACTION' 
2.6443 2.9103  10 98.0000 13466 . 0.2107 0.2655 . 688 . 14154 . . 'X-RAY DIFFRACTION' 
2.9103 3.3313  10 99.0000 13639 . 0.2247 0.2684 . 710 . 14349 . . 'X-RAY DIFFRACTION' 
3.3313 4.1965  10 99.0000 13714 . 0.1799 0.2046 . 681 . 14395 . . 'X-RAY DIFFRACTION' 
4.1965 42.4207 10 99.0000 13800 . 0.1632 0.1840 . 754 . 14554 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OE5 
_struct.title                     'Structure of Human ALDH4A1 Crystallized in Space Group P21' 
_struct.pdbx_descriptor           'Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial (E.C.1.2.1.88)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OE5 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'ALDEHYDE DEHYDROGENASE, ALDH4A1, ROSSMANN FOLD, OXIDOREDUCTASE, NAD, MITOCHONDRIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 2 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 30  ? LYS A 44  ? SER A 44  LYS A 58  1 ? 15 
HELX_P HELX_P2  2  ASP A 84  ? LYS A 105 ? ASP A 98  LYS A 119 1 ? 22 
HELX_P HELX_P3  3  PRO A 106 ? GLY A 123 ? PRO A 120 GLY A 137 1 ? 18 
HELX_P HELX_P4  4  ARG A 125 ? GLY A 138 ? ARG A 139 GLY A 152 1 ? 14 
HELX_P HELX_P5  5  THR A 140 ? LEU A 152 ? THR A 154 LEU A 166 1 ? 13 
HELX_P HELX_P6  6  LEU A 152 ? GLU A 167 ? LEU A 166 GLU A 181 1 ? 16 
HELX_P HELX_P7  7  GLY A 202 ? MET A 212 ? GLY A 216 MET A 226 1 ? 11 
HELX_P HELX_P8  8  SER A 221 ? THR A 223 ? SER A 235 THR A 237 5 ? 3  
HELX_P HELX_P9  9  ALA A 224 ? ALA A 238 ? ALA A 238 ALA A 252 1 ? 15 
HELX_P HELX_P10 10 ASP A 251 ? SER A 261 ? ASP A 265 SER A 275 1 ? 11 
HELX_P HELX_P11 11 SER A 273 ? ASN A 287 ? SER A 287 ASN A 301 1 ? 15 
HELX_P HELX_P12 12 LEU A 288 ? PHE A 291 ? LEU A 302 PHE A 305 5 ? 4  
HELX_P HELX_P13 13 ASP A 314 ? GLU A 328 ? ASP A 328 GLU A 342 1 ? 15 
HELX_P HELX_P14 14 TYR A 329 ? GLN A 332 ? TYR A 343 GLN A 346 5 ? 4  
HELX_P HELX_P15 15 LEU A 346 ? SER A 359 ? LEU A 360 SER A 373 1 ? 14 
HELX_P HELX_P16 16 ASP A 379 ? SER A 396 ? ASP A 393 SER A 410 1 ? 18 
HELX_P HELX_P17 17 GLU A 427 ? GLU A 432 ? GLU A 441 GLU A 446 1 ? 6  
HELX_P HELX_P18 18 PRO A 445 ? ASP A 447 ? PRO A 459 ASP A 461 5 ? 3  
HELX_P HELX_P19 19 LYS A 448 ? THR A 459 ? LYS A 462 THR A 473 1 ? 12 
HELX_P HELX_P20 20 ASP A 472 ? LEU A 483 ? ASP A 486 LEU A 497 1 ? 12 
HELX_P HELX_P21 21 HIS A 522 ? ARG A 526 ? HIS A 536 ARG A 540 5 ? 5  
HELX_P HELX_P22 22 SER B 30  ? LYS B 44  ? SER B 44  LYS B 58  1 ? 15 
HELX_P HELX_P23 23 ASP B 84  ? LYS B 105 ? ASP B 98  LYS B 119 1 ? 22 
HELX_P HELX_P24 24 PRO B 106 ? GLY B 123 ? PRO B 120 GLY B 137 1 ? 18 
HELX_P HELX_P25 25 ARG B 125 ? GLY B 138 ? ARG B 139 GLY B 152 1 ? 14 
HELX_P HELX_P26 26 THR B 140 ? GLU B 151 ? THR B 154 GLU B 165 1 ? 12 
HELX_P HELX_P27 27 GLU B 151 ? GLN B 169 ? GLU B 165 GLN B 183 1 ? 19 
HELX_P HELX_P28 28 GLY B 202 ? MET B 212 ? GLY B 216 MET B 226 1 ? 11 
HELX_P HELX_P29 29 SER B 221 ? THR B 223 ? SER B 235 THR B 237 5 ? 3  
HELX_P HELX_P30 30 ALA B 224 ? ALA B 238 ? ALA B 238 ALA B 252 1 ? 15 
HELX_P HELX_P31 31 ASP B 251 ? SER B 262 ? ASP B 265 SER B 276 1 ? 12 
HELX_P HELX_P32 32 SER B 273 ? ASN B 287 ? SER B 287 ASN B 301 1 ? 15 
HELX_P HELX_P33 33 LEU B 288 ? PHE B 291 ? LEU B 302 PHE B 305 5 ? 4  
HELX_P HELX_P34 34 ASP B 314 ? GLU B 328 ? ASP B 328 GLU B 342 1 ? 15 
HELX_P HELX_P35 35 TYR B 329 ? GLN B 332 ? TYR B 343 GLN B 346 5 ? 4  
HELX_P HELX_P36 36 LEU B 346 ? SER B 359 ? LEU B 360 SER B 373 1 ? 14 
HELX_P HELX_P37 37 ASP B 379 ? SER B 396 ? ASP B 393 SER B 410 1 ? 18 
HELX_P HELX_P38 38 GLU B 427 ? GLU B 432 ? GLU B 441 GLU B 446 1 ? 6  
HELX_P HELX_P39 39 PRO B 445 ? ASP B 447 ? PRO B 459 ASP B 461 5 ? 3  
HELX_P HELX_P40 40 LYS B 448 ? THR B 459 ? LYS B 462 THR B 473 1 ? 12 
HELX_P HELX_P41 41 ASP B 472 ? LEU B 483 ? ASP B 486 LEU B 497 1 ? 12 
HELX_P HELX_P42 42 GLY B 513 ? LYS B 517 ? GLY B 527 LYS B 531 5 ? 5  
HELX_P HELX_P43 43 TYR B 523 ? ARG B 526 ? TYR B 537 ARG B 540 5 ? 4  
HELX_P HELX_P44 44 SER C 30  ? ASP C 42  ? SER C 44  ASP C 56  1 ? 13 
HELX_P HELX_P45 45 ASP C 84  ? LYS C 105 ? ASP C 98  LYS C 119 1 ? 22 
HELX_P HELX_P46 46 PRO C 106 ? GLY C 123 ? PRO C 120 GLY C 137 1 ? 18 
HELX_P HELX_P47 47 ARG C 125 ? GLY C 138 ? ARG C 139 GLY C 152 1 ? 14 
HELX_P HELX_P48 48 THR C 140 ? GLU C 151 ? THR C 154 GLU C 165 1 ? 12 
HELX_P HELX_P49 49 GLU C 151 ? GLN C 169 ? GLU C 165 GLN C 183 1 ? 19 
HELX_P HELX_P50 50 GLY C 202 ? MET C 212 ? GLY C 216 MET C 226 1 ? 11 
HELX_P HELX_P51 51 SER C 221 ? THR C 223 ? SER C 235 THR C 237 5 ? 3  
HELX_P HELX_P52 52 ALA C 224 ? ALA C 238 ? ALA C 238 ALA C 252 1 ? 15 
HELX_P HELX_P53 53 ASP C 251 ? SER C 261 ? ASP C 265 SER C 275 1 ? 11 
HELX_P HELX_P54 54 SER C 273 ? ASN C 287 ? SER C 287 ASN C 301 1 ? 15 
HELX_P HELX_P55 55 LEU C 288 ? PHE C 291 ? LEU C 302 PHE C 305 5 ? 4  
HELX_P HELX_P56 56 ASP C 314 ? GLU C 328 ? ASP C 328 GLU C 342 1 ? 15 
HELX_P HELX_P57 57 TYR C 329 ? GLN C 332 ? TYR C 343 GLN C 346 5 ? 4  
HELX_P HELX_P58 58 LEU C 346 ? SER C 359 ? LEU C 360 SER C 373 1 ? 14 
HELX_P HELX_P59 59 ASP C 379 ? SER C 396 ? ASP C 393 SER C 410 1 ? 18 
HELX_P HELX_P60 60 GLU C 427 ? LYS C 431 ? GLU C 441 LYS C 445 5 ? 5  
HELX_P HELX_P61 61 PRO C 445 ? ASP C 447 ? PRO C 459 ASP C 461 5 ? 3  
HELX_P HELX_P62 62 LYS C 448 ? THR C 459 ? LYS C 462 THR C 473 1 ? 12 
HELX_P HELX_P63 63 ASP C 472 ? LEU C 483 ? ASP C 486 LEU C 497 1 ? 12 
HELX_P HELX_P64 64 GLY C 513 ? LYS C 517 ? GLY C 527 LYS C 531 5 ? 5  
HELX_P HELX_P65 65 TYR C 523 ? ARG C 526 ? TYR C 537 ARG C 540 5 ? 4  
HELX_P HELX_P66 66 SER D 30  ? LYS D 44  ? SER D 44  LYS D 58  1 ? 15 
HELX_P HELX_P67 67 ASP D 84  ? LYS D 105 ? ASP D 98  LYS D 119 1 ? 22 
HELX_P HELX_P68 68 PRO D 106 ? GLY D 123 ? PRO D 120 GLY D 137 1 ? 18 
HELX_P HELX_P69 69 ARG D 125 ? GLY D 138 ? ARG D 139 GLY D 152 1 ? 14 
HELX_P HELX_P70 70 THR D 140 ? LEU D 152 ? THR D 154 LEU D 166 1 ? 13 
HELX_P HELX_P71 71 LEU D 152 ? GLN D 169 ? LEU D 166 GLN D 183 1 ? 18 
HELX_P HELX_P72 72 GLY D 202 ? MET D 212 ? GLY D 216 MET D 226 1 ? 11 
HELX_P HELX_P73 73 SER D 221 ? THR D 223 ? SER D 235 THR D 237 5 ? 3  
HELX_P HELX_P74 74 ALA D 224 ? ALA D 238 ? ALA D 238 ALA D 252 1 ? 15 
HELX_P HELX_P75 75 ASP D 251 ? THR D 260 ? ASP D 265 THR D 274 1 ? 10 
HELX_P HELX_P76 76 SER D 273 ? ASN D 287 ? SER D 287 ASN D 301 1 ? 15 
HELX_P HELX_P77 77 LEU D 288 ? PHE D 291 ? LEU D 302 PHE D 305 5 ? 4  
HELX_P HELX_P78 78 ASP D 314 ? GLU D 328 ? ASP D 328 GLU D 342 1 ? 15 
HELX_P HELX_P79 79 TYR D 329 ? GLN D 332 ? TYR D 343 GLN D 346 5 ? 4  
HELX_P HELX_P80 80 LEU D 346 ? SER D 359 ? LEU D 360 SER D 373 1 ? 14 
HELX_P HELX_P81 81 ASP D 379 ? SER D 396 ? ASP D 393 SER D 410 1 ? 18 
HELX_P HELX_P82 82 GLU D 427 ? GLU D 432 ? GLU D 441 GLU D 446 1 ? 6  
HELX_P HELX_P83 83 PRO D 445 ? ASP D 447 ? PRO D 459 ASP D 461 5 ? 3  
HELX_P HELX_P84 84 LYS D 448 ? THR D 459 ? LYS D 462 THR D 473 1 ? 12 
HELX_P HELX_P85 85 ASP D 472 ? LEU D 483 ? ASP D 486 LEU D 497 1 ? 12 
HELX_P HELX_P86 86 HIS D 522 ? ARG D 526 ? HIS D 536 ARG D 540 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? F MG . MG ? ? ? 1_555 J HOH . O ? ? B MG 601 B HOH 761 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc2 metalc ? ? F MG . MG ? ? ? 1_555 J HOH . O ? ? B MG 601 B HOH 762 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc3 metalc ? ? F MG . MG ? ? ? 1_555 J HOH . O ? ? B MG 601 B HOH 763 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc4 metalc ? ? F MG . MG ? ? ? 1_555 J HOH . O ? ? B MG 601 B HOH 759 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc5 metalc ? ? F MG . MG ? ? ? 1_555 J HOH . O ? ? B MG 601 B HOH 760 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc6 metalc ? ? F MG . MG ? ? ? 1_555 J HOH . O ? ? B MG 601 B HOH 758 1_555 ? ? ? ? ? ? ? 2.391 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 175 B . ? PRO 189 B PRO 176 B ? PRO 190 B 1 8.07  
2 GLY 302 B . ? GLY 316 B GLY 303 B ? GLY 317 B 1 -6.75 
3 PRO 175 C . ? PRO 189 C PRO 176 C ? PRO 190 C 1 2.78  
4 PRO 175 D . ? PRO 189 D PRO 176 D ? PRO 190 D 1 -3.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 9 ? 
D ? 5 ? 
E ? 9 ? 
F ? 2 ? 
G ? 3 ? 
H ? 2 ? 
I ? 5 ? 
J ? 2 ? 
K ? 3 ? 
L ? 2 ? 
M ? 9 ? 
N ? 5 ? 
O ? 9 ? 
P ? 2 ? 
Q ? 3 ? 
R ? 2 ? 
S ? 5 ? 
T ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
C 7 8 ? parallel      
C 8 9 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
E 7 8 ? parallel      
E 8 9 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
M 6 7 ? parallel      
M 7 8 ? parallel      
M 8 9 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
N 4 5 ? parallel      
O 1 2 ? anti-parallel 
O 2 3 ? parallel      
O 3 4 ? parallel      
O 4 5 ? parallel      
O 5 6 ? parallel      
O 6 7 ? parallel      
O 7 8 ? parallel      
O 8 9 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? parallel      
S 2 3 ? parallel      
S 3 4 ? parallel      
S 4 5 ? parallel      
T 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 48  ? ILE A 50  ? GLU A 62  ILE A 64  
A 2 ASN A 72  ? CYS A 81  ? ASN A 86  CYS A 95  
A 3 VAL A 64  ? SER A 69  ? VAL A 78  SER A 83  
B 1 CYS A 52  ? VAL A 54  ? CYS A 66  VAL A 68  
B 2 GLU A 57  ? VAL A 59  ? GLU A 71  VAL A 73  
C 1 THR A 178 ? GLY A 185 ? THR A 192 GLY A 199 
C 2 THR A 528 ? GLU A 535 ? THR A 542 GLU A 549 
C 3 ASN B 489 ? ILE B 492 ? ASN B 503 ILE B 506 
C 4 THR B 465 ? PHE B 469 ? THR B 479 PHE B 483 
C 5 ASN B 305 ? VAL B 309 ? ASN B 319 VAL B 323 
C 6 CYS B 337 ? PRO B 343 ? CYS B 351 PRO B 357 
C 7 VAL B 438 ? TYR B 444 ? VAL B 452 TYR B 458 
C 8 CYS B 418 ? SER B 422 ? CYS B 432 SER B 436 
C 9 LEU B 399 ? ALA B 403 ? LEU B 413 ALA B 417 
D 1 ILE A 245 ? PHE A 247 ? ILE A 259 PHE A 261 
D 2 VAL A 215 ? LYS A 219 ? VAL A 229 LYS A 233 
D 3 PHE A 189 ? ILE A 193 ? PHE A 203 ILE A 207 
D 4 LEU A 265 ? GLY A 272 ? LEU A 279 GLY A 286 
D 5 ARG A 296 ? CYS A 301 ? ARG A 310 CYS A 315 
E 1 LEU A 399 ? ALA A 403 ? LEU A 413 ALA A 417 
E 2 CYS A 418 ? SER A 422 ? CYS A 432 SER A 436 
E 3 VAL A 438 ? TYR A 444 ? VAL A 452 TYR A 458 
E 4 CYS A 337 ? PRO A 343 ? CYS A 351 PRO A 357 
E 5 ASN A 305 ? VAL A 309 ? ASN A 319 VAL A 323 
E 6 THR A 465 ? PHE A 469 ? THR A 479 PHE A 483 
E 7 ASN A 489 ? ILE A 492 ? ASN A 503 ILE A 506 
E 8 THR B 528 ? THR B 536 ? THR B 542 THR B 550 
E 9 SER B 177 ? GLY B 185 ? SER B 191 GLY B 199 
F 1 CYS A 407 ? ASP A 408 ? CYS A 421 ASP A 422 
F 2 PHE A 414 ? VAL A 415 ? PHE A 428 VAL A 429 
G 1 GLU B 48  ? ALA B 49  ? GLU B 62  ALA B 63  
G 2 ASN B 72  ? CYS B 81  ? ASN B 86  CYS B 95  
G 3 VAL B 64  ? SER B 69  ? VAL B 78  SER B 83  
H 1 CYS B 52  ? VAL B 54  ? CYS B 66  VAL B 68  
H 2 GLU B 57  ? VAL B 59  ? GLU B 71  VAL B 73  
I 1 ILE B 245 ? PHE B 247 ? ILE B 259 PHE B 261 
I 2 VAL B 216 ? LYS B 219 ? VAL B 230 LYS B 233 
I 3 PHE B 189 ? ILE B 193 ? PHE B 203 ILE B 207 
I 4 LEU B 265 ? THR B 271 ? LEU B 279 THR B 285 
I 5 ARG B 296 ? GLU B 300 ? ARG B 310 GLU B 314 
J 1 CYS B 407 ? ASP B 408 ? CYS B 421 ASP B 422 
J 2 PHE B 414 ? VAL B 415 ? PHE B 428 VAL B 429 
K 1 GLU C 48  ? ALA C 49  ? GLU C 62  ALA C 63  
K 2 ASN C 72  ? CYS C 81  ? ASN C 86  CYS C 95  
K 3 VAL C 64  ? SER C 69  ? VAL C 78  SER C 83  
L 1 CYS C 52  ? VAL C 54  ? CYS C 66  VAL C 68  
L 2 GLU C 57  ? VAL C 59  ? GLU C 71  VAL C 73  
M 1 SER C 177 ? GLY C 185 ? SER C 191 GLY C 199 
M 2 THR C 528 ? THR C 536 ? THR C 542 THR C 550 
M 3 ASN D 489 ? ILE D 492 ? ASN D 503 ILE D 506 
M 4 THR D 465 ? PHE D 469 ? THR D 479 PHE D 483 
M 5 ASN D 305 ? VAL D 309 ? ASN D 319 VAL D 323 
M 6 CYS D 337 ? PRO D 343 ? CYS D 351 PRO D 357 
M 7 VAL D 438 ? TYR D 444 ? VAL D 452 TYR D 458 
M 8 CYS D 418 ? SER D 422 ? CYS D 432 SER D 436 
M 9 LEU D 399 ? ALA D 403 ? LEU D 413 ALA D 417 
N 1 ILE C 245 ? PHE C 247 ? ILE C 259 PHE C 261 
N 2 VAL C 216 ? LYS C 219 ? VAL C 230 LYS C 233 
N 3 PHE C 189 ? ILE C 193 ? PHE C 203 ILE C 207 
N 4 LEU C 265 ? THR C 271 ? LEU C 279 THR C 285 
N 5 ARG C 296 ? GLU C 300 ? ARG C 310 GLU C 314 
O 1 LEU C 399 ? ALA C 403 ? LEU C 413 ALA C 417 
O 2 CYS C 418 ? SER C 422 ? CYS C 432 SER C 436 
O 3 VAL C 438 ? TYR C 444 ? VAL C 452 TYR C 458 
O 4 CYS C 337 ? PRO C 343 ? CYS C 351 PRO C 357 
O 5 ASN C 305 ? VAL C 309 ? ASN C 319 VAL C 323 
O 6 THR C 465 ? PHE C 469 ? THR C 479 PHE C 483 
O 7 ASN C 489 ? ILE C 492 ? ASN C 503 ILE C 506 
O 8 THR D 528 ? THR D 536 ? THR D 542 THR D 550 
O 9 SER D 177 ? GLY D 185 ? SER D 191 GLY D 199 
P 1 CYS C 407 ? ASP C 408 ? CYS C 421 ASP C 422 
P 2 PHE C 414 ? VAL C 415 ? PHE C 428 VAL C 429 
Q 1 GLU D 48  ? ALA D 49  ? GLU D 62  ALA D 63  
Q 2 ASN D 72  ? CYS D 81  ? ASN D 86  CYS D 95  
Q 3 VAL D 64  ? SER D 69  ? VAL D 78  SER D 83  
R 1 CYS D 52  ? VAL D 54  ? CYS D 66  VAL D 68  
R 2 GLU D 57  ? VAL D 59  ? GLU D 71  VAL D 73  
S 1 ILE D 245 ? PHE D 247 ? ILE D 259 PHE D 261 
S 2 VAL D 215 ? LYS D 219 ? VAL D 229 LYS D 233 
S 3 PHE D 189 ? ILE D 193 ? PHE D 203 ILE D 207 
S 4 LEU D 265 ? GLY D 272 ? LEU D 279 GLY D 286 
S 5 ARG D 296 ? CYS D 301 ? ARG D 310 CYS D 315 
T 1 CYS D 407 ? ASP D 408 ? CYS D 421 ASP D 422 
T 2 PHE D 414 ? VAL D 415 ? PHE D 428 VAL D 429 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 50  ? N ILE A 64  O LYS A 79  ? O LYS A 93  
A 2 3 O PHE A 80  ? O PHE A 94  N GLN A 65  ? N GLN A 79  
B 1 2 N CYS A 52  ? N CYS A 66  O VAL A 59  ? O VAL A 73  
C 1 2 N VAL A 182 ? N VAL A 196 O GLN A 531 ? O GLN A 545 
C 2 3 N LYS A 534 ? N LYS A 548 O ILE B 492 ? O ILE B 506 
C 3 4 O TYR B 491 ? O TYR B 505 N GLY B 466 ? N GLY B 480 
C 4 5 O ALA B 467 ? O ALA B 481 N PHE B 308 ? N PHE B 322 
C 5 6 N ASN B 305 ? N ASN B 319 O SER B 338 ? O SER B 352 
C 6 7 N LEU B 340 ? N LEU B 354 O TYR B 442 ? O TYR B 456 
C 7 8 O LEU B 439 ? O LEU B 453 N CYS B 418 ? N CYS B 432 
C 8 9 O GLU B 421 ? O GLU B 435 N THR B 400 ? N THR B 414 
D 1 2 O GLN A 246 ? O GLN A 260 N VAL A 216 ? N VAL A 230 
D 2 3 O VAL A 215 ? O VAL A 229 N VAL A 190 ? N VAL A 204 
D 3 4 N ALA A 191 ? N ALA A 205 O GLY A 267 ? O GLY A 281 
D 4 5 N PHE A 270 ? N PHE A 284 O ALA A 298 ? O ALA A 312 
E 1 2 N LEU A 402 ? N LEU A 416 O ILE A 419 ? O ILE A 433 
E 2 3 N CYS A 418 ? N CYS A 432 O LEU A 439 ? O LEU A 453 
E 3 4 O TYR A 444 ? O TYR A 458 N VAL A 342 ? N VAL A 356 
E 4 5 O TYR A 341 ? O TYR A 355 N HIS A 307 ? N HIS A 321 
E 5 6 N PHE A 308 ? N PHE A 322 O ALA A 467 ? O ALA A 481 
E 6 7 N VAL A 468 ? N VAL A 482 O TYR A 491 ? O TYR A 505 
E 7 8 N ILE A 492 ? N ILE A 506 O LYS B 534 ? O LYS B 548 
E 8 9 O GLN B 531 ? O GLN B 545 N VAL B 182 ? N VAL B 196 
F 1 2 N ASP A 408 ? N ASP A 422 O PHE A 414 ? O PHE A 428 
G 1 2 N GLU B 48  ? N GLU B 62  O LYS B 79  ? O LYS B 93  
G 2 3 O PHE B 80  ? O PHE B 94  N GLN B 65  ? N GLN B 79  
H 1 2 N CYS B 52  ? N CYS B 66  O VAL B 59  ? O VAL B 73  
I 1 2 O GLN B 246 ? O GLN B 260 N VAL B 216 ? N VAL B 230 
I 2 3 O LYS B 219 ? O LYS B 233 N ALA B 192 ? N ALA B 206 
I 3 4 N ALA B 191 ? N ALA B 205 O GLY B 267 ? O GLY B 281 
I 4 5 N PHE B 270 ? N PHE B 284 O ALA B 298 ? O ALA B 312 
J 1 2 N ASP B 408 ? N ASP B 422 O PHE B 414 ? O PHE B 428 
K 1 2 N GLU C 48  ? N GLU C 62  O LYS C 79  ? O LYS C 93  
K 2 3 O PHE C 80  ? O PHE C 94  N GLN C 65  ? N GLN C 79  
L 1 2 N CYS C 52  ? N CYS C 66  O VAL C 59  ? O VAL C 73  
M 1 2 N THR C 178 ? N THR C 192 O GLU C 535 ? O GLU C 549 
M 2 3 N VAL C 532 ? N VAL C 546 O PHE D 490 ? O PHE D 504 
M 3 4 O TYR D 491 ? O TYR D 505 N GLY D 466 ? N GLY D 480 
M 4 5 O ALA D 467 ? O ALA D 481 N PHE D 308 ? N PHE D 322 
M 5 6 N ASN D 305 ? N ASN D 319 O SER D 338 ? O SER D 352 
M 6 7 N LEU D 340 ? N LEU D 354 O TYR D 442 ? O TYR D 456 
M 7 8 O LEU D 439 ? O LEU D 453 N VAL D 420 ? N VAL D 434 
M 8 9 O GLU D 421 ? O GLU D 435 N THR D 400 ? N THR D 414 
N 1 2 O GLN C 246 ? O GLN C 260 N VAL C 216 ? N VAL C 230 
N 2 3 O LYS C 219 ? O LYS C 233 N ALA C 192 ? N ALA C 206 
N 3 4 N ALA C 191 ? N ALA C 205 O GLY C 267 ? O GLY C 281 
N 4 5 N PHE C 270 ? N PHE C 284 O ALA C 298 ? O ALA C 312 
O 1 2 N THR C 400 ? N THR C 414 O GLU C 421 ? O GLU C 435 
O 2 3 N VAL C 420 ? N VAL C 434 O LEU C 439 ? O LEU C 453 
O 3 4 O TYR C 442 ? O TYR C 456 N LEU C 340 ? N LEU C 354 
O 4 5 O SER C 338 ? O SER C 352 N ASN C 305 ? N ASN C 319 
O 5 6 N PHE C 308 ? N PHE C 322 O ALA C 467 ? O ALA C 481 
O 6 7 N GLY C 466 ? N GLY C 480 O TYR C 491 ? O TYR C 505 
O 7 8 N PHE C 490 ? N PHE C 504 O VAL D 532 ? O VAL D 546 
O 8 9 O GLN D 531 ? O GLN D 545 N VAL D 182 ? N VAL D 196 
P 1 2 N ASP C 408 ? N ASP C 422 O PHE C 414 ? O PHE C 428 
Q 1 2 N GLU D 48  ? N GLU D 62  O LYS D 79  ? O LYS D 93  
Q 2 3 O PHE D 80  ? O PHE D 94  N GLN D 65  ? N GLN D 79  
R 1 2 N CYS D 52  ? N CYS D 66  O VAL D 59  ? O VAL D 73  
S 1 2 O GLN D 246 ? O GLN D 260 N VAL D 216 ? N VAL D 230 
S 2 3 O LYS D 219 ? O LYS D 233 N ALA D 192 ? N ALA D 206 
S 3 4 N ALA D 191 ? N ALA D 205 O GLY D 267 ? O GLY D 281 
S 4 5 N PHE D 270 ? N PHE D 284 O ALA D 298 ? O ALA D 312 
T 1 2 N ASP D 408 ? N ASP D 422 O PHE D 414 ? O PHE D 428 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE 1PE A 601' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 601'  
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE 1PE B 602' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE 1PE C 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 MET A 47 ? MET A 61  . ? 1_555 ? 
2  AC1 5 ALA A 49 ? ALA A 63  . ? 1_555 ? 
3  AC1 5 TRP A 60 ? TRP A 74  . ? 1_555 ? 
4  AC1 5 TYR A 66 ? TYR A 80  . ? 1_555 ? 
5  AC1 5 LYS A 79 ? LYS A 93  . ? 1_555 ? 
6  AC2 6 HOH J .  ? HOH B 758 . ? 1_555 ? 
7  AC2 6 HOH J .  ? HOH B 759 . ? 1_555 ? 
8  AC2 6 HOH J .  ? HOH B 760 . ? 1_555 ? 
9  AC2 6 HOH J .  ? HOH B 761 . ? 1_555 ? 
10 AC2 6 HOH J .  ? HOH B 762 . ? 1_555 ? 
11 AC2 6 HOH J .  ? HOH B 763 . ? 1_555 ? 
12 AC3 3 ALA B 49 ? ALA B 63  . ? 1_555 ? 
13 AC3 3 TRP B 60 ? TRP B 74  . ? 1_555 ? 
14 AC3 3 LYS B 79 ? LYS B 93  . ? 1_555 ? 
15 AC4 5 MET C 47 ? MET C 61  . ? 1_555 ? 
16 AC4 5 ALA C 49 ? ALA C 63  . ? 1_555 ? 
17 AC4 5 TRP C 60 ? TRP C 74  . ? 1_555 ? 
18 AC4 5 TYR C 66 ? TYR C 80  . ? 1_555 ? 
19 AC4 5 LYS C 79 ? LYS C 93  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4OE5 
_atom_sites.fract_transf_matrix[1][1]   0.010874 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002757 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008242 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011046 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ARG A 1 9   ? 33.368  -14.636 -5.750  1.00 58.40 ? 23  ARG A N   1 
ATOM   2     C  CA  . ARG A 1 9   ? 32.240  -15.550 -5.576  1.00 49.40 ? 23  ARG A CA  1 
ATOM   3     C  C   . ARG A 1 9   ? 30.917  -14.937 -6.055  1.00 47.84 ? 23  ARG A C   1 
ATOM   4     O  O   . ARG A 1 9   ? 30.866  -13.785 -6.510  1.00 41.89 ? 23  ARG A O   1 
ATOM   5     C  CB  . ARG A 1 9   ? 32.126  -16.021 -4.118  1.00 48.01 ? 23  ARG A CB  1 
ATOM   6     N  N   . TRP A 1 10  ? 29.852  -15.724 -5.953  1.00 43.07 ? 24  TRP A N   1 
ATOM   7     C  CA  . TRP A 1 10  ? 28.534  -15.307 -6.420  1.00 40.68 ? 24  TRP A CA  1 
ATOM   8     C  C   . TRP A 1 10  ? 27.445  -16.099 -5.708  1.00 41.56 ? 24  TRP A C   1 
ATOM   9     O  O   . TRP A 1 10  ? 27.679  -17.223 -5.271  1.00 40.81 ? 24  TRP A O   1 
ATOM   10    C  CB  . TRP A 1 10  ? 28.422  -15.549 -7.922  1.00 40.82 ? 24  TRP A CB  1 
ATOM   11    C  CG  . TRP A 1 10  ? 28.500  -17.002 -8.302  1.00 41.48 ? 24  TRP A CG  1 
ATOM   12    C  CD1 . TRP A 1 10  ? 29.620  -17.700 -8.647  1.00 42.94 ? 24  TRP A CD1 1 
ATOM   13    C  CD2 . TRP A 1 10  ? 27.414  -17.931 -8.371  1.00 44.14 ? 24  TRP A CD2 1 
ATOM   14    N  NE1 . TRP A 1 10  ? 29.298  -19.001 -8.934  1.00 43.23 ? 24  TRP A NE1 1 
ATOM   15    C  CE2 . TRP A 1 10  ? 27.948  -19.169 -8.769  1.00 44.80 ? 24  TRP A CE2 1 
ATOM   16    C  CE3 . TRP A 1 10  ? 26.037  -17.835 -8.134  1.00 45.82 ? 24  TRP A CE3 1 
ATOM   17    C  CZ2 . TRP A 1 10  ? 27.159  -20.305 -8.938  1.00 46.50 ? 24  TRP A CZ2 1 
ATOM   18    C  CZ3 . TRP A 1 10  ? 25.253  -18.966 -8.303  1.00 45.02 ? 24  TRP A CZ3 1 
ATOM   19    C  CH2 . TRP A 1 10  ? 25.818  -20.185 -8.699  1.00 44.44 ? 24  TRP A CH2 1 
ATOM   20    N  N   . LYS A 1 11  ? 26.247  -15.530 -5.610  1.00 40.65 ? 25  LYS A N   1 
ATOM   21    C  CA  . LYS A 1 11  ? 25.130  -16.251 -5.003  1.00 37.94 ? 25  LYS A CA  1 
ATOM   22    C  C   . LYS A 1 11  ? 23.838  -16.025 -5.774  1.00 41.19 ? 25  LYS A C   1 
ATOM   23    O  O   . LYS A 1 11  ? 23.718  -15.060 -6.525  1.00 44.41 ? 25  LYS A O   1 
ATOM   24    C  CB  . LYS A 1 11  ? 24.934  -15.811 -3.546  1.00 33.26 ? 25  LYS A CB  1 
ATOM   25    N  N   . HIS A 1 12  ? 22.876  -16.922 -5.580  1.00 41.07 ? 26  HIS A N   1 
ATOM   26    C  CA  . HIS A 1 12  ? 21.510  -16.675 -6.021  1.00 44.38 ? 26  HIS A CA  1 
ATOM   27    C  C   . HIS A 1 12  ? 20.822  -15.781 -4.997  1.00 44.45 ? 26  HIS A C   1 
ATOM   28    O  O   . HIS A 1 12  ? 21.043  -15.926 -3.799  1.00 44.09 ? 26  HIS A O   1 
ATOM   29    C  CB  . HIS A 1 12  ? 20.728  -17.982 -6.136  1.00 43.62 ? 26  HIS A CB  1 
ATOM   30    C  CG  . HIS A 1 12  ? 21.307  -18.955 -7.111  1.00 48.11 ? 26  HIS A CG  1 
ATOM   31    N  ND1 . HIS A 1 12  ? 21.259  -18.762 -8.476  1.00 53.80 ? 26  HIS A ND1 1 
ATOM   32    C  CD2 . HIS A 1 12  ? 21.933  -20.142 -6.922  1.00 51.22 ? 26  HIS A CD2 1 
ATOM   33    C  CE1 . HIS A 1 12  ? 21.840  -19.779 -9.083  1.00 57.69 ? 26  HIS A CE1 1 
ATOM   34    N  NE2 . HIS A 1 12  ? 22.257  -20.633 -8.163  1.00 55.56 ? 26  HIS A NE2 1 
ATOM   35    N  N   . THR A 1 13  ? 20.002  -14.846 -5.465  1.00 46.15 ? 27  THR A N   1 
ATOM   36    C  CA  . THR A 1 13  ? 19.128  -14.103 -4.569  1.00 44.66 ? 27  THR A CA  1 
ATOM   37    C  C   . THR A 1 13  ? 17.773  -14.784 -4.599  1.00 49.62 ? 27  THR A C   1 
ATOM   38    O  O   . THR A 1 13  ? 17.509  -15.625 -5.459  1.00 48.20 ? 27  THR A O   1 
ATOM   39    C  CB  . THR A 1 13  ? 18.948  -12.633 -5.002  1.00 50.44 ? 27  THR A CB  1 
ATOM   40    O  OG1 . THR A 1 13  ? 18.336  -12.582 -6.297  1.00 56.26 ? 27  THR A OG1 1 
ATOM   41    C  CG2 . THR A 1 13  ? 20.282  -11.903 -5.042  1.00 51.14 ? 27  THR A CG2 1 
ATOM   42    N  N   . SER A 1 14  ? 16.905  -14.425 -3.667  1.00 50.49 ? 28  SER A N   1 
ATOM   43    C  CA  . SER A 1 14  ? 15.579  -15.016 -3.649  1.00 50.74 ? 28  SER A CA  1 
ATOM   44    C  C   . SER A 1 14  ? 14.512  -13.941 -3.521  1.00 48.39 ? 28  SER A C   1 
ATOM   45    O  O   . SER A 1 14  ? 14.598  -13.057 -2.665  1.00 50.25 ? 28  SER A O   1 
ATOM   46    C  CB  . SER A 1 14  ? 15.457  -16.031 -2.514  1.00 52.72 ? 28  SER A CB  1 
ATOM   47    O  OG  . SER A 1 14  ? 14.455  -16.983 -2.811  1.00 55.72 ? 28  SER A OG  1 
ATOM   48    N  N   . SER A 1 15  ? 13.515  -14.011 -4.392  1.00 44.19 ? 29  SER A N   1 
ATOM   49    C  CA  . SER A 1 15  ? 12.395  -13.086 -4.338  1.00 40.80 ? 29  SER A CA  1 
ATOM   50    C  C   . SER A 1 15  ? 11.114  -13.855 -4.629  1.00 40.78 ? 29  SER A C   1 
ATOM   51    O  O   . SER A 1 15  ? 11.145  -15.056 -4.933  1.00 33.16 ? 29  SER A O   1 
ATOM   52    C  CB  . SER A 1 15  ? 12.580  -11.950 -5.346  1.00 42.31 ? 29  SER A CB  1 
ATOM   53    N  N   . LEU A 1 16  ? 9.997   -13.146 -4.535  1.00 36.24 ? 30  LEU A N   1 
ATOM   54    C  CA  . LEU A 1 16  ? 8.682   -13.732 -4.666  1.00 35.40 ? 30  LEU A CA  1 
ATOM   55    C  C   . LEU A 1 16  ? 7.834   -12.731 -5.429  1.00 37.56 ? 30  LEU A C   1 
ATOM   56    O  O   . LEU A 1 16  ? 7.647   -11.606 -4.975  1.00 42.79 ? 30  LEU A O   1 
ATOM   57    C  CB  . LEU A 1 16  ? 8.092   -13.954 -3.275  1.00 35.61 ? 30  LEU A CB  1 
ATOM   58    C  CG  . LEU A 1 16  ? 7.247   -15.189 -2.985  1.00 40.90 ? 30  LEU A CG  1 
ATOM   59    C  CD1 . LEU A 1 16  ? 7.865   -16.437 -3.582  1.00 46.07 ? 30  LEU A CD1 1 
ATOM   60    C  CD2 . LEU A 1 16  ? 7.086   -15.347 -1.486  1.00 37.91 ? 30  LEU A CD2 1 
ATOM   61    N  N   . LYS A 1 17  ? 7.348   -13.121 -6.601  1.00 34.80 ? 31  LYS A N   1 
ATOM   62    C  CA  . LYS A 1 17  ? 6.440   -12.258 -7.355  1.00 29.54 ? 31  LYS A CA  1 
ATOM   63    C  C   . LYS A 1 17  ? 5.023   -12.570 -6.901  1.00 33.57 ? 31  LYS A C   1 
ATOM   64    O  O   . LYS A 1 17  ? 4.628   -13.733 -6.862  1.00 35.59 ? 31  LYS A O   1 
ATOM   65    C  CB  . LYS A 1 17  ? 6.600   -12.486 -8.858  1.00 30.15 ? 31  LYS A CB  1 
ATOM   66    N  N   . VAL A 1 18  ? 4.267   -11.542 -6.523  1.00 35.28 ? 32  VAL A N   1 
ATOM   67    C  CA  . VAL A 1 18  ? 2.935   -11.765 -5.969  1.00 34.43 ? 32  VAL A CA  1 
ATOM   68    C  C   . VAL A 1 18  ? 1.900   -10.840 -6.601  1.00 37.15 ? 32  VAL A C   1 
ATOM   69    O  O   . VAL A 1 18  ? 2.110   -9.629  -6.699  1.00 33.52 ? 32  VAL A O   1 
ATOM   70    C  CB  . VAL A 1 18  ? 2.907   -11.597 -4.428  1.00 34.14 ? 32  VAL A CB  1 
ATOM   71    C  CG1 . VAL A 1 18  ? 1.476   -11.711 -3.897  1.00 36.37 ? 32  VAL A CG1 1 
ATOM   72    C  CG2 . VAL A 1 18  ? 3.812   -12.617 -3.751  1.00 30.01 ? 32  VAL A CG2 1 
ATOM   73    N  N   . ALA A 1 19  ? 0.789   -11.424 -7.040  1.00 35.70 ? 33  ALA A N   1 
ATOM   74    C  CA  . ALA A 1 19  ? -0.332  -10.653 -7.551  1.00 32.59 ? 33  ALA A CA  1 
ATOM   75    C  C   . ALA A 1 19  ? -1.427  -10.590 -6.492  1.00 31.90 ? 33  ALA A C   1 
ATOM   76    O  O   . ALA A 1 19  ? -1.516  -11.468 -5.637  1.00 30.38 ? 33  ALA A O   1 
ATOM   77    C  CB  . ALA A 1 19  ? -0.864  -11.281 -8.824  1.00 39.77 ? 33  ALA A CB  1 
ATOM   78    N  N   . ASN A 1 20  ? -2.251  -9.548  -6.543  1.00 34.31 ? 34  ASN A N   1 
ATOM   79    C  CA  . ASN A 1 20  ? -3.374  -9.423  -5.625  1.00 34.02 ? 34  ASN A CA  1 
ATOM   80    C  C   . ASN A 1 20  ? -4.400  -10.515 -5.888  1.00 28.97 ? 34  ASN A C   1 
ATOM   81    O  O   . ASN A 1 20  ? -4.558  -10.961 -7.015  1.00 30.76 ? 34  ASN A O   1 
ATOM   82    C  CB  . ASN A 1 20  ? -4.031  -8.043  -5.753  1.00 36.97 ? 34  ASN A CB  1 
ATOM   83    C  CG  . ASN A 1 20  ? -3.157  -6.928  -5.204  1.00 42.40 ? 34  ASN A CG  1 
ATOM   84    O  OD1 . ASN A 1 20  ? -2.458  -6.251  -5.953  1.00 47.82 ? 34  ASN A OD1 1 
ATOM   85    N  ND2 . ASN A 1 20  ? -3.191  -6.736  -3.886  1.00 39.14 ? 34  ASN A ND2 1 
ATOM   86    N  N   . GLU A 1 21  ? -5.071  -10.967 -4.838  1.00 27.40 ? 35  GLU A N   1 
ATOM   87    C  CA  . GLU A 1 21  ? -6.143  -11.933 -4.983  1.00 25.33 ? 35  GLU A CA  1 
ATOM   88    C  C   . GLU A 1 21  ? -7.350  -11.229 -5.623  1.00 27.17 ? 35  GLU A C   1 
ATOM   89    O  O   . GLU A 1 21  ? -7.788  -10.194 -5.138  1.00 29.11 ? 35  GLU A O   1 
ATOM   90    C  CB  . GLU A 1 21  ? -6.501  -12.511 -3.611  1.00 26.31 ? 35  GLU A CB  1 
ATOM   91    C  CG  . GLU A 1 21  ? -7.596  -13.549 -3.619  1.00 27.88 ? 35  GLU A CG  1 
ATOM   92    C  CD  . GLU A 1 21  ? -7.219  -14.849 -4.312  1.00 30.24 ? 35  GLU A CD  1 
ATOM   93    O  OE1 . GLU A 1 21  ? -6.016  -15.124 -4.523  1.00 27.86 ? 35  GLU A OE1 1 
ATOM   94    O  OE2 . GLU A 1 21  ? -8.152  -15.608 -4.652  1.00 34.90 ? 35  GLU A OE2 1 
ATOM   95    N  N   . PRO A 1 22  ? -7.867  -11.771 -6.734  1.00 29.87 ? 36  PRO A N   1 
ATOM   96    C  CA  . PRO A 1 22  ? -9.037  -11.120 -7.333  1.00 32.90 ? 36  PRO A CA  1 
ATOM   97    C  C   . PRO A 1 22  ? -10.261 -11.209 -6.422  1.00 34.38 ? 36  PRO A C   1 
ATOM   98    O  O   . PRO A 1 22  ? -10.392 -12.129 -5.605  1.00 29.94 ? 36  PRO A O   1 
ATOM   99    C  CB  . PRO A 1 22  ? -9.251  -11.898 -8.636  1.00 40.13 ? 36  PRO A CB  1 
ATOM   100   C  CG  . PRO A 1 22  ? -8.579  -13.206 -8.416  1.00 41.52 ? 36  PRO A CG  1 
ATOM   101   C  CD  . PRO A 1 22  ? -7.421  -12.942 -7.502  1.00 33.67 ? 36  PRO A CD  1 
ATOM   102   N  N   . VAL A 1 23  ? -11.139 -10.222 -6.543  1.00 30.62 ? 37  VAL A N   1 
ATOM   103   C  CA  . VAL A 1 23  ? -12.368 -10.186 -5.768  1.00 31.30 ? 37  VAL A CA  1 
ATOM   104   C  C   . VAL A 1 23  ? -13.478 -10.679 -6.693  1.00 34.67 ? 37  VAL A C   1 
ATOM   105   O  O   . VAL A 1 23  ? -13.668 -10.126 -7.770  1.00 28.70 ? 37  VAL A O   1 
ATOM   106   C  CB  . VAL A 1 23  ? -12.633 -8.752  -5.277  1.00 38.81 ? 37  VAL A CB  1 
ATOM   107   C  CG1 . VAL A 1 23  ? -13.949 -8.653  -4.522  1.00 34.70 ? 37  VAL A CG1 1 
ATOM   108   C  CG2 . VAL A 1 23  ? -11.471 -8.282  -4.410  1.00 38.23 ? 37  VAL A CG2 1 
ATOM   109   N  N   . LEU A 1 24  ? -14.176 -11.744 -6.302  1.00 34.00 ? 38  LEU A N   1 
ATOM   110   C  CA  . LEU A 1 24  ? -15.138 -12.381 -7.206  1.00 36.17 ? 38  LEU A CA  1 
ATOM   111   C  C   . LEU A 1 24  ? -16.475 -11.652 -7.195  1.00 34.39 ? 38  LEU A C   1 
ATOM   112   O  O   . LEU A 1 24  ? -16.799 -10.944 -6.237  1.00 38.51 ? 38  LEU A O   1 
ATOM   113   C  CB  . LEU A 1 24  ? -15.336 -13.854 -6.841  1.00 41.13 ? 38  LEU A CB  1 
ATOM   114   C  CG  . LEU A 1 24  ? -14.044 -14.667 -6.732  1.00 40.37 ? 38  LEU A CG  1 
ATOM   115   C  CD1 . LEU A 1 24  ? -14.308 -16.028 -6.124  1.00 34.23 ? 38  LEU A CD1 1 
ATOM   116   C  CD2 . LEU A 1 24  ? -13.393 -14.801 -8.100  1.00 43.24 ? 38  LEU A CD2 1 
ATOM   117   N  N   . ALA A 1 25  ? -17.250 -11.834 -8.256  1.00 34.02 ? 39  ALA A N   1 
ATOM   118   C  CA  . ALA A 1 25  ? -18.495 -11.092 -8.421  1.00 34.56 ? 39  ALA A CA  1 
ATOM   119   C  C   . ALA A 1 25  ? -19.701 -11.762 -7.749  1.00 36.02 ? 39  ALA A C   1 
ATOM   120   O  O   . ALA A 1 25  ? -20.620 -11.077 -7.314  1.00 37.55 ? 39  ALA A O   1 
ATOM   121   C  CB  . ALA A 1 25  ? -18.773 -10.840 -9.905  1.00 35.40 ? 39  ALA A CB  1 
ATOM   122   N  N   . PHE A 1 26  ? -19.696 -13.091 -7.681  1.00 36.22 ? 40  PHE A N   1 
ATOM   123   C  CA  . PHE A 1 26  ? -20.800 -13.854 -7.077  1.00 35.28 ? 40  PHE A CA  1 
ATOM   124   C  C   . PHE A 1 26  ? -22.140 -13.664 -7.785  1.00 31.88 ? 40  PHE A C   1 
ATOM   125   O  O   . PHE A 1 26  ? -23.210 -13.695 -7.168  1.00 30.88 ? 40  PHE A O   1 
ATOM   126   C  CB  . PHE A 1 26  ? -20.907 -13.571 -5.577  1.00 38.82 ? 40  PHE A CB  1 
ATOM   127   C  CG  . PHE A 1 26  ? -19.737 -14.088 -4.799  1.00 38.41 ? 40  PHE A CG  1 
ATOM   128   C  CD1 . PHE A 1 26  ? -19.713 -15.408 -4.360  1.00 39.77 ? 40  PHE A CD1 1 
ATOM   129   C  CD2 . PHE A 1 26  ? -18.636 -13.278 -4.551  1.00 31.99 ? 40  PHE A CD2 1 
ATOM   130   C  CE1 . PHE A 1 26  ? -18.620 -15.904 -3.662  1.00 33.64 ? 40  PHE A CE1 1 
ATOM   131   C  CE2 . PHE A 1 26  ? -17.549 -13.764 -3.851  1.00 31.36 ? 40  PHE A CE2 1 
ATOM   132   C  CZ  . PHE A 1 26  ? -17.538 -15.078 -3.409  1.00 31.07 ? 40  PHE A CZ  1 
ATOM   133   N  N   . THR A 1 27  ? -22.060 -13.467 -9.090  1.00 31.22 ? 41  THR A N   1 
ATOM   134   C  CA  . THR A 1 27  ? -23.243 -13.388 -9.935  1.00 37.53 ? 41  THR A CA  1 
ATOM   135   C  C   . THR A 1 27  ? -24.040 -14.695 -9.863  1.00 36.77 ? 41  THR A C   1 
ATOM   136   O  O   . THR A 1 27  ? -23.458 -15.773 -9.709  1.00 37.83 ? 41  THR A O   1 
ATOM   137   C  CB  . THR A 1 27  ? -22.839 -13.109 -11.404 1.00 45.69 ? 41  THR A CB  1 
ATOM   138   O  OG1 . THR A 1 27  ? -22.055 -14.202 -11.906 1.00 55.05 ? 41  THR A OG1 1 
ATOM   139   C  CG2 . THR A 1 27  ? -22.013 -11.831 -11.499 1.00 37.43 ? 41  THR A CG2 1 
ATOM   140   N  N   . GLN A 1 28  ? -25.369 -14.605 -9.962  1.00 37.31 ? 42  GLN A N   1 
ATOM   141   C  CA  . GLN A 1 28  ? -26.205 -15.803 -10.023 1.00 39.06 ? 42  GLN A CA  1 
ATOM   142   C  C   . GLN A 1 28  ? -25.766 -16.706 -11.171 1.00 45.30 ? 42  GLN A C   1 
ATOM   143   O  O   . GLN A 1 28  ? -25.528 -16.243 -12.283 1.00 45.82 ? 42  GLN A O   1 
ATOM   144   C  CB  . GLN A 1 28  ? -27.694 -15.453 -10.152 1.00 44.05 ? 42  GLN A CB  1 
ATOM   145   C  CG  . GLN A 1 28  ? -28.294 -14.746 -8.931  1.00 46.06 ? 42  GLN A CG  1 
ATOM   146   C  CD  . GLN A 1 28  ? -29.804 -14.585 -9.030  1.00 48.19 ? 42  GLN A CD  1 
ATOM   147   O  OE1 . GLN A 1 28  ? -30.468 -15.309 -9.781  1.00 44.40 ? 42  GLN A OE1 1 
ATOM   148   N  NE2 . GLN A 1 28  ? -30.354 -13.631 -8.275  1.00 47.12 ? 42  GLN A NE2 1 
ATOM   149   N  N   . GLY A 1 29  ? -25.637 -17.996 -10.885 1.00 49.97 ? 43  GLY A N   1 
ATOM   150   C  CA  . GLY A 1 29  ? -25.148 -18.940 -11.871 1.00 45.98 ? 43  GLY A CA  1 
ATOM   151   C  C   . GLY A 1 29  ? -23.650 -19.175 -11.785 1.00 41.93 ? 43  GLY A C   1 
ATOM   152   O  O   . GLY A 1 29  ? -23.137 -20.128 -12.363 1.00 47.16 ? 43  GLY A O   1 
ATOM   153   N  N   . SER A 1 30  ? -22.929 -18.311 -11.075 1.00 37.22 ? 44  SER A N   1 
ATOM   154   C  CA  . SER A 1 30  ? -21.476 -18.479 -11.002 1.00 37.27 ? 44  SER A CA  1 
ATOM   155   C  C   . SER A 1 30  ? -21.122 -19.625 -10.059 1.00 41.37 ? 44  SER A C   1 
ATOM   156   O  O   . SER A 1 30  ? -21.847 -19.888 -9.096  1.00 45.32 ? 44  SER A O   1 
ATOM   157   C  CB  . SER A 1 30  ? -20.784 -17.181 -10.563 1.00 38.85 ? 44  SER A CB  1 
ATOM   158   O  OG  . SER A 1 30  ? -21.145 -16.830 -9.236  1.00 37.90 ? 44  SER A OG  1 
ATOM   159   N  N   . PRO A 1 31  ? -20.005 -20.314 -10.336 1.00 45.66 ? 45  PRO A N   1 
ATOM   160   C  CA  . PRO A 1 31  ? -19.513 -21.381 -9.455  1.00 51.42 ? 45  PRO A CA  1 
ATOM   161   C  C   . PRO A 1 31  ? -19.272 -20.916 -8.012  1.00 42.30 ? 45  PRO A C   1 
ATOM   162   O  O   . PRO A 1 31  ? -19.571 -21.659 -7.070  1.00 35.93 ? 45  PRO A O   1 
ATOM   163   C  CB  . PRO A 1 31  ? -18.181 -21.791 -10.108 1.00 56.39 ? 45  PRO A CB  1 
ATOM   164   C  CG  . PRO A 1 31  ? -17.825 -20.652 -11.035 1.00 54.65 ? 45  PRO A CG  1 
ATOM   165   C  CD  . PRO A 1 31  ? -19.142 -20.134 -11.516 1.00 46.41 ? 45  PRO A CD  1 
ATOM   166   N  N   . GLU A 1 32  ? -18.736 -19.710 -7.838  1.00 36.11 ? 46  GLU A N   1 
ATOM   167   C  CA  . GLU A 1 32  ? -18.431 -19.236 -6.493  1.00 36.13 ? 46  GLU A CA  1 
ATOM   168   C  C   . GLU A 1 32  ? -19.709 -18.970 -5.712  1.00 29.89 ? 46  GLU A C   1 
ATOM   169   O  O   . GLU A 1 32  ? -19.762 -19.188 -4.497  1.00 30.20 ? 46  GLU A O   1 
ATOM   170   C  CB  . GLU A 1 32  ? -17.516 -18.009 -6.507  1.00 40.79 ? 46  GLU A CB  1 
ATOM   171   C  CG  . GLU A 1 32  ? -18.138 -16.768 -7.101  1.00 42.65 ? 46  GLU A CG  1 
ATOM   172   C  CD  . GLU A 1 32  ? -17.863 -16.612 -8.582  1.00 46.68 ? 46  GLU A CD  1 
ATOM   173   O  OE1 . GLU A 1 32  ? -18.012 -15.471 -9.076  1.00 48.30 ? 46  GLU A OE1 1 
ATOM   174   O  OE2 . GLU A 1 32  ? -17.509 -17.616 -9.248  1.00 45.16 ? 46  GLU A OE2 1 
ATOM   175   N  N   . ARG A 1 33  ? -20.753 -18.528 -6.409  1.00 32.91 ? 47  ARG A N   1 
ATOM   176   C  CA  . ARG A 1 33  ? -22.031 -18.321 -5.754  1.00 34.00 ? 47  ARG A CA  1 
ATOM   177   C  C   . ARG A 1 33  ? -22.639 -19.673 -5.396  1.00 33.34 ? 47  ARG A C   1 
ATOM   178   O  O   . ARG A 1 33  ? -23.097 -19.864 -4.279  1.00 33.58 ? 47  ARG A O   1 
ATOM   179   C  CB  . ARG A 1 33  ? -22.996 -17.512 -6.619  1.00 33.10 ? 47  ARG A CB  1 
ATOM   180   C  CG  . ARG A 1 33  ? -24.182 -16.973 -5.823  1.00 35.78 ? 47  ARG A CG  1 
ATOM   181   C  CD  . ARG A 1 33  ? -25.142 -16.243 -6.724  1.00 46.86 ? 47  ARG A CD  1 
ATOM   182   N  NE  . ARG A 1 33  ? -26.393 -15.907 -6.051  1.00 55.53 ? 47  ARG A NE  1 
ATOM   183   C  CZ  . ARG A 1 33  ? -26.801 -14.667 -5.804  1.00 51.20 ? 47  ARG A CZ  1 
ATOM   184   N  NH1 . ARG A 1 33  ? -26.061 -13.635 -6.177  1.00 46.07 ? 47  ARG A NH1 1 
ATOM   185   N  NH2 . ARG A 1 33  ? -27.956 -14.459 -5.190  1.00 54.38 ? 47  ARG A NH2 1 
ATOM   186   N  N   . ASP A 1 34  ? -22.631 -20.601 -6.347  1.00 32.19 ? 48  ASP A N   1 
ATOM   187   C  CA  . ASP A 1 34  ? -23.031 -21.977 -6.074  1.00 38.70 ? 48  ASP A CA  1 
ATOM   188   C  C   . ASP A 1 34  ? -22.307 -22.533 -4.835  1.00 34.41 ? 48  ASP A C   1 
ATOM   189   O  O   . ASP A 1 34  ? -22.951 -23.036 -3.915  1.00 33.68 ? 48  ASP A O   1 
ATOM   190   C  CB  . ASP A 1 34  ? -22.763 -22.873 -7.294  1.00 48.84 ? 48  ASP A CB  1 
ATOM   191   C  CG  . ASP A 1 34  ? -23.691 -22.573 -8.469  1.00 61.56 ? 48  ASP A CG  1 
ATOM   192   O  OD1 . ASP A 1 34  ? -24.683 -21.831 -8.293  1.00 62.48 ? 48  ASP A OD1 1 
ATOM   193   O  OD2 . ASP A 1 34  ? -23.430 -23.096 -9.576  1.00 66.53 ? 48  ASP A OD2 1 
ATOM   194   N  N   . ALA A 1 35  ? -20.978 -22.419 -4.799  1.00 35.35 ? 49  ALA A N   1 
ATOM   195   C  CA  . ALA A 1 35  ? -20.200 -22.882 -3.642  1.00 32.55 ? 49  ALA A CA  1 
ATOM   196   C  C   . ALA A 1 35  ? -20.597 -22.189 -2.337  1.00 31.33 ? 49  ALA A C   1 
ATOM   197   O  O   . ALA A 1 35  ? -20.729 -22.830 -1.293  1.00 27.88 ? 49  ALA A O   1 
ATOM   198   C  CB  . ALA A 1 35  ? -18.710 -22.703 -3.891  1.00 38.14 ? 49  ALA A CB  1 
ATOM   199   N  N   . LEU A 1 36  ? -20.791 -20.877 -2.388  1.00 32.43 ? 50  LEU A N   1 
ATOM   200   C  CA  . LEU A 1 36  ? -21.130 -20.134 -1.178  1.00 33.93 ? 50  LEU A CA  1 
ATOM   201   C  C   . LEU A 1 36  ? -22.519 -20.525 -0.660  1.00 36.50 ? 50  LEU A C   1 
ATOM   202   O  O   . LEU A 1 36  ? -22.709 -20.733 0.546   1.00 30.10 ? 50  LEU A O   1 
ATOM   203   C  CB  . LEU A 1 36  ? -21.054 -18.623 -1.422  1.00 24.81 ? 50  LEU A CB  1 
ATOM   204   C  CG  . LEU A 1 36  ? -21.456 -17.739 -0.241  1.00 26.38 ? 50  LEU A CG  1 
ATOM   205   C  CD1 . LEU A 1 36  ? -20.570 -17.989 0.975   1.00 23.59 ? 50  LEU A CD1 1 
ATOM   206   C  CD2 . LEU A 1 36  ? -21.380 -16.266 -0.647  1.00 31.11 ? 50  LEU A CD2 1 
ATOM   207   N  N   . GLN A 1 37  ? -23.479 -20.636 -1.576  1.00 32.39 ? 51  GLN A N   1 
ATOM   208   C  CA  . GLN A 1 37  ? -24.833 -21.049 -1.210  1.00 43.18 ? 51  GLN A CA  1 
ATOM   209   C  C   . GLN A 1 37  ? -24.787 -22.379 -0.455  1.00 38.95 ? 51  GLN A C   1 
ATOM   210   O  O   . GLN A 1 37  ? -25.482 -22.553 0.551   1.00 35.77 ? 51  GLN A O   1 
ATOM   211   C  CB  . GLN A 1 37  ? -25.725 -21.163 -2.449  1.00 51.67 ? 51  GLN A CB  1 
ATOM   212   C  CG  . GLN A 1 37  ? -25.845 -19.881 -3.277  1.00 58.68 ? 51  GLN A CG  1 
ATOM   213   C  CD  . GLN A 1 37  ? -26.964 -18.966 -2.834  1.00 60.22 ? 51  GLN A CD  1 
ATOM   214   O  OE1 . GLN A 1 37  ? -26.935 -18.409 -1.737  1.00 61.55 ? 51  GLN A OE1 1 
ATOM   215   N  NE2 . GLN A 1 37  ? -27.959 -18.801 -3.695  1.00 56.34 ? 51  GLN A NE2 1 
ATOM   216   N  N   . LYS A 1 38  ? -23.932 -23.285 -0.933  1.00 36.70 ? 52  LYS A N   1 
ATOM   217   C  CA  . LYS A 1 38  ? -23.703 -24.591 -0.308  1.00 40.95 ? 52  LYS A CA  1 
ATOM   218   C  C   . LYS A 1 38  ? -23.094 -24.504 1.090   1.00 39.42 ? 52  LYS A C   1 
ATOM   219   O  O   . LYS A 1 38  ? -23.529 -25.198 2.014   1.00 36.80 ? 52  LYS A O   1 
ATOM   220   C  CB  . LYS A 1 38  ? -22.794 -25.446 -1.192  1.00 45.15 ? 52  LYS A CB  1 
ATOM   221   N  N   . ALA A 1 39  ? -22.069 -23.668 1.237   1.00 31.38 ? 53  ALA A N   1 
ATOM   222   C  CA  . ALA A 1 39  ? -21.411 -23.501 2.530   1.00 33.07 ? 53  ALA A CA  1 
ATOM   223   C  C   . ALA A 1 39  ? -22.346 -22.823 3.531   1.00 33.95 ? 53  ALA A C   1 
ATOM   224   O  O   . ALA A 1 39  ? -22.325 -23.143 4.715   1.00 32.55 ? 53  ALA A O   1 
ATOM   225   C  CB  . ALA A 1 39  ? -20.120 -22.711 2.372   1.00 27.68 ? 53  ALA A CB  1 
ATOM   226   N  N   . LEU A 1 40  ? -23.180 -21.905 3.045   1.00 35.54 ? 54  LEU A N   1 
ATOM   227   C  CA  . LEU A 1 40  ? -24.149 -21.213 3.901   1.00 33.96 ? 54  LEU A CA  1 
ATOM   228   C  C   . LEU A 1 40  ? -25.212 -22.171 4.442   1.00 37.54 ? 54  LEU A C   1 
ATOM   229   O  O   . LEU A 1 40  ? -25.554 -22.125 5.627   1.00 39.60 ? 54  LEU A O   1 
ATOM   230   C  CB  . LEU A 1 40  ? -24.797 -20.035 3.161   1.00 24.45 ? 54  LEU A CB  1 
ATOM   231   C  CG  . LEU A 1 40  ? -23.907 -18.803 2.973   1.00 26.63 ? 54  LEU A CG  1 
ATOM   232   C  CD1 . LEU A 1 40  ? -24.495 -17.827 1.936   1.00 26.53 ? 54  LEU A CD1 1 
ATOM   233   C  CD2 . LEU A 1 40  ? -23.674 -18.102 4.319   1.00 26.73 ? 54  LEU A CD2 1 
ATOM   234   N  N   . LYS A 1 41  ? -25.714 -23.052 3.582   1.00 35.20 ? 55  LYS A N   1 
ATOM   235   C  CA  . LYS A 1 41  ? -26.679 -24.071 4.006   1.00 42.25 ? 55  LYS A CA  1 
ATOM   236   C  C   . LYS A 1 41  ? -26.101 -25.009 5.072   1.00 48.19 ? 55  LYS A C   1 
ATOM   237   O  O   . LYS A 1 41  ? -26.795 -25.369 6.027   1.00 49.02 ? 55  LYS A O   1 
ATOM   238   C  CB  . LYS A 1 41  ? -27.194 -24.879 2.809   1.00 40.42 ? 55  LYS A CB  1 
ATOM   239   N  N   . ASP A 1 42  ? -24.830 -25.385 4.915   1.00 49.37 ? 56  ASP A N   1 
ATOM   240   C  CA  . ASP A 1 42  ? -24.160 -26.276 5.867   1.00 50.32 ? 56  ASP A CA  1 
ATOM   241   C  C   . ASP A 1 42  ? -24.101 -25.689 7.271   1.00 45.16 ? 56  ASP A C   1 
ATOM   242   O  O   . ASP A 1 42  ? -24.097 -26.426 8.262   1.00 43.89 ? 56  ASP A O   1 
ATOM   243   C  CB  . ASP A 1 42  ? -22.743 -26.619 5.400   1.00 53.86 ? 56  ASP A CB  1 
ATOM   244   C  CG  . ASP A 1 42  ? -22.735 -27.499 4.166   1.00 63.59 ? 56  ASP A CG  1 
ATOM   245   O  OD1 . ASP A 1 42  ? -23.827 -27.939 3.748   1.00 65.45 ? 56  ASP A OD1 1 
ATOM   246   O  OD2 . ASP A 1 42  ? -21.638 -27.757 3.620   1.00 65.83 ? 56  ASP A OD2 1 
ATOM   247   N  N   . LEU A 1 43  ? -24.048 -24.361 7.344   1.00 39.00 ? 57  LEU A N   1 
ATOM   248   C  CA  . LEU A 1 43  ? -24.018 -23.656 8.617   1.00 32.62 ? 57  LEU A CA  1 
ATOM   249   C  C   . LEU A 1 43  ? -25.408 -23.534 9.246   1.00 35.21 ? 57  LEU A C   1 
ATOM   250   O  O   . LEU A 1 43  ? -25.530 -23.361 10.461  1.00 33.32 ? 57  LEU A O   1 
ATOM   251   C  CB  . LEU A 1 43  ? -23.388 -22.271 8.441   1.00 29.00 ? 57  LEU A CB  1 
ATOM   252   C  CG  . LEU A 1 43  ? -21.911 -22.292 8.043   1.00 31.69 ? 57  LEU A CG  1 
ATOM   253   C  CD1 . LEU A 1 43  ? -21.345 -20.885 8.019   1.00 32.80 ? 57  LEU A CD1 1 
ATOM   254   C  CD2 . LEU A 1 43  ? -21.110 -23.182 8.999   1.00 32.28 ? 57  LEU A CD2 1 
ATOM   255   N  N   . LYS A 1 44  ? -26.447 -23.615 8.414   1.00 40.63 ? 58  LYS A N   1 
ATOM   256   C  CA  . LYS A 1 44  ? -27.826 -23.461 8.878   1.00 51.89 ? 58  LYS A CA  1 
ATOM   257   C  C   . LYS A 1 44  ? -28.178 -24.461 9.977   1.00 54.42 ? 58  LYS A C   1 
ATOM   258   O  O   . LYS A 1 44  ? -28.096 -25.676 9.780   1.00 49.12 ? 58  LYS A O   1 
ATOM   259   C  CB  . LYS A 1 44  ? -28.815 -23.592 7.716   1.00 54.12 ? 58  LYS A CB  1 
ATOM   260   N  N   . GLY A 1 45  ? -28.561 -23.933 11.136  1.00 60.65 ? 59  GLY A N   1 
ATOM   261   C  CA  . GLY A 1 45  ? -28.948 -24.749 12.273  1.00 63.26 ? 59  GLY A CA  1 
ATOM   262   C  C   . GLY A 1 45  ? -27.869 -25.673 12.817  1.00 61.34 ? 59  GLY A C   1 
ATOM   263   O  O   . GLY A 1 45  ? -28.184 -26.682 13.447  1.00 64.44 ? 59  GLY A O   1 
ATOM   264   N  N   . ARG A 1 46  ? -26.600 -25.339 12.585  1.00 51.24 ? 60  ARG A N   1 
ATOM   265   C  CA  . ARG A 1 46  ? -25.496 -26.174 13.065  1.00 45.04 ? 60  ARG A CA  1 
ATOM   266   C  C   . ARG A 1 46  ? -24.528 -25.394 13.970  1.00 43.01 ? 60  ARG A C   1 
ATOM   267   O  O   . ARG A 1 46  ? -24.330 -24.187 13.794  1.00 35.28 ? 60  ARG A O   1 
ATOM   268   C  CB  . ARG A 1 46  ? -24.742 -26.795 11.886  1.00 45.41 ? 60  ARG A CB  1 
ATOM   269   N  N   . MET A 1 47  ? -23.921 -26.088 14.930  1.00 40.97 ? 61  MET A N   1 
ATOM   270   C  CA  . MET A 1 47  ? -23.034 -25.437 15.893  1.00 34.29 ? 61  MET A CA  1 
ATOM   271   C  C   . MET A 1 47  ? -21.707 -26.177 15.969  1.00 30.06 ? 61  MET A C   1 
ATOM   272   O  O   . MET A 1 47  ? -21.663 -27.332 16.385  1.00 30.85 ? 61  MET A O   1 
ATOM   273   C  CB  . MET A 1 47  ? -23.696 -25.421 17.270  1.00 35.90 ? 61  MET A CB  1 
ATOM   274   C  CG  . MET A 1 47  ? -22.951 -24.639 18.329  1.00 32.65 ? 61  MET A CG  1 
ATOM   275   S  SD  . MET A 1 47  ? -23.782 -24.678 19.934  1.00 35.41 ? 61  MET A SD  1 
ATOM   276   C  CE  . MET A 1 47  ? -23.716 -26.422 20.315  1.00 48.37 ? 61  MET A CE  1 
ATOM   277   N  N   . GLU A 1 48  ? -20.621 -25.529 15.555  1.00 28.03 ? 62  GLU A N   1 
ATOM   278   C  CA  . GLU A 1 48  ? -19.328 -26.178 15.643  1.00 32.18 ? 62  GLU A CA  1 
ATOM   279   C  C   . GLU A 1 48  ? -18.804 -26.132 17.081  1.00 29.42 ? 62  GLU A C   1 
ATOM   280   O  O   . GLU A 1 48  ? -18.964 -25.130 17.790  1.00 22.69 ? 62  GLU A O   1 
ATOM   281   C  CB  . GLU A 1 48  ? -18.296 -25.583 14.670  1.00 32.40 ? 62  GLU A CB  1 
ATOM   282   C  CG  . GLU A 1 48  ? -17.038 -26.473 14.555  1.00 33.97 ? 62  GLU A CG  1 
ATOM   283   C  CD  . GLU A 1 48  ? -15.893 -25.833 13.771  1.00 39.77 ? 62  GLU A CD  1 
ATOM   284   O  OE1 . GLU A 1 48  ? -14.742 -26.316 13.903  1.00 38.77 ? 62  GLU A OE1 1 
ATOM   285   O  OE2 . GLU A 1 48  ? -16.140 -24.858 13.028  1.00 36.64 ? 62  GLU A OE2 1 
ATOM   286   N  N   . ALA A 1 49  ? -18.199 -27.234 17.515  1.00 25.62 ? 63  ALA A N   1 
ATOM   287   C  CA  . ALA A 1 49  ? -17.590 -27.292 18.840  1.00 25.43 ? 63  ALA A CA  1 
ATOM   288   C  C   . ALA A 1 49  ? -16.111 -26.985 18.684  1.00 30.98 ? 63  ALA A C   1 
ATOM   289   O  O   . ALA A 1 49  ? -15.383 -27.780 18.100  1.00 27.48 ? 63  ALA A O   1 
ATOM   290   C  CB  . ALA A 1 49  ? -17.799 -28.677 19.449  1.00 24.26 ? 63  ALA A CB  1 
ATOM   291   N  N   . ILE A 1 50  ? -15.677 -25.826 19.193  1.00 21.22 ? 64  ILE A N   1 
ATOM   292   C  CA  . ILE A 1 50  ? -14.329 -25.339 18.975  1.00 21.04 ? 64  ILE A CA  1 
ATOM   293   C  C   . ILE A 1 50  ? -13.508 -25.330 20.253  1.00 22.65 ? 64  ILE A C   1 
ATOM   294   O  O   . ILE A 1 50  ? -13.755 -24.520 21.160  1.00 19.40 ? 64  ILE A O   1 
ATOM   295   C  CB  . ILE A 1 50  ? -14.341 -23.904 18.430  1.00 22.09 ? 64  ILE A CB  1 
ATOM   296   C  CG1 . ILE A 1 50  ? -15.090 -23.858 17.089  1.00 25.92 ? 64  ILE A CG1 1 
ATOM   297   C  CG2 . ILE A 1 50  ? -12.914 -23.393 18.316  1.00 17.10 ? 64  ILE A CG2 1 
ATOM   298   C  CD1 . ILE A 1 50  ? -15.178 -22.467 16.475  1.00 26.76 ? 64  ILE A CD1 1 
ATOM   299   N  N   . PRO A 1 51  ? -12.503 -26.214 20.323  1.00 21.45 ? 65  PRO A N   1 
ATOM   300   C  CA  . PRO A 1 51  ? -11.715 -26.325 21.547  1.00 19.25 ? 65  PRO A CA  1 
ATOM   301   C  C   . PRO A 1 51  ? -10.604 -25.288 21.565  1.00 15.86 ? 65  PRO A C   1 
ATOM   302   O  O   . PRO A 1 51  ? -10.288 -24.699 20.528  1.00 22.67 ? 65  PRO A O   1 
ATOM   303   C  CB  . PRO A 1 51  ? -11.089 -27.714 21.405  1.00 21.96 ? 65  PRO A CB  1 
ATOM   304   C  CG  . PRO A 1 51  ? -10.815 -27.818 19.936  1.00 23.64 ? 65  PRO A CG  1 
ATOM   305   C  CD  . PRO A 1 51  ? -11.997 -27.114 19.264  1.00 21.74 ? 65  PRO A CD  1 
ATOM   306   N  N   . CYS A 1 52  ? -10.009 -25.071 22.726  1.00 15.54 ? 66  CYS A N   1 
ATOM   307   C  CA  . CYS A 1 52  ? -8.693  -24.440 22.749  1.00 19.48 ? 66  CYS A CA  1 
ATOM   308   C  C   . CYS A 1 52  ? -7.717  -25.446 22.138  1.00 22.95 ? 66  CYS A C   1 
ATOM   309   O  O   . CYS A 1 52  ? -7.936  -26.647 22.220  1.00 22.54 ? 66  CYS A O   1 
ATOM   310   C  CB  . CYS A 1 52  ? -8.275  -24.080 24.170  1.00 22.58 ? 66  CYS A CB  1 
ATOM   311   S  SG  . CYS A 1 52  ? -9.297  -22.813 24.920  1.00 23.40 ? 66  CYS A SG  1 
ATOM   312   N  N   . VAL A 1 53  ? -6.660  -24.962 21.498  1.00 17.53 ? 67  VAL A N   1 
ATOM   313   C  CA  . VAL A 1 53  ? -5.641  -25.849 20.955  1.00 14.62 ? 67  VAL A CA  1 
ATOM   314   C  C   . VAL A 1 53  ? -4.263  -25.441 21.467  1.00 21.05 ? 67  VAL A C   1 
ATOM   315   O  O   . VAL A 1 53  ? -3.796  -24.322 21.220  1.00 24.37 ? 67  VAL A O   1 
ATOM   316   C  CB  . VAL A 1 53  ? -5.634  -25.877 19.407  1.00 17.93 ? 67  VAL A CB  1 
ATOM   317   C  CG1 . VAL A 1 53  ? -4.559  -26.849 18.906  1.00 16.82 ? 67  VAL A CG1 1 
ATOM   318   C  CG2 . VAL A 1 53  ? -7.020  -26.301 18.850  1.00 16.01 ? 67  VAL A CG2 1 
ATOM   319   N  N   . VAL A 1 54  ? -3.623  -26.346 22.202  1.00 20.63 ? 68  VAL A N   1 
ATOM   320   C  CA  . VAL A 1 54  ? -2.275  -26.113 22.718  1.00 21.65 ? 68  VAL A CA  1 
ATOM   321   C  C   . VAL A 1 54  ? -1.376  -27.203 22.160  1.00 26.86 ? 68  VAL A C   1 
ATOM   322   O  O   . VAL A 1 54  ? -1.550  -28.388 22.475  1.00 25.18 ? 68  VAL A O   1 
ATOM   323   C  CB  . VAL A 1 54  ? -2.255  -26.137 24.249  1.00 22.70 ? 68  VAL A CB  1 
ATOM   324   C  CG1 . VAL A 1 54  ? -0.830  -25.962 24.768  1.00 24.28 ? 68  VAL A CG1 1 
ATOM   325   C  CG2 . VAL A 1 54  ? -3.187  -25.042 24.801  1.00 22.61 ? 68  VAL A CG2 1 
ATOM   326   N  N   . GLY A 1 55  ? -0.431  -26.808 21.316  1.00 16.24 ? 69  GLY A N   1 
ATOM   327   C  CA  . GLY A 1 55  ? 0.266   -27.772 20.480  1.00 23.99 ? 69  GLY A CA  1 
ATOM   328   C  C   . GLY A 1 55  ? -0.717  -28.481 19.565  1.00 23.91 ? 69  GLY A C   1 
ATOM   329   O  O   . GLY A 1 55  ? -1.332  -27.864 18.669  1.00 17.55 ? 69  GLY A O   1 
ATOM   330   N  N   . ASP A 1 56  ? -0.875  -29.782 19.799  1.00 20.61 ? 70  ASP A N   1 
ATOM   331   C  CA  . ASP A 1 56  ? -1.822  -30.590 19.040  1.00 23.98 ? 70  ASP A CA  1 
ATOM   332   C  C   . ASP A 1 56  ? -2.939  -31.090 19.944  1.00 27.44 ? 70  ASP A C   1 
ATOM   333   O  O   . ASP A 1 56  ? -3.805  -31.845 19.501  1.00 31.77 ? 70  ASP A O   1 
ATOM   334   C  CB  . ASP A 1 56  ? -1.121  -31.770 18.354  1.00 26.99 ? 70  ASP A CB  1 
ATOM   335   C  CG  . ASP A 1 56  ? -0.406  -31.361 17.079  1.00 32.44 ? 70  ASP A CG  1 
ATOM   336   O  OD1 . ASP A 1 56  ? -0.745  -30.304 16.515  1.00 30.87 ? 70  ASP A OD1 1 
ATOM   337   O  OD2 . ASP A 1 56  ? 0.495   -32.092 16.629  1.00 36.20 ? 70  ASP A OD2 1 
ATOM   338   N  N   . GLU A 1 57  ? -2.925  -30.663 21.206  1.00 25.78 ? 71  GLU A N   1 
ATOM   339   C  CA  . GLU A 1 57  ? -3.964  -31.062 22.162  1.00 29.20 ? 71  GLU A CA  1 
ATOM   340   C  C   . GLU A 1 57  ? -5.185  -30.159 22.024  1.00 23.93 ? 71  GLU A C   1 
ATOM   341   O  O   . GLU A 1 57  ? -5.075  -28.942 22.138  1.00 20.19 ? 71  GLU A O   1 
ATOM   342   C  CB  . GLU A 1 57  ? -3.451  -30.972 23.608  1.00 29.80 ? 71  GLU A CB  1 
ATOM   343   C  CG  . GLU A 1 57  ? -3.008  -32.278 24.230  1.00 38.41 ? 71  GLU A CG  1 
ATOM   344   C  CD  . GLU A 1 57  ? -2.686  -32.166 25.729  1.00 33.26 ? 71  GLU A CD  1 
ATOM   345   O  OE1 . GLU A 1 57  ? -3.249  -32.958 26.521  1.00 31.99 ? 71  GLU A OE1 1 
ATOM   346   O  OE2 . GLU A 1 57  ? -1.845  -31.323 26.117  1.00 26.13 ? 71  GLU A OE2 1 
ATOM   347   N  N   . GLU A 1 58  ? -6.348  -30.751 21.782  1.00 19.84 ? 72  GLU A N   1 
ATOM   348   C  CA  . GLU A 1 58  ? -7.583  -29.988 21.821  1.00 24.88 ? 72  GLU A CA  1 
ATOM   349   C  C   . GLU A 1 58  ? -8.022  -30.031 23.266  1.00 25.67 ? 72  GLU A C   1 
ATOM   350   O  O   . GLU A 1 58  ? -8.123  -31.102 23.842  1.00 31.34 ? 72  GLU A O   1 
ATOM   351   C  CB  . GLU A 1 58  ? -8.635  -30.639 20.925  1.00 25.78 ? 72  GLU A CB  1 
ATOM   352   C  CG  . GLU A 1 58  ? -8.234  -30.635 19.469  1.00 29.48 ? 72  GLU A CG  1 
ATOM   353   C  CD  . GLU A 1 58  ? -9.305  -31.220 18.551  1.00 38.02 ? 72  GLU A CD  1 
ATOM   354   O  OE1 . GLU A 1 58  ? -10.390 -31.620 19.042  1.00 42.51 ? 72  GLU A OE1 1 
ATOM   355   O  OE2 . GLU A 1 58  ? -9.050  -31.259 17.329  1.00 41.02 ? 72  GLU A OE2 1 
ATOM   356   N  N   . VAL A 1 59  ? -8.254  -28.870 23.866  1.00 20.00 ? 73  VAL A N   1 
ATOM   357   C  CA  . VAL A 1 59  ? -8.506  -28.821 25.298  1.00 17.20 ? 73  VAL A CA  1 
ATOM   358   C  C   . VAL A 1 59  ? -9.796  -28.076 25.623  1.00 25.85 ? 73  VAL A C   1 
ATOM   359   O  O   . VAL A 1 59  ? -10.024 -26.966 25.137  1.00 21.46 ? 73  VAL A O   1 
ATOM   360   C  CB  . VAL A 1 59  ? -7.322  -28.151 26.028  1.00 20.88 ? 73  VAL A CB  1 
ATOM   361   C  CG1 . VAL A 1 59  ? -7.626  -27.985 27.501  1.00 23.68 ? 73  VAL A CG1 1 
ATOM   362   C  CG2 . VAL A 1 59  ? -6.040  -28.971 25.809  1.00 21.47 ? 73  VAL A CG2 1 
ATOM   363   N  N   . TRP A 1 60  ? -10.644 -28.709 26.430  1.00 20.27 ? 74  TRP A N   1 
ATOM   364   C  CA  . TRP A 1 60  ? -11.870 -28.083 26.914  1.00 25.91 ? 74  TRP A CA  1 
ATOM   365   C  C   . TRP A 1 60  ? -11.715 -27.676 28.379  1.00 30.57 ? 74  TRP A C   1 
ATOM   366   O  O   . TRP A 1 60  ? -11.137 -28.409 29.179  1.00 32.38 ? 74  TRP A O   1 
ATOM   367   C  CB  . TRP A 1 60  ? -13.074 -29.030 26.729  1.00 25.78 ? 74  TRP A CB  1 
ATOM   368   C  CG  . TRP A 1 60  ? -13.488 -29.092 25.288  1.00 30.20 ? 74  TRP A CG  1 
ATOM   369   C  CD1 . TRP A 1 60  ? -13.082 -30.002 24.354  1.00 24.77 ? 74  TRP A CD1 1 
ATOM   370   C  CD2 . TRP A 1 60  ? -14.324 -28.148 24.596  1.00 25.55 ? 74  TRP A CD2 1 
ATOM   371   N  NE1 . TRP A 1 60  ? -13.632 -29.696 23.129  1.00 26.34 ? 74  TRP A NE1 1 
ATOM   372   C  CE2 . TRP A 1 60  ? -14.396 -28.565 23.249  1.00 25.96 ? 74  TRP A CE2 1 
ATOM   373   C  CE3 . TRP A 1 60  ? -15.028 -27.006 24.990  1.00 21.47 ? 74  TRP A CE3 1 
ATOM   374   C  CZ2 . TRP A 1 60  ? -15.149 -27.874 22.286  1.00 25.16 ? 74  TRP A CZ2 1 
ATOM   375   C  CZ3 . TRP A 1 60  ? -15.786 -26.318 24.025  1.00 19.90 ? 74  TRP A CZ3 1 
ATOM   376   C  CH2 . TRP A 1 60  ? -15.827 -26.757 22.692  1.00 21.79 ? 74  TRP A CH2 1 
ATOM   377   N  N   . THR A 1 61  ? -12.217 -26.496 28.724  1.00 20.57 ? 75  THR A N   1 
ATOM   378   C  CA  . THR A 1 61  ? -12.369 -26.142 30.123  1.00 22.14 ? 75  THR A CA  1 
ATOM   379   C  C   . THR A 1 61  ? -13.859 -26.117 30.368  1.00 28.34 ? 75  THR A C   1 
ATOM   380   O  O   . THR A 1 61  ? -14.638 -26.243 29.429  1.00 20.73 ? 75  THR A O   1 
ATOM   381   C  CB  . THR A 1 61  ? -11.813 -24.733 30.400  1.00 22.60 ? 75  THR A CB  1 
ATOM   382   O  OG1 . THR A 1 61  ? -12.654 -23.752 29.762  1.00 19.61 ? 75  THR A OG1 1 
ATOM   383   C  CG2 . THR A 1 61  ? -10.383 -24.610 29.875  1.00 21.53 ? 75  THR A CG2 1 
ATOM   384   N  N   . SER A 1 62  ? -14.257 -25.911 31.616  1.00 19.60 ? 76  SER A N   1 
ATOM   385   C  CA  . SER A 1 62  ? -15.658 -25.805 31.947  1.00 23.55 ? 76  SER A CA  1 
ATOM   386   C  C   . SER A 1 62  ? -16.232 -24.431 31.657  1.00 21.53 ? 76  SER A C   1 
ATOM   387   O  O   . SER A 1 62  ? -17.431 -24.230 31.818  1.00 25.61 ? 76  SER A O   1 
ATOM   388   C  CB  . SER A 1 62  ? -15.888 -26.141 33.420  1.00 32.76 ? 76  SER A CB  1 
ATOM   389   O  OG  . SER A 1 62  ? -15.163 -25.256 34.245  1.00 34.52 ? 76  SER A OG  1 
ATOM   390   N  N   . ASP A 1 63  ? -15.399 -23.493 31.218  1.00 19.74 ? 77  ASP A N   1 
ATOM   391   C  CA  . ASP A 1 63  ? -15.888 -22.138 30.961  1.00 20.82 ? 77  ASP A CA  1 
ATOM   392   C  C   . ASP A 1 63  ? -16.387 -22.030 29.532  1.00 21.49 ? 77  ASP A C   1 
ATOM   393   O  O   . ASP A 1 63  ? -15.792 -21.348 28.688  1.00 24.65 ? 77  ASP A O   1 
ATOM   394   C  CB  . ASP A 1 63  ? -14.801 -21.094 31.258  1.00 25.93 ? 77  ASP A CB  1 
ATOM   395   C  CG  . ASP A 1 63  ? -15.377 -19.687 31.483  1.00 33.25 ? 77  ASP A CG  1 
ATOM   396   O  OD1 . ASP A 1 63  ? -16.592 -19.473 31.244  1.00 25.29 ? 77  ASP A OD1 1 
ATOM   397   O  OD2 . ASP A 1 63  ? -14.604 -18.793 31.894  1.00 34.10 ? 77  ASP A OD2 1 
ATOM   398   N  N   . VAL A 1 64  ? -17.495 -22.714 29.272  1.00 23.80 ? 78  VAL A N   1 
ATOM   399   C  CA  . VAL A 1 64  ? -18.077 -22.817 27.938  1.00 22.13 ? 78  VAL A CA  1 
ATOM   400   C  C   . VAL A 1 64  ? -18.746 -21.514 27.505  1.00 20.63 ? 78  VAL A C   1 
ATOM   401   O  O   . VAL A 1 64  ? -19.428 -20.864 28.293  1.00 21.54 ? 78  VAL A O   1 
ATOM   402   C  CB  . VAL A 1 64  ? -19.103 -23.978 27.878  1.00 23.37 ? 78  VAL A CB  1 
ATOM   403   C  CG1 . VAL A 1 64  ? -19.766 -24.058 26.497  1.00 20.61 ? 78  VAL A CG1 1 
ATOM   404   C  CG2 . VAL A 1 64  ? -18.418 -25.300 28.205  1.00 26.75 ? 78  VAL A CG2 1 
ATOM   405   N  N   . GLN A 1 65  ? -18.518 -21.136 26.253  1.00 21.09 ? 79  GLN A N   1 
ATOM   406   C  CA  . GLN A 1 65  ? -19.044 -19.896 25.682  1.00 20.59 ? 79  GLN A CA  1 
ATOM   407   C  C   . GLN A 1 65  ? -19.654 -20.206 24.328  1.00 26.06 ? 79  GLN A C   1 
ATOM   408   O  O   . GLN A 1 65  ? -19.321 -21.221 23.702  1.00 27.60 ? 79  GLN A O   1 
ATOM   409   C  CB  . GLN A 1 65  ? -17.908 -18.893 25.480  1.00 17.94 ? 79  GLN A CB  1 
ATOM   410   C  CG  . GLN A 1 65  ? -17.099 -18.634 26.723  1.00 19.40 ? 79  GLN A CG  1 
ATOM   411   C  CD  . GLN A 1 65  ? -17.879 -17.864 27.746  1.00 23.98 ? 79  GLN A CD  1 
ATOM   412   O  OE1 . GLN A 1 65  ? -18.731 -17.048 27.398  1.00 25.72 ? 79  GLN A OE1 1 
ATOM   413   N  NE2 . GLN A 1 65  ? -17.618 -18.133 29.016  1.00 31.25 ? 79  GLN A NE2 1 
ATOM   414   N  N   . TYR A 1 66  ? -20.529 -19.321 23.865  1.00 25.07 ? 80  TYR A N   1 
ATOM   415   C  CA  . TYR A 1 66  ? -21.219 -19.514 22.593  1.00 25.23 ? 80  TYR A CA  1 
ATOM   416   C  C   . TYR A 1 66  ? -21.106 -18.280 21.692  1.00 27.44 ? 80  TYR A C   1 
ATOM   417   O  O   . TYR A 1 66  ? -21.233 -17.159 22.168  1.00 26.47 ? 80  TYR A O   1 
ATOM   418   C  CB  . TYR A 1 66  ? -22.688 -19.844 22.848  1.00 21.43 ? 80  TYR A CB  1 
ATOM   419   C  CG  . TYR A 1 66  ? -22.859 -21.171 23.547  1.00 26.37 ? 80  TYR A CG  1 
ATOM   420   C  CD1 . TYR A 1 66  ? -22.954 -21.244 24.929  1.00 27.84 ? 80  TYR A CD1 1 
ATOM   421   C  CD2 . TYR A 1 66  ? -22.873 -22.348 22.828  1.00 23.81 ? 80  TYR A CD2 1 
ATOM   422   C  CE1 . TYR A 1 66  ? -23.081 -22.459 25.577  1.00 30.55 ? 80  TYR A CE1 1 
ATOM   423   C  CE2 . TYR A 1 66  ? -22.998 -23.568 23.462  1.00 28.99 ? 80  TYR A CE2 1 
ATOM   424   C  CZ  . TYR A 1 66  ? -23.102 -23.616 24.837  1.00 29.85 ? 80  TYR A CZ  1 
ATOM   425   O  OH  . TYR A 1 66  ? -23.222 -24.825 25.466  1.00 31.09 ? 80  TYR A OH  1 
ATOM   426   N  N   . GLN A 1 67  ? -20.834 -18.501 20.406  1.00 17.63 ? 81  GLN A N   1 
ATOM   427   C  CA  . GLN A 1 67  ? -20.935 -17.458 19.387  1.00 20.03 ? 81  GLN A CA  1 
ATOM   428   C  C   . GLN A 1 67  ? -22.308 -17.540 18.728  1.00 19.84 ? 81  GLN A C   1 
ATOM   429   O  O   . GLN A 1 67  ? -22.734 -18.624 18.344  1.00 21.50 ? 81  GLN A O   1 
ATOM   430   C  CB  . GLN A 1 67  ? -19.889 -17.673 18.306  1.00 18.57 ? 81  GLN A CB  1 
ATOM   431   C  CG  . GLN A 1 67  ? -19.788 -16.530 17.309  1.00 18.51 ? 81  GLN A CG  1 
ATOM   432   C  CD  . GLN A 1 67  ? -18.894 -16.893 16.149  1.00 22.84 ? 81  GLN A CD  1 
ATOM   433   O  OE1 . GLN A 1 67  ? -18.242 -17.946 16.167  1.00 24.03 ? 81  GLN A OE1 1 
ATOM   434   N  NE2 . GLN A 1 67  ? -18.856 -16.036 15.125  1.00 17.22 ? 81  GLN A NE2 1 
ATOM   435   N  N   . VAL A 1 68  ? -22.981 -16.406 18.563  1.00 18.45 ? 82  VAL A N   1 
ATOM   436   C  CA  . VAL A 1 68  ? -24.301 -16.408 17.917  1.00 21.83 ? 82  VAL A CA  1 
ATOM   437   C  C   . VAL A 1 68  ? -24.286 -15.576 16.637  1.00 26.40 ? 82  VAL A C   1 
ATOM   438   O  O   . VAL A 1 68  ? -23.374 -14.777 16.424  1.00 25.87 ? 82  VAL A O   1 
ATOM   439   C  CB  . VAL A 1 68  ? -25.395 -15.871 18.844  1.00 22.63 ? 82  VAL A CB  1 
ATOM   440   C  CG1 . VAL A 1 68  ? -25.582 -16.793 20.056  1.00 20.50 ? 82  VAL A CG1 1 
ATOM   441   C  CG2 . VAL A 1 68  ? -25.077 -14.417 19.268  1.00 28.33 ? 82  VAL A CG2 1 
ATOM   442   N  N   . SER A 1 69  ? -25.288 -15.767 15.778  1.00 21.24 ? 83  SER A N   1 
ATOM   443   C  CA  . SER A 1 69  ? -25.370 -14.996 14.541  1.00 25.15 ? 83  SER A CA  1 
ATOM   444   C  C   . SER A 1 69  ? -25.935 -13.607 14.857  1.00 23.41 ? 83  SER A C   1 
ATOM   445   O  O   . SER A 1 69  ? -27.006 -13.508 15.449  1.00 22.79 ? 83  SER A O   1 
ATOM   446   C  CB  . SER A 1 69  ? -26.266 -15.720 13.532  1.00 25.13 ? 83  SER A CB  1 
ATOM   447   O  OG  . SER A 1 69  ? -26.176 -15.124 12.256  1.00 28.24 ? 83  SER A OG  1 
ATOM   448   N  N   . PRO A 1 70  ? -25.203 -12.537 14.497  1.00 25.05 ? 84  PRO A N   1 
ATOM   449   C  CA  . PRO A 1 70  ? -25.632 -11.167 14.832  1.00 28.87 ? 84  PRO A CA  1 
ATOM   450   C  C   . PRO A 1 70  ? -27.054 -10.858 14.362  1.00 25.21 ? 84  PRO A C   1 
ATOM   451   O  O   . PRO A 1 70  ? -27.796 -10.183 15.081  1.00 26.68 ? 84  PRO A O   1 
ATOM   452   C  CB  . PRO A 1 70  ? -24.628 -10.295 14.079  1.00 28.82 ? 84  PRO A CB  1 
ATOM   453   C  CG  . PRO A 1 70  ? -23.390 -11.133 14.034  1.00 28.25 ? 84  PRO A CG  1 
ATOM   454   C  CD  . PRO A 1 70  ? -23.839 -12.564 13.932  1.00 19.85 ? 84  PRO A CD  1 
ATOM   455   N  N   . PHE A 1 71  ? -27.424 -11.371 13.191  1.00 25.52 ? 85  PHE A N   1 
ATOM   456   C  CA  . PHE A 1 71  ? -28.751 -11.118 12.612  1.00 28.67 ? 85  PHE A CA  1 
ATOM   457   C  C   . PHE A 1 71  ? -29.829 -12.112 13.068  1.00 29.05 ? 85  PHE A C   1 
ATOM   458   O  O   . PHE A 1 71  ? -31.013 -11.940 12.771  1.00 29.58 ? 85  PHE A O   1 
ATOM   459   C  CB  . PHE A 1 71  ? -28.679 -11.055 11.078  1.00 28.62 ? 85  PHE A CB  1 
ATOM   460   C  CG  . PHE A 1 71  ? -27.994 -12.242 10.444  1.00 28.52 ? 85  PHE A CG  1 
ATOM   461   C  CD1 . PHE A 1 71  ? -28.734 -13.358 10.043  1.00 29.77 ? 85  PHE A CD1 1 
ATOM   462   C  CD2 . PHE A 1 71  ? -26.618 -12.241 10.236  1.00 26.04 ? 85  PHE A CD2 1 
ATOM   463   C  CE1 . PHE A 1 71  ? -28.114 -14.447 9.452   1.00 31.93 ? 85  PHE A CE1 1 
ATOM   464   C  CE2 . PHE A 1 71  ? -25.983 -13.336 9.642   1.00 24.64 ? 85  PHE A CE2 1 
ATOM   465   C  CZ  . PHE A 1 71  ? -26.735 -14.440 9.255   1.00 25.44 ? 85  PHE A CZ  1 
ATOM   466   N  N   . ASN A 1 72  ? -29.412 -13.138 13.805  1.00 23.09 ? 86  ASN A N   1 
ATOM   467   C  CA  . ASN A 1 72  ? -30.323 -14.142 14.346  1.00 29.81 ? 86  ASN A CA  1 
ATOM   468   C  C   . ASN A 1 72  ? -29.703 -14.719 15.604  1.00 28.77 ? 86  ASN A C   1 
ATOM   469   O  O   . ASN A 1 72  ? -29.112 -15.805 15.579  1.00 31.37 ? 86  ASN A O   1 
ATOM   470   C  CB  . ASN A 1 72  ? -30.573 -15.254 13.323  1.00 33.15 ? 86  ASN A CB  1 
ATOM   471   C  CG  . ASN A 1 72  ? -31.592 -16.277 13.807  1.00 40.07 ? 86  ASN A CG  1 
ATOM   472   O  OD1 . ASN A 1 72  ? -32.231 -16.098 14.848  1.00 38.05 ? 86  ASN A OD1 1 
ATOM   473   N  ND2 . ASN A 1 72  ? -31.755 -17.351 13.044  1.00 41.67 ? 86  ASN A ND2 1 
ATOM   474   N  N   . HIS A 1 73  ? -29.802 -13.981 16.704  1.00 27.57 ? 87  HIS A N   1 
ATOM   475   C  CA  . HIS A 1 73  ? -28.988 -14.315 17.872  1.00 30.84 ? 87  HIS A CA  1 
ATOM   476   C  C   . HIS A 1 73  ? -29.518 -15.530 18.638  1.00 31.30 ? 87  HIS A C   1 
ATOM   477   O  O   . HIS A 1 73  ? -28.908 -15.958 19.599  1.00 30.93 ? 87  HIS A O   1 
ATOM   478   C  CB  . HIS A 1 73  ? -28.757 -13.091 18.779  1.00 28.23 ? 87  HIS A CB  1 
ATOM   479   C  CG  . HIS A 1 73  ? -30.002 -12.317 19.083  1.00 30.16 ? 87  HIS A CG  1 
ATOM   480   N  ND1 . HIS A 1 73  ? -31.136 -12.907 19.595  1.00 27.57 ? 87  HIS A ND1 1 
ATOM   481   C  CD2 . HIS A 1 73  ? -30.291 -10.999 18.953  1.00 28.33 ? 87  HIS A CD2 1 
ATOM   482   C  CE1 . HIS A 1 73  ? -32.074 -11.991 19.762  1.00 31.74 ? 87  HIS A CE1 1 
ATOM   483   N  NE2 . HIS A 1 73  ? -31.589 -10.824 19.372  1.00 28.82 ? 87  HIS A NE2 1 
ATOM   484   N  N   . GLY A 1 74  ? -30.642 -16.093 18.194  1.00 31.54 ? 88  GLY A N   1 
ATOM   485   C  CA  . GLY A 1 74  ? -31.116 -17.355 18.742  1.00 35.11 ? 88  GLY A CA  1 
ATOM   486   C  C   . GLY A 1 74  ? -30.348 -18.522 18.133  1.00 35.54 ? 88  GLY A C   1 
ATOM   487   O  O   . GLY A 1 74  ? -30.433 -19.666 18.596  1.00 32.17 ? 88  GLY A O   1 
ATOM   488   N  N   . HIS A 1 75  ? -29.585 -18.219 17.089  1.00 35.87 ? 89  HIS A N   1 
ATOM   489   C  CA  . HIS A 1 75  ? -28.793 -19.215 16.379  1.00 34.24 ? 89  HIS A CA  1 
ATOM   490   C  C   . HIS A 1 75  ? -27.355 -19.265 16.912  1.00 29.57 ? 89  HIS A C   1 
ATOM   491   O  O   . HIS A 1 75  ? -26.538 -18.391 16.620  1.00 28.80 ? 89  HIS A O   1 
ATOM   492   C  CB  . HIS A 1 75  ? -28.819 -18.911 14.873  1.00 33.85 ? 89  HIS A CB  1 
ATOM   493   C  CG  . HIS A 1 75  ? -27.960 -19.816 14.039  1.00 36.59 ? 89  HIS A CG  1 
ATOM   494   N  ND1 . HIS A 1 75  ? -27.576 -21.075 14.445  1.00 39.44 ? 89  HIS A ND1 1 
ATOM   495   C  CD2 . HIS A 1 75  ? -27.417 -19.636 12.810  1.00 32.76 ? 89  HIS A CD2 1 
ATOM   496   C  CE1 . HIS A 1 75  ? -26.830 -21.633 13.507  1.00 35.17 ? 89  HIS A CE1 1 
ATOM   497   N  NE2 . HIS A 1 75  ? -26.723 -20.782 12.503  1.00 33.45 ? 89  HIS A NE2 1 
ATOM   498   N  N   . LYS A 1 76  ? -27.052 -20.282 17.714  1.00 27.61 ? 90  LYS A N   1 
ATOM   499   C  CA  . LYS A 1 76  ? -25.684 -20.462 18.201  1.00 32.58 ? 90  LYS A CA  1 
ATOM   500   C  C   . LYS A 1 76  ? -24.854 -21.116 17.102  1.00 28.86 ? 90  LYS A C   1 
ATOM   501   O  O   . LYS A 1 76  ? -25.150 -22.239 16.679  1.00 28.75 ? 90  LYS A O   1 
ATOM   502   C  CB  . LYS A 1 76  ? -25.661 -21.323 19.467  1.00 32.33 ? 90  LYS A CB  1 
ATOM   503   C  CG  . LYS A 1 76  ? -26.430 -20.737 20.640  1.00 35.02 ? 90  LYS A CG  1 
ATOM   504   C  CD  . LYS A 1 76  ? -26.436 -21.696 21.843  1.00 36.34 ? 90  LYS A CD  1 
ATOM   505   C  CE  . LYS A 1 76  ? -27.614 -21.423 22.773  1.00 44.08 ? 90  LYS A CE  1 
ATOM   506   N  N   . VAL A 1 77  ? -23.819 -20.420 16.637  1.00 22.76 ? 91  VAL A N   1 
ATOM   507   C  CA  . VAL A 1 77  ? -23.036 -20.914 15.507  1.00 24.65 ? 91  VAL A CA  1 
ATOM   508   C  C   . VAL A 1 77  ? -21.765 -21.632 15.944  1.00 26.49 ? 91  VAL A C   1 
ATOM   509   O  O   . VAL A 1 77  ? -21.195 -22.422 15.186  1.00 22.07 ? 91  VAL A O   1 
ATOM   510   C  CB  . VAL A 1 77  ? -22.687 -19.791 14.512  1.00 27.51 ? 91  VAL A CB  1 
ATOM   511   C  CG1 . VAL A 1 77  ? -23.964 -19.084 14.057  1.00 25.98 ? 91  VAL A CG1 1 
ATOM   512   C  CG2 . VAL A 1 77  ? -21.712 -18.812 15.139  1.00 30.68 ? 91  VAL A CG2 1 
ATOM   513   N  N   . ALA A 1 78  ? -21.315 -21.348 17.160  1.00 23.27 ? 92  ALA A N   1 
ATOM   514   C  CA  . ALA A 1 78  ? -20.193 -22.081 17.721  1.00 22.00 ? 92  ALA A CA  1 
ATOM   515   C  C   . ALA A 1 78  ? -20.312 -22.190 19.240  1.00 27.60 ? 92  ALA A C   1 
ATOM   516   O  O   . ALA A 1 78  ? -20.823 -21.289 19.908  1.00 24.15 ? 92  ALA A O   1 
ATOM   517   C  CB  . ALA A 1 78  ? -18.867 -21.419 17.330  1.00 23.60 ? 92  ALA A CB  1 
ATOM   518   N  N   . LYS A 1 79  ? -19.855 -23.320 19.763  1.00 23.75 ? 93  LYS A N   1 
ATOM   519   C  CA  . LYS A 1 79  ? -19.624 -23.499 21.182  1.00 23.43 ? 93  LYS A CA  1 
ATOM   520   C  C   . LYS A 1 79  ? -18.106 -23.537 21.337  1.00 22.87 ? 93  LYS A C   1 
ATOM   521   O  O   . LYS A 1 79  ? -17.420 -24.231 20.593  1.00 22.82 ? 93  LYS A O   1 
ATOM   522   C  CB  . LYS A 1 79  ? -20.247 -24.825 21.649  1.00 28.89 ? 93  LYS A CB  1 
ATOM   523   C  CG  . LYS A 1 79  ? -19.926 -25.215 23.095  1.00 29.72 ? 93  LYS A CG  1 
ATOM   524   C  CD  . LYS A 1 79  ? -20.672 -26.489 23.546  1.00 35.22 ? 93  LYS A CD  1 
ATOM   525   C  CE  . LYS A 1 79  ? -19.908 -27.752 23.161  1.00 33.78 ? 93  LYS A CE  1 
ATOM   526   N  NZ  . LYS A 1 79  ? -20.517 -29.050 23.672  1.00 27.81 ? 93  LYS A NZ  1 
ATOM   527   N  N   . PHE A 1 80  ? -17.565 -22.763 22.266  1.00 20.41 ? 94  PHE A N   1 
ATOM   528   C  CA  . PHE A 1 80  ? -16.130 -22.815 22.526  1.00 17.06 ? 94  PHE A CA  1 
ATOM   529   C  C   . PHE A 1 80  ? -15.918 -22.652 24.014  1.00 25.80 ? 94  PHE A C   1 
ATOM   530   O  O   . PHE A 1 80  ? -16.872 -22.702 24.781  1.00 22.50 ? 94  PHE A O   1 
ATOM   531   C  CB  . PHE A 1 80  ? -15.355 -21.754 21.719  1.00 18.59 ? 94  PHE A CB  1 
ATOM   532   C  CG  . PHE A 1 80  ? -15.734 -20.323 22.032  1.00 21.96 ? 94  PHE A CG  1 
ATOM   533   C  CD1 . PHE A 1 80  ? -14.890 -19.512 22.797  1.00 23.99 ? 94  PHE A CD1 1 
ATOM   534   C  CD2 . PHE A 1 80  ? -16.903 -19.778 21.532  1.00 22.10 ? 94  PHE A CD2 1 
ATOM   535   C  CE1 . PHE A 1 80  ? -15.234 -18.181 23.081  1.00 20.68 ? 94  PHE A CE1 1 
ATOM   536   C  CE2 . PHE A 1 80  ? -17.260 -18.459 21.810  1.00 20.48 ? 94  PHE A CE2 1 
ATOM   537   C  CZ  . PHE A 1 80  ? -16.421 -17.657 22.581  1.00 17.94 ? 94  PHE A CZ  1 
ATOM   538   N  N   . CYS A 1 81  ? -14.679 -22.447 24.440  1.00 20.54 ? 95  CYS A N   1 
ATOM   539   C  CA  . CYS A 1 81  ? -14.446 -22.261 25.869  1.00 17.65 ? 95  CYS A CA  1 
ATOM   540   C  C   . CYS A 1 81  ? -13.290 -21.306 26.111  1.00 18.99 ? 95  CYS A C   1 
ATOM   541   O  O   . CYS A 1 81  ? -12.478 -21.081 25.228  1.00 19.57 ? 95  CYS A O   1 
ATOM   542   C  CB  . CYS A 1 81  ? -14.202 -23.593 26.569  1.00 21.58 ? 95  CYS A CB  1 
ATOM   543   S  SG  . CYS A 1 81  ? -12.681 -24.417 26.078  1.00 24.26 ? 95  CYS A SG  1 
ATOM   544   N  N   . TYR A 1 82  ? -13.252 -20.740 27.316  1.00 16.89 ? 96  TYR A N   1 
ATOM   545   C  CA  . TYR A 1 82  ? -12.233 -19.779 27.706  1.00 21.99 ? 96  TYR A CA  1 
ATOM   546   C  C   . TYR A 1 82  ? -11.083 -20.516 28.388  1.00 22.54 ? 96  TYR A C   1 
ATOM   547   O  O   . TYR A 1 82  ? -11.298 -21.309 29.302  1.00 17.68 ? 96  TYR A O   1 
ATOM   548   C  CB  . TYR A 1 82  ? -12.825 -18.771 28.699  1.00 21.94 ? 96  TYR A CB  1 
ATOM   549   C  CG  . TYR A 1 82  ? -13.523 -17.566 28.093  1.00 21.71 ? 96  TYR A CG  1 
ATOM   550   C  CD1 . TYR A 1 82  ? -13.404 -17.258 26.736  1.00 19.21 ? 96  TYR A CD1 1 
ATOM   551   C  CD2 . TYR A 1 82  ? -14.285 -16.718 28.892  1.00 19.03 ? 96  TYR A CD2 1 
ATOM   552   C  CE1 . TYR A 1 82  ? -14.021 -16.121 26.200  1.00 19.91 ? 96  TYR A CE1 1 
ATOM   553   C  CE2 . TYR A 1 82  ? -14.906 -15.602 28.365  1.00 26.68 ? 96  TYR A CE2 1 
ATOM   554   C  CZ  . TYR A 1 82  ? -14.768 -15.304 27.021  1.00 25.71 ? 96  TYR A CZ  1 
ATOM   555   O  OH  . TYR A 1 82  ? -15.401 -14.187 26.515  1.00 27.35 ? 96  TYR A OH  1 
ATOM   556   N  N   . ALA A 1 83  ? -9.865  -20.254 27.948  1.00 19.63 ? 97  ALA A N   1 
ATOM   557   C  CA  . ALA A 1 83  ? -8.715  -20.784 28.663  1.00 22.78 ? 97  ALA A CA  1 
ATOM   558   C  C   . ALA A 1 83  ? -8.669  -20.165 30.057  1.00 22.96 ? 97  ALA A C   1 
ATOM   559   O  O   . ALA A 1 83  ? -9.006  -18.988 30.237  1.00 23.66 ? 97  ALA A O   1 
ATOM   560   C  CB  . ALA A 1 83  ? -7.430  -20.510 27.898  1.00 19.45 ? 97  ALA A CB  1 
ATOM   561   N  N   . ASP A 1 84  ? -8.296  -20.973 31.048  1.00 23.32 ? 98  ASP A N   1 
ATOM   562   C  CA  . ASP A 1 84  ? -8.003  -20.453 32.381  1.00 24.45 ? 98  ASP A CA  1 
ATOM   563   C  C   . ASP A 1 84  ? -6.492  -20.181 32.515  1.00 20.35 ? 98  ASP A C   1 
ATOM   564   O  O   . ASP A 1 84  ? -5.727  -20.438 31.586  1.00 17.12 ? 98  ASP A O   1 
ATOM   565   C  CB  . ASP A 1 84  ? -8.533  -21.381 33.501  1.00 24.01 ? 98  ASP A CB  1 
ATOM   566   C  CG  . ASP A 1 84  ? -7.928  -22.796 33.463  1.00 27.52 ? 98  ASP A CG  1 
ATOM   567   O  OD1 . ASP A 1 84  ? -7.041  -23.076 32.638  1.00 26.78 ? 98  ASP A OD1 1 
ATOM   568   O  OD2 . ASP A 1 84  ? -8.350  -23.642 34.280  1.00 35.72 ? 98  ASP A OD2 1 
ATOM   569   N  N   . LYS A 1 85  ? -6.079  -19.650 33.664  1.00 22.22 ? 99  LYS A N   1 
ATOM   570   C  CA  . LYS A 1 85  ? -4.674  -19.296 33.894  1.00 27.43 ? 99  LYS A CA  1 
ATOM   571   C  C   . LYS A 1 85  ? -3.770  -20.507 33.697  1.00 20.49 ? 99  LYS A C   1 
ATOM   572   O  O   . LYS A 1 85  ? -2.723  -20.433 33.042  1.00 19.98 ? 99  LYS A O   1 
ATOM   573   C  CB  . LYS A 1 85  ? -4.491  -18.715 35.299  1.00 32.73 ? 99  LYS A CB  1 
ATOM   574   N  N   . SER A 1 86  ? -4.195  -21.640 34.240  1.00 20.14 ? 100 SER A N   1 
ATOM   575   C  CA  . SER A 1 86  ? -3.402  -22.858 34.139  1.00 25.74 ? 100 SER A CA  1 
ATOM   576   C  C   . SER A 1 86  ? -3.169  -23.258 32.677  1.00 24.18 ? 100 SER A C   1 
ATOM   577   O  O   . SER A 1 86  ? -2.066  -23.641 32.304  1.00 24.89 ? 100 SER A O   1 
ATOM   578   C  CB  . SER A 1 86  ? -4.069  -23.991 34.934  1.00 32.51 ? 100 SER A CB  1 
ATOM   579   O  OG  . SER A 1 86  ? -3.540  -25.252 34.568  1.00 40.35 ? 100 SER A OG  1 
ATOM   580   N  N   . LEU A 1 87  ? -4.197  -23.168 31.841  1.00 24.61 ? 101 LEU A N   1 
ATOM   581   C  CA  . LEU A 1 87  ? -4.005  -23.511 30.431  1.00 21.97 ? 101 LEU A CA  1 
ATOM   582   C  C   . LEU A 1 87  ? -3.137  -22.500 29.666  1.00 13.27 ? 101 LEU A C   1 
ATOM   583   O  O   . LEU A 1 87  ? -2.308  -22.889 28.836  1.00 19.77 ? 101 LEU A O   1 
ATOM   584   C  CB  . LEU A 1 87  ? -5.344  -23.695 29.718  1.00 20.93 ? 101 LEU A CB  1 
ATOM   585   C  CG  . LEU A 1 87  ? -5.255  -24.224 28.282  1.00 23.56 ? 101 LEU A CG  1 
ATOM   586   C  CD1 . LEU A 1 87  ? -4.508  -25.547 28.248  1.00 26.56 ? 101 LEU A CD1 1 
ATOM   587   C  CD2 . LEU A 1 87  ? -6.661  -24.391 27.682  1.00 26.93 ? 101 LEU A CD2 1 
ATOM   588   N  N   . LEU A 1 88  ? -3.347  -21.208 29.922  1.00 17.58 ? 102 LEU A N   1 
ATOM   589   C  CA  . LEU A 1 88  ? -2.520  -20.172 29.310  1.00 15.84 ? 102 LEU A CA  1 
ATOM   590   C  C   . LEU A 1 88  ? -1.038  -20.375 29.658  1.00 19.58 ? 102 LEU A C   1 
ATOM   591   O  O   . LEU A 1 88  ? -0.175  -20.296 28.793  1.00 16.94 ? 102 LEU A O   1 
ATOM   592   C  CB  . LEU A 1 88  ? -2.988  -18.779 29.752  1.00 16.96 ? 102 LEU A CB  1 
ATOM   593   C  CG  . LEU A 1 88  ? -4.409  -18.440 29.267  1.00 18.10 ? 102 LEU A CG  1 
ATOM   594   C  CD1 . LEU A 1 88  ? -4.879  -17.099 29.831  1.00 19.62 ? 102 LEU A CD1 1 
ATOM   595   C  CD2 . LEU A 1 88  ? -4.447  -18.449 27.764  1.00 13.50 ? 102 LEU A CD2 1 
ATOM   596   N  N   . ASN A 1 89  ? -0.752  -20.645 30.923  1.00 19.05 ? 103 ASN A N   1 
ATOM   597   C  CA  . ASN A 1 89  ? 0.631   -20.912 31.342  1.00 21.07 ? 103 ASN A CA  1 
ATOM   598   C  C   . ASN A 1 89  ? 1.207   -22.124 30.629  1.00 15.84 ? 103 ASN A C   1 
ATOM   599   O  O   . ASN A 1 89  ? 2.357   -22.123 30.161  1.00 17.72 ? 103 ASN A O   1 
ATOM   600   C  CB  . ASN A 1 89  ? 0.708   -21.098 32.864  1.00 24.17 ? 103 ASN A CB  1 
ATOM   601   C  CG  . ASN A 1 89  ? 0.621   -19.788 33.603  1.00 35.07 ? 103 ASN A CG  1 
ATOM   602   O  OD1 . ASN A 1 89  ? 1.046   -18.751 33.092  1.00 39.41 ? 103 ASN A OD1 1 
ATOM   603   N  ND2 . ASN A 1 89  ? 0.065   -19.819 34.807  1.00 39.36 ? 103 ASN A ND2 1 
ATOM   604   N  N   . LYS A 1 90  ? 0.392   -23.163 30.522  1.00 17.88 ? 104 LYS A N   1 
ATOM   605   C  CA  . LYS A 1 90  ? 0.814   -24.352 29.814  1.00 18.63 ? 104 LYS A CA  1 
ATOM   606   C  C   . LYS A 1 90  ? 1.054   -24.027 28.351  1.00 20.51 ? 104 LYS A C   1 
ATOM   607   O  O   . LYS A 1 90  ? 2.007   -24.523 27.771  1.00 17.88 ? 104 LYS A O   1 
ATOM   608   C  CB  . LYS A 1 90  ? -0.227  -25.473 29.980  1.00 21.28 ? 104 LYS A CB  1 
ATOM   609   C  CG  . LYS A 1 90  ? -0.118  -26.583 28.962  1.00 22.92 ? 104 LYS A CG  1 
ATOM   610   C  CD  . LYS A 1 90  ? -1.031  -27.759 29.325  1.00 30.34 ? 104 LYS A CD  1 
ATOM   611   C  CE  . LYS A 1 90  ? -1.228  -28.692 28.137  1.00 33.58 ? 104 LYS A CE  1 
ATOM   612   N  NZ  . LYS A 1 90  ? -2.000  -29.915 28.494  1.00 34.87 ? 104 LYS A NZ  1 
ATOM   613   N  N   . ALA A 1 91  ? 0.202   -23.181 27.754  1.00 16.87 ? 105 ALA A N   1 
ATOM   614   C  CA  . ALA A 1 91  ? 0.394   -22.756 26.362  1.00 14.58 ? 105 ALA A CA  1 
ATOM   615   C  C   . ALA A 1 91  ? 1.696   -21.937 26.183  1.00 16.00 ? 105 ALA A C   1 
ATOM   616   O  O   . ALA A 1 91  ? 2.402   -22.088 25.185  1.00 19.80 ? 105 ALA A O   1 
ATOM   617   C  CB  . ALA A 1 91  ? -0.828  -21.919 25.855  1.00 12.54 ? 105 ALA A CB  1 
ATOM   618   N  N   . ILE A 1 92  ? 1.992   -21.077 27.145  1.00 14.97 ? 106 ILE A N   1 
ATOM   619   C  CA  . ILE A 1 92  ? 3.227   -20.273 27.109  1.00 12.59 ? 106 ILE A CA  1 
ATOM   620   C  C   . ILE A 1 92  ? 4.455   -21.199 27.141  1.00 18.52 ? 106 ILE A C   1 
ATOM   621   O  O   . ILE A 1 92  ? 5.316   -21.137 26.261  1.00 19.06 ? 106 ILE A O   1 
ATOM   622   C  CB  . ILE A 1 92  ? 3.280   -19.269 28.273  1.00 15.09 ? 106 ILE A CB  1 
ATOM   623   C  CG1 . ILE A 1 92  ? 2.310   -18.103 28.016  1.00 16.53 ? 106 ILE A CG1 1 
ATOM   624   C  CG2 . ILE A 1 92  ? 4.720   -18.708 28.478  1.00 11.48 ? 106 ILE A CG2 1 
ATOM   625   C  CD1 . ILE A 1 92  ? 2.117   -17.203 29.222  1.00 22.42 ? 106 ILE A CD1 1 
ATOM   626   N  N   . GLU A 1 93  ? 4.495   -22.084 28.135  1.00 18.61 ? 107 GLU A N   1 
ATOM   627   C  CA  . GLU A 1 93  ? 5.609   -23.022 28.290  1.00 22.98 ? 107 GLU A CA  1 
ATOM   628   C  C   . GLU A 1 93  ? 5.838   -23.849 27.027  1.00 17.82 ? 107 GLU A C   1 
ATOM   629   O  O   . GLU A 1 93  ? 6.959   -23.973 26.565  1.00 17.90 ? 107 GLU A O   1 
ATOM   630   C  CB  . GLU A 1 93  ? 5.378   -23.942 29.495  1.00 25.52 ? 107 GLU A CB  1 
ATOM   631   N  N   . ALA A 1 94  ? 4.772   -24.394 26.450  1.00 15.03 ? 108 ALA A N   1 
ATOM   632   C  CA  . ALA A 1 94  ? 4.909   -25.242 25.265  1.00 18.86 ? 108 ALA A CA  1 
ATOM   633   C  C   . ALA A 1 94  ? 5.348   -24.446 24.033  1.00 17.99 ? 108 ALA A C   1 
ATOM   634   O  O   . ALA A 1 94  ? 6.091   -24.934 23.189  1.00 16.57 ? 108 ALA A O   1 
ATOM   635   C  CB  . ALA A 1 94  ? 3.598   -25.998 24.990  1.00 20.43 ? 108 ALA A CB  1 
ATOM   636   N  N   . ALA A 1 95  ? 4.888   -23.207 23.916  1.00 18.96 ? 109 ALA A N   1 
ATOM   637   C  CA  . ALA A 1 95  ? 5.296   -22.380 22.783  1.00 17.05 ? 109 ALA A CA  1 
ATOM   638   C  C   . ALA A 1 95  ? 6.765   -22.013 22.940  1.00 17.52 ? 109 ALA A C   1 
ATOM   639   O  O   . ALA A 1 95  ? 7.530   -22.025 21.980  1.00 15.50 ? 109 ALA A O   1 
ATOM   640   C  CB  . ALA A 1 95  ? 4.447   -21.112 22.712  1.00 15.28 ? 109 ALA A CB  1 
ATOM   641   N  N   . LEU A 1 96  ? 7.153   -21.649 24.150  1.00 16.19 ? 110 LEU A N   1 
ATOM   642   C  CA  . LEU A 1 96  ? 8.557   -21.277 24.379  1.00 16.75 ? 110 LEU A CA  1 
ATOM   643   C  C   . LEU A 1 96  ? 9.508   -22.432 24.049  1.00 21.13 ? 110 LEU A C   1 
ATOM   644   O  O   . LEU A 1 96  ? 10.585  -22.213 23.504  1.00 16.64 ? 110 LEU A O   1 
ATOM   645   C  CB  . LEU A 1 96  ? 8.764   -20.821 25.814  1.00 14.91 ? 110 LEU A CB  1 
ATOM   646   C  CG  . LEU A 1 96  ? 8.011   -19.550 26.203  1.00 19.05 ? 110 LEU A CG  1 
ATOM   647   C  CD1 . LEU A 1 96  ? 8.221   -19.282 27.689  1.00 19.80 ? 110 LEU A CD1 1 
ATOM   648   C  CD2 . LEU A 1 96  ? 8.478   -18.370 25.348  1.00 19.13 ? 110 LEU A CD2 1 
ATOM   649   N  N   . ALA A 1 97  ? 9.097   -23.659 24.356  1.00 20.62 ? 111 ALA A N   1 
ATOM   650   C  CA  . ALA A 1 97  ? 9.926   -24.828 24.049  1.00 25.90 ? 111 ALA A CA  1 
ATOM   651   C  C   . ALA A 1 97  ? 10.044  -25.104 22.545  1.00 28.10 ? 111 ALA A C   1 
ATOM   652   O  O   . ALA A 1 97  ? 10.977  -25.773 22.110  1.00 25.51 ? 111 ALA A O   1 
ATOM   653   C  CB  . ALA A 1 97  ? 9.408   -26.072 24.788  1.00 27.65 ? 111 ALA A CB  1 
ATOM   654   N  N   . ALA A 1 98  ? 9.109   -24.584 21.749  1.00 18.28 ? 112 ALA A N   1 
ATOM   655   C  CA  . ALA A 1 98  ? 9.102   -24.841 20.310  1.00 17.71 ? 112 ALA A CA  1 
ATOM   656   C  C   . ALA A 1 98  ? 9.733   -23.700 19.528  1.00 16.12 ? 112 ALA A C   1 
ATOM   657   O  O   . ALA A 1 98  ? 10.002  -23.827 18.336  1.00 20.68 ? 112 ALA A O   1 
ATOM   658   C  CB  . ALA A 1 98  ? 7.666   -25.051 19.816  1.00 21.06 ? 112 ALA A CB  1 
ATOM   659   N  N   . ARG A 1 99  ? 9.922   -22.576 20.198  1.00 20.96 ? 113 ARG A N   1 
ATOM   660   C  CA  . ARG A 1 99  ? 10.322  -21.344 19.513  1.00 22.66 ? 113 ARG A CA  1 
ATOM   661   C  C   . ARG A 1 99  ? 11.688  -21.413 18.810  1.00 20.93 ? 113 ARG A C   1 
ATOM   662   O  O   . ARG A 1 99  ? 11.800  -21.044 17.642  1.00 16.00 ? 113 ARG A O   1 
ATOM   663   C  CB  . ARG A 1 99  ? 10.261  -20.150 20.473  1.00 18.66 ? 113 ARG A CB  1 
ATOM   664   C  CG  . ARG A 1 99  ? 10.620  -18.812 19.821  1.00 15.69 ? 113 ARG A CG  1 
ATOM   665   C  CD  . ARG A 1 99  ? 10.988  -17.764 20.876  1.00 16.64 ? 113 ARG A CD  1 
ATOM   666   N  NE  . ARG A 1 99  ? 12.276  -18.085 21.496  1.00 22.93 ? 113 ARG A NE  1 
ATOM   667   C  CZ  . ARG A 1 99  ? 13.458  -17.829 20.940  1.00 26.23 ? 113 ARG A CZ  1 
ATOM   668   N  NH1 . ARG A 1 99  ? 13.520  -17.268 19.742  1.00 17.34 ? 113 ARG A NH1 1 
ATOM   669   N  NH2 . ARG A 1 99  ? 14.585  -18.150 21.576  1.00 23.54 ? 113 ARG A NH2 1 
ATOM   670   N  N   . LYS A 1 100 ? 12.726  -21.884 19.506  1.00 20.24 ? 114 LYS A N   1 
ATOM   671   C  CA  . LYS A 1 100 ? 14.072  -21.865 18.917  1.00 21.37 ? 114 LYS A CA  1 
ATOM   672   C  C   . LYS A 1 100 ? 14.145  -22.619 17.581  1.00 20.39 ? 114 LYS A C   1 
ATOM   673   O  O   . LYS A 1 100 ? 14.749  -22.125 16.637  1.00 18.17 ? 114 LYS A O   1 
ATOM   674   C  CB  . LYS A 1 100 ? 15.147  -22.362 19.909  1.00 17.32 ? 114 LYS A CB  1 
ATOM   675   N  N   . GLU A 1 101 ? 13.510  -23.791 17.472  1.00 18.75 ? 115 GLU A N   1 
ATOM   676   C  CA  . GLU A 1 101 ? 13.569  -24.520 16.203  1.00 18.43 ? 115 GLU A CA  1 
ATOM   677   C  C   . GLU A 1 101 ? 12.806  -23.804 15.081  1.00 21.84 ? 115 GLU A C   1 
ATOM   678   O  O   . GLU A 1 101 ? 13.254  -23.789 13.938  1.00 20.16 ? 115 GLU A O   1 
ATOM   679   C  CB  . GLU A 1 101 ? 13.086  -25.974 16.353  1.00 24.39 ? 115 GLU A CB  1 
ATOM   680   N  N   . TRP A 1 102 ? 11.654  -23.215 15.415  1.00 22.97 ? 116 TRP A N   1 
ATOM   681   C  CA  . TRP A 1 102 ? 10.853  -22.453 14.456  1.00 20.77 ? 116 TRP A CA  1 
ATOM   682   C  C   . TRP A 1 102 ? 11.610  -21.212 13.987  1.00 19.06 ? 116 TRP A C   1 
ATOM   683   O  O   . TRP A 1 102 ? 11.666  -20.900 12.791  1.00 20.53 ? 116 TRP A O   1 
ATOM   684   C  CB  . TRP A 1 102 ? 9.529   -22.052 15.117  1.00 17.89 ? 116 TRP A CB  1 
ATOM   685   C  CG  . TRP A 1 102 ? 8.604   -21.198 14.292  1.00 20.57 ? 116 TRP A CG  1 
ATOM   686   C  CD1 . TRP A 1 102 ? 8.201   -19.919 14.580  1.00 19.19 ? 116 TRP A CD1 1 
ATOM   687   C  CD2 . TRP A 1 102 ? 7.955   -21.554 13.059  1.00 18.87 ? 116 TRP A CD2 1 
ATOM   688   N  NE1 . TRP A 1 102 ? 7.344   -19.468 13.609  1.00 20.31 ? 116 TRP A NE1 1 
ATOM   689   C  CE2 . TRP A 1 102 ? 7.181   -20.443 12.660  1.00 18.85 ? 116 TRP A CE2 1 
ATOM   690   C  CE3 . TRP A 1 102 ? 7.950   -22.707 12.255  1.00 20.73 ? 116 TRP A CE3 1 
ATOM   691   C  CZ2 . TRP A 1 102 ? 6.408   -20.442 11.493  1.00 16.66 ? 116 TRP A CZ2 1 
ATOM   692   C  CZ3 . TRP A 1 102 ? 7.190   -22.704 11.094  1.00 24.80 ? 116 TRP A CZ3 1 
ATOM   693   C  CH2 . TRP A 1 102 ? 6.425   -21.577 10.725  1.00 21.44 ? 116 TRP A CH2 1 
ATOM   694   N  N   . ASP A 1 103 ? 12.194  -20.500 14.942  1.00 19.96 ? 117 ASP A N   1 
ATOM   695   C  CA  . ASP A 1 103 ? 13.014  -19.329 14.626  1.00 16.24 ? 117 ASP A CA  1 
ATOM   696   C  C   . ASP A 1 103 ? 14.136  -19.696 13.672  1.00 19.88 ? 117 ASP A C   1 
ATOM   697   O  O   . ASP A 1 103 ? 14.447  -18.940 12.750  1.00 21.55 ? 117 ASP A O   1 
ATOM   698   C  CB  . ASP A 1 103 ? 13.561  -18.708 15.915  1.00 13.56 ? 117 ASP A CB  1 
ATOM   699   C  CG  . ASP A 1 103 ? 14.524  -17.559 15.662  1.00 20.69 ? 117 ASP A CG  1 
ATOM   700   O  OD1 . ASP A 1 103 ? 14.339  -16.809 14.697  1.00 22.98 ? 117 ASP A OD1 1 
ATOM   701   O  OD2 . ASP A 1 103 ? 15.471  -17.409 16.450  1.00 20.55 ? 117 ASP A OD2 1 
ATOM   702   N  N   . LEU A 1 104 ? 14.722  -20.874 13.878  1.00 21.29 ? 118 LEU A N   1 
ATOM   703   C  CA  . LEU A 1 104 ? 15.868  -21.297 13.083  1.00 23.68 ? 118 LEU A CA  1 
ATOM   704   C  C   . LEU A 1 104 ? 15.498  -21.823 11.703  1.00 27.26 ? 118 LEU A C   1 
ATOM   705   O  O   . LEU A 1 104 ? 16.336  -21.816 10.806  1.00 23.85 ? 118 LEU A O   1 
ATOM   706   C  CB  . LEU A 1 104 ? 16.692  -22.351 13.831  1.00 27.67 ? 118 LEU A CB  1 
ATOM   707   C  CG  . LEU A 1 104 ? 17.604  -21.788 14.926  1.00 27.15 ? 118 LEU A CG  1 
ATOM   708   C  CD1 . LEU A 1 104 ? 18.196  -22.892 15.760  1.00 27.67 ? 118 LEU A CD1 1 
ATOM   709   C  CD2 . LEU A 1 104 ? 18.692  -20.937 14.296  1.00 27.52 ? 118 LEU A CD2 1 
ATOM   710   N  N   . LYS A 1 105 ? 14.261  -22.292 11.535  1.00 24.98 ? 119 LYS A N   1 
ATOM   711   C  CA  . LYS A 1 105 ? 13.816  -22.736 10.219  1.00 26.62 ? 119 LYS A CA  1 
ATOM   712   C  C   . LYS A 1 105 ? 14.026  -21.596 9.222   1.00 27.58 ? 119 LYS A C   1 
ATOM   713   O  O   . LYS A 1 105 ? 13.773  -20.435 9.545   1.00 31.75 ? 119 LYS A O   1 
ATOM   714   C  CB  . LYS A 1 105 ? 12.335  -23.161 10.253  1.00 23.28 ? 119 LYS A CB  1 
ATOM   715   N  N   . PRO A 1 106 ? 14.518  -21.914 8.017   1.00 27.86 ? 120 PRO A N   1 
ATOM   716   C  CA  . PRO A 1 106 ? 14.683  -20.859 7.006   1.00 29.92 ? 120 PRO A CA  1 
ATOM   717   C  C   . PRO A 1 106 ? 13.364  -20.140 6.706   1.00 32.18 ? 120 PRO A C   1 
ATOM   718   O  O   . PRO A 1 106 ? 12.283  -20.752 6.754   1.00 25.22 ? 120 PRO A O   1 
ATOM   719   C  CB  . PRO A 1 106 ? 15.168  -21.629 5.773   1.00 33.62 ? 120 PRO A CB  1 
ATOM   720   C  CG  . PRO A 1 106 ? 15.809  -22.871 6.336   1.00 38.54 ? 120 PRO A CG  1 
ATOM   721   C  CD  . PRO A 1 106 ? 15.014  -23.223 7.556   1.00 32.43 ? 120 PRO A CD  1 
ATOM   722   N  N   . ILE A 1 107 ? 13.454  -18.848 6.408   1.00 33.15 ? 121 ILE A N   1 
ATOM   723   C  CA  . ILE A 1 107 ? 12.260  -18.034 6.155   1.00 32.36 ? 121 ILE A CA  1 
ATOM   724   C  C   . ILE A 1 107 ? 11.465  -18.570 4.962   1.00 29.84 ? 121 ILE A C   1 
ATOM   725   O  O   . ILE A 1 107 ? 10.236  -18.524 4.954   1.00 31.00 ? 121 ILE A O   1 
ATOM   726   C  CB  . ILE A 1 107 ? 12.628  -16.543 5.928   1.00 32.24 ? 121 ILE A CB  1 
ATOM   727   C  CG1 . ILE A 1 107 ? 11.371  -15.712 5.641   1.00 28.27 ? 121 ILE A CG1 1 
ATOM   728   C  CG2 . ILE A 1 107 ? 13.662  -16.405 4.818   1.00 30.53 ? 121 ILE A CG2 1 
ATOM   729   C  CD1 . ILE A 1 107 ? 10.282  -15.865 6.723   1.00 26.54 ? 121 ILE A CD1 1 
ATOM   730   N  N   . ALA A 1 108 ? 12.173  -19.091 3.963   1.00 27.70 ? 122 ALA A N   1 
ATOM   731   C  CA  . ALA A 1 108 ? 11.520  -19.701 2.810   1.00 32.05 ? 122 ALA A CA  1 
ATOM   732   C  C   . ALA A 1 108 ? 10.581  -20.820 3.249   1.00 33.24 ? 122 ALA A C   1 
ATOM   733   O  O   . ALA A 1 108 ? 9.467   -20.947 2.730   1.00 30.87 ? 122 ALA A O   1 
ATOM   734   C  CB  . ALA A 1 108 ? 12.551  -20.219 1.809   1.00 37.16 ? 122 ALA A CB  1 
ATOM   735   N  N   . ASP A 1 109 ? 11.032  -21.619 4.211   1.00 30.96 ? 123 ASP A N   1 
ATOM   736   C  CA  . ASP A 1 109 ? 10.228  -22.714 4.740   1.00 34.04 ? 123 ASP A CA  1 
ATOM   737   C  C   . ASP A 1 109 ? 9.017   -22.176 5.481   1.00 29.99 ? 123 ASP A C   1 
ATOM   738   O  O   . ASP A 1 109 ? 7.914   -22.696 5.340   1.00 30.79 ? 123 ASP A O   1 
ATOM   739   C  CB  . ASP A 1 109 ? 11.049  -23.585 5.693   1.00 38.10 ? 123 ASP A CB  1 
ATOM   740   C  CG  . ASP A 1 109 ? 12.071  -24.437 4.975   1.00 43.88 ? 123 ASP A CG  1 
ATOM   741   O  OD1 . ASP A 1 109 ? 12.395  -24.130 3.809   1.00 45.38 ? 123 ASP A OD1 1 
ATOM   742   O  OD2 . ASP A 1 109 ? 12.548  -25.416 5.585   1.00 48.47 ? 123 ASP A OD2 1 
ATOM   743   N  N   . ARG A 1 110 ? 9.217   -21.134 6.281   1.00 22.14 ? 124 ARG A N   1 
ATOM   744   C  CA  . ARG A 1 110 ? 8.095   -20.574 7.021   1.00 24.75 ? 124 ARG A CA  1 
ATOM   745   C  C   . ARG A 1 110 ? 7.096   -19.933 6.066   1.00 26.95 ? 124 ARG A C   1 
ATOM   746   O  O   . ARG A 1 110 ? 5.897   -20.178 6.165   1.00 25.87 ? 124 ARG A O   1 
ATOM   747   C  CB  . ARG A 1 110 ? 8.564   -19.576 8.080   1.00 23.00 ? 124 ARG A CB  1 
ATOM   748   C  CG  . ARG A 1 110 ? 9.391   -20.207 9.183   1.00 22.07 ? 124 ARG A CG  1 
ATOM   749   C  CD  . ARG A 1 110 ? 9.496   -19.284 10.408  1.00 21.13 ? 124 ARG A CD  1 
ATOM   750   N  NE  . ARG A 1 110 ? 10.151  -18.017 10.110  1.00 23.00 ? 124 ARG A NE  1 
ATOM   751   C  CZ  . ARG A 1 110 ? 11.385  -17.697 10.493  1.00 26.89 ? 124 ARG A CZ  1 
ATOM   752   N  NH1 . ARG A 1 110 ? 12.134  -18.558 11.177  1.00 25.76 ? 124 ARG A NH1 1 
ATOM   753   N  NH2 . ARG A 1 110 ? 11.879  -16.509 10.174  1.00 28.12 ? 124 ARG A NH2 1 
ATOM   754   N  N   . ALA A 1 111 ? 7.603   -19.134 5.130   1.00 27.55 ? 125 ALA A N   1 
ATOM   755   C  CA  . ALA A 1 111 ? 6.750   -18.436 4.174   1.00 27.72 ? 125 ALA A CA  1 
ATOM   756   C  C   . ALA A 1 111 ? 5.896   -19.408 3.361   1.00 28.87 ? 125 ALA A C   1 
ATOM   757   O  O   . ALA A 1 111 ? 4.770   -19.086 2.988   1.00 26.92 ? 125 ALA A O   1 
ATOM   758   C  CB  . ALA A 1 111 ? 7.592   -17.562 3.243   1.00 21.46 ? 125 ALA A CB  1 
ATOM   759   N  N   . GLN A 1 112 ? 6.438   -20.592 3.081   1.00 21.86 ? 126 GLN A N   1 
ATOM   760   C  CA  . GLN A 1 112 ? 5.737   -21.572 2.257   1.00 26.15 ? 126 GLN A CA  1 
ATOM   761   C  C   . GLN A 1 112 ? 4.414   -22.014 2.885   1.00 23.62 ? 126 GLN A C   1 
ATOM   762   O  O   . GLN A 1 112 ? 3.436   -22.250 2.178   1.00 25.70 ? 126 GLN A O   1 
ATOM   763   C  CB  . GLN A 1 112 ? 6.626   -22.791 1.998   1.00 30.30 ? 126 GLN A CB  1 
ATOM   764   C  CG  . GLN A 1 112 ? 6.104   -23.705 0.907   1.00 45.65 ? 126 GLN A CG  1 
ATOM   765   C  CD  . GLN A 1 112 ? 6.060   -23.030 -0.465  1.00 56.73 ? 126 GLN A CD  1 
ATOM   766   O  OE1 . GLN A 1 112 ? 6.823   -22.098 -0.748  1.00 55.02 ? 126 GLN A OE1 1 
ATOM   767   N  NE2 . GLN A 1 112 ? 5.157   -23.501 -1.322  1.00 61.67 ? 126 GLN A NE2 1 
ATOM   768   N  N   . ILE A 1 113 ? 4.415   -22.158 4.208   1.00 25.02 ? 127 ILE A N   1 
ATOM   769   C  CA  . ILE A 1 113 ? 3.228   -22.518 4.960   1.00 24.51 ? 127 ILE A CA  1 
ATOM   770   C  C   . ILE A 1 113 ? 2.159   -21.451 4.769   1.00 27.51 ? 127 ILE A C   1 
ATOM   771   O  O   . ILE A 1 113 ? 0.994   -21.760 4.557   1.00 20.87 ? 127 ILE A O   1 
ATOM   772   C  CB  . ILE A 1 113 ? 3.543   -22.637 6.449   1.00 22.45 ? 127 ILE A CB  1 
ATOM   773   C  CG1 . ILE A 1 113 ? 4.504   -23.799 6.692   1.00 29.24 ? 127 ILE A CG1 1 
ATOM   774   C  CG2 . ILE A 1 113 ? 2.259   -22.819 7.270   1.00 24.66 ? 127 ILE A CG2 1 
ATOM   775   C  CD1 . ILE A 1 113 ? 5.263   -23.665 7.994   1.00 25.64 ? 127 ILE A CD1 1 
ATOM   776   N  N   . PHE A 1 114 ? 2.565   -20.190 4.824   1.00 23.40 ? 128 PHE A N   1 
ATOM   777   C  CA  . PHE A 1 114 ? 1.599   -19.112 4.684   1.00 24.32 ? 128 PHE A CA  1 
ATOM   778   C  C   . PHE A 1 114 ? 1.104   -18.952 3.252   1.00 27.87 ? 128 PHE A C   1 
ATOM   779   O  O   . PHE A 1 114 ? -0.045  -18.542 3.021   1.00 22.77 ? 128 PHE A O   1 
ATOM   780   C  CB  . PHE A 1 114 ? 2.151   -17.816 5.283   1.00 25.23 ? 128 PHE A CB  1 
ATOM   781   C  CG  . PHE A 1 114 ? 2.191   -17.845 6.774   1.00 23.77 ? 128 PHE A CG  1 
ATOM   782   C  CD1 . PHE A 1 114 ? 3.284   -18.380 7.438   1.00 17.75 ? 128 PHE A CD1 1 
ATOM   783   C  CD2 . PHE A 1 114 ? 1.109   -17.396 7.512   1.00 23.82 ? 128 PHE A CD2 1 
ATOM   784   C  CE1 . PHE A 1 114 ? 3.327   -18.430 8.838   1.00 23.12 ? 128 PHE A CE1 1 
ATOM   785   C  CE2 . PHE A 1 114 ? 1.135   -17.442 8.903   1.00 27.63 ? 128 PHE A CE2 1 
ATOM   786   C  CZ  . PHE A 1 114 ? 2.245   -17.969 9.568   1.00 23.29 ? 128 PHE A CZ  1 
ATOM   787   N  N   . LEU A 1 115 ? 1.961   -19.300 2.296   1.00 23.67 ? 129 LEU A N   1 
ATOM   788   C  CA  . LEU A 1 115 ? 1.559   -19.302 0.893   1.00 25.02 ? 129 LEU A CA  1 
ATOM   789   C  C   . LEU A 1 115 ? 0.560   -20.425 0.637   1.00 28.41 ? 129 LEU A C   1 
ATOM   790   O  O   . LEU A 1 115 ? -0.437  -20.219 -0.053  1.00 25.00 ? 129 LEU A O   1 
ATOM   791   C  CB  . LEU A 1 115 ? 2.770   -19.411 -0.033  1.00 29.02 ? 129 LEU A CB  1 
ATOM   792   C  CG  . LEU A 1 115 ? 3.625   -18.137 -0.104  1.00 29.54 ? 129 LEU A CG  1 
ATOM   793   C  CD1 . LEU A 1 115 ? 4.972   -18.413 -0.757  1.00 28.88 ? 129 LEU A CD1 1 
ATOM   794   C  CD2 . LEU A 1 115 ? 2.875   -17.031 -0.852  1.00 26.36 ? 129 LEU A CD2 1 
ATOM   795   N  N   . LYS A 1 116 ? 0.812   -21.603 1.208   1.00 30.06 ? 130 LYS A N   1 
ATOM   796   C  CA  . LYS A 1 116 ? -0.133  -22.710 1.056   1.00 27.67 ? 130 LYS A CA  1 
ATOM   797   C  C   . LYS A 1 116 ? -1.476  -22.321 1.669   1.00 26.01 ? 130 LYS A C   1 
ATOM   798   O  O   . LYS A 1 116 ? -2.542  -22.531 1.068   1.00 24.11 ? 130 LYS A O   1 
ATOM   799   C  CB  . LYS A 1 116 ? 0.395   -23.987 1.717   1.00 27.34 ? 130 LYS A CB  1 
ATOM   800   N  N   . ALA A 1 117 ? -1.427  -21.740 2.863   1.00 25.02 ? 131 ALA A N   1 
ATOM   801   C  CA  . ALA A 1 117 ? -2.654  -21.363 3.564   1.00 26.91 ? 131 ALA A CA  1 
ATOM   802   C  C   . ALA A 1 117 ? -3.458  -20.353 2.757   1.00 21.53 ? 131 ALA A C   1 
ATOM   803   O  O   . ALA A 1 117 ? -4.684  -20.448 2.685   1.00 20.16 ? 131 ALA A O   1 
ATOM   804   C  CB  . ALA A 1 117 ? -2.340  -20.817 4.958   1.00 22.53 ? 131 ALA A CB  1 
ATOM   805   N  N   . ALA A 1 118 ? -2.765  -19.387 2.155   1.00 24.18 ? 132 ALA A N   1 
ATOM   806   C  CA  . ALA A 1 118 ? -3.432  -18.382 1.331   1.00 22.12 ? 132 ALA A CA  1 
ATOM   807   C  C   . ALA A 1 118 ? -4.064  -19.041 0.110   1.00 24.64 ? 132 ALA A C   1 
ATOM   808   O  O   . ALA A 1 118 ? -5.155  -18.663 -0.304  1.00 26.57 ? 132 ALA A O   1 
ATOM   809   C  CB  . ALA A 1 118 ? -2.460  -17.296 0.894   1.00 21.41 ? 132 ALA A CB  1 
ATOM   810   N  N   . ASP A 1 119 ? -3.378  -20.025 -0.469  1.00 26.25 ? 133 ASP A N   1 
ATOM   811   C  CA  . ASP A 1 119 ? -3.908  -20.690 -1.657  1.00 26.20 ? 133 ASP A CA  1 
ATOM   812   C  C   . ASP A 1 119 ? -5.135  -21.528 -1.312  1.00 29.15 ? 133 ASP A C   1 
ATOM   813   O  O   . ASP A 1 119 ? -6.070  -21.620 -2.113  1.00 25.57 ? 133 ASP A O   1 
ATOM   814   C  CB  . ASP A 1 119 ? -2.847  -21.530 -2.379  1.00 28.60 ? 133 ASP A CB  1 
ATOM   815   C  CG  . ASP A 1 119 ? -1.815  -20.667 -3.106  1.00 34.46 ? 133 ASP A CG  1 
ATOM   816   O  OD1 . ASP A 1 119 ? -2.059  -19.450 -3.273  1.00 29.65 ? 133 ASP A OD1 1 
ATOM   817   O  OD2 . ASP A 1 119 ? -0.760  -21.199 -3.503  1.00 35.20 ? 133 ASP A OD2 1 
ATOM   818   N  N   . MET A 1 120 ? -5.135  -22.120 -0.119  1.00 26.21 ? 134 MET A N   1 
ATOM   819   C  CA  . MET A 1 120 ? -6.272  -22.910 0.351   1.00 25.36 ? 134 MET A CA  1 
ATOM   820   C  C   . MET A 1 120 ? -7.505  -22.025 0.541   1.00 23.96 ? 134 MET A C   1 
ATOM   821   O  O   . MET A 1 120 ? -8.607  -22.359 0.074   1.00 24.74 ? 134 MET A O   1 
ATOM   822   C  CB  . MET A 1 120 ? -5.918  -23.632 1.655   1.00 25.71 ? 134 MET A CB  1 
ATOM   823   C  CG  . MET A 1 120 ? -4.892  -24.765 1.467   1.00 26.68 ? 134 MET A CG  1 
ATOM   824   S  SD  . MET A 1 120 ? -4.327  -25.414 3.047   1.00 28.78 ? 134 MET A SD  1 
ATOM   825   C  CE  . MET A 1 120 ? -5.782  -26.314 3.593   1.00 32.48 ? 134 MET A CE  1 
ATOM   826   N  N   . LEU A 1 121 ? -7.288  -20.883 1.196   1.00 23.53 ? 135 LEU A N   1 
ATOM   827   C  CA  . LEU A 1 121 ? -8.317  -19.867 1.420   1.00 22.81 ? 135 LEU A CA  1 
ATOM   828   C  C   . LEU A 1 121 ? -8.810  -19.299 0.110   1.00 27.64 ? 135 LEU A C   1 
ATOM   829   O  O   . LEU A 1 121 ? -9.982  -18.959 -0.016  1.00 30.83 ? 135 LEU A O   1 
ATOM   830   C  CB  . LEU A 1 121 ? -7.774  -18.732 2.293   1.00 24.84 ? 135 LEU A CB  1 
ATOM   831   C  CG  . LEU A 1 121 ? -7.645  -19.077 3.773   1.00 25.92 ? 135 LEU A CG  1 
ATOM   832   C  CD1 . LEU A 1 121 ? -6.745  -18.066 4.475   1.00 22.12 ? 135 LEU A CD1 1 
ATOM   833   C  CD2 . LEU A 1 121 ? -9.033  -19.114 4.416   1.00 23.11 ? 135 LEU A CD2 1 
ATOM   834   N  N   . SER A 1 122 ? -7.913  -19.202 -0.864  1.00 26.45 ? 136 SER A N   1 
ATOM   835   C  CA  . SER A 1 122 ? -8.277  -18.739 -2.206  1.00 27.22 ? 136 SER A CA  1 
ATOM   836   C  C   . SER A 1 122 ? -9.198  -19.702 -2.966  1.00 28.50 ? 136 SER A C   1 
ATOM   837   O  O   . SER A 1 122 ? -10.153 -19.280 -3.625  1.00 31.80 ? 136 SER A O   1 
ATOM   838   C  CB  . SER A 1 122 ? -7.008  -18.515 -3.033  1.00 26.16 ? 136 SER A CB  1 
ATOM   839   O  OG  . SER A 1 122 ? -7.325  -18.318 -4.400  1.00 35.82 ? 136 SER A OG  1 
ATOM   840   N  N   . GLY A 1 123 ? -8.894  -20.991 -2.897  1.00 31.40 ? 137 GLY A N   1 
ATOM   841   C  CA  . GLY A 1 123 ? -9.607  -21.975 -3.692  1.00 33.12 ? 137 GLY A CA  1 
ATOM   842   C  C   . GLY A 1 123 ? -10.637 -22.775 -2.918  1.00 32.48 ? 137 GLY A C   1 
ATOM   843   O  O   . GLY A 1 123 ? -11.761 -22.323 -2.721  1.00 33.24 ? 137 GLY A O   1 
ATOM   844   N  N   . PRO A 1 124 ? -10.251 -23.975 -2.468  1.00 32.09 ? 138 PRO A N   1 
ATOM   845   C  CA  . PRO A 1 124 ? -11.181 -24.941 -1.876  1.00 31.40 ? 138 PRO A CA  1 
ATOM   846   C  C   . PRO A 1 124 ? -11.748 -24.531 -0.516  1.00 30.15 ? 138 PRO A C   1 
ATOM   847   O  O   . PRO A 1 124 ? -12.766 -25.088 -0.117  1.00 40.42 ? 138 PRO A O   1 
ATOM   848   C  CB  . PRO A 1 124 ? -10.330 -26.205 -1.752  1.00 30.35 ? 138 PRO A CB  1 
ATOM   849   C  CG  . PRO A 1 124 ? -8.921  -25.675 -1.592  1.00 29.58 ? 138 PRO A CG  1 
ATOM   850   C  CD  . PRO A 1 124 ? -8.871  -24.497 -2.526  1.00 30.30 ? 138 PRO A CD  1 
ATOM   851   N  N   . ARG A 1 125 ? -11.135 -23.573 0.172   1.00 23.02 ? 139 ARG A N   1 
ATOM   852   C  CA  . ARG A 1 125 ? -11.685 -23.118 1.452   1.00 26.42 ? 139 ARG A CA  1 
ATOM   853   C  C   . ARG A 1 125 ? -12.363 -21.742 1.381   1.00 24.76 ? 139 ARG A C   1 
ATOM   854   O  O   . ARG A 1 125 ? -12.805 -21.208 2.396   1.00 23.06 ? 139 ARG A O   1 
ATOM   855   C  CB  . ARG A 1 125 ? -10.611 -23.138 2.555   1.00 22.76 ? 139 ARG A CB  1 
ATOM   856   C  CG  . ARG A 1 125 ? -9.905  -24.496 2.689   1.00 25.05 ? 139 ARG A CG  1 
ATOM   857   C  CD  . ARG A 1 125 ? -10.870 -25.598 3.171   1.00 31.63 ? 139 ARG A CD  1 
ATOM   858   N  NE  . ARG A 1 125 ? -10.786 -25.810 4.618   1.00 31.98 ? 139 ARG A NE  1 
ATOM   859   C  CZ  . ARG A 1 125 ? -9.890  -26.601 5.202   1.00 31.37 ? 139 ARG A CZ  1 
ATOM   860   N  NH1 . ARG A 1 125 ? -9.876  -26.736 6.524   1.00 28.58 ? 139 ARG A NH1 1 
ATOM   861   N  NH2 . ARG A 1 125 ? -9.007  -27.269 4.465   1.00 31.25 ? 139 ARG A NH2 1 
ATOM   862   N  N   . ARG A 1 126 ? -12.456 -21.172 0.188   1.00 24.33 ? 140 ARG A N   1 
ATOM   863   C  CA  . ARG A 1 126 ? -13.014 -19.825 0.068   1.00 23.27 ? 140 ARG A CA  1 
ATOM   864   C  C   . ARG A 1 126 ? -14.493 -19.741 0.475   1.00 28.72 ? 140 ARG A C   1 
ATOM   865   O  O   . ARG A 1 126 ? -14.879 -18.861 1.239   1.00 22.43 ? 140 ARG A O   1 
ATOM   866   C  CB  . ARG A 1 126 ? -12.829 -19.275 -1.339  1.00 25.50 ? 140 ARG A CB  1 
ATOM   867   C  CG  . ARG A 1 126 ? -12.942 -17.748 -1.381  1.00 24.08 ? 140 ARG A CG  1 
ATOM   868   C  CD  . ARG A 1 126 ? -13.213 -17.272 -2.783  1.00 30.18 ? 140 ARG A CD  1 
ATOM   869   N  NE  . ARG A 1 126 ? -12.854 -15.869 -2.959  1.00 35.17 ? 140 ARG A NE  1 
ATOM   870   C  CZ  . ARG A 1 126 ? -11.685 -15.455 -3.432  1.00 37.09 ? 140 ARG A CZ  1 
ATOM   871   N  NH1 . ARG A 1 126 ? -11.446 -14.157 -3.568  1.00 36.89 ? 140 ARG A NH1 1 
ATOM   872   N  NH2 . ARG A 1 126 ? -10.755 -16.339 -3.776  1.00 39.86 ? 140 ARG A NH2 1 
ATOM   873   N  N   . ALA A 1 127 ? -15.309 -20.660 -0.034  1.00 22.77 ? 141 ALA A N   1 
ATOM   874   C  CA  . ALA A 1 127 ? -16.733 -20.694 0.309   1.00 22.99 ? 141 ALA A CA  1 
ATOM   875   C  C   . ALA A 1 127 ? -16.924 -20.838 1.813   1.00 26.50 ? 141 ALA A C   1 
ATOM   876   O  O   . ALA A 1 127 ? -17.806 -20.205 2.395   1.00 28.54 ? 141 ALA A O   1 
ATOM   877   C  CB  . ALA A 1 127 ? -17.444 -21.831 -0.435  1.00 24.30 ? 141 ALA A CB  1 
ATOM   878   N  N   . GLU A 1 128 ? -16.076 -21.652 2.439   1.00 25.36 ? 142 GLU A N   1 
ATOM   879   C  CA  . GLU A 1 128 ? -16.134 -21.864 3.883   1.00 27.25 ? 142 GLU A CA  1 
ATOM   880   C  C   . GLU A 1 128 ? -15.864 -20.594 4.682   1.00 26.43 ? 142 GLU A C   1 
ATOM   881   O  O   . GLU A 1 128 ? -16.649 -20.214 5.568   1.00 24.50 ? 142 GLU A O   1 
ATOM   882   C  CB  . GLU A 1 128 ? -15.138 -22.945 4.324   1.00 25.58 ? 142 GLU A CB  1 
ATOM   883   C  CG  . GLU A 1 128 ? -14.916 -22.949 5.833   1.00 28.32 ? 142 GLU A CG  1 
ATOM   884   C  CD  . GLU A 1 128 ? -13.860 -23.954 6.288   1.00 30.82 ? 142 GLU A CD  1 
ATOM   885   O  OE1 . GLU A 1 128 ? -13.302 -24.690 5.436   1.00 26.01 ? 142 GLU A OE1 1 
ATOM   886   O  OE2 . GLU A 1 128 ? -13.597 -24.001 7.514   1.00 22.86 ? 142 GLU A OE2 1 
ATOM   887   N  N   . ILE A 1 129 ? -14.738 -19.945 4.397   1.00 24.01 ? 143 ILE A N   1 
ATOM   888   C  CA  . ILE A 1 129 ? -14.387 -18.760 5.160   1.00 21.83 ? 143 ILE A CA  1 
ATOM   889   C  C   . ILE A 1 129 ? -15.419 -17.643 4.954   1.00 24.60 ? 143 ILE A C   1 
ATOM   890   O  O   . ILE A 1 129 ? -15.805 -16.985 5.917   1.00 23.23 ? 143 ILE A O   1 
ATOM   891   C  CB  . ILE A 1 129 ? -12.925 -18.287 4.903   1.00 22.98 ? 143 ILE A CB  1 
ATOM   892   C  CG1 . ILE A 1 129 ? -12.518 -17.260 5.961   1.00 27.20 ? 143 ILE A CG1 1 
ATOM   893   C  CG2 . ILE A 1 129 ? -12.761 -17.738 3.486   1.00 23.74 ? 143 ILE A CG2 1 
ATOM   894   C  CD1 . ILE A 1 129 ? -12.519 -17.826 7.364   1.00 27.42 ? 143 ILE A CD1 1 
ATOM   895   N  N   . LEU A 1 130 ? -15.905 -17.478 3.722   1.00 23.25 ? 144 LEU A N   1 
ATOM   896   C  CA  . LEU A 1 130 ? -16.927 -16.475 3.442   1.00 23.15 ? 144 LEU A CA  1 
ATOM   897   C  C   . LEU A 1 130 ? -18.197 -16.766 4.234   1.00 28.07 ? 144 LEU A C   1 
ATOM   898   O  O   . LEU A 1 130 ? -18.735 -15.877 4.901   1.00 28.25 ? 144 LEU A O   1 
ATOM   899   C  CB  . LEU A 1 130 ? -17.238 -16.398 1.949   1.00 25.88 ? 144 LEU A CB  1 
ATOM   900   C  CG  . LEU A 1 130 ? -16.044 -16.016 1.091   1.00 32.31 ? 144 LEU A CG  1 
ATOM   901   C  CD1 . LEU A 1 130 ? -16.372 -16.206 -0.373  1.00 28.64 ? 144 LEU A CD1 1 
ATOM   902   C  CD2 . LEU A 1 130 ? -15.567 -14.582 1.391   1.00 34.67 ? 144 LEU A CD2 1 
ATOM   903   N  N   . ALA A 1 131 ? -18.653 -18.016 4.183   1.00 20.77 ? 145 ALA A N   1 
ATOM   904   C  CA  . ALA A 1 131 ? -19.897 -18.390 4.847   1.00 20.53 ? 145 ALA A CA  1 
ATOM   905   C  C   . ALA A 1 131 ? -19.764 -18.175 6.340   1.00 23.44 ? 145 ALA A C   1 
ATOM   906   O  O   . ALA A 1 131 ? -20.689 -17.676 6.991   1.00 20.26 ? 145 ALA A O   1 
ATOM   907   C  CB  . ALA A 1 131 ? -20.283 -19.841 4.544   1.00 21.46 ? 145 ALA A CB  1 
ATOM   908   N  N   . LYS A 1 132 ? -18.605 -18.544 6.882   1.00 19.76 ? 146 LYS A N   1 
ATOM   909   C  CA  . LYS A 1 132 ? -18.396 -18.447 8.315   1.00 25.40 ? 146 LYS A CA  1 
ATOM   910   C  C   . LYS A 1 132 ? -18.337 -17.011 8.801   1.00 23.67 ? 146 LYS A C   1 
ATOM   911   O  O   . LYS A 1 132 ? -18.797 -16.713 9.911   1.00 21.36 ? 146 LYS A O   1 
ATOM   912   C  CB  . LYS A 1 132 ? -17.169 -19.259 8.744   1.00 20.94 ? 146 LYS A CB  1 
ATOM   913   C  CG  . LYS A 1 132 ? -17.465 -20.759 8.679   1.00 20.84 ? 146 LYS A CG  1 
ATOM   914   C  CD  . LYS A 1 132 ? -16.265 -21.640 9.073   1.00 25.99 ? 146 LYS A CD  1 
ATOM   915   C  CE  . LYS A 1 132 ? -16.655 -23.138 9.016   1.00 25.43 ? 146 LYS A CE  1 
ATOM   916   N  NZ  . LYS A 1 132 ? -15.496 -24.035 9.341   1.00 23.98 ? 146 LYS A NZ  1 
ATOM   917   N  N   . THR A 1 133 ? -17.812 -16.114 7.970   1.00 24.79 ? 147 THR A N   1 
ATOM   918   C  CA  . THR A 1 133 ? -17.773 -14.702 8.351   1.00 22.17 ? 147 THR A CA  1 
ATOM   919   C  C   . THR A 1 133 ? -19.125 -14.014 8.156   1.00 23.24 ? 147 THR A C   1 
ATOM   920   O  O   . THR A 1 133 ? -19.493 -13.139 8.938   1.00 23.37 ? 147 THR A O   1 
ATOM   921   C  CB  . THR A 1 133 ? -16.649 -13.901 7.636   1.00 29.54 ? 147 THR A CB  1 
ATOM   922   O  OG1 . THR A 1 133 ? -16.893 -13.847 6.226   1.00 30.07 ? 147 THR A OG1 1 
ATOM   923   C  CG2 . THR A 1 133 ? -15.312 -14.549 7.875   1.00 28.09 ? 147 THR A CG2 1 
ATOM   924   N  N   . MET A 1 134 ? -19.862 -14.415 7.123   1.00 22.96 ? 148 MET A N   1 
ATOM   925   C  CA  . MET A 1 134 ? -21.227 -13.921 6.924   1.00 23.89 ? 148 MET A CA  1 
ATOM   926   C  C   . MET A 1 134 ? -22.128 -14.291 8.102   1.00 21.38 ? 148 MET A C   1 
ATOM   927   O  O   . MET A 1 134 ? -22.629 -13.430 8.809   1.00 23.73 ? 148 MET A O   1 
ATOM   928   C  CB  . MET A 1 134 ? -21.812 -14.495 5.638   1.00 28.94 ? 148 MET A CB  1 
ATOM   929   C  CG  . MET A 1 134 ? -21.121 -13.982 4.400   1.00 27.62 ? 148 MET A CG  1 
ATOM   930   S  SD  . MET A 1 134 ? -21.838 -14.607 2.880   1.00 27.18 ? 148 MET A SD  1 
ATOM   931   C  CE  . MET A 1 134 ? -23.540 -14.042 3.023   1.00 24.72 ? 148 MET A CE  1 
ATOM   932   N  N   . VAL A 1 135 ? -22.315 -15.587 8.318   1.00 24.95 ? 149 VAL A N   1 
ATOM   933   C  CA  . VAL A 1 135 ? -23.189 -16.083 9.377   1.00 22.41 ? 149 VAL A CA  1 
ATOM   934   C  C   . VAL A 1 135 ? -22.722 -15.702 10.775  1.00 24.33 ? 149 VAL A C   1 
ATOM   935   O  O   . VAL A 1 135 ? -23.533 -15.365 11.644  1.00 25.84 ? 149 VAL A O   1 
ATOM   936   C  CB  . VAL A 1 135 ? -23.335 -17.624 9.302   1.00 28.23 ? 149 VAL A CB  1 
ATOM   937   C  CG1 . VAL A 1 135 ? -24.180 -18.135 10.449  1.00 32.16 ? 149 VAL A CG1 1 
ATOM   938   C  CG2 . VAL A 1 135 ? -23.927 -18.038 7.967   1.00 25.33 ? 149 VAL A CG2 1 
ATOM   939   N  N   . GLY A 1 136 ? -21.411 -15.745 10.989  1.00 25.22 ? 150 GLY A N   1 
ATOM   940   C  CA  . GLY A 1 136 ? -20.845 -15.491 12.301  1.00 22.67 ? 150 GLY A CA  1 
ATOM   941   C  C   . GLY A 1 136 ? -20.647 -14.035 12.679  1.00 20.91 ? 150 GLY A C   1 
ATOM   942   O  O   . GLY A 1 136 ? -20.824 -13.672 13.843  1.00 22.92 ? 150 GLY A O   1 
ATOM   943   N  N   . GLN A 1 137 ? -20.244 -13.210 11.716  1.00 20.76 ? 151 GLN A N   1 
ATOM   944   C  CA  . GLN A 1 137 ? -19.937 -11.808 11.995  1.00 22.41 ? 151 GLN A CA  1 
ATOM   945   C  C   . GLN A 1 137 ? -20.936 -10.825 11.366  1.00 21.37 ? 151 GLN A C   1 
ATOM   946   O  O   . GLN A 1 137 ? -20.804 -9.608  11.532  1.00 20.95 ? 151 GLN A O   1 
ATOM   947   C  CB  . GLN A 1 137 ? -18.497 -11.468 11.569  1.00 20.20 ? 151 GLN A CB  1 
ATOM   948   C  CG  . GLN A 1 137 ? -17.417 -12.127 12.445  1.00 19.05 ? 151 GLN A CG  1 
ATOM   949   C  CD  . GLN A 1 137 ? -16.228 -12.616 11.641  1.00 17.38 ? 151 GLN A CD  1 
ATOM   950   O  OE1 . GLN A 1 137 ? -16.094 -13.815 11.379  1.00 20.20 ? 151 GLN A OE1 1 
ATOM   951   N  NE2 . GLN A 1 137 ? -15.363 -11.683 11.222  1.00 20.46 ? 151 GLN A NE2 1 
ATOM   952   N  N   . GLY A 1 138 ? -21.919 -11.352 10.639  1.00 20.18 ? 152 GLY A N   1 
ATOM   953   C  CA  . GLY A 1 138 ? -22.975 -10.530 10.048  1.00 20.09 ? 152 GLY A CA  1 
ATOM   954   C  C   . GLY A 1 138 ? -22.598 -9.781  8.773   1.00 26.20 ? 152 GLY A C   1 
ATOM   955   O  O   . GLY A 1 138 ? -23.277 -8.827  8.375   1.00 29.50 ? 152 GLY A O   1 
ATOM   956   N  N   . LYS A 1 139 ? -21.518 -10.208 8.127   1.00 24.39 ? 153 LYS A N   1 
ATOM   957   C  CA  . LYS A 1 139 ? -21.055 -9.574  6.898   1.00 26.80 ? 153 LYS A CA  1 
ATOM   958   C  C   . LYS A 1 139 ? -21.909 -9.962  5.693   1.00 25.24 ? 153 LYS A C   1 
ATOM   959   O  O   . LYS A 1 139 ? -22.336 -11.116 5.573   1.00 28.29 ? 153 LYS A O   1 
ATOM   960   C  CB  . LYS A 1 139 ? -19.597 -9.964  6.604   1.00 29.12 ? 153 LYS A CB  1 
ATOM   961   C  CG  . LYS A 1 139 ? -18.570 -9.362  7.553   1.00 23.57 ? 153 LYS A CG  1 
ATOM   962   C  CD  . LYS A 1 139 ? -17.160 -9.645  7.060   1.00 27.95 ? 153 LYS A CD  1 
ATOM   963   C  CE  . LYS A 1 139 ? -16.132 -9.368  8.143   1.00 32.43 ? 153 LYS A CE  1 
ATOM   964   N  NZ  . LYS A 1 139 ? -14.753 -9.751  7.692   1.00 40.62 ? 153 LYS A NZ  1 
ATOM   965   N  N   . THR A 1 140 ? -22.149 -8.998  4.799   1.00 26.22 ? 154 THR A N   1 
ATOM   966   C  CA  . THR A 1 140 ? -22.715 -9.313  3.484   1.00 29.26 ? 154 THR A CA  1 
ATOM   967   C  C   . THR A 1 140 ? -21.702 -10.096 2.651   1.00 26.73 ? 154 THR A C   1 
ATOM   968   O  O   . THR A 1 140 ? -20.528 -10.200 3.025   1.00 24.51 ? 154 THR A O   1 
ATOM   969   C  CB  . THR A 1 140 ? -23.095 -8.039  2.690   1.00 24.89 ? 154 THR A CB  1 
ATOM   970   O  OG1 . THR A 1 140 ? -21.957 -7.170  2.597   1.00 21.20 ? 154 THR A OG1 1 
ATOM   971   C  CG2 . THR A 1 140 ? -24.235 -7.302  3.387   1.00 27.76 ? 154 THR A CG2 1 
ATOM   972   N  N   . VAL A 1 141 ? -22.140 -10.602 1.503   1.00 27.33 ? 155 VAL A N   1 
ATOM   973   C  CA  . VAL A 1 141 ? -21.256 -11.402 0.663   1.00 29.85 ? 155 VAL A CA  1 
ATOM   974   C  C   . VAL A 1 141 ? -20.041 -10.626 0.164   1.00 32.48 ? 155 VAL A C   1 
ATOM   975   O  O   . VAL A 1 141 ? -18.915 -11.089 0.302   1.00 36.87 ? 155 VAL A O   1 
ATOM   976   C  CB  . VAL A 1 141 ? -21.998 -12.091 -0.515  1.00 34.40 ? 155 VAL A CB  1 
ATOM   977   C  CG1 . VAL A 1 141 ? -22.918 -11.115 -1.242  1.00 37.99 ? 155 VAL A CG1 1 
ATOM   978   C  CG2 . VAL A 1 141 ? -20.994 -12.703 -1.474  1.00 33.11 ? 155 VAL A CG2 1 
ATOM   979   N  N   . ILE A 1 142 ? -20.259 -9.442  -0.393  1.00 33.08 ? 156 ILE A N   1 
ATOM   980   C  CA  . ILE A 1 142 ? -19.134 -8.653  -0.904  1.00 34.75 ? 156 ILE A CA  1 
ATOM   981   C  C   . ILE A 1 142 ? -18.191 -8.144  0.207   1.00 29.86 ? 156 ILE A C   1 
ATOM   982   O  O   . ILE A 1 142 ? -16.977 -8.050  0.014   1.00 32.55 ? 156 ILE A O   1 
ATOM   983   C  CB  . ILE A 1 142 ? -19.612 -7.494  -1.798  1.00 32.27 ? 156 ILE A CB  1 
ATOM   984   C  CG1 . ILE A 1 142 ? -20.346 -8.049  -3.030  1.00 40.41 ? 156 ILE A CG1 1 
ATOM   985   C  CG2 . ILE A 1 142 ? -18.436 -6.622  -2.227  1.00 27.95 ? 156 ILE A CG2 1 
ATOM   986   C  CD1 . ILE A 1 142 ? -19.535 -9.077  -3.834  1.00 43.37 ? 156 ILE A CD1 1 
ATOM   987   N  N   . GLN A 1 143 ? -18.745 -7.825  1.371   1.00 25.02 ? 157 GLN A N   1 
ATOM   988   C  CA  . GLN A 1 143 ? -17.916 -7.402  2.492   1.00 26.19 ? 157 GLN A CA  1 
ATOM   989   C  C   . GLN A 1 143 ? -17.015 -8.546  2.943   1.00 25.67 ? 157 GLN A C   1 
ATOM   990   O  O   . GLN A 1 143 ? -15.831 -8.351  3.205   1.00 24.66 ? 157 GLN A O   1 
ATOM   991   C  CB  . GLN A 1 143 ? -18.784 -6.940  3.662   1.00 24.32 ? 157 GLN A CB  1 
ATOM   992   C  CG  . GLN A 1 143 ? -17.990 -6.324  4.781   1.00 32.12 ? 157 GLN A CG  1 
ATOM   993   C  CD  . GLN A 1 143 ? -17.164 -5.142  4.301   1.00 35.81 ? 157 GLN A CD  1 
ATOM   994   O  OE1 . GLN A 1 143 ? -17.689 -4.216  3.681   1.00 33.37 ? 157 GLN A OE1 1 
ATOM   995   N  NE2 . GLN A 1 143 ? -15.864 -5.181  4.566   1.00 32.17 ? 157 GLN A NE2 1 
ATOM   996   N  N   . ALA A 1 144 ? -17.602 -9.735  3.048   1.00 27.02 ? 158 ALA A N   1 
ATOM   997   C  CA  . ALA A 1 144 ? -16.875 -10.936 3.440   1.00 25.85 ? 158 ALA A CA  1 
ATOM   998   C  C   . ALA A 1 144 ? -15.784 -11.248 2.414   1.00 28.63 ? 158 ALA A C   1 
ATOM   999   O  O   . ALA A 1 144 ? -14.665 -11.648 2.771   1.00 22.82 ? 158 ALA A O   1 
ATOM   1000  C  CB  . ALA A 1 144 ? -17.848 -12.115 3.573   1.00 23.48 ? 158 ALA A CB  1 
ATOM   1001  N  N   . GLU A 1 145 ? -16.125 -11.068 1.138   1.00 31.24 ? 159 GLU A N   1 
ATOM   1002  C  CA  . GLU A 1 145 ? -15.212 -11.352 0.025   1.00 33.91 ? 159 GLU A CA  1 
ATOM   1003  C  C   . GLU A 1 145 ? -14.037 -10.382 -0.017  1.00 35.32 ? 159 GLU A C   1 
ATOM   1004  O  O   . GLU A 1 145 ? -12.885 -10.798 -0.116  1.00 37.91 ? 159 GLU A O   1 
ATOM   1005  C  CB  . GLU A 1 145 ? -15.976 -11.338 -1.305  1.00 36.61 ? 159 GLU A CB  1 
ATOM   1006  C  CG  . GLU A 1 145 ? -15.106 -11.322 -2.564  1.00 43.04 ? 159 GLU A CG  1 
ATOM   1007  C  CD  . GLU A 1 145 ? -14.357 -12.629 -2.824  1.00 40.53 ? 159 GLU A CD  1 
ATOM   1008  O  OE1 . GLU A 1 145 ? -14.521 -13.588 -2.043  1.00 35.60 ? 159 GLU A OE1 1 
ATOM   1009  O  OE2 . GLU A 1 145 ? -13.601 -12.692 -3.817  1.00 34.92 ? 159 GLU A OE2 1 
ATOM   1010  N  N   . ILE A 1 146 ? -14.333 -9.091  0.063   1.00 30.92 ? 160 ILE A N   1 
ATOM   1011  C  CA  . ILE A 1 146 ? -13.287 -8.073  0.118   1.00 27.92 ? 160 ILE A CA  1 
ATOM   1012  C  C   . ILE A 1 146 ? -12.332 -8.325  1.285   1.00 30.08 ? 160 ILE A C   1 
ATOM   1013  O  O   . ILE A 1 146 ? -11.116 -8.290  1.113   1.00 30.64 ? 160 ILE A O   1 
ATOM   1014  C  CB  . ILE A 1 146 ? -13.886 -6.644  0.190   1.00 28.18 ? 160 ILE A CB  1 
ATOM   1015  C  CG1 . ILE A 1 146 ? -14.602 -6.309  -1.121  1.00 34.24 ? 160 ILE A CG1 1 
ATOM   1016  C  CG2 . ILE A 1 146 ? -12.795 -5.614  0.458   1.00 33.35 ? 160 ILE A CG2 1 
ATOM   1017  C  CD1 . ILE A 1 146 ? -15.323 -4.961  -1.112  1.00 38.67 ? 160 ILE A CD1 1 
ATOM   1018  N  N   . ASP A 1 147 ? -12.881 -8.621  2.462   1.00 30.22 ? 161 ASP A N   1 
ATOM   1019  C  CA  . ASP A 1 147 ? -12.058 -8.889  3.637   1.00 26.98 ? 161 ASP A CA  1 
ATOM   1020  C  C   . ASP A 1 147 ? -11.199 -10.157 3.523   1.00 32.06 ? 161 ASP A C   1 
ATOM   1021  O  O   . ASP A 1 147 ? -10.026 -10.158 3.931   1.00 27.79 ? 161 ASP A O   1 
ATOM   1022  C  CB  . ASP A 1 147 ? -12.918 -8.937  4.900   1.00 25.54 ? 161 ASP A CB  1 
ATOM   1023  C  CG  . ASP A 1 147 ? -13.477 -7.578  5.264   1.00 34.71 ? 161 ASP A CG  1 
ATOM   1024  O  OD1 . ASP A 1 147 ? -13.026 -6.577  4.658   1.00 34.06 ? 161 ASP A OD1 1 
ATOM   1025  O  OD2 . ASP A 1 147 ? -14.358 -7.508  6.150   1.00 31.71 ? 161 ASP A OD2 1 
ATOM   1026  N  N   . ALA A 1 148 ? -11.772 -11.230 2.979   1.00 33.74 ? 162 ALA A N   1 
ATOM   1027  C  CA  . ALA A 1 148 ? -11.016 -12.471 2.792   1.00 32.97 ? 162 ALA A CA  1 
ATOM   1028  C  C   . ALA A 1 148 ? -9.857  -12.272 1.820   1.00 31.75 ? 162 ALA A C   1 
ATOM   1029  O  O   . ALA A 1 148 ? -8.726  -12.659 2.113   1.00 27.65 ? 162 ALA A O   1 
ATOM   1030  C  CB  . ALA A 1 148 ? -11.912 -13.590 2.315   1.00 28.05 ? 162 ALA A CB  1 
ATOM   1031  N  N   . ALA A 1 149 ? -10.147 -11.660 0.673   1.00 29.58 ? 163 ALA A N   1 
ATOM   1032  C  CA  . ALA A 1 149 ? -9.121  -11.366 -0.323  1.00 32.15 ? 163 ALA A CA  1 
ATOM   1033  C  C   . ALA A 1 149 ? -8.045  -10.408 0.203   1.00 39.43 ? 163 ALA A C   1 
ATOM   1034  O  O   . ALA A 1 149 ? -6.854  -10.609 -0.043  1.00 40.96 ? 163 ALA A O   1 
ATOM   1035  C  CB  . ALA A 1 149 ? -9.758  -10.809 -1.600  1.00 31.69 ? 163 ALA A CB  1 
ATOM   1036  N  N   . ALA A 1 150 ? -8.459  -9.385  0.945   1.00 43.15 ? 164 ALA A N   1 
ATOM   1037  C  CA  . ALA A 1 150 ? -7.529  -8.342  1.387   1.00 47.13 ? 164 ALA A CA  1 
ATOM   1038  C  C   . ALA A 1 150 ? -6.885  -8.587  2.753   1.00 52.30 ? 164 ALA A C   1 
ATOM   1039  O  O   . ALA A 1 150 ? -5.663  -8.635  2.865   1.00 59.75 ? 164 ALA A O   1 
ATOM   1040  C  CB  . ALA A 1 150 ? -8.199  -6.976  1.351   1.00 49.66 ? 164 ALA A CB  1 
ATOM   1041  N  N   . GLU A 1 151 ? -7.700  -8.737  3.790   1.00 46.38 ? 165 GLU A N   1 
ATOM   1042  C  CA  . GLU A 1 151 ? -7.180  -8.831  5.152   1.00 44.96 ? 165 GLU A CA  1 
ATOM   1043  C  C   . GLU A 1 151 ? -6.632  -10.218 5.496   1.00 48.53 ? 165 GLU A C   1 
ATOM   1044  O  O   . GLU A 1 151 ? -6.061  -10.424 6.571   1.00 52.79 ? 165 GLU A O   1 
ATOM   1045  C  CB  . GLU A 1 151 ? -8.253  -8.420  6.168   1.00 45.32 ? 165 GLU A CB  1 
ATOM   1046  N  N   . LEU A 1 152 ? -6.787  -11.167 4.580   1.00 38.40 ? 166 LEU A N   1 
ATOM   1047  C  CA  . LEU A 1 152 ? -6.414  -12.542 4.876   1.00 32.10 ? 166 LEU A CA  1 
ATOM   1048  C  C   . LEU A 1 152 ? -5.490  -13.125 3.801   1.00 28.95 ? 166 LEU A C   1 
ATOM   1049  O  O   . LEU A 1 152 ? -4.317  -13.400 4.060   1.00 24.31 ? 166 LEU A O   1 
ATOM   1050  C  CB  . LEU A 1 152 ? -7.687  -13.373 5.043   1.00 37.06 ? 166 LEU A CB  1 
ATOM   1051  C  CG  . LEU A 1 152 ? -7.710  -14.723 5.741   1.00 38.29 ? 166 LEU A CG  1 
ATOM   1052  C  CD1 . LEU A 1 152 ? -7.060  -14.631 7.106   1.00 30.86 ? 166 LEU A CD1 1 
ATOM   1053  C  CD2 . LEU A 1 152 ? -9.174  -15.236 5.841   1.00 21.63 ? 166 LEU A CD2 1 
ATOM   1054  N  N   . ILE A 1 153 ? -6.009  -13.291 2.586   1.00 25.47 ? 167 ILE A N   1 
ATOM   1055  C  CA  . ILE A 1 153 ? -5.233  -13.878 1.500   1.00 22.59 ? 167 ILE A CA  1 
ATOM   1056  C  C   . ILE A 1 153 ? -4.055  -13.015 1.036   1.00 22.82 ? 167 ILE A C   1 
ATOM   1057  O  O   . ILE A 1 153 ? -2.930  -13.511 0.935   1.00 24.75 ? 167 ILE A O   1 
ATOM   1058  C  CB  . ILE A 1 153 ? -6.133  -14.227 0.300   1.00 25.51 ? 167 ILE A CB  1 
ATOM   1059  C  CG1 . ILE A 1 153 ? -7.126  -15.321 0.698   1.00 30.33 ? 167 ILE A CG1 1 
ATOM   1060  C  CG2 . ILE A 1 153 ? -5.292  -14.698 -0.863  1.00 26.68 ? 167 ILE A CG2 1 
ATOM   1061  C  CD1 . ILE A 1 153 ? -8.272  -15.500 -0.298  1.00 35.72 ? 167 ILE A CD1 1 
ATOM   1062  N  N   . ASP A 1 154 ? -4.308  -11.738 0.749   1.00 22.02 ? 168 ASP A N   1 
ATOM   1063  C  CA  . ASP A 1 154 ? -3.233  -10.825 0.326   1.00 23.47 ? 168 ASP A CA  1 
ATOM   1064  C  C   . ASP A 1 154 ? -2.200  -10.628 1.429   1.00 25.17 ? 168 ASP A C   1 
ATOM   1065  O  O   . ASP A 1 154 ? -1.000  -10.549 1.159   1.00 24.50 ? 168 ASP A O   1 
ATOM   1066  C  CB  . ASP A 1 154 ? -3.783  -9.453  -0.087  1.00 21.81 ? 168 ASP A CB  1 
ATOM   1067  C  CG  . ASP A 1 154 ? -4.318  -9.431  -1.513  1.00 29.51 ? 168 ASP A CG  1 
ATOM   1068  O  OD1 . ASP A 1 154 ? -4.032  -10.366 -2.297  1.00 33.92 ? 168 ASP A OD1 1 
ATOM   1069  O  OD2 . ASP A 1 154 ? -5.020  -8.455  -1.851  1.00 31.30 ? 168 ASP A OD2 1 
ATOM   1070  N  N   . PHE A 1 155 ? -2.664  -10.532 2.670   1.00 22.97 ? 169 PHE A N   1 
ATOM   1071  C  CA  . PHE A 1 155 ? -1.742  -10.354 3.786   1.00 23.92 ? 169 PHE A CA  1 
ATOM   1072  C  C   . PHE A 1 155 ? -0.776  -11.534 3.896   1.00 30.35 ? 169 PHE A C   1 
ATOM   1073  O  O   . PHE A 1 155 ? 0.435   -11.330 4.045   1.00 21.07 ? 169 PHE A O   1 
ATOM   1074  C  CB  . PHE A 1 155 ? -2.481  -10.128 5.116   1.00 24.64 ? 169 PHE A CB  1 
ATOM   1075  N  N   . PHE A 1 156 ? -1.305  -12.759 3.814   1.00 19.97 ? 170 PHE A N   1 
ATOM   1076  C  CA  . PHE A 1 156 ? -0.446  -13.942 3.838   1.00 23.30 ? 170 PHE A CA  1 
ATOM   1077  C  C   . PHE A 1 156 ? 0.566   -13.906 2.700   1.00 24.68 ? 170 PHE A C   1 
ATOM   1078  O  O   . PHE A 1 156 ? 1.775   -14.039 2.932   1.00 21.90 ? 170 PHE A O   1 
ATOM   1079  C  CB  . PHE A 1 156 ? -1.257  -15.246 3.784   1.00 19.57 ? 170 PHE A CB  1 
ATOM   1080  C  CG  . PHE A 1 156 ? -1.923  -15.606 5.090   1.00 24.15 ? 170 PHE A CG  1 
ATOM   1081  C  CD1 . PHE A 1 156 ? -1.700  -14.860 6.227   1.00 26.03 ? 170 PHE A CD1 1 
ATOM   1082  C  CD2 . PHE A 1 156 ? -2.766  -16.705 5.171   1.00 31.80 ? 170 PHE A CD2 1 
ATOM   1083  C  CE1 . PHE A 1 156 ? -2.302  -15.192 7.432   1.00 32.87 ? 170 PHE A CE1 1 
ATOM   1084  C  CE2 . PHE A 1 156 ? -3.376  -17.044 6.367   1.00 34.26 ? 170 PHE A CE2 1 
ATOM   1085  C  CZ  . PHE A 1 156 ? -3.143  -16.282 7.504   1.00 29.98 ? 170 PHE A CZ  1 
ATOM   1086  N  N   . ARG A 1 157 ? 0.085   -13.706 1.476   1.00 21.63 ? 171 ARG A N   1 
ATOM   1087  C  CA  . ARG A 1 157 ? 0.987   -13.738 0.325   1.00 22.70 ? 171 ARG A CA  1 
ATOM   1088  C  C   . ARG A 1 157 ? 2.048   -12.632 0.358   1.00 24.67 ? 171 ARG A C   1 
ATOM   1089  O  O   . ARG A 1 157 ? 3.241   -12.899 0.191   1.00 22.87 ? 171 ARG A O   1 
ATOM   1090  C  CB  . ARG A 1 157 ? 0.220   -13.715 -1.004  1.00 22.89 ? 171 ARG A CB  1 
ATOM   1091  C  CG  . ARG A 1 157 ? -0.626  -14.969 -1.253  1.00 25.62 ? 171 ARG A CG  1 
ATOM   1092  C  CD  . ARG A 1 157 ? -0.696  -15.312 -2.738  1.00 27.08 ? 171 ARG A CD  1 
ATOM   1093  N  NE  . ARG A 1 157 ? -1.648  -16.392 -3.007  1.00 31.98 ? 171 ARG A NE  1 
ATOM   1094  C  CZ  . ARG A 1 157 ? -2.901  -16.195 -3.409  1.00 29.32 ? 171 ARG A CZ  1 
ATOM   1095  N  NH1 . ARG A 1 157 ? -3.346  -14.961 -3.615  1.00 27.61 ? 171 ARG A NH1 1 
ATOM   1096  N  NH2 . ARG A 1 157 ? -3.704  -17.229 -3.628  1.00 31.32 ? 171 ARG A NH2 1 
ATOM   1097  N  N   . PHE A 1 158 ? 1.611   -11.399 0.572   1.00 25.73 ? 172 PHE A N   1 
ATOM   1098  C  CA  . PHE A 1 158 ? 2.523   -10.258 0.507   1.00 25.89 ? 172 PHE A CA  1 
ATOM   1099  C  C   . PHE A 1 158 ? 3.505   -10.192 1.675   1.00 25.70 ? 172 PHE A C   1 
ATOM   1100  O  O   . PHE A 1 158 ? 4.652   -9.785  1.503   1.00 28.92 ? 172 PHE A O   1 
ATOM   1101  C  CB  . PHE A 1 158 ? 1.736   -8.951  0.361   1.00 22.76 ? 172 PHE A CB  1 
ATOM   1102  C  CG  . PHE A 1 158 ? 1.262   -8.693  -1.043  1.00 28.92 ? 172 PHE A CG  1 
ATOM   1103  C  CD1 . PHE A 1 158 ? 2.123   -8.152  -1.991  1.00 34.03 ? 172 PHE A CD1 1 
ATOM   1104  C  CD2 . PHE A 1 158 ? -0.030  -9.019  -1.428  1.00 31.01 ? 172 PHE A CD2 1 
ATOM   1105  C  CE1 . PHE A 1 158 ? 1.701   -7.923  -3.290  1.00 33.95 ? 172 PHE A CE1 1 
ATOM   1106  C  CE2 . PHE A 1 158 ? -0.461  -8.784  -2.726  1.00 29.30 ? 172 PHE A CE2 1 
ATOM   1107  C  CZ  . PHE A 1 158 ? 0.412   -8.240  -3.662  1.00 28.80 ? 172 PHE A CZ  1 
ATOM   1108  N  N   . ASN A 1 159 ? 3.054   -10.589 2.860   1.00 24.54 ? 173 ASN A N   1 
ATOM   1109  C  CA  . ASN A 1 159 ? 3.938   -10.661 4.011   1.00 23.07 ? 173 ASN A CA  1 
ATOM   1110  C  C   . ASN A 1 159 ? 5.038   -11.682 3.753   1.00 24.35 ? 173 ASN A C   1 
ATOM   1111  O  O   . ASN A 1 159 ? 6.191   -11.452 4.087   1.00 22.74 ? 173 ASN A O   1 
ATOM   1112  C  CB  . ASN A 1 159 ? 3.165   -11.068 5.265   1.00 25.31 ? 173 ASN A CB  1 
ATOM   1113  C  CG  . ASN A 1 159 ? 2.587   -9.888  6.006   1.00 33.23 ? 173 ASN A CG  1 
ATOM   1114  O  OD1 . ASN A 1 159 ? 2.780   -8.736  5.619   1.00 34.20 ? 173 ASN A OD1 1 
ATOM   1115  N  ND2 . ASN A 1 159 ? 1.864   -10.172 7.083   1.00 42.62 ? 173 ASN A ND2 1 
ATOM   1116  N  N   . ALA A 1 160 ? 4.657   -12.816 3.170   1.00 21.02 ? 174 ALA A N   1 
ATOM   1117  C  CA  . ALA A 1 160 ? 5.605   -13.865 2.821   1.00 28.04 ? 174 ALA A CA  1 
ATOM   1118  C  C   . ALA A 1 160 ? 6.676   -13.304 1.891   1.00 29.97 ? 174 ALA A C   1 
ATOM   1119  O  O   . ALA A 1 160 ? 7.864   -13.600 2.041   1.00 24.46 ? 174 ALA A O   1 
ATOM   1120  C  CB  . ALA A 1 160 ? 4.882   -15.044 2.154   1.00 21.61 ? 174 ALA A CB  1 
ATOM   1121  N  N   . LYS A 1 161 ? 6.246   -12.486 0.937   1.00 26.50 ? 175 LYS A N   1 
ATOM   1122  C  CA  . LYS A 1 161 ? 7.163   -11.879 -0.024  1.00 25.34 ? 175 LYS A CA  1 
ATOM   1123  C  C   . LYS A 1 161 ? 8.114   -10.905 0.665   1.00 28.83 ? 175 LYS A C   1 
ATOM   1124  O  O   . LYS A 1 161 ? 9.321   -10.889 0.395   1.00 27.57 ? 175 LYS A O   1 
ATOM   1125  C  CB  . LYS A 1 161 ? 6.376   -11.143 -1.101  1.00 21.81 ? 175 LYS A CB  1 
ATOM   1126  C  CG  . LYS A 1 161 ? 7.226   -10.262 -2.012  1.00 28.20 ? 175 LYS A CG  1 
ATOM   1127  C  CD  . LYS A 1 161 ? 6.335   -9.366  -2.872  1.00 32.48 ? 175 LYS A CD  1 
ATOM   1128  C  CE  . LYS A 1 161 ? 7.146   -8.401  -3.724  1.00 33.43 ? 175 LYS A CE  1 
ATOM   1129  N  NZ  . LYS A 1 161 ? 7.892   -9.108  -4.798  1.00 36.69 ? 175 LYS A NZ  1 
ATOM   1130  N  N   . TYR A 1 162 ? 7.568   -10.079 1.545   1.00 22.50 ? 176 TYR A N   1 
ATOM   1131  C  CA  . TYR A 1 162 ? 8.401   -9.123  2.255   1.00 29.71 ? 176 TYR A CA  1 
ATOM   1132  C  C   . TYR A 1 162 ? 9.417   -9.851  3.129   1.00 32.22 ? 176 TYR A C   1 
ATOM   1133  O  O   . TYR A 1 162 ? 10.580  -9.452  3.189   1.00 30.69 ? 176 TYR A O   1 
ATOM   1134  C  CB  . TYR A 1 162 ? 7.558   -8.173  3.101   1.00 35.12 ? 176 TYR A CB  1 
ATOM   1135  C  CG  . TYR A 1 162 ? 6.478   -7.451  2.332   1.00 47.16 ? 176 TYR A CG  1 
ATOM   1136  C  CD1 . TYR A 1 162 ? 6.622   -7.174  0.975   1.00 50.53 ? 176 TYR A CD1 1 
ATOM   1137  C  CD2 . TYR A 1 162 ? 5.303   -7.047  2.967   1.00 47.91 ? 176 TYR A CD2 1 
ATOM   1138  C  CE1 . TYR A 1 162 ? 5.625   -6.519  0.274   1.00 53.23 ? 176 TYR A CE1 1 
ATOM   1139  C  CE2 . TYR A 1 162 ? 4.306   -6.396  2.275   1.00 51.29 ? 176 TYR A CE2 1 
ATOM   1140  C  CZ  . TYR A 1 162 ? 4.470   -6.131  0.932   1.00 53.62 ? 176 TYR A CZ  1 
ATOM   1141  O  OH  . TYR A 1 162 ? 3.470   -5.476  0.249   1.00 56.98 ? 176 TYR A OH  1 
ATOM   1142  N  N   . ALA A 1 163 ? 8.981   -10.924 3.790   1.00 28.17 ? 177 ALA A N   1 
ATOM   1143  C  CA  . ALA A 1 163 ? 9.863   -11.690 4.678   1.00 30.03 ? 177 ALA A CA  1 
ATOM   1144  C  C   . ALA A 1 163 ? 10.996  -12.338 3.894   1.00 27.45 ? 177 ALA A C   1 
ATOM   1145  O  O   . ALA A 1 163 ? 12.171  -12.235 4.272   1.00 24.70 ? 177 ALA A O   1 
ATOM   1146  C  CB  . ALA A 1 163 ? 9.066   -12.752 5.447   1.00 24.81 ? 177 ALA A CB  1 
ATOM   1147  N  N   . VAL A 1 164 ? 10.632  -12.985 2.792   1.00 26.02 ? 178 VAL A N   1 
ATOM   1148  C  CA  . VAL A 1 164 ? 11.588  -13.649 1.915   1.00 29.51 ? 178 VAL A CA  1 
ATOM   1149  C  C   . VAL A 1 164 ? 12.611  -12.667 1.344   1.00 34.31 ? 178 VAL A C   1 
ATOM   1150  O  O   . VAL A 1 164 ? 13.806  -12.954 1.309   1.00 31.19 ? 178 VAL A O   1 
ATOM   1151  C  CB  . VAL A 1 164 ? 10.882  -14.391 0.756   1.00 28.46 ? 178 VAL A CB  1 
ATOM   1152  C  CG1 . VAL A 1 164 ? 11.864  -14.716 -0.351  1.00 31.92 ? 178 VAL A CG1 1 
ATOM   1153  C  CG2 . VAL A 1 164 ? 10.210  -15.665 1.255   1.00 24.73 ? 178 VAL A CG2 1 
ATOM   1154  N  N   . GLU A 1 165 ? 12.147  -11.503 0.914   1.00 30.36 ? 179 GLU A N   1 
ATOM   1155  C  CA  . GLU A 1 165 ? 13.050  -10.532 0.309   1.00 34.48 ? 179 GLU A CA  1 
ATOM   1156  C  C   . GLU A 1 165 ? 13.973  -9.894  1.337   1.00 35.19 ? 179 GLU A C   1 
ATOM   1157  O  O   . GLU A 1 165 ? 15.110  -9.537  1.021   1.00 31.47 ? 179 GLU A O   1 
ATOM   1158  C  CB  . GLU A 1 165 ? 12.278  -9.473  -0.468  1.00 34.83 ? 179 GLU A CB  1 
ATOM   1159  C  CG  . GLU A 1 165 ? 11.765  -10.001 -1.803  1.00 46.23 ? 179 GLU A CG  1 
ATOM   1160  C  CD  . GLU A 1 165 ? 10.838  -9.037  -2.506  1.00 53.04 ? 179 GLU A CD  1 
ATOM   1161  O  OE1 . GLU A 1 165 ? 10.473  -8.004  -1.902  1.00 59.61 ? 179 GLU A OE1 1 
ATOM   1162  O  OE2 . GLU A 1 165 ? 10.472  -9.322  -3.663  1.00 53.68 ? 179 GLU A OE2 1 
ATOM   1163  N  N   . LEU A 1 166 ? 13.486  -9.776  2.567   1.00 34.99 ? 180 LEU A N   1 
ATOM   1164  C  CA  . LEU A 1 166 ? 14.273  -9.207  3.659   1.00 37.35 ? 180 LEU A CA  1 
ATOM   1165  C  C   . LEU A 1 166 ? 15.660  -9.855  3.734   1.00 41.68 ? 180 LEU A C   1 
ATOM   1166  O  O   . LEU A 1 166 ? 16.656  -9.170  3.944   1.00 38.74 ? 180 LEU A O   1 
ATOM   1167  C  CB  . LEU A 1 166 ? 13.518  -9.340  4.985   1.00 36.06 ? 180 LEU A CB  1 
ATOM   1168  C  CG  . LEU A 1 166 ? 13.764  -8.270  6.050   1.00 37.26 ? 180 LEU A CG  1 
ATOM   1169  C  CD1 . LEU A 1 166 ? 13.745  -6.872  5.447   1.00 34.19 ? 180 LEU A CD1 1 
ATOM   1170  C  CD2 . LEU A 1 166 ? 12.754  -8.389  7.181   1.00 36.06 ? 180 LEU A CD2 1 
ATOM   1171  N  N   . GLU A 1 167 ? 15.718  -11.171 3.541   1.00 45.82 ? 181 GLU A N   1 
ATOM   1172  C  CA  . GLU A 1 167 ? 16.989  -11.858 3.310   1.00 52.04 ? 181 GLU A CA  1 
ATOM   1173  C  C   . GLU A 1 167 ? 17.303  -11.903 1.808   1.00 58.94 ? 181 GLU A C   1 
ATOM   1174  O  O   . GLU A 1 167 ? 17.157  -12.942 1.163   1.00 59.22 ? 181 GLU A O   1 
ATOM   1175  C  CB  . GLU A 1 167 ? 16.958  -13.271 3.897   1.00 52.48 ? 181 GLU A CB  1 
ATOM   1176  N  N   . GLY A 1 168 ? 17.711  -10.756 1.263   1.00 61.59 ? 182 GLY A N   1 
ATOM   1177  C  CA  . GLY A 1 168 ? 18.097  -10.611 -0.136  1.00 55.05 ? 182 GLY A CA  1 
ATOM   1178  C  C   . GLY A 1 168 ? 19.147  -9.513  -0.220  1.00 52.63 ? 182 GLY A C   1 
ATOM   1179  O  O   . GLY A 1 168 ? 19.024  -8.550  -0.977  1.00 46.88 ? 182 GLY A O   1 
ATOM   1180  N  N   . GLN A 1 169 ? 20.196  -9.682  0.578   1.00 55.30 ? 183 GLN A N   1 
ATOM   1181  C  CA  . GLN A 1 169 ? 21.179  -8.638  0.858   1.00 50.36 ? 183 GLN A CA  1 
ATOM   1182  C  C   . GLN A 1 169 ? 22.413  -8.741  -0.033  1.00 47.66 ? 183 GLN A C   1 
ATOM   1183  O  O   . GLN A 1 169 ? 22.592  -9.725  -0.750  1.00 44.63 ? 183 GLN A O   1 
ATOM   1184  C  CB  . GLN A 1 169 ? 21.600  -8.739  2.325   1.00 48.33 ? 183 GLN A CB  1 
ATOM   1185  C  CG  . GLN A 1 169 ? 20.431  -9.016  3.264   1.00 47.39 ? 183 GLN A CG  1 
ATOM   1186  C  CD  . GLN A 1 169 ? 20.850  -9.744  4.526   1.00 46.97 ? 183 GLN A CD  1 
ATOM   1187  O  OE1 . GLN A 1 169 ? 22.040  -9.867  4.821   1.00 45.41 ? 183 GLN A OE1 1 
ATOM   1188  N  NE2 . GLN A 1 169 ? 19.870  -10.239 5.277   1.00 45.14 ? 183 GLN A NE2 1 
ATOM   1189  N  N   . GLN A 1 170 ? 23.265  -7.724  0.031   1.00 48.97 ? 184 GLN A N   1 
ATOM   1190  C  CA  . GLN A 1 170 ? 24.471  -7.672  -0.793  1.00 52.23 ? 184 GLN A CA  1 
ATOM   1191  C  C   . GLN A 1 170 ? 25.418  -8.851  -0.527  1.00 51.22 ? 184 GLN A C   1 
ATOM   1192  O  O   . GLN A 1 170 ? 25.552  -9.301  0.614   1.00 47.78 ? 184 GLN A O   1 
ATOM   1193  C  CB  . GLN A 1 170 ? 25.202  -6.348  -0.562  1.00 51.42 ? 184 GLN A CB  1 
ATOM   1194  N  N   . PRO A 1 171 ? 26.081  -9.359  -1.582  1.00 53.63 ? 185 PRO A N   1 
ATOM   1195  C  CA  . PRO A 1 171 ? 27.055  -10.430 -1.352  1.00 51.47 ? 185 PRO A CA  1 
ATOM   1196  C  C   . PRO A 1 171 ? 28.260  -9.874  -0.607  1.00 48.92 ? 185 PRO A C   1 
ATOM   1197  O  O   . PRO A 1 171 ? 28.771  -8.816  -0.974  1.00 50.96 ? 185 PRO A O   1 
ATOM   1198  C  CB  . PRO A 1 171 ? 27.467  -10.842 -2.768  1.00 56.25 ? 185 PRO A CB  1 
ATOM   1199  C  CG  . PRO A 1 171 ? 27.283  -9.605  -3.582  1.00 60.91 ? 185 PRO A CG  1 
ATOM   1200  C  CD  . PRO A 1 171 ? 26.080  -8.902  -2.985  1.00 61.23 ? 185 PRO A CD  1 
ATOM   1201  N  N   . ILE A 1 172 ? 28.683  -10.568 0.441   1.00 51.10 ? 186 ILE A N   1 
ATOM   1202  C  CA  . ILE A 1 172 ? 29.892  -10.209 1.175   1.00 54.64 ? 186 ILE A CA  1 
ATOM   1203  C  C   . ILE A 1 172 ? 30.886  -11.342 1.002   1.00 56.83 ? 186 ILE A C   1 
ATOM   1204  O  O   . ILE A 1 172 ? 30.511  -12.517 1.037   1.00 56.34 ? 186 ILE A O   1 
ATOM   1205  C  CB  . ILE A 1 172 ? 29.617  -9.998  2.678   1.00 52.30 ? 186 ILE A CB  1 
ATOM   1206  N  N   . SER A 1 173 ? 32.153  -11.000 0.806   1.00 58.28 ? 187 SER A N   1 
ATOM   1207  C  CA  . SER A 1 173 ? 33.139  -12.022 0.495   1.00 59.15 ? 187 SER A CA  1 
ATOM   1208  C  C   . SER A 1 173 ? 34.374  -11.934 1.381   1.00 64.81 ? 187 SER A C   1 
ATOM   1209  O  O   . SER A 1 173 ? 34.711  -10.866 1.899   1.00 64.26 ? 187 SER A O   1 
ATOM   1210  C  CB  . SER A 1 173 ? 33.527  -11.952 -0.987  1.00 59.17 ? 187 SER A CB  1 
ATOM   1211  N  N   . VAL A 1 174 ? 35.042  -13.073 1.541   1.00 67.76 ? 188 VAL A N   1 
ATOM   1212  C  CA  . VAL A 1 174 ? 36.254  -13.174 2.345   1.00 66.07 ? 188 VAL A CA  1 
ATOM   1213  C  C   . VAL A 1 174 ? 37.359  -12.247 1.841   1.00 68.53 ? 188 VAL A C   1 
ATOM   1214  O  O   . VAL A 1 174 ? 37.687  -11.245 2.478   1.00 69.25 ? 188 VAL A O   1 
ATOM   1215  C  CB  . VAL A 1 174 ? 36.778  -14.621 2.362   1.00 63.39 ? 188 VAL A CB  1 
ATOM   1216  N  N   . SER A 1 177 ? 36.569  -10.897 5.191   1.00 58.52 ? 191 SER A N   1 
ATOM   1217  C  CA  . SER A 1 177 ? 35.674  -10.141 6.067   1.00 59.66 ? 191 SER A CA  1 
ATOM   1218  C  C   . SER A 1 177 ? 34.217  -10.157 5.578   1.00 57.05 ? 191 SER A C   1 
ATOM   1219  O  O   . SER A 1 177 ? 33.754  -9.210  4.935   1.00 52.37 ? 191 SER A O   1 
ATOM   1220  C  CB  . SER A 1 177 ? 36.170  -8.698  6.223   1.00 62.93 ? 191 SER A CB  1 
ATOM   1221  N  N   . THR A 1 178 ? 33.499  -11.236 5.889   1.00 52.55 ? 192 THR A N   1 
ATOM   1222  C  CA  . THR A 1 178 ? 32.110  -11.383 5.451   1.00 47.48 ? 192 THR A CA  1 
ATOM   1223  C  C   . THR A 1 178 ? 31.121  -10.769 6.439   1.00 45.28 ? 192 THR A C   1 
ATOM   1224  O  O   . THR A 1 178 ? 31.438  -10.544 7.612   1.00 42.00 ? 192 THR A O   1 
ATOM   1225  C  CB  . THR A 1 178 ? 31.725  -12.856 5.179   1.00 48.29 ? 192 THR A CB  1 
ATOM   1226  O  OG1 . THR A 1 178 ? 31.948  -13.648 6.354   1.00 48.01 ? 192 THR A OG1 1 
ATOM   1227  C  CG2 . THR A 1 178 ? 32.544  -13.414 4.025   1.00 47.95 ? 192 THR A CG2 1 
ATOM   1228  N  N   . ASN A 1 179 ? 29.915  -10.509 5.958   1.00 45.63 ? 193 ASN A N   1 
ATOM   1229  C  CA  . ASN A 1 179 ? 28.945  -9.763  6.740   1.00 48.97 ? 193 ASN A CA  1 
ATOM   1230  C  C   . ASN A 1 179 ? 27.512  -10.046 6.297   1.00 48.03 ? 193 ASN A C   1 
ATOM   1231  O  O   . ASN A 1 179 ? 27.175  -9.928  5.119   1.00 47.88 ? 193 ASN A O   1 
ATOM   1232  C  CB  . ASN A 1 179 ? 29.283  -8.266  6.662   1.00 54.63 ? 193 ASN A CB  1 
ATOM   1233  C  CG  . ASN A 1 179 ? 28.089  -7.372  6.915   1.00 61.22 ? 193 ASN A CG  1 
ATOM   1234  O  OD1 . ASN A 1 179 ? 27.699  -6.591  6.049   1.00 65.00 ? 193 ASN A OD1 1 
ATOM   1235  N  ND2 . ASN A 1 179 ? 27.508  -7.473  8.105   1.00 63.60 ? 193 ASN A ND2 1 
ATOM   1236  N  N   . SER A 1 180 ? 26.670  -10.441 7.243   1.00 41.16 ? 194 SER A N   1 
ATOM   1237  C  CA  . SER A 1 180 ? 25.264  -10.611 6.935   1.00 39.09 ? 194 SER A CA  1 
ATOM   1238  C  C   . SER A 1 180 ? 24.367  -10.223 8.101   1.00 34.78 ? 194 SER A C   1 
ATOM   1239  O  O   . SER A 1 180 ? 24.817  -10.116 9.244   1.00 30.00 ? 194 SER A O   1 
ATOM   1240  C  CB  . SER A 1 180 ? 24.979  -12.042 6.478   1.00 43.70 ? 194 SER A CB  1 
ATOM   1241  O  OG  . SER A 1 180 ? 25.394  -12.980 7.448   1.00 46.81 ? 194 SER A OG  1 
ATOM   1242  N  N   . THR A 1 181 ? 23.097  -9.993  7.785   1.00 30.27 ? 195 THR A N   1 
ATOM   1243  C  CA  . THR A 1 181 ? 22.086  -9.697  8.785   1.00 30.24 ? 195 THR A CA  1 
ATOM   1244  C  C   . THR A 1 181 ? 21.131  -10.887 8.881   1.00 30.76 ? 195 THR A C   1 
ATOM   1245  O  O   . THR A 1 181 ? 20.601  -11.351 7.870   1.00 29.06 ? 195 THR A O   1 
ATOM   1246  C  CB  . THR A 1 181 ? 21.298  -8.423  8.406   1.00 33.31 ? 195 THR A CB  1 
ATOM   1247  O  OG1 . THR A 1 181 ? 22.217  -7.362  8.127   1.00 37.88 ? 195 THR A OG1 1 
ATOM   1248  C  CG2 . THR A 1 181 ? 20.379  -7.990  9.542   1.00 36.04 ? 195 THR A CG2 1 
ATOM   1249  N  N   . VAL A 1 182 ? 20.945  -11.386 10.098  1.00 24.14 ? 196 VAL A N   1 
ATOM   1250  C  CA  . VAL A 1 182 ? 20.019  -12.467 10.392  1.00 24.07 ? 196 VAL A CA  1 
ATOM   1251  C  C   . VAL A 1 182 ? 18.765  -11.870 11.030  1.00 22.46 ? 196 VAL A C   1 
ATOM   1252  O  O   . VAL A 1 182 ? 18.853  -11.173 12.040  1.00 22.49 ? 196 VAL A O   1 
ATOM   1253  C  CB  . VAL A 1 182 ? 20.659  -13.453 11.379  1.00 25.67 ? 196 VAL A CB  1 
ATOM   1254  C  CG1 . VAL A 1 182 ? 19.619  -14.421 11.920  1.00 28.94 ? 196 VAL A CG1 1 
ATOM   1255  C  CG2 . VAL A 1 182 ? 21.804  -14.184 10.714  1.00 31.88 ? 196 VAL A CG2 1 
ATOM   1256  N  N   . TYR A 1 183 ? 17.598  -12.125 10.454  1.00 18.45 ? 197 TYR A N   1 
ATOM   1257  C  CA  . TYR A 1 183 ? 16.383  -11.543 11.013  1.00 17.64 ? 197 TYR A CA  1 
ATOM   1258  C  C   . TYR A 1 183 ? 15.759  -12.498 12.020  1.00 23.12 ? 197 TYR A C   1 
ATOM   1259  O  O   . TYR A 1 183 ? 15.045  -13.423 11.649  1.00 25.52 ? 197 TYR A O   1 
ATOM   1260  C  CB  . TYR A 1 183 ? 15.415  -11.110 9.899   1.00 22.83 ? 197 TYR A CB  1 
ATOM   1261  C  CG  . TYR A 1 183 ? 15.915  -9.858  9.193   1.00 23.40 ? 197 TYR A CG  1 
ATOM   1262  C  CD1 . TYR A 1 183 ? 15.639  -8.590  9.702   1.00 25.89 ? 197 TYR A CD1 1 
ATOM   1263  C  CD2 . TYR A 1 183 ? 16.702  -9.948  8.053   1.00 24.21 ? 197 TYR A CD2 1 
ATOM   1264  C  CE1 . TYR A 1 183 ? 16.113  -7.444  9.074   1.00 28.19 ? 197 TYR A CE1 1 
ATOM   1265  C  CE2 . TYR A 1 183 ? 17.188  -8.818  7.422   1.00 34.23 ? 197 TYR A CE2 1 
ATOM   1266  C  CZ  . TYR A 1 183 ? 16.894  -7.569  7.936   1.00 36.84 ? 197 TYR A CZ  1 
ATOM   1267  O  OH  . TYR A 1 183 ? 17.381  -6.446  7.299   1.00 36.40 ? 197 TYR A OH  1 
ATOM   1268  N  N   . ARG A 1 184 ? 16.081  -12.283 13.294  1.00 22.92 ? 198 ARG A N   1 
ATOM   1269  C  CA  . ARG A 1 184 ? 15.668  -13.172 14.375  1.00 23.08 ? 198 ARG A CA  1 
ATOM   1270  C  C   . ARG A 1 184 ? 14.239  -12.907 14.755  1.00 22.47 ? 198 ARG A C   1 
ATOM   1271  O  O   . ARG A 1 184 ? 13.804  -11.766 14.771  1.00 19.92 ? 198 ARG A O   1 
ATOM   1272  C  CB  . ARG A 1 184 ? 16.530  -12.946 15.625  1.00 21.26 ? 198 ARG A CB  1 
ATOM   1273  C  CG  . ARG A 1 184 ? 18.020  -13.089 15.395  1.00 19.00 ? 198 ARG A CG  1 
ATOM   1274  C  CD  . ARG A 1 184 ? 18.816  -12.628 16.607  1.00 23.68 ? 198 ARG A CD  1 
ATOM   1275  N  NE  . ARG A 1 184 ? 18.679  -11.187 16.823  1.00 26.39 ? 198 ARG A NE  1 
ATOM   1276  C  CZ  . ARG A 1 184 ? 19.343  -10.502 17.747  1.00 23.77 ? 198 ARG A CZ  1 
ATOM   1277  N  NH1 . ARG A 1 184 ? 20.192  -11.124 18.547  1.00 20.15 ? 198 ARG A NH1 1 
ATOM   1278  N  NH2 . ARG A 1 184 ? 19.147  -9.198  17.876  1.00 18.82 ? 198 ARG A NH2 1 
ATOM   1279  N  N   . GLY A 1 185 ? 13.502  -13.966 15.076  1.00 17.82 ? 199 GLY A N   1 
ATOM   1280  C  CA  . GLY A 1 185 ? 12.243  -13.770 15.752  1.00 18.95 ? 199 GLY A CA  1 
ATOM   1281  C  C   . GLY A 1 185 ? 12.546  -13.224 17.135  1.00 20.47 ? 199 GLY A C   1 
ATOM   1282  O  O   . GLY A 1 185 ? 13.665  -13.343 17.636  1.00 20.98 ? 199 GLY A O   1 
ATOM   1283  N  N   . LEU A 1 186 ? 11.547  -12.630 17.765  1.00 15.51 ? 200 LEU A N   1 
ATOM   1284  C  CA  . LEU A 1 186 ? 11.727  -12.107 19.108  1.00 17.56 ? 200 LEU A CA  1 
ATOM   1285  C  C   . LEU A 1 186 ? 11.814  -13.246 20.115  1.00 20.87 ? 200 LEU A C   1 
ATOM   1286  O  O   . LEU A 1 186 ? 11.131  -14.275 19.978  1.00 17.95 ? 200 LEU A O   1 
ATOM   1287  C  CB  . LEU A 1 186 ? 10.565  -11.175 19.456  1.00 14.74 ? 200 LEU A CB  1 
ATOM   1288  C  CG  . LEU A 1 186 ? 10.273  -10.044 18.474  1.00 18.62 ? 200 LEU A CG  1 
ATOM   1289  C  CD1 . LEU A 1 186 ? 9.134   -9.187  18.996  1.00 18.36 ? 200 LEU A CD1 1 
ATOM   1290  C  CD2 . LEU A 1 186 ? 11.506  -9.175  18.223  1.00 20.06 ? 200 LEU A CD2 1 
ATOM   1291  N  N   . GLU A 1 187 ? 12.644  -13.064 21.136  1.00 19.40 ? 201 GLU A N   1 
ATOM   1292  C  CA  . GLU A 1 187 ? 12.823  -14.086 22.165  1.00 21.94 ? 201 GLU A CA  1 
ATOM   1293  C  C   . GLU A 1 187 ? 11.745  -13.973 23.227  1.00 21.34 ? 201 GLU A C   1 
ATOM   1294  O  O   . GLU A 1 187 ? 11.725  -13.016 23.993  1.00 24.51 ? 201 GLU A O   1 
ATOM   1295  C  CB  . GLU A 1 187 ? 14.200  -13.931 22.834  1.00 22.88 ? 201 GLU A CB  1 
ATOM   1296  C  CG  . GLU A 1 187 ? 14.443  -14.914 23.961  1.00 24.85 ? 201 GLU A CG  1 
ATOM   1297  C  CD  . GLU A 1 187 ? 15.907  -14.928 24.394  1.00 29.29 ? 201 GLU A CD  1 
ATOM   1298  O  OE1 . GLU A 1 187 ? 16.520  -13.844 24.451  1.00 25.91 ? 201 GLU A OE1 1 
ATOM   1299  O  OE2 . GLU A 1 187 ? 16.438  -16.021 24.650  1.00 25.77 ? 201 GLU A OE2 1 
ATOM   1300  N  N   . GLY A 1 188 ? 10.864  -14.961 23.279  1.00 17.79 ? 202 GLY A N   1 
ATOM   1301  C  CA  . GLY A 1 188 ? 9.718   -14.945 24.164  1.00 19.88 ? 202 GLY A CA  1 
ATOM   1302  C  C   . GLY A 1 188 ? 8.502   -15.395 23.371  1.00 16.65 ? 202 GLY A C   1 
ATOM   1303  O  O   . GLY A 1 188 ? 8.649   -16.084 22.378  1.00 16.81 ? 202 GLY A O   1 
ATOM   1304  N  N   . PHE A 1 189 ? 7.311   -14.998 23.802  1.00 15.34 ? 203 PHE A N   1 
ATOM   1305  C  CA  . PHE A 1 189 ? 6.115   -15.254 23.015  1.00 16.60 ? 203 PHE A CA  1 
ATOM   1306  C  C   . PHE A 1 189 ? 5.383   -13.958 22.745  1.00 18.76 ? 203 PHE A C   1 
ATOM   1307  O  O   . PHE A 1 189 ? 5.483   -12.993 23.516  1.00 19.20 ? 203 PHE A O   1 
ATOM   1308  C  CB  . PHE A 1 189 ? 5.180   -16.257 23.714  1.00 15.52 ? 203 PHE A CB  1 
ATOM   1309  C  CG  . PHE A 1 189 ? 4.425   -15.679 24.886  1.00 20.69 ? 203 PHE A CG  1 
ATOM   1310  C  CD1 . PHE A 1 189 ? 4.992   -15.666 26.154  1.00 14.47 ? 203 PHE A CD1 1 
ATOM   1311  C  CD2 . PHE A 1 189 ? 3.147   -15.144 24.717  1.00 15.20 ? 203 PHE A CD2 1 
ATOM   1312  C  CE1 . PHE A 1 189 ? 4.320   -15.127 27.245  1.00 13.87 ? 203 PHE A CE1 1 
ATOM   1313  C  CE2 . PHE A 1 189 ? 2.454   -14.613 25.800  1.00 15.98 ? 203 PHE A CE2 1 
ATOM   1314  C  CZ  . PHE A 1 189 ? 3.038   -14.593 27.069  1.00 18.06 ? 203 PHE A CZ  1 
ATOM   1315  N  N   . VAL A 1 190 ? 4.630   -13.954 21.651  1.00 17.36 ? 204 VAL A N   1 
ATOM   1316  C  CA  . VAL A 1 190 ? 3.825   -12.803 21.287  1.00 14.84 ? 204 VAL A CA  1 
ATOM   1317  C  C   . VAL A 1 190 ? 2.356   -13.095 21.576  1.00 18.57 ? 204 VAL A C   1 
ATOM   1318  O  O   . VAL A 1 190 ? 1.865   -14.175 21.260  1.00 16.97 ? 204 VAL A O   1 
ATOM   1319  C  CB  . VAL A 1 190 ? 4.012   -12.463 19.794  1.00 15.87 ? 204 VAL A CB  1 
ATOM   1320  C  CG1 . VAL A 1 190 ? 3.051   -11.360 19.361  1.00 16.00 ? 204 VAL A CG1 1 
ATOM   1321  C  CG2 . VAL A 1 190 ? 5.469   -12.056 19.526  1.00 14.63 ? 204 VAL A CG2 1 
ATOM   1322  N  N   . ALA A 1 191 ? 1.660   -12.147 22.201  1.00 15.26 ? 205 ALA A N   1 
ATOM   1323  C  CA  . ALA A 1 191 ? 0.221   -12.290 22.387  1.00 15.87 ? 205 ALA A CA  1 
ATOM   1324  C  C   . ALA A 1 191 ? -0.533  -11.588 21.253  1.00 19.90 ? 205 ALA A C   1 
ATOM   1325  O  O   . ALA A 1 191 ? -0.334  -10.389 21.010  1.00 18.77 ? 205 ALA A O   1 
ATOM   1326  C  CB  . ALA A 1 191 ? -0.205  -11.746 23.745  1.00 10.69 ? 205 ALA A CB  1 
ATOM   1327  N  N   . ALA A 1 192 ? -1.383  -12.331 20.545  1.00 16.26 ? 206 ALA A N   1 
ATOM   1328  C  CA  . ALA A 1 192 ? -2.265  -11.705 19.556  1.00 14.02 ? 206 ALA A CA  1 
ATOM   1329  C  C   . ALA A 1 192 ? -3.659  -11.549 20.143  1.00 15.97 ? 206 ALA A C   1 
ATOM   1330  O  O   . ALA A 1 192 ? -4.351  -12.542 20.424  1.00 17.29 ? 206 ALA A O   1 
ATOM   1331  C  CB  . ALA A 1 192 ? -2.304  -12.513 18.248  1.00 20.17 ? 206 ALA A CB  1 
ATOM   1332  N  N   . ILE A 1 193 ? -4.076  -10.295 20.330  1.00 15.80 ? 207 ILE A N   1 
ATOM   1333  C  CA  . ILE A 1 193 ? -5.306  -10.006 21.046  1.00 15.26 ? 207 ILE A CA  1 
ATOM   1334  C  C   . ILE A 1 193 ? -6.291  -9.164  20.244  1.00 16.84 ? 207 ILE A C   1 
ATOM   1335  O  O   . ILE A 1 193 ? -5.924  -8.138  19.700  1.00 15.32 ? 207 ILE A O   1 
ATOM   1336  C  CB  . ILE A 1 193 ? -5.013  -9.236  22.341  1.00 17.73 ? 207 ILE A CB  1 
ATOM   1337  C  CG1 . ILE A 1 193 ? -4.042  -10.004 23.233  1.00 18.32 ? 207 ILE A CG1 1 
ATOM   1338  C  CG2 . ILE A 1 193 ? -6.302  -8.888  23.078  1.00 19.58 ? 207 ILE A CG2 1 
ATOM   1339  C  CD1 . ILE A 1 193 ? -3.714  -9.263  24.523  1.00 20.27 ? 207 ILE A CD1 1 
ATOM   1340  N  N   . SER A 1 194 ? -7.540  -9.609  20.159  1.00 17.91 ? 208 SER A N   1 
ATOM   1341  C  CA  . SER A 1 194 ? -8.633  -8.706  19.748  1.00 21.83 ? 208 SER A CA  1 
ATOM   1342  C  C   . SER A 1 194 ? -9.800  -8.866  20.716  1.00 25.34 ? 208 SER A C   1 
ATOM   1343  O  O   . SER A 1 194 ? -10.044 -9.972  21.203  1.00 22.91 ? 208 SER A O   1 
ATOM   1344  C  CB  . SER A 1 194 ? -9.069  -8.976  18.306  1.00 22.52 ? 208 SER A CB  1 
ATOM   1345  O  OG  . SER A 1 194 ? -9.330  -10.349 18.097  1.00 27.73 ? 208 SER A OG  1 
ATOM   1346  N  N   . PRO A 1 195 ? -10.532 -7.768  21.001  1.00 24.16 ? 209 PRO A N   1 
ATOM   1347  C  CA  . PRO A 1 195 ? -11.556 -7.805  22.050  1.00 21.25 ? 209 PRO A CA  1 
ATOM   1348  C  C   . PRO A 1 195 ? -12.708 -8.781  21.766  1.00 24.13 ? 209 PRO A C   1 
ATOM   1349  O  O   . PRO A 1 195 ? -12.976 -9.140  20.606  1.00 19.12 ? 209 PRO A O   1 
ATOM   1350  C  CB  . PRO A 1 195 ? -12.059 -6.350  22.102  1.00 28.65 ? 209 PRO A CB  1 
ATOM   1351  C  CG  . PRO A 1 195 ? -10.906 -5.529  21.533  1.00 31.06 ? 209 PRO A CG  1 
ATOM   1352  C  CD  . PRO A 1 195 ? -10.395 -6.416  20.426  1.00 26.87 ? 209 PRO A CD  1 
ATOM   1353  N  N   . PHE A 1 196 ? -13.388 -9.185  22.837  1.00 20.05 ? 210 PHE A N   1 
ATOM   1354  C  CA  . PHE A 1 196 ? -14.369 -10.274 22.789  1.00 22.97 ? 210 PHE A CA  1 
ATOM   1355  C  C   . PHE A 1 196 ? -15.508 -10.007 21.801  1.00 26.07 ? 210 PHE A C   1 
ATOM   1356  O  O   . PHE A 1 196 ? -16.133 -10.943 21.309  1.00 27.03 ? 210 PHE A O   1 
ATOM   1357  C  CB  . PHE A 1 196 ? -14.968 -10.511 24.179  1.00 25.54 ? 210 PHE A CB  1 
ATOM   1358  C  CG  . PHE A 1 196 ? -15.939 -9.439  24.604  1.00 37.52 ? 210 PHE A CG  1 
ATOM   1359  C  CD1 . PHE A 1 196 ? -17.312 -9.627  24.462  1.00 40.56 ? 210 PHE A CD1 1 
ATOM   1360  C  CD2 . PHE A 1 196 ? -15.478 -8.232  25.124  1.00 39.70 ? 210 PHE A CD2 1 
ATOM   1361  C  CE1 . PHE A 1 196 ? -18.206 -8.637  24.843  1.00 45.05 ? 210 PHE A CE1 1 
ATOM   1362  C  CE2 . PHE A 1 196 ? -16.370 -7.237  25.509  1.00 41.53 ? 210 PHE A CE2 1 
ATOM   1363  C  CZ  . PHE A 1 196 ? -17.731 -7.441  25.368  1.00 42.83 ? 210 PHE A CZ  1 
ATOM   1364  N  N   . ASN A 1 197 ? -15.792 -8.734  21.531  1.00 27.53 ? 211 ASN A N   1 
ATOM   1365  C  CA  . ASN A 1 197 ? -16.852 -8.399  20.588  1.00 29.49 ? 211 ASN A CA  1 
ATOM   1366  C  C   . ASN A 1 197 ? -16.378 -7.600  19.380  1.00 28.53 ? 211 ASN A C   1 
ATOM   1367  O  O   . ASN A 1 197 ? -17.157 -6.865  18.783  1.00 29.75 ? 211 ASN A O   1 
ATOM   1368  C  CB  . ASN A 1 197 ? -18.022 -7.691  21.288  1.00 33.16 ? 211 ASN A CB  1 
ATOM   1369  C  CG  . ASN A 1 197 ? -17.636 -6.328  21.856  1.00 32.94 ? 211 ASN A CG  1 
ATOM   1370  O  OD1 . ASN A 1 197 ? -16.457 -5.985  21.956  1.00 27.97 ? 211 ASN A OD1 1 
ATOM   1371  N  ND2 . ASN A 1 197 ? -18.639 -5.550  22.237  1.00 35.87 ? 211 ASN A ND2 1 
ATOM   1372  N  N   . PHE A 1 198 ? -15.108 -7.749  19.020  1.00 27.67 ? 212 PHE A N   1 
ATOM   1373  C  CA  . PHE A 1 198 ? -14.586 -7.112  17.812  1.00 29.26 ? 212 PHE A CA  1 
ATOM   1374  C  C   . PHE A 1 198 ? -14.903 -7.941  16.570  1.00 28.61 ? 212 PHE A C   1 
ATOM   1375  O  O   . PHE A 1 198 ? -15.306 -9.107  16.662  1.00 31.24 ? 212 PHE A O   1 
ATOM   1376  C  CB  . PHE A 1 198 ? -13.078 -6.876  17.907  1.00 27.61 ? 212 PHE A CB  1 
ATOM   1377  C  CG  . PHE A 1 198 ? -12.570 -5.801  16.970  1.00 27.54 ? 212 PHE A CG  1 
ATOM   1378  C  CD1 . PHE A 1 198 ? -13.188 -4.559  16.921  1.00 25.15 ? 212 PHE A CD1 1 
ATOM   1379  C  CD2 . PHE A 1 198 ? -11.475 -6.031  16.149  1.00 24.63 ? 212 PHE A CD2 1 
ATOM   1380  C  CE1 . PHE A 1 198 ? -12.715 -3.566  16.066  1.00 30.09 ? 212 PHE A CE1 1 
ATOM   1381  C  CE2 . PHE A 1 198 ? -11.003 -5.046  15.292  1.00 29.30 ? 212 PHE A CE2 1 
ATOM   1382  C  CZ  . PHE A 1 198 ? -11.619 -3.812  15.254  1.00 25.56 ? 212 PHE A CZ  1 
ATOM   1383  N  N   . THR A 1 199 ? -14.670 -7.339  15.413  1.00 25.07 ? 213 THR A N   1 
ATOM   1384  C  CA  . THR A 1 199 ? -15.203 -7.827  14.151  1.00 29.06 ? 213 THR A CA  1 
ATOM   1385  C  C   . THR A 1 199 ? -14.132 -8.488  13.279  1.00 32.73 ? 213 THR A C   1 
ATOM   1386  O  O   . THR A 1 199 ? -14.428 -8.978  12.193  1.00 38.03 ? 213 THR A O   1 
ATOM   1387  C  CB  . THR A 1 199 ? -15.830 -6.657  13.361  1.00 26.51 ? 213 THR A CB  1 
ATOM   1388  O  OG1 . THR A 1 199 ? -14.893 -5.582  13.313  1.00 32.06 ? 213 THR A OG1 1 
ATOM   1389  C  CG2 . THR A 1 199 ? -17.086 -6.155  14.055  1.00 27.31 ? 213 THR A CG2 1 
ATOM   1390  N  N   . ALA A 1 200 ? -12.892 -8.497  13.756  1.00 33.03 ? 214 ALA A N   1 
ATOM   1391  C  CA  . ALA A 1 200 ? -11.776 -9.016  12.960  1.00 36.90 ? 214 ALA A CA  1 
ATOM   1392  C  C   . ALA A 1 200 ? -11.608 -10.532 13.063  1.00 33.84 ? 214 ALA A C   1 
ATOM   1393  O  O   . ALA A 1 200 ? -11.811 -11.122 14.123  1.00 30.04 ? 214 ALA A O   1 
ATOM   1394  C  CB  . ALA A 1 200 ? -10.477 -8.314  13.336  1.00 30.73 ? 214 ALA A CB  1 
ATOM   1395  N  N   . ILE A 1 201 ? -11.237 -11.153 11.948  1.00 29.32 ? 215 ILE A N   1 
ATOM   1396  C  CA  . ILE A 1 201 ? -10.899 -12.572 11.938  1.00 30.75 ? 215 ILE A CA  1 
ATOM   1397  C  C   . ILE A 1 201 ? -9.595  -12.839 12.693  1.00 32.78 ? 215 ILE A C   1 
ATOM   1398  O  O   . ILE A 1 201 ? -9.488  -13.834 13.425  1.00 26.97 ? 215 ILE A O   1 
ATOM   1399  C  CB  . ILE A 1 201 ? -10.759 -13.096 10.502  1.00 36.69 ? 215 ILE A CB  1 
ATOM   1400  C  CG1 . ILE A 1 201 ? -12.086 -12.951 9.752   1.00 34.06 ? 215 ILE A CG1 1 
ATOM   1401  C  CG2 . ILE A 1 201 ? -10.286 -14.545 10.497  1.00 39.14 ? 215 ILE A CG2 1 
ATOM   1402  C  CD1 . ILE A 1 201 ? -11.985 -13.325 8.293   1.00 37.11 ? 215 ILE A CD1 1 
ATOM   1403  N  N   . GLY A 1 202 ? -8.609  -11.960 12.498  1.00 27.82 ? 216 GLY A N   1 
ATOM   1404  C  CA  . GLY A 1 202 ? -7.351  -12.028 13.228  1.00 31.85 ? 216 GLY A CA  1 
ATOM   1405  C  C   . GLY A 1 202 ? -6.280  -12.932 12.643  1.00 37.63 ? 216 GLY A C   1 
ATOM   1406  O  O   . GLY A 1 202 ? -5.272  -13.221 13.302  1.00 37.84 ? 216 GLY A O   1 
ATOM   1407  N  N   . GLY A 1 203 ? -6.498  -13.392 11.413  1.00 36.16 ? 217 GLY A N   1 
ATOM   1408  C  CA  . GLY A 1 203 ? -5.510  -14.183 10.704  1.00 31.70 ? 217 GLY A CA  1 
ATOM   1409  C  C   . GLY A 1 203 ? -4.154  -13.490 10.615  1.00 32.59 ? 217 GLY A C   1 
ATOM   1410  O  O   . GLY A 1 203 ? -3.115  -14.107 10.900  1.00 23.52 ? 217 GLY A O   1 
ATOM   1411  N  N   . ASN A 1 204 ? -4.134  -12.213 10.236  1.00 26.99 ? 218 ASN A N   1 
ATOM   1412  C  CA  . ASN A 1 204 ? -2.840  -11.521 10.135  1.00 29.82 ? 218 ASN A CA  1 
ATOM   1413  C  C   . ASN A 1 204 ? -2.287  -11.059 11.494  1.00 25.55 ? 218 ASN A C   1 
ATOM   1414  O  O   . ASN A 1 204 ? -1.094  -10.777 11.632  1.00 26.27 ? 218 ASN A O   1 
ATOM   1415  C  CB  . ASN A 1 204 ? -2.866  -10.370 9.116   1.00 40.77 ? 218 ASN A CB  1 
ATOM   1416  C  CG  . ASN A 1 204 ? -1.448  -9.867  8.750   1.00 42.21 ? 218 ASN A CG  1 
ATOM   1417  O  OD1 . ASN A 1 204 ? -0.649  -10.598 8.166   1.00 42.48 ? 218 ASN A OD1 1 
ATOM   1418  N  ND2 . ASN A 1 204 ? -1.153  -8.616  9.085   1.00 40.29 ? 218 ASN A ND2 1 
ATOM   1419  N  N   . LEU A 1 205 ? -3.149  -11.007 12.506  1.00 21.82 ? 219 LEU A N   1 
ATOM   1420  C  CA  . LEU A 1 205 ? -2.696  -10.625 13.854  1.00 23.20 ? 219 LEU A CA  1 
ATOM   1421  C  C   . LEU A 1 205 ? -1.785  -11.693 14.471  1.00 21.00 ? 219 LEU A C   1 
ATOM   1422  O  O   . LEU A 1 205 ? -0.732  -11.407 15.078  1.00 15.99 ? 219 LEU A O   1 
ATOM   1423  C  CB  . LEU A 1 205 ? -3.908  -10.409 14.739  1.00 25.67 ? 219 LEU A CB  1 
ATOM   1424  C  CG  . LEU A 1 205 ? -3.778  -9.541  15.966  1.00 27.79 ? 219 LEU A CG  1 
ATOM   1425  C  CD1 . LEU A 1 205 ? -3.707  -8.027  15.603  1.00 20.50 ? 219 LEU A CD1 1 
ATOM   1426  C  CD2 . LEU A 1 205 ? -4.960  -9.838  16.852  1.00 25.06 ? 219 LEU A CD2 1 
ATOM   1427  N  N   . ALA A 1 206 ? -2.207  -12.939 14.322  1.00 18.52 ? 220 ALA A N   1 
ATOM   1428  C  CA  . ALA A 1 206 ? -1.417  -14.056 14.799  1.00 18.02 ? 220 ALA A CA  1 
ATOM   1429  C  C   . ALA A 1 206 ? -0.395  -14.435 13.741  1.00 19.15 ? 220 ALA A C   1 
ATOM   1430  O  O   . ALA A 1 206 ? 0.705   -14.878 14.055  1.00 17.47 ? 220 ALA A O   1 
ATOM   1431  C  CB  . ALA A 1 206 ? -2.337  -15.251 15.122  1.00 17.71 ? 220 ALA A CB  1 
ATOM   1432  N  N   . GLY A 1 207 ? -0.757  -14.256 12.478  1.00 20.45 ? 221 GLY A N   1 
ATOM   1433  C  CA  . GLY A 1 207 ? 0.052   -14.760 11.382  1.00 18.88 ? 221 GLY A CA  1 
ATOM   1434  C  C   . GLY A 1 207 ? 1.330   -14.005 11.072  1.00 25.27 ? 221 GLY A C   1 
ATOM   1435  O  O   . GLY A 1 207 ? 2.358   -14.620 10.759  1.00 21.80 ? 221 GLY A O   1 
ATOM   1436  N  N   . ALA A 1 208 ? 1.272   -12.678 11.122  1.00 18.66 ? 222 ALA A N   1 
ATOM   1437  C  CA  . ALA A 1 208 ? 2.456   -11.876 10.828  1.00 18.65 ? 222 ALA A CA  1 
ATOM   1438  C  C   . ALA A 1 208 ? 3.618   -12.198 11.791  1.00 18.33 ? 222 ALA A C   1 
ATOM   1439  O  O   . ALA A 1 208 ? 4.708   -12.510 11.334  1.00 20.32 ? 222 ALA A O   1 
ATOM   1440  C  CB  . ALA A 1 208 ? 2.125   -10.360 10.805  1.00 21.04 ? 222 ALA A CB  1 
ATOM   1441  N  N   . PRO A 1 209 ? 3.383   -12.163 13.119  1.00 17.58 ? 223 PRO A N   1 
ATOM   1442  C  CA  . PRO A 1 209 ? 4.504   -12.502 14.010  1.00 18.39 ? 223 PRO A CA  1 
ATOM   1443  C  C   . PRO A 1 209 ? 4.992   -13.950 13.847  1.00 19.21 ? 223 PRO A C   1 
ATOM   1444  O  O   . PRO A 1 209 ? 6.201   -14.162 13.895  1.00 17.56 ? 223 PRO A O   1 
ATOM   1445  C  CB  . PRO A 1 209 ? 3.924   -12.297 15.418  1.00 15.79 ? 223 PRO A CB  1 
ATOM   1446  C  CG  . PRO A 1 209 ? 2.707   -11.482 15.235  1.00 23.60 ? 223 PRO A CG  1 
ATOM   1447  C  CD  . PRO A 1 209 ? 2.174   -11.800 13.877  1.00 19.12 ? 223 PRO A CD  1 
ATOM   1448  N  N   . ALA A 1 210 ? 4.084   -14.908 13.633  1.00 15.23 ? 224 ALA A N   1 
ATOM   1449  C  CA  . ALA A 1 210 ? 4.475   -16.305 13.435  1.00 15.50 ? 224 ALA A CA  1 
ATOM   1450  C  C   . ALA A 1 210 ? 5.376   -16.458 12.221  1.00 15.85 ? 224 ALA A C   1 
ATOM   1451  O  O   . ALA A 1 210 ? 6.386   -17.162 12.266  1.00 20.74 ? 224 ALA A O   1 
ATOM   1452  C  CB  . ALA A 1 210 ? 3.238   -17.204 13.281  1.00 17.61 ? 224 ALA A CB  1 
ATOM   1453  N  N   . LEU A 1 211 ? 5.000   -15.793 11.136  1.00 17.93 ? 225 LEU A N   1 
ATOM   1454  C  CA  . LEU A 1 211 ? 5.778   -15.818 9.906   1.00 18.52 ? 225 LEU A CA  1 
ATOM   1455  C  C   . LEU A 1 211 ? 7.210   -15.354 10.160  1.00 20.91 ? 225 LEU A C   1 
ATOM   1456  O  O   . LEU A 1 211 ? 8.155   -15.868 9.553   1.00 23.39 ? 225 LEU A O   1 
ATOM   1457  C  CB  . LEU A 1 211 ? 5.134   -14.917 8.841   1.00 19.62 ? 225 LEU A CB  1 
ATOM   1458  C  CG  . LEU A 1 211 ? 5.974   -14.602 7.596   1.00 23.44 ? 225 LEU A CG  1 
ATOM   1459  C  CD1 . LEU A 1 211 ? 6.289   -15.864 6.794   1.00 21.21 ? 225 LEU A CD1 1 
ATOM   1460  C  CD2 . LEU A 1 211 ? 5.274   -13.570 6.722   1.00 28.44 ? 225 LEU A CD2 1 
ATOM   1461  N  N   . MET A 1 212 ? 7.371   -14.398 11.068  1.00 18.16 ? 226 MET A N   1 
ATOM   1462  C  CA  . MET A 1 212 ? 8.713   -13.870 11.366  1.00 20.85 ? 226 MET A CA  1 
ATOM   1463  C  C   . MET A 1 212 ? 9.508   -14.670 12.422  1.00 19.04 ? 226 MET A C   1 
ATOM   1464  O  O   . MET A 1 212 ? 10.521  -14.196 12.940  1.00 19.47 ? 226 MET A O   1 
ATOM   1465  C  CB  . MET A 1 212 ? 8.624   -12.383 11.730  1.00 17.31 ? 226 MET A CB  1 
ATOM   1466  C  CG  . MET A 1 212 ? 7.938   -11.537 10.626  1.00 19.70 ? 226 MET A CG  1 
ATOM   1467  S  SD  . MET A 1 212 ? 8.805   -11.650 9.040   1.00 24.77 ? 226 MET A SD  1 
ATOM   1468  C  CE  . MET A 1 212 ? 10.428  -11.043 9.496   1.00 37.94 ? 226 MET A CE  1 
ATOM   1469  N  N   . GLY A 1 213 ? 9.062   -15.888 12.713  1.00 13.97 ? 227 GLY A N   1 
ATOM   1470  C  CA  . GLY A 1 213 ? 9.784   -16.795 13.588  1.00 16.05 ? 227 GLY A CA  1 
ATOM   1471  C  C   . GLY A 1 213 ? 9.433   -16.700 15.065  1.00 17.03 ? 227 GLY A C   1 
ATOM   1472  O  O   . GLY A 1 213 ? 10.158  -17.211 15.925  1.00 20.53 ? 227 GLY A O   1 
ATOM   1473  N  N   . ASN A 1 214 ? 8.313   -16.056 15.364  1.00 14.54 ? 228 ASN A N   1 
ATOM   1474  C  CA  . ASN A 1 214 ? 7.832   -15.966 16.727  1.00 14.17 ? 228 ASN A CA  1 
ATOM   1475  C  C   . ASN A 1 214 ? 6.813   -17.063 17.038  1.00 15.63 ? 228 ASN A C   1 
ATOM   1476  O  O   . ASN A 1 214 ? 6.250   -17.650 16.130  1.00 16.16 ? 228 ASN A O   1 
ATOM   1477  C  CB  . ASN A 1 214 ? 7.173   -14.606 16.936  1.00 16.50 ? 228 ASN A CB  1 
ATOM   1478  C  CG  . ASN A 1 214 ? 8.141   -13.463 16.716  1.00 19.68 ? 228 ASN A CG  1 
ATOM   1479  O  OD1 . ASN A 1 214 ? 9.017   -13.224 17.551  1.00 20.61 ? 228 ASN A OD1 1 
ATOM   1480  N  ND2 . ASN A 1 214 ? 8.000   -12.763 15.595  1.00 15.93 ? 228 ASN A ND2 1 
ATOM   1481  N  N   . VAL A 1 215 ? 6.568   -17.319 18.319  1.00 13.49 ? 229 VAL A N   1 
ATOM   1482  C  CA  . VAL A 1 215 ? 5.451   -18.177 18.709  1.00 15.70 ? 229 VAL A CA  1 
ATOM   1483  C  C   . VAL A 1 215 ? 4.395   -17.280 19.362  1.00 18.13 ? 229 VAL A C   1 
ATOM   1484  O  O   . VAL A 1 215 ? 4.716   -16.247 19.934  1.00 17.31 ? 229 VAL A O   1 
ATOM   1485  C  CB  . VAL A 1 215 ? 5.890   -19.284 19.672  1.00 17.20 ? 229 VAL A CB  1 
ATOM   1486  C  CG1 . VAL A 1 215 ? 6.876   -20.216 18.960  1.00 20.76 ? 229 VAL A CG1 1 
ATOM   1487  C  CG2 . VAL A 1 215 ? 6.526   -18.674 20.935  1.00 15.16 ? 229 VAL A CG2 1 
ATOM   1488  N  N   . VAL A 1 216 ? 3.135   -17.688 19.282  1.00 19.14 ? 230 VAL A N   1 
ATOM   1489  C  CA  . VAL A 1 216 ? 2.033   -16.763 19.511  1.00 16.06 ? 230 VAL A CA  1 
ATOM   1490  C  C   . VAL A 1 216 ? 0.972   -17.424 20.368  1.00 13.45 ? 230 VAL A C   1 
ATOM   1491  O  O   . VAL A 1 216 ? 0.626   -18.594 20.144  1.00 14.43 ? 230 VAL A O   1 
ATOM   1492  C  CB  . VAL A 1 216 ? 1.400   -16.389 18.166  1.00 12.90 ? 230 VAL A CB  1 
ATOM   1493  C  CG1 . VAL A 1 216 ? 0.132   -15.490 18.330  1.00 15.99 ? 230 VAL A CG1 1 
ATOM   1494  C  CG2 . VAL A 1 216 ? 2.431   -15.774 17.222  1.00 16.47 ? 230 VAL A CG2 1 
ATOM   1495  N  N   . LEU A 1 217 ? 0.472   -16.705 21.370  1.00 10.62 ? 231 LEU A N   1 
ATOM   1496  C  CA  . LEU A 1 217 ? -0.787  -17.111 21.990  1.00 13.67 ? 231 LEU A CA  1 
ATOM   1497  C  C   . LEU A 1 217 ? -1.868  -16.225 21.390  1.00 18.16 ? 231 LEU A C   1 
ATOM   1498  O  O   . LEU A 1 217 ? -1.825  -15.001 21.521  1.00 16.31 ? 231 LEU A O   1 
ATOM   1499  C  CB  . LEU A 1 217 ? -0.787  -16.923 23.504  1.00 13.94 ? 231 LEU A CB  1 
ATOM   1500  C  CG  . LEU A 1 217 ? -0.472  -18.142 24.367  1.00 20.35 ? 231 LEU A CG  1 
ATOM   1501  C  CD1 . LEU A 1 217 ? 0.956   -18.630 24.126  1.00 14.56 ? 231 LEU A CD1 1 
ATOM   1502  C  CD2 . LEU A 1 217 ? -0.699  -17.781 25.839  1.00 21.36 ? 231 LEU A CD2 1 
ATOM   1503  N  N   . TRP A 1 218 ? -2.835  -16.847 20.733  1.00 13.70 ? 232 TRP A N   1 
ATOM   1504  C  CA  . TRP A 1 218 ? -3.834  -16.094 19.999  1.00 16.01 ? 232 TRP A CA  1 
ATOM   1505  C  C   . TRP A 1 218 ? -5.156  -16.152 20.752  1.00 15.34 ? 232 TRP A C   1 
ATOM   1506  O  O   . TRP A 1 218 ? -5.741  -17.233 20.911  1.00 14.92 ? 232 TRP A O   1 
ATOM   1507  C  CB  . TRP A 1 218 ? -3.956  -16.662 18.578  1.00 12.58 ? 232 TRP A CB  1 
ATOM   1508  C  CG  . TRP A 1 218 ? -4.984  -15.970 17.693  1.00 18.01 ? 232 TRP A CG  1 
ATOM   1509  C  CD1 . TRP A 1 218 ? -5.568  -14.743 17.896  1.00 14.37 ? 232 TRP A CD1 1 
ATOM   1510  C  CD2 . TRP A 1 218 ? -5.532  -16.475 16.465  1.00 16.03 ? 232 TRP A CD2 1 
ATOM   1511  N  NE1 . TRP A 1 218 ? -6.448  -14.461 16.869  1.00 17.37 ? 232 TRP A NE1 1 
ATOM   1512  C  CE2 . TRP A 1 218 ? -6.439  -15.503 15.978  1.00 20.76 ? 232 TRP A CE2 1 
ATOM   1513  C  CE3 . TRP A 1 218 ? -5.338  -17.648 15.727  1.00 16.63 ? 232 TRP A CE3 1 
ATOM   1514  C  CZ2 . TRP A 1 218 ? -7.157  -15.682 14.799  1.00 20.36 ? 232 TRP A CZ2 1 
ATOM   1515  C  CZ3 . TRP A 1 218 ? -6.045  -17.822 14.558  1.00 21.41 ? 232 TRP A CZ3 1 
ATOM   1516  C  CH2 . TRP A 1 218 ? -6.940  -16.843 14.100  1.00 19.53 ? 232 TRP A CH2 1 
ATOM   1517  N  N   . LYS A 1 219 ? -5.602  -14.995 21.245  1.00 16.16 ? 233 LYS A N   1 
ATOM   1518  C  CA  . LYS A 1 219 ? -6.915  -14.882 21.859  1.00 15.72 ? 233 LYS A CA  1 
ATOM   1519  C  C   . LYS A 1 219 ? -7.846  -14.181 20.888  1.00 13.98 ? 233 LYS A C   1 
ATOM   1520  O  O   . LYS A 1 219 ? -7.866  -12.954 20.833  1.00 16.62 ? 233 LYS A O   1 
ATOM   1521  C  CB  . LYS A 1 219 ? -6.883  -14.072 23.159  1.00 24.03 ? 233 LYS A CB  1 
ATOM   1522  C  CG  . LYS A 1 219 ? -8.249  -14.085 23.889  1.00 24.94 ? 233 LYS A CG  1 
ATOM   1523  C  CD  . LYS A 1 219 ? -8.514  -12.802 24.676  1.00 20.49 ? 233 LYS A CD  1 
ATOM   1524  C  CE  . LYS A 1 219 ? -9.032  -11.693 23.779  1.00 17.33 ? 233 LYS A CE  1 
ATOM   1525  N  NZ  . LYS A 1 219 ? -10.348 -12.018 23.170  1.00 21.54 ? 233 LYS A NZ  1 
ATOM   1526  N  N   . PRO A 1 220 ? -8.612  -14.957 20.116  1.00 16.68 ? 234 PRO A N   1 
ATOM   1527  C  CA  . PRO A 1 220 ? -9.452  -14.368 19.067  1.00 16.40 ? 234 PRO A CA  1 
ATOM   1528  C  C   . PRO A 1 220 ? -10.698 -13.692 19.625  1.00 17.15 ? 234 PRO A C   1 
ATOM   1529  O  O   . PRO A 1 220 ? -10.956 -13.783 20.817  1.00 17.53 ? 234 PRO A O   1 
ATOM   1530  C  CB  . PRO A 1 220 ? -9.842  -15.578 18.203  1.00 19.81 ? 234 PRO A CB  1 
ATOM   1531  C  CG  . PRO A 1 220 ? -9.007  -16.768 18.746  1.00 20.95 ? 234 PRO A CG  1 
ATOM   1532  C  CD  . PRO A 1 220 ? -8.748  -16.429 20.175  1.00 14.32 ? 234 PRO A CD  1 
ATOM   1533  N  N   . SER A 1 221 ? -11.464 -13.018 18.772  1.00 16.79 ? 235 SER A N   1 
ATOM   1534  C  CA  . SER A 1 221 ? -12.723 -12.412 19.217  1.00 17.94 ? 235 SER A CA  1 
ATOM   1535  C  C   . SER A 1 221 ? -13.827 -13.466 19.303  1.00 19.57 ? 235 SER A C   1 
ATOM   1536  O  O   . SER A 1 221 ? -14.011 -14.241 18.368  1.00 17.53 ? 235 SER A O   1 
ATOM   1537  C  CB  . SER A 1 221 ? -13.154 -11.300 18.262  1.00 19.82 ? 235 SER A CB  1 
ATOM   1538  O  OG  . SER A 1 221 ? -12.242 -10.212 18.313  1.00 23.30 ? 235 SER A OG  1 
ATOM   1539  N  N   . ASP A 1 222 ? -14.552 -13.487 20.423  1.00 22.22 ? 236 ASP A N   1 
ATOM   1540  C  CA  . ASP A 1 222 ? -15.674 -14.411 20.606  1.00 18.55 ? 236 ASP A CA  1 
ATOM   1541  C  C   . ASP A 1 222 ? -16.648 -14.272 19.440  1.00 19.23 ? 236 ASP A C   1 
ATOM   1542  O  O   . ASP A 1 222 ? -17.172 -15.266 18.946  1.00 19.42 ? 236 ASP A O   1 
ATOM   1543  C  CB  . ASP A 1 222 ? -16.450 -14.119 21.900  1.00 18.67 ? 236 ASP A CB  1 
ATOM   1544  C  CG  . ASP A 1 222 ? -15.582 -14.191 23.151  1.00 22.25 ? 236 ASP A CG  1 
ATOM   1545  O  OD1 . ASP A 1 222 ? -14.348 -14.268 23.021  1.00 24.23 ? 236 ASP A OD1 1 
ATOM   1546  O  OD2 . ASP A 1 222 ? -16.148 -14.132 24.270  1.00 20.62 ? 236 ASP A OD2 1 
ATOM   1547  N  N   . THR A 1 223 ? -16.865 -13.030 19.000  1.00 19.20 ? 237 THR A N   1 
ATOM   1548  C  CA  . THR A 1 223 ? -17.862 -12.731 17.972  1.00 17.22 ? 237 THR A CA  1 
ATOM   1549  C  C   . THR A 1 223 ? -17.408 -13.120 16.572  1.00 15.78 ? 237 THR A C   1 
ATOM   1550  O  O   . THR A 1 223 ? -18.164 -12.999 15.614  1.00 22.99 ? 237 THR A O   1 
ATOM   1551  C  CB  . THR A 1 223 ? -18.284 -11.244 17.996  1.00 22.01 ? 237 THR A CB  1 
ATOM   1552  O  OG1 . THR A 1 223 ? -17.121 -10.401 18.085  1.00 24.00 ? 237 THR A OG1 1 
ATOM   1553  C  CG2 . THR A 1 223 ? -19.201 -10.978 19.184  1.00 26.67 ? 237 THR A CG2 1 
ATOM   1554  N  N   . ALA A 1 224 ? -16.177 -13.618 16.462  1.00 21.89 ? 238 ALA A N   1 
ATOM   1555  C  CA  . ALA A 1 224 ? -15.645 -14.090 15.182  1.00 15.39 ? 238 ALA A CA  1 
ATOM   1556  C  C   . ALA A 1 224 ? -15.064 -15.500 15.292  1.00 18.23 ? 238 ALA A C   1 
ATOM   1557  O  O   . ALA A 1 224 ? -14.291 -15.926 14.423  1.00 17.54 ? 238 ALA A O   1 
ATOM   1558  C  CB  . ALA A 1 224 ? -14.553 -13.122 14.677  1.00 15.77 ? 238 ALA A CB  1 
ATOM   1559  N  N   . MET A 1 225 ? -15.439 -16.217 16.349  1.00 20.57 ? 239 MET A N   1 
ATOM   1560  C  CA  . MET A 1 225 ? -14.761 -17.470 16.702  1.00 23.65 ? 239 MET A CA  1 
ATOM   1561  C  C   . MET A 1 225 ? -14.794 -18.524 15.594  1.00 21.79 ? 239 MET A C   1 
ATOM   1562  O  O   . MET A 1 225 ? -13.781 -19.168 15.317  1.00 19.05 ? 239 MET A O   1 
ATOM   1563  C  CB  . MET A 1 225 ? -15.314 -18.055 18.014  1.00 17.83 ? 239 MET A CB  1 
ATOM   1564  C  CG  . MET A 1 225 ? -14.442 -19.186 18.611  1.00 24.90 ? 239 MET A CG  1 
ATOM   1565  S  SD  . MET A 1 225 ? -12.751 -18.644 19.033  1.00 23.58 ? 239 MET A SD  1 
ATOM   1566  C  CE  . MET A 1 225 ? -13.023 -17.201 20.069  1.00 25.10 ? 239 MET A CE  1 
ATOM   1567  N  N   . LEU A 1 226 ? -15.962 -18.698 14.978  1.00 17.66 ? 240 LEU A N   1 
ATOM   1568  C  CA  . LEU A 1 226 ? -16.150 -19.678 13.910  1.00 20.00 ? 240 LEU A CA  1 
ATOM   1569  C  C   . LEU A 1 226 ? -15.149 -19.478 12.769  1.00 21.24 ? 240 LEU A C   1 
ATOM   1570  O  O   . LEU A 1 226 ? -14.446 -20.417 12.362  1.00 19.85 ? 240 LEU A O   1 
ATOM   1571  C  CB  . LEU A 1 226 ? -17.592 -19.584 13.373  1.00 20.73 ? 240 LEU A CB  1 
ATOM   1572  C  CG  . LEU A 1 226 ? -18.042 -20.610 12.342  1.00 26.27 ? 240 LEU A CG  1 
ATOM   1573  C  CD1 . LEU A 1 226 ? -17.992 -22.039 12.912  1.00 28.04 ? 240 LEU A CD1 1 
ATOM   1574  C  CD2 . LEU A 1 226 ? -19.449 -20.252 11.868  1.00 26.35 ? 240 LEU A CD2 1 
ATOM   1575  N  N   . ALA A 1 227 ? -15.070 -18.249 12.258  1.00 20.73 ? 241 ALA A N   1 
ATOM   1576  C  CA  . ALA A 1 227 ? -14.138 -17.950 11.174  1.00 20.15 ? 241 ALA A CA  1 
ATOM   1577  C  C   . ALA A 1 227 ? -12.669 -18.012 11.605  1.00 19.66 ? 241 ALA A C   1 
ATOM   1578  O  O   . ALA A 1 227 ? -11.807 -18.452 10.836  1.00 16.58 ? 241 ALA A O   1 
ATOM   1579  C  CB  . ALA A 1 227 ? -14.439 -16.597 10.564  1.00 16.87 ? 241 ALA A CB  1 
ATOM   1580  N  N   . SER A 1 228 ? -12.391 -17.554 12.821  1.00 19.51 ? 242 SER A N   1 
ATOM   1581  C  CA  . SER A 1 228 ? -11.022 -17.556 13.341  1.00 24.05 ? 242 SER A CA  1 
ATOM   1582  C  C   . SER A 1 228 ? -10.473 -18.981 13.473  1.00 20.18 ? 242 SER A C   1 
ATOM   1583  O  O   . SER A 1 228 ? -9.333  -19.256 13.098  1.00 20.28 ? 242 SER A O   1 
ATOM   1584  C  CB  . SER A 1 228 ? -10.951 -16.823 14.684  1.00 19.06 ? 242 SER A CB  1 
ATOM   1585  O  OG  . SER A 1 228 ? -11.115 -15.421 14.509  1.00 24.24 ? 242 SER A OG  1 
ATOM   1586  N  N   . TYR A 1 229 ? -11.290 -19.894 13.992  1.00 20.73 ? 243 TYR A N   1 
ATOM   1587  C  CA  . TYR A 1 229 ? -10.843 -21.268 14.127  1.00 17.25 ? 243 TYR A CA  1 
ATOM   1588  C  C   . TYR A 1 229 ? -10.655 -21.886 12.735  1.00 22.23 ? 243 TYR A C   1 
ATOM   1589  O  O   . TYR A 1 229 ? -9.762  -22.706 12.519  1.00 17.76 ? 243 TYR A O   1 
ATOM   1590  C  CB  . TYR A 1 229 ? -11.829 -22.081 14.971  1.00 15.50 ? 243 TYR A CB  1 
ATOM   1591  C  CG  . TYR A 1 229 ? -11.324 -23.471 15.298  1.00 23.78 ? 243 TYR A CG  1 
ATOM   1592  C  CD1 . TYR A 1 229 ? -12.019 -24.605 14.899  1.00 27.19 ? 243 TYR A CD1 1 
ATOM   1593  C  CD2 . TYR A 1 229 ? -10.137 -23.638 16.001  1.00 24.43 ? 243 TYR A CD2 1 
ATOM   1594  C  CE1 . TYR A 1 229 ? -11.539 -25.884 15.208  1.00 30.71 ? 243 TYR A CE1 1 
ATOM   1595  C  CE2 . TYR A 1 229 ? -9.655  -24.888 16.311  1.00 31.88 ? 243 TYR A CE2 1 
ATOM   1596  C  CZ  . TYR A 1 229 ? -10.346 -26.006 15.921  1.00 29.62 ? 243 TYR A CZ  1 
ATOM   1597  O  OH  . TYR A 1 229 ? -9.826  -27.237 16.248  1.00 30.93 ? 243 TYR A OH  1 
ATOM   1598  N  N   . ALA A 1 230 ? -11.478 -21.462 11.782  1.00 19.01 ? 244 ALA A N   1 
ATOM   1599  C  CA  . ALA A 1 230 ? -11.391 -22.019 10.434  1.00 21.82 ? 244 ALA A CA  1 
ATOM   1600  C  C   . ALA A 1 230 ? -10.028 -21.704 9.833   1.00 22.13 ? 244 ALA A C   1 
ATOM   1601  O  O   . ALA A 1 230 ? -9.425  -22.551 9.176   1.00 21.04 ? 244 ALA A O   1 
ATOM   1602  C  CB  . ALA A 1 230 ? -12.524 -21.490 9.543   1.00 19.43 ? 244 ALA A CB  1 
ATOM   1603  N  N   . VAL A 1 231 ? -9.551  -20.484 10.081  1.00 20.09 ? 245 VAL A N   1 
ATOM   1604  C  CA  . VAL A 1 231 ? -8.245  -20.041 9.609   1.00 18.93 ? 245 VAL A CA  1 
ATOM   1605  C  C   . VAL A 1 231 ? -7.132  -20.768 10.361  1.00 15.19 ? 245 VAL A C   1 
ATOM   1606  O  O   . VAL A 1 231 ? -6.119  -21.135 9.773   1.00 17.47 ? 245 VAL A O   1 
ATOM   1607  C  CB  . VAL A 1 231 ? -8.075  -18.500 9.764   1.00 15.41 ? 245 VAL A CB  1 
ATOM   1608  C  CG1 . VAL A 1 231 ? -6.627  -18.073 9.483   1.00 14.56 ? 245 VAL A CG1 1 
ATOM   1609  C  CG2 . VAL A 1 231 ? -9.048  -17.756 8.846   1.00 18.28 ? 245 VAL A CG2 1 
ATOM   1610  N  N   . TYR A 1 232 ? -7.332  -20.979 11.658  1.00 14.81 ? 246 TYR A N   1 
ATOM   1611  C  CA  . TYR A 1 232 ? -6.345  -21.704 12.461  1.00 17.79 ? 246 TYR A CA  1 
ATOM   1612  C  C   . TYR A 1 232 ? -6.140  -23.093 11.905  1.00 18.98 ? 246 TYR A C   1 
ATOM   1613  O  O   . TYR A 1 232 ? -5.008  -23.531 11.685  1.00 19.77 ? 246 TYR A O   1 
ATOM   1614  C  CB  . TYR A 1 232 ? -6.772  -21.812 13.930  1.00 15.33 ? 246 TYR A CB  1 
ATOM   1615  C  CG  . TYR A 1 232 ? -5.731  -22.542 14.756  1.00 20.15 ? 246 TYR A CG  1 
ATOM   1616  C  CD1 . TYR A 1 232 ? -4.556  -21.898 15.145  1.00 19.40 ? 246 TYR A CD1 1 
ATOM   1617  C  CD2 . TYR A 1 232 ? -5.902  -23.880 15.115  1.00 22.15 ? 246 TYR A CD2 1 
ATOM   1618  C  CE1 . TYR A 1 232 ? -3.578  -22.565 15.883  1.00 22.08 ? 246 TYR A CE1 1 
ATOM   1619  C  CE2 . TYR A 1 232 ? -4.932  -24.559 15.858  1.00 20.66 ? 246 TYR A CE2 1 
ATOM   1620  C  CZ  . TYR A 1 232 ? -3.763  -23.895 16.234  1.00 24.57 ? 246 TYR A CZ  1 
ATOM   1621  O  OH  . TYR A 1 232 ? -2.777  -24.547 16.968  1.00 24.36 ? 246 TYR A OH  1 
ATOM   1622  N  N   . ARG A 1 233 ? -7.253  -23.788 11.679  1.00 18.89 ? 247 ARG A N   1 
ATOM   1623  C  CA  . ARG A 1 233 ? -7.214  -25.151 11.172  1.00 21.60 ? 247 ARG A CA  1 
ATOM   1624  C  C   . ARG A 1 233 ? -6.517  -25.196 9.816   1.00 24.22 ? 247 ARG A C   1 
ATOM   1625  O  O   . ARG A 1 233 ? -5.739  -26.107 9.530   1.00 19.04 ? 247 ARG A O   1 
ATOM   1626  C  CB  . ARG A 1 233 ? -8.642  -25.705 11.061  1.00 26.83 ? 247 ARG A CB  1 
ATOM   1627  C  CG  . ARG A 1 233 ? -9.096  -26.483 12.292  1.00 33.70 ? 247 ARG A CG  1 
ATOM   1628  C  CD  . ARG A 1 233 ? -8.623  -27.946 12.210  1.00 44.05 ? 247 ARG A CD  1 
ATOM   1629  N  NE  . ARG A 1 233 ? -7.406  -28.188 12.979  1.00 53.85 ? 247 ARG A NE  1 
ATOM   1630  C  CZ  . ARG A 1 233 ? -6.521  -29.146 12.713  1.00 58.79 ? 247 ARG A CZ  1 
ATOM   1631  N  NH1 . ARG A 1 233 ? -5.447  -29.281 13.479  1.00 57.88 ? 247 ARG A NH1 1 
ATOM   1632  N  NH2 . ARG A 1 233 ? -6.705  -29.965 11.682  1.00 64.20 ? 247 ARG A NH2 1 
ATOM   1633  N  N   . ILE A 1 234 ? -6.806  -24.211 8.974   1.00 17.24 ? 248 ILE A N   1 
ATOM   1634  C  CA  . ILE A 1 234 ? -6.195  -24.157 7.657   1.00 19.76 ? 248 ILE A CA  1 
ATOM   1635  C  C   . ILE A 1 234 ? -4.678  -23.957 7.788   1.00 25.36 ? 248 ILE A C   1 
ATOM   1636  O  O   . ILE A 1 234 ? -3.900  -24.629 7.099   1.00 21.11 ? 248 ILE A O   1 
ATOM   1637  C  CB  . ILE A 1 234 ? -6.837  -23.071 6.788   1.00 19.87 ? 248 ILE A CB  1 
ATOM   1638  C  CG1 . ILE A 1 234 ? -8.223  -23.532 6.320   1.00 21.81 ? 248 ILE A CG1 1 
ATOM   1639  C  CG2 . ILE A 1 234 ? -5.980  -22.784 5.581   1.00 25.68 ? 248 ILE A CG2 1 
ATOM   1640  C  CD1 . ILE A 1 234 ? -9.024  -22.442 5.651   1.00 20.50 ? 248 ILE A CD1 1 
ATOM   1641  N  N   . LEU A 1 235 ? -4.261  -23.068 8.694   1.00 21.08 ? 249 LEU A N   1 
ATOM   1642  C  CA  . LEU A 1 235 ? -2.833  -22.883 8.965   1.00 23.74 ? 249 LEU A CA  1 
ATOM   1643  C  C   . LEU A 1 235 ? -2.133  -24.182 9.364   1.00 27.61 ? 249 LEU A C   1 
ATOM   1644  O  O   . LEU A 1 235 ? -1.065  -24.500 8.836   1.00 22.13 ? 249 LEU A O   1 
ATOM   1645  C  CB  . LEU A 1 235 ? -2.590  -21.806 10.035  1.00 21.95 ? 249 LEU A CB  1 
ATOM   1646  C  CG  . LEU A 1 235 ? -2.814  -20.366 9.554   1.00 25.96 ? 249 LEU A CG  1 
ATOM   1647  C  CD1 . LEU A 1 235 ? -2.802  -19.368 10.717  1.00 24.59 ? 249 LEU A CD1 1 
ATOM   1648  C  CD2 . LEU A 1 235 ? -1.785  -19.961 8.496   1.00 27.92 ? 249 LEU A CD2 1 
ATOM   1649  N  N   . ARG A 1 236 ? -2.734  -24.926 10.292  1.00 24.20 ? 250 ARG A N   1 
ATOM   1650  C  CA  . ARG A 1 236 ? -2.167  -26.200 10.703  1.00 24.71 ? 250 ARG A CA  1 
ATOM   1651  C  C   . ARG A 1 236 ? -2.148  -27.168 9.512   1.00 27.66 ? 250 ARG A C   1 
ATOM   1652  O  O   . ARG A 1 236 ? -1.125  -27.796 9.262   1.00 30.37 ? 250 ARG A O   1 
ATOM   1653  C  CB  . ARG A 1 236 ? -2.911  -26.798 11.905  1.00 21.34 ? 250 ARG A CB  1 
ATOM   1654  C  CG  . ARG A 1 236 ? -3.018  -25.878 13.140  1.00 17.57 ? 250 ARG A CG  1 
ATOM   1655  C  CD  . ARG A 1 236 ? -1.645  -25.467 13.682  1.00 22.74 ? 250 ARG A CD  1 
ATOM   1656  N  NE  . ARG A 1 236 ? -0.758  -26.619 13.756  1.00 25.44 ? 250 ARG A NE  1 
ATOM   1657  C  CZ  . ARG A 1 236 ? -0.724  -27.472 14.774  1.00 26.41 ? 250 ARG A CZ  1 
ATOM   1658  N  NH1 . ARG A 1 236 ? -1.508  -27.276 15.830  1.00 19.37 ? 250 ARG A NH1 1 
ATOM   1659  N  NH2 . ARG A 1 236 ? 0.098   -28.521 14.735  1.00 24.15 ? 250 ARG A NH2 1 
ATOM   1660  N  N   . GLU A 1 237 ? -3.259  -27.270 8.769   1.00 25.47 ? 251 GLU A N   1 
ATOM   1661  C  CA  . GLU A 1 237 ? -3.321  -28.171 7.609   1.00 27.50 ? 251 GLU A CA  1 
ATOM   1662  C  C   . GLU A 1 237 ? -2.265  -27.821 6.572   1.00 26.98 ? 251 GLU A C   1 
ATOM   1663  O  O   . GLU A 1 237 ? -1.791  -28.692 5.843   1.00 24.79 ? 251 GLU A O   1 
ATOM   1664  C  CB  . GLU A 1 237 ? -4.697  -28.153 6.934   1.00 31.29 ? 251 GLU A CB  1 
ATOM   1665  C  CG  . GLU A 1 237 ? -5.770  -28.914 7.680   1.00 28.26 ? 251 GLU A CG  1 
ATOM   1666  C  CD  . GLU A 1 237 ? -7.137  -28.769 7.031   1.00 32.49 ? 251 GLU A CD  1 
ATOM   1667  O  OE1 . GLU A 1 237 ? -7.222  -28.813 5.787   1.00 31.33 ? 251 GLU A OE1 1 
ATOM   1668  O  OE2 . GLU A 1 237 ? -8.127  -28.605 7.771   1.00 37.55 ? 251 GLU A OE2 1 
ATOM   1669  N  N   . ALA A 1 238 ? -1.910  -26.540 6.519   1.00 22.58 ? 252 ALA A N   1 
ATOM   1670  C  CA  . ALA A 1 238 ? -0.905  -26.029 5.584   1.00 25.49 ? 252 ALA A CA  1 
ATOM   1671  C  C   . ALA A 1 238 ? 0.522   -26.358 6.040   1.00 28.04 ? 252 ALA A C   1 
ATOM   1672  O  O   . ALA A 1 238 ? 1.477   -26.120 5.307   1.00 30.59 ? 252 ALA A O   1 
ATOM   1673  C  CB  . ALA A 1 238 ? -1.062  -24.512 5.418   1.00 20.43 ? 252 ALA A CB  1 
ATOM   1674  N  N   . GLY A 1 239 ? 0.658   -26.881 7.256   1.00 27.67 ? 253 GLY A N   1 
ATOM   1675  C  CA  . GLY A 1 239 ? 1.950   -27.330 7.755   1.00 27.16 ? 253 GLY A CA  1 
ATOM   1676  C  C   . GLY A 1 239 ? 2.539   -26.506 8.896   1.00 23.83 ? 253 GLY A C   1 
ATOM   1677  O  O   . GLY A 1 239 ? 3.705   -26.675 9.244   1.00 21.76 ? 253 GLY A O   1 
ATOM   1678  N  N   . LEU A 1 240 ? 1.751   -25.613 9.489   1.00 25.00 ? 254 LEU A N   1 
ATOM   1679  C  CA  . LEU A 1 240 ? 2.217   -24.916 10.684  1.00 16.01 ? 254 LEU A CA  1 
ATOM   1680  C  C   . LEU A 1 240 ? 2.439   -25.945 11.803  1.00 20.68 ? 254 LEU A C   1 
ATOM   1681  O  O   . LEU A 1 240 ? 1.513   -26.663 12.183  1.00 24.23 ? 254 LEU A O   1 
ATOM   1682  C  CB  . LEU A 1 240 ? 1.224   -23.844 11.141  1.00 20.13 ? 254 LEU A CB  1 
ATOM   1683  C  CG  . LEU A 1 240 ? 1.796   -22.914 12.227  1.00 18.15 ? 254 LEU A CG  1 
ATOM   1684  C  CD1 . LEU A 1 240 ? 2.879   -22.022 11.623  1.00 20.27 ? 254 LEU A CD1 1 
ATOM   1685  C  CD2 . LEU A 1 240 ? 0.725   -22.053 12.896  1.00 20.21 ? 254 LEU A CD2 1 
ATOM   1686  N  N   . PRO A 1 241 ? 3.677   -26.035 12.320  1.00 21.79 ? 255 PRO A N   1 
ATOM   1687  C  CA  . PRO A 1 241 ? 4.002   -27.043 13.338  1.00 21.03 ? 255 PRO A CA  1 
ATOM   1688  C  C   . PRO A 1 241 ? 3.248   -26.776 14.640  1.00 19.14 ? 255 PRO A C   1 
ATOM   1689  O  O   . PRO A 1 241 ? 2.749   -25.656 14.844  1.00 20.04 ? 255 PRO A O   1 
ATOM   1690  C  CB  . PRO A 1 241 ? 5.513   -26.843 13.553  1.00 28.56 ? 255 PRO A CB  1 
ATOM   1691  C  CG  . PRO A 1 241 ? 6.001   -26.165 12.329  1.00 27.73 ? 255 PRO A CG  1 
ATOM   1692  C  CD  . PRO A 1 241 ? 4.867   -25.276 11.899  1.00 25.30 ? 255 PRO A CD  1 
ATOM   1693  N  N   . PRO A 1 242 ? 3.180   -27.779 15.531  1.00 24.67 ? 256 PRO A N   1 
ATOM   1694  C  CA  . PRO A 1 242 ? 2.525   -27.542 16.822  1.00 20.24 ? 256 PRO A CA  1 
ATOM   1695  C  C   . PRO A 1 242 ? 3.249   -26.496 17.664  1.00 19.46 ? 256 PRO A C   1 
ATOM   1696  O  O   . PRO A 1 242 ? 4.472   -26.369 17.564  1.00 26.67 ? 256 PRO A O   1 
ATOM   1697  C  CB  . PRO A 1 242 ? 2.600   -28.910 17.513  1.00 22.16 ? 256 PRO A CB  1 
ATOM   1698  C  CG  . PRO A 1 242 ? 3.706   -29.645 16.818  1.00 27.85 ? 256 PRO A CG  1 
ATOM   1699  C  CD  . PRO A 1 242 ? 3.711   -29.153 15.414  1.00 25.79 ? 256 PRO A CD  1 
ATOM   1700  N  N   . ASN A 1 243 ? 2.487   -25.790 18.502  1.00 16.29 ? 257 ASN A N   1 
ATOM   1701  C  CA  . ASN A 1 243 ? 3.017   -24.850 19.483  1.00 18.11 ? 257 ASN A CA  1 
ATOM   1702  C  C   . ASN A 1 243 ? 3.554   -23.535 18.916  1.00 19.06 ? 257 ASN A C   1 
ATOM   1703  O  O   . ASN A 1 243 ? 4.109   -22.739 19.653  1.00 23.02 ? 257 ASN A O   1 
ATOM   1704  C  CB  . ASN A 1 243 ? 4.056   -25.513 20.395  1.00 18.59 ? 257 ASN A CB  1 
ATOM   1705  C  CG  . ASN A 1 243 ? 3.446   -26.593 21.270  1.00 19.97 ? 257 ASN A CG  1 
ATOM   1706  O  OD1 . ASN A 1 243 ? 2.524   -26.326 22.045  1.00 20.12 ? 257 ASN A OD1 1 
ATOM   1707  N  ND2 . ASN A 1 243 ? 3.938   -27.821 21.130  1.00 17.91 ? 257 ASN A ND2 1 
ATOM   1708  N  N   . ILE A 1 244 ? 3.380   -23.309 17.622  1.00 15.77 ? 258 ILE A N   1 
ATOM   1709  C  CA  . ILE A 1 244 ? 3.757   -22.034 17.024  1.00 13.67 ? 258 ILE A CA  1 
ATOM   1710  C  C   . ILE A 1 244 ? 2.665   -20.984 17.231  1.00 17.68 ? 258 ILE A C   1 
ATOM   1711  O  O   . ILE A 1 244 ? 2.937   -19.848 17.610  1.00 18.81 ? 258 ILE A O   1 
ATOM   1712  C  CB  . ILE A 1 244 ? 4.038   -22.195 15.547  1.00 17.32 ? 258 ILE A CB  1 
ATOM   1713  C  CG1 . ILE A 1 244 ? 5.053   -23.320 15.359  1.00 19.45 ? 258 ILE A CG1 1 
ATOM   1714  C  CG2 . ILE A 1 244 ? 4.563   -20.856 14.972  1.00 13.98 ? 258 ILE A CG2 1 
ATOM   1715  C  CD1 . ILE A 1 244 ? 6.349   -23.096 16.194  1.00 20.26 ? 258 ILE A CD1 1 
ATOM   1716  N  N   . ILE A 1 245 ? 1.422   -21.369 16.958  1.00 14.49 ? 259 ILE A N   1 
ATOM   1717  C  CA  . ILE A 1 245 ? 0.281   -20.550 17.344  1.00 13.76 ? 259 ILE A CA  1 
ATOM   1718  C  C   . ILE A 1 245 ? -0.632  -21.391 18.230  1.00 14.69 ? 259 ILE A C   1 
ATOM   1719  O  O   . ILE A 1 245 ? -1.158  -22.419 17.792  1.00 16.42 ? 259 ILE A O   1 
ATOM   1720  C  CB  . ILE A 1 245 ? -0.518  -20.043 16.128  1.00 18.85 ? 259 ILE A CB  1 
ATOM   1721  C  CG1 . ILE A 1 245 ? 0.360   -19.146 15.245  1.00 17.30 ? 259 ILE A CG1 1 
ATOM   1722  C  CG2 . ILE A 1 245 ? -1.741  -19.263 16.627  1.00 17.40 ? 259 ILE A CG2 1 
ATOM   1723  C  CD1 . ILE A 1 245 ? -0.238  -18.768 13.903  1.00 15.18 ? 259 ILE A CD1 1 
ATOM   1724  N  N   . GLN A 1 246 ? -0.779  -20.968 19.480  1.00 16.10 ? 260 GLN A N   1 
ATOM   1725  C  CA  . GLN A 1 246 ? -1.689  -21.612 20.411  1.00 17.22 ? 260 GLN A CA  1 
ATOM   1726  C  C   . GLN A 1 246 ? -3.063  -20.948 20.294  1.00 19.95 ? 260 GLN A C   1 
ATOM   1727  O  O   . GLN A 1 246 ? -3.176  -19.731 20.447  1.00 16.47 ? 260 GLN A O   1 
ATOM   1728  C  CB  . GLN A 1 246 ? -1.173  -21.463 21.851  1.00 16.73 ? 260 GLN A CB  1 
ATOM   1729  C  CG  . GLN A 1 246 ? 0.331   -21.811 22.067  1.00 12.52 ? 260 GLN A CG  1 
ATOM   1730  C  CD  . GLN A 1 246 ? 0.620   -23.310 21.869  1.00 21.29 ? 260 GLN A CD  1 
ATOM   1731  O  OE1 . GLN A 1 246 ? -0.020  -23.984 21.056  1.00 20.11 ? 260 GLN A OE1 1 
ATOM   1732  N  NE2 . GLN A 1 246 ? 1.602   -23.825 22.604  1.00 15.54 ? 260 GLN A NE2 1 
ATOM   1733  N  N   . PHE A 1 247 ? -4.099  -21.741 20.033  1.00 16.50 ? 261 PHE A N   1 
ATOM   1734  C  CA  . PHE A 1 247 ? -5.446  -21.193 19.873  1.00 15.69 ? 261 PHE A CA  1 
ATOM   1735  C  C   . PHE A 1 247 ? -6.129  -21.121 21.229  1.00 16.82 ? 261 PHE A C   1 
ATOM   1736  O  O   . PHE A 1 247 ? -6.706  -22.119 21.696  1.00 17.01 ? 261 PHE A O   1 
ATOM   1737  C  CB  . PHE A 1 247 ? -6.259  -22.071 18.919  1.00 15.73 ? 261 PHE A CB  1 
ATOM   1738  C  CG  . PHE A 1 247 ? -7.524  -21.421 18.413  1.00 20.67 ? 261 PHE A CG  1 
ATOM   1739  C  CD1 . PHE A 1 247 ? -7.476  -20.504 17.372  1.00 19.68 ? 261 PHE A CD1 1 
ATOM   1740  C  CD2 . PHE A 1 247 ? -8.768  -21.750 18.966  1.00 19.09 ? 261 PHE A CD2 1 
ATOM   1741  C  CE1 . PHE A 1 247 ? -8.644  -19.909 16.898  1.00 19.74 ? 261 PHE A CE1 1 
ATOM   1742  C  CE2 . PHE A 1 247 ? -9.928  -21.167 18.499  1.00 18.32 ? 261 PHE A CE2 1 
ATOM   1743  C  CZ  . PHE A 1 247 ? -9.863  -20.240 17.452  1.00 16.45 ? 261 PHE A CZ  1 
ATOM   1744  N  N   . VAL A 1 248 ? -6.066  -19.952 21.866  1.00 17.56 ? 262 VAL A N   1 
ATOM   1745  C  CA  . VAL A 1 248 ? -6.565  -19.810 23.239  1.00 13.95 ? 262 VAL A CA  1 
ATOM   1746  C  C   . VAL A 1 248 ? -7.567  -18.667 23.479  1.00 18.48 ? 262 VAL A C   1 
ATOM   1747  O  O   . VAL A 1 248 ? -7.223  -17.628 24.065  1.00 19.35 ? 262 VAL A O   1 
ATOM   1748  C  CB  . VAL A 1 248 ? -5.415  -19.710 24.245  1.00 12.43 ? 262 VAL A CB  1 
ATOM   1749  C  CG1 . VAL A 1 248 ? -4.760  -21.096 24.423  1.00 16.71 ? 262 VAL A CG1 1 
ATOM   1750  C  CG2 . VAL A 1 248 ? -4.375  -18.683 23.786  1.00 14.83 ? 262 VAL A CG2 1 
ATOM   1751  N  N   . PRO A 1 249 ? -8.821  -18.871 23.048  1.00 18.82 ? 263 PRO A N   1 
ATOM   1752  C  CA  . PRO A 1 249 ? -9.906  -17.968 23.452  1.00 16.21 ? 263 PRO A CA  1 
ATOM   1753  C  C   . PRO A 1 249 ? -9.886  -17.853 24.967  1.00 19.98 ? 263 PRO A C   1 
ATOM   1754  O  O   . PRO A 1 249 ? -9.541  -18.822 25.650  1.00 18.09 ? 263 PRO A O   1 
ATOM   1755  C  CB  . PRO A 1 249 ? -11.160 -18.725 23.020  1.00 16.17 ? 263 PRO A CB  1 
ATOM   1756  C  CG  . PRO A 1 249 ? -10.720 -19.527 21.865  1.00 18.08 ? 263 PRO A CG  1 
ATOM   1757  C  CD  . PRO A 1 249 ? -9.310  -19.977 22.206  1.00 17.27 ? 263 PRO A CD  1 
ATOM   1758  N  N   . ALA A 1 250 ? -10.203 -16.674 25.481  1.00 13.81 ? 264 ALA A N   1 
ATOM   1759  C  CA  . ALA A 1 250 ? -10.137 -16.433 26.906  1.00 15.12 ? 264 ALA A CA  1 
ATOM   1760  C  C   . ALA A 1 250 ? -10.886 -15.157 27.225  1.00 16.67 ? 264 ALA A C   1 
ATOM   1761  O  O   . ALA A 1 250 ? -11.134 -14.340 26.348  1.00 18.20 ? 264 ALA A O   1 
ATOM   1762  C  CB  . ALA A 1 250 ? -8.683  -16.312 27.361  1.00 15.35 ? 264 ALA A CB  1 
ATOM   1763  N  N   . ASP A 1 251 ? -11.230 -14.986 28.491  1.00 18.35 ? 265 ASP A N   1 
ATOM   1764  C  CA  . ASP A 1 251 ? -11.742 -13.708 28.954  1.00 20.61 ? 265 ASP A CA  1 
ATOM   1765  C  C   . ASP A 1 251 ? -10.669 -12.654 28.687  1.00 26.86 ? 265 ASP A C   1 
ATOM   1766  O  O   . ASP A 1 251 ? -9.491  -12.879 28.993  1.00 18.94 ? 265 ASP A O   1 
ATOM   1767  C  CB  . ASP A 1 251 ? -12.031 -13.806 30.444  1.00 23.82 ? 265 ASP A CB  1 
ATOM   1768  C  CG  . ASP A 1 251 ? -12.435 -12.489 31.038  1.00 30.79 ? 265 ASP A CG  1 
ATOM   1769  O  OD1 . ASP A 1 251 ? -13.518 -12.001 30.673  1.00 31.82 ? 265 ASP A OD1 1 
ATOM   1770  O  OD2 . ASP A 1 251 ? -11.668 -11.946 31.865  1.00 30.57 ? 265 ASP A OD2 1 
ATOM   1771  N  N   . GLY A 1 252 ? -11.069 -11.531 28.090  1.00 21.52 ? 266 GLY A N   1 
ATOM   1772  C  CA  . GLY A 1 252 ? -10.153 -10.440 27.781  1.00 21.87 ? 266 GLY A CA  1 
ATOM   1773  C  C   . GLY A 1 252 ? -9.209  -10.026 28.901  1.00 22.33 ? 266 GLY A C   1 
ATOM   1774  O  O   . GLY A 1 252 ? -7.987  -10.099 28.750  1.00 18.71 ? 266 GLY A O   1 
ATOM   1775  N  N   . PRO A 1 253 ? -9.772  -9.587  30.038  1.00 25.99 ? 267 PRO A N   1 
ATOM   1776  C  CA  . PRO A 1 253 ? -8.971  -9.161  31.191  1.00 27.83 ? 267 PRO A CA  1 
ATOM   1777  C  C   . PRO A 1 253 ? -8.048  -10.246 31.743  1.00 29.25 ? 267 PRO A C   1 
ATOM   1778  O  O   . PRO A 1 253 ? -6.872  -9.953  32.002  1.00 23.01 ? 267 PRO A O   1 
ATOM   1779  C  CB  . PRO A 1 253 ? -10.033 -8.787  32.225  1.00 29.51 ? 267 PRO A CB  1 
ATOM   1780  C  CG  . PRO A 1 253 ? -11.187 -8.338  31.404  1.00 30.37 ? 267 PRO A CG  1 
ATOM   1781  C  CD  . PRO A 1 253 ? -11.196 -9.244  30.207  1.00 27.09 ? 267 PRO A CD  1 
ATOM   1782  N  N   . LEU A 1 254 ? -8.571  -11.457 31.941  1.00 21.55 ? 268 LEU A N   1 
ATOM   1783  C  CA  . LEU A 1 254 ? -7.749  -12.583 32.386  1.00 23.13 ? 268 LEU A CA  1 
ATOM   1784  C  C   . LEU A 1 254 ? -6.572  -12.802 31.446  1.00 16.45 ? 268 LEU A C   1 
ATOM   1785  O  O   . LEU A 1 254 ? -5.422  -12.929 31.879  1.00 22.07 ? 268 LEU A O   1 
ATOM   1786  C  CB  . LEU A 1 254 ? -8.577  -13.875 32.478  1.00 24.24 ? 268 LEU A CB  1 
ATOM   1787  C  CG  . LEU A 1 254 ? -7.735  -15.086 32.894  1.00 29.68 ? 268 LEU A CG  1 
ATOM   1788  C  CD1 . LEU A 1 254 ? -6.947  -14.761 34.153  1.00 31.38 ? 268 LEU A CD1 1 
ATOM   1789  C  CD2 . LEU A 1 254 ? -8.606  -16.312 33.132  1.00 35.70 ? 268 LEU A CD2 1 
ATOM   1790  N  N   . PHE A 1 255 ? -6.850  -12.834 30.149  1.00 17.19 ? 269 PHE A N   1 
ATOM   1791  C  CA  . PHE A 1 255 ? -5.771  -13.050 29.193  1.00 20.74 ? 269 PHE A CA  1 
ATOM   1792  C  C   . PHE A 1 255 ? -4.730  -11.919 29.244  1.00 18.26 ? 269 PHE A C   1 
ATOM   1793  O  O   . PHE A 1 255 ? -3.524  -12.184 29.300  1.00 19.54 ? 269 PHE A O   1 
ATOM   1794  C  CB  . PHE A 1 255 ? -6.328  -13.189 27.781  1.00 18.84 ? 269 PHE A CB  1 
ATOM   1795  C  CG  . PHE A 1 255 ? -5.297  -13.575 26.758  1.00 19.57 ? 269 PHE A CG  1 
ATOM   1796  C  CD1 . PHE A 1 255 ? -5.022  -14.913 26.503  1.00 14.22 ? 269 PHE A CD1 1 
ATOM   1797  C  CD2 . PHE A 1 255 ? -4.606  -12.597 26.043  1.00 13.84 ? 269 PHE A CD2 1 
ATOM   1798  C  CE1 . PHE A 1 255 ? -4.076  -15.285 25.555  1.00 15.64 ? 269 PHE A CE1 1 
ATOM   1799  C  CE2 . PHE A 1 255 ? -3.666  -12.953 25.093  1.00 14.98 ? 269 PHE A CE2 1 
ATOM   1800  C  CZ  . PHE A 1 255 ? -3.389  -14.295 24.846  1.00 17.44 ? 269 PHE A CZ  1 
ATOM   1801  N  N   . GLY A 1 256 ? -5.201  -10.675 29.205  1.00 22.70 ? 270 GLY A N   1 
ATOM   1802  C  CA  . GLY A 1 256 ? -4.312  -9.519  29.276  1.00 17.88 ? 270 GLY A CA  1 
ATOM   1803  C  C   . GLY A 1 256 ? -3.457  -9.519  30.533  1.00 20.93 ? 270 GLY A C   1 
ATOM   1804  O  O   . GLY A 1 256 ? -2.244  -9.334  30.458  1.00 19.82 ? 270 GLY A O   1 
ATOM   1805  N  N   . ASP A 1 257 ? -4.089  -9.752  31.685  1.00 21.46 ? 271 ASP A N   1 
ATOM   1806  C  CA  . ASP A 1 257 ? -3.371  -9.878  32.952  1.00 24.73 ? 271 ASP A CA  1 
ATOM   1807  C  C   . ASP A 1 257 ? -2.347  -11.020 32.940  1.00 24.82 ? 271 ASP A C   1 
ATOM   1808  O  O   . ASP A 1 257 ? -1.232  -10.855 33.422  1.00 21.55 ? 271 ASP A O   1 
ATOM   1809  C  CB  . ASP A 1 257 ? -4.343  -10.111 34.116  1.00 21.65 ? 271 ASP A CB  1 
ATOM   1810  C  CG  . ASP A 1 257 ? -5.282  -8.942  34.338  1.00 30.57 ? 271 ASP A CG  1 
ATOM   1811  O  OD1 . ASP A 1 257 ? -5.181  -7.932  33.601  1.00 33.77 ? 271 ASP A OD1 1 
ATOM   1812  O  OD2 . ASP A 1 257 ? -6.124  -9.036  35.254  1.00 29.86 ? 271 ASP A OD2 1 
ATOM   1813  N  N   . THR A 1 258 ? -2.734  -12.184 32.419  1.00 19.78 ? 272 THR A N   1 
ATOM   1814  C  CA  . THR A 1 258 ? -1.823  -13.329 32.387  1.00 20.68 ? 272 THR A CA  1 
ATOM   1815  C  C   . THR A 1 258 ? -0.570  -13.110 31.530  1.00 15.83 ? 272 THR A C   1 
ATOM   1816  O  O   . THR A 1 258 ? 0.554   -13.356 31.985  1.00 19.47 ? 272 THR A O   1 
ATOM   1817  C  CB  . THR A 1 258 ? -2.544  -14.632 31.930  1.00 18.48 ? 272 THR A CB  1 
ATOM   1818  O  OG1 . THR A 1 258 ? -3.610  -14.916 32.839  1.00 18.83 ? 272 THR A OG1 1 
ATOM   1819  C  CG2 . THR A 1 258 ? -1.566  -15.808 31.929  1.00 18.31 ? 272 THR A CG2 1 
ATOM   1820  N  N   . VAL A 1 259 ? -0.742  -12.654 30.296  1.00 14.02 ? 273 VAL A N   1 
ATOM   1821  C  CA  . VAL A 1 259 ? 0.421   -12.515 29.421  1.00 15.59 ? 273 VAL A CA  1 
ATOM   1822  C  C   . VAL A 1 259 ? 1.340   -11.367 29.880  1.00 19.89 ? 273 VAL A C   1 
ATOM   1823  O  O   . VAL A 1 259 ? 2.567   -11.482 29.818  1.00 15.03 ? 273 VAL A O   1 
ATOM   1824  C  CB  . VAL A 1 259 ? 0.037   -12.382 27.927  1.00 15.48 ? 273 VAL A CB  1 
ATOM   1825  C  CG1 . VAL A 1 259 ? -0.821  -13.576 27.480  1.00 18.60 ? 273 VAL A CG1 1 
ATOM   1826  C  CG2 . VAL A 1 259 ? -0.695  -11.061 27.642  1.00 16.09 ? 273 VAL A CG2 1 
ATOM   1827  N  N   . THR A 1 260 ? 0.750   -10.281 30.377  1.00 19.00 ? 274 THR A N   1 
ATOM   1828  C  CA  . THR A 1 260 ? 1.558   -9.163  30.855  1.00 21.71 ? 274 THR A CA  1 
ATOM   1829  C  C   . THR A 1 260 ? 2.234   -9.464  32.176  1.00 22.16 ? 274 THR A C   1 
ATOM   1830  O  O   . THR A 1 260 ? 3.188   -8.801  32.532  1.00 21.43 ? 274 THR A O   1 
ATOM   1831  C  CB  . THR A 1 260 ? 0.777   -7.807  30.918  1.00 18.17 ? 274 THR A CB  1 
ATOM   1832  O  OG1 . THR A 1 260 ? -0.343  -7.913  31.804  1.00 20.67 ? 274 THR A OG1 1 
ATOM   1833  C  CG2 . THR A 1 260 ? 0.293   -7.429  29.561  1.00 14.06 ? 274 THR A CG2 1 
ATOM   1834  N  N   . SER A 1 261 ? 1.763   -10.478 32.899  1.00 21.12 ? 275 SER A N   1 
ATOM   1835  C  CA  . SER A 1 261 ? 2.443   -10.894 34.116  1.00 21.25 ? 275 SER A CA  1 
ATOM   1836  C  C   . SER A 1 261 ? 3.533   -11.917 33.834  1.00 22.56 ? 275 SER A C   1 
ATOM   1837  O  O   . SER A 1 261 ? 4.229   -12.340 34.750  1.00 22.84 ? 275 SER A O   1 
ATOM   1838  C  CB  . SER A 1 261 ? 1.464   -11.482 35.133  1.00 27.46 ? 275 SER A CB  1 
ATOM   1839  O  OG  . SER A 1 261 ? 0.605   -10.485 35.644  1.00 36.37 ? 275 SER A OG  1 
ATOM   1840  N  N   . SER A 1 262 ? 3.677   -12.329 32.579  1.00 25.39 ? 276 SER A N   1 
ATOM   1841  C  CA  . SER A 1 262 ? 4.683   -13.335 32.236  1.00 24.75 ? 276 SER A CA  1 
ATOM   1842  C  C   . SER A 1 262 ? 6.031   -12.710 31.889  1.00 25.52 ? 276 SER A C   1 
ATOM   1843  O  O   . SER A 1 262 ? 6.117   -11.849 31.018  1.00 19.03 ? 276 SER A O   1 
ATOM   1844  C  CB  . SER A 1 262 ? 4.209   -14.214 31.075  1.00 24.69 ? 276 SER A CB  1 
ATOM   1845  O  OG  . SER A 1 262 ? 5.269   -15.002 30.560  1.00 18.44 ? 276 SER A OG  1 
ATOM   1846  N  N   . GLU A 1 263 ? 7.086   -13.182 32.550  1.00 19.11 ? 277 GLU A N   1 
ATOM   1847  C  CA  . GLU A 1 263 ? 8.448   -12.734 32.266  1.00 21.79 ? 277 GLU A CA  1 
ATOM   1848  C  C   . GLU A 1 263 ? 8.880   -12.989 30.821  1.00 19.14 ? 277 GLU A C   1 
ATOM   1849  O  O   . GLU A 1 263 ? 9.853   -12.386 30.345  1.00 21.74 ? 277 GLU A O   1 
ATOM   1850  C  CB  . GLU A 1 263 ? 9.439   -13.442 33.201  1.00 22.69 ? 277 GLU A CB  1 
ATOM   1851  C  CG  . GLU A 1 263 ? 9.544   -14.936 32.950  1.00 26.37 ? 277 GLU A CG  1 
ATOM   1852  C  CD  . GLU A 1 263 ? 10.449  -15.632 33.960  1.00 36.15 ? 277 GLU A CD  1 
ATOM   1853  O  OE1 . GLU A 1 263 ? 10.064  -16.703 34.477  1.00 44.67 ? 277 GLU A OE1 1 
ATOM   1854  O  OE2 . GLU A 1 263 ? 11.546  -15.101 34.228  1.00 41.39 ? 277 GLU A OE2 1 
ATOM   1855  N  N   . HIS A 1 264 ? 8.175   -13.893 30.143  1.00 13.88 ? 278 HIS A N   1 
ATOM   1856  C  CA  . HIS A 1 264 ? 8.494   -14.274 28.761  1.00 15.71 ? 278 HIS A CA  1 
ATOM   1857  C  C   . HIS A 1 264 ? 7.765   -13.498 27.647  1.00 15.84 ? 278 HIS A C   1 
ATOM   1858  O  O   . HIS A 1 264 ? 7.984   -13.773 26.469  1.00 15.60 ? 278 HIS A O   1 
ATOM   1859  C  CB  . HIS A 1 264 ? 8.231   -15.763 28.574  1.00 19.26 ? 278 HIS A CB  1 
ATOM   1860  C  CG  . HIS A 1 264 ? 8.932   -16.614 29.582  1.00 25.71 ? 278 HIS A CG  1 
ATOM   1861  N  ND1 . HIS A 1 264 ? 10.305  -16.703 29.643  1.00 25.84 ? 278 HIS A ND1 1 
ATOM   1862  C  CD2 . HIS A 1 264 ? 8.456   -17.395 30.579  1.00 25.05 ? 278 HIS A CD2 1 
ATOM   1863  C  CE1 . HIS A 1 264 ? 10.647  -17.513 30.630  1.00 28.48 ? 278 HIS A CE1 1 
ATOM   1864  N  NE2 . HIS A 1 264 ? 9.545   -17.943 31.216  1.00 31.70 ? 278 HIS A NE2 1 
ATOM   1865  N  N   . LEU A 1 265 ? 6.892   -12.560 28.003  1.00 18.64 ? 279 LEU A N   1 
ATOM   1866  C  CA  . LEU A 1 265 ? 6.200   -11.764 26.974  1.00 15.97 ? 279 LEU A CA  1 
ATOM   1867  C  C   . LEU A 1 265 ? 7.203   -10.951 26.165  1.00 18.25 ? 279 LEU A C   1 
ATOM   1868  O  O   . LEU A 1 265 ? 8.007   -10.225 26.735  1.00 17.04 ? 279 LEU A O   1 
ATOM   1869  C  CB  . LEU A 1 265 ? 5.218   -10.793 27.613  1.00 13.84 ? 279 LEU A CB  1 
ATOM   1870  C  CG  . LEU A 1 265 ? 4.380   -9.969  26.633  1.00 15.46 ? 279 LEU A CG  1 
ATOM   1871  C  CD1 . LEU A 1 265 ? 3.404   -10.889 25.890  1.00 17.72 ? 279 LEU A CD1 1 
ATOM   1872  C  CD2 . LEU A 1 265 ? 3.643   -8.875  27.389  1.00 18.47 ? 279 LEU A CD2 1 
ATOM   1873  N  N   . CYS A 1 266 ? 7.169   -11.064 24.844  1.00 19.02 ? 280 CYS A N   1 
ATOM   1874  C  CA  . CYS A 1 266 ? 8.038   -10.207 24.035  1.00 20.61 ? 280 CYS A CA  1 
ATOM   1875  C  C   . CYS A 1 266 ? 7.272   -9.333  23.058  1.00 18.04 ? 280 CYS A C   1 
ATOM   1876  O  O   . CYS A 1 266 ? 7.870   -8.518  22.342  1.00 16.66 ? 280 CYS A O   1 
ATOM   1877  C  CB  . CYS A 1 266 ? 9.097   -11.028 23.297  1.00 17.29 ? 280 CYS A CB  1 
ATOM   1878  S  SG  . CYS A 1 266 ? 8.442   -12.210 22.107  1.00 21.75 ? 280 CYS A SG  1 
ATOM   1879  N  N   . GLY A 1 267 ? 5.954   -9.495  23.015  1.00 17.90 ? 281 GLY A N   1 
ATOM   1880  C  CA  . GLY A 1 267 ? 5.150   -8.623  22.168  1.00 23.18 ? 281 GLY A CA  1 
ATOM   1881  C  C   . GLY A 1 267 ? 3.646   -8.791  22.264  1.00 18.40 ? 281 GLY A C   1 
ATOM   1882  O  O   . GLY A 1 267 ? 3.148   -9.854  22.634  1.00 17.90 ? 281 GLY A O   1 
ATOM   1883  N  N   . ILE A 1 268 ? 2.924   -7.721  21.941  1.00 16.44 ? 282 ILE A N   1 
ATOM   1884  C  CA  . ILE A 1 268 ? 1.474   -7.753  21.861  1.00 17.80 ? 282 ILE A CA  1 
ATOM   1885  C  C   . ILE A 1 268 ? 1.051   -7.144  20.529  1.00 18.58 ? 282 ILE A C   1 
ATOM   1886  O  O   . ILE A 1 268 ? 1.423   -6.005  20.219  1.00 16.41 ? 282 ILE A O   1 
ATOM   1887  C  CB  . ILE A 1 268 ? 0.801   -6.915  22.958  1.00 20.30 ? 282 ILE A CB  1 
ATOM   1888  C  CG1 . ILE A 1 268 ? 1.170   -7.438  24.345  1.00 18.57 ? 282 ILE A CG1 1 
ATOM   1889  C  CG2 . ILE A 1 268 ? -0.730  -6.937  22.752  1.00 21.75 ? 282 ILE A CG2 1 
ATOM   1890  C  CD1 . ILE A 1 268 ? 0.408   -6.784  25.459  1.00 17.47 ? 282 ILE A CD1 1 
ATOM   1891  N  N   . ASN A 1 269 ? 0.329   -7.924  19.730  1.00 13.63 ? 283 ASN A N   1 
ATOM   1892  C  CA  . ASN A 1 269 ? -0.192  -7.465  18.456  1.00 16.22 ? 283 ASN A CA  1 
ATOM   1893  C  C   . ASN A 1 269 ? -1.687  -7.377  18.685  1.00 19.67 ? 283 ASN A C   1 
ATOM   1894  O  O   . ASN A 1 269 ? -2.349  -8.387  18.938  1.00 19.26 ? 283 ASN A O   1 
ATOM   1895  C  CB  . ASN A 1 269 ? 0.146   -8.446  17.317  1.00 15.93 ? 283 ASN A CB  1 
ATOM   1896  C  CG  . ASN A 1 269 ? 0.101   -7.787  15.938  1.00 19.57 ? 283 ASN A CG  1 
ATOM   1897  O  OD1 . ASN A 1 269 ? -0.003  -6.567  15.826  1.00 17.08 ? 283 ASN A OD1 1 
ATOM   1898  N  ND2 . ASN A 1 269 ? 0.197   -8.594  14.888  1.00 17.49 ? 283 ASN A ND2 1 
ATOM   1899  N  N   . PHE A 1 270 ? -2.211  -6.159  18.626  1.00 17.01 ? 284 PHE A N   1 
ATOM   1900  C  CA  . PHE A 1 270 ? -3.572  -5.910  19.064  1.00 14.72 ? 284 PHE A CA  1 
ATOM   1901  C  C   . PHE A 1 270 ? -4.383  -5.185  17.994  1.00 16.27 ? 284 PHE A C   1 
ATOM   1902  O  O   . PHE A 1 270 ? -3.852  -4.354  17.250  1.00 19.81 ? 284 PHE A O   1 
ATOM   1903  C  CB  . PHE A 1 270 ? -3.543  -5.080  20.362  1.00 13.60 ? 284 PHE A CB  1 
ATOM   1904  C  CG  . PHE A 1 270 ? -4.887  -4.601  20.792  1.00 16.63 ? 284 PHE A CG  1 
ATOM   1905  C  CD1 . PHE A 1 270 ? -5.359  -3.347  20.392  1.00 18.54 ? 284 PHE A CD1 1 
ATOM   1906  C  CD2 . PHE A 1 270 ? -5.696  -5.410  21.565  1.00 18.68 ? 284 PHE A CD2 1 
ATOM   1907  C  CE1 . PHE A 1 270 ? -6.620  -2.916  20.770  1.00 21.81 ? 284 PHE A CE1 1 
ATOM   1908  C  CE2 . PHE A 1 270 ? -6.966  -4.995  21.946  1.00 22.28 ? 284 PHE A CE2 1 
ATOM   1909  C  CZ  . PHE A 1 270 ? -7.430  -3.748  21.554  1.00 20.63 ? 284 PHE A CZ  1 
ATOM   1910  N  N   . THR A 1 271 ? -5.674  -5.488  17.921  1.00 20.10 ? 285 THR A N   1 
ATOM   1911  C  CA  . THR A 1 271 ? -6.588  -4.663  17.118  1.00 17.21 ? 285 THR A CA  1 
ATOM   1912  C  C   . THR A 1 271 ? -7.897  -4.524  17.891  1.00 19.04 ? 285 THR A C   1 
ATOM   1913  O  O   . THR A 1 271 ? -8.383  -5.494  18.471  1.00 19.99 ? 285 THR A O   1 
ATOM   1914  C  CB  . THR A 1 271 ? -6.784  -5.233  15.678  1.00 23.53 ? 285 THR A CB  1 
ATOM   1915  O  OG1 . THR A 1 271 ? -7.644  -4.373  14.921  1.00 28.67 ? 285 THR A OG1 1 
ATOM   1916  C  CG2 . THR A 1 271 ? -7.376  -6.645  15.710  1.00 20.40 ? 285 THR A CG2 1 
ATOM   1917  N  N   . GLY A 1 272 ? -8.462  -3.320  17.928  1.00 23.24 ? 286 GLY A N   1 
ATOM   1918  C  CA  . GLY A 1 272 ? -9.597  -3.044  18.800  1.00 20.20 ? 286 GLY A CA  1 
ATOM   1919  C  C   . GLY A 1 272 ? -9.641  -1.566  19.154  1.00 20.58 ? 286 GLY A C   1 
ATOM   1920  O  O   . GLY A 1 272 ? -9.080  -0.751  18.431  1.00 21.40 ? 286 GLY A O   1 
ATOM   1921  N  N   . SER A 1 273 ? -10.285 -1.210  20.264  1.00 25.85 ? 287 SER A N   1 
ATOM   1922  C  CA  . SER A 1 273 ? -10.397 0.210   20.640  1.00 32.36 ? 287 SER A CA  1 
ATOM   1923  C  C   . SER A 1 273 ? -9.110  0.807   21.199  1.00 30.22 ? 287 SER A C   1 
ATOM   1924  O  O   . SER A 1 273 ? -8.310  0.117   21.829  1.00 28.30 ? 287 SER A O   1 
ATOM   1925  C  CB  . SER A 1 273 ? -11.514 0.427   21.662  1.00 35.95 ? 287 SER A CB  1 
ATOM   1926  O  OG  . SER A 1 273 ? -11.105 0.002   22.950  1.00 39.95 ? 287 SER A OG  1 
ATOM   1927  N  N   . VAL A 1 274 ? -8.924  2.100   20.971  1.00 28.68 ? 288 VAL A N   1 
ATOM   1928  C  CA  . VAL A 1 274 ? -7.764  2.809   21.508  1.00 28.92 ? 288 VAL A CA  1 
ATOM   1929  C  C   . VAL A 1 274 ? -7.630  2.674   23.035  1.00 29.75 ? 288 VAL A C   1 
ATOM   1930  O  O   . VAL A 1 274 ? -6.531  2.387   23.526  1.00 27.76 ? 288 VAL A O   1 
ATOM   1931  C  CB  . VAL A 1 274 ? -7.748  4.308   21.089  1.00 33.12 ? 288 VAL A CB  1 
ATOM   1932  C  CG1 . VAL A 1 274 ? -6.630  5.045   21.808  1.00 36.19 ? 288 VAL A CG1 1 
ATOM   1933  C  CG2 . VAL A 1 274 ? -7.606  4.440   19.586  1.00 31.90 ? 288 VAL A CG2 1 
ATOM   1934  N  N   . PRO A 1 275 ? -8.737  2.865   23.789  1.00 33.70 ? 289 PRO A N   1 
ATOM   1935  C  CA  . PRO A 1 275 ? -8.631  2.716   25.246  1.00 32.09 ? 289 PRO A CA  1 
ATOM   1936  C  C   . PRO A 1 275 ? -8.186  1.335   25.696  1.00 29.53 ? 289 PRO A C   1 
ATOM   1937  O  O   . PRO A 1 275 ? -7.456  1.229   26.666  1.00 24.39 ? 289 PRO A O   1 
ATOM   1938  C  CB  . PRO A 1 275 ? -10.057 3.012   25.745  1.00 33.39 ? 289 PRO A CB  1 
ATOM   1939  C  CG  . PRO A 1 275 ? -10.920 2.983   24.549  1.00 39.45 ? 289 PRO A CG  1 
ATOM   1940  C  CD  . PRO A 1 275 ? -10.058 3.402   23.411  1.00 39.91 ? 289 PRO A CD  1 
ATOM   1941  N  N   . THR A 1 276 ? -8.609  0.286   25.006  1.00 27.99 ? 290 THR A N   1 
ATOM   1942  C  CA  . THR A 1 276 ? -8.137  -1.035  25.378  1.00 28.18 ? 290 THR A CA  1 
ATOM   1943  C  C   . THR A 1 276 ? -6.644  -1.177  25.078  1.00 26.28 ? 290 THR A C   1 
ATOM   1944  O  O   . THR A 1 276 ? -5.889  -1.667  25.915  1.00 23.35 ? 290 THR A O   1 
ATOM   1945  C  CB  . THR A 1 276 ? -8.955  -2.142  24.708  1.00 32.21 ? 290 THR A CB  1 
ATOM   1946  O  OG1 . THR A 1 276 ? -10.307 -2.049  25.171  1.00 27.18 ? 290 THR A OG1 1 
ATOM   1947  C  CG2 . THR A 1 276 ? -8.392  -3.501  25.063  1.00 31.62 ? 290 THR A CG2 1 
ATOM   1948  N  N   . PHE A 1 277 ? -6.219  -0.720  23.901  1.00 26.72 ? 291 PHE A N   1 
ATOM   1949  C  CA  . PHE A 1 277 ? -4.789  -0.704  23.580  1.00 24.32 ? 291 PHE A CA  1 
ATOM   1950  C  C   . PHE A 1 277 ? -3.976  0.070   24.618  1.00 23.67 ? 291 PHE A C   1 
ATOM   1951  O  O   . PHE A 1 277 ? -2.928  -0.400  25.070  1.00 18.94 ? 291 PHE A O   1 
ATOM   1952  C  CB  . PHE A 1 277 ? -4.541  -0.125  22.189  1.00 19.84 ? 291 PHE A CB  1 
ATOM   1953  C  CG  . PHE A 1 277 ? -3.104  -0.186  21.767  1.00 21.17 ? 291 PHE A CG  1 
ATOM   1954  C  CD1 . PHE A 1 277 ? -2.476  -1.416  21.595  1.00 21.49 ? 291 PHE A CD1 1 
ATOM   1955  C  CD2 . PHE A 1 277 ? -2.374  0.976   21.557  1.00 23.20 ? 291 PHE A CD2 1 
ATOM   1956  C  CE1 . PHE A 1 277 ? -1.149  -1.494  21.209  1.00 23.38 ? 291 PHE A CE1 1 
ATOM   1957  C  CE2 . PHE A 1 277 ? -1.034  0.915   21.169  1.00 25.80 ? 291 PHE A CE2 1 
ATOM   1958  C  CZ  . PHE A 1 277 ? -0.420  -0.324  20.994  1.00 26.38 ? 291 PHE A CZ  1 
ATOM   1959  N  N   . LYS A 1 278 ? -4.462  1.255   24.993  1.00 21.81 ? 292 LYS A N   1 
ATOM   1960  C  CA  . LYS A 1 278 ? -3.776  2.070   25.996  1.00 25.40 ? 292 LYS A CA  1 
ATOM   1961  C  C   . LYS A 1 278 ? -3.670  1.314   27.315  1.00 21.26 ? 292 LYS A C   1 
ATOM   1962  O  O   . LYS A 1 278 ? -2.647  1.367   27.992  1.00 24.10 ? 292 LYS A O   1 
ATOM   1963  C  CB  . LYS A 1 278 ? -4.482  3.421   26.197  1.00 29.30 ? 292 LYS A CB  1 
ATOM   1964  C  CG  . LYS A 1 278 ? -4.283  4.406   25.047  1.00 33.47 ? 292 LYS A CG  1 
ATOM   1965  C  CD  . LYS A 1 278 ? -4.803  5.812   25.388  1.00 33.95 ? 292 LYS A CD  1 
ATOM   1966  N  N   . HIS A 1 279 ? -4.728  0.587   27.670  1.00 23.24 ? 293 HIS A N   1 
ATOM   1967  C  CA  . HIS A 1 279 ? -4.714  -0.238  28.879  1.00 22.23 ? 293 HIS A CA  1 
ATOM   1968  C  C   . HIS A 1 279 ? -3.599  -1.279  28.840  1.00 16.46 ? 293 HIS A C   1 
ATOM   1969  O  O   . HIS A 1 279 ? -2.861  -1.448  29.813  1.00 17.92 ? 293 HIS A O   1 
ATOM   1970  C  CB  . HIS A 1 279 ? -6.071  -0.934  29.084  1.00 24.95 ? 293 HIS A CB  1 
ATOM   1971  C  CG  . HIS A 1 279 ? -6.118  -1.807  30.299  1.00 26.54 ? 293 HIS A CG  1 
ATOM   1972  N  ND1 . HIS A 1 279 ? -6.258  -1.303  31.577  1.00 34.49 ? 293 HIS A ND1 1 
ATOM   1973  C  CD2 . HIS A 1 279 ? -6.037  -3.152  30.436  1.00 30.58 ? 293 HIS A CD2 1 
ATOM   1974  C  CE1 . HIS A 1 279 ? -6.266  -2.297  32.443  1.00 30.98 ? 293 HIS A CE1 1 
ATOM   1975  N  NE2 . HIS A 1 279 ? -6.127  -3.431  31.778  1.00 30.23 ? 293 HIS A NE2 1 
ATOM   1976  N  N   . LEU A 1 280 ? -3.450  -1.959  27.709  1.00 17.11 ? 294 LEU A N   1 
ATOM   1977  C  CA  . LEU A 1 280 ? -2.416  -2.985  27.605  1.00 16.19 ? 294 LEU A CA  1 
ATOM   1978  C  C   . LEU A 1 280 ? -1.010  -2.362  27.617  1.00 19.38 ? 294 LEU A C   1 
ATOM   1979  O  O   . LEU A 1 280 ? -0.064  -2.922  28.186  1.00 21.12 ? 294 LEU A O   1 
ATOM   1980  C  CB  . LEU A 1 280 ? -2.601  -3.803  26.321  1.00 14.69 ? 294 LEU A CB  1 
ATOM   1981  C  CG  . LEU A 1 280 ? -3.759  -4.808  26.350  1.00 19.35 ? 294 LEU A CG  1 
ATOM   1982  C  CD1 . LEU A 1 280 ? -4.120  -5.213  24.935  1.00 21.03 ? 294 LEU A CD1 1 
ATOM   1983  C  CD2 . LEU A 1 280 ? -3.401  -6.023  27.200  1.00 16.43 ? 294 LEU A CD2 1 
ATOM   1984  N  N   . TRP A 1 281 ? -0.890  -1.228  26.945  1.00 23.96 ? 295 TRP A N   1 
ATOM   1985  C  CA  . TRP A 1 281 ? 0.354   -0.474  26.888  1.00 20.71 ? 295 TRP A CA  1 
ATOM   1986  C  C   . TRP A 1 281 ? 0.793   -0.116  28.307  1.00 24.14 ? 295 TRP A C   1 
ATOM   1987  O  O   . TRP A 1 281 ? 1.950   -0.320  28.684  1.00 18.68 ? 295 TRP A O   1 
ATOM   1988  C  CB  . TRP A 1 281 ? 0.125   0.796   26.071  1.00 25.42 ? 295 TRP A CB  1 
ATOM   1989  C  CG  . TRP A 1 281 ? 1.294   1.240   25.256  1.00 33.74 ? 295 TRP A CG  1 
ATOM   1990  C  CD1 . TRP A 1 281 ? 1.550   0.931   23.951  1.00 36.13 ? 295 TRP A CD1 1 
ATOM   1991  C  CD2 . TRP A 1 281 ? 2.362   2.088   25.684  1.00 35.30 ? 295 TRP A CD2 1 
ATOM   1992  N  NE1 . TRP A 1 281 ? 2.716   1.526   23.544  1.00 40.89 ? 295 TRP A NE1 1 
ATOM   1993  C  CE2 . TRP A 1 281 ? 3.234   2.243   24.589  1.00 41.66 ? 295 TRP A CE2 1 
ATOM   1994  C  CE3 . TRP A 1 281 ? 2.672   2.720   26.889  1.00 28.99 ? 295 TRP A CE3 1 
ATOM   1995  C  CZ2 . TRP A 1 281 ? 4.390   3.013   24.664  1.00 41.22 ? 295 TRP A CZ2 1 
ATOM   1996  C  CZ3 . TRP A 1 281 ? 3.817   3.475   26.962  1.00 37.25 ? 295 TRP A CZ3 1 
ATOM   1997  C  CH2 . TRP A 1 281 ? 4.667   3.617   25.858  1.00 40.52 ? 295 TRP A CH2 1 
ATOM   1998  N  N   . LYS A 1 282 ? -0.143  0.416   29.094  1.00 25.87 ? 296 LYS A N   1 
ATOM   1999  C  CA  . LYS A 1 282 ? 0.122   0.762   30.494  1.00 21.50 ? 296 LYS A CA  1 
ATOM   2000  C  C   . LYS A 1 282 ? 0.484   -0.463  31.320  1.00 22.78 ? 296 LYS A C   1 
ATOM   2001  O  O   . LYS A 1 282 ? 1.364   -0.422  32.186  1.00 18.82 ? 296 LYS A O   1 
ATOM   2002  C  CB  . LYS A 1 282 ? -1.099  1.451   31.109  1.00 23.24 ? 296 LYS A CB  1 
ATOM   2003  C  CG  . LYS A 1 282 ? -1.336  2.864   30.613  1.00 21.54 ? 296 LYS A CG  1 
ATOM   2004  C  CD  . LYS A 1 282 ? -2.644  3.402   31.181  1.00 28.08 ? 296 LYS A CD  1 
ATOM   2005  C  CE  . LYS A 1 282 ? -2.893  4.839   30.780  1.00 29.04 ? 296 LYS A CE  1 
ATOM   2006  N  NZ  . LYS A 1 282 ? -2.098  5.767   31.635  1.00 39.85 ? 296 LYS A NZ  1 
ATOM   2007  N  N   . GLN A 1 283 ? -0.198  -1.566  31.049  1.00 16.58 ? 297 GLN A N   1 
ATOM   2008  C  CA  . GLN A 1 283 ? 0.045   -2.790  31.798  1.00 18.48 ? 297 GLN A CA  1 
ATOM   2009  C  C   . GLN A 1 283 ? 1.458   -3.332  31.568  1.00 18.86 ? 297 GLN A C   1 
ATOM   2010  O  O   . GLN A 1 283 ? 2.147   -3.739  32.507  1.00 20.88 ? 297 GLN A O   1 
ATOM   2011  C  CB  . GLN A 1 283 ? -1.017  -3.831  31.404  1.00 22.73 ? 297 GLN A CB  1 
ATOM   2012  C  CG  . GLN A 1 283 ? -1.214  -4.949  32.381  1.00 28.64 ? 297 GLN A CG  1 
ATOM   2013  C  CD  . GLN A 1 283 ? -2.573  -5.635  32.203  1.00 28.53 ? 297 GLN A CD  1 
ATOM   2014  O  OE1 . GLN A 1 283 ? -3.153  -5.630  31.118  1.00 21.57 ? 297 GLN A OE1 1 
ATOM   2015  N  NE2 . GLN A 1 283 ? -3.089  -6.198  33.280  1.00 29.23 ? 297 GLN A NE2 1 
ATOM   2016  N  N   . VAL A 1 284 ? 1.897   -3.326  30.312  1.00 20.88 ? 298 VAL A N   1 
ATOM   2017  C  CA  . VAL A 1 284 ? 3.257   -3.743  29.990  1.00 20.16 ? 298 VAL A CA  1 
ATOM   2018  C  C   . VAL A 1 284 ? 4.281   -2.835  30.690  1.00 16.43 ? 298 VAL A C   1 
ATOM   2019  O  O   . VAL A 1 284 ? 5.232   -3.318  31.297  1.00 17.38 ? 298 VAL A O   1 
ATOM   2020  C  CB  . VAL A 1 284 ? 3.487   -3.756  28.461  1.00 21.97 ? 298 VAL A CB  1 
ATOM   2021  C  CG1 . VAL A 1 284 ? 4.988   -3.874  28.126  1.00 20.15 ? 298 VAL A CG1 1 
ATOM   2022  C  CG2 . VAL A 1 284 ? 2.686   -4.892  27.823  1.00 22.04 ? 298 VAL A CG2 1 
ATOM   2023  N  N   . ALA A 1 285 ? 4.047   -1.524  30.652  1.00 15.67 ? 299 ALA A N   1 
ATOM   2024  C  CA  . ALA A 1 285 ? 4.975   -0.586  31.283  1.00 20.12 ? 299 ALA A CA  1 
ATOM   2025  C  C   . ALA A 1 285 ? 5.069   -0.763  32.800  1.00 19.91 ? 299 ALA A C   1 
ATOM   2026  O  O   . ALA A 1 285 ? 6.157   -0.671  33.376  1.00 20.45 ? 299 ALA A O   1 
ATOM   2027  C  CB  . ALA A 1 285 ? 4.588   0.836   30.957  1.00 17.68 ? 299 ALA A CB  1 
ATOM   2028  N  N   . GLN A 1 286 ? 3.932   -1.007  33.442  1.00 21.47 ? 300 GLN A N   1 
ATOM   2029  C  CA  . GLN A 1 286 ? 3.901   -1.229  34.884  1.00 25.04 ? 300 GLN A CA  1 
ATOM   2030  C  C   . GLN A 1 286 ? 4.672   -2.480  35.260  1.00 21.12 ? 300 GLN A C   1 
ATOM   2031  O  O   . GLN A 1 286 ? 5.147   -2.604  36.374  1.00 20.20 ? 300 GLN A O   1 
ATOM   2032  C  CB  . GLN A 1 286 ? 2.461   -1.352  35.379  1.00 27.59 ? 300 GLN A CB  1 
ATOM   2033  C  CG  . GLN A 1 286 ? 1.704   -0.019  35.352  1.00 36.95 ? 300 GLN A CG  1 
ATOM   2034  C  CD  . GLN A 1 286 ? 0.228   -0.167  35.694  1.00 44.77 ? 300 GLN A CD  1 
ATOM   2035  O  OE1 . GLN A 1 286 ? -0.205  -1.200  36.214  1.00 41.42 ? 300 GLN A OE1 1 
ATOM   2036  N  NE2 . GLN A 1 286 ? -0.553  0.869   35.393  1.00 52.34 ? 300 GLN A NE2 1 
ATOM   2037  N  N   . ASN A 1 287 ? 4.777   -3.400  34.310  1.00 24.67 ? 301 ASN A N   1 
ATOM   2038  C  CA  . ASN A 1 287 ? 5.381   -4.698  34.537  1.00 23.09 ? 301 ASN A CA  1 
ATOM   2039  C  C   . ASN A 1 287 ? 6.771   -4.828  33.938  1.00 19.91 ? 301 ASN A C   1 
ATOM   2040  O  O   . ASN A 1 287 ? 7.334   -5.926  33.932  1.00 19.33 ? 301 ASN A O   1 
ATOM   2041  C  CB  . ASN A 1 287 ? 4.496   -5.799  33.923  1.00 20.99 ? 301 ASN A CB  1 
ATOM   2042  C  CG  . ASN A 1 287 ? 3.284   -6.122  34.772  1.00 30.46 ? 301 ASN A CG  1 
ATOM   2043  O  OD1 . ASN A 1 287 ? 3.379   -6.896  35.705  1.00 39.63 ? 301 ASN A OD1 1 
ATOM   2044  N  ND2 . ASN A 1 287 ? 2.135   -5.548  34.432  1.00 35.24 ? 301 ASN A ND2 1 
ATOM   2045  N  N   . LEU A 1 288 ? 7.311   -3.722  33.417  1.00 22.27 ? 302 LEU A N   1 
ATOM   2046  C  CA  . LEU A 1 288 ? 8.539   -3.760  32.626  1.00 17.36 ? 302 LEU A CA  1 
ATOM   2047  C  C   . LEU A 1 288 ? 9.691   -4.497  33.288  1.00 24.80 ? 302 LEU A C   1 
ATOM   2048  O  O   . LEU A 1 288 ? 10.476  -5.154  32.618  1.00 24.05 ? 302 LEU A O   1 
ATOM   2049  C  CB  . LEU A 1 288 ? 9.023   -2.338  32.299  1.00 22.26 ? 302 LEU A CB  1 
ATOM   2050  C  CG  . LEU A 1 288 ? 8.785   -1.754  30.916  1.00 30.46 ? 302 LEU A CG  1 
ATOM   2051  C  CD1 . LEU A 1 288 ? 9.602   -0.460  30.792  1.00 24.00 ? 302 LEU A CD1 1 
ATOM   2052  C  CD2 . LEU A 1 288 ? 9.071   -2.741  29.768  1.00 21.74 ? 302 LEU A CD2 1 
ATOM   2053  N  N   . ASP A 1 289 ? 9.805   -4.374  34.602  1.00 27.94 ? 303 ASP A N   1 
ATOM   2054  C  CA  . ASP A 1 289 ? 10.966  -4.909  35.290  1.00 24.90 ? 303 ASP A CA  1 
ATOM   2055  C  C   . ASP A 1 289 ? 11.087  -6.436  35.234  1.00 22.57 ? 303 ASP A C   1 
ATOM   2056  O  O   . ASP A 1 289 ? 12.175  -6.968  35.385  1.00 23.90 ? 303 ASP A O   1 
ATOM   2057  C  CB  . ASP A 1 289 ? 10.988  -4.424  36.737  1.00 30.09 ? 303 ASP A CB  1 
ATOM   2058  C  CG  . ASP A 1 289 ? 11.223  -2.933  36.838  1.00 38.47 ? 303 ASP A CG  1 
ATOM   2059  O  OD1 . ASP A 1 289 ? 12.225  -2.452  36.268  1.00 41.03 ? 303 ASP A OD1 1 
ATOM   2060  O  OD2 . ASP A 1 289 ? 10.398  -2.241  37.464  1.00 37.45 ? 303 ASP A OD2 1 
ATOM   2061  N  N   . ARG A 1 290 ? 9.976   -7.135  35.004  1.00 21.67 ? 304 ARG A N   1 
ATOM   2062  C  CA  . ARG A 1 290 ? 10.002  -8.599  34.999  1.00 25.20 ? 304 ARG A CA  1 
ATOM   2063  C  C   . ARG A 1 290 ? 10.477  -9.207  33.676  1.00 22.98 ? 304 ARG A C   1 
ATOM   2064  O  O   . ARG A 1 290 ? 10.929  -10.348 33.659  1.00 20.58 ? 304 ARG A O   1 
ATOM   2065  C  CB  . ARG A 1 290 ? 8.618   -9.165  35.356  1.00 25.44 ? 304 ARG A CB  1 
ATOM   2066  C  CG  . ARG A 1 290 ? 7.632   -9.141  34.191  1.00 23.84 ? 304 ARG A CG  1 
ATOM   2067  C  CD  . ARG A 1 290 ? 6.301   -9.774  34.550  1.00 29.14 ? 304 ARG A CD  1 
ATOM   2068  N  NE  . ARG A 1 290 ? 5.551   -8.923  35.464  1.00 33.68 ? 304 ARG A NE  1 
ATOM   2069  C  CZ  . ARG A 1 290 ? 5.402   -9.150  36.762  1.00 33.87 ? 304 ARG A CZ  1 
ATOM   2070  N  NH1 . ARG A 1 290 ? 5.956   -10.223 37.334  1.00 35.35 ? 304 ARG A NH1 1 
ATOM   2071  N  NH2 . ARG A 1 290 ? 4.703   -8.292  37.493  1.00 28.78 ? 304 ARG A NH2 1 
ATOM   2072  N  N   . PHE A 1 291 ? 10.366  -8.465  32.567  1.00 22.72 ? 305 PHE A N   1 
ATOM   2073  C  CA  . PHE A 1 291 ? 10.560  -9.070  31.235  1.00 18.30 ? 305 PHE A CA  1 
ATOM   2074  C  C   . PHE A 1 291 ? 12.026  -9.271  30.879  1.00 24.05 ? 305 PHE A C   1 
ATOM   2075  O  O   . PHE A 1 291 ? 12.860  -8.418  31.163  1.00 22.90 ? 305 PHE A O   1 
ATOM   2076  C  CB  . PHE A 1 291 ? 9.911   -8.212  30.142  1.00 18.50 ? 305 PHE A CB  1 
ATOM   2077  C  CG  . PHE A 1 291 ? 8.457   -7.925  30.378  1.00 19.30 ? 305 PHE A CG  1 
ATOM   2078  C  CD1 . PHE A 1 291 ? 7.523   -8.960  30.390  1.00 14.30 ? 305 PHE A CD1 1 
ATOM   2079  C  CD2 . PHE A 1 291 ? 8.020   -6.621  30.574  1.00 14.76 ? 305 PHE A CD2 1 
ATOM   2080  C  CE1 . PHE A 1 291 ? 6.179   -8.694  30.612  1.00 15.26 ? 305 PHE A CE1 1 
ATOM   2081  C  CE2 . PHE A 1 291 ? 6.689   -6.344  30.775  1.00 17.22 ? 305 PHE A CE2 1 
ATOM   2082  C  CZ  . PHE A 1 291 ? 5.757   -7.395  30.792  1.00 16.98 ? 305 PHE A CZ  1 
ATOM   2083  N  N   . HIS A 1 292 ? 12.331  -10.384 30.225  1.00 21.53 ? 306 HIS A N   1 
ATOM   2084  C  CA  . HIS A 1 292 ? 13.695  -10.653 29.779  1.00 26.35 ? 306 HIS A CA  1 
ATOM   2085  C  C   . HIS A 1 292 ? 14.062  -9.831  28.549  1.00 28.89 ? 306 HIS A C   1 
ATOM   2086  O  O   . HIS A 1 292 ? 15.235  -9.571  28.292  1.00 24.56 ? 306 HIS A O   1 
ATOM   2087  C  CB  . HIS A 1 292 ? 13.893  -12.146 29.519  1.00 28.73 ? 306 HIS A CB  1 
ATOM   2088  C  CG  . HIS A 1 292 ? 13.698  -12.985 30.744  1.00 41.95 ? 306 HIS A CG  1 
ATOM   2089  N  ND1 . HIS A 1 292 ? 14.454  -12.817 31.884  1.00 42.55 ? 306 HIS A ND1 1 
ATOM   2090  C  CD2 . HIS A 1 292 ? 12.816  -13.975 31.015  1.00 40.82 ? 306 HIS A CD2 1 
ATOM   2091  C  CE1 . HIS A 1 292 ? 14.051  -13.677 32.805  1.00 44.12 ? 306 HIS A CE1 1 
ATOM   2092  N  NE2 . HIS A 1 292 ? 13.060  -14.389 32.303  1.00 42.88 ? 306 HIS A NE2 1 
ATOM   2093  N  N   . THR A 1 293 ? 13.063  -9.434  27.771  1.00 21.91 ? 307 THR A N   1 
ATOM   2094  C  CA  . THR A 1 293 ? 13.323  -8.490  26.692  1.00 25.85 ? 307 THR A CA  1 
ATOM   2095  C  C   . THR A 1 293 ? 12.204  -7.462  26.660  1.00 29.75 ? 307 THR A C   1 
ATOM   2096  O  O   . THR A 1 293 ? 11.092  -7.752  27.116  1.00 32.89 ? 307 THR A O   1 
ATOM   2097  C  CB  . THR A 1 293 ? 13.479  -9.198  25.321  1.00 37.05 ? 307 THR A CB  1 
ATOM   2098  O  OG1 . THR A 1 293 ? 14.059  -8.290  24.376  1.00 41.94 ? 307 THR A OG1 1 
ATOM   2099  C  CG2 . THR A 1 293 ? 12.141  -9.687  24.793  1.00 23.25 ? 307 THR A CG2 1 
ATOM   2100  N  N   . PHE A 1 294 ? 12.505  -6.271  26.146  1.00 23.03 ? 308 PHE A N   1 
ATOM   2101  C  CA  . PHE A 1 294 ? 11.510  -5.205  26.018  1.00 25.07 ? 308 PHE A CA  1 
ATOM   2102  C  C   . PHE A 1 294 ? 10.384  -5.630  25.085  1.00 21.93 ? 308 PHE A C   1 
ATOM   2103  O  O   . PHE A 1 294 ? 10.620  -5.808  23.889  1.00 23.46 ? 308 PHE A O   1 
ATOM   2104  C  CB  . PHE A 1 294 ? 12.142  -3.955  25.414  1.00 28.78 ? 308 PHE A CB  1 
ATOM   2105  C  CG  . PHE A 1 294 ? 13.134  -3.268  26.309  1.00 34.29 ? 308 PHE A CG  1 
ATOM   2106  C  CD1 . PHE A 1 294 ? 14.292  -2.721  25.779  1.00 39.12 ? 308 PHE A CD1 1 
ATOM   2107  C  CD2 . PHE A 1 294 ? 12.899  -3.147  27.665  1.00 37.47 ? 308 PHE A CD2 1 
ATOM   2108  C  CE1 . PHE A 1 294 ? 15.214  -2.072  26.593  1.00 43.50 ? 308 PHE A CE1 1 
ATOM   2109  C  CE2 . PHE A 1 294 ? 13.819  -2.503  28.488  1.00 42.94 ? 308 PHE A CE2 1 
ATOM   2110  C  CZ  . PHE A 1 294 ? 14.971  -1.965  27.950  1.00 41.15 ? 308 PHE A CZ  1 
ATOM   2111  N  N   . PRO A 1 295 ? 9.160   -5.775  25.617  1.00 20.36 ? 309 PRO A N   1 
ATOM   2112  C  CA  . PRO A 1 295 ? 8.050   -6.149  24.725  1.00 18.94 ? 309 PRO A CA  1 
ATOM   2113  C  C   . PRO A 1 295 ? 7.751   -5.083  23.670  1.00 19.71 ? 309 PRO A C   1 
ATOM   2114  O  O   . PRO A 1 295 ? 7.797   -3.903  23.968  1.00 19.61 ? 309 PRO A O   1 
ATOM   2115  C  CB  . PRO A 1 295 ? 6.857   -6.269  25.679  1.00 19.45 ? 309 PRO A CB  1 
ATOM   2116  C  CG  . PRO A 1 295 ? 7.462   -6.598  27.022  1.00 17.32 ? 309 PRO A CG  1 
ATOM   2117  C  CD  . PRO A 1 295 ? 8.742   -5.749  27.033  1.00 20.68 ? 309 PRO A CD  1 
ATOM   2118  N  N   . ARG A 1 296 ? 7.434   -5.507  22.455  1.00 20.69 ? 310 ARG A N   1 
ATOM   2119  C  CA  . ARG A 1 296 ? 7.039   -4.566  21.429  1.00 19.34 ? 310 ARG A CA  1 
ATOM   2120  C  C   . ARG A 1 296 ? 5.529   -4.585  21.267  1.00 21.17 ? 310 ARG A C   1 
ATOM   2121  O  O   . ARG A 1 296 ? 4.918   -5.645  21.185  1.00 17.09 ? 310 ARG A O   1 
ATOM   2122  C  CB  . ARG A 1 296 ? 7.730   -4.908  20.115  1.00 19.49 ? 310 ARG A CB  1 
ATOM   2123  C  CG  . ARG A 1 296 ? 9.246   -4.953  20.243  1.00 26.61 ? 310 ARG A CG  1 
ATOM   2124  C  CD  . ARG A 1 296 ? 9.868   -5.289  18.917  1.00 23.15 ? 310 ARG A CD  1 
ATOM   2125  N  NE  . ARG A 1 296 ? 11.322  -5.191  18.947  1.00 25.74 ? 310 ARG A NE  1 
ATOM   2126  C  CZ  . ARG A 1 296 ? 12.079  -5.227  17.858  1.00 28.85 ? 310 ARG A CZ  1 
ATOM   2127  N  NH1 . ARG A 1 296 ? 11.497  -5.340  16.672  1.00 20.93 ? 310 ARG A NH1 1 
ATOM   2128  N  NH2 . ARG A 1 296 ? 13.408  -5.128  17.949  1.00 27.47 ? 310 ARG A NH2 1 
ATOM   2129  N  N   . LEU A 1 297 ? 4.909   -3.417  21.224  1.00 15.07 ? 311 LEU A N   1 
ATOM   2130  C  CA  . LEU A 1 297 ? 3.455   -3.415  21.064  1.00 18.16 ? 311 LEU A CA  1 
ATOM   2131  C  C   . LEU A 1 297 ? 3.021   -2.809  19.747  1.00 21.58 ? 311 LEU A C   1 
ATOM   2132  O  O   . LEU A 1 297 ? 3.605   -1.830  19.282  1.00 17.76 ? 311 LEU A O   1 
ATOM   2133  C  CB  . LEU A 1 297 ? 2.782   -2.692  22.220  1.00 23.09 ? 311 LEU A CB  1 
ATOM   2134  C  CG  . LEU A 1 297 ? 2.756   -3.440  23.555  1.00 31.40 ? 311 LEU A CG  1 
ATOM   2135  C  CD1 . LEU A 1 297 ? 3.998   -3.131  24.357  1.00 33.48 ? 311 LEU A CD1 1 
ATOM   2136  C  CD2 . LEU A 1 297 ? 1.509   -3.068  24.342  1.00 36.77 ? 311 LEU A CD2 1 
ATOM   2137  N  N   . ALA A 1 298 ? 1.993   -3.398  19.147  1.00 14.64 ? 312 ALA A N   1 
ATOM   2138  C  CA  . ALA A 1 298 ? 1.409   -2.862  17.926  1.00 22.06 ? 312 ALA A CA  1 
ATOM   2139  C  C   . ALA A 1 298 ? -0.107  -2.814  18.091  1.00 17.44 ? 312 ALA A C   1 
ATOM   2140  O  O   . ALA A 1 298 ? -0.698  -3.742  18.622  1.00 17.69 ? 312 ALA A O   1 
ATOM   2141  C  CB  . ALA A 1 298 ? 1.801   -3.723  16.726  1.00 22.27 ? 312 ALA A CB  1 
ATOM   2142  N  N   . GLY A 1 299 ? -0.728  -1.726  17.664  1.00 17.65 ? 313 GLY A N   1 
ATOM   2143  C  CA  . GLY A 1 299 ? -2.155  -1.582  17.826  1.00 22.64 ? 313 GLY A CA  1 
ATOM   2144  C  C   . GLY A 1 299 ? -2.809  -0.985  16.602  1.00 25.36 ? 313 GLY A C   1 
ATOM   2145  O  O   . GLY A 1 299 ? -2.471  0.116   16.185  1.00 28.58 ? 313 GLY A O   1 
ATOM   2146  N  N   . GLU A 1 300 ? -3.746  -1.716  16.015  1.00 19.80 ? 314 GLU A N   1 
ATOM   2147  C  CA  . GLU A 1 300 ? -4.482  -1.206  14.864  1.00 24.20 ? 314 GLU A CA  1 
ATOM   2148  C  C   . GLU A 1 300 ? -5.880  -0.856  15.346  1.00 27.50 ? 314 GLU A C   1 
ATOM   2149  O  O   . GLU A 1 300 ? -6.685  -1.742  15.656  1.00 25.17 ? 314 GLU A O   1 
ATOM   2150  C  CB  . GLU A 1 300 ? -4.507  -2.241  13.744  1.00 30.69 ? 314 GLU A CB  1 
ATOM   2151  C  CG  . GLU A 1 300 ? -5.490  -1.949  12.633  1.00 42.84 ? 314 GLU A CG  1 
ATOM   2152  C  CD  . GLU A 1 300 ? -5.312  -2.880  11.443  1.00 55.19 ? 314 GLU A CD  1 
ATOM   2153  O  OE1 . GLU A 1 300 ? -4.478  -3.811  11.525  1.00 51.08 ? 314 GLU A OE1 1 
ATOM   2154  O  OE2 . GLU A 1 300 ? -6.005  -2.676  10.421  1.00 65.37 ? 314 GLU A OE2 1 
ATOM   2155  N  N   . CYS A 1 301 ? -6.152  0.444   15.447  1.00 24.63 ? 315 CYS A N   1 
ATOM   2156  C  CA  . CYS A 1 301 ? -7.382  0.915   16.084  1.00 30.04 ? 315 CYS A CA  1 
ATOM   2157  C  C   . CYS A 1 301 ? -8.256  1.742   15.148  1.00 30.01 ? 315 CYS A C   1 
ATOM   2158  O  O   . CYS A 1 301 ? -7.854  2.055   14.032  1.00 28.26 ? 315 CYS A O   1 
ATOM   2159  C  CB  . CYS A 1 301 ? -7.044  1.730   17.331  1.00 29.07 ? 315 CYS A CB  1 
ATOM   2160  S  SG  . CYS A 1 301 ? -6.041  0.830   18.548  1.00 32.45 ? 315 CYS A SG  1 
ATOM   2161  N  N   . GLY A 1 302 ? -9.451  2.086   15.617  1.00 30.95 ? 316 GLY A N   1 
ATOM   2162  C  CA  . GLY A 1 302 ? -10.391 2.886   14.842  1.00 29.16 ? 316 GLY A CA  1 
ATOM   2163  C  C   . GLY A 1 302 ? -10.243 4.374   15.108  1.00 30.70 ? 316 GLY A C   1 
ATOM   2164  O  O   . GLY A 1 302 ? -9.514  4.788   16.008  1.00 34.61 ? 316 GLY A O   1 
ATOM   2165  N  N   . GLY A 1 303 ? -10.925 5.190   14.310  1.00 24.40 ? 317 GLY A N   1 
ATOM   2166  C  CA  . GLY A 1 303 ? -10.851 6.629   14.477  1.00 25.72 ? 317 GLY A CA  1 
ATOM   2167  C  C   . GLY A 1 303 ? -12.199 7.245   14.190  1.00 28.56 ? 317 GLY A C   1 
ATOM   2168  O  O   . GLY A 1 303 ? -13.152 6.525   13.854  1.00 28.92 ? 317 GLY A O   1 
ATOM   2169  N  N   . LYS A 1 304 ? -12.290 8.560   14.357  1.00 30.55 ? 318 LYS A N   1 
ATOM   2170  C  CA  . LYS A 1 304 ? -13.489 9.303   13.983  1.00 30.38 ? 318 LYS A CA  1 
ATOM   2171  C  C   . LYS A 1 304 ? -13.188 9.909   12.626  1.00 29.75 ? 318 LYS A C   1 
ATOM   2172  O  O   . LYS A 1 304 ? -12.698 11.038  12.532  1.00 34.35 ? 318 LYS A O   1 
ATOM   2173  C  CB  . LYS A 1 304 ? -13.793 10.402  15.005  1.00 31.22 ? 318 LYS A CB  1 
ATOM   2174  C  CG  . LYS A 1 304 ? -15.166 11.079  14.834  1.00 33.30 ? 318 LYS A CG  1 
ATOM   2175  C  CD  . LYS A 1 304 ? -16.302 10.155  15.312  1.00 26.51 ? 318 LYS A CD  1 
ATOM   2176  C  CE  . LYS A 1 304 ? -17.693 10.714  15.004  1.00 23.50 ? 318 LYS A CE  1 
ATOM   2177  N  NZ  . LYS A 1 304 ? -18.746 9.923   15.714  1.00 23.14 ? 318 LYS A NZ  1 
ATOM   2178  N  N   . ASN A 1 305 ? -13.450 9.139   11.575  1.00 25.71 ? 319 ASN A N   1 
ATOM   2179  C  CA  . ASN A 1 305 ? -13.006 9.493   10.232  1.00 23.40 ? 319 ASN A CA  1 
ATOM   2180  C  C   . ASN A 1 305 ? -13.941 10.499  9.535   1.00 23.15 ? 319 ASN A C   1 
ATOM   2181  O  O   . ASN A 1 305 ? -15.132 10.521  9.815   1.00 28.22 ? 319 ASN A O   1 
ATOM   2182  C  CB  . ASN A 1 305 ? -12.841 8.205   9.412   1.00 20.51 ? 319 ASN A CB  1 
ATOM   2183  C  CG  . ASN A 1 305 ? -12.024 7.147   10.157  1.00 22.36 ? 319 ASN A CG  1 
ATOM   2184  O  OD1 . ASN A 1 305 ? -10.846 7.358   10.458  1.00 21.62 ? 319 ASN A OD1 1 
ATOM   2185  N  ND2 . ASN A 1 305 ? -12.651 6.024   10.474  1.00 19.07 ? 319 ASN A ND2 1 
ATOM   2186  N  N   . PHE A 1 306 ? -13.399 11.332  8.645   1.00 22.53 ? 320 PHE A N   1 
ATOM   2187  C  CA  . PHE A 1 306 ? -14.175 12.421  8.044   1.00 21.65 ? 320 PHE A CA  1 
ATOM   2188  C  C   . PHE A 1 306 ? -14.240 12.377  6.529   1.00 23.57 ? 320 PHE A C   1 
ATOM   2189  O  O   . PHE A 1 306 ? -13.340 11.858  5.878   1.00 24.58 ? 320 PHE A O   1 
ATOM   2190  C  CB  . PHE A 1 306 ? -13.578 13.778  8.439   1.00 27.36 ? 320 PHE A CB  1 
ATOM   2191  C  CG  . PHE A 1 306 ? -12.169 14.001  7.919   1.00 28.58 ? 320 PHE A CG  1 
ATOM   2192  C  CD1 . PHE A 1 306 ? -11.950 14.564  6.670   1.00 30.92 ? 320 PHE A CD1 1 
ATOM   2193  C  CD2 . PHE A 1 306 ? -11.064 13.635  8.684   1.00 34.12 ? 320 PHE A CD2 1 
ATOM   2194  C  CE1 . PHE A 1 306 ? -10.659 14.771  6.193   1.00 33.77 ? 320 PHE A CE1 1 
ATOM   2195  C  CE2 . PHE A 1 306 ? -9.765  13.842  8.214   1.00 26.84 ? 320 PHE A CE2 1 
ATOM   2196  C  CZ  . PHE A 1 306 ? -9.561  14.404  6.968   1.00 25.30 ? 320 PHE A CZ  1 
ATOM   2197  N  N   . HIS A 1 307 ? -15.319 12.938  5.978   1.00 26.84 ? 321 HIS A N   1 
ATOM   2198  C  CA  . HIS A 1 307 ? -15.339 13.423  4.599   1.00 27.09 ? 321 HIS A CA  1 
ATOM   2199  C  C   . HIS A 1 307 ? -15.517 14.940  4.610   1.00 31.39 ? 321 HIS A C   1 
ATOM   2200  O  O   . HIS A 1 307 ? -16.488 15.444  5.171   1.00 29.52 ? 321 HIS A O   1 
ATOM   2201  C  CB  . HIS A 1 307 ? -16.487 12.806  3.797   1.00 23.80 ? 321 HIS A CB  1 
ATOM   2202  C  CG  . HIS A 1 307 ? -16.285 11.359  3.459   1.00 23.98 ? 321 HIS A CG  1 
ATOM   2203  N  ND1 . HIS A 1 307 ? -17.214 10.631  2.741   1.00 25.10 ? 321 HIS A ND1 1 
ATOM   2204  C  CD2 . HIS A 1 307 ? -15.277 10.502  3.751   1.00 28.94 ? 321 HIS A CD2 1 
ATOM   2205  C  CE1 . HIS A 1 307 ? -16.785 9.389   2.607   1.00 27.36 ? 321 HIS A CE1 1 
ATOM   2206  N  NE2 . HIS A 1 307 ? -15.609 9.284   3.204   1.00 27.37 ? 321 HIS A NE2 1 
ATOM   2207  N  N   . PHE A 1 308 ? -14.576 15.663  4.008   1.00 33.93 ? 322 PHE A N   1 
ATOM   2208  C  CA  . PHE A 1 308 ? -14.705 17.107  3.879   1.00 32.42 ? 322 PHE A CA  1 
ATOM   2209  C  C   . PHE A 1 308 ? -15.102 17.466  2.463   1.00 35.73 ? 322 PHE A C   1 
ATOM   2210  O  O   . PHE A 1 308 ? -14.434 17.070  1.506   1.00 36.19 ? 322 PHE A O   1 
ATOM   2211  C  CB  . PHE A 1 308 ? -13.409 17.838  4.240   1.00 36.65 ? 322 PHE A CB  1 
ATOM   2212  C  CG  . PHE A 1 308 ? -13.511 19.341  4.096   1.00 37.18 ? 322 PHE A CG  1 
ATOM   2213  C  CD1 . PHE A 1 308 ? -13.891 20.128  5.171   1.00 37.25 ? 322 PHE A CD1 1 
ATOM   2214  C  CD2 . PHE A 1 308 ? -13.254 19.957  2.883   1.00 35.55 ? 322 PHE A CD2 1 
ATOM   2215  C  CE1 . PHE A 1 308 ? -13.996 21.494  5.042   1.00 37.15 ? 322 PHE A CE1 1 
ATOM   2216  C  CE2 . PHE A 1 308 ? -13.368 21.323  2.748   1.00 40.75 ? 322 PHE A CE2 1 
ATOM   2217  C  CZ  . PHE A 1 308 ? -13.737 22.093  3.827   1.00 42.74 ? 322 PHE A CZ  1 
ATOM   2218  N  N   . VAL A 1 309 ? -16.181 18.231  2.335   1.00 30.13 ? 323 VAL A N   1 
ATOM   2219  C  CA  . VAL A 1 309 ? -16.664 18.636  1.021   1.00 34.78 ? 323 VAL A CA  1 
ATOM   2220  C  C   . VAL A 1 309 ? -16.425 20.118  0.764   1.00 36.94 ? 323 VAL A C   1 
ATOM   2221  O  O   . VAL A 1 309 ? -16.730 20.966  1.605   1.00 36.49 ? 323 VAL A O   1 
ATOM   2222  C  CB  . VAL A 1 309 ? -18.165 18.330  0.850   1.00 32.25 ? 323 VAL A CB  1 
ATOM   2223  C  CG1 . VAL A 1 309 ? -18.654 18.808  -0.509  1.00 36.36 ? 323 VAL A CG1 1 
ATOM   2224  C  CG2 . VAL A 1 309 ? -18.422 16.845  1.023   1.00 29.98 ? 323 VAL A CG2 1 
ATOM   2225  N  N   . HIS A 1 310 ? -15.853 20.415  -0.398  1.00 39.02 ? 324 HIS A N   1 
ATOM   2226  C  CA  . HIS A 1 310 ? -15.753 21.785  -0.881  1.00 39.23 ? 324 HIS A CA  1 
ATOM   2227  C  C   . HIS A 1 310 ? -16.891 22.029  -1.875  1.00 40.08 ? 324 HIS A C   1 
ATOM   2228  O  O   . HIS A 1 310 ? -17.408 21.082  -2.476  1.00 35.80 ? 324 HIS A O   1 
ATOM   2229  C  CB  . HIS A 1 310 ? -14.397 22.034  -1.538  1.00 36.96 ? 324 HIS A CB  1 
ATOM   2230  C  CG  . HIS A 1 310 ? -14.260 23.402  -2.129  1.00 42.04 ? 324 HIS A CG  1 
ATOM   2231  N  ND1 . HIS A 1 310 ? -14.315 23.636  -3.491  1.00 44.78 ? 324 HIS A ND1 1 
ATOM   2232  C  CD2 . HIS A 1 310 ? -14.100 24.615  -1.550  1.00 47.03 ? 324 HIS A CD2 1 
ATOM   2233  C  CE1 . HIS A 1 310 ? -14.182 24.928  -3.718  1.00 46.67 ? 324 HIS A CE1 1 
ATOM   2234  N  NE2 . HIS A 1 310 ? -14.055 25.548  -2.556  1.00 47.84 ? 324 HIS A NE2 1 
ATOM   2235  N  N   . ARG A 1 311 ? -17.284 23.291  -2.038  1.00 39.21 ? 325 ARG A N   1 
ATOM   2236  C  CA  . ARG A 1 311 ? -18.443 23.640  -2.870  1.00 43.15 ? 325 ARG A CA  1 
ATOM   2237  C  C   . ARG A 1 311 ? -18.327 23.166  -4.323  1.00 46.66 ? 325 ARG A C   1 
ATOM   2238  O  O   . ARG A 1 311 ? -19.337 22.962  -5.002  1.00 47.20 ? 325 ARG A O   1 
ATOM   2239  C  CB  . ARG A 1 311 ? -18.699 25.153  -2.833  1.00 45.50 ? 325 ARG A CB  1 
ATOM   2240  C  CG  . ARG A 1 311 ? -17.535 26.005  -3.334  1.00 47.51 ? 325 ARG A CG  1 
ATOM   2241  C  CD  . ARG A 1 311 ? -17.943 27.461  -3.538  1.00 46.61 ? 325 ARG A CD  1 
ATOM   2242  N  N   . SER A 1 312 ? -17.096 22.985  -4.789  1.00 45.17 ? 326 SER A N   1 
ATOM   2243  C  CA  . SER A 1 312 ? -16.836 22.565  -6.163  1.00 42.81 ? 326 SER A CA  1 
ATOM   2244  C  C   . SER A 1 312 ? -16.974 21.057  -6.359  1.00 42.94 ? 326 SER A C   1 
ATOM   2245  O  O   . SER A 1 312 ? -16.815 20.557  -7.470  1.00 43.37 ? 326 SER A O   1 
ATOM   2246  C  CB  . SER A 1 312 ? -15.425 22.986  -6.574  1.00 50.53 ? 326 SER A CB  1 
ATOM   2247  O  OG  . SER A 1 312 ? -14.448 22.312  -5.790  1.00 49.50 ? 326 SER A OG  1 
ATOM   2248  N  N   . ALA A 1 313 ? -17.258 20.330  -5.283  1.00 43.14 ? 327 ALA A N   1 
ATOM   2249  C  CA  . ALA A 1 313 ? -17.304 18.869  -5.350  1.00 44.09 ? 327 ALA A CA  1 
ATOM   2250  C  C   . ALA A 1 313 ? -18.437 18.347  -6.238  1.00 42.62 ? 327 ALA A C   1 
ATOM   2251  O  O   . ALA A 1 313 ? -19.415 19.051  -6.486  1.00 39.15 ? 327 ALA A O   1 
ATOM   2252  C  CB  . ALA A 1 313 ? -17.414 18.275  -3.950  1.00 37.22 ? 327 ALA A CB  1 
ATOM   2253  N  N   . ASP A 1 314 ? -18.297 17.111  -6.716  1.00 37.86 ? 328 ASP A N   1 
ATOM   2254  C  CA  . ASP A 1 314 ? -19.377 16.463  -7.449  1.00 44.14 ? 328 ASP A CA  1 
ATOM   2255  C  C   . ASP A 1 314 ? -20.320 15.839  -6.444  1.00 42.18 ? 328 ASP A C   1 
ATOM   2256  O  O   . ASP A 1 314 ? -19.905 15.003  -5.651  1.00 37.30 ? 328 ASP A O   1 
ATOM   2257  C  CB  . ASP A 1 314 ? -18.850 15.370  -8.374  1.00 46.55 ? 328 ASP A CB  1 
ATOM   2258  C  CG  . ASP A 1 314 ? -19.967 14.638  -9.087  1.00 51.99 ? 328 ASP A CG  1 
ATOM   2259  O  OD1 . ASP A 1 314 ? -19.967 13.389  -9.104  1.00 50.98 ? 328 ASP A OD1 1 
ATOM   2260  O  OD2 . ASP A 1 314 ? -20.858 15.322  -9.632  1.00 60.95 ? 328 ASP A OD2 1 
ATOM   2261  N  N   . VAL A 1 315 ? -21.587 16.238  -6.484  1.00 40.19 ? 329 VAL A N   1 
ATOM   2262  C  CA  . VAL A 1 315 ? -22.553 15.812  -5.475  1.00 39.75 ? 329 VAL A CA  1 
ATOM   2263  C  C   . VAL A 1 315 ? -22.740 14.302  -5.384  1.00 39.04 ? 329 VAL A C   1 
ATOM   2264  O  O   . VAL A 1 315 ? -22.695 13.737  -4.290  1.00 36.51 ? 329 VAL A O   1 
ATOM   2265  C  CB  . VAL A 1 315 ? -23.927 16.463  -5.697  1.00 39.29 ? 329 VAL A CB  1 
ATOM   2266  C  CG1 . VAL A 1 315 ? -24.957 15.839  -4.769  1.00 32.15 ? 329 VAL A CG1 1 
ATOM   2267  C  CG2 . VAL A 1 315 ? -23.841 17.961  -5.476  1.00 45.19 ? 329 VAL A CG2 1 
ATOM   2268  N  N   . GLU A 1 316 ? -22.958 13.656  -6.527  1.00 43.21 ? 330 GLU A N   1 
ATOM   2269  C  CA  . GLU A 1 316 ? -23.203 12.215  -6.557  1.00 45.26 ? 330 GLU A CA  1 
ATOM   2270  C  C   . GLU A 1 316 ? -22.042 11.406  -5.982  1.00 43.21 ? 330 GLU A C   1 
ATOM   2271  O  O   . GLU A 1 316 ? -22.252 10.369  -5.354  1.00 45.86 ? 330 GLU A O   1 
ATOM   2272  C  CB  . GLU A 1 316 ? -23.502 11.742  -7.980  1.00 44.96 ? 330 GLU A CB  1 
ATOM   2273  C  CG  . GLU A 1 316 ? -24.791 12.305  -8.560  1.00 48.49 ? 330 GLU A CG  1 
ATOM   2274  C  CD  . GLU A 1 316 ? -26.018 11.920  -7.745  1.00 48.16 ? 330 GLU A CD  1 
ATOM   2275  O  OE1 . GLU A 1 316 ? -26.211 10.714  -7.468  1.00 40.31 ? 330 GLU A OE1 1 
ATOM   2276  O  OE2 . GLU A 1 316 ? -26.792 12.832  -7.381  1.00 48.45 ? 330 GLU A OE2 1 
ATOM   2277  N  N   . SER A 1 317 ? -20.822 11.873  -6.224  1.00 41.66 ? 331 SER A N   1 
ATOM   2278  C  CA  . SER A 1 317 ? -19.631 11.236  -5.672  1.00 43.09 ? 331 SER A CA  1 
ATOM   2279  C  C   . SER A 1 317 ? -19.656 11.379  -4.162  1.00 37.82 ? 331 SER A C   1 
ATOM   2280  O  O   . SER A 1 317 ? -19.477 10.407  -3.432  1.00 40.08 ? 331 SER A O   1 
ATOM   2281  C  CB  . SER A 1 317 ? -18.359 11.877  -6.229  1.00 45.56 ? 331 SER A CB  1 
ATOM   2282  O  OG  . SER A 1 317 ? -18.295 11.747  -7.639  1.00 55.77 ? 331 SER A OG  1 
ATOM   2283  N  N   . VAL A 1 318 ? -19.881 12.605  -3.706  1.00 36.76 ? 332 VAL A N   1 
ATOM   2284  C  CA  . VAL A 1 318 ? -19.986 12.879  -2.280  1.00 38.00 ? 332 VAL A CA  1 
ATOM   2285  C  C   . VAL A 1 318 ? -21.050 11.997  -1.638  1.00 31.77 ? 332 VAL A C   1 
ATOM   2286  O  O   . VAL A 1 318 ? -20.804 11.363  -0.617  1.00 32.12 ? 332 VAL A O   1 
ATOM   2287  C  CB  . VAL A 1 318 ? -20.311 14.368  -2.017  1.00 36.52 ? 332 VAL A CB  1 
ATOM   2288  C  CG1 . VAL A 1 318 ? -20.712 14.583  -0.562  1.00 34.51 ? 332 VAL A CG1 1 
ATOM   2289  C  CG2 . VAL A 1 318 ? -19.132 15.238  -2.393  1.00 37.83 ? 332 VAL A CG2 1 
ATOM   2290  N  N   . VAL A 1 319 ? -22.229 11.942  -2.255  1.00 30.39 ? 333 VAL A N   1 
ATOM   2291  C  CA  . VAL A 1 319 ? -23.347 11.168  -1.706  1.00 28.79 ? 333 VAL A CA  1 
ATOM   2292  C  C   . VAL A 1 319 ? -23.069 9.659   -1.672  1.00 32.30 ? 333 VAL A C   1 
ATOM   2293  O  O   . VAL A 1 319 ? -23.210 9.013   -0.628  1.00 30.02 ? 333 VAL A O   1 
ATOM   2294  C  CB  . VAL A 1 319 ? -24.664 11.452  -2.468  1.00 30.00 ? 333 VAL A CB  1 
ATOM   2295  C  CG1 . VAL A 1 319 ? -25.758 10.513  -2.011  1.00 27.63 ? 333 VAL A CG1 1 
ATOM   2296  C  CG2 . VAL A 1 319 ? -25.089 12.895  -2.264  1.00 32.58 ? 333 VAL A CG2 1 
ATOM   2297  N  N   . SER A 1 320 ? -22.675 9.095   -2.807  1.00 31.58 ? 334 SER A N   1 
ATOM   2298  C  CA  . SER A 1 320 ? -22.414 7.663   -2.865  1.00 31.88 ? 334 SER A CA  1 
ATOM   2299  C  C   . SER A 1 320 ? -21.235 7.261   -1.968  1.00 29.30 ? 334 SER A C   1 
ATOM   2300  O  O   . SER A 1 320 ? -21.328 6.285   -1.233  1.00 28.15 ? 334 SER A O   1 
ATOM   2301  C  CB  . SER A 1 320 ? -22.155 7.207   -4.296  1.00 42.52 ? 334 SER A CB  1 
ATOM   2302  O  OG  . SER A 1 320 ? -20.937 7.740   -4.780  1.00 50.80 ? 334 SER A OG  1 
ATOM   2303  N  N   . GLY A 1 321 ? -20.145 8.017   -2.026  1.00 33.14 ? 335 GLY A N   1 
ATOM   2304  C  CA  . GLY A 1 321 ? -18.968 7.711   -1.220  1.00 32.30 ? 335 GLY A CA  1 
ATOM   2305  C  C   . GLY A 1 321 ? -19.247 7.765   0.272   1.00 32.77 ? 335 GLY A C   1 
ATOM   2306  O  O   . GLY A 1 321 ? -18.818 6.882   1.030   1.00 32.13 ? 335 GLY A O   1 
ATOM   2307  N  N   . THR A 1 322 ? -19.978 8.794   0.695   1.00 24.72 ? 336 THR A N   1 
ATOM   2308  C  CA  . THR A 1 322 ? -20.282 8.978   2.107   1.00 25.03 ? 336 THR A CA  1 
ATOM   2309  C  C   . THR A 1 322 ? -21.192 7.881   2.656   1.00 23.34 ? 336 THR A C   1 
ATOM   2310  O  O   . THR A 1 322 ? -20.953 7.364   3.748   1.00 21.83 ? 336 THR A O   1 
ATOM   2311  C  CB  . THR A 1 322 ? -20.922 10.356  2.383   1.00 30.19 ? 336 THR A CB  1 
ATOM   2312  O  OG1 . THR A 1 322 ? -20.054 11.399  1.906   1.00 31.13 ? 336 THR A OG1 1 
ATOM   2313  C  CG2 . THR A 1 322 ? -21.177 10.543  3.880   1.00 31.28 ? 336 THR A CG2 1 
ATOM   2314  N  N   . LEU A 1 323 ? -22.242 7.528   1.918   1.00 29.91 ? 337 LEU A N   1 
ATOM   2315  C  CA  . LEU A 1 323 ? -23.159 6.484   2.390   1.00 27.83 ? 337 LEU A CA  1 
ATOM   2316  C  C   . LEU A 1 323 ? -22.470 5.129   2.453   1.00 25.79 ? 337 LEU A C   1 
ATOM   2317  O  O   . LEU A 1 323 ? -22.690 4.358   3.379   1.00 29.60 ? 337 LEU A O   1 
ATOM   2318  C  CB  . LEU A 1 323 ? -24.415 6.407   1.520   1.00 27.21 ? 337 LEU A CB  1 
ATOM   2319  C  CG  . LEU A 1 323 ? -25.337 7.618   1.636   1.00 27.68 ? 337 LEU A CG  1 
ATOM   2320  C  CD1 . LEU A 1 323 ? -26.407 7.551   0.569   1.00 31.93 ? 337 LEU A CD1 1 
ATOM   2321  C  CD2 . LEU A 1 323 ? -25.984 7.709   3.021   1.00 23.95 ? 337 LEU A CD2 1 
ATOM   2322  N  N   . ARG A 1 324 ? -21.632 4.845   1.465   1.00 26.52 ? 338 ARG A N   1 
ATOM   2323  C  CA  . ARG A 1 324 ? -20.909 3.585   1.453   1.00 25.97 ? 338 ARG A CA  1 
ATOM   2324  C  C   . ARG A 1 324 ? -19.916 3.520   2.614   1.00 23.69 ? 338 ARG A C   1 
ATOM   2325  O  O   . ARG A 1 324 ? -19.881 2.536   3.339   1.00 23.70 ? 338 ARG A O   1 
ATOM   2326  C  CB  . ARG A 1 324 ? -20.204 3.370   0.113   1.00 29.78 ? 338 ARG A CB  1 
ATOM   2327  C  CG  . ARG A 1 324 ? -21.172 3.184   -1.049  1.00 37.32 ? 338 ARG A CG  1 
ATOM   2328  C  CD  . ARG A 1 324 ? -20.439 2.833   -2.335  1.00 49.72 ? 338 ARG A CD  1 
ATOM   2329  N  NE  . ARG A 1 324 ? -19.649 1.613   -2.188  1.00 57.17 ? 338 ARG A NE  1 
ATOM   2330  C  CZ  . ARG A 1 324 ? -18.935 1.063   -3.165  1.00 59.64 ? 338 ARG A CZ  1 
ATOM   2331  N  NH1 . ARG A 1 324 ? -18.914 1.623   -4.369  1.00 55.97 ? 338 ARG A NH1 1 
ATOM   2332  N  NH2 . ARG A 1 324 ? -18.244 -0.049  -2.939  1.00 60.69 ? 338 ARG A NH2 1 
ATOM   2333  N  N   . SER A 1 325 ? -19.134 4.581   2.808   1.00 23.60 ? 339 SER A N   1 
ATOM   2334  C  CA  . SER A 1 325 ? -18.148 4.582   3.887   1.00 22.22 ? 339 SER A CA  1 
ATOM   2335  C  C   . SER A 1 325 ? -18.832 4.538   5.253   1.00 25.10 ? 339 SER A C   1 
ATOM   2336  O  O   . SER A 1 325 ? -18.370 3.869   6.171   1.00 22.91 ? 339 SER A O   1 
ATOM   2337  C  CB  . SER A 1 325 ? -17.237 5.814   3.799   1.00 21.81 ? 339 SER A CB  1 
ATOM   2338  O  OG  . SER A 1 325 ? -16.309 5.847   4.877   1.00 25.21 ? 339 SER A OG  1 
ATOM   2339  N  N   . ALA A 1 326 ? -19.945 5.249   5.388   1.00 28.04 ? 340 ALA A N   1 
ATOM   2340  C  CA  . ALA A 1 326 ? -20.606 5.334   6.681   1.00 25.01 ? 340 ALA A CA  1 
ATOM   2341  C  C   . ALA A 1 326 ? -21.307 4.039   7.054   1.00 22.47 ? 340 ALA A C   1 
ATOM   2342  O  O   . ALA A 1 326 ? -21.383 3.686   8.237   1.00 21.50 ? 340 ALA A O   1 
ATOM   2343  C  CB  . ALA A 1 326 ? -21.613 6.501   6.708   1.00 28.08 ? 340 ALA A CB  1 
ATOM   2344  N  N   . PHE A 1 327 ? -21.816 3.323   6.057   1.00 19.90 ? 341 PHE A N   1 
ATOM   2345  C  CA  . PHE A 1 327 ? -22.809 2.293   6.351   1.00 19.65 ? 341 PHE A CA  1 
ATOM   2346  C  C   . PHE A 1 327 ? -22.458 0.873   5.944   1.00 20.52 ? 341 PHE A C   1 
ATOM   2347  O  O   . PHE A 1 327 ? -23.110 -0.070  6.398   1.00 27.19 ? 341 PHE A O   1 
ATOM   2348  C  CB  . PHE A 1 327 ? -24.178 2.708   5.765   1.00 24.66 ? 341 PHE A CB  1 
ATOM   2349  C  CG  . PHE A 1 327 ? -24.755 3.941   6.413   1.00 20.86 ? 341 PHE A CG  1 
ATOM   2350  C  CD1 . PHE A 1 327 ? -24.806 4.041   7.795   1.00 20.78 ? 341 PHE A CD1 1 
ATOM   2351  C  CD2 . PHE A 1 327 ? -25.237 4.991   5.650   1.00 24.86 ? 341 PHE A CD2 1 
ATOM   2352  C  CE1 . PHE A 1 327 ? -25.329 5.158   8.407   1.00 20.94 ? 341 PHE A CE1 1 
ATOM   2353  C  CE2 . PHE A 1 327 ? -25.764 6.109   6.253   1.00 27.39 ? 341 PHE A CE2 1 
ATOM   2354  C  CZ  . PHE A 1 327 ? -25.808 6.200   7.631   1.00 30.91 ? 341 PHE A CZ  1 
ATOM   2355  N  N   . GLU A 1 328 ? -21.445 0.702   5.104   1.00 27.67 ? 342 GLU A N   1 
ATOM   2356  C  CA  . GLU A 1 328 ? -21.008 -0.651  4.795   1.00 25.61 ? 342 GLU A CA  1 
ATOM   2357  C  C   . GLU A 1 328 ? -20.572 -1.342  6.085   1.00 26.19 ? 342 GLU A C   1 
ATOM   2358  O  O   . GLU A 1 328 ? -19.874 -0.741  6.913   1.00 23.23 ? 342 GLU A O   1 
ATOM   2359  C  CB  . GLU A 1 328 ? -19.910 -0.650  3.723   1.00 35.70 ? 342 GLU A CB  1 
ATOM   2360  C  CG  . GLU A 1 328 ? -20.482 -0.372  2.325   1.00 46.23 ? 342 GLU A CG  1 
ATOM   2361  C  CD  . GLU A 1 328 ? -19.437 -0.049  1.263   1.00 52.64 ? 342 GLU A CD  1 
ATOM   2362  O  OE1 . GLU A 1 328 ? -18.306 0.362   1.610   1.00 49.45 ? 342 GLU A OE1 1 
ATOM   2363  O  OE2 . GLU A 1 328 ? -19.765 -0.198  0.062   1.00 57.05 ? 342 GLU A OE2 1 
ATOM   2364  N  N   . TYR A 1 329 ? -21.028 -2.587  6.255   1.00 21.66 ? 343 TYR A N   1 
ATOM   2365  C  CA  . TYR A 1 329 ? -20.779 -3.387  7.454   1.00 24.86 ? 343 TYR A CA  1 
ATOM   2366  C  C   . TYR A 1 329 ? -21.302 -2.664  8.695   1.00 23.93 ? 343 TYR A C   1 
ATOM   2367  O  O   . TYR A 1 329 ? -20.777 -2.825  9.792   1.00 21.34 ? 343 TYR A O   1 
ATOM   2368  C  CB  . TYR A 1 329 ? -19.289 -3.721  7.618   1.00 22.06 ? 343 TYR A CB  1 
ATOM   2369  C  CG  . TYR A 1 329 ? -19.051 -4.859  8.579   1.00 24.77 ? 343 TYR A CG  1 
ATOM   2370  C  CD1 . TYR A 1 329 ? -20.075 -5.759  8.870   1.00 22.67 ? 343 TYR A CD1 1 
ATOM   2371  C  CD2 . TYR A 1 329 ? -17.820 -5.032  9.209   1.00 28.99 ? 343 TYR A CD2 1 
ATOM   2372  C  CE1 . TYR A 1 329 ? -19.882 -6.802  9.752   1.00 24.76 ? 343 TYR A CE1 1 
ATOM   2373  C  CE2 . TYR A 1 329 ? -17.613 -6.079  10.098  1.00 28.98 ? 343 TYR A CE2 1 
ATOM   2374  C  CZ  . TYR A 1 329 ? -18.646 -6.960  10.364  1.00 24.15 ? 343 TYR A CZ  1 
ATOM   2375  O  OH  . TYR A 1 329 ? -18.471 -8.002  11.243  1.00 23.14 ? 343 TYR A OH  1 
ATOM   2376  N  N   . GLY A 1 330 ? -22.343 -1.857  8.510   1.00 25.85 ? 344 GLY A N   1 
ATOM   2377  C  CA  . GLY A 1 330 ? -22.943 -1.144  9.618   1.00 25.36 ? 344 GLY A CA  1 
ATOM   2378  C  C   . GLY A 1 330 ? -22.025 -0.113  10.240  1.00 23.83 ? 344 GLY A C   1 
ATOM   2379  O  O   . GLY A 1 330 ? -22.184 0.233   11.402  1.00 27.63 ? 344 GLY A O   1 
ATOM   2380  N  N   . GLY A 1 331 ? -21.051 0.372   9.479   1.00 20.04 ? 345 GLY A N   1 
ATOM   2381  C  CA  . GLY A 1 331 ? -20.126 1.365   10.005  1.00 21.99 ? 345 GLY A CA  1 
ATOM   2382  C  C   . GLY A 1 331 ? -19.061 0.728   10.879  1.00 25.44 ? 345 GLY A C   1 
ATOM   2383  O  O   . GLY A 1 331 ? -18.228 1.422   11.450  1.00 26.43 ? 345 GLY A O   1 
ATOM   2384  N  N   . GLN A 1 332 ? -19.082 -0.599  10.967  1.00 21.40 ? 346 GLN A N   1 
ATOM   2385  C  CA  . GLN A 1 332 ? -18.125 -1.341  11.798  1.00 21.99 ? 346 GLN A CA  1 
ATOM   2386  C  C   . GLN A 1 332 ? -16.779 -1.569  11.125  1.00 24.10 ? 346 GLN A C   1 
ATOM   2387  O  O   . GLN A 1 332 ? -16.312 -2.706  11.008  1.00 23.81 ? 346 GLN A O   1 
ATOM   2388  C  CB  . GLN A 1 332 ? -18.736 -2.677  12.230  1.00 22.92 ? 346 GLN A CB  1 
ATOM   2389  C  CG  . GLN A 1 332 ? -20.032 -2.521  13.006  1.00 27.04 ? 346 GLN A CG  1 
ATOM   2390  C  CD  . GLN A 1 332 ? -20.688 -3.856  13.272  1.00 23.87 ? 346 GLN A CD  1 
ATOM   2391  O  OE1 . GLN A 1 332 ? -21.012 -4.194  14.413  1.00 18.59 ? 346 GLN A OE1 1 
ATOM   2392  N  NE2 . GLN A 1 332 ? -20.880 -4.627  12.214  1.00 22.90 ? 346 GLN A NE2 1 
ATOM   2393  N  N   . LYS A 1 333 ? -16.164 -0.477  10.681  1.00 24.52 ? 347 LYS A N   1 
ATOM   2394  C  CA  . LYS A 1 333 ? -14.835 -0.514  10.102  1.00 27.08 ? 347 LYS A CA  1 
ATOM   2395  C  C   . LYS A 1 333 ? -14.021 0.578   10.758  1.00 25.23 ? 347 LYS A C   1 
ATOM   2396  O  O   . LYS A 1 333 ? -14.549 1.656   11.055  1.00 23.66 ? 347 LYS A O   1 
ATOM   2397  C  CB  . LYS A 1 333 ? -14.875 -0.252  8.598   1.00 26.03 ? 347 LYS A CB  1 
ATOM   2398  C  CG  . LYS A 1 333 ? -15.604 -1.289  7.783   1.00 27.03 ? 347 LYS A CG  1 
ATOM   2399  C  CD  . LYS A 1 333 ? -15.285 -1.112  6.304   1.00 29.73 ? 347 LYS A CD  1 
ATOM   2400  C  CE  . LYS A 1 333 ? -16.262 -1.881  5.440   1.00 34.88 ? 347 LYS A CE  1 
ATOM   2401  N  NZ  . LYS A 1 333 ? -15.982 -1.678  3.991   1.00 28.91 ? 347 LYS A NZ  1 
ATOM   2402  N  N   . CYS A 1 334 ? -12.737 0.314   10.977  1.00 21.78 ? 348 CYS A N   1 
ATOM   2403  C  CA  . CYS A 1 334 ? -11.873 1.306   11.613  1.00 23.35 ? 348 CYS A CA  1 
ATOM   2404  C  C   . CYS A 1 334 ? -11.727 2.534   10.735  1.00 24.82 ? 348 CYS A C   1 
ATOM   2405  O  O   . CYS A 1 334 ? -11.409 3.631   11.219  1.00 22.94 ? 348 CYS A O   1 
ATOM   2406  C  CB  . CYS A 1 334 ? -10.495 0.713   11.910  1.00 22.28 ? 348 CYS A CB  1 
ATOM   2407  S  SG  . CYS A 1 334 ? -10.523 -0.622  13.129  1.00 31.11 ? 348 CYS A SG  1 
ATOM   2408  N  N   . SER A 1 335 ? -11.978 2.344   9.444   1.00 20.20 ? 349 SER A N   1 
ATOM   2409  C  CA  . SER A 1 335 ? -11.790 3.391   8.454   1.00 16.56 ? 349 SER A CA  1 
ATOM   2410  C  C   . SER A 1 335 ? -13.081 4.082   8.045   1.00 18.90 ? 349 SER A C   1 
ATOM   2411  O  O   . SER A 1 335 ? -13.050 4.948   7.177   1.00 23.42 ? 349 SER A O   1 
ATOM   2412  C  CB  . SER A 1 335 ? -11.179 2.781   7.199   1.00 26.26 ? 349 SER A CB  1 
ATOM   2413  O  OG  . SER A 1 335 ? -12.038 1.775   6.705   1.00 29.40 ? 349 SER A OG  1 
ATOM   2414  N  N   . ALA A 1 336 ? -14.201 3.707   8.666   1.00 21.17 ? 350 ALA A N   1 
ATOM   2415  C  CA  . ALA A 1 336 ? -15.533 4.196   8.241   1.00 24.08 ? 350 ALA A CA  1 
ATOM   2416  C  C   . ALA A 1 336 ? -15.764 5.687   8.491   1.00 26.01 ? 350 ALA A C   1 
ATOM   2417  O  O   . ALA A 1 336 ? -15.386 6.220   9.545   1.00 25.32 ? 350 ALA A O   1 
ATOM   2418  C  CB  . ALA A 1 336 ? -16.644 3.378   8.915   1.00 24.12 ? 350 ALA A CB  1 
ATOM   2419  N  N   . CYS A 1 337 ? -16.398 6.355   7.529   1.00 24.40 ? 351 CYS A N   1 
ATOM   2420  C  CA  . CYS A 1 337 ? -16.729 7.770   7.691   1.00 27.28 ? 351 CYS A CA  1 
ATOM   2421  C  C   . CYS A 1 337 ? -17.842 7.927   8.722   1.00 26.36 ? 351 CYS A C   1 
ATOM   2422  O  O   . CYS A 1 337 ? -18.856 7.243   8.647   1.00 29.53 ? 351 CYS A O   1 
ATOM   2423  C  CB  . CYS A 1 337 ? -17.181 8.384   6.369   1.00 29.35 ? 351 CYS A CB  1 
ATOM   2424  S  SG  . CYS A 1 337 ? -17.687 10.132  6.537   1.00 27.63 ? 351 CYS A SG  1 
ATOM   2425  N  N   . SER A 1 338 ? -17.652 8.819   9.684   1.00 25.62 ? 352 SER A N   1 
ATOM   2426  C  CA  . SER A 1 338 ? -18.693 9.087   10.680  1.00 27.67 ? 352 SER A CA  1 
ATOM   2427  C  C   . SER A 1 338 ? -19.012 10.579  10.789  1.00 27.26 ? 352 SER A C   1 
ATOM   2428  O  O   . SER A 1 338 ? -19.934 10.981  11.500  1.00 25.70 ? 352 SER A O   1 
ATOM   2429  C  CB  . SER A 1 338 ? -18.288 8.529   12.045  1.00 29.26 ? 352 SER A CB  1 
ATOM   2430  O  OG  . SER A 1 338 ? -17.026 9.043   12.450  1.00 29.34 ? 352 SER A OG  1 
ATOM   2431  N  N   . ARG A 1 339 ? -18.242 11.404  10.090  1.00 28.86 ? 353 ARG A N   1 
ATOM   2432  C  CA  . ARG A 1 339 ? -18.510 12.829  10.086  1.00 23.71 ? 353 ARG A CA  1 
ATOM   2433  C  C   . ARG A 1 339 ? -18.309 13.442  8.704   1.00 26.76 ? 353 ARG A C   1 
ATOM   2434  O  O   . ARG A 1 339 ? -17.309 13.189  8.023   1.00 25.71 ? 353 ARG A O   1 
ATOM   2435  C  CB  . ARG A 1 339 ? -17.695 13.559  11.161  1.00 33.48 ? 353 ARG A CB  1 
ATOM   2436  C  CG  . ARG A 1 339 ? -16.208 13.344  11.080  1.00 36.05 ? 353 ARG A CG  1 
ATOM   2437  C  CD  . ARG A 1 339 ? -15.489 13.991  12.261  1.00 35.11 ? 353 ARG A CD  1 
ATOM   2438  N  NE  . ARG A 1 339 ? -14.105 13.550  12.330  1.00 29.27 ? 353 ARG A NE  1 
ATOM   2439  C  CZ  . ARG A 1 339 ? -13.044 14.353  12.341  1.00 30.44 ? 353 ARG A CZ  1 
ATOM   2440  N  NH1 . ARG A 1 339 ? -11.827 13.831  12.408  1.00 28.35 ? 353 ARG A NH1 1 
ATOM   2441  N  NH2 . ARG A 1 339 ? -13.187 15.671  12.302  1.00 31.17 ? 353 ARG A NH2 1 
ATOM   2442  N  N   . LEU A 1 340 ? -19.298 14.234  8.300   1.00 25.75 ? 354 LEU A N   1 
ATOM   2443  C  CA  . LEU A 1 340 ? -19.370 14.819  6.971   1.00 31.78 ? 354 LEU A CA  1 
ATOM   2444  C  C   . LEU A 1 340 ? -19.482 16.320  7.135   1.00 30.08 ? 354 LEU A C   1 
ATOM   2445  O  O   . LEU A 1 340 ? -20.316 16.798  7.888   1.00 29.08 ? 354 LEU A O   1 
ATOM   2446  C  CB  . LEU A 1 340 ? -20.604 14.288  6.234   1.00 30.52 ? 354 LEU A CB  1 
ATOM   2447  C  CG  . LEU A 1 340 ? -20.985 14.898  4.882   1.00 33.31 ? 354 LEU A CG  1 
ATOM   2448  C  CD1 . LEU A 1 340 ? -19.992 14.544  3.782   1.00 29.81 ? 354 LEU A CD1 1 
ATOM   2449  C  CD2 . LEU A 1 340 ? -22.401 14.483  4.484   1.00 33.11 ? 354 LEU A CD2 1 
ATOM   2450  N  N   . TYR A 1 341 ? -18.616 17.053  6.449   1.00 34.85 ? 355 TYR A N   1 
ATOM   2451  C  CA  . TYR A 1 341 ? -18.585 18.500  6.530   1.00 33.41 ? 355 TYR A CA  1 
ATOM   2452  C  C   . TYR A 1 341 ? -18.982 19.034  5.176   1.00 35.57 ? 355 TYR A C   1 
ATOM   2453  O  O   . TYR A 1 341 ? -18.366 18.686  4.171   1.00 40.33 ? 355 TYR A O   1 
ATOM   2454  C  CB  . TYR A 1 341 ? -17.174 18.978  6.890   1.00 36.20 ? 355 TYR A CB  1 
ATOM   2455  C  CG  . TYR A 1 341 ? -16.731 18.553  8.273   1.00 29.88 ? 355 TYR A CG  1 
ATOM   2456  C  CD1 . TYR A 1 341 ? -16.954 19.377  9.369   1.00 33.70 ? 355 TYR A CD1 1 
ATOM   2457  C  CD2 . TYR A 1 341 ? -16.101 17.332  8.484   1.00 30.75 ? 355 TYR A CD2 1 
ATOM   2458  C  CE1 . TYR A 1 341 ? -16.570 19.000  10.635  1.00 28.84 ? 355 TYR A CE1 1 
ATOM   2459  C  CE2 . TYR A 1 341 ? -15.712 16.937  9.759   1.00 30.56 ? 355 TYR A CE2 1 
ATOM   2460  C  CZ  . TYR A 1 341 ? -15.946 17.785  10.831  1.00 31.67 ? 355 TYR A CZ  1 
ATOM   2461  O  OH  . TYR A 1 341 ? -15.560 17.424  12.104  1.00 28.15 ? 355 TYR A OH  1 
ATOM   2462  N  N   . VAL A 1 342 ? -20.021 19.866  5.145   1.00 32.46 ? 356 VAL A N   1 
ATOM   2463  C  CA  . VAL A 1 342 ? -20.587 20.328  3.880   1.00 35.91 ? 356 VAL A CA  1 
ATOM   2464  C  C   . VAL A 1 342 ? -20.804 21.836  3.852   1.00 35.35 ? 356 VAL A C   1 
ATOM   2465  O  O   . VAL A 1 342 ? -21.227 22.437  4.845   1.00 34.90 ? 356 VAL A O   1 
ATOM   2466  C  CB  . VAL A 1 342 ? -21.931 19.628  3.551   1.00 47.60 ? 356 VAL A CB  1 
ATOM   2467  C  CG1 . VAL A 1 342 ? -21.771 18.121  3.565   1.00 42.13 ? 356 VAL A CG1 1 
ATOM   2468  C  CG2 . VAL A 1 342 ? -23.010 20.048  4.526   1.00 52.86 ? 356 VAL A CG2 1 
ATOM   2469  N  N   . PRO A 1 343 ? -20.522 22.457  2.701   1.00 35.88 ? 357 PRO A N   1 
ATOM   2470  C  CA  . PRO A 1 343 ? -20.701 23.901  2.582   1.00 35.68 ? 357 PRO A CA  1 
ATOM   2471  C  C   . PRO A 1 343 ? -22.176 24.237  2.426   1.00 37.71 ? 357 PRO A C   1 
ATOM   2472  O  O   . PRO A 1 343 ? -22.954 23.433  1.906   1.00 36.52 ? 357 PRO A O   1 
ATOM   2473  C  CB  . PRO A 1 343 ? -19.934 24.231  1.305   1.00 38.10 ? 357 PRO A CB  1 
ATOM   2474  C  CG  . PRO A 1 343 ? -20.115 23.009  0.466   1.00 37.11 ? 357 PRO A CG  1 
ATOM   2475  C  CD  . PRO A 1 343 ? -20.079 21.851  1.433   1.00 37.95 ? 357 PRO A CD  1 
ATOM   2476  N  N   . HIS A 1 344 ? -22.550 25.420  2.896   1.00 40.77 ? 358 HIS A N   1 
ATOM   2477  C  CA  . HIS A 1 344 ? -23.943 25.852  2.907   1.00 43.68 ? 358 HIS A CA  1 
ATOM   2478  C  C   . HIS A 1 344 ? -24.578 25.791  1.515   1.00 43.86 ? 358 HIS A C   1 
ATOM   2479  O  O   . HIS A 1 344 ? -25.727 25.380  1.368   1.00 45.47 ? 358 HIS A O   1 
ATOM   2480  C  CB  . HIS A 1 344 ? -24.017 27.272  3.475   1.00 49.24 ? 358 HIS A CB  1 
ATOM   2481  C  CG  . HIS A 1 344 ? -25.398 27.707  3.855   1.00 58.65 ? 358 HIS A CG  1 
ATOM   2482  N  ND1 . HIS A 1 344 ? -25.999 28.821  3.313   1.00 58.97 ? 358 HIS A ND1 1 
ATOM   2483  C  CD2 . HIS A 1 344 ? -26.289 27.181  4.728   1.00 62.48 ? 358 HIS A CD2 1 
ATOM   2484  C  CE1 . HIS A 1 344 ? -27.206 28.964  3.834   1.00 63.53 ? 358 HIS A CE1 1 
ATOM   2485  N  NE2 . HIS A 1 344 ? -27.406 27.983  4.694   1.00 64.46 ? 358 HIS A NE2 1 
ATOM   2486  N  N   . SER A 1 345 ? -23.818 26.188  0.498   1.00 40.77 ? 359 SER A N   1 
ATOM   2487  C  CA  . SER A 1 345 ? -24.340 26.272  -0.865  1.00 46.32 ? 359 SER A CA  1 
ATOM   2488  C  C   . SER A 1 345 ? -24.709 24.919  -1.474  1.00 45.25 ? 359 SER A C   1 
ATOM   2489  O  O   . SER A 1 345 ? -25.596 24.840  -2.324  1.00 42.60 ? 359 SER A O   1 
ATOM   2490  C  CB  . SER A 1 345 ? -23.347 26.997  -1.773  1.00 49.27 ? 359 SER A CB  1 
ATOM   2491  O  OG  . SER A 1 345 ? -22.081 26.361  -1.735  1.00 54.70 ? 359 SER A OG  1 
ATOM   2492  N  N   . LEU A 1 346 ? -24.029 23.860  -1.045  1.00 43.36 ? 360 LEU A N   1 
ATOM   2493  C  CA  . LEU A 1 346 ? -24.272 22.526  -1.585  1.00 41.56 ? 360 LEU A CA  1 
ATOM   2494  C  C   . LEU A 1 346 ? -25.259 21.724  -0.756  1.00 41.06 ? 360 LEU A C   1 
ATOM   2495  O  O   . LEU A 1 346 ? -25.799 20.727  -1.232  1.00 40.22 ? 360 LEU A O   1 
ATOM   2496  C  CB  . LEU A 1 346 ? -22.965 21.733  -1.683  1.00 44.23 ? 360 LEU A CB  1 
ATOM   2497  C  CG  . LEU A 1 346 ? -22.133 21.856  -2.959  1.00 49.88 ? 360 LEU A CG  1 
ATOM   2498  C  CD1 . LEU A 1 346 ? -20.919 20.948  -2.887  1.00 43.32 ? 360 LEU A CD1 1 
ATOM   2499  C  CD2 . LEU A 1 346 ? -22.971 21.521  -4.181  1.00 55.93 ? 360 LEU A CD2 1 
ATOM   2500  N  N   . TRP A 1 347 ? -25.477 22.146  0.487   1.00 45.01 ? 361 TRP A N   1 
ATOM   2501  C  CA  . TRP A 1 347 ? -26.277 21.358  1.435   1.00 42.47 ? 361 TRP A CA  1 
ATOM   2502  C  C   . TRP A 1 347 ? -27.677 20.935  0.948   1.00 38.35 ? 361 TRP A C   1 
ATOM   2503  O  O   . TRP A 1 347 ? -27.996 19.748  1.015   1.00 37.35 ? 361 TRP A O   1 
ATOM   2504  C  CB  . TRP A 1 347 ? -26.315 22.021  2.825   1.00 43.09 ? 361 TRP A CB  1 
ATOM   2505  C  CG  . TRP A 1 347 ? -27.122 21.290  3.870   1.00 40.54 ? 361 TRP A CG  1 
ATOM   2506  C  CD1 . TRP A 1 347 ? -28.094 21.825  4.668   1.00 43.06 ? 361 TRP A CD1 1 
ATOM   2507  C  CD2 . TRP A 1 347 ? -27.030 19.901  4.230   1.00 36.40 ? 361 TRP A CD2 1 
ATOM   2508  N  NE1 . TRP A 1 347 ? -28.605 20.859  5.504   1.00 39.50 ? 361 TRP A NE1 1 
ATOM   2509  C  CE2 . TRP A 1 347 ? -27.971 19.674  5.254   1.00 35.96 ? 361 TRP A CE2 1 
ATOM   2510  C  CE3 . TRP A 1 347 ? -26.239 18.833  3.793   1.00 36.27 ? 361 TRP A CE3 1 
ATOM   2511  C  CZ2 . TRP A 1 347 ? -28.144 18.421  5.842   1.00 37.52 ? 361 TRP A CZ2 1 
ATOM   2512  C  CZ3 . TRP A 1 347 ? -26.420 17.588  4.376   1.00 35.56 ? 361 TRP A CZ3 1 
ATOM   2513  C  CH2 . TRP A 1 347 ? -27.363 17.393  5.388   1.00 36.74 ? 361 TRP A CH2 1 
ATOM   2514  N  N   . PRO A 1 348 ? -28.498 21.881  0.437   1.00 38.14 ? 362 PRO A N   1 
ATOM   2515  C  CA  . PRO A 1 348 ? -29.833 21.468  -0.034  1.00 42.78 ? 362 PRO A CA  1 
ATOM   2516  C  C   . PRO A 1 348 ? -29.779 20.307  -1.033  1.00 41.71 ? 362 PRO A C   1 
ATOM   2517  O  O   . PRO A 1 348 ? -30.512 19.328  -0.873  1.00 44.45 ? 362 PRO A O   1 
ATOM   2518  C  CB  . PRO A 1 348 ? -30.373 22.733  -0.711  1.00 45.02 ? 362 PRO A CB  1 
ATOM   2519  C  CG  . PRO A 1 348 ? -29.666 23.850  -0.033  1.00 46.78 ? 362 PRO A CG  1 
ATOM   2520  C  CD  . PRO A 1 348 ? -28.283 23.329  0.254   1.00 40.69 ? 362 PRO A CD  1 
ATOM   2521  N  N   . GLN A 1 349 ? -28.898 20.407  -2.026  1.00 40.11 ? 363 GLN A N   1 
ATOM   2522  C  CA  . GLN A 1 349 ? -28.693 19.325  -2.988  1.00 41.73 ? 363 GLN A CA  1 
ATOM   2523  C  C   . GLN A 1 349 ? -28.141 18.055  -2.334  1.00 42.28 ? 363 GLN A C   1 
ATOM   2524  O  O   . GLN A 1 349 ? -28.631 16.952  -2.598  1.00 38.78 ? 363 GLN A O   1 
ATOM   2525  C  CB  . GLN A 1 349 ? -27.771 19.779  -4.126  1.00 44.05 ? 363 GLN A CB  1 
ATOM   2526  N  N   . ILE A 1 350 ? -27.112 18.206  -1.496  1.00 36.44 ? 364 ILE A N   1 
ATOM   2527  C  CA  . ILE A 1 350 ? -26.509 17.053  -0.837  1.00 31.12 ? 364 ILE A CA  1 
ATOM   2528  C  C   . ILE A 1 350 ? -27.505 16.397  0.110   1.00 36.69 ? 364 ILE A C   1 
ATOM   2529  O  O   . ILE A 1 350 ? -27.666 15.178  0.096   1.00 32.98 ? 364 ILE A O   1 
ATOM   2530  C  CB  . ILE A 1 350 ? -25.187 17.409  -0.094  1.00 30.60 ? 364 ILE A CB  1 
ATOM   2531  C  CG1 . ILE A 1 350 ? -24.069 17.678  -1.095  1.00 37.15 ? 364 ILE A CG1 1 
ATOM   2532  C  CG2 . ILE A 1 350 ? -24.754 16.260  0.861   1.00 29.21 ? 364 ILE A CG2 1 
ATOM   2533  C  CD1 . ILE A 1 350 ? -22.736 17.999  -0.443  1.00 38.21 ? 364 ILE A CD1 1 
ATOM   2534  N  N   . LYS A 1 351 ? -28.192 17.211  0.910   1.00 40.08 ? 365 LYS A N   1 
ATOM   2535  C  CA  . LYS A 1 351 ? -29.180 16.694  1.862   1.00 39.67 ? 365 LYS A CA  1 
ATOM   2536  C  C   . LYS A 1 351 ? -30.262 15.870  1.171   1.00 30.77 ? 365 LYS A C   1 
ATOM   2537  O  O   . LYS A 1 351 ? -30.571 14.754  1.596   1.00 30.03 ? 365 LYS A O   1 
ATOM   2538  C  CB  . LYS A 1 351 ? -29.818 17.833  2.672   1.00 45.83 ? 365 LYS A CB  1 
ATOM   2539  C  CG  . LYS A 1 351 ? -30.773 17.372  3.772   1.00 40.39 ? 365 LYS A CG  1 
ATOM   2540  C  CD  . LYS A 1 351 ? -31.384 18.547  4.529   1.00 44.07 ? 365 LYS A CD  1 
ATOM   2541  C  CE  . LYS A 1 351 ? -32.414 18.049  5.532   1.00 45.11 ? 365 LYS A CE  1 
ATOM   2542  N  NZ  . LYS A 1 351 ? -33.168 19.148  6.191   1.00 40.30 ? 365 LYS A NZ  1 
ATOM   2543  N  N   . GLY A 1 352 ? -30.820 16.418  0.097   1.00 38.93 ? 366 GLY A N   1 
ATOM   2544  C  CA  . GLY A 1 352 ? -31.899 15.766  -0.620  1.00 36.71 ? 366 GLY A CA  1 
ATOM   2545  C  C   . GLY A 1 352 ? -31.494 14.426  -1.207  1.00 36.69 ? 366 GLY A C   1 
ATOM   2546  O  O   . GLY A 1 352 ? -32.232 13.438  -1.122  1.00 32.74 ? 366 GLY A O   1 
ATOM   2547  N  N   . ARG A 1 353 ? -30.311 14.395  -1.806  1.00 35.68 ? 367 ARG A N   1 
ATOM   2548  C  CA  . ARG A 1 353 ? -29.794 13.161  -2.379  1.00 34.15 ? 367 ARG A CA  1 
ATOM   2549  C  C   . ARG A 1 353 ? -29.454 12.143  -1.293  1.00 35.87 ? 367 ARG A C   1 
ATOM   2550  O  O   . ARG A 1 353 ? -29.672 10.943  -1.471  1.00 33.45 ? 367 ARG A O   1 
ATOM   2551  C  CB  . ARG A 1 353 ? -28.577 13.459  -3.257  1.00 34.41 ? 367 ARG A CB  1 
ATOM   2552  C  CG  . ARG A 1 353 ? -28.885 14.336  -4.463  1.00 41.09 ? 367 ARG A CG  1 
ATOM   2553  C  CD  . ARG A 1 353 ? -29.735 13.600  -5.489  1.00 42.45 ? 367 ARG A CD  1 
ATOM   2554  N  NE  . ARG A 1 353 ? -29.059 12.399  -5.969  1.00 41.14 ? 367 ARG A NE  1 
ATOM   2555  C  CZ  . ARG A 1 353 ? -29.503 11.162  -5.787  1.00 35.55 ? 367 ARG A CZ  1 
ATOM   2556  N  NH1 . ARG A 1 353 ? -28.811 10.136  -6.258  1.00 31.71 ? 367 ARG A NH1 1 
ATOM   2557  N  NH2 . ARG A 1 353 ? -30.639 10.949  -5.143  1.00 36.30 ? 367 ARG A NH2 1 
ATOM   2558  N  N   . LEU A 1 354 ? -28.916 12.613  -0.168  1.00 39.58 ? 368 LEU A N   1 
ATOM   2559  C  CA  . LEU A 1 354 ? -28.586 11.696  0.928   1.00 40.10 ? 368 LEU A CA  1 
ATOM   2560  C  C   . LEU A 1 354 ? -29.833 10.976  1.420   1.00 36.58 ? 368 LEU A C   1 
ATOM   2561  O  O   . LEU A 1 354 ? -29.804 9.782   1.689   1.00 34.90 ? 368 LEU A O   1 
ATOM   2562  C  CB  . LEU A 1 354 ? -27.919 12.425  2.096   1.00 38.78 ? 368 LEU A CB  1 
ATOM   2563  C  CG  . LEU A 1 354 ? -26.416 12.677  2.008   1.00 32.85 ? 368 LEU A CG  1 
ATOM   2564  C  CD1 . LEU A 1 354 ? -25.992 13.571  3.161   1.00 33.00 ? 368 LEU A CD1 1 
ATOM   2565  C  CD2 . LEU A 1 354 ? -25.639 11.366  2.032   1.00 30.16 ? 368 LEU A CD2 1 
ATOM   2566  N  N   . LEU A 1 355 ? -30.939 11.701  1.512   1.00 33.83 ? 369 LEU A N   1 
ATOM   2567  C  CA  . LEU A 1 355 ? -32.153 11.114  2.058   1.00 30.49 ? 369 LEU A CA  1 
ATOM   2568  C  C   . LEU A 1 355 ? -32.825 10.155  1.066   1.00 28.91 ? 369 LEU A C   1 
ATOM   2569  O  O   . LEU A 1 355 ? -33.373 9.127   1.463   1.00 36.55 ? 369 LEU A O   1 
ATOM   2570  C  CB  . LEU A 1 355 ? -33.113 12.210  2.534   1.00 37.65 ? 369 LEU A CB  1 
ATOM   2571  C  CG  . LEU A 1 355 ? -32.916 12.703  3.979   1.00 41.35 ? 369 LEU A CG  1 
ATOM   2572  C  CD1 . LEU A 1 355 ? -31.455 12.805  4.381   1.00 40.42 ? 369 LEU A CD1 1 
ATOM   2573  C  CD2 . LEU A 1 355 ? -33.605 14.047  4.182   1.00 45.32 ? 369 LEU A CD2 1 
ATOM   2574  N  N   . GLU A 1 356 ? -32.772 10.494  -0.219  1.00 34.69 ? 370 GLU A N   1 
ATOM   2575  C  CA  . GLU A 1 356 ? -33.314 9.636   -1.273  1.00 36.08 ? 370 GLU A CA  1 
ATOM   2576  C  C   . GLU A 1 356 ? -32.536 8.312   -1.324  1.00 38.68 ? 370 GLU A C   1 
ATOM   2577  O  O   . GLU A 1 356 ? -33.125 7.229   -1.349  1.00 37.75 ? 370 GLU A O   1 
ATOM   2578  C  CB  . GLU A 1 356 ? -33.277 10.362  -2.629  1.00 39.27 ? 370 GLU A CB  1 
ATOM   2579  C  CG  . GLU A 1 356 ? -34.222 11.572  -2.692  1.00 46.17 ? 370 GLU A CG  1 
ATOM   2580  C  CD  . GLU A 1 356 ? -34.092 12.411  -3.964  1.00 47.02 ? 370 GLU A CD  1 
ATOM   2581  O  OE1 . GLU A 1 356 ? -32.984 12.494  -4.534  1.00 41.48 ? 370 GLU A OE1 1 
ATOM   2582  O  OE2 . GLU A 1 356 ? -35.108 13.004  -4.387  1.00 53.90 ? 370 GLU A OE2 1 
ATOM   2583  N  N   . GLU A 1 357 ? -31.210 8.398   -1.313  1.00 38.51 ? 371 GLU A N   1 
ATOM   2584  C  CA  . GLU A 1 357 ? -30.401 7.184   -1.337  1.00 39.68 ? 371 GLU A CA  1 
ATOM   2585  C  C   . GLU A 1 357 ? -30.520 6.390   -0.030  1.00 38.80 ? 371 GLU A C   1 
ATOM   2586  O  O   . GLU A 1 357 ? -30.546 5.156   -0.046  1.00 33.63 ? 371 GLU A O   1 
ATOM   2587  C  CB  . GLU A 1 357 ? -28.943 7.505   -1.657  1.00 36.97 ? 371 GLU A CB  1 
ATOM   2588  C  CG  . GLU A 1 357 ? -28.722 8.118   -3.031  1.00 47.48 ? 371 GLU A CG  1 
ATOM   2589  C  CD  . GLU A 1 357 ? -29.239 7.241   -4.160  1.00 59.02 ? 371 GLU A CD  1 
ATOM   2590  O  OE1 . GLU A 1 357 ? -29.317 6.006   -3.981  1.00 60.59 ? 371 GLU A OE1 1 
ATOM   2591  O  OE2 . GLU A 1 357 ? -29.572 7.793   -5.232  1.00 65.25 ? 371 GLU A OE2 1 
ATOM   2592  N  N   . HIS A 1 358 ? -30.615 7.103   1.090   1.00 38.54 ? 372 HIS A N   1 
ATOM   2593  C  CA  . HIS A 1 358 ? -30.796 6.471   2.397   1.00 35.87 ? 372 HIS A CA  1 
ATOM   2594  C  C   . HIS A 1 358 ? -32.005 5.544   2.407   1.00 29.34 ? 372 HIS A C   1 
ATOM   2595  O  O   . HIS A 1 358 ? -31.937 4.438   2.937   1.00 27.55 ? 372 HIS A O   1 
ATOM   2596  C  CB  . HIS A 1 358 ? -30.944 7.527   3.500   1.00 34.05 ? 372 HIS A CB  1 
ATOM   2597  C  CG  . HIS A 1 358 ? -31.228 6.955   4.853   1.00 30.21 ? 372 HIS A CG  1 
ATOM   2598  N  ND1 . HIS A 1 358 ? -32.465 6.458   5.209   1.00 28.80 ? 372 HIS A ND1 1 
ATOM   2599  C  CD2 . HIS A 1 358 ? -30.437 6.801   5.943   1.00 34.08 ? 372 HIS A CD2 1 
ATOM   2600  C  CE1 . HIS A 1 358 ? -32.421 6.017   6.451   1.00 36.51 ? 372 HIS A CE1 1 
ATOM   2601  N  NE2 . HIS A 1 358 ? -31.200 6.215   6.922   1.00 31.79 ? 372 HIS A NE2 1 
ATOM   2602  N  N   . SER A 1 359 ? -33.108 5.999   1.817   1.00 36.04 ? 373 SER A N   1 
ATOM   2603  C  CA  . SER A 1 359 ? -34.341 5.220   1.797   1.00 36.65 ? 373 SER A CA  1 
ATOM   2604  C  C   . SER A 1 359 ? -34.223 3.909   1.001   1.00 41.51 ? 373 SER A C   1 
ATOM   2605  O  O   . SER A 1 359 ? -35.055 3.022   1.150   1.00 39.24 ? 373 SER A O   1 
ATOM   2606  C  CB  . SER A 1 359 ? -35.493 6.061   1.247   1.00 40.75 ? 373 SER A CB  1 
ATOM   2607  O  OG  . SER A 1 359 ? -35.317 6.303   -0.139  1.00 44.92 ? 373 SER A OG  1 
ATOM   2608  N  N   . ARG A 1 360 ? -33.193 3.794   0.164   1.00 42.44 ? 374 ARG A N   1 
ATOM   2609  C  CA  . ARG A 1 360 ? -32.962 2.581   -0.625  1.00 39.60 ? 374 ARG A CA  1 
ATOM   2610  C  C   . ARG A 1 360 ? -31.999 1.590   0.048   1.00 39.87 ? 374 ARG A C   1 
ATOM   2611  O  O   . ARG A 1 360 ? -31.647 0.568   -0.538  1.00 36.78 ? 374 ARG A O   1 
ATOM   2612  C  CB  . ARG A 1 360 ? -32.405 2.939   -2.005  1.00 37.14 ? 374 ARG A CB  1 
ATOM   2613  C  CG  . ARG A 1 360 ? -33.398 3.621   -2.950  1.00 44.50 ? 374 ARG A CG  1 
ATOM   2614  C  CD  . ARG A 1 360 ? -32.757 3.871   -4.311  1.00 43.69 ? 374 ARG A CD  1 
ATOM   2615  N  N   . ILE A 1 361 ? -31.559 1.892   1.263   1.00 32.02 ? 375 ILE A N   1 
ATOM   2616  C  CA  . ILE A 1 361 ? -30.634 0.999   1.955   1.00 35.30 ? 375 ILE A CA  1 
ATOM   2617  C  C   . ILE A 1 361 ? -31.399 -0.113  2.665   1.00 38.12 ? 375 ILE A C   1 
ATOM   2618  O  O   . ILE A 1 361 ? -32.197 0.145   3.567   1.00 37.26 ? 375 ILE A O   1 
ATOM   2619  C  CB  . ILE A 1 361 ? -29.718 1.773   2.940   1.00 35.62 ? 375 ILE A CB  1 
ATOM   2620  C  CG1 . ILE A 1 361 ? -28.789 2.704   2.169   1.00 32.26 ? 375 ILE A CG1 1 
ATOM   2621  C  CG2 . ILE A 1 361 ? -28.888 0.819   3.782   1.00 36.04 ? 375 ILE A CG2 1 
ATOM   2622  C  CD1 . ILE A 1 361 ? -28.054 3.682   3.048   1.00 30.13 ? 375 ILE A CD1 1 
ATOM   2623  N  N   . LYS A 1 362 ? -31.165 -1.348  2.232   1.00 35.31 ? 376 LYS A N   1 
ATOM   2624  C  CA  . LYS A 1 362 ? -31.855 -2.508  2.790   1.00 34.48 ? 376 LYS A CA  1 
ATOM   2625  C  C   . LYS A 1 362 ? -31.037 -3.170  3.897   1.00 31.36 ? 376 LYS A C   1 
ATOM   2626  O  O   . LYS A 1 362 ? -29.934 -3.654  3.659   1.00 31.52 ? 376 LYS A O   1 
ATOM   2627  C  CB  . LYS A 1 362 ? -32.138 -3.537  1.696   1.00 40.73 ? 376 LYS A CB  1 
ATOM   2628  N  N   . VAL A 1 363 ? -31.579 -3.183  5.109   1.00 30.61 ? 377 VAL A N   1 
ATOM   2629  C  CA  . VAL A 1 363 ? -30.958 -3.915  6.206   1.00 31.10 ? 377 VAL A CA  1 
ATOM   2630  C  C   . VAL A 1 363 ? -31.686 -5.229  6.432   1.00 32.81 ? 377 VAL A C   1 
ATOM   2631  O  O   . VAL A 1 363 ? -32.917 -5.260  6.496   1.00 27.74 ? 377 VAL A O   1 
ATOM   2632  C  CB  . VAL A 1 363 ? -30.952 -3.089  7.494   1.00 33.36 ? 377 VAL A CB  1 
ATOM   2633  C  CG1 . VAL A 1 363 ? -30.391 -3.910  8.651   1.00 35.35 ? 377 VAL A CG1 1 
ATOM   2634  C  CG2 . VAL A 1 363 ? -30.132 -1.816  7.283   1.00 31.36 ? 377 VAL A CG2 1 
ATOM   2635  N  N   . GLY A 1 364 ? -30.940 -6.325  6.525   1.00 34.89 ? 378 GLY A N   1 
ATOM   2636  C  CA  . GLY A 1 364 ? -31.574 -7.625  6.690   1.00 36.27 ? 378 GLY A CA  1 
ATOM   2637  C  C   . GLY A 1 364 ? -30.618 -8.791  6.870   1.00 33.72 ? 378 GLY A C   1 
ATOM   2638  O  O   . GLY A 1 364 ? -29.476 -8.619  7.282   1.00 29.12 ? 378 GLY A O   1 
ATOM   2639  N  N   . ASP A 1 365 ? -31.115 -9.984  6.567   1.00 29.12 ? 379 ASP A N   1 
ATOM   2640  C  CA  . ASP A 1 365 ? -30.338 -11.221 6.609   1.00 32.52 ? 379 ASP A CA  1 
ATOM   2641  C  C   . ASP A 1 365 ? -29.453 -11.302 5.370   1.00 33.29 ? 379 ASP A C   1 
ATOM   2642  O  O   . ASP A 1 365 ? -29.963 -11.398 4.254   1.00 32.49 ? 379 ASP A O   1 
ATOM   2643  C  CB  . ASP A 1 365 ? -31.314 -12.408 6.619   1.00 31.80 ? 379 ASP A CB  1 
ATOM   2644  C  CG  . ASP A 1 365 ? -30.636 -13.738 6.884   1.00 34.29 ? 379 ASP A CG  1 
ATOM   2645  O  OD1 . ASP A 1 365 ? -29.475 -13.938 6.461   1.00 34.98 ? 379 ASP A OD1 1 
ATOM   2646  O  OD2 . ASP A 1 365 ? -31.284 -14.594 7.524   1.00 36.51 ? 379 ASP A OD2 1 
ATOM   2647  N  N   . PRO A 1 366 ? -28.123 -11.297 5.562   1.00 26.04 ? 380 PRO A N   1 
ATOM   2648  C  CA  . PRO A 1 366 ? -27.192 -11.306 4.431   1.00 25.68 ? 380 PRO A CA  1 
ATOM   2649  C  C   . PRO A 1 366 ? -27.060 -12.685 3.793   1.00 28.62 ? 380 PRO A C   1 
ATOM   2650  O  O   . PRO A 1 366 ? -26.667 -12.790 2.634   1.00 33.52 ? 380 PRO A O   1 
ATOM   2651  C  CB  . PRO A 1 366 ? -25.873 -10.918 5.083   1.00 24.94 ? 380 PRO A CB  1 
ATOM   2652  C  CG  . PRO A 1 366 ? -25.959 -11.534 6.444   1.00 27.40 ? 380 PRO A CG  1 
ATOM   2653  C  CD  . PRO A 1 366 ? -27.420 -11.381 6.850   1.00 21.27 ? 380 PRO A CD  1 
ATOM   2654  N  N   . ALA A 1 367 ? -27.371 -13.725 4.556   1.00 30.07 ? 381 ALA A N   1 
ATOM   2655  C  CA  . ALA A 1 367 ? -27.255 -15.096 4.081   1.00 31.88 ? 381 ALA A CA  1 
ATOM   2656  C  C   . ALA A 1 367 ? -28.460 -15.467 3.236   1.00 36.09 ? 381 ALA A C   1 
ATOM   2657  O  O   . ALA A 1 367 ? -28.346 -16.225 2.274   1.00 40.10 ? 381 ALA A O   1 
ATOM   2658  C  CB  . ALA A 1 367 ? -27.141 -16.040 5.256   1.00 33.96 ? 381 ALA A CB  1 
ATOM   2659  N  N   . GLU A 1 368 ? -29.620 -14.937 3.609   1.00 35.75 ? 382 GLU A N   1 
ATOM   2660  C  CA  . GLU A 1 368 ? -30.869 -15.303 2.949   1.00 39.94 ? 382 GLU A CA  1 
ATOM   2661  C  C   . GLU A 1 368 ? -31.203 -14.331 1.821   1.00 41.39 ? 382 GLU A C   1 
ATOM   2662  O  O   . GLU A 1 368 ? -31.928 -14.673 0.888   1.00 42.64 ? 382 GLU A O   1 
ATOM   2663  C  CB  . GLU A 1 368 ? -32.016 -15.366 3.965   1.00 42.33 ? 382 GLU A CB  1 
ATOM   2664  N  N   . ASP A 1 369 ? -30.662 -13.120 1.905   1.00 37.89 ? 383 ASP A N   1 
ATOM   2665  C  CA  . ASP A 1 369 ? -30.985 -12.080 0.938   1.00 38.83 ? 383 ASP A CA  1 
ATOM   2666  C  C   . ASP A 1 369 ? -29.727 -11.350 0.502   1.00 38.07 ? 383 ASP A C   1 
ATOM   2667  O  O   . ASP A 1 369 ? -29.206 -10.492 1.230   1.00 34.33 ? 383 ASP A O   1 
ATOM   2668  C  CB  . ASP A 1 369 ? -31.996 -11.090 1.539   1.00 38.75 ? 383 ASP A CB  1 
ATOM   2669  C  CG  . ASP A 1 369 ? -32.526 -10.093 0.519   1.00 44.97 ? 383 ASP A CG  1 
ATOM   2670  O  OD1 . ASP A 1 369 ? -31.903 -9.916  -0.553  1.00 45.48 ? 383 ASP A OD1 1 
ATOM   2671  O  OD2 . ASP A 1 369 ? -33.575 -9.475  0.796   1.00 47.97 ? 383 ASP A OD2 1 
ATOM   2672  N  N   . PHE A 1 370 ? -29.250 -11.667 -0.698  1.00 36.46 ? 384 PHE A N   1 
ATOM   2673  C  CA  . PHE A 1 370 ? -28.018 -11.054 -1.198  1.00 38.95 ? 384 PHE A CA  1 
ATOM   2674  C  C   . PHE A 1 370 ? -28.213 -9.605  -1.639  1.00 39.14 ? 384 PHE A C   1 
ATOM   2675  O  O   . PHE A 1 370 ? -27.289 -8.973  -2.127  1.00 43.54 ? 384 PHE A O   1 
ATOM   2676  C  CB  . PHE A 1 370 ? -27.407 -11.872 -2.341  1.00 38.94 ? 384 PHE A CB  1 
ATOM   2677  C  CG  . PHE A 1 370 ? -26.687 -13.117 -1.889  1.00 43.16 ? 384 PHE A CG  1 
ATOM   2678  C  CD1 . PHE A 1 370 ? -26.878 -13.635 -0.612  1.00 40.04 ? 384 PHE A CD1 1 
ATOM   2679  C  CD2 . PHE A 1 370 ? -25.809 -13.767 -2.743  1.00 46.64 ? 384 PHE A CD2 1 
ATOM   2680  C  CE1 . PHE A 1 370 ? -26.222 -14.786 -0.206  1.00 36.04 ? 384 PHE A CE1 1 
ATOM   2681  C  CE2 . PHE A 1 370 ? -25.149 -14.913 -2.343  1.00 47.17 ? 384 PHE A CE2 1 
ATOM   2682  C  CZ  . PHE A 1 370 ? -25.350 -15.420 -1.070  1.00 43.00 ? 384 PHE A CZ  1 
ATOM   2683  N  N   . GLY A 1 371 ? -29.424 -9.092  -1.477  1.00 44.07 ? 385 GLY A N   1 
ATOM   2684  C  CA  . GLY A 1 371 ? -29.704 -7.706  -1.800  1.00 42.31 ? 385 GLY A CA  1 
ATOM   2685  C  C   . GLY A 1 371 ? -29.389 -6.809  -0.618  1.00 36.69 ? 385 GLY A C   1 
ATOM   2686  O  O   . GLY A 1 371 ? -29.361 -5.595  -0.747  1.00 33.14 ? 385 GLY A O   1 
ATOM   2687  N  N   . THR A 1 372 ? -29.147 -7.422  0.537   1.00 35.04 ? 386 THR A N   1 
ATOM   2688  C  CA  . THR A 1 372 ? -28.871 -6.692  1.771   1.00 32.78 ? 386 THR A CA  1 
ATOM   2689  C  C   . THR A 1 372 ? -27.657 -5.777  1.603   1.00 29.38 ? 386 THR A C   1 
ATOM   2690  O  O   . THR A 1 372 ? -26.620 -6.219  1.121   1.00 29.66 ? 386 THR A O   1 
ATOM   2691  C  CB  . THR A 1 372 ? -28.588 -7.683  2.927   1.00 32.17 ? 386 THR A CB  1 
ATOM   2692  O  OG1 . THR A 1 372 ? -29.757 -8.468  3.186   1.00 32.35 ? 386 THR A OG1 1 
ATOM   2693  C  CG2 . THR A 1 372 ? -28.180 -6.947  4.199   1.00 33.43 ? 386 THR A CG2 1 
ATOM   2694  N  N   . PHE A 1 373 ? -27.804 -4.508  1.988   1.00 24.02 ? 387 PHE A N   1 
ATOM   2695  C  CA  . PHE A 1 373 ? -26.700 -3.544  1.977   1.00 27.38 ? 387 PHE A CA  1 
ATOM   2696  C  C   . PHE A 1 373 ? -25.805 -3.786  3.190   1.00 32.94 ? 387 PHE A C   1 
ATOM   2697  O  O   . PHE A 1 373 ? -24.585 -3.860  3.073   1.00 25.28 ? 387 PHE A O   1 
ATOM   2698  C  CB  . PHE A 1 373 ? -27.248 -2.108  2.013   1.00 25.91 ? 387 PHE A CB  1 
ATOM   2699  C  CG  . PHE A 1 373 ? -26.214 -1.047  1.764   1.00 38.08 ? 387 PHE A CG  1 
ATOM   2700  C  CD1 . PHE A 1 373 ? -26.179 -0.373  0.557   1.00 46.96 ? 387 PHE A CD1 1 
ATOM   2701  C  CD2 . PHE A 1 373 ? -25.283 -0.710  2.743   1.00 37.18 ? 387 PHE A CD2 1 
ATOM   2702  C  CE1 . PHE A 1 373 ? -25.231 0.613   0.324   1.00 48.18 ? 387 PHE A CE1 1 
ATOM   2703  C  CE2 . PHE A 1 373 ? -24.334 0.269   2.514   1.00 37.93 ? 387 PHE A CE2 1 
ATOM   2704  C  CZ  . PHE A 1 373 ? -24.303 0.931   1.309   1.00 41.09 ? 387 PHE A CZ  1 
ATOM   2705  N  N   . PHE A 1 374 ? -26.421 -3.860  4.362   1.00 31.28 ? 388 PHE A N   1 
ATOM   2706  C  CA  . PHE A 1 374 ? -25.712 -4.288  5.557   1.00 27.84 ? 388 PHE A CA  1 
ATOM   2707  C  C   . PHE A 1 374 ? -26.696 -4.880  6.548   1.00 24.67 ? 388 PHE A C   1 
ATOM   2708  O  O   . PHE A 1 374 ? -27.907 -4.660  6.438   1.00 27.46 ? 388 PHE A O   1 
ATOM   2709  C  CB  . PHE A 1 374 ? -24.875 -3.160  6.172   1.00 25.17 ? 388 PHE A CB  1 
ATOM   2710  C  CG  . PHE A 1 374 ? -25.679 -2.113  6.912   1.00 22.82 ? 388 PHE A CG  1 
ATOM   2711  C  CD1 . PHE A 1 374 ? -26.192 -1.006  6.245   1.00 23.03 ? 388 PHE A CD1 1 
ATOM   2712  C  CD2 . PHE A 1 374 ? -25.878 -2.216  8.284   1.00 24.47 ? 388 PHE A CD2 1 
ATOM   2713  C  CE1 . PHE A 1 374 ? -26.917 -0.036  6.937   1.00 25.03 ? 388 PHE A CE1 1 
ATOM   2714  C  CE2 . PHE A 1 374 ? -26.603 -1.261  8.983   1.00 22.78 ? 388 PHE A CE2 1 
ATOM   2715  C  CZ  . PHE A 1 374 ? -27.116 -0.161  8.308   1.00 23.25 ? 388 PHE A CZ  1 
ATOM   2716  N  N   . SER A 1 375 ? -26.169 -5.647  7.498   1.00 22.93 ? 389 SER A N   1 
ATOM   2717  C  CA  . SER A 1 375 ? -26.978 -6.444  8.411   1.00 25.29 ? 389 SER A CA  1 
ATOM   2718  C  C   . SER A 1 375 ? -26.846 -5.921  9.841   1.00 23.06 ? 389 SER A C   1 
ATOM   2719  O  O   . SER A 1 375 ? -26.400 -4.789  10.051  1.00 23.45 ? 389 SER A O   1 
ATOM   2720  C  CB  . SER A 1 375 ? -26.533 -7.920  8.329   1.00 29.84 ? 389 SER A CB  1 
ATOM   2721  O  OG  . SER A 1 375 ? -27.426 -8.808  8.998   1.00 30.45 ? 389 SER A OG  1 
ATOM   2722  N  N   . ALA A 1 376 ? -27.225 -6.753  10.811  1.00 22.93 ? 390 ALA A N   1 
ATOM   2723  C  CA  . ALA A 1 376 ? -27.128 -6.422  12.235  1.00 23.47 ? 390 ALA A CA  1 
ATOM   2724  C  C   . ALA A 1 376 ? -25.700 -6.101  12.654  1.00 24.49 ? 390 ALA A C   1 
ATOM   2725  O  O   . ALA A 1 376 ? -24.758 -6.604  12.062  1.00 23.80 ? 390 ALA A O   1 
ATOM   2726  C  CB  . ALA A 1 376 ? -27.648 -7.563  13.073  1.00 24.27 ? 390 ALA A CB  1 
ATOM   2727  N  N   . VAL A 1 377 ? -25.558 -5.266  13.679  1.00 18.19 ? 391 VAL A N   1 
ATOM   2728  C  CA  . VAL A 1 377 ? -24.262 -4.989  14.270  1.00 17.46 ? 391 VAL A CA  1 
ATOM   2729  C  C   . VAL A 1 377 ? -23.872 -6.193  15.136  1.00 21.49 ? 391 VAL A C   1 
ATOM   2730  O  O   . VAL A 1 377 ? -24.698 -7.082  15.400  1.00 21.32 ? 391 VAL A O   1 
ATOM   2731  C  CB  . VAL A 1 377 ? -24.265 -3.686  15.070  1.00 21.02 ? 391 VAL A CB  1 
ATOM   2732  C  CG1 . VAL A 1 377 ? -24.760 -2.509  14.179  1.00 20.47 ? 391 VAL A CG1 1 
ATOM   2733  C  CG2 . VAL A 1 377 ? -25.133 -3.831  16.324  1.00 21.54 ? 391 VAL A CG2 1 
ATOM   2734  N  N   . ILE A 1 378 ? -22.615 -6.220  15.566  1.00 20.73 ? 392 ILE A N   1 
ATOM   2735  C  CA  . ILE A 1 378 ? -21.941 -7.471  15.964  1.00 17.44 ? 392 ILE A CA  1 
ATOM   2736  C  C   . ILE A 1 378 ? -22.438 -8.156  17.248  1.00 23.68 ? 392 ILE A C   1 
ATOM   2737  O  O   . ILE A 1 378 ? -22.427 -9.384  17.328  1.00 22.41 ? 392 ILE A O   1 
ATOM   2738  C  CB  . ILE A 1 378 ? -20.404 -7.259  16.023  1.00 22.94 ? 392 ILE A CB  1 
ATOM   2739  C  CG1 . ILE A 1 378 ? -19.654 -8.595  16.055  1.00 24.65 ? 392 ILE A CG1 1 
ATOM   2740  C  CG2 . ILE A 1 378 ? -20.018 -6.373  17.203  1.00 19.00 ? 392 ILE A CG2 1 
ATOM   2741  C  CD1 . ILE A 1 378 ? -19.730 -9.384  14.760  1.00 20.58 ? 392 ILE A CD1 1 
ATOM   2742  N  N   . ASP A 1 379 ? -22.874 -7.382  18.242  1.00 20.16 ? 393 ASP A N   1 
ATOM   2743  C  CA  . ASP A 1 379 ? -23.282 -7.962  19.521  1.00 21.02 ? 393 ASP A CA  1 
ATOM   2744  C  C   . ASP A 1 379 ? -24.182 -7.034  20.340  1.00 29.41 ? 393 ASP A C   1 
ATOM   2745  O  O   . ASP A 1 379 ? -24.492 -5.909  19.922  1.00 24.92 ? 393 ASP A O   1 
ATOM   2746  C  CB  . ASP A 1 379 ? -22.063 -8.365  20.359  1.00 26.99 ? 393 ASP A CB  1 
ATOM   2747  C  CG  . ASP A 1 379 ? -21.447 -7.190  21.111  1.00 29.04 ? 393 ASP A CG  1 
ATOM   2748  O  OD1 . ASP A 1 379 ? -21.305 -6.103  20.523  1.00 23.94 ? 393 ASP A OD1 1 
ATOM   2749  O  OD2 . ASP A 1 379 ? -21.111 -7.344  22.299  1.00 30.71 ? 393 ASP A OD2 1 
ATOM   2750  N  N   . ALA A 1 380 ? -24.581 -7.514  21.517  1.00 26.63 ? 394 ALA A N   1 
ATOM   2751  C  CA  . ALA A 1 380 ? -25.492 -6.773  22.379  1.00 33.46 ? 394 ALA A CA  1 
ATOM   2752  C  C   . ALA A 1 380 ? -24.852 -5.524  22.980  1.00 30.14 ? 394 ALA A C   1 
ATOM   2753  O  O   . ALA A 1 380 ? -25.502 -4.490  23.092  1.00 23.59 ? 394 ALA A O   1 
ATOM   2754  C  CB  . ALA A 1 380 ? -26.046 -7.675  23.472  1.00 31.25 ? 394 ALA A CB  1 
ATOM   2755  N  N   . LYS A 1 381 ? -23.587 -5.620  23.380  1.00 24.52 ? 395 LYS A N   1 
ATOM   2756  C  CA  . LYS A 1 381 ? -22.888 -4.466  23.933  1.00 27.98 ? 395 LYS A CA  1 
ATOM   2757  C  C   . LYS A 1 381 ? -22.791 -3.357  22.872  1.00 30.22 ? 395 LYS A C   1 
ATOM   2758  O  O   . LYS A 1 381 ? -23.029 -2.171  23.161  1.00 22.60 ? 395 LYS A O   1 
ATOM   2759  C  CB  . LYS A 1 381 ? -21.502 -4.869  24.456  1.00 28.90 ? 395 LYS A CB  1 
ATOM   2760  N  N   . SER A 1 382 ? -22.482 -3.736  21.635  1.00 25.83 ? 396 SER A N   1 
ATOM   2761  C  CA  . SER A 1 382 ? -22.414 -2.740  20.564  1.00 24.96 ? 396 SER A CA  1 
ATOM   2762  C  C   . SER A 1 382 ? -23.785 -2.137  20.315  1.00 28.29 ? 396 SER A C   1 
ATOM   2763  O  O   . SER A 1 382 ? -23.915 -0.924  20.174  1.00 28.27 ? 396 SER A O   1 
ATOM   2764  C  CB  . SER A 1 382 ? -21.847 -3.326  19.264  1.00 24.94 ? 396 SER A CB  1 
ATOM   2765  O  OG  . SER A 1 382 ? -20.456 -3.564  19.410  1.00 37.99 ? 396 SER A OG  1 
ATOM   2766  N  N   . PHE A 1 383 ? -24.803 -2.992  20.279  1.00 28.41 ? 397 PHE A N   1 
ATOM   2767  C  CA  . PHE A 1 383 ? -26.170 -2.546  20.052  1.00 24.74 ? 397 PHE A CA  1 
ATOM   2768  C  C   . PHE A 1 383 ? -26.586 -1.512  21.097  1.00 27.18 ? 397 PHE A C   1 
ATOM   2769  O  O   . PHE A 1 383 ? -27.241 -0.524  20.780  1.00 28.35 ? 397 PHE A O   1 
ATOM   2770  C  CB  . PHE A 1 383 ? -27.130 -3.739  20.089  1.00 28.18 ? 397 PHE A CB  1 
ATOM   2771  C  CG  . PHE A 1 383 ? -28.580 -3.372  19.851  1.00 29.96 ? 397 PHE A CG  1 
ATOM   2772  C  CD1 . PHE A 1 383 ? -29.395 -2.971  20.899  1.00 31.50 ? 397 PHE A CD1 1 
ATOM   2773  C  CD2 . PHE A 1 383 ? -29.127 -3.450  18.580  1.00 30.21 ? 397 PHE A CD2 1 
ATOM   2774  C  CE1 . PHE A 1 383 ? -30.733 -2.633  20.681  1.00 30.82 ? 397 PHE A CE1 1 
ATOM   2775  C  CE2 . PHE A 1 383 ? -30.457 -3.134  18.355  1.00 29.24 ? 397 PHE A CE2 1 
ATOM   2776  C  CZ  . PHE A 1 383 ? -31.262 -2.722  19.409  1.00 32.60 ? 397 PHE A CZ  1 
ATOM   2777  N  N   . ALA A 1 384 ? -26.214 -1.766  22.347  1.00 23.73 ? 398 ALA A N   1 
ATOM   2778  C  CA  . ALA A 1 384 ? -26.564 -0.891  23.448  1.00 30.89 ? 398 ALA A CA  1 
ATOM   2779  C  C   . ALA A 1 384 ? -25.863 0.454   23.298  1.00 33.35 ? 398 ALA A C   1 
ATOM   2780  O  O   . ALA A 1 384 ? -26.483 1.505   23.474  1.00 29.07 ? 398 ALA A O   1 
ATOM   2781  C  CB  . ALA A 1 384 ? -26.207 -1.545  24.783  1.00 31.46 ? 398 ALA A CB  1 
ATOM   2782  N  N   . ARG A 1 385 ? -24.574 0.412   22.971  1.00 27.68 ? 399 ARG A N   1 
ATOM   2783  C  CA  . ARG A 1 385 ? -23.793 1.626   22.775  1.00 31.04 ? 399 ARG A CA  1 
ATOM   2784  C  C   . ARG A 1 385 ? -24.422 2.476   21.677  1.00 31.11 ? 399 ARG A C   1 
ATOM   2785  O  O   . ARG A 1 385 ? -24.646 3.673   21.859  1.00 30.07 ? 399 ARG A O   1 
ATOM   2786  C  CB  . ARG A 1 385 ? -22.336 1.298   22.423  1.00 32.68 ? 399 ARG A CB  1 
ATOM   2787  C  CG  . ARG A 1 385 ? -21.470 2.536   22.171  1.00 32.77 ? 399 ARG A CG  1 
ATOM   2788  C  CD  . ARG A 1 385 ? -20.057 2.190   21.698  1.00 31.29 ? 399 ARG A CD  1 
ATOM   2789  N  NE  . ARG A 1 385 ? -20.041 1.595   20.363  1.00 34.90 ? 399 ARG A NE  1 
ATOM   2790  C  CZ  . ARG A 1 385 ? -19.724 0.323   20.122  1.00 33.19 ? 399 ARG A CZ  1 
ATOM   2791  N  NH1 . ARG A 1 385 ? -19.742 -0.155  18.877  1.00 29.42 ? 399 ARG A NH1 1 
ATOM   2792  N  NH2 . ARG A 1 385 ? -19.392 -0.471  21.132  1.00 30.91 ? 399 ARG A NH2 1 
ATOM   2793  N  N   . ILE A 1 386 ? -24.724 1.843   20.549  1.00 25.23 ? 400 ILE A N   1 
ATOM   2794  C  CA  . ILE A 1 386 ? -25.330 2.533   19.416  1.00 23.64 ? 400 ILE A CA  1 
ATOM   2795  C  C   . ILE A 1 386 ? -26.681 3.133   19.790  1.00 26.76 ? 400 ILE A C   1 
ATOM   2796  O  O   . ILE A 1 386 ? -26.978 4.284   19.446  1.00 26.06 ? 400 ILE A O   1 
ATOM   2797  C  CB  . ILE A 1 386 ? -25.482 1.581   18.209  1.00 27.61 ? 400 ILE A CB  1 
ATOM   2798  C  CG1 . ILE A 1 386 ? -24.098 1.105   17.749  1.00 31.74 ? 400 ILE A CG1 1 
ATOM   2799  C  CG2 . ILE A 1 386 ? -26.189 2.267   17.063  1.00 21.50 ? 400 ILE A CG2 1 
ATOM   2800  C  CD1 . ILE A 1 386 ? -24.148 0.041   16.670  1.00 33.15 ? 400 ILE A CD1 1 
ATOM   2801  N  N   . LYS A 1 387 ? -27.487 2.347   20.496  1.00 28.39 ? 401 LYS A N   1 
ATOM   2802  C  CA  . LYS A 1 387 ? -28.806 2.769   20.929  1.00 27.97 ? 401 LYS A CA  1 
ATOM   2803  C  C   . LYS A 1 387 ? -28.731 4.024   21.803  1.00 30.18 ? 401 LYS A C   1 
ATOM   2804  O  O   . LYS A 1 387 ? -29.615 4.868   21.738  1.00 27.02 ? 401 LYS A O   1 
ATOM   2805  C  CB  . LYS A 1 387 ? -29.523 1.639   21.673  1.00 26.46 ? 401 LYS A CB  1 
ATOM   2806  C  CG  . LYS A 1 387 ? -30.960 1.960   22.081  1.00 29.02 ? 401 LYS A CG  1 
ATOM   2807  N  N   . LYS A 1 388 ? -27.672 4.150   22.603  1.00 27.73 ? 402 LYS A N   1 
ATOM   2808  C  CA  . LYS A 1 388 ? -27.533 5.307   23.490  1.00 31.96 ? 402 LYS A CA  1 
ATOM   2809  C  C   . LYS A 1 388 ? -27.186 6.552   22.690  1.00 29.57 ? 402 LYS A C   1 
ATOM   2810  O  O   . LYS A 1 388 ? -27.626 7.657   23.017  1.00 30.56 ? 402 LYS A O   1 
ATOM   2811  C  CB  . LYS A 1 388 ? -26.486 5.054   24.580  1.00 31.49 ? 402 LYS A CB  1 
ATOM   2812  N  N   . TRP A 1 389 ? -26.400 6.376   21.632  1.00 24.67 ? 403 TRP A N   1 
ATOM   2813  C  CA  . TRP A 1 389 ? -26.087 7.496   20.756  1.00 27.55 ? 403 TRP A CA  1 
ATOM   2814  C  C   . TRP A 1 389 ? -27.315 7.961   19.988  1.00 28.66 ? 403 TRP A C   1 
ATOM   2815  O  O   . TRP A 1 389 ? -27.479 9.157   19.746  1.00 23.94 ? 403 TRP A O   1 
ATOM   2816  C  CB  . TRP A 1 389 ? -24.946 7.163   19.797  1.00 21.04 ? 403 TRP A CB  1 
ATOM   2817  C  CG  . TRP A 1 389 ? -23.625 7.295   20.445  1.00 22.82 ? 403 TRP A CG  1 
ATOM   2818  C  CD1 . TRP A 1 389 ? -22.840 6.285   20.929  1.00 23.71 ? 403 TRP A CD1 1 
ATOM   2819  C  CD2 . TRP A 1 389 ? -22.931 8.511   20.712  1.00 24.47 ? 403 TRP A CD2 1 
ATOM   2820  N  NE1 . TRP A 1 389 ? -21.692 6.806   21.472  1.00 27.65 ? 403 TRP A NE1 1 
ATOM   2821  C  CE2 . TRP A 1 389 ? -21.723 8.173   21.350  1.00 29.58 ? 403 TRP A CE2 1 
ATOM   2822  C  CE3 . TRP A 1 389 ? -23.208 9.860   20.463  1.00 27.85 ? 403 TRP A CE3 1 
ATOM   2823  C  CZ2 . TRP A 1 389 ? -20.794 9.130   21.744  1.00 33.19 ? 403 TRP A CZ2 1 
ATOM   2824  C  CZ3 . TRP A 1 389 ? -22.284 10.811  20.856  1.00 32.54 ? 403 TRP A CZ3 1 
ATOM   2825  C  CH2 . TRP A 1 389 ? -21.091 10.442  21.489  1.00 33.69 ? 403 TRP A CH2 1 
ATOM   2826  N  N   . LEU A 1 390 ? -28.178 7.020   19.620  1.00 26.63 ? 404 LEU A N   1 
ATOM   2827  C  CA  . LEU A 1 390 ? -29.416 7.366   18.924  1.00 25.69 ? 404 LEU A CA  1 
ATOM   2828  C  C   . LEU A 1 390 ? -30.342 8.206   19.802  1.00 33.27 ? 404 LEU A C   1 
ATOM   2829  O  O   . LEU A 1 390 ? -30.939 9.184   19.331  1.00 35.39 ? 404 LEU A O   1 
ATOM   2830  C  CB  . LEU A 1 390 ? -30.139 6.103   18.440  1.00 25.04 ? 404 LEU A CB  1 
ATOM   2831  C  CG  . LEU A 1 390 ? -29.459 5.258   17.358  1.00 29.80 ? 404 LEU A CG  1 
ATOM   2832  C  CD1 . LEU A 1 390 ? -30.261 3.995   17.068  1.00 37.16 ? 404 LEU A CD1 1 
ATOM   2833  C  CD2 . LEU A 1 390 ? -29.278 6.081   16.090  1.00 23.76 ? 404 LEU A CD2 1 
ATOM   2834  N  N   . GLU A 1 391 ? -30.468 7.820   21.071  1.00 30.26 ? 405 GLU A N   1 
ATOM   2835  C  CA  . GLU A 1 391 ? -31.281 8.577   22.022  1.00 31.58 ? 405 GLU A CA  1 
ATOM   2836  C  C   . GLU A 1 391 ? -30.649 9.943   22.308  1.00 35.42 ? 405 GLU A C   1 
ATOM   2837  O  O   . GLU A 1 391 ? -31.350 10.948  22.471  1.00 34.14 ? 405 GLU A O   1 
ATOM   2838  C  CB  . GLU A 1 391 ? -31.488 7.785   23.320  1.00 36.88 ? 405 GLU A CB  1 
ATOM   2839  C  CG  . GLU A 1 391 ? -32.078 8.593   24.478  1.00 44.18 ? 405 GLU A CG  1 
ATOM   2840  C  CD  . GLU A 1 391 ? -33.490 9.125   24.208  1.00 50.46 ? 405 GLU A CD  1 
ATOM   2841  O  OE1 . GLU A 1 391 ? -34.195 8.597   23.316  1.00 47.75 ? 405 GLU A OE1 1 
ATOM   2842  O  OE2 . GLU A 1 391 ? -33.896 10.082  24.903  1.00 56.03 ? 405 GLU A OE2 1 
ATOM   2843  N  N   . HIS A 1 392 ? -29.321 9.973   22.358  1.00 32.84 ? 406 HIS A N   1 
ATOM   2844  C  CA  . HIS A 1 392 ? -28.592 11.235  22.454  1.00 32.79 ? 406 HIS A CA  1 
ATOM   2845  C  C   . HIS A 1 392 ? -28.877 12.152  21.258  1.00 32.95 ? 406 HIS A C   1 
ATOM   2846  O  O   . HIS A 1 392 ? -29.109 13.358  21.424  1.00 30.65 ? 406 HIS A O   1 
ATOM   2847  C  CB  . HIS A 1 392 ? -27.086 10.980  22.571  1.00 33.80 ? 406 HIS A CB  1 
ATOM   2848  C  CG  . HIS A 1 392 ? -26.261 12.225  22.481  1.00 38.55 ? 406 HIS A CG  1 
ATOM   2849  N  ND1 . HIS A 1 392 ? -26.077 13.078  23.550  1.00 38.09 ? 406 HIS A ND1 1 
ATOM   2850  C  CD2 . HIS A 1 392 ? -25.580 12.772  21.447  1.00 36.04 ? 406 HIS A CD2 1 
ATOM   2851  C  CE1 . HIS A 1 392 ? -25.317 14.090  23.180  1.00 37.95 ? 406 HIS A CE1 1 
ATOM   2852  N  NE2 . HIS A 1 392 ? -25.000 13.928  21.907  1.00 40.05 ? 406 HIS A NE2 1 
ATOM   2853  N  N   . ALA A 1 393 ? -28.859 11.584  20.054  1.00 30.55 ? 407 ALA A N   1 
ATOM   2854  C  CA  . ALA A 1 393 ? -29.179 12.351  18.847  1.00 31.76 ? 407 ALA A CA  1 
ATOM   2855  C  C   . ALA A 1 393 ? -30.604 12.879  18.899  1.00 36.72 ? 407 ALA A C   1 
ATOM   2856  O  O   . ALA A 1 393 ? -30.881 14.017  18.500  1.00 27.77 ? 407 ALA A O   1 
ATOM   2857  C  CB  . ALA A 1 393 ? -28.976 11.494  17.598  1.00 30.88 ? 407 ALA A CB  1 
ATOM   2858  N  N   . ARG A 1 394 ? -31.506 12.053  19.410  1.00 35.04 ? 408 ARG A N   1 
ATOM   2859  C  CA  . ARG A 1 394 ? -32.908 12.426  19.478  1.00 38.28 ? 408 ARG A CA  1 
ATOM   2860  C  C   . ARG A 1 394 ? -33.166 13.563  20.471  1.00 33.11 ? 408 ARG A C   1 
ATOM   2861  O  O   . ARG A 1 394 ? -33.959 14.453  20.199  1.00 33.38 ? 408 ARG A O   1 
ATOM   2862  C  CB  . ARG A 1 394 ? -33.767 11.209  19.834  1.00 40.58 ? 408 ARG A CB  1 
ATOM   2863  C  CG  . ARG A 1 394 ? -35.268 11.461  19.760  1.00 41.12 ? 408 ARG A CG  1 
ATOM   2864  C  CD  . ARG A 1 394 ? -36.039 10.430  20.589  1.00 42.24 ? 408 ARG A CD  1 
ATOM   2865  N  NE  . ARG A 1 394 ? -35.766 10.576  22.018  1.00 38.70 ? 408 ARG A NE  1 
ATOM   2866  C  CZ  . ARG A 1 394 ? -36.335 11.492  22.802  1.00 38.39 ? 408 ARG A CZ  1 
ATOM   2867  N  NH1 . ARG A 1 394 ? -36.017 11.553  24.090  1.00 41.23 ? 408 ARG A NH1 1 
ATOM   2868  N  NH2 . ARG A 1 394 ? -37.227 12.346  22.302  1.00 42.21 ? 408 ARG A NH2 1 
ATOM   2869  N  N   . SER A 1 395 ? -32.484 13.540  21.610  1.00 36.69 ? 409 SER A N   1 
ATOM   2870  C  CA  . SER A 1 395 ? -32.839 14.427  22.717  1.00 46.16 ? 409 SER A CA  1 
ATOM   2871  C  C   . SER A 1 395 ? -31.997 15.702  22.818  1.00 46.62 ? 409 SER A C   1 
ATOM   2872  O  O   . SER A 1 395 ? -32.450 16.701  23.375  1.00 52.45 ? 409 SER A O   1 
ATOM   2873  C  CB  . SER A 1 395 ? -32.783 13.668  24.045  1.00 43.97 ? 409 SER A CB  1 
ATOM   2874  O  OG  . SER A 1 395 ? -31.455 13.265  24.332  1.00 46.26 ? 409 SER A OG  1 
ATOM   2875  N  N   . SER A 1 396 ? -30.781 15.665  22.287  1.00 37.27 ? 410 SER A N   1 
ATOM   2876  C  CA  . SER A 1 396 ? -29.883 16.816  22.346  1.00 39.44 ? 410 SER A CA  1 
ATOM   2877  C  C   . SER A 1 396 ? -30.378 18.006  21.519  1.00 45.85 ? 410 SER A C   1 
ATOM   2878  O  O   . SER A 1 396 ? -30.793 17.844  20.370  1.00 40.62 ? 410 SER A O   1 
ATOM   2879  C  CB  . SER A 1 396 ? -28.478 16.425  21.886  1.00 44.62 ? 410 SER A CB  1 
ATOM   2880  O  OG  . SER A 1 396 ? -27.712 17.579  21.570  1.00 47.61 ? 410 SER A OG  1 
ATOM   2881  N  N   . PRO A 1 397 ? -30.323 19.213  22.109  1.00 52.10 ? 411 PRO A N   1 
ATOM   2882  C  CA  . PRO A 1 397 ? -30.726 20.467  21.461  1.00 51.43 ? 411 PRO A CA  1 
ATOM   2883  C  C   . PRO A 1 397 ? -29.915 20.769  20.204  1.00 47.87 ? 411 PRO A C   1 
ATOM   2884  O  O   . PRO A 1 397 ? -30.421 21.416  19.291  1.00 50.40 ? 411 PRO A O   1 
ATOM   2885  C  CB  . PRO A 1 397 ? -30.421 21.525  22.530  1.00 53.98 ? 411 PRO A CB  1 
ATOM   2886  C  CG  . PRO A 1 397 ? -30.432 20.779  23.817  1.00 54.08 ? 411 PRO A CG  1 
ATOM   2887  C  CD  . PRO A 1 397 ? -29.888 19.427  23.499  1.00 52.47 ? 411 PRO A CD  1 
ATOM   2888  N  N   . SER A 1 398 ? -28.675 20.296  20.157  1.00 44.54 ? 412 SER A N   1 
ATOM   2889  C  CA  . SER A 1 398 ? -27.779 20.620  19.056  1.00 45.64 ? 412 SER A CA  1 
ATOM   2890  C  C   . SER A 1 398 ? -27.905 19.657  17.879  1.00 40.29 ? 412 SER A C   1 
ATOM   2891  O  O   . SER A 1 398 ? -27.340 19.907  16.808  1.00 35.05 ? 412 SER A O   1 
ATOM   2892  C  CB  . SER A 1 398 ? -26.331 20.640  19.552  1.00 53.87 ? 412 SER A CB  1 
ATOM   2893  O  OG  . SER A 1 398 ? -26.163 21.600  20.583  1.00 57.16 ? 412 SER A OG  1 
ATOM   2894  N  N   . LEU A 1 399 ? -28.653 18.571  18.072  1.00 34.99 ? 413 LEU A N   1 
ATOM   2895  C  CA  . LEU A 1 399 ? -28.720 17.494  17.081  1.00 31.23 ? 413 LEU A CA  1 
ATOM   2896  C  C   . LEU A 1 399 ? -30.130 17.256  16.533  1.00 34.23 ? 413 LEU A C   1 
ATOM   2897  O  O   . LEU A 1 399 ? -31.094 17.247  17.291  1.00 38.90 ? 413 LEU A O   1 
ATOM   2898  C  CB  . LEU A 1 399 ? -28.239 16.192  17.704  1.00 27.72 ? 413 LEU A CB  1 
ATOM   2899  C  CG  . LEU A 1 399 ? -26.859 16.221  18.361  1.00 29.04 ? 413 LEU A CG  1 
ATOM   2900  C  CD1 . LEU A 1 399 ? -26.510 14.847  18.907  1.00 26.10 ? 413 LEU A CD1 1 
ATOM   2901  C  CD2 . LEU A 1 399 ? -25.817 16.679  17.359  1.00 31.46 ? 413 LEU A CD2 1 
ATOM   2902  N  N   . THR A 1 400 ? -30.225 17.019  15.225  1.00 30.11 ? 414 THR A N   1 
ATOM   2903  C  CA  . THR A 1 400 ? -31.472 16.618  14.584  1.00 34.72 ? 414 THR A CA  1 
ATOM   2904  C  C   . THR A 1 400 ? -31.260 15.335  13.787  1.00 34.25 ? 414 THR A C   1 
ATOM   2905  O  O   . THR A 1 400 ? -30.404 15.287  12.905  1.00 37.07 ? 414 THR A O   1 
ATOM   2906  C  CB  . THR A 1 400 ? -31.935 17.690  13.594  1.00 36.99 ? 414 THR A CB  1 
ATOM   2907  O  OG1 . THR A 1 400 ? -32.072 18.937  14.280  1.00 44.44 ? 414 THR A OG1 1 
ATOM   2908  C  CG2 . THR A 1 400 ? -33.264 17.294  12.959  1.00 42.42 ? 414 THR A CG2 1 
ATOM   2909  N  N   . ILE A 1 401 ? -32.028 14.294  14.083  1.00 31.10 ? 415 ILE A N   1 
ATOM   2910  C  CA  . ILE A 1 401 ? -31.946 13.076  13.276  1.00 32.30 ? 415 ILE A CA  1 
ATOM   2911  C  C   . ILE A 1 401 ? -32.604 13.351  11.918  1.00 41.77 ? 415 ILE A C   1 
ATOM   2912  O  O   . ILE A 1 401 ? -33.791 13.682  11.852  1.00 43.17 ? 415 ILE A O   1 
ATOM   2913  C  CB  . ILE A 1 401 ? -32.621 11.894  13.975  1.00 36.24 ? 415 ILE A CB  1 
ATOM   2914  C  CG1 . ILE A 1 401 ? -31.911 11.599  15.296  1.00 32.00 ? 415 ILE A CG1 1 
ATOM   2915  C  CG2 . ILE A 1 401 ? -32.634 10.658  13.072  1.00 33.49 ? 415 ILE A CG2 1 
ATOM   2916  C  CD1 . ILE A 1 401 ? -32.504 10.435  16.061  1.00 35.75 ? 415 ILE A CD1 1 
ATOM   2917  N  N   . LEU A 1 402 ? -31.830 13.237  10.842  1.00 27.48 ? 416 LEU A N   1 
ATOM   2918  C  CA  . LEU A 1 402 ? -32.339 13.544  9.506   1.00 31.92 ? 416 LEU A CA  1 
ATOM   2919  C  C   . LEU A 1 402 ? -33.041 12.341  8.891   1.00 31.48 ? 416 LEU A C   1 
ATOM   2920  O  O   . LEU A 1 402 ? -33.996 12.491  8.119   1.00 30.35 ? 416 LEU A O   1 
ATOM   2921  C  CB  . LEU A 1 402 ? -31.199 13.993  8.599   1.00 29.69 ? 416 LEU A CB  1 
ATOM   2922  C  CG  . LEU A 1 402 ? -30.592 15.345  8.950   1.00 35.04 ? 416 LEU A CG  1 
ATOM   2923  C  CD1 . LEU A 1 402 ? -29.538 15.718  7.924   1.00 36.02 ? 416 LEU A CD1 1 
ATOM   2924  C  CD2 . LEU A 1 402 ? -31.695 16.386  9.007   1.00 29.61 ? 416 LEU A CD2 1 
ATOM   2925  N  N   . ALA A 1 403 ? -32.551 11.154  9.243   1.00 32.42 ? 417 ALA A N   1 
ATOM   2926  C  CA  . ALA A 1 403 ? -33.073 9.895   8.724   1.00 32.87 ? 417 ALA A CA  1 
ATOM   2927  C  C   . ALA A 1 403 ? -32.669 8.735   9.631   1.00 35.39 ? 417 ALA A C   1 
ATOM   2928  O  O   . ALA A 1 403 ? -31.607 8.768   10.259  1.00 30.98 ? 417 ALA A O   1 
ATOM   2929  C  CB  . ALA A 1 403 ? -32.572 9.659   7.309   1.00 31.46 ? 417 ALA A CB  1 
ATOM   2930  N  N   . GLY A 1 404 ? -33.513 7.706   9.681   1.00 25.90 ? 418 GLY A N   1 
ATOM   2931  C  CA  . GLY A 1 404 ? -33.317 6.589   10.586  1.00 25.81 ? 418 GLY A CA  1 
ATOM   2932  C  C   . GLY A 1 404 ? -33.493 6.978   12.048  1.00 34.21 ? 418 GLY A C   1 
ATOM   2933  O  O   . GLY A 1 404 ? -34.281 7.860   12.383  1.00 28.32 ? 418 GLY A O   1 
ATOM   2934  N  N   . GLY A 1 405 ? -32.768 6.298   12.930  1.00 39.74 ? 419 GLY A N   1 
ATOM   2935  C  CA  . GLY A 1 405 ? -32.853 6.568   14.355  1.00 41.47 ? 419 GLY A CA  1 
ATOM   2936  C  C   . GLY A 1 405 ? -33.440 5.416   15.156  1.00 39.00 ? 419 GLY A C   1 
ATOM   2937  O  O   . GLY A 1 405 ? -33.398 5.428   16.386  1.00 42.00 ? 419 GLY A O   1 
ATOM   2938  N  N   . LYS A 1 406 ? -33.983 4.418   14.463  1.00 27.75 ? 420 LYS A N   1 
ATOM   2939  C  CA  . LYS A 1 406 ? -34.622 3.293   15.131  1.00 34.46 ? 420 LYS A CA  1 
ATOM   2940  C  C   . LYS A 1 406 ? -33.694 2.086   15.255  1.00 38.76 ? 420 LYS A C   1 
ATOM   2941  O  O   . LYS A 1 406 ? -32.686 1.983   14.547  1.00 33.56 ? 420 LYS A O   1 
ATOM   2942  C  CB  . LYS A 1 406 ? -35.902 2.885   14.395  1.00 36.11 ? 420 LYS A CB  1 
ATOM   2943  N  N   . CYS A 1 407 ? -34.048 1.176   16.161  1.00 34.07 ? 421 CYS A N   1 
ATOM   2944  C  CA  . CYS A 1 407 ? -33.324 -0.086  16.306  1.00 34.06 ? 421 CYS A CA  1 
ATOM   2945  C  C   . CYS A 1 407 ? -34.234 -1.131  16.938  1.00 33.17 ? 421 CYS A C   1 
ATOM   2946  O  O   . CYS A 1 407 ? -35.255 -0.793  17.537  1.00 33.90 ? 421 CYS A O   1 
ATOM   2947  C  CB  . CYS A 1 407 ? -32.035 0.096   17.125  1.00 30.07 ? 421 CYS A CB  1 
ATOM   2948  S  SG  . CYS A 1 407 ? -32.253 0.784   18.798  1.00 42.55 ? 421 CYS A SG  1 
ATOM   2949  N  N   . ASP A 1 408 ? -33.872 -2.401  16.801  1.00 36.50 ? 422 ASP A N   1 
ATOM   2950  C  CA  . ASP A 1 408 ? -34.689 -3.486  17.342  1.00 37.57 ? 422 ASP A CA  1 
ATOM   2951  C  C   . ASP A 1 408 ? -33.847 -4.736  17.545  1.00 31.95 ? 422 ASP A C   1 
ATOM   2952  O  O   . ASP A 1 408 ? -33.271 -5.266  16.593  1.00 25.22 ? 422 ASP A O   1 
ATOM   2953  C  CB  . ASP A 1 408 ? -35.852 -3.777  16.396  1.00 41.95 ? 422 ASP A CB  1 
ATOM   2954  C  CG  . ASP A 1 408 ? -36.558 -5.081  16.714  1.00 50.52 ? 422 ASP A CG  1 
ATOM   2955  O  OD1 . ASP A 1 408 ? -36.658 -5.435  17.908  1.00 46.82 ? 422 ASP A OD1 1 
ATOM   2956  O  OD2 . ASP A 1 408 ? -37.017 -5.751  15.761  1.00 55.92 ? 422 ASP A OD2 1 
ATOM   2957  N  N   . ASP A 1 409 ? -33.785 -5.208  18.784  1.00 34.20 ? 423 ASP A N   1 
ATOM   2958  C  CA  . ASP A 1 409 ? -32.932 -6.348  19.112  1.00 40.15 ? 423 ASP A CA  1 
ATOM   2959  C  C   . ASP A 1 409 ? -33.746 -7.600  19.419  1.00 38.89 ? 423 ASP A C   1 
ATOM   2960  O  O   . ASP A 1 409 ? -33.299 -8.481  20.151  1.00 38.77 ? 423 ASP A O   1 
ATOM   2961  C  CB  . ASP A 1 409 ? -32.000 -6.009  20.282  1.00 42.71 ? 423 ASP A CB  1 
ATOM   2962  C  CG  . ASP A 1 409 ? -32.755 -5.683  21.565  1.00 42.01 ? 423 ASP A CG  1 
ATOM   2963  O  OD1 . ASP A 1 409 ? -34.005 -5.645  21.545  1.00 40.61 ? 423 ASP A OD1 1 
ATOM   2964  O  OD2 . ASP A 1 409 ? -32.087 -5.452  22.595  1.00 36.30 ? 423 ASP A OD2 1 
ATOM   2965  N  N   . SER A 1 410 ? -34.949 -7.674  18.865  1.00 38.28 ? 424 SER A N   1 
ATOM   2966  C  CA  . SER A 1 410 ? -35.830 -8.795  19.164  1.00 37.84 ? 424 SER A CA  1 
ATOM   2967  C  C   . SER A 1 410 ? -35.363 -10.087 18.483  1.00 36.05 ? 424 SER A C   1 
ATOM   2968  O  O   . SER A 1 410 ? -35.490 -11.168 19.047  1.00 36.43 ? 424 SER A O   1 
ATOM   2969  C  CB  . SER A 1 410 ? -37.279 -8.466  18.789  1.00 36.82 ? 424 SER A CB  1 
ATOM   2970  O  OG  . SER A 1 410 ? -37.454 -8.499  17.388  1.00 45.04 ? 424 SER A OG  1 
ATOM   2971  N  N   . VAL A 1 411 ? -34.811 -9.958  17.280  1.00 33.06 ? 425 VAL A N   1 
ATOM   2972  C  CA  . VAL A 1 411 ? -34.354 -11.107 16.503  1.00 32.91 ? 425 VAL A CA  1 
ATOM   2973  C  C   . VAL A 1 411 ? -32.830 -11.075 16.308  1.00 34.24 ? 425 VAL A C   1 
ATOM   2974  O  O   . VAL A 1 411 ? -32.126 -12.042 16.604  1.00 33.33 ? 425 VAL A O   1 
ATOM   2975  C  CB  . VAL A 1 411 ? -35.023 -11.130 15.117  1.00 32.51 ? 425 VAL A CB  1 
ATOM   2976  C  CG1 . VAL A 1 411 ? -34.440 -12.244 14.262  1.00 34.33 ? 425 VAL A CG1 1 
ATOM   2977  C  CG2 . VAL A 1 411 ? -36.546 -11.267 15.253  1.00 44.74 ? 425 VAL A CG2 1 
ATOM   2978  N  N   . GLY A 1 412 ? -32.335 -9.960  15.785  1.00 31.32 ? 426 GLY A N   1 
ATOM   2979  C  CA  . GLY A 1 412 ? -30.905 -9.727  15.669  1.00 25.86 ? 426 GLY A CA  1 
ATOM   2980  C  C   . GLY A 1 412 ? -30.624 -8.327  16.174  1.00 26.84 ? 426 GLY A C   1 
ATOM   2981  O  O   . GLY A 1 412 ? -31.550 -7.604  16.540  1.00 27.43 ? 426 GLY A O   1 
ATOM   2982  N  N   . TYR A 1 413 ? -29.356 -7.930  16.192  1.00 26.18 ? 427 TYR A N   1 
ATOM   2983  C  CA  . TYR A 1 413 ? -28.988 -6.609  16.681  1.00 24.39 ? 427 TYR A CA  1 
ATOM   2984  C  C   . TYR A 1 413 ? -29.127 -5.559  15.577  1.00 22.58 ? 427 TYR A C   1 
ATOM   2985  O  O   . TYR A 1 413 ? -28.151 -4.976  15.103  1.00 21.31 ? 427 TYR A O   1 
ATOM   2986  C  CB  . TYR A 1 413 ? -27.582 -6.649  17.288  1.00 21.04 ? 427 TYR A CB  1 
ATOM   2987  C  CG  . TYR A 1 413 ? -27.468 -7.727  18.364  1.00 24.54 ? 427 TYR A CG  1 
ATOM   2988  C  CD1 . TYR A 1 413 ? -28.145 -7.602  19.573  1.00 25.62 ? 427 TYR A CD1 1 
ATOM   2989  C  CD2 . TYR A 1 413 ? -26.705 -8.873  18.160  1.00 23.37 ? 427 TYR A CD2 1 
ATOM   2990  C  CE1 . TYR A 1 413 ? -28.058 -8.576  20.551  1.00 27.64 ? 427 TYR A CE1 1 
ATOM   2991  C  CE2 . TYR A 1 413 ? -26.612 -9.852  19.140  1.00 26.62 ? 427 TYR A CE2 1 
ATOM   2992  C  CZ  . TYR A 1 413 ? -27.284 -9.693  20.333  1.00 21.84 ? 427 TYR A CZ  1 
ATOM   2993  O  OH  . TYR A 1 413 ? -27.206 -10.662 21.312  1.00 28.50 ? 427 TYR A OH  1 
ATOM   2994  N  N   . PHE A 1 414 ? -30.368 -5.326  15.173  1.00 27.11 ? 428 PHE A N   1 
ATOM   2995  C  CA  . PHE A 1 414 ? -30.629 -4.496  14.010  1.00 26.55 ? 428 PHE A CA  1 
ATOM   2996  C  C   . PHE A 1 414 ? -30.737 -3.011  14.328  1.00 28.72 ? 428 PHE A C   1 
ATOM   2997  O  O   . PHE A 1 414 ? -31.476 -2.595  15.229  1.00 28.25 ? 428 PHE A O   1 
ATOM   2998  C  CB  . PHE A 1 414 ? -31.866 -4.987  13.268  1.00 26.77 ? 428 PHE A CB  1 
ATOM   2999  C  CG  . PHE A 1 414 ? -31.642 -6.248  12.473  1.00 30.89 ? 428 PHE A CG  1 
ATOM   3000  C  CD1 . PHE A 1 414 ? -30.931 -6.216  11.278  1.00 24.60 ? 428 PHE A CD1 1 
ATOM   3001  C  CD2 . PHE A 1 414 ? -32.175 -7.464  12.901  1.00 32.61 ? 428 PHE A CD2 1 
ATOM   3002  C  CE1 . PHE A 1 414 ? -30.748 -7.379  10.529  1.00 27.90 ? 428 PHE A CE1 1 
ATOM   3003  C  CE2 . PHE A 1 414 ? -31.992 -8.628  12.162  1.00 29.86 ? 428 PHE A CE2 1 
ATOM   3004  C  CZ  . PHE A 1 414 ? -31.279 -8.590  10.974  1.00 25.67 ? 428 PHE A CZ  1 
ATOM   3005  N  N   . VAL A 1 415 ? -29.977 -2.223  13.576  1.00 23.56 ? 429 VAL A N   1 
ATOM   3006  C  CA  . VAL A 1 415 ? -30.017 -0.778  13.667  1.00 26.04 ? 429 VAL A CA  1 
ATOM   3007  C  C   . VAL A 1 415 ? -30.190 -0.186  12.273  1.00 26.34 ? 429 VAL A C   1 
ATOM   3008  O  O   . VAL A 1 415 ? -29.428 -0.514  11.357  1.00 25.75 ? 429 VAL A O   1 
ATOM   3009  C  CB  . VAL A 1 415 ? -28.686 -0.231  14.217  1.00 28.48 ? 429 VAL A CB  1 
ATOM   3010  C  CG1 . VAL A 1 415 ? -28.764 1.273   14.370  1.00 30.12 ? 429 VAL A CG1 1 
ATOM   3011  C  CG2 . VAL A 1 415 ? -28.318 -0.902  15.537  1.00 30.45 ? 429 VAL A CG2 1 
ATOM   3012  N  N   . GLU A 1 416 ? -31.173 0.697   12.108  1.00 28.39 ? 430 GLU A N   1 
ATOM   3013  C  CA  . GLU A 1 416 ? -31.299 1.437   10.858  1.00 27.89 ? 430 GLU A CA  1 
ATOM   3014  C  C   . GLU A 1 416 ? -30.085 2.337   10.672  1.00 24.18 ? 430 GLU A C   1 
ATOM   3015  O  O   . GLU A 1 416 ? -29.573 2.894   11.640  1.00 29.21 ? 430 GLU A O   1 
ATOM   3016  C  CB  . GLU A 1 416 ? -32.553 2.323   10.867  1.00 30.21 ? 430 GLU A CB  1 
ATOM   3017  C  CG  . GLU A 1 416 ? -33.869 1.586   10.874  1.00 32.66 ? 430 GLU A CG  1 
ATOM   3018  C  CD  . GLU A 1 416 ? -35.059 2.554   10.833  1.00 35.85 ? 430 GLU A CD  1 
ATOM   3019  O  OE1 . GLU A 1 416 ? -34.907 3.715   11.278  1.00 34.96 ? 430 GLU A OE1 1 
ATOM   3020  O  OE2 . GLU A 1 416 ? -36.136 2.156   10.348  1.00 42.41 ? 430 GLU A OE2 1 
ATOM   3021  N  N   . PRO A 1 417 ? -29.625 2.495   9.423   1.00 23.02 ? 431 PRO A N   1 
ATOM   3022  C  CA  . PRO A 1 417 ? -28.604 3.522   9.185   1.00 21.80 ? 431 PRO A CA  1 
ATOM   3023  C  C   . PRO A 1 417 ? -29.162 4.880   9.611   1.00 22.42 ? 431 PRO A C   1 
ATOM   3024  O  O   . PRO A 1 417 ? -30.307 5.187   9.277   1.00 27.08 ? 431 PRO A O   1 
ATOM   3025  C  CB  . PRO A 1 417 ? -28.415 3.488   7.667   1.00 22.38 ? 431 PRO A CB  1 
ATOM   3026  C  CG  . PRO A 1 417 ? -29.734 2.915   7.133   1.00 28.01 ? 431 PRO A CG  1 
ATOM   3027  C  CD  . PRO A 1 417 ? -30.120 1.889   8.174   1.00 22.43 ? 431 PRO A CD  1 
ATOM   3028  N  N   . CYS A 1 418 ? -28.378 5.668   10.342  1.00 22.16 ? 432 CYS A N   1 
ATOM   3029  C  CA  . CYS A 1 418 ? -28.865 6.937   10.886  1.00 25.82 ? 432 CYS A CA  1 
ATOM   3030  C  C   . CYS A 1 418 ? -28.006 8.107   10.420  1.00 24.15 ? 432 CYS A C   1 
ATOM   3031  O  O   . CYS A 1 418 ? -26.773 8.056   10.469  1.00 23.13 ? 432 CYS A O   1 
ATOM   3032  C  CB  . CYS A 1 418 ? -28.867 6.883   12.421  1.00 24.25 ? 432 CYS A CB  1 
ATOM   3033  S  SG  . CYS A 1 418 ? -29.592 8.310   13.273  1.00 31.55 ? 432 CYS A SG  1 
ATOM   3034  N  N   . ILE A 1 419 ? -28.667 9.162   9.969   1.00 26.86 ? 433 ILE A N   1 
ATOM   3035  C  CA  . ILE A 1 419 ? -27.975 10.388  9.623   1.00 29.20 ? 433 ILE A CA  1 
ATOM   3036  C  C   . ILE A 1 419 ? -28.427 11.498  10.564  1.00 34.29 ? 433 ILE A C   1 
ATOM   3037  O  O   . ILE A 1 419 ? -29.629 11.737  10.738  1.00 30.82 ? 433 ILE A O   1 
ATOM   3038  C  CB  . ILE A 1 419 ? -28.216 10.768  8.159   1.00 27.09 ? 433 ILE A CB  1 
ATOM   3039  C  CG1 . ILE A 1 419 ? -27.653 9.676   7.241   1.00 24.12 ? 433 ILE A CG1 1 
ATOM   3040  C  CG2 . ILE A 1 419 ? -27.582 12.124  7.849   1.00 28.84 ? 433 ILE A CG2 1 
ATOM   3041  C  CD1 . ILE A 1 419 ? -28.072 9.793   5.806   1.00 24.75 ? 433 ILE A CD1 1 
ATOM   3042  N  N   . VAL A 1 420 ? -27.459 12.154  11.192  1.00 24.63 ? 434 VAL A N   1 
ATOM   3043  C  CA  . VAL A 1 420 ? -27.747 13.194  12.165  1.00 26.38 ? 434 VAL A CA  1 
ATOM   3044  C  C   . VAL A 1 420 ? -27.065 14.486  11.740  1.00 31.49 ? 434 VAL A C   1 
ATOM   3045  O  O   . VAL A 1 420 ? -25.910 14.466  11.328  1.00 33.54 ? 434 VAL A O   1 
ATOM   3046  C  CB  . VAL A 1 420 ? -27.188 12.801  13.553  1.00 34.94 ? 434 VAL A CB  1 
ATOM   3047  C  CG1 . VAL A 1 420 ? -27.446 13.899  14.577  1.00 34.84 ? 434 VAL A CG1 1 
ATOM   3048  C  CG2 . VAL A 1 420 ? -27.777 11.473  14.013  1.00 37.69 ? 434 VAL A CG2 1 
ATOM   3049  N  N   . GLU A 1 421 ? -27.768 15.607  11.837  1.00 28.36 ? 435 GLU A N   1 
ATOM   3050  C  CA  . GLU A 1 421 ? -27.111 16.907  11.674  1.00 34.98 ? 435 GLU A CA  1 
ATOM   3051  C  C   . GLU A 1 421 ? -26.764 17.530  13.028  1.00 38.58 ? 435 GLU A C   1 
ATOM   3052  O  O   . GLU A 1 421 ? -27.571 17.526  13.954  1.00 37.98 ? 435 GLU A O   1 
ATOM   3053  C  CB  . GLU A 1 421 ? -27.972 17.874  10.864  1.00 37.28 ? 435 GLU A CB  1 
ATOM   3054  C  CG  . GLU A 1 421 ? -27.286 19.224  10.600  1.00 29.51 ? 435 GLU A CG  1 
ATOM   3055  C  CD  . GLU A 1 421 ? -28.106 20.127  9.693   1.00 38.03 ? 435 GLU A CD  1 
ATOM   3056  O  OE1 . GLU A 1 421 ? -29.225 19.731  9.329   1.00 36.44 ? 435 GLU A OE1 1 
ATOM   3057  O  OE2 . GLU A 1 421 ? -27.621 21.218  9.329   1.00 42.71 ? 435 GLU A OE2 1 
ATOM   3058  N  N   . SER A 1 422 ? -25.552 18.056  13.140  1.00 33.00 ? 436 SER A N   1 
ATOM   3059  C  CA  . SER A 1 422 ? -25.150 18.785  14.324  1.00 29.82 ? 436 SER A CA  1 
ATOM   3060  C  C   . SER A 1 422 ? -24.951 20.253  13.999  1.00 34.51 ? 436 SER A C   1 
ATOM   3061  O  O   . SER A 1 422 ? -24.217 20.592  13.071  1.00 31.05 ? 436 SER A O   1 
ATOM   3062  C  CB  . SER A 1 422 ? -23.826 18.250  14.849  1.00 33.69 ? 436 SER A CB  1 
ATOM   3063  O  OG  . SER A 1 422 ? -23.345 19.092  15.883  1.00 42.73 ? 436 SER A OG  1 
ATOM   3064  N  N   . LYS A 1 423 ? -25.581 21.120  14.780  1.00 39.08 ? 437 LYS A N   1 
ATOM   3065  C  CA  . LYS A 1 423 ? -25.363 22.552  14.654  1.00 38.81 ? 437 LYS A CA  1 
ATOM   3066  C  C   . LYS A 1 423 ? -24.029 22.958  15.293  1.00 41.76 ? 437 LYS A C   1 
ATOM   3067  O  O   . LYS A 1 423 ? -23.545 24.066  15.082  1.00 49.93 ? 437 LYS A O   1 
ATOM   3068  C  CB  . LYS A 1 423 ? -26.527 23.323  15.287  1.00 40.99 ? 437 LYS A CB  1 
ATOM   3069  N  N   . ASP A 1 424 ? -23.434 22.049  16.061  1.00 37.24 ? 438 ASP A N   1 
ATOM   3070  C  CA  . ASP A 1 424 ? -22.187 22.321  16.774  1.00 38.70 ? 438 ASP A CA  1 
ATOM   3071  C  C   . ASP A 1 424 ? -21.087 21.371  16.292  1.00 36.38 ? 438 ASP A C   1 
ATOM   3072  O  O   . ASP A 1 424 ? -21.227 20.159  16.390  1.00 33.50 ? 438 ASP A O   1 
ATOM   3073  C  CB  . ASP A 1 424 ? -22.434 22.157  18.281  1.00 44.78 ? 438 ASP A CB  1 
ATOM   3074  C  CG  . ASP A 1 424 ? -21.173 22.317  19.124  1.00 50.22 ? 438 ASP A CG  1 
ATOM   3075  O  OD1 . ASP A 1 424 ? -20.145 22.813  18.619  1.00 53.14 ? 438 ASP A OD1 1 
ATOM   3076  O  OD2 . ASP A 1 424 ? -21.221 21.951  20.319  1.00 50.63 ? 438 ASP A OD2 1 
ATOM   3077  N  N   . PRO A 1 425 ? -19.986 21.922  15.761  1.00 34.21 ? 439 PRO A N   1 
ATOM   3078  C  CA  . PRO A 1 425 ? -18.876 21.077  15.291  1.00 34.42 ? 439 PRO A CA  1 
ATOM   3079  C  C   . PRO A 1 425 ? -18.095 20.429  16.438  1.00 32.66 ? 439 PRO A C   1 
ATOM   3080  O  O   . PRO A 1 425 ? -17.340 19.483  16.208  1.00 38.36 ? 439 PRO A O   1 
ATOM   3081  C  CB  . PRO A 1 425 ? -17.992 22.063  14.524  1.00 34.08 ? 439 PRO A CB  1 
ATOM   3082  C  CG  . PRO A 1 425 ? -18.287 23.392  15.151  1.00 34.02 ? 439 PRO A CG  1 
ATOM   3083  C  CD  . PRO A 1 425 ? -19.733 23.355  15.530  1.00 37.35 ? 439 PRO A CD  1 
ATOM   3084  N  N   . GLN A 1 426 ? -18.294 20.912  17.661  1.00 30.64 ? 440 GLN A N   1 
ATOM   3085  C  CA  . GLN A 1 426 ? -17.611 20.345  18.827  1.00 37.32 ? 440 GLN A CA  1 
ATOM   3086  C  C   . GLN A 1 426 ? -18.477 19.354  19.621  1.00 34.07 ? 440 GLN A C   1 
ATOM   3087  O  O   . GLN A 1 426 ? -18.072 18.891  20.692  1.00 32.19 ? 440 GLN A O   1 
ATOM   3088  C  CB  . GLN A 1 426 ? -17.123 21.467  19.755  1.00 46.45 ? 440 GLN A CB  1 
ATOM   3089  C  CG  . GLN A 1 426 ? -16.163 22.464  19.102  1.00 53.99 ? 440 GLN A CG  1 
ATOM   3090  C  CD  . GLN A 1 426 ? -14.736 21.940  19.011  1.00 55.55 ? 440 GLN A CD  1 
ATOM   3091  O  OE1 . GLN A 1 426 ? -14.390 20.929  19.630  1.00 54.62 ? 440 GLN A OE1 1 
ATOM   3092  N  NE2 . GLN A 1 426 ? -13.902 22.628  18.239  1.00 53.51 ? 440 GLN A NE2 1 
ATOM   3093  N  N   . GLU A 1 427 ? -19.659 19.032  19.093  1.00 34.70 ? 441 GLU A N   1 
ATOM   3094  C  CA  . GLU A 1 427 ? -20.605 18.117  19.743  1.00 31.23 ? 441 GLU A CA  1 
ATOM   3095  C  C   . GLU A 1 427 ? -19.961 16.736  19.873  1.00 30.11 ? 441 GLU A C   1 
ATOM   3096  O  O   . GLU A 1 427 ? -19.232 16.317  18.982  1.00 32.59 ? 441 GLU A O   1 
ATOM   3097  C  CB  . GLU A 1 427 ? -21.892 18.027  18.908  1.00 37.85 ? 441 GLU A CB  1 
ATOM   3098  C  CG  . GLU A 1 427 ? -23.216 18.164  19.675  1.00 40.09 ? 441 GLU A CG  1 
ATOM   3099  C  CD  . GLU A 1 427 ? -23.631 16.884  20.395  1.00 39.04 ? 441 GLU A CD  1 
ATOM   3100  O  OE1 . GLU A 1 427 ? -23.252 15.778  19.941  1.00 32.55 ? 441 GLU A OE1 1 
ATOM   3101  O  OE2 . GLU A 1 427 ? -24.323 16.987  21.431  1.00 39.87 ? 441 GLU A OE2 1 
ATOM   3102  N  N   . PRO A 1 428 ? -20.206 16.038  20.996  1.00 34.23 ? 442 PRO A N   1 
ATOM   3103  C  CA  . PRO A 1 428 ? -19.679 14.688  21.245  1.00 34.87 ? 442 PRO A CA  1 
ATOM   3104  C  C   . PRO A 1 428 ? -19.856 13.740  20.059  1.00 33.38 ? 442 PRO A C   1 
ATOM   3105  O  O   . PRO A 1 428 ? -18.965 12.937  19.743  1.00 21.93 ? 442 PRO A O   1 
ATOM   3106  C  CB  . PRO A 1 428 ? -20.531 14.202  22.412  1.00 28.91 ? 442 PRO A CB  1 
ATOM   3107  C  CG  . PRO A 1 428 ? -20.849 15.441  23.164  1.00 35.63 ? 442 PRO A CG  1 
ATOM   3108  C  CD  . PRO A 1 428 ? -20.889 16.581  22.182  1.00 35.18 ? 442 PRO A CD  1 
ATOM   3109  N  N   . ILE A 1 429 ? -20.995 13.846  19.387  1.00 33.89 ? 443 ILE A N   1 
ATOM   3110  C  CA  . ILE A 1 429 ? -21.276 12.924  18.294  1.00 33.94 ? 443 ILE A CA  1 
ATOM   3111  C  C   . ILE A 1 429 ? -20.351 13.195  17.100  1.00 34.26 ? 443 ILE A C   1 
ATOM   3112  O  O   . ILE A 1 429 ? -20.143 12.325  16.253  1.00 33.54 ? 443 ILE A O   1 
ATOM   3113  C  CB  . ILE A 1 429 ? -22.772 12.945  17.892  1.00 28.51 ? 443 ILE A CB  1 
ATOM   3114  C  CG1 . ILE A 1 429 ? -23.187 11.600  17.281  1.00 27.34 ? 443 ILE A CG1 1 
ATOM   3115  C  CG2 . ILE A 1 429 ? -23.098 14.142  16.968  1.00 27.77 ? 443 ILE A CG2 1 
ATOM   3116  C  CD1 . ILE A 1 429 ? -24.693 11.525  16.964  1.00 32.83 ? 443 ILE A CD1 1 
ATOM   3117  N  N   . MET A 1 430 ? -19.778 14.397  17.058  1.00 28.09 ? 444 MET A N   1 
ATOM   3118  C  CA  . MET A 1 430 ? -18.804 14.749  16.031  1.00 31.44 ? 444 MET A CA  1 
ATOM   3119  C  C   . MET A 1 430 ? -17.408 14.237  16.373  1.00 32.15 ? 444 MET A C   1 
ATOM   3120  O  O   . MET A 1 430 ? -16.532 14.155  15.505  1.00 33.27 ? 444 MET A O   1 
ATOM   3121  C  CB  . MET A 1 430 ? -18.747 16.266  15.860  1.00 34.20 ? 444 MET A CB  1 
ATOM   3122  C  CG  . MET A 1 430 ? -20.019 16.880  15.338  1.00 34.82 ? 444 MET A CG  1 
ATOM   3123  S  SD  . MET A 1 430 ? -20.323 16.401  13.639  1.00 36.23 ? 444 MET A SD  1 
ATOM   3124  C  CE  . MET A 1 430 ? -18.949 17.175  12.799  1.00 40.08 ? 444 MET A CE  1 
ATOM   3125  N  N   . LYS A 1 431 ? -17.201 13.887  17.637  1.00 34.93 ? 445 LYS A N   1 
ATOM   3126  C  CA  . LYS A 1 431 ? -15.856 13.607  18.131  1.00 34.55 ? 445 LYS A CA  1 
ATOM   3127  C  C   . LYS A 1 431 ? -15.623 12.165  18.585  1.00 34.03 ? 445 LYS A C   1 
ATOM   3128  O  O   . LYS A 1 431 ? -14.528 11.625  18.429  1.00 31.67 ? 445 LYS A O   1 
ATOM   3129  C  CB  . LYS A 1 431 ? -15.519 14.559  19.282  1.00 41.00 ? 445 LYS A CB  1 
ATOM   3130  C  CG  . LYS A 1 431 ? -15.319 16.003  18.870  1.00 45.65 ? 445 LYS A CG  1 
ATOM   3131  C  CD  . LYS A 1 431 ? -14.736 16.832  20.009  1.00 49.65 ? 445 LYS A CD  1 
ATOM   3132  C  CE  . LYS A 1 431 ? -15.582 16.714  21.263  1.00 51.47 ? 445 LYS A CE  1 
ATOM   3133  N  N   . GLU A 1 432 ? -16.645 11.545  19.159  1.00 34.35 ? 446 GLU A N   1 
ATOM   3134  C  CA  . GLU A 1 432 ? -16.476 10.231  19.771  1.00 35.24 ? 446 GLU A CA  1 
ATOM   3135  C  C   . GLU A 1 432 ? -16.773 9.081   18.802  1.00 32.73 ? 446 GLU A C   1 
ATOM   3136  O  O   . GLU A 1 432 ? -17.767 9.107   18.085  1.00 28.94 ? 446 GLU A O   1 
ATOM   3137  C  CB  . GLU A 1 432 ? -17.347 10.149  21.027  1.00 34.74 ? 446 GLU A CB  1 
ATOM   3138  C  CG  . GLU A 1 432 ? -17.119 11.342  21.956  1.00 38.13 ? 446 GLU A CG  1 
ATOM   3139  C  CD  . GLU A 1 432 ? -17.785 11.187  23.311  1.00 46.22 ? 446 GLU A CD  1 
ATOM   3140  O  OE1 . GLU A 1 432 ? -18.162 10.051  23.670  1.00 46.81 ? 446 GLU A OE1 1 
ATOM   3141  O  OE2 . GLU A 1 432 ? -17.933 12.209  24.019  1.00 49.84 ? 446 GLU A OE2 1 
ATOM   3142  N  N   . GLU A 1 433 ? -15.907 8.072   18.777  1.00 32.49 ? 447 GLU A N   1 
ATOM   3143  C  CA  . GLU A 1 433 ? -16.101 6.934   17.877  1.00 32.33 ? 447 GLU A CA  1 
ATOM   3144  C  C   . GLU A 1 433 ? -17.290 6.076   18.318  1.00 30.59 ? 447 GLU A C   1 
ATOM   3145  O  O   . GLU A 1 433 ? -17.392 5.690   19.481  1.00 29.32 ? 447 GLU A O   1 
ATOM   3146  C  CB  . GLU A 1 433 ? -14.823 6.086   17.789  1.00 33.00 ? 447 GLU A CB  1 
ATOM   3147  N  N   . ILE A 1 434 ? -18.198 5.786   17.391  1.00 30.56 ? 448 ILE A N   1 
ATOM   3148  C  CA  . ILE A 1 434 ? -19.397 5.000   17.707  1.00 24.97 ? 448 ILE A CA  1 
ATOM   3149  C  C   . ILE A 1 434 ? -19.249 3.560   17.196  1.00 23.53 ? 448 ILE A C   1 
ATOM   3150  O  O   . ILE A 1 434 ? -19.824 2.608   17.755  1.00 22.82 ? 448 ILE A O   1 
ATOM   3151  C  CB  . ILE A 1 434 ? -20.660 5.678   17.093  1.00 26.16 ? 448 ILE A CB  1 
ATOM   3152  C  CG1 . ILE A 1 434 ? -20.964 6.996   17.809  1.00 23.62 ? 448 ILE A CG1 1 
ATOM   3153  C  CG2 . ILE A 1 434 ? -21.886 4.776   17.174  1.00 24.88 ? 448 ILE A CG2 1 
ATOM   3154  C  CD1 . ILE A 1 434 ? -21.919 7.928   17.020  1.00 22.09 ? 448 ILE A CD1 1 
ATOM   3155  N  N   . PHE A 1 435 ? -18.467 3.417   16.127  1.00 21.25 ? 449 PHE A N   1 
ATOM   3156  C  CA  . PHE A 1 435 ? -18.269 2.138   15.448  1.00 23.00 ? 449 PHE A CA  1 
ATOM   3157  C  C   . PHE A 1 435 ? -19.600 1.487   15.102  1.00 25.69 ? 449 PHE A C   1 
ATOM   3158  O  O   . PHE A 1 435 ? -19.870 0.340   15.468  1.00 26.40 ? 449 PHE A O   1 
ATOM   3159  C  CB  . PHE A 1 435 ? -17.418 1.200   16.300  1.00 22.38 ? 449 PHE A CB  1 
ATOM   3160  C  CG  . PHE A 1 435 ? -16.671 0.182   15.506  1.00 20.56 ? 449 PHE A CG  1 
ATOM   3161  C  CD1 . PHE A 1 435 ? -17.014 -1.169  15.581  1.00 23.50 ? 449 PHE A CD1 1 
ATOM   3162  C  CD2 . PHE A 1 435 ? -15.617 0.564   14.688  1.00 22.45 ? 449 PHE A CD2 1 
ATOM   3163  C  CE1 . PHE A 1 435 ? -16.302 -2.128  14.855  1.00 21.61 ? 449 PHE A CE1 1 
ATOM   3164  C  CE2 . PHE A 1 435 ? -14.912 -0.389  13.950  1.00 26.88 ? 449 PHE A CE2 1 
ATOM   3165  C  CZ  . PHE A 1 435 ? -15.255 -1.734  14.040  1.00 21.50 ? 449 PHE A CZ  1 
ATOM   3166  N  N   . GLY A 1 436 ? -20.428 2.241   14.389  1.00 23.77 ? 450 GLY A N   1 
ATOM   3167  C  CA  . GLY A 1 436 ? -21.767 1.812   14.050  1.00 23.93 ? 450 GLY A CA  1 
ATOM   3168  C  C   . GLY A 1 436 ? -22.285 2.675   12.920  1.00 22.60 ? 450 GLY A C   1 
ATOM   3169  O  O   . GLY A 1 436 ? -21.558 3.542   12.428  1.00 25.87 ? 450 GLY A O   1 
ATOM   3170  N  N   . PRO A 1 437 ? -23.543 2.443   12.506  1.00 19.72 ? 451 PRO A N   1 
ATOM   3171  C  CA  . PRO A 1 437 ? -24.150 3.102   11.343  1.00 19.17 ? 451 PRO A CA  1 
ATOM   3172  C  C   . PRO A 1 437 ? -24.792 4.433   11.723  1.00 26.79 ? 451 PRO A C   1 
ATOM   3173  O  O   . PRO A 1 437 ? -26.008 4.630   11.593  1.00 23.63 ? 451 PRO A O   1 
ATOM   3174  C  CB  . PRO A 1 437 ? -25.197 2.086   10.904  1.00 20.44 ? 451 PRO A CB  1 
ATOM   3175  C  CG  . PRO A 1 437 ? -25.646 1.480   12.181  1.00 24.14 ? 451 PRO A CG  1 
ATOM   3176  C  CD  . PRO A 1 437 ? -24.460 1.465   13.115  1.00 20.61 ? 451 PRO A CD  1 
ATOM   3177  N  N   . VAL A 1 438 ? -23.959 5.345   12.209  1.00 25.31 ? 452 VAL A N   1 
ATOM   3178  C  CA  . VAL A 1 438 ? -24.414 6.667   12.596  1.00 28.46 ? 452 VAL A CA  1 
ATOM   3179  C  C   . VAL A 1 438 ? -23.509 7.700   11.954  1.00 26.51 ? 452 VAL A C   1 
ATOM   3180  O  O   . VAL A 1 438 ? -22.326 7.812   12.294  1.00 30.65 ? 452 VAL A O   1 
ATOM   3181  C  CB  . VAL A 1 438 ? -24.388 6.842   14.120  1.00 28.77 ? 452 VAL A CB  1 
ATOM   3182  C  CG1 . VAL A 1 438 ? -24.922 8.225   14.509  1.00 29.25 ? 452 VAL A CG1 1 
ATOM   3183  C  CG2 . VAL A 1 438 ? -25.195 5.744   14.784  1.00 21.14 ? 452 VAL A CG2 1 
ATOM   3184  N  N   . LEU A 1 439 ? -24.062 8.445   11.009  1.00 22.66 ? 453 LEU A N   1 
ATOM   3185  C  CA  . LEU A 1 439 ? -23.300 9.467   10.313  1.00 21.58 ? 453 LEU A CA  1 
ATOM   3186  C  C   . LEU A 1 439 ? -23.720 10.843  10.809  1.00 26.83 ? 453 LEU A C   1 
ATOM   3187  O  O   . LEU A 1 439 ? -24.908 11.133  10.888  1.00 28.85 ? 453 LEU A O   1 
ATOM   3188  C  CB  . LEU A 1 439 ? -23.511 9.346   8.806   1.00 21.91 ? 453 LEU A CB  1 
ATOM   3189  C  CG  . LEU A 1 439 ? -23.046 10.552  8.001   1.00 31.18 ? 453 LEU A CG  1 
ATOM   3190  C  CD1 . LEU A 1 439 ? -21.508 10.617  7.981   1.00 25.95 ? 453 LEU A CD1 1 
ATOM   3191  C  CD2 . LEU A 1 439 ? -23.625 10.492  6.605   1.00 31.66 ? 453 LEU A CD2 1 
ATOM   3192  N  N   . SER A 1 440 ? -22.739 11.679  11.157  1.00 25.16 ? 454 SER A N   1 
ATOM   3193  C  CA  . SER A 1 440 ? -23.004 13.017  11.683  1.00 27.37 ? 454 SER A CA  1 
ATOM   3194  C  C   . SER A 1 440 ? -22.590 14.069  10.667  1.00 29.10 ? 454 SER A C   1 
ATOM   3195  O  O   . SER A 1 440 ? -21.539 13.962  10.043  1.00 27.95 ? 454 SER A O   1 
ATOM   3196  C  CB  . SER A 1 440 ? -22.250 13.239  12.997  1.00 35.30 ? 454 SER A CB  1 
ATOM   3197  O  OG  . SER A 1 440 ? -22.665 12.319  13.993  1.00 41.91 ? 454 SER A OG  1 
ATOM   3198  N  N   . VAL A 1 441 ? -23.422 15.086  10.493  1.00 28.92 ? 455 VAL A N   1 
ATOM   3199  C  CA  . VAL A 1 441 ? -23.187 16.069  9.442   1.00 25.79 ? 455 VAL A CA  1 
ATOM   3200  C  C   . VAL A 1 441 ? -23.098 17.480  10.017  1.00 31.08 ? 455 VAL A C   1 
ATOM   3201  O  O   . VAL A 1 441 ? -23.956 17.887  10.809  1.00 32.41 ? 455 VAL A O   1 
ATOM   3202  C  CB  . VAL A 1 441 ? -24.309 16.002  8.376   1.00 26.32 ? 455 VAL A CB  1 
ATOM   3203  C  CG1 . VAL A 1 441 ? -24.004 16.925  7.208   1.00 35.03 ? 455 VAL A CG1 1 
ATOM   3204  C  CG2 . VAL A 1 441 ? -24.475 14.568  7.896   1.00 31.22 ? 455 VAL A CG2 1 
ATOM   3205  N  N   . TYR A 1 442 ? -22.063 18.223  9.623   1.00 28.69 ? 456 TYR A N   1 
ATOM   3206  C  CA  . TYR A 1 442 ? -21.979 19.641  9.981   1.00 30.75 ? 456 TYR A CA  1 
ATOM   3207  C  C   . TYR A 1 442 ? -21.915 20.517  8.745   1.00 33.45 ? 456 TYR A C   1 
ATOM   3208  O  O   . TYR A 1 442 ? -21.045 20.331  7.893   1.00 31.85 ? 456 TYR A O   1 
ATOM   3209  C  CB  . TYR A 1 442 ? -20.777 19.908  10.888  1.00 29.96 ? 456 TYR A CB  1 
ATOM   3210  C  CG  . TYR A 1 442 ? -20.574 21.376  11.192  1.00 29.98 ? 456 TYR A CG  1 
ATOM   3211  C  CD1 . TYR A 1 442 ? -21.394 22.036  12.094  1.00 35.53 ? 456 TYR A CD1 1 
ATOM   3212  C  CD2 . TYR A 1 442 ? -19.572 22.105  10.563  1.00 34.13 ? 456 TYR A CD2 1 
ATOM   3213  C  CE1 . TYR A 1 442 ? -21.221 23.387  12.361  1.00 40.32 ? 456 TYR A CE1 1 
ATOM   3214  C  CE2 . TYR A 1 442 ? -19.384 23.445  10.827  1.00 37.56 ? 456 TYR A CE2 1 
ATOM   3215  C  CZ  . TYR A 1 442 ? -20.210 24.082  11.727  1.00 38.59 ? 456 TYR A CZ  1 
ATOM   3216  O  OH  . TYR A 1 442 ? -20.022 25.413  11.990  1.00 36.57 ? 456 TYR A OH  1 
ATOM   3217  N  N   . VAL A 1 443 ? -22.847 21.468  8.652   1.00 32.66 ? 457 VAL A N   1 
ATOM   3218  C  CA  . VAL A 1 443 ? -22.923 22.398  7.533   1.00 36.15 ? 457 VAL A CA  1 
ATOM   3219  C  C   . VAL A 1 443 ? -22.171 23.695  7.859   1.00 37.03 ? 457 VAL A C   1 
ATOM   3220  O  O   . VAL A 1 443 ? -22.439 24.347  8.871   1.00 38.35 ? 457 VAL A O   1 
ATOM   3221  C  CB  . VAL A 1 443 ? -24.392 22.723  7.188   1.00 35.99 ? 457 VAL A CB  1 
ATOM   3222  C  CG1 . VAL A 1 443 ? -24.476 23.562  5.908   1.00 34.13 ? 457 VAL A CG1 1 
ATOM   3223  C  CG2 . VAL A 1 443 ? -25.198 21.429  7.056   1.00 37.50 ? 457 VAL A CG2 1 
ATOM   3224  N  N   . TYR A 1 444 ? -21.218 24.062  7.012   1.00 36.28 ? 458 TYR A N   1 
ATOM   3225  C  CA  . TYR A 1 444 ? -20.383 25.225  7.299   1.00 42.97 ? 458 TYR A CA  1 
ATOM   3226  C  C   . TYR A 1 444 ? -20.609 26.325  6.250   1.00 46.98 ? 458 TYR A C   1 
ATOM   3227  O  O   . TYR A 1 444 ? -20.958 26.034  5.109   1.00 50.45 ? 458 TYR A O   1 
ATOM   3228  C  CB  . TYR A 1 444 ? -18.894 24.823  7.412   1.00 39.18 ? 458 TYR A CB  1 
ATOM   3229  C  CG  . TYR A 1 444 ? -18.242 24.466  6.091   1.00 37.79 ? 458 TYR A CG  1 
ATOM   3230  C  CD1 . TYR A 1 444 ? -17.704 25.453  5.276   1.00 41.93 ? 458 TYR A CD1 1 
ATOM   3231  C  CD2 . TYR A 1 444 ? -18.168 23.148  5.659   1.00 38.13 ? 458 TYR A CD2 1 
ATOM   3232  C  CE1 . TYR A 1 444 ? -17.126 25.148  4.071   1.00 40.25 ? 458 TYR A CE1 1 
ATOM   3233  C  CE2 . TYR A 1 444 ? -17.589 22.830  4.444   1.00 40.15 ? 458 TYR A CE2 1 
ATOM   3234  C  CZ  . TYR A 1 444 ? -17.066 23.840  3.656   1.00 41.95 ? 458 TYR A CZ  1 
ATOM   3235  O  OH  . TYR A 1 444 ? -16.479 23.547  2.446   1.00 42.48 ? 458 TYR A OH  1 
ATOM   3236  N  N   . PRO A 1 445 ? -20.418 27.595  6.637   1.00 46.53 ? 459 PRO A N   1 
ATOM   3237  C  CA  . PRO A 1 445 ? -20.591 28.684  5.665   1.00 50.10 ? 459 PRO A CA  1 
ATOM   3238  C  C   . PRO A 1 445 ? -19.534 28.610  4.567   1.00 51.83 ? 459 PRO A C   1 
ATOM   3239  O  O   . PRO A 1 445 ? -18.360 28.448  4.886   1.00 52.47 ? 459 PRO A O   1 
ATOM   3240  C  CB  . PRO A 1 445 ? -20.386 29.949  6.511   1.00 50.27 ? 459 PRO A CB  1 
ATOM   3241  C  CG  . PRO A 1 445 ? -20.572 29.509  7.937   1.00 49.06 ? 459 PRO A CG  1 
ATOM   3242  C  CD  . PRO A 1 445 ? -20.083 28.095  7.981   1.00 42.84 ? 459 PRO A CD  1 
ATOM   3243  N  N   . ASP A 1 446 ? -19.948 28.732  3.306   1.00 51.55 ? 460 ASP A N   1 
ATOM   3244  C  CA  . ASP A 1 446 ? -19.046 28.605  2.154   1.00 52.97 ? 460 ASP A CA  1 
ATOM   3245  C  C   . ASP A 1 446 ? -17.728 29.375  2.251   1.00 55.64 ? 460 ASP A C   1 
ATOM   3246  O  O   . ASP A 1 446 ? -16.673 28.856  1.872   1.00 51.79 ? 460 ASP A O   1 
ATOM   3247  C  CB  . ASP A 1 446 ? -19.763 29.032  0.877   1.00 59.06 ? 460 ASP A CB  1 
ATOM   3248  C  CG  . ASP A 1 446 ? -20.545 27.911  0.246   1.00 59.75 ? 460 ASP A CG  1 
ATOM   3249  O  OD1 . ASP A 1 446 ? -21.484 27.400  0.893   1.00 59.61 ? 460 ASP A OD1 1 
ATOM   3250  O  OD2 . ASP A 1 446 ? -20.230 27.552  -0.909  1.00 60.86 ? 460 ASP A OD2 1 
ATOM   3251  N  N   . ASP A 1 447 ? -17.787 30.612  2.739   1.00 55.49 ? 461 ASP A N   1 
ATOM   3252  C  CA  . ASP A 1 447 ? -16.585 31.443  2.812   1.00 57.86 ? 461 ASP A CA  1 
ATOM   3253  C  C   . ASP A 1 447 ? -15.799 31.293  4.125   1.00 54.56 ? 461 ASP A C   1 
ATOM   3254  O  O   . ASP A 1 447 ? -14.911 32.095  4.428   1.00 54.29 ? 461 ASP A O   1 
ATOM   3255  C  CB  . ASP A 1 447 ? -16.900 32.917  2.497   1.00 62.55 ? 461 ASP A CB  1 
ATOM   3256  C  CG  . ASP A 1 447 ? -18.023 33.478  3.348   1.00 68.22 ? 461 ASP A CG  1 
ATOM   3257  O  OD1 . ASP A 1 447 ? -18.263 32.951  4.456   1.00 69.18 ? 461 ASP A OD1 1 
ATOM   3258  O  OD2 . ASP A 1 447 ? -18.662 34.460  2.908   1.00 74.52 ? 461 ASP A OD2 1 
ATOM   3259  N  N   . LYS A 1 448 ? -16.126 30.258  4.894   1.00 48.20 ? 462 LYS A N   1 
ATOM   3260  C  CA  . LYS A 1 448 ? -15.338 29.903  6.069   1.00 48.76 ? 462 LYS A CA  1 
ATOM   3261  C  C   . LYS A 1 448 ? -14.709 28.515  5.907   1.00 50.50 ? 462 LYS A C   1 
ATOM   3262  O  O   . LYS A 1 448 ? -14.404 27.841  6.895   1.00 47.22 ? 462 LYS A O   1 
ATOM   3263  C  CB  . LYS A 1 448 ? -16.195 29.958  7.339   1.00 48.77 ? 462 LYS A CB  1 
ATOM   3264  C  CG  . LYS A 1 448 ? -16.683 31.357  7.705   1.00 47.80 ? 462 LYS A CG  1 
ATOM   3265  N  N   . TYR A 1 449 ? -14.511 28.095  4.661   1.00 49.54 ? 463 TYR A N   1 
ATOM   3266  C  CA  . TYR A 1 449 ? -14.026 26.747  4.400   1.00 45.61 ? 463 TYR A CA  1 
ATOM   3267  C  C   . TYR A 1 449 ? -12.601 26.593  4.910   1.00 43.59 ? 463 TYR A C   1 
ATOM   3268  O  O   . TYR A 1 449 ? -12.185 25.502  5.275   1.00 40.14 ? 463 TYR A O   1 
ATOM   3269  C  CB  . TYR A 1 449 ? -14.124 26.391  2.910   1.00 47.03 ? 463 TYR A CB  1 
ATOM   3270  C  CG  . TYR A 1 449 ? -12.892 26.721  2.100   1.00 52.27 ? 463 TYR A CG  1 
ATOM   3271  C  CD1 . TYR A 1 449 ? -11.851 25.801  1.968   1.00 54.59 ? 463 TYR A CD1 1 
ATOM   3272  C  CD2 . TYR A 1 449 ? -12.773 27.942  1.449   1.00 59.67 ? 463 TYR A CD2 1 
ATOM   3273  C  CE1 . TYR A 1 449 ? -10.722 26.098  1.227   1.00 58.60 ? 463 TYR A CE1 1 
ATOM   3274  C  CE2 . TYR A 1 449 ? -11.651 28.247  0.704   1.00 63.44 ? 463 TYR A CE2 1 
ATOM   3275  C  CZ  . TYR A 1 449 ? -10.628 27.323  0.596   1.00 64.91 ? 463 TYR A CZ  1 
ATOM   3276  O  OH  . TYR A 1 449 ? -9.511  27.631  -0.148  1.00 68.75 ? 463 TYR A OH  1 
ATOM   3277  N  N   . LYS A 1 450 ? -11.853 27.692  4.928   1.00 46.90 ? 464 LYS A N   1 
ATOM   3278  C  CA  . LYS A 1 450 ? -10.507 27.665  5.482   1.00 47.40 ? 464 LYS A CA  1 
ATOM   3279  C  C   . LYS A 1 450 ? -10.576 27.367  6.973   1.00 46.31 ? 464 LYS A C   1 
ATOM   3280  O  O   . LYS A 1 450 ? -9.941  26.426  7.455   1.00 42.33 ? 464 LYS A O   1 
ATOM   3281  C  CB  . LYS A 1 450 ? -9.769  28.980  5.218   1.00 49.84 ? 464 LYS A CB  1 
ATOM   3282  C  CG  . LYS A 1 450 ? -9.320  29.162  3.772   1.00 53.17 ? 464 LYS A CG  1 
ATOM   3283  N  N   . GLU A 1 451 ? -11.367 28.156  7.695   1.00 42.35 ? 465 GLU A N   1 
ATOM   3284  C  CA  . GLU A 1 451 ? -11.547 27.948  9.129   1.00 44.72 ? 465 GLU A CA  1 
ATOM   3285  C  C   . GLU A 1 451 ? -12.050 26.533  9.432   1.00 43.13 ? 465 GLU A C   1 
ATOM   3286  O  O   . GLU A 1 451 ? -11.686 25.935  10.444  1.00 41.47 ? 465 GLU A O   1 
ATOM   3287  C  CB  . GLU A 1 451 ? -12.519 28.986  9.698   1.00 47.96 ? 465 GLU A CB  1 
ATOM   3288  N  N   . THR A 1 452 ? -12.888 26.001  8.549   1.00 41.16 ? 466 THR A N   1 
ATOM   3289  C  CA  . THR A 1 452 ? -13.495 24.692  8.784   1.00 41.66 ? 466 THR A CA  1 
ATOM   3290  C  C   . THR A 1 452 ? -12.493 23.549  8.586   1.00 38.13 ? 466 THR A C   1 
ATOM   3291  O  O   . THR A 1 452 ? -12.529 22.548  9.307   1.00 38.24 ? 466 THR A O   1 
ATOM   3292  C  CB  . THR A 1 452 ? -14.753 24.501  7.911   1.00 40.54 ? 466 THR A CB  1 
ATOM   3293  O  OG1 . THR A 1 452 ? -15.685 25.551  8.201   1.00 43.12 ? 466 THR A OG1 1 
ATOM   3294  C  CG2 . THR A 1 452 ? -15.417 23.159  8.186   1.00 34.50 ? 466 THR A CG2 1 
ATOM   3295  N  N   . LEU A 1 453 ? -11.591 23.705  7.621   1.00 43.28 ? 467 LEU A N   1 
ATOM   3296  C  CA  . LEU A 1 453 ? -10.539 22.715  7.412   1.00 43.37 ? 467 LEU A CA  1 
ATOM   3297  C  C   . LEU A 1 453 ? -9.705  22.561  8.682   1.00 45.64 ? 467 LEU A C   1 
ATOM   3298  O  O   . LEU A 1 453 ? -9.422  21.438  9.111   1.00 37.49 ? 467 LEU A O   1 
ATOM   3299  C  CB  . LEU A 1 453 ? -9.649  23.089  6.219   1.00 42.39 ? 467 LEU A CB  1 
ATOM   3300  C  CG  . LEU A 1 453 ? -10.170 22.748  4.818   1.00 37.54 ? 467 LEU A CG  1 
ATOM   3301  C  CD1 . LEU A 1 453 ? -9.358  23.446  3.753   1.00 41.08 ? 467 LEU A CD1 1 
ATOM   3302  C  CD2 . LEU A 1 453 ? -10.154 21.250  4.584   1.00 37.29 ? 467 LEU A CD2 1 
ATOM   3303  N  N   . GLN A 1 454 ? -9.333  23.688  9.291   1.00 41.93 ? 468 GLN A N   1 
ATOM   3304  C  CA  . GLN A 1 454 ? -8.584  23.652  10.548  1.00 40.28 ? 468 GLN A CA  1 
ATOM   3305  C  C   . GLN A 1 454 ? -9.445  23.008  11.636  1.00 42.65 ? 468 GLN A C   1 
ATOM   3306  O  O   . GLN A 1 454 ? -8.941  22.316  12.523  1.00 43.97 ? 468 GLN A O   1 
ATOM   3307  C  CB  . GLN A 1 454 ? -8.144  25.066  10.961  1.00 41.10 ? 468 GLN A CB  1 
ATOM   3308  N  N   . LEU A 1 455 ? -10.755 23.219  11.550  1.00 43.36 ? 469 LEU A N   1 
ATOM   3309  C  CA  . LEU A 1 455 ? -11.683 22.652  12.529  1.00 43.58 ? 469 LEU A CA  1 
ATOM   3310  C  C   . LEU A 1 455 ? -11.753 21.123  12.443  1.00 37.41 ? 469 LEU A C   1 
ATOM   3311  O  O   . LEU A 1 455 ? -11.826 20.433  13.465  1.00 34.36 ? 469 LEU A O   1 
ATOM   3312  C  CB  . LEU A 1 455 ? -13.070 23.272  12.368  1.00 50.47 ? 469 LEU A CB  1 
ATOM   3313  C  CG  . LEU A 1 455 ? -14.096 22.964  13.447  1.00 50.44 ? 469 LEU A CG  1 
ATOM   3314  C  CD1 . LEU A 1 455 ? -13.468 23.126  14.810  1.00 53.32 ? 469 LEU A CD1 1 
ATOM   3315  C  CD2 . LEU A 1 455 ? -15.272 23.896  13.295  1.00 53.61 ? 469 LEU A CD2 1 
ATOM   3316  N  N   . VAL A 1 456 ? -11.736 20.603  11.220  1.00 36.00 ? 470 VAL A N   1 
ATOM   3317  C  CA  . VAL A 1 456 ? -11.676 19.164  10.994  1.00 30.36 ? 470 VAL A CA  1 
ATOM   3318  C  C   . VAL A 1 456 ? -10.434 18.585  11.670  1.00 30.24 ? 470 VAL A C   1 
ATOM   3319  O  O   . VAL A 1 456 ? -10.487 17.545  12.337  1.00 29.16 ? 470 VAL A O   1 
ATOM   3320  C  CB  . VAL A 1 456 ? -11.600 18.862  9.498   1.00 28.50 ? 470 VAL A CB  1 
ATOM   3321  C  CG1 . VAL A 1 456 ? -11.179 17.420  9.274   1.00 26.19 ? 470 VAL A CG1 1 
ATOM   3322  C  CG2 . VAL A 1 456 ? -12.941 19.172  8.815   1.00 31.56 ? 470 VAL A CG2 1 
ATOM   3323  N  N   . ASP A 1 457 ? -9.310  19.271  11.507  1.00 32.17 ? 471 ASP A N   1 
ATOM   3324  C  CA  . ASP A 1 457 ? -8.055  18.797  12.096  1.00 32.78 ? 471 ASP A CA  1 
ATOM   3325  C  C   . ASP A 1 457 ? -8.043  18.922  13.622  1.00 34.55 ? 471 ASP A C   1 
ATOM   3326  O  O   . ASP A 1 457 ? -7.650  17.991  14.320  1.00 38.17 ? 471 ASP A O   1 
ATOM   3327  C  CB  . ASP A 1 457 ? -6.861  19.532  11.480  1.00 36.65 ? 471 ASP A CB  1 
ATOM   3328  C  CG  . ASP A 1 457 ? -5.538  19.112  12.093  1.00 50.97 ? 471 ASP A CG  1 
ATOM   3329  O  OD1 . ASP A 1 457 ? -4.985  18.061  11.688  1.00 48.70 ? 471 ASP A OD1 1 
ATOM   3330  O  OD2 . ASP A 1 457 ? -5.053  19.840  12.985  1.00 56.71 ? 471 ASP A OD2 1 
ATOM   3331  N  N   . SER A 1 458 ? -8.487  20.065  14.142  1.00 44.28 ? 472 SER A N   1 
ATOM   3332  C  CA  . SER A 1 458 ? -8.443  20.303  15.584  1.00 39.04 ? 472 SER A CA  1 
ATOM   3333  C  C   . SER A 1 458 ? -9.379  19.377  16.361  1.00 39.70 ? 472 SER A C   1 
ATOM   3334  O  O   . SER A 1 458 ? -9.134  19.081  17.526  1.00 36.46 ? 472 SER A O   1 
ATOM   3335  C  CB  . SER A 1 458 ? -8.699  21.776  15.928  1.00 38.89 ? 472 SER A CB  1 
ATOM   3336  O  OG  . SER A 1 458 ? -9.972  22.217  15.486  1.00 49.93 ? 472 SER A OG  1 
ATOM   3337  N  N   . THR A 1 459 ? -10.442 18.903  15.717  1.00 36.60 ? 473 THR A N   1 
ATOM   3338  C  CA  . THR A 1 459 ? -11.357 17.990  16.394  1.00 44.36 ? 473 THR A CA  1 
ATOM   3339  C  C   . THR A 1 459 ? -11.000 16.516  16.170  1.00 45.76 ? 473 THR A C   1 
ATOM   3340  O  O   . THR A 1 459 ? -11.696 15.624  16.658  1.00 44.24 ? 473 THR A O   1 
ATOM   3341  C  CB  . THR A 1 459 ? -12.816 18.262  15.999  1.00 46.69 ? 473 THR A CB  1 
ATOM   3342  O  OG1 . THR A 1 459 ? -12.929 18.254  14.571  1.00 41.01 ? 473 THR A OG1 1 
ATOM   3343  C  CG2 . THR A 1 459 ? -13.244 19.631  16.522  1.00 53.36 ? 473 THR A CG2 1 
ATOM   3344  N  N   . THR A 1 460 ? -9.908  16.271  15.442  1.00 42.12 ? 474 THR A N   1 
ATOM   3345  C  CA  . THR A 1 460 ? -9.458  14.912  15.147  1.00 45.40 ? 474 THR A CA  1 
ATOM   3346  C  C   . THR A 1 460 ? -8.575  14.374  16.266  1.00 44.22 ? 474 THR A C   1 
ATOM   3347  O  O   . THR A 1 460 ? -7.458  14.858  16.460  1.00 39.31 ? 474 THR A O   1 
ATOM   3348  C  CB  . THR A 1 460 ? -8.640  14.846  13.833  1.00 46.27 ? 474 THR A CB  1 
ATOM   3349  O  OG1 . THR A 1 460 ? -9.451  15.266  12.731  1.00 46.27 ? 474 THR A OG1 1 
ATOM   3350  C  CG2 . THR A 1 460 ? -8.124  13.417  13.576  1.00 38.99 ? 474 THR A CG2 1 
ATOM   3351  N  N   . SER A 1 461 ? -9.071  13.370  16.985  1.00 44.31 ? 475 SER A N   1 
ATOM   3352  C  CA  . SER A 1 461 ? -8.319  12.778  18.096  1.00 53.84 ? 475 SER A CA  1 
ATOM   3353  C  C   . SER A 1 461 ? -7.441  11.616  17.635  1.00 53.05 ? 475 SER A C   1 
ATOM   3354  O  O   . SER A 1 461 ? -6.253  11.559  17.955  1.00 59.36 ? 475 SER A O   1 
ATOM   3355  C  CB  . SER A 1 461 ? -9.269  12.323  19.202  1.00 60.61 ? 475 SER A CB  1 
ATOM   3356  O  OG  . SER A 1 461 ? -10.161 13.367  19.559  1.00 66.86 ? 475 SER A OG  1 
ATOM   3357  N  N   . TYR A 1 462 ? -8.032  10.681  16.899  1.00 50.81 ? 476 TYR A N   1 
ATOM   3358  C  CA  . TYR A 1 462 ? -7.259  9.642   16.226  1.00 56.15 ? 476 TYR A CA  1 
ATOM   3359  C  C   . TYR A 1 462 ? -7.507  9.761   14.730  1.00 61.32 ? 476 TYR A C   1 
ATOM   3360  O  O   . TYR A 1 462 ? -8.638  9.598   14.261  1.00 70.23 ? 476 TYR A O   1 
ATOM   3361  C  CB  . TYR A 1 462 ? -7.635  8.248   16.730  1.00 56.01 ? 476 TYR A CB  1 
ATOM   3362  N  N   . GLY A 1 463 ? -6.450  10.059  13.984  1.00 55.33 ? 477 GLY A N   1 
ATOM   3363  C  CA  . GLY A 1 463 ? -6.592  10.376  12.575  1.00 47.49 ? 477 GLY A CA  1 
ATOM   3364  C  C   . GLY A 1 463 ? -6.300  9.228   11.639  1.00 39.40 ? 477 GLY A C   1 
ATOM   3365  O  O   . GLY A 1 463 ? -5.261  9.211   10.972  1.00 42.21 ? 477 GLY A O   1 
ATOM   3366  N  N   . LEU A 1 464 ? -7.225  8.277   11.573  1.00 33.45 ? 478 LEU A N   1 
ATOM   3367  C  CA  . LEU A 1 464 ? -7.029  7.092   10.750  1.00 33.08 ? 478 LEU A CA  1 
ATOM   3368  C  C   . LEU A 1 464 ? -7.214  7.364   9.263   1.00 27.89 ? 478 LEU A C   1 
ATOM   3369  O  O   . LEU A 1 464 ? -6.249  7.311   8.507   1.00 25.37 ? 478 LEU A O   1 
ATOM   3370  C  CB  . LEU A 1 464 ? -7.936  5.946   11.196  1.00 30.25 ? 478 LEU A CB  1 
ATOM   3371  C  CG  . LEU A 1 464 ? -7.429  4.602   10.671  1.00 34.35 ? 478 LEU A CG  1 
ATOM   3372  C  CD1 . LEU A 1 464 ? -5.948  4.426   11.014  1.00 31.08 ? 478 LEU A CD1 1 
ATOM   3373  C  CD2 . LEU A 1 464 ? -8.248  3.459   11.240  1.00 35.39 ? 478 LEU A CD2 1 
ATOM   3374  N  N   . THR A 1 465 ? -8.448  7.640   8.836   1.00 23.19 ? 479 THR A N   1 
ATOM   3375  C  CA  . THR A 1 465 ? -8.692  7.940   7.429   1.00 26.54 ? 479 THR A CA  1 
ATOM   3376  C  C   . THR A 1 465 ? -9.487  9.220   7.232   1.00 27.04 ? 479 THR A C   1 
ATOM   3377  O  O   . THR A 1 465 ? -10.070 9.768   8.161   1.00 21.16 ? 479 THR A O   1 
ATOM   3378  C  CB  . THR A 1 465 ? -9.459  6.808   6.722   1.00 28.72 ? 479 THR A CB  1 
ATOM   3379  O  OG1 . THR A 1 465 ? -10.769 6.702   7.285   1.00 21.64 ? 479 THR A OG1 1 
ATOM   3380  C  CG2 . THR A 1 465 ? -8.721  5.476   6.877   1.00 28.58 ? 479 THR A CG2 1 
ATOM   3381  N  N   . GLY A 1 466 ? -9.500  9.702   5.999   1.00 28.77 ? 480 GLY A N   1 
ATOM   3382  C  CA  . GLY A 1 466 ? -10.262 10.885  5.691   1.00 29.29 ? 480 GLY A CA  1 
ATOM   3383  C  C   . GLY A 1 466 ? -10.327 11.089  4.198   1.00 29.23 ? 480 GLY A C   1 
ATOM   3384  O  O   . GLY A 1 466 ? -9.641  10.423  3.424   1.00 30.62 ? 480 GLY A O   1 
ATOM   3385  N  N   . ALA A 1 467 ? -11.158 12.026  3.788   1.00 29.76 ? 481 ALA A N   1 
ATOM   3386  C  CA  . ALA A 1 467 ? -11.335 12.257  2.375   1.00 29.71 ? 481 ALA A CA  1 
ATOM   3387  C  C   . ALA A 1 467 ? -11.689 13.700  2.155   1.00 30.43 ? 481 ALA A C   1 
ATOM   3388  O  O   . ALA A 1 467 ? -12.334 14.323  2.997   1.00 33.99 ? 481 ALA A O   1 
ATOM   3389  C  CB  . ALA A 1 467 ? -12.405 11.344  1.823   1.00 26.44 ? 481 ALA A CB  1 
ATOM   3390  N  N   . VAL A 1 468 ? -11.232 14.234  1.032   1.00 31.23 ? 482 VAL A N   1 
ATOM   3391  C  CA  . VAL A 1 468 ? -11.646 15.550  0.590   1.00 31.65 ? 482 VAL A CA  1 
ATOM   3392  C  C   . VAL A 1 468 ? -12.284 15.415  -0.780  1.00 38.71 ? 482 VAL A C   1 
ATOM   3393  O  O   . VAL A 1 468 ? -11.726 14.773  -1.676  1.00 36.86 ? 482 VAL A O   1 
ATOM   3394  C  CB  . VAL A 1 468 ? -10.464 16.531  0.527   1.00 34.52 ? 482 VAL A CB  1 
ATOM   3395  C  CG1 . VAL A 1 468 ? -10.767 17.689  -0.400  1.00 32.10 ? 482 VAL A CG1 1 
ATOM   3396  C  CG2 . VAL A 1 468 ? -10.153 17.040  1.917   1.00 40.69 ? 482 VAL A CG2 1 
ATOM   3397  N  N   . PHE A 1 469 ? -13.471 16.001  -0.922  1.00 37.53 ? 483 PHE A N   1 
ATOM   3398  C  CA  . PHE A 1 469 ? -14.175 16.019  -2.194  1.00 38.22 ? 483 PHE A CA  1 
ATOM   3399  C  C   . PHE A 1 469 ? -14.133 17.432  -2.745  1.00 41.11 ? 483 PHE A C   1 
ATOM   3400  O  O   . PHE A 1 469 ? -14.638 18.371  -2.127  1.00 38.37 ? 483 PHE A O   1 
ATOM   3401  C  CB  . PHE A 1 469 ? -15.616 15.545  -2.018  1.00 37.55 ? 483 PHE A CB  1 
ATOM   3402  C  CG  . PHE A 1 469 ? -15.735 14.072  -1.733  1.00 31.84 ? 483 PHE A CG  1 
ATOM   3403  C  CD1 . PHE A 1 469 ? -15.574 13.590  -0.445  1.00 28.74 ? 483 PHE A CD1 1 
ATOM   3404  C  CD2 . PHE A 1 469 ? -15.980 13.170  -2.756  1.00 31.32 ? 483 PHE A CD2 1 
ATOM   3405  C  CE1 . PHE A 1 469 ? -15.669 12.249  -0.179  1.00 30.70 ? 483 PHE A CE1 1 
ATOM   3406  C  CE2 . PHE A 1 469 ? -16.069 11.809  -2.493  1.00 32.65 ? 483 PHE A CE2 1 
ATOM   3407  C  CZ  . PHE A 1 469 ? -15.918 11.353  -1.205  1.00 33.02 ? 483 PHE A CZ  1 
ATOM   3408  N  N   . SER A 1 470 ? -13.506 17.579  -3.904  1.00 44.19 ? 484 SER A N   1 
ATOM   3409  C  CA  . SER A 1 470 ? -13.312 18.888  -4.498  1.00 43.30 ? 484 SER A CA  1 
ATOM   3410  C  C   . SER A 1 470 ? -12.912 18.744  -5.953  1.00 48.44 ? 484 SER A C   1 
ATOM   3411  O  O   . SER A 1 470 ? -12.078 17.901  -6.286  1.00 45.94 ? 484 SER A O   1 
ATOM   3412  C  CB  . SER A 1 470 ? -12.223 19.658  -3.751  1.00 44.68 ? 484 SER A CB  1 
ATOM   3413  O  OG  . SER A 1 470 ? -11.993 20.910  -4.369  1.00 53.72 ? 484 SER A OG  1 
ATOM   3414  N  N   . GLN A 1 471 ? -13.517 19.560  -6.815  1.00 52.57 ? 485 GLN A N   1 
ATOM   3415  C  CA  . GLN A 1 471 ? -13.111 19.636  -8.214  1.00 55.04 ? 485 GLN A CA  1 
ATOM   3416  C  C   . GLN A 1 471 ? -12.053 20.720  -8.377  1.00 58.50 ? 485 GLN A C   1 
ATOM   3417  O  O   . GLN A 1 471 ? -11.347 20.769  -9.384  1.00 61.29 ? 485 GLN A O   1 
ATOM   3418  C  CB  . GLN A 1 471 ? -14.307 19.922  -9.126  1.00 49.97 ? 485 GLN A CB  1 
ATOM   3419  N  N   . ASP A 1 472 ? -11.947 21.591  -7.381  1.00 58.22 ? 486 ASP A N   1 
ATOM   3420  C  CA  . ASP A 1 472 ? -10.924 22.626  -7.400  1.00 59.25 ? 486 ASP A CA  1 
ATOM   3421  C  C   . ASP A 1 472 ? -9.577  22.053  -6.966  1.00 62.10 ? 486 ASP A C   1 
ATOM   3422  O  O   . ASP A 1 472 ? -9.386  21.702  -5.798  1.00 63.00 ? 486 ASP A O   1 
ATOM   3423  C  CB  . ASP A 1 472 ? -11.317 23.788  -6.493  1.00 55.10 ? 486 ASP A CB  1 
ATOM   3424  C  CG  . ASP A 1 472 ? -10.446 25.008  -6.708  1.00 52.75 ? 486 ASP A CG  1 
ATOM   3425  O  OD1 . ASP A 1 472 ? -9.345  25.071  -6.127  1.00 49.38 ? 486 ASP A OD1 1 
ATOM   3426  O  OD2 . ASP A 1 472 ? -10.862 25.910  -7.463  1.00 59.93 ? 486 ASP A OD2 1 
ATOM   3427  N  N   . LYS A 1 473 ? -8.650  21.954  -7.916  1.00 60.59 ? 487 LYS A N   1 
ATOM   3428  C  CA  . LYS A 1 473 ? -7.324  21.403  -7.655  1.00 58.69 ? 487 LYS A CA  1 
ATOM   3429  C  C   . LYS A 1 473 ? -6.583  22.215  -6.594  1.00 54.72 ? 487 LYS A C   1 
ATOM   3430  O  O   . LYS A 1 473 ? -5.914  21.653  -5.728  1.00 52.94 ? 487 LYS A O   1 
ATOM   3431  C  CB  . LYS A 1 473 ? -6.510  21.354  -8.949  1.00 63.01 ? 487 LYS A CB  1 
ATOM   3432  N  N   . ASP A 1 474 ? -6.720  23.537  -6.662  1.00 57.53 ? 488 ASP A N   1 
ATOM   3433  C  CA  . ASP A 1 474 ? -6.093  24.433  -5.694  1.00 56.17 ? 488 ASP A CA  1 
ATOM   3434  C  C   . ASP A 1 474 ? -6.586  24.166  -4.270  1.00 57.97 ? 488 ASP A C   1 
ATOM   3435  O  O   . ASP A 1 474 ? -5.823  24.288  -3.309  1.00 59.30 ? 488 ASP A O   1 
ATOM   3436  C  CB  . ASP A 1 474 ? -6.329  25.896  -6.077  1.00 57.60 ? 488 ASP A CB  1 
ATOM   3437  N  N   . VAL A 1 475 ? -7.858  23.797  -4.137  1.00 52.77 ? 489 VAL A N   1 
ATOM   3438  C  CA  . VAL A 1 475 ? -8.416  23.460  -2.831  1.00 48.06 ? 489 VAL A CA  1 
ATOM   3439  C  C   . VAL A 1 475 ? -7.909  22.095  -2.381  1.00 42.79 ? 489 VAL A C   1 
ATOM   3440  O  O   . VAL A 1 475 ? -7.653  21.884  -1.199  1.00 43.82 ? 489 VAL A O   1 
ATOM   3441  C  CB  . VAL A 1 475 ? -9.966  23.483  -2.825  1.00 56.33 ? 489 VAL A CB  1 
ATOM   3442  C  CG1 . VAL A 1 475 ? -10.513 23.019  -1.471  1.00 49.31 ? 489 VAL A CG1 1 
ATOM   3443  C  CG2 . VAL A 1 475 ? -10.476 24.876  -3.152  1.00 61.50 ? 489 VAL A CG2 1 
ATOM   3444  N  N   . VAL A 1 476 ? -7.756  21.172  -3.326  1.00 41.68 ? 490 VAL A N   1 
ATOM   3445  C  CA  . VAL A 1 476 ? -7.194  19.863  -3.003  1.00 42.90 ? 490 VAL A CA  1 
ATOM   3446  C  C   . VAL A 1 476 ? -5.802  20.006  -2.384  1.00 45.66 ? 490 VAL A C   1 
ATOM   3447  O  O   . VAL A 1 476 ? -5.550  19.486  -1.301  1.00 40.30 ? 490 VAL A O   1 
ATOM   3448  C  CB  . VAL A 1 476 ? -7.126  18.919  -4.233  1.00 43.01 ? 490 VAL A CB  1 
ATOM   3449  C  CG1 . VAL A 1 476 ? -6.214  17.734  -3.944  1.00 37.73 ? 490 VAL A CG1 1 
ATOM   3450  C  CG2 . VAL A 1 476 ? -8.520  18.427  -4.624  1.00 39.55 ? 490 VAL A CG2 1 
ATOM   3451  N  N   . GLN A 1 477 ? -4.912  20.723  -3.069  1.00 52.85 ? 491 GLN A N   1 
ATOM   3452  C  CA  . GLN A 1 477 ? -3.556  20.939  -2.572  1.00 53.83 ? 491 GLN A CA  1 
ATOM   3453  C  C   . GLN A 1 477 ? -3.606  21.603  -1.198  1.00 51.22 ? 491 GLN A C   1 
ATOM   3454  O  O   . GLN A 1 477 ? -2.902  21.195  -0.279  1.00 40.32 ? 491 GLN A O   1 
ATOM   3455  C  CB  . GLN A 1 477 ? -2.738  21.786  -3.554  1.00 56.57 ? 491 GLN A CB  1 
ATOM   3456  N  N   . GLU A 1 478 ? -4.463  22.611  -1.060  1.00 56.00 ? 492 GLU A N   1 
ATOM   3457  C  CA  . GLU A 1 478 ? -4.662  23.279  0.220   1.00 51.22 ? 492 GLU A CA  1 
ATOM   3458  C  C   . GLU A 1 478 ? -5.081  22.303  1.325   1.00 47.93 ? 492 GLU A C   1 
ATOM   3459  O  O   . GLU A 1 478 ? -4.438  22.228  2.374   1.00 45.47 ? 492 GLU A O   1 
ATOM   3460  C  CB  . GLU A 1 478 ? -5.707  24.382  0.079   1.00 47.89 ? 492 GLU A CB  1 
ATOM   3461  C  CG  . GLU A 1 478 ? -5.927  25.178  1.347   1.00 52.55 ? 492 GLU A CG  1 
ATOM   3462  C  CD  . GLU A 1 478 ? -6.805  26.396  1.123   1.00 54.98 ? 492 GLU A CD  1 
ATOM   3463  O  OE1 . GLU A 1 478 ? -7.373  26.526  0.015   1.00 52.16 ? 492 GLU A OE1 1 
ATOM   3464  O  OE2 . GLU A 1 478 ? -6.924  27.223  2.053   1.00 55.79 ? 492 GLU A OE2 1 
ATOM   3465  N  N   . ALA A 1 479 ? -6.152  21.552  1.080   1.00 47.79 ? 493 ALA A N   1 
ATOM   3466  C  CA  . ALA A 1 479 ? -6.691  20.637  2.087   1.00 45.49 ? 493 ALA A CA  1 
ATOM   3467  C  C   . ALA A 1 479 ? -5.680  19.587  2.521   1.00 42.97 ? 493 ALA A C   1 
ATOM   3468  O  O   . ALA A 1 479 ? -5.639  19.196  3.690   1.00 44.97 ? 493 ALA A O   1 
ATOM   3469  C  CB  . ALA A 1 479 ? -7.964  19.970  1.581   1.00 44.83 ? 493 ALA A CB  1 
ATOM   3470  N  N   . THR A 1 480 ? -4.858  19.126  1.585   1.00 45.75 ? 494 THR A N   1 
ATOM   3471  C  CA  . THR A 1 480 ? -3.878  18.091  1.907   1.00 45.61 ? 494 THR A CA  1 
ATOM   3472  C  C   . THR A 1 480 ? -2.845  18.597  2.927   1.00 41.73 ? 494 THR A C   1 
ATOM   3473  O  O   . THR A 1 480 ? -2.431  17.856  3.811   1.00 39.58 ? 494 THR A O   1 
ATOM   3474  C  CB  . THR A 1 480 ? -3.175  17.551  0.637   1.00 46.37 ? 494 THR A CB  1 
ATOM   3475  O  OG1 . THR A 1 480 ? -4.159  17.210  -0.354  1.00 39.89 ? 494 THR A OG1 1 
ATOM   3476  C  CG2 . THR A 1 480 ? -2.353  16.322  0.970   1.00 44.16 ? 494 THR A CG2 1 
ATOM   3477  N  N   . LYS A 1 481 ? -2.441  19.863  2.811   1.00 44.27 ? 495 LYS A N   1 
ATOM   3478  C  CA  . LYS A 1 481 ? -1.491  20.442  3.770   1.00 43.35 ? 495 LYS A CA  1 
ATOM   3479  C  C   . LYS A 1 481 ? -2.127  20.597  5.150   1.00 41.28 ? 495 LYS A C   1 
ATOM   3480  O  O   . LYS A 1 481 ? -1.541  20.231  6.160   1.00 38.53 ? 495 LYS A O   1 
ATOM   3481  C  CB  . LYS A 1 481 ? -0.966  21.805  3.293   1.00 40.33 ? 495 LYS A CB  1 
ATOM   3482  C  CG  . LYS A 1 481 ? 0.270   21.750  2.411   1.00 46.51 ? 495 LYS A CG  1 
ATOM   3483  N  N   . VAL A 1 482 ? -3.328  21.161  5.185   1.00 45.78 ? 496 VAL A N   1 
ATOM   3484  C  CA  . VAL A 1 482 ? -4.011  21.398  6.448   1.00 42.54 ? 496 VAL A CA  1 
ATOM   3485  C  C   . VAL A 1 482 ? -4.277  20.087  7.189   1.00 39.13 ? 496 VAL A C   1 
ATOM   3486  O  O   . VAL A 1 482 ? -4.087  19.989  8.404   1.00 39.43 ? 496 VAL A O   1 
ATOM   3487  C  CB  . VAL A 1 482 ? -5.346  22.122  6.213   1.00 41.35 ? 496 VAL A CB  1 
ATOM   3488  C  CG1 . VAL A 1 482 ? -6.034  22.400  7.540   1.00 41.79 ? 496 VAL A CG1 1 
ATOM   3489  C  CG2 . VAL A 1 482 ? -5.115  23.415  5.435   1.00 49.12 ? 496 VAL A CG2 1 
ATOM   3490  N  N   . LEU A 1 483 ? -4.710  19.078  6.444   1.00 33.03 ? 497 LEU A N   1 
ATOM   3491  C  CA  . LEU A 1 483 ? -5.136  17.819  7.038   1.00 29.11 ? 497 LEU A CA  1 
ATOM   3492  C  C   . LEU A 1 483 ? -4.025  16.773  7.041   1.00 30.65 ? 497 LEU A C   1 
ATOM   3493  O  O   . LEU A 1 483 ? -4.283  15.590  7.254   1.00 26.67 ? 497 LEU A O   1 
ATOM   3494  C  CB  . LEU A 1 483 ? -6.361  17.287  6.289   1.00 33.69 ? 497 LEU A CB  1 
ATOM   3495  C  CG  . LEU A 1 483 ? -7.558  18.244  6.306   1.00 34.93 ? 497 LEU A CG  1 
ATOM   3496  C  CD1 . LEU A 1 483 ? -8.655  17.782  5.350   1.00 30.62 ? 497 LEU A CD1 1 
ATOM   3497  C  CD2 . LEU A 1 483 ? -8.098  18.349  7.716   1.00 37.77 ? 497 LEU A CD2 1 
ATOM   3498  N  N   . ARG A 1 484 ? -2.793  17.218  6.816   1.00 35.80 ? 498 ARG A N   1 
ATOM   3499  C  CA  . ARG A 1 484 ? -1.634  16.320  6.718   1.00 31.30 ? 498 ARG A CA  1 
ATOM   3500  C  C   . ARG A 1 484 ? -1.577  15.314  7.860   1.00 26.57 ? 498 ARG A C   1 
ATOM   3501  O  O   . ARG A 1 484 ? -1.237  14.150  7.666   1.00 37.28 ? 498 ARG A O   1 
ATOM   3502  C  CB  . ARG A 1 484 ? -0.351  17.155  6.681   1.00 38.22 ? 498 ARG A CB  1 
ATOM   3503  C  CG  . ARG A 1 484 ? 0.957   16.393  6.455   1.00 36.63 ? 498 ARG A CG  1 
ATOM   3504  C  CD  . ARG A 1 484 ? 2.072   17.425  6.243   1.00 36.72 ? 498 ARG A CD  1 
ATOM   3505  N  NE  . ARG A 1 484 ? 3.418   16.861  6.164   1.00 41.47 ? 498 ARG A NE  1 
ATOM   3506  C  CZ  . ARG A 1 484 ? 3.972   16.402  5.046   1.00 41.32 ? 498 ARG A CZ  1 
ATOM   3507  N  NH1 . ARG A 1 484 ? 5.213   15.924  5.066   1.00 38.46 ? 498 ARG A NH1 1 
ATOM   3508  N  NH2 . ARG A 1 484 ? 3.279   16.405  3.911   1.00 32.52 ? 498 ARG A NH2 1 
ATOM   3509  N  N   . ASN A 1 485 ? -1.912  15.768  9.059   1.00 29.50 ? 499 ASN A N   1 
ATOM   3510  C  CA  . ASN A 1 485 ? -1.933  14.894  10.216  1.00 27.51 ? 499 ASN A CA  1 
ATOM   3511  C  C   . ASN A 1 485 ? -3.331  14.551  10.711  1.00 30.97 ? 499 ASN A C   1 
ATOM   3512  O  O   . ASN A 1 485 ? -3.494  14.055  11.829  1.00 28.50 ? 499 ASN A O   1 
ATOM   3513  C  CB  . ASN A 1 485 ? -1.091  15.482  11.352  1.00 38.15 ? 499 ASN A CB  1 
ATOM   3514  C  CG  . ASN A 1 485 ? 0.395   15.340  11.099  1.00 38.46 ? 499 ASN A CG  1 
ATOM   3515  O  OD1 . ASN A 1 485 ? 1.084   16.320  10.834  1.00 40.25 ? 499 ASN A OD1 1 
ATOM   3516  N  ND2 . ASN A 1 485 ? 0.892   14.106  11.165  1.00 44.58 ? 499 ASN A ND2 1 
ATOM   3517  N  N   . ALA A 1 486 ? -4.338  14.786  9.874   1.00 30.16 ? 500 ALA A N   1 
ATOM   3518  C  CA  . ALA A 1 486 ? -5.701  14.427  10.245  1.00 31.75 ? 500 ALA A CA  1 
ATOM   3519  C  C   . ALA A 1 486 ? -6.088  13.024  9.773   1.00 33.26 ? 500 ALA A C   1 
ATOM   3520  O  O   . ALA A 1 486 ? -7.085  12.475  10.233  1.00 34.92 ? 500 ALA A O   1 
ATOM   3521  C  CB  . ALA A 1 486 ? -6.691  15.470  9.741   1.00 29.79 ? 500 ALA A CB  1 
ATOM   3522  N  N   . ALA A 1 487 ? -5.298  12.451  8.863   1.00 30.85 ? 501 ALA A N   1 
ATOM   3523  C  CA  . ALA A 1 487 ? -5.513  11.066  8.413   1.00 30.11 ? 501 ALA A CA  1 
ATOM   3524  C  C   . ALA A 1 487 ? -4.273  10.403  7.783   1.00 31.89 ? 501 ALA A C   1 
ATOM   3525  O  O   . ALA A 1 487 ? -3.576  11.009  6.961   1.00 35.49 ? 501 ALA A O   1 
ATOM   3526  C  CB  . ALA A 1 487 ? -6.681  10.996  7.449   1.00 28.98 ? 501 ALA A CB  1 
ATOM   3527  N  N   . GLY A 1 488 ? -4.028  9.150   8.163   1.00 30.18 ? 502 GLY A N   1 
ATOM   3528  C  CA  . GLY A 1 488 ? -2.946  8.354   7.600   1.00 34.05 ? 502 GLY A CA  1 
ATOM   3529  C  C   . GLY A 1 488 ? -3.261  7.811   6.213   1.00 37.20 ? 502 GLY A C   1 
ATOM   3530  O  O   . GLY A 1 488 ? -2.362  7.605   5.399   1.00 29.85 ? 502 GLY A O   1 
ATOM   3531  N  N   . ASN A 1 489 ? -4.543  7.555   5.953   1.00 29.25 ? 503 ASN A N   1 
ATOM   3532  C  CA  . ASN A 1 489 ? -4.999  7.229   4.605   1.00 30.27 ? 503 ASN A CA  1 
ATOM   3533  C  C   . ASN A 1 489 ? -5.918  8.341   4.139   1.00 28.62 ? 503 ASN A C   1 
ATOM   3534  O  O   . ASN A 1 489 ? -7.000  8.528   4.682   1.00 30.48 ? 503 ASN A O   1 
ATOM   3535  C  CB  . ASN A 1 489 ? -5.705  5.869   4.567   1.00 28.44 ? 503 ASN A CB  1 
ATOM   3536  C  CG  . ASN A 1 489 ? -4.721  4.709   4.566   1.00 38.67 ? 503 ASN A CG  1 
ATOM   3537  O  OD1 . ASN A 1 489 ? -4.180  4.341   5.607   1.00 39.59 ? 503 ASN A OD1 1 
ATOM   3538  N  ND2 . ASN A 1 489 ? -4.474  4.142   3.390   1.00 43.86 ? 503 ASN A ND2 1 
ATOM   3539  N  N   . PHE A 1 490 ? -5.449  9.105   3.160   1.00 29.52 ? 504 PHE A N   1 
ATOM   3540  C  CA  . PHE A 1 490 ? -6.142  10.297  2.731   1.00 29.56 ? 504 PHE A CA  1 
ATOM   3541  C  C   . PHE A 1 490 ? -6.619  10.147  1.296   1.00 33.75 ? 504 PHE A C   1 
ATOM   3542  O  O   . PHE A 1 490 ? -5.841  9.840   0.387   1.00 35.30 ? 504 PHE A O   1 
ATOM   3543  C  CB  . PHE A 1 490 ? -5.241  11.525  2.885   1.00 32.04 ? 504 PHE A CB  1 
ATOM   3544  C  CG  . PHE A 1 490 ? -5.984  12.811  2.811   1.00 36.23 ? 504 PHE A CG  1 
ATOM   3545  C  CD1 . PHE A 1 490 ? -7.017  13.071  3.698   1.00 35.22 ? 504 PHE A CD1 1 
ATOM   3546  C  CD2 . PHE A 1 490 ? -5.667  13.758  1.855   1.00 40.79 ? 504 PHE A CD2 1 
ATOM   3547  C  CE1 . PHE A 1 490 ? -7.717  14.261  3.634   1.00 39.76 ? 504 PHE A CE1 1 
ATOM   3548  C  CE2 . PHE A 1 490 ? -6.367  14.951  1.784   1.00 44.14 ? 504 PHE A CE2 1 
ATOM   3549  C  CZ  . PHE A 1 490 ? -7.392  15.198  2.677   1.00 40.35 ? 504 PHE A CZ  1 
ATOM   3550  N  N   . TYR A 1 491 ? -7.911  10.366  1.094   1.00 28.90 ? 505 TYR A N   1 
ATOM   3551  C  CA  . TYR A 1 491 ? -8.506  10.103  -0.198  1.00 28.07 ? 505 TYR A CA  1 
ATOM   3552  C  C   . TYR A 1 491 ? -8.991  11.384  -0.826  1.00 30.51 ? 505 TYR A C   1 
ATOM   3553  O  O   . TYR A 1 491 ? -9.572  12.238  -0.156  1.00 35.90 ? 505 TYR A O   1 
ATOM   3554  C  CB  . TYR A 1 491 ? -9.654  9.103   -0.064  1.00 27.02 ? 505 TYR A CB  1 
ATOM   3555  C  CG  . TYR A 1 491 ? -9.203  7.753   0.413   1.00 31.48 ? 505 TYR A CG  1 
ATOM   3556  C  CD1 . TYR A 1 491 ? -9.162  7.453   1.772   1.00 26.14 ? 505 TYR A CD1 1 
ATOM   3557  C  CD2 . TYR A 1 491 ? -8.819  6.772   -0.490  1.00 32.12 ? 505 TYR A CD2 1 
ATOM   3558  C  CE1 . TYR A 1 491 ? -8.749  6.216   2.213   1.00 32.30 ? 505 TYR A CE1 1 
ATOM   3559  C  CE2 . TYR A 1 491 ? -8.408  5.525   -0.056  1.00 29.58 ? 505 TYR A CE2 1 
ATOM   3560  C  CZ  . TYR A 1 491 ? -8.370  5.255   1.296   1.00 32.47 ? 505 TYR A CZ  1 
ATOM   3561  O  OH  . TYR A 1 491 ? -7.964  4.020   1.738   1.00 31.36 ? 505 TYR A OH  1 
ATOM   3562  N  N   . ILE A 1 492 ? -8.727  11.515  -2.120  1.00 31.27 ? 506 ILE A N   1 
ATOM   3563  C  CA  . ILE A 1 492 ? -9.188  12.658  -2.889  1.00 36.01 ? 506 ILE A CA  1 
ATOM   3564  C  C   . ILE A 1 492 ? -10.300 12.189  -3.816  1.00 39.85 ? 506 ILE A C   1 
ATOM   3565  O  O   . ILE A 1 492 ? -10.074 11.355  -4.702  1.00 37.67 ? 506 ILE A O   1 
ATOM   3566  C  CB  . ILE A 1 492 ? -8.038  13.258  -3.702  1.00 40.29 ? 506 ILE A CB  1 
ATOM   3567  C  CG1 . ILE A 1 492 ? -6.906  13.671  -2.763  1.00 45.96 ? 506 ILE A CG1 1 
ATOM   3568  C  CG2 . ILE A 1 492 ? -8.512  14.452  -4.528  1.00 39.25 ? 506 ILE A CG2 1 
ATOM   3569  C  CD1 . ILE A 1 492 ? -5.657  14.109  -3.477  1.00 46.27 ? 506 ILE A CD1 1 
ATOM   3570  N  N   . ASN A 1 493 ? -11.501 12.717  -3.589  1.00 38.94 ? 507 ASN A N   1 
ATOM   3571  C  CA  . ASN A 1 493 ? -12.681 12.365  -4.373  1.00 39.37 ? 507 ASN A CA  1 
ATOM   3572  C  C   . ASN A 1 493 ? -12.981 10.870  -4.364  1.00 40.50 ? 507 ASN A C   1 
ATOM   3573  O  O   . ASN A 1 493 ? -13.409 10.312  -5.370  1.00 42.50 ? 507 ASN A O   1 
ATOM   3574  C  CB  . ASN A 1 493 ? -12.571 12.896  -5.808  1.00 40.53 ? 507 ASN A CB  1 
ATOM   3575  C  CG  . ASN A 1 493 ? -12.607 14.418  -5.869  1.00 41.58 ? 507 ASN A CG  1 
ATOM   3576  O  OD1 . ASN A 1 493 ? -13.376 15.062  -5.149  1.00 37.88 ? 507 ASN A OD1 1 
ATOM   3577  N  ND2 . ASN A 1 493 ? -11.768 15.000  -6.725  1.00 39.04 ? 507 ASN A ND2 1 
ATOM   3578  N  N   . ASP A 1 494 ? -12.727 10.228  -3.225  1.00 36.90 ? 508 ASP A N   1 
ATOM   3579  C  CA  . ASP A 1 494 ? -13.115 8.838   -3.010  1.00 29.94 ? 508 ASP A CA  1 
ATOM   3580  C  C   . ASP A 1 494 ? -13.351 8.617   -1.518  1.00 30.58 ? 508 ASP A C   1 
ATOM   3581  O  O   . ASP A 1 494 ? -12.973 9.446   -0.696  1.00 34.12 ? 508 ASP A O   1 
ATOM   3582  C  CB  . ASP A 1 494 ? -12.057 7.873   -3.536  1.00 38.05 ? 508 ASP A CB  1 
ATOM   3583  C  CG  . ASP A 1 494 ? -12.645 6.535   -3.939  1.00 46.60 ? 508 ASP A CG  1 
ATOM   3584  O  OD1 . ASP A 1 494 ? -13.764 6.212   -3.487  1.00 44.28 ? 508 ASP A OD1 1 
ATOM   3585  O  OD2 . ASP A 1 494 ? -11.996 5.807   -4.717  1.00 53.83 ? 508 ASP A OD2 1 
ATOM   3586  N  N   . LYS A 1 495 ? -13.981 7.505   -1.168  1.00 33.20 ? 509 LYS A N   1 
ATOM   3587  C  CA  . LYS A 1 495 ? -14.464 7.308   0.197   1.00 32.03 ? 509 LYS A CA  1 
ATOM   3588  C  C   . LYS A 1 495 ? -13.381 6.830   1.162   1.00 32.24 ? 509 LYS A C   1 
ATOM   3589  O  O   . LYS A 1 495 ? -12.439 6.154   0.761   1.00 26.46 ? 509 LYS A O   1 
ATOM   3590  C  CB  . LYS A 1 495 ? -15.642 6.341   0.206   1.00 27.89 ? 509 LYS A CB  1 
ATOM   3591  C  CG  . LYS A 1 495 ? -15.322 4.938   -0.283  1.00 29.47 ? 509 LYS A CG  1 
ATOM   3592  C  CD  . LYS A 1 495 ? -16.625 4.141   -0.479  1.00 32.45 ? 509 LYS A CD  1 
ATOM   3593  C  CE  . LYS A 1 495 ? -16.368 2.633   -0.501  1.00 34.11 ? 509 LYS A CE  1 
ATOM   3594  N  NZ  . LYS A 1 495 ? -15.604 2.213   -1.702  1.00 38.12 ? 509 LYS A NZ  1 
ATOM   3595  N  N   . SER A 1 496 ? -13.547 7.176   2.436   1.00 28.05 ? 510 SER A N   1 
ATOM   3596  C  CA  . SER A 1 496 ? -12.522 6.954   3.457   1.00 27.61 ? 510 SER A CA  1 
ATOM   3597  C  C   . SER A 1 496 ? -12.214 5.475   3.721   1.00 31.38 ? 510 SER A C   1 
ATOM   3598  O  O   . SER A 1 496 ? -11.193 5.149   4.340   1.00 26.42 ? 510 SER A O   1 
ATOM   3599  C  CB  . SER A 1 496 ? -12.941 7.627   4.764   1.00 23.98 ? 510 SER A CB  1 
ATOM   3600  O  OG  . SER A 1 496 ? -14.077 6.975   5.306   1.00 27.37 ? 510 SER A OG  1 
ATOM   3601  N  N   . THR A 1 497 ? -13.097 4.580   3.282   1.00 29.71 ? 511 THR A N   1 
ATOM   3602  C  CA  . THR A 1 497 ? -12.849 3.152   3.461   1.00 26.16 ? 511 THR A CA  1 
ATOM   3603  C  C   . THR A 1 497 ? -12.077 2.552   2.291   1.00 26.63 ? 511 THR A C   1 
ATOM   3604  O  O   . THR A 1 497 ? -11.874 1.341   2.246   1.00 29.92 ? 511 THR A O   1 
ATOM   3605  C  CB  . THR A 1 497 ? -14.146 2.327   3.620   1.00 27.39 ? 511 THR A CB  1 
ATOM   3606  O  OG1 . THR A 1 497 ? -15.043 2.633   2.541   1.00 25.31 ? 511 THR A OG1 1 
ATOM   3607  C  CG2 . THR A 1 497 ? -14.802 2.584   4.972   1.00 26.11 ? 511 THR A CG2 1 
ATOM   3608  N  N   . GLY A 1 498 ? -11.648 3.387   1.354   1.00 30.66 ? 512 GLY A N   1 
ATOM   3609  C  CA  . GLY A 1 498 ? -10.969 2.893   0.169   1.00 39.14 ? 512 GLY A CA  1 
ATOM   3610  C  C   . GLY A 1 498 ? -11.973 2.391   -0.852  1.00 43.80 ? 512 GLY A C   1 
ATOM   3611  O  O   . GLY A 1 498 ? -13.174 2.399   -0.594  1.00 43.27 ? 512 GLY A O   1 
ATOM   3612  N  N   . SER A 1 499 ? -11.486 1.945   -2.006  1.00 46.90 ? 513 SER A N   1 
ATOM   3613  C  CA  . SER A 1 499 ? -12.368 1.518   -3.091  1.00 50.27 ? 513 SER A CA  1 
ATOM   3614  C  C   . SER A 1 499 ? -11.841 0.287   -3.836  1.00 50.23 ? 513 SER A C   1 
ATOM   3615  O  O   . SER A 1 499 ? -10.737 -0.197  -3.567  1.00 48.39 ? 513 SER A O   1 
ATOM   3616  C  CB  . SER A 1 499 ? -12.591 2.673   -4.068  1.00 49.17 ? 513 SER A CB  1 
ATOM   3617  N  N   . HIS A 1 522 ? 6.101   -3.103  5.322   1.00 53.50 ? 536 HIS A N   1 
ATOM   3618  C  CA  . HIS A 1 522 ? 7.141   -2.845  6.314   1.00 54.27 ? 536 HIS A CA  1 
ATOM   3619  C  C   . HIS A 1 522 ? 6.599   -2.878  7.744   1.00 54.54 ? 536 HIS A C   1 
ATOM   3620  O  O   . HIS A 1 522 ? 7.309   -2.549  8.691   1.00 55.16 ? 536 HIS A O   1 
ATOM   3621  C  CB  . HIS A 1 522 ? 7.849   -1.512  6.036   1.00 52.75 ? 536 HIS A CB  1 
ATOM   3622  N  N   . TYR A 1 523 ? 5.341   -3.278  7.893   1.00 54.88 ? 537 TYR A N   1 
ATOM   3623  C  CA  . TYR A 1 523 ? 4.740   -3.471  9.209   1.00 48.49 ? 537 TYR A CA  1 
ATOM   3624  C  C   . TYR A 1 523 ? 5.382   -4.644  9.952   1.00 41.19 ? 537 TYR A C   1 
ATOM   3625  O  O   . TYR A 1 523 ? 5.647   -4.549  11.154  1.00 34.91 ? 537 TYR A O   1 
ATOM   3626  C  CB  . TYR A 1 523 ? 3.233   -3.718  9.077   1.00 48.82 ? 537 TYR A CB  1 
ATOM   3627  N  N   . ILE A 1 524 ? 5.628   -5.741  9.226   1.00 37.69 ? 538 ILE A N   1 
ATOM   3628  C  CA  . ILE A 1 524 ? 6.188   -6.979  9.784   1.00 34.05 ? 538 ILE A CA  1 
ATOM   3629  C  C   . ILE A 1 524 ? 7.527   -6.793  10.485  1.00 27.85 ? 538 ILE A C   1 
ATOM   3630  O  O   . ILE A 1 524 ? 7.980   -7.698  11.194  1.00 25.70 ? 538 ILE A O   1 
ATOM   3631  C  CB  . ILE A 1 524 ? 6.463   -8.059  8.700   1.00 47.57 ? 538 ILE A CB  1 
ATOM   3632  C  CG1 . ILE A 1 524 ? 7.369   -7.489  7.599   1.00 48.48 ? 538 ILE A CG1 1 
ATOM   3633  C  CG2 . ILE A 1 524 ? 5.173   -8.625  8.148   1.00 52.72 ? 538 ILE A CG2 1 
ATOM   3634  C  CD1 . ILE A 1 524 ? 8.076   -8.535  6.755   1.00 48.99 ? 538 ILE A CD1 1 
ATOM   3635  N  N   . LEU A 1 525 ? 8.180   -5.656  10.240  1.00 18.19 ? 539 LEU A N   1 
ATOM   3636  C  CA  . LEU A 1 525 ? 9.467   -5.358  10.873  1.00 23.67 ? 539 LEU A CA  1 
ATOM   3637  C  C   . LEU A 1 525 ? 9.370   -5.289  12.391  1.00 16.56 ? 539 LEU A C   1 
ATOM   3638  O  O   . LEU A 1 525 ? 10.368  -5.454  13.099  1.00 23.42 ? 539 LEU A O   1 
ATOM   3639  C  CB  . LEU A 1 525 ? 10.040  -4.040  10.342  1.00 28.01 ? 539 LEU A CB  1 
ATOM   3640  C  CG  . LEU A 1 525 ? 10.575  -4.055  8.908   1.00 33.01 ? 539 LEU A CG  1 
ATOM   3641  C  CD1 . LEU A 1 525 ? 11.242  -2.721  8.578   1.00 36.23 ? 539 LEU A CD1 1 
ATOM   3642  C  CD2 . LEU A 1 525 ? 11.547  -5.210  8.713   1.00 30.14 ? 539 LEU A CD2 1 
ATOM   3643  N  N   . ARG A 1 526 ? 8.174   -5.053  12.908  1.00 21.92 ? 540 ARG A N   1 
ATOM   3644  C  CA  . ARG A 1 526 ? 8.050   -4.964  14.349  1.00 25.18 ? 540 ARG A CA  1 
ATOM   3645  C  C   . ARG A 1 526 ? 8.333   -6.309  15.022  1.00 24.93 ? 540 ARG A C   1 
ATOM   3646  O  O   . ARG A 1 526 ? 8.683   -6.350  16.201  1.00 19.59 ? 540 ARG A O   1 
ATOM   3647  C  CB  . ARG A 1 526 ? 6.687   -4.434  14.778  1.00 32.01 ? 540 ARG A CB  1 
ATOM   3648  C  CG  . ARG A 1 526 ? 6.694   -3.963  16.227  1.00 45.66 ? 540 ARG A CG  1 
ATOM   3649  C  CD  . ARG A 1 526 ? 5.332   -3.530  16.710  1.00 50.63 ? 540 ARG A CD  1 
ATOM   3650  N  NE  . ARG A 1 526 ? 4.891   -2.287  16.090  1.00 48.89 ? 540 ARG A NE  1 
ATOM   3651  C  CZ  . ARG A 1 526 ? 5.269   -1.079  16.488  1.00 55.03 ? 540 ARG A CZ  1 
ATOM   3652  N  NH1 . ARG A 1 526 ? 6.115   -0.945  17.502  1.00 58.85 ? 540 ARG A NH1 1 
ATOM   3653  N  NH2 . ARG A 1 526 ? 4.806   -0.002  15.869  1.00 53.47 ? 540 ARG A NH2 1 
ATOM   3654  N  N   . TRP A 1 527 ? 8.210   -7.395  14.259  1.00 19.67 ? 541 TRP A N   1 
ATOM   3655  C  CA  . TRP A 1 527 ? 8.284   -8.732  14.826  1.00 17.32 ? 541 TRP A CA  1 
ATOM   3656  C  C   . TRP A 1 527 ? 9.618   -9.402  14.560  1.00 20.99 ? 541 TRP A C   1 
ATOM   3657  O  O   . TRP A 1 527 ? 9.749   -10.608 14.708  1.00 19.15 ? 541 TRP A O   1 
ATOM   3658  C  CB  . TRP A 1 527 ? 7.116   -9.592  14.310  1.00 15.83 ? 541 TRP A CB  1 
ATOM   3659  C  CG  . TRP A 1 527 ? 5.829   -8.881  14.506  1.00 14.48 ? 541 TRP A CG  1 
ATOM   3660  C  CD1 . TRP A 1 527 ? 4.949   -8.474  13.533  1.00 16.94 ? 541 TRP A CD1 1 
ATOM   3661  C  CD2 . TRP A 1 527 ? 5.306   -8.408  15.754  1.00 14.80 ? 541 TRP A CD2 1 
ATOM   3662  N  NE1 . TRP A 1 527 ? 3.889   -7.803  14.116  1.00 20.41 ? 541 TRP A NE1 1 
ATOM   3663  C  CE2 . TRP A 1 527 ? 4.092   -7.740  15.472  1.00 16.56 ? 541 TRP A CE2 1 
ATOM   3664  C  CE3 . TRP A 1 527 ? 5.748   -8.480  17.083  1.00 19.29 ? 541 TRP A CE3 1 
ATOM   3665  C  CZ2 . TRP A 1 527 ? 3.309   -7.167  16.475  1.00 17.69 ? 541 TRP A CZ2 1 
ATOM   3666  C  CZ3 . TRP A 1 527 ? 4.974   -7.901  18.077  1.00 21.63 ? 541 TRP A CZ3 1 
ATOM   3667  C  CH2 . TRP A 1 527 ? 3.759   -7.256  17.763  1.00 20.81 ? 541 TRP A CH2 1 
ATOM   3668  N  N   . THR A 1 528 ? 10.617  -8.615  14.178  1.00 20.39 ? 542 THR A N   1 
ATOM   3669  C  CA  . THR A 1 528 ? 11.933  -9.187  13.985  1.00 15.95 ? 542 THR A CA  1 
ATOM   3670  C  C   . THR A 1 528 ? 13.015  -8.310  14.630  1.00 20.27 ? 542 THR A C   1 
ATOM   3671  O  O   . THR A 1 528 ? 12.869  -7.091  14.742  1.00 18.52 ? 542 THR A O   1 
ATOM   3672  C  CB  . THR A 1 528 ? 12.221  -9.461  12.484  1.00 20.30 ? 542 THR A CB  1 
ATOM   3673  O  OG1 . THR A 1 528 ? 13.450  -10.180 12.354  1.00 22.81 ? 542 THR A OG1 1 
ATOM   3674  C  CG2 . THR A 1 528 ? 12.292  -8.166  11.690  1.00 24.88 ? 542 THR A CG2 1 
ATOM   3675  N  N   . SER A 1 529 ? 14.072  -8.952  15.106  1.00 18.78 ? 543 SER A N   1 
ATOM   3676  C  CA  . SER A 1 529 ? 15.209  -8.232  15.671  1.00 20.75 ? 543 SER A CA  1 
ATOM   3677  C  C   . SER A 1 529 ? 16.440  -8.635  14.883  1.00 20.60 ? 543 SER A C   1 
ATOM   3678  O  O   . SER A 1 529 ? 16.900  -9.780  14.966  1.00 22.25 ? 543 SER A O   1 
ATOM   3679  C  CB  . SER A 1 529 ? 15.394  -8.569  17.157  1.00 23.88 ? 543 SER A CB  1 
ATOM   3680  O  OG  . SER A 1 529 ? 16.518  -7.891  17.700  1.00 24.31 ? 543 SER A OG  1 
ATOM   3681  N  N   . PRO A 1 530 ? 16.968  -7.705  14.088  1.00 22.01 ? 544 PRO A N   1 
ATOM   3682  C  CA  . PRO A 1 530 ? 18.079  -8.048  13.204  1.00 21.36 ? 544 PRO A CA  1 
ATOM   3683  C  C   . PRO A 1 530 ? 19.357  -8.277  13.994  1.00 24.96 ? 544 PRO A C   1 
ATOM   3684  O  O   . PRO A 1 530 ? 19.624  -7.523  14.925  1.00 26.10 ? 544 PRO A O   1 
ATOM   3685  C  CB  . PRO A 1 530 ? 18.209  -6.805  12.324  1.00 28.26 ? 544 PRO A CB  1 
ATOM   3686  C  CG  . PRO A 1 530 ? 17.670  -5.688  13.185  1.00 30.21 ? 544 PRO A CG  1 
ATOM   3687  C  CD  . PRO A 1 530 ? 16.532  -6.304  13.929  1.00 24.14 ? 544 PRO A CD  1 
ATOM   3688  N  N   . GLN A 1 531 ? 20.096  -9.328  13.654  1.00 22.24 ? 545 GLN A N   1 
ATOM   3689  C  CA  . GLN A 1 531 ? 21.440  -9.541  14.188  1.00 24.65 ? 545 GLN A CA  1 
ATOM   3690  C  C   . GLN A 1 531 ? 22.445  -9.428  13.047  1.00 27.46 ? 545 GLN A C   1 
ATOM   3691  O  O   . GLN A 1 531 ? 22.254  -10.017 11.986  1.00 29.57 ? 545 GLN A O   1 
ATOM   3692  C  CB  . GLN A 1 531 ? 21.550  -10.911 14.850  1.00 23.70 ? 545 GLN A CB  1 
ATOM   3693  C  CG  . GLN A 1 531 ? 22.971  -11.311 15.250  1.00 19.65 ? 545 GLN A CG  1 
ATOM   3694  C  CD  . GLN A 1 531 ? 23.044  -12.745 15.755  1.00 27.50 ? 545 GLN A CD  1 
ATOM   3695  O  OE1 . GLN A 1 531 ? 22.656  -13.672 15.056  1.00 27.57 ? 545 GLN A OE1 1 
ATOM   3696  N  NE2 . GLN A 1 531 ? 23.527  -12.926 16.979  1.00 28.76 ? 545 GLN A NE2 1 
ATOM   3697  N  N   . VAL A 1 532 ? 23.500  -8.646  13.251  1.00 21.99 ? 546 VAL A N   1 
ATOM   3698  C  CA  . VAL A 1 532 ? 24.562  -8.546  12.255  1.00 24.99 ? 546 VAL A CA  1 
ATOM   3699  C  C   . VAL A 1 532 ? 25.704  -9.474  12.653  1.00 29.75 ? 546 VAL A C   1 
ATOM   3700  O  O   . VAL A 1 532 ? 26.215  -9.397  13.775  1.00 25.96 ? 546 VAL A O   1 
ATOM   3701  C  CB  . VAL A 1 532 ? 25.075  -7.104  12.142  1.00 32.19 ? 546 VAL A CB  1 
ATOM   3702  C  CG1 . VAL A 1 532 ? 26.243  -7.019  11.169  1.00 31.89 ? 546 VAL A CG1 1 
ATOM   3703  C  CG2 . VAL A 1 532 ? 23.925  -6.170  11.740  1.00 29.69 ? 546 VAL A CG2 1 
ATOM   3704  N  N   . ILE A 1 533 ? 26.080  -10.369 11.744  1.00 26.03 ? 547 ILE A N   1 
ATOM   3705  C  CA  . ILE A 1 533 ? 27.187  -11.286 11.979  1.00 24.40 ? 547 ILE A CA  1 
ATOM   3706  C  C   . ILE A 1 533 ? 28.344  -10.940 11.050  1.00 27.34 ? 547 ILE A C   1 
ATOM   3707  O  O   . ILE A 1 533 ? 28.174  -10.833 9.835   1.00 33.42 ? 547 ILE A O   1 
ATOM   3708  C  CB  . ILE A 1 533 ? 26.771  -12.744 11.741  1.00 27.61 ? 547 ILE A CB  1 
ATOM   3709  C  CG1 . ILE A 1 533 ? 25.612  -13.125 12.665  1.00 26.59 ? 547 ILE A CG1 1 
ATOM   3710  C  CG2 . ILE A 1 533 ? 27.957  -13.680 11.953  1.00 28.89 ? 547 ILE A CG2 1 
ATOM   3711  C  CD1 . ILE A 1 533 ? 25.114  -14.542 12.467  1.00 33.49 ? 547 ILE A CD1 1 
ATOM   3712  N  N   . LYS A 1 534 ? 29.520  -10.748 11.628  1.00 24.84 ? 548 LYS A N   1 
ATOM   3713  C  CA  . LYS A 1 534 ? 30.693  -10.430 10.838  1.00 31.26 ? 548 LYS A CA  1 
ATOM   3714  C  C   . LYS A 1 534 ? 31.827  -11.389 11.174  1.00 31.06 ? 548 LYS A C   1 
ATOM   3715  O  O   . LYS A 1 534 ? 32.142  -11.609 12.341  1.00 35.48 ? 548 LYS A O   1 
ATOM   3716  C  CB  . LYS A 1 534 ? 31.120  -8.985  11.084  1.00 35.05 ? 548 LYS A CB  1 
ATOM   3717  C  CG  . LYS A 1 534 ? 30.168  -7.948  10.492  1.00 37.09 ? 548 LYS A CG  1 
ATOM   3718  C  CD  . LYS A 1 534 ? 30.563  -6.551  10.937  1.00 40.84 ? 548 LYS A CD  1 
ATOM   3719  C  CE  . LYS A 1 534 ? 29.599  -5.503  10.414  1.00 44.80 ? 548 LYS A CE  1 
ATOM   3720  N  NZ  . LYS A 1 534 ? 29.954  -4.154  10.941  1.00 54.36 ? 548 LYS A NZ  1 
ATOM   3721  N  N   . GLU A 1 535 ? 32.431  -11.964 10.142  1.00 33.91 ? 549 GLU A N   1 
ATOM   3722  C  CA  . GLU A 1 535 ? 33.516  -12.918 10.328  1.00 38.85 ? 549 GLU A CA  1 
ATOM   3723  C  C   . GLU A 1 535 ? 34.753  -12.437 9.602   1.00 41.43 ? 549 GLU A C   1 
ATOM   3724  O  O   . GLU A 1 535 ? 34.680  -12.002 8.455   1.00 39.18 ? 549 GLU A O   1 
ATOM   3725  C  CB  . GLU A 1 535 ? 33.130  -14.289 9.787   1.00 40.87 ? 549 GLU A CB  1 
ATOM   3726  C  CG  . GLU A 1 535 ? 34.276  -15.291 9.788   1.00 43.70 ? 549 GLU A CG  1 
ATOM   3727  C  CD  . GLU A 1 535 ? 33.809  -16.696 9.470   1.00 45.12 ? 549 GLU A CD  1 
ATOM   3728  O  OE1 . GLU A 1 535 ? 32.613  -16.857 9.161   1.00 49.91 ? 549 GLU A OE1 1 
ATOM   3729  O  OE2 . GLU A 1 535 ? 34.628  -17.637 9.528   1.00 49.09 ? 549 GLU A OE2 1 
ATOM   3730  N  N   . THR A 1 536 ? 35.889  -12.504 10.281  1.00 43.27 ? 550 THR A N   1 
ATOM   3731  C  CA  . THR A 1 536 ? 37.154  -12.195 9.648   1.00 47.30 ? 550 THR A CA  1 
ATOM   3732  C  C   . THR A 1 536 ? 37.824  -13.506 9.243   1.00 45.69 ? 550 THR A C   1 
ATOM   3733  O  O   . THR A 1 536 ? 37.939  -14.431 10.053  1.00 42.34 ? 550 THR A O   1 
ATOM   3734  C  CB  . THR A 1 536 ? 38.073  -11.385 10.581  1.00 44.47 ? 550 THR A CB  1 
ATOM   3735  O  OG1 . THR A 1 536 ? 37.416  -10.171 10.966  1.00 39.05 ? 550 THR A OG1 1 
ATOM   3736  C  CG2 . THR A 1 536 ? 39.354  -11.036 9.868   1.00 46.21 ? 550 THR A CG2 1 
ATOM   3737  N  N   . HIS A 1 537 ? 38.232  -13.588 7.979   1.00 51.47 ? 551 HIS A N   1 
ATOM   3738  C  CA  . HIS A 1 537 ? 38.891  -14.782 7.455   1.00 57.83 ? 551 HIS A CA  1 
ATOM   3739  C  C   . HIS A 1 537 ? 40.372  -14.515 7.189   1.00 59.69 ? 551 HIS A C   1 
ATOM   3740  O  O   . HIS A 1 537 ? 41.209  -14.646 8.081   1.00 62.81 ? 551 HIS A O   1 
ATOM   3741  C  CB  . HIS A 1 537 ? 38.214  -15.248 6.163   1.00 57.40 ? 551 HIS A CB  1 
ATOM   3742  C  CG  . HIS A 1 537 ? 36.727  -15.377 6.266   1.00 57.47 ? 551 HIS A CG  1 
ATOM   3743  N  ND1 . HIS A 1 537 ? 36.090  -16.593 6.417   1.00 54.04 ? 551 HIS A ND1 1 
ATOM   3744  C  CD2 . HIS A 1 537 ? 35.744  -14.445 6.231   1.00 55.97 ? 551 HIS A CD2 1 
ATOM   3745  C  CE1 . HIS A 1 537 ? 34.786  -16.403 6.470   1.00 51.71 ? 551 HIS A CE1 1 
ATOM   3746  N  NE2 . HIS A 1 537 ? 34.548  -15.106 6.360   1.00 53.97 ? 551 HIS A NE2 1 
ATOM   3747  N  N   . ARG B 1 9   ? 1.997   15.161  -17.515 1.00 58.35 ? 23  ARG B N   1 
ATOM   3748  C  CA  . ARG B 1 9   ? 2.420   15.680  -16.217 1.00 57.71 ? 23  ARG B CA  1 
ATOM   3749  C  C   . ARG B 1 9   ? 3.744   15.048  -15.790 1.00 63.32 ? 23  ARG B C   1 
ATOM   3750  O  O   . ARG B 1 9   ? 4.041   13.908  -16.151 1.00 63.32 ? 23  ARG B O   1 
ATOM   3751  C  CB  . ARG B 1 9   ? 1.339   15.426  -15.164 1.00 58.60 ? 23  ARG B CB  1 
ATOM   3752  C  CG  . ARG B 1 9   ? 1.300   16.429  -14.020 1.00 57.83 ? 23  ARG B CG  1 
ATOM   3753  C  CD  . ARG B 1 9   ? 0.783   17.805  -14.446 1.00 65.48 ? 23  ARG B CD  1 
ATOM   3754  N  NE  . ARG B 1 9   ? 1.788   18.616  -15.132 1.00 72.08 ? 23  ARG B NE  1 
ATOM   3755  C  CZ  . ARG B 1 9   ? 2.858   19.149  -14.543 1.00 75.33 ? 23  ARG B CZ  1 
ATOM   3756  N  NH1 . ARG B 1 9   ? 3.081   18.953  -13.249 1.00 75.25 ? 23  ARG B NH1 1 
ATOM   3757  N  NH2 . ARG B 1 9   ? 3.713   19.876  -15.249 1.00 78.16 ? 23  ARG B NH2 1 
ATOM   3758  N  N   . TRP B 1 10  ? 4.533   15.796  -15.022 1.00 49.17 ? 24  TRP B N   1 
ATOM   3759  C  CA  . TRP B 1 10  ? 5.875   15.373  -14.652 1.00 48.71 ? 24  TRP B CA  1 
ATOM   3760  C  C   . TRP B 1 10  ? 6.388   16.155  -13.448 1.00 50.67 ? 24  TRP B C   1 
ATOM   3761  O  O   . TRP B 1 10  ? 6.026   17.318  -13.256 1.00 55.46 ? 24  TRP B O   1 
ATOM   3762  C  CB  . TRP B 1 10  ? 6.826   15.560  -15.834 1.00 49.84 ? 24  TRP B CB  1 
ATOM   3763  C  CG  . TRP B 1 10  ? 6.939   16.985  -16.288 1.00 52.44 ? 24  TRP B CG  1 
ATOM   3764  C  CD1 . TRP B 1 10  ? 6.204   17.598  -17.259 1.00 55.93 ? 24  TRP B CD1 1 
ATOM   3765  C  CD2 . TRP B 1 10  ? 7.842   17.978  -15.781 1.00 55.17 ? 24  TRP B CD2 1 
ATOM   3766  N  NE1 . TRP B 1 10  ? 6.597   18.908  -17.393 1.00 54.41 ? 24  TRP B NE1 1 
ATOM   3767  C  CE2 . TRP B 1 10  ? 7.596   19.166  -16.497 1.00 52.77 ? 24  TRP B CE2 1 
ATOM   3768  C  CE3 . TRP B 1 10  ? 8.834   17.974  -14.794 1.00 58.44 ? 24  TRP B CE3 1 
ATOM   3769  C  CZ2 . TRP B 1 10  ? 8.308   20.339  -16.256 1.00 59.79 ? 24  TRP B CZ2 1 
ATOM   3770  C  CZ3 . TRP B 1 10  ? 9.537   19.140  -14.556 1.00 58.72 ? 24  TRP B CZ3 1 
ATOM   3771  C  CH2 . TRP B 1 10  ? 9.272   20.306  -15.286 1.00 56.61 ? 24  TRP B CH2 1 
ATOM   3772  N  N   . LYS B 1 11  ? 7.242   15.514  -12.651 1.00 44.54 ? 25  LYS B N   1 
ATOM   3773  C  CA  . LYS B 1 11  ? 7.813   16.129  -11.454 1.00 54.01 ? 25  LYS B CA  1 
ATOM   3774  C  C   . LYS B 1 11  ? 9.321   15.881  -11.345 1.00 58.59 ? 25  LYS B C   1 
ATOM   3775  O  O   . LYS B 1 11  ? 9.785   14.756  -11.533 1.00 62.94 ? 25  LYS B O   1 
ATOM   3776  C  CB  . LYS B 1 11  ? 7.118   15.590  -10.196 1.00 47.33 ? 25  LYS B CB  1 
ATOM   3777  N  N   . HIS B 1 12  ? 10.080  16.928  -11.034 1.00 57.84 ? 26  HIS B N   1 
ATOM   3778  C  CA  . HIS B 1 12  ? 11.507  16.778  -10.746 1.00 58.50 ? 26  HIS B CA  1 
ATOM   3779  C  C   . HIS B 1 12  ? 11.707  16.109  -9.388  1.00 57.12 ? 26  HIS B C   1 
ATOM   3780  O  O   . HIS B 1 12  ? 11.157  16.556  -8.384  1.00 62.85 ? 26  HIS B O   1 
ATOM   3781  C  CB  . HIS B 1 12  ? 12.214  18.137  -10.755 1.00 60.70 ? 26  HIS B CB  1 
ATOM   3782  C  CG  . HIS B 1 12  ? 13.085  18.364  -11.952 1.00 65.04 ? 26  HIS B CG  1 
ATOM   3783  N  ND1 . HIS B 1 12  ? 12.635  18.995  -13.094 1.00 70.36 ? 26  HIS B ND1 1 
ATOM   3784  C  CD2 . HIS B 1 12  ? 14.382  18.052  -12.183 1.00 65.12 ? 26  HIS B CD2 1 
ATOM   3785  C  CE1 . HIS B 1 12  ? 13.615  19.056  -13.977 1.00 70.07 ? 26  HIS B CE1 1 
ATOM   3786  N  NE2 . HIS B 1 12  ? 14.686  18.491  -13.449 1.00 70.39 ? 26  HIS B NE2 1 
ATOM   3787  N  N   . THR B 1 13  ? 12.492  15.035  -9.364  1.00 51.67 ? 27  THR B N   1 
ATOM   3788  C  CA  . THR B 1 13  ? 12.814  14.325  -8.126  1.00 43.62 ? 27  THR B CA  1 
ATOM   3789  C  C   . THR B 1 13  ? 14.340  14.272  -8.010  1.00 45.90 ? 27  THR B C   1 
ATOM   3790  O  O   . THR B 1 13  ? 15.039  14.692  -8.925  1.00 50.40 ? 27  THR B O   1 
ATOM   3791  C  CB  . THR B 1 13  ? 12.231  12.888  -8.137  1.00 59.84 ? 27  THR B CB  1 
ATOM   3792  O  OG1 . THR B 1 13  ? 10.901  12.908  -8.672  1.00 57.99 ? 27  THR B OG1 1 
ATOM   3793  C  CG2 . THR B 1 13  ? 12.184  12.293  -6.733  1.00 62.12 ? 27  THR B CG2 1 
ATOM   3794  N  N   . SER B 1 14  ? 14.868  13.775  -6.898  1.00 47.87 ? 28  SER B N   1 
ATOM   3795  C  CA  . SER B 1 14  ? 16.317  13.635  -6.770  1.00 50.70 ? 28  SER B CA  1 
ATOM   3796  C  C   . SER B 1 14  ? 16.703  12.232  -6.318  1.00 47.75 ? 28  SER B C   1 
ATOM   3797  O  O   . SER B 1 14  ? 15.905  11.522  -5.714  1.00 43.00 ? 28  SER B O   1 
ATOM   3798  C  CB  . SER B 1 14  ? 16.883  14.669  -5.793  1.00 49.35 ? 28  SER B CB  1 
ATOM   3799  O  OG  . SER B 1 14  ? 16.489  14.377  -4.462  1.00 51.86 ? 28  SER B OG  1 
ATOM   3800  N  N   . SER B 1 15  ? 17.933  11.838  -6.624  1.00 50.30 ? 29  SER B N   1 
ATOM   3801  C  CA  . SER B 1 15  ? 18.492  10.599  -6.103  1.00 48.95 ? 29  SER B CA  1 
ATOM   3802  C  C   . SER B 1 15  ? 19.866  10.921  -5.537  1.00 42.70 ? 29  SER B C   1 
ATOM   3803  O  O   . SER B 1 15  ? 20.472  11.938  -5.892  1.00 43.09 ? 29  SER B O   1 
ATOM   3804  C  CB  . SER B 1 15  ? 18.585  9.521   -7.192  1.00 54.45 ? 29  SER B CB  1 
ATOM   3805  O  OG  . SER B 1 15  ? 19.643  9.783   -8.101  1.00 56.44 ? 29  SER B OG  1 
ATOM   3806  N  N   . LEU B 1 16  ? 20.355  10.054  -4.662  1.00 39.12 ? 30  LEU B N   1 
ATOM   3807  C  CA  . LEU B 1 16  ? 21.557  10.340  -3.897  1.00 40.54 ? 30  LEU B CA  1 
ATOM   3808  C  C   . LEU B 1 16  ? 22.394  9.084   -3.682  1.00 38.92 ? 30  LEU B C   1 
ATOM   3809  O  O   . LEU B 1 16  ? 21.890  8.051   -3.243  1.00 36.24 ? 30  LEU B O   1 
ATOM   3810  C  CB  . LEU B 1 16  ? 21.156  10.933  -2.553  1.00 43.29 ? 30  LEU B CB  1 
ATOM   3811  C  CG  . LEU B 1 16  ? 22.209  11.514  -1.627  1.00 40.58 ? 30  LEU B CG  1 
ATOM   3812  C  CD1 . LEU B 1 16  ? 22.900  12.681  -2.297  1.00 43.47 ? 30  LEU B CD1 1 
ATOM   3813  C  CD2 . LEU B 1 16  ? 21.526  11.952  -0.338  1.00 36.88 ? 30  LEU B CD2 1 
ATOM   3814  N  N   . LYS B 1 17  ? 23.676  9.177   -4.007  1.00 35.60 ? 31  LYS B N   1 
ATOM   3815  C  CA  . LYS B 1 17  ? 24.612  8.102   -3.723  1.00 40.50 ? 31  LYS B CA  1 
ATOM   3816  C  C   . LYS B 1 17  ? 25.706  8.665   -2.820  1.00 40.58 ? 31  LYS B C   1 
ATOM   3817  O  O   . LYS B 1 17  ? 26.110  9.822   -2.970  1.00 39.80 ? 31  LYS B O   1 
ATOM   3818  C  CB  . LYS B 1 17  ? 25.202  7.537   -5.022  1.00 41.02 ? 31  LYS B CB  1 
ATOM   3819  N  N   . VAL B 1 18  ? 26.155  7.864   -1.858  1.00 39.57 ? 32  VAL B N   1 
ATOM   3820  C  CA  . VAL B 1 18  ? 27.161  8.312   -0.899  1.00 39.51 ? 32  VAL B CA  1 
ATOM   3821  C  C   . VAL B 1 18  ? 28.214  7.238   -0.648  1.00 39.03 ? 32  VAL B C   1 
ATOM   3822  O  O   . VAL B 1 18  ? 27.915  6.044   -0.643  1.00 41.28 ? 32  VAL B O   1 
ATOM   3823  C  CB  . VAL B 1 18  ? 26.536  8.739   0.463   1.00 35.11 ? 32  VAL B CB  1 
ATOM   3824  C  CG1 . VAL B 1 18  ? 25.436  9.768   0.261   1.00 29.16 ? 32  VAL B CG1 1 
ATOM   3825  C  CG2 . VAL B 1 18  ? 26.013  7.545   1.223   1.00 35.73 ? 32  VAL B CG2 1 
ATOM   3826  N  N   . ALA B 1 19  ? 29.454  7.671   -0.464  1.00 37.59 ? 33  ALA B N   1 
ATOM   3827  C  CA  . ALA B 1 19  ? 30.525  6.770   -0.059  1.00 40.13 ? 33  ALA B CA  1 
ATOM   3828  C  C   . ALA B 1 19  ? 30.815  6.978   1.421   1.00 35.46 ? 33  ALA B C   1 
ATOM   3829  O  O   . ALA B 1 19  ? 30.534  8.045   1.969   1.00 34.30 ? 33  ALA B O   1 
ATOM   3830  C  CB  . ALA B 1 19  ? 31.781  7.027   -0.881  1.00 43.95 ? 33  ALA B CB  1 
ATOM   3831  N  N   . ASN B 1 20  ? 31.362  5.954   2.064   1.00 29.07 ? 34  ASN B N   1 
ATOM   3832  C  CA  . ASN B 1 20  ? 31.820  6.078   3.436   1.00 33.93 ? 34  ASN B CA  1 
ATOM   3833  C  C   . ASN B 1 20  ? 32.927  7.111   3.521   1.00 34.17 ? 34  ASN B C   1 
ATOM   3834  O  O   . ASN B 1 20  ? 33.645  7.346   2.554   1.00 37.12 ? 34  ASN B O   1 
ATOM   3835  C  CB  . ASN B 1 20  ? 32.352  4.742   3.955   1.00 35.27 ? 34  ASN B CB  1 
ATOM   3836  C  CG  . ASN B 1 20  ? 31.272  3.694   4.062   1.00 39.53 ? 34  ASN B CG  1 
ATOM   3837  O  OD1 . ASN B 1 20  ? 31.094  2.881   3.157   1.00 37.34 ? 34  ASN B OD1 1 
ATOM   3838  N  ND2 . ASN B 1 20  ? 30.533  3.714   5.167   1.00 33.62 ? 34  ASN B ND2 1 
ATOM   3839  N  N   . GLU B 1 21  ? 33.064  7.720   4.687   1.00 30.30 ? 35  GLU B N   1 
ATOM   3840  C  CA  . GLU B 1 21  ? 34.137  8.668   4.922   1.00 33.99 ? 35  GLU B CA  1 
ATOM   3841  C  C   . GLU B 1 21  ? 35.426  7.904   5.214   1.00 32.61 ? 35  GLU B C   1 
ATOM   3842  O  O   . GLU B 1 21  ? 35.456  7.042   6.086   1.00 34.85 ? 35  GLU B O   1 
ATOM   3843  C  CB  . GLU B 1 21  ? 33.777  9.595   6.086   1.00 34.18 ? 35  GLU B CB  1 
ATOM   3844  C  CG  . GLU B 1 21  ? 34.857  10.605  6.441   1.00 31.11 ? 35  GLU B CG  1 
ATOM   3845  C  CD  . GLU B 1 21  ? 35.077  11.652  5.361   1.00 31.91 ? 35  GLU B CD  1 
ATOM   3846  O  OE1 . GLU B 1 21  ? 34.224  11.775  4.454   1.00 27.61 ? 35  GLU B OE1 1 
ATOM   3847  O  OE2 . GLU B 1 21  ? 36.114  12.354  5.424   1.00 33.52 ? 35  GLU B OE2 1 
ATOM   3848  N  N   . PRO B 1 22  ? 36.496  8.207   4.473   1.00 31.95 ? 36  PRO B N   1 
ATOM   3849  C  CA  . PRO B 1 22  ? 37.735  7.471   4.717   1.00 35.77 ? 36  PRO B CA  1 
ATOM   3850  C  C   . PRO B 1 22  ? 38.268  7.793   6.108   1.00 37.88 ? 36  PRO B C   1 
ATOM   3851  O  O   . PRO B 1 22  ? 38.069  8.904   6.604   1.00 31.89 ? 36  PRO B O   1 
ATOM   3852  C  CB  . PRO B 1 22  ? 38.683  8.012   3.638   1.00 40.13 ? 36  PRO B CB  1 
ATOM   3853  C  CG  . PRO B 1 22  ? 37.795  8.660   2.619   1.00 40.31 ? 36  PRO B CG  1 
ATOM   3854  C  CD  . PRO B 1 22  ? 36.644  9.201   3.398   1.00 35.47 ? 36  PRO B CD  1 
ATOM   3855  N  N   . VAL B 1 23  ? 38.914  6.819   6.736   1.00 36.07 ? 37  VAL B N   1 
ATOM   3856  C  CA  . VAL B 1 23  ? 39.549  7.034   8.021   1.00 36.43 ? 37  VAL B CA  1 
ATOM   3857  C  C   . VAL B 1 23  ? 41.023  7.350   7.800   1.00 44.63 ? 37  VAL B C   1 
ATOM   3858  O  O   . VAL B 1 23  ? 41.755  6.560   7.203   1.00 47.32 ? 37  VAL B O   1 
ATOM   3859  C  CB  . VAL B 1 23  ? 39.399  5.813   8.930   1.00 37.32 ? 37  VAL B CB  1 
ATOM   3860  C  CG1 . VAL B 1 23  ? 40.238  5.980   10.174  1.00 38.24 ? 37  VAL B CG1 1 
ATOM   3861  C  CG2 . VAL B 1 23  ? 37.934  5.615   9.301   1.00 36.04 ? 37  VAL B CG2 1 
ATOM   3862  N  N   . LEU B 1 24  ? 41.446  8.514   8.277   1.00 44.11 ? 38  LEU B N   1 
ATOM   3863  C  CA  . LEU B 1 24  ? 42.803  8.998   8.049   1.00 46.93 ? 38  LEU B CA  1 
ATOM   3864  C  C   . LEU B 1 24  ? 43.818  8.338   8.983   1.00 43.61 ? 38  LEU B C   1 
ATOM   3865  O  O   . LEU B 1 24  ? 43.517  8.034   10.139  1.00 37.52 ? 38  LEU B O   1 
ATOM   3866  C  CB  . LEU B 1 24  ? 42.853  10.524  8.178   1.00 51.29 ? 38  LEU B CB  1 
ATOM   3867  C  CG  . LEU B 1 24  ? 41.821  11.280  7.340   1.00 52.23 ? 38  LEU B CG  1 
ATOM   3868  C  CD1 . LEU B 1 24  ? 41.996  12.786  7.485   1.00 53.09 ? 38  LEU B CD1 1 
ATOM   3869  C  CD2 . LEU B 1 24  ? 41.926  10.863  5.886   1.00 53.34 ? 38  LEU B CD2 1 
ATOM   3870  N  N   . ALA B 1 25  ? 45.027  8.129   8.467   1.00 49.77 ? 39  ALA B N   1 
ATOM   3871  C  CA  . ALA B 1 25  ? 46.069  7.395   9.180   1.00 47.92 ? 39  ALA B CA  1 
ATOM   3872  C  C   . ALA B 1 25  ? 46.848  8.259   10.169  1.00 46.84 ? 39  ALA B C   1 
ATOM   3873  O  O   . ALA B 1 25  ? 47.382  7.745   11.161  1.00 47.36 ? 39  ALA B O   1 
ATOM   3874  C  CB  . ALA B 1 25  ? 47.024  6.739   8.184   1.00 53.25 ? 39  ALA B CB  1 
ATOM   3875  N  N   . PHE B 1 26  ? 46.916  9.561   9.889   1.00 38.11 ? 40  PHE B N   1 
ATOM   3876  C  CA  . PHE B 1 26  ? 47.629  10.504  10.739  1.00 47.58 ? 40  PHE B CA  1 
ATOM   3877  C  C   . PHE B 1 26  ? 49.111  10.157  10.911  1.00 56.74 ? 40  PHE B C   1 
ATOM   3878  O  O   . PHE B 1 26  ? 49.715  10.531  11.916  1.00 64.28 ? 40  PHE B O   1 
ATOM   3879  C  CB  . PHE B 1 26  ? 46.947  10.636  12.105  1.00 44.48 ? 40  PHE B CB  1 
ATOM   3880  C  CG  . PHE B 1 26  ? 45.671  11.424  12.066  1.00 45.44 ? 40  PHE B CG  1 
ATOM   3881  C  CD1 . PHE B 1 26  ? 45.673  12.782  12.338  1.00 41.36 ? 40  PHE B CD1 1 
ATOM   3882  C  CD2 . PHE B 1 26  ? 44.472  10.811  11.733  1.00 41.68 ? 40  PHE B CD2 1 
ATOM   3883  C  CE1 . PHE B 1 26  ? 44.508  13.504  12.292  1.00 39.79 ? 40  PHE B CE1 1 
ATOM   3884  C  CE2 . PHE B 1 26  ? 43.303  11.535  11.687  1.00 32.22 ? 40  PHE B CE2 1 
ATOM   3885  C  CZ  . PHE B 1 26  ? 43.319  12.875  11.970  1.00 34.11 ? 40  PHE B CZ  1 
ATOM   3886  N  N   . THR B 1 27  ? 49.690  9.469   9.925   1.00 55.86 ? 41  THR B N   1 
ATOM   3887  C  CA  . THR B 1 27  ? 51.093  9.035   9.987   1.00 60.86 ? 41  THR B CA  1 
ATOM   3888  C  C   . THR B 1 27  ? 52.049  10.157  10.402  1.00 64.34 ? 41  THR B C   1 
ATOM   3889  O  O   . THR B 1 27  ? 51.854  11.319  10.032  1.00 58.18 ? 41  THR B O   1 
ATOM   3890  C  CB  . THR B 1 27  ? 51.584  8.430   8.644   1.00 59.14 ? 41  THR B CB  1 
ATOM   3891  O  OG1 . THR B 1 27  ? 51.290  9.329   7.567   1.00 62.29 ? 41  THR B OG1 1 
ATOM   3892  C  CG2 . THR B 1 27  ? 50.920  7.084   8.372   1.00 58.53 ? 41  THR B CG2 1 
ATOM   3893  N  N   . GLN B 1 28  ? 53.069  9.800   11.183  1.00 69.27 ? 42  GLN B N   1 
ATOM   3894  C  CA  . GLN B 1 28  ? 54.053  10.766  11.670  1.00 69.42 ? 42  GLN B CA  1 
ATOM   3895  C  C   . GLN B 1 28  ? 54.603  11.604  10.520  1.00 70.12 ? 42  GLN B C   1 
ATOM   3896  O  O   . GLN B 1 28  ? 55.424  11.137  9.736   1.00 73.93 ? 42  GLN B O   1 
ATOM   3897  C  CB  . GLN B 1 28  ? 55.189  10.061  12.415  1.00 66.70 ? 42  GLN B CB  1 
ATOM   3898  N  N   . GLY B 1 29  ? 54.113  12.835  10.412  1.00 65.87 ? 43  GLY B N   1 
ATOM   3899  C  CA  . GLY B 1 29  ? 54.508  13.722  9.337   1.00 62.17 ? 43  GLY B CA  1 
ATOM   3900  C  C   . GLY B 1 29  ? 53.403  14.008  8.339   1.00 62.07 ? 43  GLY B C   1 
ATOM   3901  O  O   . GLY B 1 29  ? 53.582  14.820  7.432   1.00 61.26 ? 43  GLY B O   1 
ATOM   3902  N  N   . SER B 1 30  ? 52.257  13.347  8.500   1.00 66.26 ? 44  SER B N   1 
ATOM   3903  C  CA  . SER B 1 30  ? 51.123  13.534  7.588   1.00 64.12 ? 44  SER B CA  1 
ATOM   3904  C  C   . SER B 1 30  ? 50.405  14.873  7.849   1.00 64.04 ? 44  SER B C   1 
ATOM   3905  O  O   . SER B 1 30  ? 50.515  15.425  8.947   1.00 59.71 ? 44  SER B O   1 
ATOM   3906  C  CB  . SER B 1 30  ? 50.153  12.347  7.695   1.00 60.29 ? 44  SER B CB  1 
ATOM   3907  O  OG  . SER B 1 30  ? 49.629  12.234  9.004   1.00 53.06 ? 44  SER B OG  1 
ATOM   3908  N  N   . PRO B 1 31  ? 49.674  15.398  6.840   1.00 62.85 ? 45  PRO B N   1 
ATOM   3909  C  CA  . PRO B 1 31  ? 49.030  16.723  6.911   1.00 58.51 ? 45  PRO B CA  1 
ATOM   3910  C  C   . PRO B 1 31  ? 47.826  16.851  7.853   1.00 60.00 ? 45  PRO B C   1 
ATOM   3911  O  O   . PRO B 1 31  ? 47.689  17.892  8.500   1.00 59.21 ? 45  PRO B O   1 
ATOM   3912  C  CB  . PRO B 1 31  ? 48.563  16.960  5.472   1.00 58.54 ? 45  PRO B CB  1 
ATOM   3913  C  CG  . PRO B 1 31  ? 48.385  15.600  4.910   1.00 60.33 ? 45  PRO B CG  1 
ATOM   3914  C  CD  . PRO B 1 31  ? 49.502  14.791  5.506   1.00 63.34 ? 45  PRO B CD  1 
ATOM   3915  N  N   . GLU B 1 32  ? 46.946  15.851  7.901   1.00 56.63 ? 46  GLU B N   1 
ATOM   3916  C  CA  . GLU B 1 32  ? 45.815  15.907  8.829   1.00 48.58 ? 46  GLU B CA  1 
ATOM   3917  C  C   . GLU B 1 32  ? 46.359  15.959  10.253  1.00 44.12 ? 46  GLU B C   1 
ATOM   3918  O  O   . GLU B 1 32  ? 45.802  16.631  11.120  1.00 39.13 ? 46  GLU B O   1 
ATOM   3919  C  CB  . GLU B 1 32  ? 44.860  14.718  8.643   1.00 44.10 ? 46  GLU B CB  1 
ATOM   3920  C  CG  . GLU B 1 32  ? 45.477  13.346  8.886   1.00 41.64 ? 46  GLU B CG  1 
ATOM   3921  C  CD  . GLU B 1 32  ? 46.173  12.785  7.656   1.00 46.08 ? 46  GLU B CD  1 
ATOM   3922  O  OE1 . GLU B 1 32  ? 46.722  11.666  7.747   1.00 52.63 ? 46  GLU B OE1 1 
ATOM   3923  O  OE2 . GLU B 1 32  ? 46.161  13.459  6.601   1.00 44.63 ? 46  GLU B OE2 1 
ATOM   3924  N  N   . ARG B 1 33  ? 47.477  15.270  10.463  1.00 44.38 ? 47  ARG B N   1 
ATOM   3925  C  CA  . ARG B 1 33  ? 48.169  15.267  11.743  1.00 48.72 ? 47  ARG B CA  1 
ATOM   3926  C  C   . ARG B 1 33  ? 48.700  16.659  12.057  1.00 49.18 ? 47  ARG B C   1 
ATOM   3927  O  O   . ARG B 1 33  ? 48.781  17.050  13.214  1.00 44.96 ? 47  ARG B O   1 
ATOM   3928  C  CB  . ARG B 1 33  ? 49.324  14.263  11.720  1.00 46.95 ? 47  ARG B CB  1 
ATOM   3929  C  CG  . ARG B 1 33  ? 50.023  14.089  13.052  1.00 49.22 ? 47  ARG B CG  1 
ATOM   3930  C  CD  . ARG B 1 33  ? 51.281  13.266  12.908  1.00 55.75 ? 47  ARG B CD  1 
ATOM   3931  N  NE  . ARG B 1 33  ? 51.883  12.970  14.203  1.00 59.95 ? 47  ARG B NE  1 
ATOM   3932  C  CZ  . ARG B 1 33  ? 51.936  11.756  14.739  1.00 58.43 ? 47  ARG B CZ  1 
ATOM   3933  N  NH1 . ARG B 1 33  ? 52.503  11.575  15.925  1.00 59.84 ? 47  ARG B NH1 1 
ATOM   3934  N  NH2 . ARG B 1 33  ? 51.431  10.720  14.083  1.00 55.67 ? 47  ARG B NH2 1 
ATOM   3935  N  N   . ASP B 1 34  ? 49.054  17.402  11.016  1.00 50.92 ? 48  ASP B N   1 
ATOM   3936  C  CA  . ASP B 1 34  ? 49.517  18.769  11.179  1.00 53.84 ? 48  ASP B CA  1 
ATOM   3937  C  C   . ASP B 1 34  ? 48.383  19.670  11.673  1.00 50.59 ? 48  ASP B C   1 
ATOM   3938  O  O   . ASP B 1 34  ? 48.544  20.398  12.653  1.00 46.97 ? 48  ASP B O   1 
ATOM   3939  C  CB  . ASP B 1 34  ? 50.091  19.290  9.860   1.00 64.19 ? 48  ASP B CB  1 
ATOM   3940  C  CG  . ASP B 1 34  ? 50.977  20.508  10.045  1.00 71.87 ? 48  ASP B CG  1 
ATOM   3941  O  OD1 . ASP B 1 34  ? 51.176  21.248  9.057   1.00 79.31 ? 48  ASP B OD1 1 
ATOM   3942  O  OD2 . ASP B 1 34  ? 51.476  20.723  11.172  1.00 70.91 ? 48  ASP B OD2 1 
ATOM   3943  N  N   . ALA B 1 35  ? 47.235  19.611  11.002  1.00 48.85 ? 49  ALA B N   1 
ATOM   3944  C  CA  . ALA B 1 35  ? 46.082  20.435  11.374  1.00 42.42 ? 49  ALA B CA  1 
ATOM   3945  C  C   . ALA B 1 35  ? 45.525  20.052  12.745  1.00 35.77 ? 49  ALA B C   1 
ATOM   3946  O  O   . ALA B 1 35  ? 44.984  20.894  13.462  1.00 31.21 ? 49  ALA B O   1 
ATOM   3947  C  CB  . ALA B 1 35  ? 44.995  20.335  10.322  1.00 45.31 ? 49  ALA B CB  1 
ATOM   3948  N  N   . LEU B 1 36  ? 45.648  18.777  13.098  1.00 34.57 ? 50  LEU B N   1 
ATOM   3949  C  CA  . LEU B 1 36  ? 45.183  18.310  14.396  1.00 31.33 ? 50  LEU B CA  1 
ATOM   3950  C  C   . LEU B 1 36  ? 46.067  18.844  15.516  1.00 34.77 ? 50  LEU B C   1 
ATOM   3951  O  O   . LEU B 1 36  ? 45.561  19.212  16.574  1.00 33.18 ? 50  LEU B O   1 
ATOM   3952  C  CB  . LEU B 1 36  ? 45.127  16.791  14.443  1.00 29.33 ? 50  LEU B CB  1 
ATOM   3953  C  CG  . LEU B 1 36  ? 44.754  16.176  15.794  1.00 29.78 ? 50  LEU B CG  1 
ATOM   3954  C  CD1 . LEU B 1 36  ? 43.396  16.677  16.283  1.00 32.21 ? 50  LEU B CD1 1 
ATOM   3955  C  CD2 . LEU B 1 36  ? 44.762  14.660  15.706  1.00 32.70 ? 50  LEU B CD2 1 
ATOM   3956  N  N   . GLN B 1 37  ? 47.382  18.873  15.279  1.00 36.60 ? 51  GLN B N   1 
ATOM   3957  C  CA  . GLN B 1 37  ? 48.315  19.463  16.230  1.00 37.80 ? 51  GLN B CA  1 
ATOM   3958  C  C   . GLN B 1 37  ? 47.905  20.906  16.505  1.00 36.03 ? 51  GLN B C   1 
ATOM   3959  O  O   . GLN B 1 37  ? 47.878  21.339  17.656  1.00 32.69 ? 51  GLN B O   1 
ATOM   3960  C  CB  . GLN B 1 37  ? 49.764  19.408  15.718  1.00 46.64 ? 51  GLN B CB  1 
ATOM   3961  C  CG  . GLN B 1 37  ? 50.392  18.012  15.635  1.00 49.34 ? 51  GLN B CG  1 
ATOM   3962  C  CD  . GLN B 1 37  ? 50.646  17.370  16.996  1.00 53.07 ? 51  GLN B CD  1 
ATOM   3963  O  OE1 . GLN B 1 37  ? 50.276  17.920  18.035  1.00 57.15 ? 51  GLN B OE1 1 
ATOM   3964  N  NE2 . GLN B 1 37  ? 51.286  16.197  16.992  1.00 47.73 ? 51  GLN B NE2 1 
ATOM   3965  N  N   . LYS B 1 38  ? 47.554  21.628  15.442  1.00 36.82 ? 52  LYS B N   1 
ATOM   3966  C  CA  . LYS B 1 38  ? 47.116  23.022  15.552  1.00 34.33 ? 52  LYS B CA  1 
ATOM   3967  C  C   . LYS B 1 38  ? 45.810  23.165  16.329  1.00 35.01 ? 52  LYS B C   1 
ATOM   3968  O  O   . LYS B 1 38  ? 45.680  24.053  17.170  1.00 33.59 ? 52  LYS B O   1 
ATOM   3969  C  CB  . LYS B 1 38  ? 46.971  23.662  14.165  1.00 33.25 ? 52  LYS B CB  1 
ATOM   3970  N  N   . ALA B 1 39  ? 44.838  22.300  16.040  1.00 27.92 ? 53  ALA B N   1 
ATOM   3971  C  CA  . ALA B 1 39  ? 43.573  22.328  16.766  1.00 37.58 ? 53  ALA B CA  1 
ATOM   3972  C  C   . ALA B 1 39  ? 43.765  22.024  18.255  1.00 32.39 ? 53  ALA B C   1 
ATOM   3973  O  O   . ALA B 1 39  ? 43.174  22.678  19.107  1.00 29.94 ? 53  ALA B O   1 
ATOM   3974  C  CB  . ALA B 1 39  ? 42.567  21.362  16.140  1.00 39.58 ? 53  ALA B CB  1 
ATOM   3975  N  N   . LEU B 1 40  ? 44.610  21.045  18.560  1.00 26.33 ? 54  LEU B N   1 
ATOM   3976  C  CA  . LEU B 1 40  ? 44.903  20.686  19.951  1.00 30.72 ? 54  LEU B CA  1 
ATOM   3977  C  C   . LEU B 1 40  ? 45.592  21.821  20.711  1.00 33.16 ? 54  LEU B C   1 
ATOM   3978  O  O   . LEU B 1 40  ? 45.269  22.106  21.862  1.00 29.48 ? 54  LEU B O   1 
ATOM   3979  C  CB  . LEU B 1 40  ? 45.770  19.425  20.004  1.00 28.75 ? 54  LEU B CB  1 
ATOM   3980  C  CG  . LEU B 1 40  ? 45.063  18.118  19.627  1.00 27.19 ? 54  LEU B CG  1 
ATOM   3981  C  CD1 . LEU B 1 40  ? 46.067  16.998  19.309  1.00 25.56 ? 54  LEU B CD1 1 
ATOM   3982  C  CD2 . LEU B 1 40  ? 44.088  17.680  20.725  1.00 24.41 ? 54  LEU B CD2 1 
ATOM   3983  N  N   . LYS B 1 41  ? 46.543  22.474  20.059  1.00 37.69 ? 55  LYS B N   1 
ATOM   3984  C  CA  . LYS B 1 41  ? 47.223  23.604  20.674  1.00 37.56 ? 55  LYS B CA  1 
ATOM   3985  C  C   . LYS B 1 41  ? 46.212  24.724  20.919  1.00 40.48 ? 55  LYS B C   1 
ATOM   3986  O  O   . LYS B 1 41  ? 46.312  25.467  21.896  1.00 38.89 ? 55  LYS B O   1 
ATOM   3987  C  CB  . LYS B 1 41  ? 48.379  24.086  19.791  1.00 39.46 ? 55  LYS B CB  1 
ATOM   3988  N  N   . ASP B 1 42  ? 45.226  24.820  20.033  1.00 42.84 ? 56  ASP B N   1 
ATOM   3989  C  CA  . ASP B 1 42  ? 44.153  25.802  20.164  1.00 44.42 ? 56  ASP B CA  1 
ATOM   3990  C  C   . ASP B 1 42  ? 43.326  25.600  21.433  1.00 37.66 ? 56  ASP B C   1 
ATOM   3991  O  O   . ASP B 1 42  ? 42.854  26.564  22.033  1.00 38.39 ? 56  ASP B O   1 
ATOM   3992  C  CB  . ASP B 1 42  ? 43.236  25.751  18.942  1.00 53.37 ? 56  ASP B CB  1 
ATOM   3993  C  CG  . ASP B 1 42  ? 43.228  27.047  18.164  1.00 68.45 ? 56  ASP B CG  1 
ATOM   3994  O  OD1 . ASP B 1 42  ? 43.605  28.088  18.744  1.00 69.62 ? 56  ASP B OD1 1 
ATOM   3995  O  OD2 . ASP B 1 42  ? 42.839  27.023  16.975  1.00 75.15 ? 56  ASP B OD2 1 
ATOM   3996  N  N   . LEU B 1 43  ? 43.132  24.348  21.839  1.00 33.10 ? 57  LEU B N   1 
ATOM   3997  C  CA  . LEU B 1 43  ? 42.329  24.079  23.037  1.00 25.71 ? 57  LEU B CA  1 
ATOM   3998  C  C   . LEU B 1 43  ? 43.118  24.163  24.358  1.00 36.41 ? 57  LEU B C   1 
ATOM   3999  O  O   . LEU B 1 43  ? 42.530  24.327  25.433  1.00 25.92 ? 57  LEU B O   1 
ATOM   4000  C  CB  . LEU B 1 43  ? 41.640  22.728  22.930  1.00 24.62 ? 57  LEU B CB  1 
ATOM   4001  C  CG  . LEU B 1 43  ? 40.600  22.620  21.814  1.00 24.13 ? 57  LEU B CG  1 
ATOM   4002  C  CD1 . LEU B 1 43  ? 40.047  21.215  21.736  1.00 23.16 ? 57  LEU B CD1 1 
ATOM   4003  C  CD2 . LEU B 1 43  ? 39.479  23.639  22.051  1.00 30.41 ? 57  LEU B CD2 1 
ATOM   4004  N  N   . LYS B 1 44  ? 44.440  24.036  24.278  1.00 33.20 ? 58  LYS B N   1 
ATOM   4005  C  CA  . LYS B 1 44  ? 45.258  24.043  25.487  1.00 44.30 ? 58  LYS B CA  1 
ATOM   4006  C  C   . LYS B 1 44  ? 45.024  25.332  26.292  1.00 40.27 ? 58  LYS B C   1 
ATOM   4007  O  O   . LYS B 1 44  ? 45.068  26.430  25.746  1.00 31.41 ? 58  LYS B O   1 
ATOM   4008  C  CB  . LYS B 1 44  ? 46.740  23.870  25.143  1.00 52.20 ? 58  LYS B CB  1 
ATOM   4009  C  CG  . LYS B 1 44  ? 47.644  23.678  26.356  1.00 52.67 ? 58  LYS B CG  1 
ATOM   4010  C  CD  . LYS B 1 44  ? 47.510  22.282  26.942  1.00 49.61 ? 58  LYS B CD  1 
ATOM   4011  N  N   . GLY B 1 45  ? 44.719  25.176  27.578  1.00 32.79 ? 59  GLY B N   1 
ATOM   4012  C  CA  . GLY B 1 45  ? 44.420  26.296  28.444  1.00 30.08 ? 59  GLY B CA  1 
ATOM   4013  C  C   . GLY B 1 45  ? 43.161  27.078  28.100  1.00 32.27 ? 59  GLY B C   1 
ATOM   4014  O  O   . GLY B 1 45  ? 42.949  28.156  28.645  1.00 33.19 ? 59  GLY B O   1 
ATOM   4015  N  N   . ARG B 1 46  ? 42.305  26.538  27.230  1.00 29.58 ? 60  ARG B N   1 
ATOM   4016  C  CA  . ARG B 1 46  ? 41.139  27.295  26.769  1.00 30.47 ? 60  ARG B CA  1 
ATOM   4017  C  C   . ARG B 1 46  ? 39.812  26.695  27.218  1.00 28.64 ? 60  ARG B C   1 
ATOM   4018  O  O   . ARG B 1 46  ? 39.682  25.488  27.350  1.00 31.59 ? 60  ARG B O   1 
ATOM   4019  C  CB  . ARG B 1 46  ? 41.161  27.437  25.247  1.00 27.74 ? 60  ARG B CB  1 
ATOM   4020  C  CG  . ARG B 1 46  ? 42.320  28.309  24.741  1.00 38.17 ? 60  ARG B CG  1 
ATOM   4021  N  N   . MET B 1 47  ? 38.831  27.556  27.448  1.00 28.83 ? 61  MET B N   1 
ATOM   4022  C  CA  . MET B 1 47  ? 37.499  27.121  27.849  1.00 32.60 ? 61  MET B CA  1 
ATOM   4023  C  C   . MET B 1 47  ? 36.457  27.812  26.986  1.00 29.35 ? 61  MET B C   1 
ATOM   4024  O  O   . MET B 1 47  ? 36.633  28.970  26.612  1.00 28.92 ? 61  MET B O   1 
ATOM   4025  C  CB  . MET B 1 47  ? 37.255  27.467  29.318  1.00 33.66 ? 61  MET B CB  1 
ATOM   4026  C  CG  . MET B 1 47  ? 35.836  27.185  29.791  1.00 31.24 ? 61  MET B CG  1 
ATOM   4027  S  SD  . MET B 1 47  ? 35.584  27.685  31.506  1.00 34.03 ? 61  MET B SD  1 
ATOM   4028  C  CE  . MET B 1 47  ? 34.860  29.310  31.322  1.00 28.15 ? 61  MET B CE  1 
ATOM   4029  N  N   . GLU B 1 48  ? 35.378  27.114  26.649  1.00 28.71 ? 62  GLU B N   1 
ATOM   4030  C  CA  . GLU B 1 48  ? 34.282  27.763  25.939  1.00 28.29 ? 62  GLU B CA  1 
ATOM   4031  C  C   . GLU B 1 48  ? 33.064  27.877  26.846  1.00 28.21 ? 62  GLU B C   1 
ATOM   4032  O  O   . GLU B 1 48  ? 32.711  26.938  27.559  1.00 31.38 ? 62  GLU B O   1 
ATOM   4033  C  CB  . GLU B 1 48  ? 33.923  27.018  24.643  1.00 34.94 ? 62  GLU B CB  1 
ATOM   4034  C  CG  . GLU B 1 48  ? 32.833  27.716  23.824  1.00 35.44 ? 62  GLU B CG  1 
ATOM   4035  C  CD  . GLU B 1 48  ? 32.468  26.987  22.534  1.00 34.85 ? 62  GLU B CD  1 
ATOM   4036  O  OE1 . GLU B 1 48  ? 31.618  27.508  21.778  1.00 32.85 ? 62  GLU B OE1 1 
ATOM   4037  O  OE2 . GLU B 1 48  ? 33.029  25.906  22.269  1.00 34.23 ? 62  GLU B OE2 1 
ATOM   4038  N  N   . ALA B 1 49  ? 32.436  29.045  26.820  1.00 25.95 ? 63  ALA B N   1 
ATOM   4039  C  CA  . ALA B 1 49  ? 31.204  29.278  27.547  1.00 25.20 ? 63  ALA B CA  1 
ATOM   4040  C  C   . ALA B 1 49  ? 30.059  28.895  26.606  1.00 27.59 ? 63  ALA B C   1 
ATOM   4041  O  O   . ALA B 1 49  ? 29.803  29.564  25.598  1.00 24.90 ? 63  ALA B O   1 
ATOM   4042  C  CB  . ALA B 1 49  ? 31.105  30.739  27.958  1.00 26.92 ? 63  ALA B CB  1 
ATOM   4043  N  N   . ILE B 1 50  ? 29.394  27.794  26.927  1.00 23.65 ? 64  ILE B N   1 
ATOM   4044  C  CA  . ILE B 1 50  ? 28.392  27.213  26.031  1.00 25.96 ? 64  ILE B CA  1 
ATOM   4045  C  C   . ILE B 1 50  ? 27.002  27.441  26.612  1.00 28.26 ? 64  ILE B C   1 
ATOM   4046  O  O   . ILE B 1 50  ? 26.694  26.928  27.682  1.00 30.39 ? 64  ILE B O   1 
ATOM   4047  C  CB  . ILE B 1 50  ? 28.657  25.706  25.813  1.00 25.26 ? 64  ILE B CB  1 
ATOM   4048  C  CG1 . ILE B 1 50  ? 30.013  25.503  25.125  1.00 26.21 ? 64  ILE B CG1 1 
ATOM   4049  C  CG2 . ILE B 1 50  ? 27.550  25.067  24.978  1.00 27.57 ? 64  ILE B CG2 1 
ATOM   4050  C  CD1 . ILE B 1 50  ? 30.389  24.021  24.890  1.00 22.96 ? 64  ILE B CD1 1 
ATOM   4051  N  N   . PRO B 1 51  ? 26.176  28.260  25.930  1.00 27.39 ? 65  PRO B N   1 
ATOM   4052  C  CA  . PRO B 1 51  ? 24.831  28.586  26.406  1.00 23.70 ? 65  PRO B CA  1 
ATOM   4053  C  C   . PRO B 1 51  ? 23.840  27.522  25.963  1.00 29.76 ? 65  PRO B C   1 
ATOM   4054  O  O   . PRO B 1 51  ? 24.149  26.759  25.045  1.00 31.71 ? 65  PRO B O   1 
ATOM   4055  C  CB  . PRO B 1 51  ? 24.511  29.860  25.637  1.00 26.17 ? 65  PRO B CB  1 
ATOM   4056  C  CG  . PRO B 1 51  ? 25.150  29.627  24.309  1.00 30.27 ? 65  PRO B CG  1 
ATOM   4057  C  CD  . PRO B 1 51  ? 26.465  28.914  24.640  1.00 28.71 ? 65  PRO B CD  1 
ATOM   4058  N  N   . CYS B 1 52  ? 22.664  27.471  26.579  1.00 26.05 ? 66  CYS B N   1 
ATOM   4059  C  CA  . CYS B 1 52  ? 21.552  26.754  25.942  1.00 25.06 ? 66  CYS B CA  1 
ATOM   4060  C  C   . CYS B 1 52  ? 21.169  27.574  24.722  1.00 24.67 ? 66  CYS B C   1 
ATOM   4061  O  O   . CYS B 1 52  ? 21.345  28.803  24.715  1.00 30.37 ? 66  CYS B O   1 
ATOM   4062  C  CB  . CYS B 1 52  ? 20.343  26.654  26.856  1.00 23.87 ? 66  CYS B CB  1 
ATOM   4063  S  SG  . CYS B 1 52  ? 20.595  25.747  28.375  1.00 31.60 ? 66  CYS B SG  1 
ATOM   4064  N  N   . VAL B 1 53  ? 20.650  26.915  23.692  1.00 27.36 ? 67  VAL B N   1 
ATOM   4065  C  CA  . VAL B 1 53  ? 20.181  27.621  22.508  1.00 26.96 ? 67  VAL B CA  1 
ATOM   4066  C  C   . VAL B 1 53  ? 18.744  27.252  22.174  1.00 28.34 ? 67  VAL B C   1 
ATOM   4067  O  O   . VAL B 1 53  ? 18.424  26.089  21.904  1.00 28.01 ? 67  VAL B O   1 
ATOM   4068  C  CB  . VAL B 1 53  ? 21.063  27.369  21.268  1.00 28.57 ? 67  VAL B CB  1 
ATOM   4069  C  CG1 . VAL B 1 53  ? 20.556  28.224  20.096  1.00 26.57 ? 67  VAL B CG1 1 
ATOM   4070  C  CG2 . VAL B 1 53  ? 22.523  27.698  21.565  1.00 26.53 ? 67  VAL B CG2 1 
ATOM   4071  N  N   . VAL B 1 54  ? 17.876  28.252  22.216  1.00 26.89 ? 68  VAL B N   1 
ATOM   4072  C  CA  . VAL B 1 54  ? 16.489  28.088  21.829  1.00 27.76 ? 68  VAL B CA  1 
ATOM   4073  C  C   . VAL B 1 54  ? 16.271  29.031  20.647  1.00 31.24 ? 68  VAL B C   1 
ATOM   4074  O  O   . VAL B 1 54  ? 16.524  30.230  20.750  1.00 35.94 ? 68  VAL B O   1 
ATOM   4075  C  CB  . VAL B 1 54  ? 15.552  28.405  23.003  1.00 30.53 ? 68  VAL B CB  1 
ATOM   4076  C  CG1 . VAL B 1 54  ? 14.099  28.342  22.565  1.00 31.70 ? 68  VAL B CG1 1 
ATOM   4077  C  CG2 . VAL B 1 54  ? 15.810  27.429  24.148  1.00 29.67 ? 68  VAL B CG2 1 
ATOM   4078  N  N   . GLY B 1 55  ? 15.854  28.475  19.513  1.00 29.47 ? 69  GLY B N   1 
ATOM   4079  C  CA  . GLY B 1 55  ? 15.866  29.217  18.264  1.00 34.63 ? 69  GLY B CA  1 
ATOM   4080  C  C   . GLY B 1 55  ? 17.265  29.681  17.910  1.00 36.79 ? 69  GLY B C   1 
ATOM   4081  O  O   . GLY B 1 55  ? 18.187  28.865  17.764  1.00 30.08 ? 69  GLY B O   1 
ATOM   4082  N  N   . ASP B 1 56  ? 17.422  30.997  17.776  1.00 33.63 ? 70  ASP B N   1 
ATOM   4083  C  CA  . ASP B 1 56  ? 18.725  31.583  17.542  1.00 36.68 ? 70  ASP B CA  1 
ATOM   4084  C  C   . ASP B 1 56  ? 19.217  32.277  18.805  1.00 41.92 ? 70  ASP B C   1 
ATOM   4085  O  O   . ASP B 1 56  ? 20.257  32.918  18.803  1.00 37.61 ? 70  ASP B O   1 
ATOM   4086  C  CB  . ASP B 1 56  ? 18.686  32.557  16.365  1.00 36.34 ? 70  ASP B CB  1 
ATOM   4087  C  CG  . ASP B 1 56  ? 18.725  31.848  15.026  1.00 39.87 ? 70  ASP B CG  1 
ATOM   4088  O  OD1 . ASP B 1 56  ? 19.067  30.641  15.008  1.00 37.69 ? 70  ASP B OD1 1 
ATOM   4089  O  OD2 . ASP B 1 56  ? 18.415  32.487  13.993  1.00 45.85 ? 70  ASP B OD2 1 
ATOM   4090  N  N   . GLU B 1 57  ? 18.471  32.117  19.892  1.00 44.97 ? 71  GLU B N   1 
ATOM   4091  C  CA  . GLU B 1 57  ? 18.762  32.821  21.139  1.00 45.79 ? 71  GLU B CA  1 
ATOM   4092  C  C   . GLU B 1 57  ? 19.681  32.033  22.076  1.00 41.41 ? 71  GLU B C   1 
ATOM   4093  O  O   . GLU B 1 57  ? 19.447  30.844  22.340  1.00 34.60 ? 71  GLU B O   1 
ATOM   4094  C  CB  . GLU B 1 57  ? 17.452  33.154  21.855  1.00 49.60 ? 71  GLU B CB  1 
ATOM   4095  C  CG  . GLU B 1 57  ? 17.629  33.842  23.188  1.00 58.17 ? 71  GLU B CG  1 
ATOM   4096  C  CD  . GLU B 1 57  ? 16.308  34.274  23.793  1.00 65.40 ? 71  GLU B CD  1 
ATOM   4097  O  OE1 . GLU B 1 57  ? 16.332  35.010  24.802  1.00 64.50 ? 71  GLU B OE1 1 
ATOM   4098  O  OE2 . GLU B 1 57  ? 15.248  33.875  23.259  1.00 66.87 ? 71  GLU B OE2 1 
ATOM   4099  N  N   . GLU B 1 58  ? 20.727  32.699  22.569  1.00 35.11 ? 72  GLU B N   1 
ATOM   4100  C  CA  . GLU B 1 58  ? 21.604  32.110  23.578  1.00 35.74 ? 72  GLU B CA  1 
ATOM   4101  C  C   . GLU B 1 58  ? 21.044  32.442  24.956  1.00 36.76 ? 72  GLU B C   1 
ATOM   4102  O  O   . GLU B 1 58  ? 20.840  33.613  25.278  1.00 37.66 ? 72  GLU B O   1 
ATOM   4103  C  CB  . GLU B 1 58  ? 23.048  32.630  23.444  1.00 29.77 ? 72  GLU B CB  1 
ATOM   4104  C  CG  . GLU B 1 58  ? 23.637  32.447  22.055  1.00 34.79 ? 72  GLU B CG  1 
ATOM   4105  C  CD  . GLU B 1 58  ? 25.140  32.700  21.986  1.00 43.85 ? 72  GLU B CD  1 
ATOM   4106  O  OE1 . GLU B 1 58  ? 25.760  33.025  23.025  1.00 49.94 ? 72  GLU B OE1 1 
ATOM   4107  O  OE2 . GLU B 1 58  ? 25.702  32.564  20.880  1.00 41.17 ? 72  GLU B OE2 1 
ATOM   4108  N  N   . VAL B 1 59  ? 20.797  31.412  25.763  1.00 32.78 ? 73  VAL B N   1 
ATOM   4109  C  CA  . VAL B 1 59  ? 20.184  31.587  27.079  1.00 34.69 ? 73  VAL B CA  1 
ATOM   4110  C  C   . VAL B 1 59  ? 21.044  31.036  28.211  1.00 34.60 ? 73  VAL B C   1 
ATOM   4111  O  O   . VAL B 1 59  ? 21.543  29.915  28.134  1.00 31.24 ? 73  VAL B O   1 
ATOM   4112  C  CB  . VAL B 1 59  ? 18.803  30.900  27.149  1.00 33.01 ? 73  VAL B CB  1 
ATOM   4113  C  CG1 . VAL B 1 59  ? 18.142  31.185  28.498  1.00 31.89 ? 73  VAL B CG1 1 
ATOM   4114  C  CG2 . VAL B 1 59  ? 17.919  31.395  26.017  1.00 35.34 ? 73  VAL B CG2 1 
ATOM   4115  N  N   . TRP B 1 60  ? 21.201  31.822  29.272  1.00 36.27 ? 74  TRP B N   1 
ATOM   4116  C  CA  . TRP B 1 60  ? 21.940  31.361  30.444  1.00 38.94 ? 74  TRP B CA  1 
ATOM   4117  C  C   . TRP B 1 60  ? 21.019  31.207  31.646  1.00 40.59 ? 74  TRP B C   1 
ATOM   4118  O  O   . TRP B 1 60  ? 20.077  31.972  31.806  1.00 43.40 ? 74  TRP B O   1 
ATOM   4119  C  CB  . TRP B 1 60  ? 23.117  32.309  30.751  1.00 41.38 ? 74  TRP B CB  1 
ATOM   4120  C  CG  . TRP B 1 60  ? 24.270  32.073  29.818  1.00 34.10 ? 74  TRP B CG  1 
ATOM   4121  C  CD1 . TRP B 1 60  ? 24.523  32.714  28.631  1.00 33.79 ? 74  TRP B CD1 1 
ATOM   4122  C  CD2 . TRP B 1 60  ? 25.299  31.092  29.971  1.00 32.46 ? 74  TRP B CD2 1 
ATOM   4123  N  NE1 . TRP B 1 60  ? 25.660  32.201  28.051  1.00 35.05 ? 74  TRP B NE1 1 
ATOM   4124  C  CE2 . TRP B 1 60  ? 26.152  31.201  28.848  1.00 29.83 ? 74  TRP B CE2 1 
ATOM   4125  C  CE3 . TRP B 1 60  ? 25.587  30.133  30.950  1.00 34.72 ? 74  TRP B CE3 1 
ATOM   4126  C  CZ2 . TRP B 1 60  ? 27.268  30.379  28.676  1.00 30.49 ? 74  TRP B CZ2 1 
ATOM   4127  C  CZ3 . TRP B 1 60  ? 26.709  29.322  30.783  1.00 31.06 ? 74  TRP B CZ3 1 
ATOM   4128  C  CH2 . TRP B 1 60  ? 27.533  29.450  29.654  1.00 30.32 ? 74  TRP B CH2 1 
ATOM   4129  N  N   . THR B 1 61  ? 21.273  30.185  32.459  1.00 37.74 ? 75  THR B N   1 
ATOM   4130  C  CA  . THR B 1 61  ? 20.626  30.042  33.760  1.00 38.64 ? 75  THR B CA  1 
ATOM   4131  C  C   . THR B 1 61  ? 21.723  30.101  34.815  1.00 40.75 ? 75  THR B C   1 
ATOM   4132  O  O   . THR B 1 61  ? 22.905  30.095  34.474  1.00 32.22 ? 75  THR B O   1 
ATOM   4133  C  CB  . THR B 1 61  ? 19.869  28.704  33.890  1.00 38.33 ? 75  THR B CB  1 
ATOM   4134  O  OG1 . THR B 1 61  ? 20.797  27.617  33.799  1.00 39.47 ? 75  THR B OG1 1 
ATOM   4135  C  CG2 . THR B 1 61  ? 18.841  28.567  32.786  1.00 42.62 ? 75  THR B CG2 1 
ATOM   4136  N  N   . SER B 1 62  ? 21.341  30.147  36.087  1.00 43.47 ? 76  SER B N   1 
ATOM   4137  C  CA  . SER B 1 62  ? 22.320  30.270  37.165  1.00 48.11 ? 76  SER B CA  1 
ATOM   4138  C  C   . SER B 1 62  ? 22.863  28.908  37.569  1.00 47.21 ? 76  SER B C   1 
ATOM   4139  O  O   . SER B 1 62  ? 23.798  28.808  38.371  1.00 41.24 ? 76  SER B O   1 
ATOM   4140  C  CB  . SER B 1 62  ? 21.713  30.978  38.379  1.00 53.49 ? 76  SER B CB  1 
ATOM   4141  O  OG  . SER B 1 62  ? 20.991  30.075  39.195  1.00 56.21 ? 76  SER B OG  1 
ATOM   4142  N  N   . ASP B 1 63  ? 22.270  27.862  36.999  1.00 42.06 ? 77  ASP B N   1 
ATOM   4143  C  CA  . ASP B 1 63  ? 22.672  26.495  37.272  1.00 39.11 ? 77  ASP B CA  1 
ATOM   4144  C  C   . ASP B 1 63  ? 23.844  26.165  36.369  1.00 33.70 ? 77  ASP B C   1 
ATOM   4145  O  O   . ASP B 1 63  ? 23.715  25.428  35.399  1.00 27.33 ? 77  ASP B O   1 
ATOM   4146  C  CB  . ASP B 1 63  ? 21.507  25.537  37.018  1.00 40.16 ? 77  ASP B CB  1 
ATOM   4147  C  CG  . ASP B 1 63  ? 21.702  24.188  37.678  1.00 44.09 ? 77  ASP B CG  1 
ATOM   4148  O  OD1 . ASP B 1 63  ? 22.827  23.899  38.146  1.00 48.48 ? 77  ASP B OD1 1 
ATOM   4149  O  OD2 . ASP B 1 63  ? 20.727  23.408  37.723  1.00 45.69 ? 77  ASP B OD2 1 
ATOM   4150  N  N   . VAL B 1 64  ? 24.999  26.717  36.710  1.00 34.64 ? 78  VAL B N   1 
ATOM   4151  C  CA  . VAL B 1 64  ? 26.187  26.624  35.884  1.00 29.90 ? 78  VAL B CA  1 
ATOM   4152  C  C   . VAL B 1 64  ? 26.942  25.322  36.125  1.00 26.27 ? 78  VAL B C   1 
ATOM   4153  O  O   . VAL B 1 64  ? 27.018  24.839  37.250  1.00 29.15 ? 78  VAL B O   1 
ATOM   4154  C  CB  . VAL B 1 64  ? 27.104  27.841  36.160  1.00 33.49 ? 78  VAL B CB  1 
ATOM   4155  C  CG1 . VAL B 1 64  ? 28.462  27.649  35.517  1.00 30.58 ? 78  VAL B CG1 1 
ATOM   4156  C  CG2 . VAL B 1 64  ? 26.438  29.098  35.650  1.00 30.13 ? 78  VAL B CG2 1 
ATOM   4157  N  N   . GLN B 1 65  ? 27.477  24.743  35.054  1.00 24.88 ? 79  GLN B N   1 
ATOM   4158  C  CA  . GLN B 1 65  ? 28.181  23.463  35.125  1.00 27.44 ? 79  GLN B CA  1 
ATOM   4159  C  C   . GLN B 1 65  ? 29.472  23.534  34.315  1.00 26.91 ? 79  GLN B C   1 
ATOM   4160  O  O   . GLN B 1 65  ? 29.623  24.402  33.448  1.00 28.64 ? 79  GLN B O   1 
ATOM   4161  C  CB  . GLN B 1 65  ? 27.297  22.356  34.549  1.00 26.94 ? 79  GLN B CB  1 
ATOM   4162  C  CG  . GLN B 1 65  ? 25.894  22.325  35.125  1.00 33.76 ? 79  GLN B CG  1 
ATOM   4163  C  CD  . GLN B 1 65  ? 25.873  21.799  36.548  1.00 35.14 ? 79  GLN B CD  1 
ATOM   4164  O  OE1 . GLN B 1 65  ? 26.718  20.990  36.925  1.00 36.70 ? 79  GLN B OE1 1 
ATOM   4165  N  NE2 . GLN B 1 65  ? 24.910  22.257  37.345  1.00 34.59 ? 79  GLN B NE2 1 
ATOM   4166  N  N   . TYR B 1 66  ? 30.398  22.620  34.590  1.00 30.57 ? 80  TYR B N   1 
ATOM   4167  C  CA  . TYR B 1 66  ? 31.678  22.601  33.892  1.00 27.78 ? 80  TYR B CA  1 
ATOM   4168  C  C   . TYR B 1 66  ? 32.026  21.225  33.342  1.00 31.98 ? 80  TYR B C   1 
ATOM   4169  O  O   . TYR B 1 66  ? 31.839  20.212  34.015  1.00 32.89 ? 80  TYR B O   1 
ATOM   4170  C  CB  . TYR B 1 66  ? 32.805  23.063  34.814  1.00 25.69 ? 80  TYR B CB  1 
ATOM   4171  C  CG  . TYR B 1 66  ? 32.708  24.517  35.216  1.00 28.54 ? 80  TYR B CG  1 
ATOM   4172  C  CD1 . TYR B 1 66  ? 32.056  24.888  36.386  1.00 34.89 ? 80  TYR B CD1 1 
ATOM   4173  C  CD2 . TYR B 1 66  ? 33.279  25.516  34.434  1.00 28.17 ? 80  TYR B CD2 1 
ATOM   4174  C  CE1 . TYR B 1 66  ? 31.969  26.215  36.769  1.00 37.04 ? 80  TYR B CE1 1 
ATOM   4175  C  CE2 . TYR B 1 66  ? 33.195  26.859  34.811  1.00 31.87 ? 80  TYR B CE2 1 
ATOM   4176  C  CZ  . TYR B 1 66  ? 32.536  27.195  35.978  1.00 32.52 ? 80  TYR B CZ  1 
ATOM   4177  O  OH  . TYR B 1 66  ? 32.440  28.503  36.365  1.00 40.88 ? 80  TYR B OH  1 
ATOM   4178  N  N   . GLN B 1 67  ? 32.536  21.205  32.114  1.00 26.01 ? 81  GLN B N   1 
ATOM   4179  C  CA  . GLN B 1 67  ? 33.170  20.014  31.570  1.00 26.38 ? 81  GLN B CA  1 
ATOM   4180  C  C   . GLN B 1 67  ? 34.676  20.156  31.768  1.00 25.70 ? 81  GLN B C   1 
ATOM   4181  O  O   . GLN B 1 67  ? 35.262  21.191  31.452  1.00 26.85 ? 81  GLN B O   1 
ATOM   4182  C  CB  . GLN B 1 67  ? 32.839  19.851  30.085  1.00 23.10 ? 81  GLN B CB  1 
ATOM   4183  C  CG  . GLN B 1 67  ? 33.474  18.619  29.429  1.00 20.55 ? 81  GLN B CG  1 
ATOM   4184  C  CD  . GLN B 1 67  ? 33.288  18.635  27.917  1.00 21.18 ? 81  GLN B CD  1 
ATOM   4185  O  OE1 . GLN B 1 67  ? 32.738  19.587  27.366  1.00 24.90 ? 81  GLN B OE1 1 
ATOM   4186  N  NE2 . GLN B 1 67  ? 33.747  17.582  27.244  1.00 23.35 ? 81  GLN B NE2 1 
ATOM   4187  N  N   . VAL B 1 68  ? 35.299  19.127  32.320  1.00 26.77 ? 82  VAL B N   1 
ATOM   4188  C  CA  . VAL B 1 68  ? 36.747  19.125  32.474  1.00 25.20 ? 82  VAL B CA  1 
ATOM   4189  C  C   . VAL B 1 68  ? 37.395  18.078  31.568  1.00 29.51 ? 82  VAL B C   1 
ATOM   4190  O  O   . VAL B 1 68  ? 36.750  17.099  31.141  1.00 29.76 ? 82  VAL B O   1 
ATOM   4191  C  CB  . VAL B 1 68  ? 37.165  18.865  33.929  1.00 26.14 ? 82  VAL B CB  1 
ATOM   4192  C  CG1 . VAL B 1 68  ? 36.427  19.822  34.870  1.00 29.43 ? 82  VAL B CG1 1 
ATOM   4193  C  CG2 . VAL B 1 68  ? 36.897  17.430  34.313  1.00 26.54 ? 82  VAL B CG2 1 
ATOM   4194  N  N   . SER B 1 69  ? 38.668  18.307  31.265  1.00 27.31 ? 83  SER B N   1 
ATOM   4195  C  CA  . SER B 1 69  ? 39.462  17.367  30.498  1.00 26.49 ? 83  SER B CA  1 
ATOM   4196  C  C   . SER B 1 69  ? 39.801  16.181  31.399  1.00 23.37 ? 83  SER B C   1 
ATOM   4197  O  O   . SER B 1 69  ? 40.392  16.354  32.464  1.00 25.89 ? 83  SER B O   1 
ATOM   4198  C  CB  . SER B 1 69  ? 40.732  18.045  29.982  1.00 26.33 ? 83  SER B CB  1 
ATOM   4199  O  OG  . SER B 1 69  ? 41.570  17.134  29.283  1.00 26.33 ? 83  SER B OG  1 
ATOM   4200  N  N   . PRO B 1 70  ? 39.415  14.969  30.972  1.00 23.87 ? 84  PRO B N   1 
ATOM   4201  C  CA  . PRO B 1 70  ? 39.523  13.759  31.806  1.00 23.84 ? 84  PRO B CA  1 
ATOM   4202  C  C   . PRO B 1 70  ? 40.945  13.437  32.241  1.00 23.89 ? 84  PRO B C   1 
ATOM   4203  O  O   . PRO B 1 70  ? 41.158  12.942  33.348  1.00 24.48 ? 84  PRO B O   1 
ATOM   4204  C  CB  . PRO B 1 70  ? 38.964  12.652  30.898  1.00 28.22 ? 84  PRO B CB  1 
ATOM   4205  C  CG  . PRO B 1 70  ? 38.020  13.378  29.965  1.00 28.67 ? 84  PRO B CG  1 
ATOM   4206  C  CD  . PRO B 1 70  ? 38.643  14.737  29.735  1.00 25.39 ? 84  PRO B CD  1 
ATOM   4207  N  N   . PHE B 1 71  ? 41.910  13.718  31.379  1.00 23.02 ? 85  PHE B N   1 
ATOM   4208  C  CA  . PHE B 1 71  ? 43.300  13.441  31.697  1.00 23.42 ? 85  PHE B CA  1 
ATOM   4209  C  C   . PHE B 1 71  ? 43.997  14.642  32.355  1.00 30.14 ? 85  PHE B C   1 
ATOM   4210  O  O   . PHE B 1 71  ? 45.189  14.603  32.601  1.00 28.75 ? 85  PHE B O   1 
ATOM   4211  C  CB  . PHE B 1 71  ? 44.057  12.994  30.437  1.00 27.49 ? 85  PHE B CB  1 
ATOM   4212  C  CG  . PHE B 1 71  ? 43.960  13.964  29.283  1.00 28.02 ? 85  PHE B CG  1 
ATOM   4213  C  CD1 . PHE B 1 71  ? 44.850  15.016  29.164  1.00 27.92 ? 85  PHE B CD1 1 
ATOM   4214  C  CD2 . PHE B 1 71  ? 42.961  13.819  28.316  1.00 27.97 ? 85  PHE B CD2 1 
ATOM   4215  C  CE1 . PHE B 1 71  ? 44.768  15.909  28.108  1.00 29.22 ? 85  PHE B CE1 1 
ATOM   4216  C  CE2 . PHE B 1 71  ? 42.874  14.691  27.259  1.00 22.98 ? 85  PHE B CE2 1 
ATOM   4217  C  CZ  . PHE B 1 71  ? 43.786  15.755  27.156  1.00 23.22 ? 85  PHE B CZ  1 
ATOM   4218  N  N   . ASN B 1 72  ? 43.243  15.702  32.635  1.00 33.92 ? 86  ASN B N   1 
ATOM   4219  C  CA  . ASN B 1 72  ? 43.781  16.898  33.308  1.00 33.93 ? 86  ASN B CA  1 
ATOM   4220  C  C   . ASN B 1 72  ? 42.621  17.733  33.823  1.00 33.93 ? 86  ASN B C   1 
ATOM   4221  O  O   . ASN B 1 72  ? 42.266  18.752  33.234  1.00 34.54 ? 86  ASN B O   1 
ATOM   4222  C  CB  . ASN B 1 72  ? 44.651  17.725  32.360  1.00 32.91 ? 86  ASN B CB  1 
ATOM   4223  C  CG  . ASN B 1 72  ? 45.222  18.984  33.021  1.00 39.93 ? 86  ASN B CG  1 
ATOM   4224  O  OD1 . ASN B 1 72  ? 45.136  19.171  34.240  1.00 37.51 ? 86  ASN B OD1 1 
ATOM   4225  N  ND2 . ASN B 1 72  ? 45.801  19.857  32.205  1.00 39.59 ? 86  ASN B ND2 1 
ATOM   4226  N  N   . HIS B 1 73  ? 42.028  17.276  34.920  1.00 35.31 ? 87  HIS B N   1 
ATOM   4227  C  CA  . HIS B 1 73  ? 40.756  17.806  35.396  1.00 36.49 ? 87  HIS B CA  1 
ATOM   4228  C  C   . HIS B 1 73  ? 40.892  19.212  35.945  1.00 35.50 ? 87  HIS B C   1 
ATOM   4229  O  O   . HIS B 1 73  ? 39.891  19.859  36.225  1.00 31.63 ? 87  HIS B O   1 
ATOM   4230  C  CB  . HIS B 1 73  ? 40.138  16.879  36.446  1.00 30.23 ? 87  HIS B CB  1 
ATOM   4231  C  CG  . HIS B 1 73  ? 41.130  16.324  37.417  1.00 35.81 ? 87  HIS B CG  1 
ATOM   4232  N  ND1 . HIS B 1 73  ? 41.892  17.121  38.242  1.00 35.19 ? 87  HIS B ND1 1 
ATOM   4233  C  CD2 . HIS B 1 73  ? 41.491  15.047  37.689  1.00 35.14 ? 87  HIS B CD2 1 
ATOM   4234  C  CE1 . HIS B 1 73  ? 42.678  16.359  38.982  1.00 37.52 ? 87  HIS B CE1 1 
ATOM   4235  N  NE2 . HIS B 1 73  ? 42.451  15.097  38.666  1.00 34.71 ? 87  HIS B NE2 1 
ATOM   4236  N  N   . GLY B 1 74  ? 42.133  19.668  36.104  1.00 30.12 ? 88  GLY B N   1 
ATOM   4237  C  CA  . GLY B 1 74  ? 42.401  21.073  36.353  1.00 33.61 ? 88  GLY B CA  1 
ATOM   4238  C  C   . GLY B 1 74  ? 41.949  21.946  35.189  1.00 33.46 ? 88  GLY B C   1 
ATOM   4239  O  O   . GLY B 1 74  ? 41.633  23.112  35.378  1.00 35.63 ? 88  GLY B O   1 
ATOM   4240  N  N   . HIS B 1 75  ? 41.882  21.366  33.991  1.00 32.53 ? 89  HIS B N   1 
ATOM   4241  C  CA  . HIS B 1 75  ? 41.503  22.099  32.782  1.00 33.54 ? 89  HIS B CA  1 
ATOM   4242  C  C   . HIS B 1 75  ? 40.003  22.055  32.525  1.00 33.85 ? 89  HIS B C   1 
ATOM   4243  O  O   . HIS B 1 75  ? 39.474  21.067  32.003  1.00 32.20 ? 89  HIS B O   1 
ATOM   4244  C  CB  . HIS B 1 75  ? 42.243  21.517  31.572  1.00 36.10 ? 89  HIS B CB  1 
ATOM   4245  C  CG  . HIS B 1 75  ? 41.930  22.192  30.268  1.00 28.73 ? 89  HIS B CG  1 
ATOM   4246  N  ND1 . HIS B 1 75  ? 42.237  21.620  29.052  1.00 26.12 ? 89  HIS B ND1 1 
ATOM   4247  C  CD2 . HIS B 1 75  ? 41.366  23.390  29.986  1.00 27.46 ? 89  HIS B CD2 1 
ATOM   4248  C  CE1 . HIS B 1 75  ? 41.872  22.433  28.078  1.00 25.51 ? 89  HIS B CE1 1 
ATOM   4249  N  NE2 . HIS B 1 75  ? 41.332  23.510  28.618  1.00 25.78 ? 89  HIS B NE2 1 
ATOM   4250  N  N   . LYS B 1 76  ? 39.317  23.136  32.874  1.00 33.57 ? 90  LYS B N   1 
ATOM   4251  C  CA  . LYS B 1 76  ? 37.901  23.253  32.549  1.00 33.19 ? 90  LYS B CA  1 
ATOM   4252  C  C   . LYS B 1 76  ? 37.776  23.591  31.066  1.00 31.01 ? 90  LYS B C   1 
ATOM   4253  O  O   . LYS B 1 76  ? 38.154  24.683  30.649  1.00 26.80 ? 90  LYS B O   1 
ATOM   4254  C  CB  . LYS B 1 76  ? 37.242  24.326  33.413  1.00 32.46 ? 90  LYS B CB  1 
ATOM   4255  C  CG  . LYS B 1 76  ? 37.318  24.048  34.905  1.00 40.23 ? 90  LYS B CG  1 
ATOM   4256  N  N   . VAL B 1 77  ? 37.272  22.651  30.268  1.00 24.96 ? 91  VAL B N   1 
ATOM   4257  C  CA  . VAL B 1 77  ? 37.234  22.841  28.824  1.00 28.48 ? 91  VAL B CA  1 
ATOM   4258  C  C   . VAL B 1 77  ? 35.972  23.574  28.365  1.00 29.25 ? 91  VAL B C   1 
ATOM   4259  O  O   . VAL B 1 77  ? 35.925  24.135  27.262  1.00 24.99 ? 91  VAL B O   1 
ATOM   4260  C  CB  . VAL B 1 77  ? 37.405  21.517  28.055  1.00 24.53 ? 91  VAL B CB  1 
ATOM   4261  C  CG1 . VAL B 1 77  ? 38.680  20.821  28.506  1.00 29.69 ? 91  VAL B CG1 1 
ATOM   4262  C  CG2 . VAL B 1 77  ? 36.160  20.587  28.216  1.00 21.41 ? 91  VAL B CG2 1 
ATOM   4263  N  N   . ALA B 1 78  ? 34.968  23.598  29.232  1.00 23.45 ? 92  ALA B N   1 
ATOM   4264  C  CA  . ALA B 1 78  ? 33.710  24.253  28.910  1.00 24.31 ? 92  ALA B CA  1 
ATOM   4265  C  C   . ALA B 1 78  ? 32.932  24.633  30.162  1.00 28.22 ? 92  ALA B C   1 
ATOM   4266  O  O   . ALA B 1 78  ? 32.964  23.924  31.174  1.00 26.11 ? 92  ALA B O   1 
ATOM   4267  C  CB  . ALA B 1 78  ? 32.843  23.340  28.014  1.00 24.16 ? 92  ALA B CB  1 
ATOM   4268  N  N   . LYS B 1 79  ? 32.247  25.766  30.086  1.00 30.02 ? 93  LYS B N   1 
ATOM   4269  C  CA  . LYS B 1 79  ? 31.276  26.146  31.090  1.00 27.60 ? 93  LYS B CA  1 
ATOM   4270  C  C   . LYS B 1 79  ? 29.930  26.184  30.382  1.00 27.17 ? 93  LYS B C   1 
ATOM   4271  O  O   . LYS B 1 79  ? 29.803  26.779  29.306  1.00 27.74 ? 93  LYS B O   1 
ATOM   4272  C  CB  . LYS B 1 79  ? 31.603  27.521  31.680  1.00 27.99 ? 93  LYS B CB  1 
ATOM   4273  C  CG  . LYS B 1 79  ? 30.553  28.029  32.654  1.00 28.68 ? 93  LYS B CG  1 
ATOM   4274  C  CD  . LYS B 1 79  ? 30.871  29.424  33.218  1.00 35.31 ? 93  LYS B CD  1 
ATOM   4275  C  CE  . LYS B 1 79  ? 31.070  30.449  32.119  1.00 38.24 ? 93  LYS B CE  1 
ATOM   4276  N  NZ  . LYS B 1 79  ? 31.093  31.872  32.633  1.00 40.24 ? 93  LYS B NZ  1 
ATOM   4277  N  N   . PHE B 1 80  ? 28.936  25.521  30.961  1.00 30.54 ? 94  PHE B N   1 
ATOM   4278  C  CA  . PHE B 1 80  ? 27.583  25.550  30.402  1.00 29.99 ? 94  PHE B CA  1 
ATOM   4279  C  C   . PHE B 1 80  ? 26.574  25.707  31.523  1.00 31.23 ? 94  PHE B C   1 
ATOM   4280  O  O   . PHE B 1 80  ? 26.943  26.039  32.643  1.00 31.58 ? 94  PHE B O   1 
ATOM   4281  C  CB  . PHE B 1 80  ? 27.284  24.296  29.546  1.00 26.31 ? 94  PHE B CB  1 
ATOM   4282  C  CG  . PHE B 1 80  ? 27.346  22.987  30.300  1.00 26.06 ? 94  PHE B CG  1 
ATOM   4283  C  CD1 . PHE B 1 80  ? 26.179  22.326  30.665  1.00 24.67 ? 94  PHE B CD1 1 
ATOM   4284  C  CD2 . PHE B 1 80  ? 28.572  22.403  30.621  1.00 25.86 ? 94  PHE B CD2 1 
ATOM   4285  C  CE1 . PHE B 1 80  ? 26.230  21.104  31.338  1.00 26.68 ? 94  PHE B CE1 1 
ATOM   4286  C  CE2 . PHE B 1 80  ? 28.632  21.198  31.301  1.00 30.93 ? 94  PHE B CE2 1 
ATOM   4287  C  CZ  . PHE B 1 80  ? 27.453  20.537  31.656  1.00 24.89 ? 94  PHE B CZ  1 
ATOM   4288  N  N   . CYS B 1 81  ? 25.300  25.467  31.233  1.00 26.67 ? 95  CYS B N   1 
ATOM   4289  C  CA  . CYS B 1 81  ? 24.292  25.586  32.281  1.00 28.99 ? 95  CYS B CA  1 
ATOM   4290  C  C   . CYS B 1 81  ? 23.124  24.647  32.017  1.00 31.82 ? 95  CYS B C   1 
ATOM   4291  O  O   . CYS B 1 81  ? 22.868  24.293  30.870  1.00 30.71 ? 95  CYS B O   1 
ATOM   4292  C  CB  . CYS B 1 81  ? 23.789  27.028  32.394  1.00 32.61 ? 95  CYS B CB  1 
ATOM   4293  S  SG  . CYS B 1 81  ? 22.841  27.615  30.967  1.00 34.53 ? 95  CYS B SG  1 
ATOM   4294  N  N   . TYR B 1 82  ? 22.432  24.250  33.084  1.00 26.59 ? 96  TYR B N   1 
ATOM   4295  C  CA  . TYR B 1 82  ? 21.289  23.343  32.971  1.00 30.43 ? 96  TYR B CA  1 
ATOM   4296  C  C   . TYR B 1 82  ? 20.033  24.175  32.724  1.00 28.46 ? 96  TYR B C   1 
ATOM   4297  O  O   . TYR B 1 82  ? 19.745  25.117  33.470  1.00 28.50 ? 96  TYR B O   1 
ATOM   4298  C  CB  . TYR B 1 82  ? 21.112  22.547  34.264  1.00 26.35 ? 96  TYR B CB  1 
ATOM   4299  C  CG  . TYR B 1 82  ? 22.004  21.331  34.425  1.00 27.68 ? 96  TYR B CG  1 
ATOM   4300  C  CD1 . TYR B 1 82  ? 22.725  20.809  33.357  1.00 25.78 ? 96  TYR B CD1 1 
ATOM   4301  C  CD2 . TYR B 1 82  ? 22.094  20.687  35.651  1.00 29.06 ? 96  TYR B CD2 1 
ATOM   4302  C  CE1 . TYR B 1 82  ? 23.514  19.671  33.517  1.00 29.85 ? 96  TYR B CE1 1 
ATOM   4303  C  CE2 . TYR B 1 82  ? 22.877  19.565  35.821  1.00 29.33 ? 96  TYR B CE2 1 
ATOM   4304  C  CZ  . TYR B 1 82  ? 23.582  19.057  34.759  1.00 29.61 ? 96  TYR B CZ  1 
ATOM   4305  O  OH  . TYR B 1 82  ? 24.357  17.936  34.954  1.00 34.88 ? 96  TYR B OH  1 
ATOM   4306  N  N   . ALA B 1 83  ? 19.292  23.835  31.676  1.00 28.79 ? 97  ALA B N   1 
ATOM   4307  C  CA  . ALA B 1 83  ? 18.010  24.470  31.418  1.00 32.76 ? 97  ALA B CA  1 
ATOM   4308  C  C   . ALA B 1 83  ? 17.073  24.210  32.595  1.00 31.20 ? 97  ALA B C   1 
ATOM   4309  O  O   . ALA B 1 83  ? 17.163  23.167  33.243  1.00 34.19 ? 97  ALA B O   1 
ATOM   4310  C  CB  . ALA B 1 83  ? 17.412  23.924  30.134  1.00 33.10 ? 97  ALA B CB  1 
ATOM   4311  N  N   . ASP B 1 84  ? 16.196  25.165  32.898  1.00 29.59 ? 98  ASP B N   1 
ATOM   4312  C  CA  . ASP B 1 84  ? 15.188  24.919  33.922  1.00 31.26 ? 98  ASP B CA  1 
ATOM   4313  C  C   . ASP B 1 84  ? 13.841  24.622  33.267  1.00 32.62 ? 98  ASP B C   1 
ATOM   4314  O  O   . ASP B 1 84  ? 13.722  24.662  32.040  1.00 31.83 ? 98  ASP B O   1 
ATOM   4315  C  CB  . ASP B 1 84  ? 15.082  26.063  34.942  1.00 36.62 ? 98  ASP B CB  1 
ATOM   4316  C  CG  . ASP B 1 84  ? 14.820  27.420  34.301  1.00 39.05 ? 98  ASP B CG  1 
ATOM   4317  O  OD1 . ASP B 1 84  ? 14.502  27.490  33.093  1.00 41.88 ? 98  ASP B OD1 1 
ATOM   4318  O  OD2 . ASP B 1 84  ? 14.930  28.431  35.023  1.00 50.21 ? 98  ASP B OD2 1 
ATOM   4319  N  N   . LYS B 1 85  ? 12.841  24.322  34.086  1.00 33.61 ? 99  LYS B N   1 
ATOM   4320  C  CA  . LYS B 1 85  ? 11.530  23.930  33.578  1.00 43.35 ? 99  LYS B CA  1 
ATOM   4321  C  C   . LYS B 1 85  ? 10.993  24.980  32.612  1.00 43.04 ? 99  LYS B C   1 
ATOM   4322  O  O   . LYS B 1 85  ? 10.467  24.651  31.544  1.00 45.58 ? 99  LYS B O   1 
ATOM   4323  C  CB  . LYS B 1 85  ? 10.547  23.700  34.734  1.00 44.55 ? 99  LYS B CB  1 
ATOM   4324  N  N   . SER B 1 86  ? 11.162  26.243  32.988  1.00 39.62 ? 100 SER B N   1 
ATOM   4325  C  CA  . SER B 1 86  ? 10.682  27.368  32.197  1.00 41.37 ? 100 SER B CA  1 
ATOM   4326  C  C   . SER B 1 86  ? 11.305  27.400  30.802  1.00 40.84 ? 100 SER B C   1 
ATOM   4327  O  O   . SER B 1 86  ? 10.606  27.521  29.797  1.00 36.00 ? 100 SER B O   1 
ATOM   4328  C  CB  . SER B 1 86  ? 10.975  28.681  32.929  1.00 45.38 ? 100 SER B CB  1 
ATOM   4329  O  OG  . SER B 1 86  ? 10.523  29.782  32.171  1.00 50.56 ? 100 SER B OG  1 
ATOM   4330  N  N   . LEU B 1 87  ? 12.627  27.291  30.747  1.00 36.72 ? 101 LEU B N   1 
ATOM   4331  C  CA  . LEU B 1 87  ? 13.331  27.307  29.475  1.00 37.90 ? 101 LEU B CA  1 
ATOM   4332  C  C   . LEU B 1 87  ? 12.929  26.122  28.574  1.00 37.70 ? 101 LEU B C   1 
ATOM   4333  O  O   . LEU B 1 87  ? 12.689  26.288  27.373  1.00 35.93 ? 101 LEU B O   1 
ATOM   4334  C  CB  . LEU B 1 87  ? 14.838  27.305  29.719  1.00 37.71 ? 101 LEU B CB  1 
ATOM   4335  C  CG  . LEU B 1 87  ? 15.677  27.438  28.459  1.00 37.49 ? 101 LEU B CG  1 
ATOM   4336  C  CD1 . LEU B 1 87  ? 15.246  28.684  27.689  1.00 37.28 ? 101 LEU B CD1 1 
ATOM   4337  C  CD2 . LEU B 1 87  ? 17.150  27.503  28.832  1.00 34.21 ? 101 LEU B CD2 1 
ATOM   4338  N  N   . LEU B 1 88  ? 12.858  24.932  29.159  1.00 33.30 ? 102 LEU B N   1 
ATOM   4339  C  CA  . LEU B 1 88  ? 12.472  23.733  28.413  1.00 32.47 ? 102 LEU B CA  1 
ATOM   4340  C  C   . LEU B 1 88  ? 11.083  23.892  27.786  1.00 33.27 ? 102 LEU B C   1 
ATOM   4341  O  O   . LEU B 1 88  ? 10.860  23.531  26.626  1.00 35.59 ? 102 LEU B O   1 
ATOM   4342  C  CB  . LEU B 1 88  ? 12.519  22.503  29.322  1.00 30.28 ? 102 LEU B CB  1 
ATOM   4343  C  CG  . LEU B 1 88  ? 13.921  22.085  29.769  1.00 30.39 ? 102 LEU B CG  1 
ATOM   4344  C  CD1 . LEU B 1 88  ? 13.890  20.884  30.717  1.00 34.95 ? 102 LEU B CD1 1 
ATOM   4345  C  CD2 . LEU B 1 88  ? 14.759  21.775  28.553  1.00 30.23 ? 102 LEU B CD2 1 
ATOM   4346  N  N   . ASN B 1 89  ? 10.152  24.450  28.549  1.00 32.86 ? 103 ASN B N   1 
ATOM   4347  C  CA  . ASN B 1 89  ? 8.810   24.671  28.022  1.00 37.80 ? 103 ASN B CA  1 
ATOM   4348  C  C   . ASN B 1 89  ? 8.804   25.660  26.856  1.00 33.61 ? 103 ASN B C   1 
ATOM   4349  O  O   . ASN B 1 89  ? 8.076   25.471  25.880  1.00 40.10 ? 103 ASN B O   1 
ATOM   4350  C  CB  . ASN B 1 89  ? 7.827   25.070  29.129  1.00 34.82 ? 103 ASN B CB  1 
ATOM   4351  C  CG  . ASN B 1 89  ? 7.357   23.874  29.951  1.00 41.36 ? 103 ASN B CG  1 
ATOM   4352  O  OD1 . ASN B 1 89  ? 7.246   22.757  29.439  1.00 46.02 ? 103 ASN B OD1 1 
ATOM   4353  N  ND2 . ASN B 1 89  ? 7.073   24.105  31.227  1.00 43.86 ? 103 ASN B ND2 1 
ATOM   4354  N  N   . LYS B 1 90  ? 9.639   26.687  26.935  1.00 31.58 ? 104 LYS B N   1 
ATOM   4355  C  CA  . LYS B 1 90  ? 9.732   27.655  25.849  1.00 30.53 ? 104 LYS B CA  1 
ATOM   4356  C  C   . LYS B 1 90  ? 10.370  26.999  24.631  1.00 30.21 ? 104 LYS B C   1 
ATOM   4357  O  O   . LYS B 1 90  ? 9.943   27.222  23.492  1.00 34.07 ? 104 LYS B O   1 
ATOM   4358  C  CB  . LYS B 1 90  ? 10.535  28.894  26.272  1.00 35.20 ? 104 LYS B CB  1 
ATOM   4359  N  N   . ALA B 1 91  ? 11.401  26.193  24.874  1.00 28.99 ? 105 ALA B N   1 
ATOM   4360  C  CA  . ALA B 1 91  ? 12.036  25.436  23.804  1.00 25.91 ? 105 ALA B CA  1 
ATOM   4361  C  C   . ALA B 1 91  ? 11.000  24.589  23.060  1.00 32.97 ? 105 ALA B C   1 
ATOM   4362  O  O   . ALA B 1 91  ? 10.968  24.569  21.825  1.00 32.58 ? 105 ALA B O   1 
ATOM   4363  C  CB  . ALA B 1 91  ? 13.130  24.573  24.358  1.00 21.70 ? 105 ALA B CB  1 
ATOM   4364  N  N   . ILE B 1 92  ? 10.154  23.905  23.828  1.00 30.06 ? 106 ILE B N   1 
ATOM   4365  C  CA  . ILE B 1 92  ? 9.064   23.096  23.275  1.00 24.49 ? 106 ILE B CA  1 
ATOM   4366  C  C   . ILE B 1 92  ? 8.104   23.930  22.424  1.00 29.86 ? 106 ILE B C   1 
ATOM   4367  O  O   . ILE B 1 92  ? 7.827   23.587  21.271  1.00 28.13 ? 106 ILE B O   1 
ATOM   4368  C  CB  . ILE B 1 92  ? 8.299   22.345  24.391  1.00 26.73 ? 106 ILE B CB  1 
ATOM   4369  C  CG1 . ILE B 1 92  ? 9.186   21.245  24.980  1.00 20.76 ? 106 ILE B CG1 1 
ATOM   4370  C  CG2 . ILE B 1 92  ? 7.025   21.691  23.842  1.00 27.89 ? 106 ILE B CG2 1 
ATOM   4371  C  CD1 . ILE B 1 92  ? 8.658   20.670  26.281  1.00 25.41 ? 106 ILE B CD1 1 
ATOM   4372  N  N   . GLU B 1 93  ? 7.622   25.038  22.977  1.00 27.95 ? 107 GLU B N   1 
ATOM   4373  C  CA  . GLU B 1 93  ? 6.654   25.861  22.250  1.00 35.08 ? 107 GLU B CA  1 
ATOM   4374  C  C   . GLU B 1 93  ? 7.245   26.369  20.934  1.00 33.08 ? 107 GLU B C   1 
ATOM   4375  O  O   . GLU B 1 93  ? 6.592   26.308  19.892  1.00 33.99 ? 107 GLU B O   1 
ATOM   4376  C  CB  . GLU B 1 93  ? 6.151   27.023  23.113  1.00 32.68 ? 107 GLU B CB  1 
ATOM   4377  N  N   . ALA B 1 94  ? 8.497   26.819  20.979  1.00 29.02 ? 108 ALA B N   1 
ATOM   4378  C  CA  . ALA B 1 94  ? 9.141   27.368  19.793  1.00 31.06 ? 108 ALA B CA  1 
ATOM   4379  C  C   . ALA B 1 94  ? 9.436   26.304  18.737  1.00 30.30 ? 108 ALA B C   1 
ATOM   4380  O  O   . ALA B 1 94  ? 9.361   26.581  17.531  1.00 30.20 ? 108 ALA B O   1 
ATOM   4381  C  CB  . ALA B 1 94  ? 10.413  28.149  20.171  1.00 33.65 ? 108 ALA B CB  1 
ATOM   4382  N  N   . ALA B 1 95  ? 9.763   25.088  19.183  1.00 25.72 ? 109 ALA B N   1 
ATOM   4383  C  CA  . ALA B 1 95  ? 10.020  23.989  18.261  1.00 28.00 ? 109 ALA B CA  1 
ATOM   4384  C  C   . ALA B 1 95  ? 8.727   23.608  17.550  1.00 30.50 ? 109 ALA B C   1 
ATOM   4385  O  O   . ALA B 1 95  ? 8.704   23.407  16.332  1.00 29.34 ? 109 ALA B O   1 
ATOM   4386  C  CB  . ALA B 1 95  ? 10.587  22.774  19.007  1.00 22.35 ? 109 ALA B CB  1 
ATOM   4387  N  N   . LEU B 1 96  ? 7.649   23.516  18.317  1.00 29.89 ? 110 LEU B N   1 
ATOM   4388  C  CA  . LEU B 1 96  ? 6.355   23.148  17.754  1.00 32.84 ? 110 LEU B CA  1 
ATOM   4389  C  C   . LEU B 1 96  ? 5.908   24.160  16.703  1.00 34.94 ? 110 LEU B C   1 
ATOM   4390  O  O   . LEU B 1 96  ? 5.375   23.780  15.662  1.00 29.92 ? 110 LEU B O   1 
ATOM   4391  C  CB  . LEU B 1 96  ? 5.305   23.007  18.857  1.00 34.21 ? 110 LEU B CB  1 
ATOM   4392  C  CG  . LEU B 1 96  ? 5.571   21.853  19.827  1.00 33.09 ? 110 LEU B CG  1 
ATOM   4393  C  CD1 . LEU B 1 96  ? 4.616   21.873  21.004  1.00 34.82 ? 110 LEU B CD1 1 
ATOM   4394  C  CD2 . LEU B 1 96  ? 5.486   20.522  19.098  1.00 28.89 ? 110 LEU B CD2 1 
ATOM   4395  N  N   . ALA B 1 97  ? 6.144   25.443  16.967  1.00 31.68 ? 111 ALA B N   1 
ATOM   4396  C  CA  . ALA B 1 97  ? 5.735   26.488  16.029  1.00 30.82 ? 111 ALA B CA  1 
ATOM   4397  C  C   . ALA B 1 97  ? 6.549   26.462  14.730  1.00 34.33 ? 111 ALA B C   1 
ATOM   4398  O  O   . ALA B 1 97  ? 6.111   26.974  13.702  1.00 35.67 ? 111 ALA B O   1 
ATOM   4399  C  CB  . ALA B 1 97  ? 5.804   27.855  16.683  1.00 34.18 ? 111 ALA B CB  1 
ATOM   4400  N  N   . ALA B 1 98  ? 7.730   25.854  14.782  1.00 29.85 ? 112 ALA B N   1 
ATOM   4401  C  CA  . ALA B 1 98  ? 8.604   25.762  13.618  1.00 31.61 ? 112 ALA B CA  1 
ATOM   4402  C  C   . ALA B 1 98  ? 8.408   24.467  12.840  1.00 32.72 ? 112 ALA B C   1 
ATOM   4403  O  O   . ALA B 1 98  ? 8.794   24.380  11.669  1.00 28.41 ? 112 ALA B O   1 
ATOM   4404  C  CB  . ALA B 1 98  ? 10.075  25.888  14.053  1.00 35.83 ? 112 ALA B CB  1 
ATOM   4405  N  N   . ARG B 1 99  ? 7.800   23.473  13.490  1.00 26.70 ? 113 ARG B N   1 
ATOM   4406  C  CA  . ARG B 1 99  ? 7.755   22.096  12.982  1.00 31.54 ? 113 ARG B CA  1 
ATOM   4407  C  C   . ARG B 1 99  ? 7.112   21.937  11.594  1.00 34.96 ? 113 ARG B C   1 
ATOM   4408  O  O   . ARG B 1 99  ? 7.714   21.356  10.684  1.00 26.06 ? 113 ARG B O   1 
ATOM   4409  C  CB  . ARG B 1 99  ? 7.046   21.174  13.994  1.00 29.38 ? 113 ARG B CB  1 
ATOM   4410  C  CG  . ARG B 1 99  ? 7.058   19.693  13.623  1.00 27.71 ? 113 ARG B CG  1 
ATOM   4411  C  CD  . ARG B 1 99  ? 6.039   18.867  14.427  1.00 27.67 ? 113 ARG B CD  1 
ATOM   4412  N  NE  . ARG B 1 99  ? 4.651   19.243  14.141  1.00 32.33 ? 113 ARG B NE  1 
ATOM   4413  C  CZ  . ARG B 1 99  ? 3.986   18.902  13.039  1.00 31.09 ? 113 ARG B CZ  1 
ATOM   4414  N  NH1 . ARG B 1 99  ? 4.574   18.171  12.102  1.00 31.78 ? 113 ARG B NH1 1 
ATOM   4415  N  NH2 . ARG B 1 99  ? 2.726   19.293  12.873  1.00 31.95 ? 113 ARG B NH2 1 
ATOM   4416  N  N   . LYS B 1 100 ? 5.895   22.455  11.440  1.00 35.44 ? 114 LYS B N   1 
ATOM   4417  C  CA  . LYS B 1 100 ? 5.115   22.239  10.221  1.00 34.25 ? 114 LYS B CA  1 
ATOM   4418  C  C   . LYS B 1 100 ? 5.847   22.652  8.946   1.00 31.98 ? 114 LYS B C   1 
ATOM   4419  O  O   . LYS B 1 100 ? 5.815   21.927  7.952   1.00 28.35 ? 114 LYS B O   1 
ATOM   4420  C  CB  . LYS B 1 100 ? 3.758   22.939  10.316  1.00 35.05 ? 114 LYS B CB  1 
ATOM   4421  N  N   . GLU B 1 101 ? 6.523   23.799  8.980   1.00 33.27 ? 115 GLU B N   1 
ATOM   4422  C  CA  . GLU B 1 101 ? 7.270   24.276  7.820   1.00 33.05 ? 115 GLU B CA  1 
ATOM   4423  C  C   . GLU B 1 101 ? 8.450   23.354  7.520   1.00 35.09 ? 115 GLU B C   1 
ATOM   4424  O  O   . GLU B 1 101 ? 8.747   23.056  6.359   1.00 32.34 ? 115 GLU B O   1 
ATOM   4425  C  CB  . GLU B 1 101 ? 7.767   25.719  8.034   1.00 35.34 ? 115 GLU B CB  1 
ATOM   4426  N  N   . TRP B 1 102 ? 9.117   22.902  8.576   1.00 30.10 ? 116 TRP B N   1 
ATOM   4427  C  CA  . TRP B 1 102 ? 10.268  22.020  8.438   1.00 29.50 ? 116 TRP B CA  1 
ATOM   4428  C  C   . TRP B 1 102 ? 9.820   20.683  7.859   1.00 27.32 ? 116 TRP B C   1 
ATOM   4429  O  O   . TRP B 1 102 ? 10.407  20.178  6.896   1.00 26.66 ? 116 TRP B O   1 
ATOM   4430  C  CB  . TRP B 1 102 ? 10.945  21.842  9.800   1.00 31.38 ? 116 TRP B CB  1 
ATOM   4431  C  CG  . TRP B 1 102 ? 12.085  20.869  9.843   1.00 31.39 ? 116 TRP B CG  1 
ATOM   4432  C  CD1 . TRP B 1 102 ? 12.126  19.692  10.542  1.00 28.08 ? 116 TRP B CD1 1 
ATOM   4433  C  CD2 . TRP B 1 102 ? 13.350  20.982  9.179   1.00 29.63 ? 116 TRP B CD2 1 
ATOM   4434  N  NE1 . TRP B 1 102 ? 13.331  19.068  10.346  1.00 25.91 ? 116 TRP B NE1 1 
ATOM   4435  C  CE2 . TRP B 1 102 ? 14.104  19.840  9.519   1.00 30.19 ? 116 TRP B CE2 1 
ATOM   4436  C  CE3 . TRP B 1 102 ? 13.923  21.938  8.334   1.00 29.10 ? 116 TRP B CE3 1 
ATOM   4437  C  CZ2 . TRP B 1 102 ? 15.397  19.626  9.040   1.00 28.25 ? 116 TRP B CZ2 1 
ATOM   4438  C  CZ3 . TRP B 1 102 ? 15.200  21.718  7.855   1.00 29.89 ? 116 TRP B CZ3 1 
ATOM   4439  C  CH2 . TRP B 1 102 ? 15.923  20.574  8.210   1.00 30.58 ? 116 TRP B CH2 1 
ATOM   4440  N  N   . ASP B 1 103 ? 8.753   20.134  8.431   1.00 25.62 ? 117 ASP B N   1 
ATOM   4441  C  CA  . ASP B 1 103 ? 8.144   18.907  7.926   1.00 26.54 ? 117 ASP B CA  1 
ATOM   4442  C  C   . ASP B 1 103 ? 7.808   19.020  6.445   1.00 30.43 ? 117 ASP B C   1 
ATOM   4443  O  O   . ASP B 1 103 ? 8.036   18.088  5.671   1.00 32.47 ? 117 ASP B O   1 
ATOM   4444  C  CB  . ASP B 1 103 ? 6.882   18.584  8.729   1.00 26.73 ? 117 ASP B CB  1 
ATOM   4445  C  CG  . ASP B 1 103 ? 6.165   17.339  8.232   1.00 27.76 ? 117 ASP B CG  1 
ATOM   4446  O  OD1 . ASP B 1 103 ? 6.827   16.391  7.751   1.00 32.41 ? 117 ASP B OD1 1 
ATOM   4447  O  OD2 . ASP B 1 103 ? 4.923   17.306  8.337   1.00 28.76 ? 117 ASP B OD2 1 
ATOM   4448  N  N   . LEU B 1 104 ? 7.280   20.171  6.051   1.00 31.64 ? 118 LEU B N   1 
ATOM   4449  C  CA  . LEU B 1 104 ? 6.870   20.374  4.664   1.00 39.02 ? 118 LEU B CA  1 
ATOM   4450  C  C   . LEU B 1 104 ? 8.034   20.635  3.703   1.00 39.22 ? 118 LEU B C   1 
ATOM   4451  O  O   . LEU B 1 104 ? 7.888   20.445  2.499   1.00 38.88 ? 118 LEU B O   1 
ATOM   4452  C  CB  . LEU B 1 104 ? 5.831   21.495  4.556   1.00 37.15 ? 118 LEU B CB  1 
ATOM   4453  C  CG  . LEU B 1 104 ? 4.404   21.097  4.919   1.00 37.35 ? 118 LEU B CG  1 
ATOM   4454  C  CD1 . LEU B 1 104 ? 3.504   22.315  4.885   1.00 44.42 ? 118 LEU B CD1 1 
ATOM   4455  C  CD2 . LEU B 1 104 ? 3.900   20.041  3.956   1.00 36.05 ? 118 LEU B CD2 1 
ATOM   4456  N  N   . LYS B 1 105 ? 9.182   21.071  4.223   1.00 39.69 ? 119 LYS B N   1 
ATOM   4457  C  CA  . LYS B 1 105 ? 10.342  21.265  3.364   1.00 36.42 ? 119 LYS B CA  1 
ATOM   4458  C  C   . LYS B 1 105 ? 10.665  19.926  2.713   1.00 37.80 ? 119 LYS B C   1 
ATOM   4459  O  O   . LYS B 1 105 ? 10.616  18.886  3.374   1.00 35.42 ? 119 LYS B O   1 
ATOM   4460  C  CB  . LYS B 1 105 ? 11.540  21.797  4.159   1.00 35.48 ? 119 LYS B CB  1 
ATOM   4461  N  N   . PRO B 1 106 ? 10.935  19.940  1.401   1.00 37.26 ? 120 PRO B N   1 
ATOM   4462  C  CA  . PRO B 1 106 ? 11.252  18.728  0.633   1.00 39.16 ? 120 PRO B CA  1 
ATOM   4463  C  C   . PRO B 1 106 ? 12.466  18.000  1.210   1.00 38.49 ? 120 PRO B C   1 
ATOM   4464  O  O   . PRO B 1 106 ? 13.416  18.649  1.648   1.00 31.92 ? 120 PRO B O   1 
ATOM   4465  C  CB  . PRO B 1 106 ? 11.589  19.278  -0.756  1.00 42.79 ? 120 PRO B CB  1 
ATOM   4466  C  CG  . PRO B 1 106 ? 10.845  20.570  -0.840  1.00 47.35 ? 120 PRO B CG  1 
ATOM   4467  C  CD  . PRO B 1 106 ? 10.852  21.138  0.544   1.00 44.30 ? 120 PRO B CD  1 
ATOM   4468  N  N   . ILE B 1 107 ? 12.442  16.673  1.197   1.00 39.10 ? 121 ILE B N   1 
ATOM   4469  C  CA  . ILE B 1 107 ? 13.515  15.904  1.822   1.00 36.94 ? 121 ILE B CA  1 
ATOM   4470  C  C   . ILE B 1 107 ? 14.881  16.199  1.196   1.00 34.64 ? 121 ILE B C   1 
ATOM   4471  O  O   . ILE B 1 107 ? 15.886  16.256  1.898   1.00 36.68 ? 121 ILE B O   1 
ATOM   4472  C  CB  . ILE B 1 107 ? 13.225  14.385  1.805   1.00 38.47 ? 121 ILE B CB  1 
ATOM   4473  C  CG1 . ILE B 1 107 ? 14.329  13.618  2.543   1.00 37.90 ? 121 ILE B CG1 1 
ATOM   4474  C  CG2 . ILE B 1 107 ? 13.055  13.880  0.378   1.00 45.86 ? 121 ILE B CG2 1 
ATOM   4475  C  CD1 . ILE B 1 107 ? 14.333  13.855  4.047   1.00 36.73 ? 121 ILE B CD1 1 
ATOM   4476  N  N   . ALA B 1 108 ? 14.908  16.406  -0.116  1.00 33.87 ? 122 ALA B N   1 
ATOM   4477  C  CA  . ALA B 1 108 ? 16.144  16.757  -0.812  1.00 42.77 ? 122 ALA B CA  1 
ATOM   4478  C  C   . ALA B 1 108 ? 16.798  17.985  -0.185  1.00 44.91 ? 122 ALA B C   1 
ATOM   4479  O  O   . ALA B 1 108 ? 18.022  18.030  -0.029  1.00 42.14 ? 122 ALA B O   1 
ATOM   4480  C  CB  . ALA B 1 108 ? 15.874  17.002  -2.297  1.00 43.70 ? 122 ALA B CB  1 
ATOM   4481  N  N   . ASP B 1 109 ? 15.974  18.971  0.174   1.00 40.56 ? 123 ASP B N   1 
ATOM   4482  C  CA  . ASP B 1 109 ? 16.461  20.201  0.794   1.00 39.74 ? 123 ASP B CA  1 
ATOM   4483  C  C   . ASP B 1 109 ? 16.937  19.956  2.220   1.00 38.24 ? 123 ASP B C   1 
ATOM   4484  O  O   . ASP B 1 109 ? 17.945  20.517  2.638   1.00 35.51 ? 123 ASP B O   1 
ATOM   4485  C  CB  . ASP B 1 109 ? 15.378  21.281  0.799   1.00 39.77 ? 123 ASP B CB  1 
ATOM   4486  C  CG  . ASP B 1 109 ? 14.992  21.732  -0.596  1.00 45.85 ? 123 ASP B CG  1 
ATOM   4487  O  OD1 . ASP B 1 109 ? 15.831  21.642  -1.516  1.00 46.90 ? 123 ASP B OD1 1 
ATOM   4488  O  OD2 . ASP B 1 109 ? 13.844  22.187  -0.766  1.00 50.71 ? 123 ASP B OD2 1 
ATOM   4489  N  N   . ARG B 1 110 ? 16.210  19.135  2.979   1.00 35.95 ? 124 ARG B N   1 
ATOM   4490  C  CA  . ARG B 1 110 ? 16.660  18.817  4.334   1.00 28.93 ? 124 ARG B CA  1 
ATOM   4491  C  C   . ARG B 1 110 ? 17.971  18.040  4.290   1.00 35.17 ? 124 ARG B C   1 
ATOM   4492  O  O   . ARG B 1 110 ? 18.910  18.368  5.014   1.00 35.57 ? 124 ARG B O   1 
ATOM   4493  C  CB  . ARG B 1 110 ? 15.604  18.040  5.123   1.00 29.30 ? 124 ARG B CB  1 
ATOM   4494  C  CG  . ARG B 1 110 ? 14.311  18.803  5.339   1.00 29.74 ? 124 ARG B CG  1 
ATOM   4495  C  CD  . ARG B 1 110 ? 13.502  18.222  6.500   1.00 30.45 ? 124 ARG B CD  1 
ATOM   4496  N  NE  . ARG B 1 110 ? 13.127  16.825  6.301   1.00 32.92 ? 124 ARG B NE  1 
ATOM   4497  C  CZ  . ARG B 1 110 ? 11.907  16.407  5.971   1.00 34.99 ? 124 ARG B CZ  1 
ATOM   4498  N  NH1 . ARG B 1 110 ? 10.925  17.277  5.785   1.00 31.14 ? 124 ARG B NH1 1 
ATOM   4499  N  NH2 . ARG B 1 110 ? 11.667  15.106  5.821   1.00 32.92 ? 124 ARG B NH2 1 
ATOM   4500  N  N   . ALA B 1 111 ? 18.022  17.019  3.435   1.00 31.66 ? 125 ALA B N   1 
ATOM   4501  C  CA  . ALA B 1 111 ? 19.245  16.251  3.183   1.00 30.82 ? 125 ALA B CA  1 
ATOM   4502  C  C   . ALA B 1 111 ? 20.451  17.139  2.887   1.00 32.89 ? 125 ALA B C   1 
ATOM   4503  O  O   . ALA B 1 111 ? 21.535  16.914  3.418   1.00 30.37 ? 125 ALA B O   1 
ATOM   4504  C  CB  . ALA B 1 111 ? 19.030  15.286  2.029   1.00 27.88 ? 125 ALA B CB  1 
ATOM   4505  N  N   . GLN B 1 112 ? 20.265  18.138  2.030   1.00 30.27 ? 126 GLN B N   1 
ATOM   4506  C  CA  . GLN B 1 112 ? 21.377  18.995  1.631   1.00 35.86 ? 126 GLN B CA  1 
ATOM   4507  C  C   . GLN B 1 112 ? 22.046  19.653  2.838   1.00 37.46 ? 126 GLN B C   1 
ATOM   4508  O  O   . GLN B 1 112 ? 23.263  19.858  2.851   1.00 37.19 ? 126 GLN B O   1 
ATOM   4509  C  CB  . GLN B 1 112 ? 20.926  20.056  0.626   1.00 43.37 ? 126 GLN B CB  1 
ATOM   4510  C  CG  . GLN B 1 112 ? 22.076  20.641  -0.194  1.00 55.40 ? 126 GLN B CG  1 
ATOM   4511  C  CD  . GLN B 1 112 ? 22.838  19.574  -0.980  1.00 62.78 ? 126 GLN B CD  1 
ATOM   4512  O  OE1 . GLN B 1 112 ? 22.348  19.049  -1.988  1.00 64.70 ? 126 GLN B OE1 1 
ATOM   4513  N  NE2 . GLN B 1 112 ? 24.039  19.246  -0.515  1.00 62.32 ? 126 GLN B NE2 1 
ATOM   4514  N  N   . ILE B 1 113 ? 21.252  19.964  3.858   1.00 34.73 ? 127 ILE B N   1 
ATOM   4515  C  CA  . ILE B 1 113 ? 21.788  20.555  5.079   1.00 36.66 ? 127 ILE B CA  1 
ATOM   4516  C  C   . ILE B 1 113 ? 22.750  19.589  5.768   1.00 33.00 ? 127 ILE B C   1 
ATOM   4517  O  O   . ILE B 1 113 ? 23.854  19.963  6.152   1.00 27.99 ? 127 ILE B O   1 
ATOM   4518  C  CB  . ILE B 1 113 ? 20.669  20.951  6.056   1.00 37.83 ? 127 ILE B CB  1 
ATOM   4519  C  CG1 . ILE B 1 113 ? 19.759  22.008  5.425   1.00 41.43 ? 127 ILE B CG1 1 
ATOM   4520  C  CG2 . ILE B 1 113 ? 21.262  21.477  7.357   1.00 33.02 ? 127 ILE B CG2 1 
ATOM   4521  C  CD1 . ILE B 1 113 ? 18.551  22.331  6.268   1.00 38.55 ? 127 ILE B CD1 1 
ATOM   4522  N  N   . PHE B 1 114 ? 22.334  18.333  5.892   1.00 27.70 ? 128 PHE B N   1 
ATOM   4523  C  CA  . PHE B 1 114 ? 23.144  17.338  6.578   1.00 26.61 ? 128 PHE B CA  1 
ATOM   4524  C  C   . PHE B 1 114 ? 24.357  16.911  5.778   1.00 29.22 ? 128 PHE B C   1 
ATOM   4525  O  O   . PHE B 1 114 ? 25.384  16.536  6.358   1.00 30.82 ? 128 PHE B O   1 
ATOM   4526  C  CB  . PHE B 1 114 ? 22.291  16.134  7.000   1.00 23.31 ? 128 PHE B CB  1 
ATOM   4527  C  CG  . PHE B 1 114 ? 21.405  16.434  8.156   1.00 27.97 ? 128 PHE B CG  1 
ATOM   4528  C  CD1 . PHE B 1 114 ? 20.175  17.039  7.958   1.00 23.66 ? 128 PHE B CD1 1 
ATOM   4529  C  CD2 . PHE B 1 114 ? 21.821  16.163  9.447   1.00 30.70 ? 128 PHE B CD2 1 
ATOM   4530  C  CE1 . PHE B 1 114 ? 19.365  17.350  9.031   1.00 27.93 ? 128 PHE B CE1 1 
ATOM   4531  C  CE2 . PHE B 1 114 ? 21.019  16.466  10.524  1.00 32.39 ? 128 PHE B CE2 1 
ATOM   4532  C  CZ  . PHE B 1 114 ? 19.790  17.059  10.320  1.00 29.45 ? 128 PHE B CZ  1 
ATOM   4533  N  N   . LEU B 1 115 ? 24.240  16.970  4.453   1.00 28.47 ? 129 LEU B N   1 
ATOM   4534  C  CA  . LEU B 1 115 ? 25.367  16.679  3.577   1.00 33.61 ? 129 LEU B CA  1 
ATOM   4535  C  C   . LEU B 1 115 ? 26.415  17.783  3.667   1.00 36.20 ? 129 LEU B C   1 
ATOM   4536  O  O   . LEU B 1 115 ? 27.615  17.506  3.632   1.00 30.71 ? 129 LEU B O   1 
ATOM   4537  C  CB  . LEU B 1 115 ? 24.909  16.518  2.129   1.00 32.85 ? 129 LEU B CB  1 
ATOM   4538  C  CG  . LEU B 1 115 ? 24.098  15.258  1.838   1.00 38.62 ? 129 LEU B CG  1 
ATOM   4539  C  CD1 . LEU B 1 115 ? 23.590  15.312  0.406   1.00 44.95 ? 129 LEU B CD1 1 
ATOM   4540  C  CD2 . LEU B 1 115 ? 24.953  14.025  2.067   1.00 37.25 ? 129 LEU B CD2 1 
ATOM   4541  N  N   . LYS B 1 116 ? 25.958  19.030  3.768   1.00 34.18 ? 130 LYS B N   1 
ATOM   4542  C  CA  . LYS B 1 116 ? 26.875  20.150  3.944   1.00 35.49 ? 130 LYS B CA  1 
ATOM   4543  C  C   . LYS B 1 116 ? 27.632  19.972  5.255   1.00 31.49 ? 130 LYS B C   1 
ATOM   4544  O  O   . LYS B 1 116 ? 28.861  20.054  5.284   1.00 30.03 ? 130 LYS B O   1 
ATOM   4545  C  CB  . LYS B 1 116 ? 26.131  21.491  3.933   1.00 34.08 ? 130 LYS B CB  1 
ATOM   4546  N  N   . ALA B 1 117 ? 26.889  19.719  6.333   1.00 29.95 ? 131 ALA B N   1 
ATOM   4547  C  CA  . ALA B 1 117 ? 27.491  19.528  7.648   1.00 31.23 ? 131 ALA B CA  1 
ATOM   4548  C  C   . ALA B 1 117 ? 28.529  18.408  7.626   1.00 32.92 ? 131 ALA B C   1 
ATOM   4549  O  O   . ALA B 1 117 ? 29.639  18.599  8.114   1.00 28.68 ? 131 ALA B O   1 
ATOM   4550  C  CB  . ALA B 1 117 ? 26.431  19.260  8.699   1.00 23.68 ? 131 ALA B CB  1 
ATOM   4551  N  N   . ALA B 1 118 ? 28.171  17.260  7.045   1.00 27.16 ? 132 ALA B N   1 
ATOM   4552  C  CA  . ALA B 1 118 ? 29.115  16.152  6.876   1.00 29.45 ? 132 ALA B CA  1 
ATOM   4553  C  C   . ALA B 1 118 ? 30.413  16.590  6.198   1.00 34.17 ? 132 ALA B C   1 
ATOM   4554  O  O   . ALA B 1 118 ? 31.514  16.223  6.641   1.00 31.09 ? 132 ALA B O   1 
ATOM   4555  C  CB  . ALA B 1 118 ? 28.485  15.022  6.089   1.00 29.17 ? 132 ALA B CB  1 
ATOM   4556  N  N   . ASP B 1 119 ? 30.275  17.361  5.119   1.00 35.76 ? 133 ASP B N   1 
ATOM   4557  C  CA  . ASP B 1 119 ? 31.426  17.814  4.343   1.00 40.59 ? 133 ASP B CA  1 
ATOM   4558  C  C   . ASP B 1 119 ? 32.301  18.777  5.157   1.00 35.45 ? 133 ASP B C   1 
ATOM   4559  O  O   . ASP B 1 119 ? 33.528  18.723  5.076   1.00 30.81 ? 133 ASP B O   1 
ATOM   4560  C  CB  . ASP B 1 119 ? 30.978  18.440  3.012   1.00 41.22 ? 133 ASP B CB  1 
ATOM   4561  C  CG  . ASP B 1 119 ? 30.550  17.388  1.975   1.00 44.56 ? 133 ASP B CG  1 
ATOM   4562  O  OD1 . ASP B 1 119 ? 30.425  16.193  2.328   1.00 36.87 ? 133 ASP B OD1 1 
ATOM   4563  O  OD2 . ASP B 1 119 ? 30.338  17.756  0.803   1.00 47.76 ? 133 ASP B OD2 1 
ATOM   4564  N  N   . MET B 1 120 ? 31.659  19.635  5.946   1.00 33.02 ? 134 MET B N   1 
ATOM   4565  C  CA  . MET B 1 120 ? 32.361  20.545  6.847   1.00 35.99 ? 134 MET B CA  1 
ATOM   4566  C  C   . MET B 1 120 ? 33.161  19.775  7.902   1.00 32.53 ? 134 MET B C   1 
ATOM   4567  O  O   . MET B 1 120 ? 34.325  20.094  8.178   1.00 31.94 ? 134 MET B O   1 
ATOM   4568  C  CB  . MET B 1 120 ? 31.363  21.490  7.525   1.00 38.08 ? 134 MET B CB  1 
ATOM   4569  C  CG  . MET B 1 120 ? 30.658  22.434  6.561   1.00 36.17 ? 134 MET B CG  1 
ATOM   4570  S  SD  . MET B 1 120 ? 29.387  23.460  7.347   1.00 35.31 ? 134 MET B SD  1 
ATOM   4571  C  CE  . MET B 1 120 ? 30.406  24.456  8.431   1.00 37.10 ? 134 MET B CE  1 
ATOM   4572  N  N   . LEU B 1 121 ? 32.537  18.759  8.489   1.00 28.93 ? 135 LEU B N   1 
ATOM   4573  C  CA  . LEU B 1 121 ? 33.212  17.940  9.491   1.00 29.88 ? 135 LEU B CA  1 
ATOM   4574  C  C   . LEU B 1 121 ? 34.300  17.086  8.857   1.00 31.86 ? 135 LEU B C   1 
ATOM   4575  O  O   . LEU B 1 121 ? 35.297  16.743  9.498   1.00 29.62 ? 135 LEU B O   1 
ATOM   4576  C  CB  . LEU B 1 121 ? 32.202  17.042  10.205  1.00 26.91 ? 135 LEU B CB  1 
ATOM   4577  C  CG  . LEU B 1 121 ? 31.322  17.776  11.212  1.00 21.59 ? 135 LEU B CG  1 
ATOM   4578  C  CD1 . LEU B 1 121 ? 30.009  17.040  11.358  1.00 24.89 ? 135 LEU B CD1 1 
ATOM   4579  C  CD2 . LEU B 1 121 ? 32.049  17.861  12.553  1.00 24.67 ? 135 LEU B CD2 1 
ATOM   4580  N  N   . SER B 1 122 ? 34.098  16.739  7.592   1.00 32.29 ? 136 SER B N   1 
ATOM   4581  C  CA  . SER B 1 122 ? 35.046  15.900  6.879   1.00 32.61 ? 136 SER B CA  1 
ATOM   4582  C  C   . SER B 1 122 ? 36.349  16.644  6.580   1.00 34.63 ? 136 SER B C   1 
ATOM   4583  O  O   . SER B 1 122 ? 37.431  16.051  6.571   1.00 30.13 ? 136 SER B O   1 
ATOM   4584  C  CB  . SER B 1 122 ? 34.427  15.405  5.576   1.00 32.52 ? 136 SER B CB  1 
ATOM   4585  O  OG  . SER B 1 122 ? 35.430  14.903  4.717   1.00 37.84 ? 136 SER B OG  1 
ATOM   4586  N  N   . GLY B 1 123 ? 36.236  17.944  6.339   1.00 28.07 ? 137 GLY B N   1 
ATOM   4587  C  CA  . GLY B 1 123 ? 37.357  18.724  5.854   1.00 33.17 ? 137 GLY B CA  1 
ATOM   4588  C  C   . GLY B 1 123 ? 37.768  19.841  6.791   1.00 32.92 ? 137 GLY B C   1 
ATOM   4589  O  O   . GLY B 1 123 ? 38.645  19.638  7.636   1.00 32.53 ? 137 GLY B O   1 
ATOM   4590  N  N   . PRO B 1 124 ? 37.129  21.017  6.649   1.00 33.24 ? 138 PRO B N   1 
ATOM   4591  C  CA  . PRO B 1 124 ? 37.475  22.270  7.339   1.00 40.22 ? 138 PRO B CA  1 
ATOM   4592  C  C   . PRO B 1 124 ? 37.423  22.164  8.861   1.00 35.11 ? 138 PRO B C   1 
ATOM   4593  O  O   . PRO B 1 124 ? 38.184  22.836  9.553   1.00 31.37 ? 138 PRO B O   1 
ATOM   4594  C  CB  . PRO B 1 124 ? 36.386  23.247  6.872   1.00 42.07 ? 138 PRO B CB  1 
ATOM   4595  C  CG  . PRO B 1 124 ? 35.812  22.658  5.650   1.00 37.74 ? 138 PRO B CG  1 
ATOM   4596  C  CD  . PRO B 1 124 ? 35.995  21.184  5.723   1.00 36.58 ? 138 PRO B CD  1 
ATOM   4597  N  N   . ARG B 1 125 ? 36.525  21.333  9.373   1.00 28.28 ? 139 ARG B N   1 
ATOM   4598  C  CA  . ARG B 1 125 ? 36.265  21.271  10.810  1.00 25.81 ? 139 ARG B CA  1 
ATOM   4599  C  C   . ARG B 1 125 ? 36.694  19.948  11.430  1.00 25.75 ? 139 ARG B C   1 
ATOM   4600  O  O   . ARG B 1 125 ? 36.396  19.687  12.596  1.00 26.91 ? 139 ARG B O   1 
ATOM   4601  C  CB  . ARG B 1 125 ? 34.768  21.485  11.070  1.00 28.70 ? 139 ARG B CB  1 
ATOM   4602  C  CG  . ARG B 1 125 ? 34.227  22.766  10.436  1.00 31.47 ? 139 ARG B CG  1 
ATOM   4603  C  CD  . ARG B 1 125 ? 34.863  24.021  11.056  1.00 32.17 ? 139 ARG B CD  1 
ATOM   4604  N  NE  . ARG B 1 125 ? 34.005  24.569  12.102  1.00 35.52 ? 139 ARG B NE  1 
ATOM   4605  C  CZ  . ARG B 1 125 ? 32.924  25.304  11.857  1.00 35.96 ? 139 ARG B CZ  1 
ATOM   4606  N  NH1 . ARG B 1 125 ? 32.181  25.760  12.856  1.00 34.01 ? 139 ARG B NH1 1 
ATOM   4607  N  NH2 . ARG B 1 125 ? 32.595  25.594  10.604  1.00 34.90 ? 139 ARG B NH2 1 
ATOM   4608  N  N   . ARG B 1 126 ? 37.386  19.113  10.657  1.00 28.29 ? 140 ARG B N   1 
ATOM   4609  C  CA  . ARG B 1 126 ? 37.756  17.778  11.131  1.00 25.92 ? 140 ARG B CA  1 
ATOM   4610  C  C   . ARG B 1 126 ? 38.708  17.869  12.318  1.00 27.22 ? 140 ARG B C   1 
ATOM   4611  O  O   . ARG B 1 126 ? 38.457  17.280  13.370  1.00 28.89 ? 140 ARG B O   1 
ATOM   4612  C  CB  . ARG B 1 126 ? 38.376  16.936  10.016  1.00 29.06 ? 140 ARG B CB  1 
ATOM   4613  C  CG  . ARG B 1 126 ? 38.348  15.439  10.292  1.00 33.10 ? 140 ARG B CG  1 
ATOM   4614  C  CD  . ARG B 1 126 ? 39.368  14.722  9.426   1.00 38.24 ? 140 ARG B CD  1 
ATOM   4615  N  NE  . ARG B 1 126 ? 39.140  13.281  9.375   1.00 42.36 ? 140 ARG B NE  1 
ATOM   4616  C  CZ  . ARG B 1 126 ? 38.322  12.692  8.508   1.00 41.86 ? 140 ARG B CZ  1 
ATOM   4617  N  NH1 . ARG B 1 126 ? 38.169  11.374  8.517   1.00 40.39 ? 140 ARG B NH1 1 
ATOM   4618  N  NH2 . ARG B 1 126 ? 37.653  13.428  7.632   1.00 38.21 ? 140 ARG B NH2 1 
ATOM   4619  N  N   . ALA B 1 127 ? 39.786  18.624  12.146  1.00 27.45 ? 141 ALA B N   1 
ATOM   4620  C  CA  . ALA B 1 127 ? 40.717  18.868  13.239  1.00 29.08 ? 141 ALA B CA  1 
ATOM   4621  C  C   . ALA B 1 127 ? 39.993  19.365  14.485  1.00 26.31 ? 141 ALA B C   1 
ATOM   4622  O  O   . ALA B 1 127 ? 40.266  18.894  15.581  1.00 26.29 ? 141 ALA B O   1 
ATOM   4623  C  CB  . ALA B 1 127 ? 41.816  19.858  12.813  1.00 31.54 ? 141 ALA B CB  1 
ATOM   4624  N  N   . GLU B 1 128 ? 39.058  20.300  14.310  1.00 28.54 ? 142 GLU B N   1 
ATOM   4625  C  CA  . GLU B 1 128 ? 38.329  20.862  15.441  1.00 28.99 ? 142 GLU B CA  1 
ATOM   4626  C  C   . GLU B 1 128 ? 37.534  19.807  16.197  1.00 26.62 ? 142 GLU B C   1 
ATOM   4627  O  O   . GLU B 1 128 ? 37.606  19.716  17.419  1.00 28.51 ? 142 GLU B O   1 
ATOM   4628  C  CB  . GLU B 1 128 ? 37.367  21.965  14.994  1.00 30.28 ? 142 GLU B CB  1 
ATOM   4629  C  CG  . GLU B 1 128 ? 36.463  22.441  16.134  1.00 28.81 ? 142 GLU B CG  1 
ATOM   4630  C  CD  . GLU B 1 128 ? 35.276  23.263  15.666  1.00 38.76 ? 142 GLU B CD  1 
ATOM   4631  O  OE1 . GLU B 1 128 ? 35.244  23.648  14.476  1.00 38.29 ? 142 GLU B OE1 1 
ATOM   4632  O  OE2 . GLU B 1 128 ? 34.372  23.523  16.492  1.00 32.84 ? 142 GLU B OE2 1 
ATOM   4633  N  N   . ILE B 1 129 ? 36.768  19.004  15.469  1.00 29.05 ? 143 ILE B N   1 
ATOM   4634  C  CA  . ILE B 1 129 ? 35.952  18.002  16.131  1.00 27.07 ? 143 ILE B CA  1 
ATOM   4635  C  C   . ILE B 1 129 ? 36.821  16.946  16.821  1.00 24.64 ? 143 ILE B C   1 
ATOM   4636  O  O   . ILE B 1 129 ? 36.556  16.572  17.966  1.00 24.24 ? 143 ILE B O   1 
ATOM   4637  C  CB  . ILE B 1 129 ? 34.878  17.384  15.187  1.00 23.26 ? 143 ILE B CB  1 
ATOM   4638  C  CG1 . ILE B 1 129 ? 33.855  16.604  16.014  1.00 25.14 ? 143 ILE B CG1 1 
ATOM   4639  C  CG2 . ILE B 1 129 ? 35.507  16.510  14.118  1.00 25.64 ? 143 ILE B CG2 1 
ATOM   4640  C  CD1 . ILE B 1 129 ? 33.169  17.483  17.040  1.00 27.19 ? 143 ILE B CD1 1 
ATOM   4641  N  N   . LEU B 1 130 ? 37.880  16.509  16.148  1.00 27.80 ? 144 LEU B N   1 
ATOM   4642  C  CA  . LEU B 1 130 ? 38.799  15.533  16.723  1.00 24.49 ? 144 LEU B CA  1 
ATOM   4643  C  C   . LEU B 1 130 ? 39.432  16.060  18.008  1.00 28.92 ? 144 LEU B C   1 
ATOM   4644  O  O   . LEU B 1 130 ? 39.442  15.360  19.027  1.00 29.61 ? 144 LEU B O   1 
ATOM   4645  C  CB  . LEU B 1 130 ? 39.897  15.171  15.719  1.00 26.70 ? 144 LEU B CB  1 
ATOM   4646  C  CG  . LEU B 1 130 ? 39.438  14.564  14.391  1.00 35.20 ? 144 LEU B CG  1 
ATOM   4647  C  CD1 . LEU B 1 130 ? 40.609  14.342  13.458  1.00 34.48 ? 144 LEU B CD1 1 
ATOM   4648  C  CD2 . LEU B 1 130 ? 38.678  13.273  14.618  1.00 32.69 ? 144 LEU B CD2 1 
ATOM   4649  N  N   . ALA B 1 131 ? 39.951  17.291  17.957  1.00 23.58 ? 145 ALA B N   1 
ATOM   4650  C  CA  . ALA B 1 131 ? 40.614  17.890  19.119  1.00 23.68 ? 145 ALA B CA  1 
ATOM   4651  C  C   . ALA B 1 131 ? 39.664  18.040  20.305  1.00 23.68 ? 145 ALA B C   1 
ATOM   4652  O  O   . ALA B 1 131 ? 40.036  17.780  21.452  1.00 23.14 ? 145 ALA B O   1 
ATOM   4653  C  CB  . ALA B 1 131 ? 41.233  19.246  18.756  1.00 28.86 ? 145 ALA B CB  1 
ATOM   4654  N  N   . LYS B 1 132 ? 38.432  18.452  20.025  1.00 21.43 ? 146 LYS B N   1 
ATOM   4655  C  CA  . LYS B 1 132 ? 37.441  18.608  21.088  1.00 23.69 ? 146 LYS B CA  1 
ATOM   4656  C  C   . LYS B 1 132 ? 36.995  17.276  21.716  1.00 24.59 ? 146 LYS B C   1 
ATOM   4657  O  O   . LYS B 1 132 ? 36.725  17.219  22.923  1.00 23.47 ? 146 LYS B O   1 
ATOM   4658  C  CB  . LYS B 1 132 ? 36.239  19.417  20.599  1.00 20.97 ? 146 LYS B CB  1 
ATOM   4659  C  CG  . LYS B 1 132 ? 36.620  20.839  20.248  1.00 22.14 ? 146 LYS B CG  1 
ATOM   4660  C  CD  . LYS B 1 132 ? 35.459  21.653  19.701  1.00 21.65 ? 146 LYS B CD  1 
ATOM   4661  C  CE  . LYS B 1 132 ? 35.872  23.137  19.639  1.00 27.32 ? 146 LYS B CE  1 
ATOM   4662  N  NZ  . LYS B 1 132 ? 34.819  24.028  19.076  1.00 25.09 ? 146 LYS B NZ  1 
ATOM   4663  N  N   . THR B 1 133 ? 36.912  16.209  20.926  1.00 23.12 ? 147 THR B N   1 
ATOM   4664  C  CA  . THR B 1 133 ? 36.630  14.901  21.532  1.00 27.72 ? 147 THR B CA  1 
ATOM   4665  C  C   . THR B 1 133 ? 37.868  14.350  22.262  1.00 26.23 ? 147 THR B C   1 
ATOM   4666  O  O   . THR B 1 133 ? 37.753  13.651  23.276  1.00 19.25 ? 147 THR B O   1 
ATOM   4667  C  CB  . THR B 1 133 ? 36.070  13.859  20.527  1.00 21.94 ? 147 THR B CB  1 
ATOM   4668  O  OG1 . THR B 1 133 ? 36.984  13.685  19.445  1.00 25.24 ? 147 THR B OG1 1 
ATOM   4669  C  CG2 . THR B 1 133 ? 34.721  14.316  19.961  1.00 24.91 ? 147 THR B CG2 1 
ATOM   4670  N  N   . MET B 1 134 ? 39.054  14.674  21.765  1.00 20.24 ? 148 MET B N   1 
ATOM   4671  C  CA  . MET B 1 134 ? 40.264  14.198  22.435  1.00 22.05 ? 148 MET B CA  1 
ATOM   4672  C  C   . MET B 1 134 ? 40.420  14.887  23.788  1.00 23.59 ? 148 MET B C   1 
ATOM   4673  O  O   . MET B 1 134 ? 40.482  14.225  24.823  1.00 26.33 ? 148 MET B O   1 
ATOM   4674  C  CB  . MET B 1 134 ? 41.494  14.436  21.574  1.00 28.38 ? 148 MET B CB  1 
ATOM   4675  C  CG  . MET B 1 134 ? 41.595  13.504  20.396  1.00 26.79 ? 148 MET B CG  1 
ATOM   4676  S  SD  . MET B 1 134 ? 43.023  13.914  19.379  1.00 28.73 ? 148 MET B SD  1 
ATOM   4677  C  CE  . MET B 1 134 ? 44.374  13.366  20.431  1.00 28.71 ? 148 MET B CE  1 
ATOM   4678  N  N   . VAL B 1 135 ? 40.447  16.218  23.765  1.00 25.26 ? 149 VAL B N   1 
ATOM   4679  C  CA  . VAL B 1 135 ? 40.614  17.033  24.974  1.00 23.51 ? 149 VAL B CA  1 
ATOM   4680  C  C   . VAL B 1 135 ? 39.428  16.951  25.932  1.00 29.79 ? 149 VAL B C   1 
ATOM   4681  O  O   . VAL B 1 135 ? 39.619  16.818  27.143  1.00 27.01 ? 149 VAL B O   1 
ATOM   4682  C  CB  . VAL B 1 135 ? 40.922  18.507  24.625  1.00 25.57 ? 149 VAL B CB  1 
ATOM   4683  C  CG1 . VAL B 1 135 ? 40.971  19.381  25.878  1.00 23.84 ? 149 VAL B CG1 1 
ATOM   4684  C  CG2 . VAL B 1 135 ? 42.250  18.600  23.870  1.00 27.03 ? 149 VAL B CG2 1 
ATOM   4685  N  N   . GLY B 1 136 ? 38.212  17.013  25.385  1.00 27.12 ? 150 GLY B N   1 
ATOM   4686  C  CA  . GLY B 1 136 ? 37.010  17.051  26.187  1.00 23.79 ? 150 GLY B CA  1 
ATOM   4687  C  C   . GLY B 1 136 ? 36.530  15.702  26.719  1.00 24.22 ? 150 GLY B C   1 
ATOM   4688  O  O   . GLY B 1 136 ? 35.850  15.656  27.754  1.00 23.71 ? 150 GLY B O   1 
ATOM   4689  N  N   . GLN B 1 137 ? 36.873  14.615  26.025  1.00 22.27 ? 151 GLN B N   1 
ATOM   4690  C  CA  . GLN B 1 137 ? 36.371  13.276  26.384  1.00 21.58 ? 151 GLN B CA  1 
ATOM   4691  C  C   . GLN B 1 137 ? 37.484  12.245  26.627  1.00 25.63 ? 151 GLN B C   1 
ATOM   4692  O  O   . GLN B 1 137 ? 37.222  11.116  27.049  1.00 27.49 ? 151 GLN B O   1 
ATOM   4693  C  CB  . GLN B 1 137 ? 35.377  12.775  25.315  1.00 24.58 ? 151 GLN B CB  1 
ATOM   4694  C  CG  . GLN B 1 137 ? 34.110  13.657  25.225  1.00 24.02 ? 151 GLN B CG  1 
ATOM   4695  C  CD  . GLN B 1 137 ? 33.437  13.625  23.859  1.00 24.14 ? 151 GLN B CD  1 
ATOM   4696  O  OE1 . GLN B 1 137 ? 33.197  14.672  23.254  1.00 22.09 ? 151 GLN B OE1 1 
ATOM   4697  N  NE2 . GLN B 1 137 ? 33.126  12.421  23.365  1.00 18.65 ? 151 GLN B NE2 1 
ATOM   4698  N  N   . GLY B 1 138 ? 38.724  12.637  26.360  1.00 22.32 ? 152 GLY B N   1 
ATOM   4699  C  CA  . GLY B 1 138 ? 39.861  11.769  26.594  1.00 23.53 ? 152 GLY B CA  1 
ATOM   4700  C  C   . GLY B 1 138 ? 40.133  10.746  25.503  1.00 25.47 ? 152 GLY B C   1 
ATOM   4701  O  O   . GLY B 1 138 ? 40.847  9.766   25.732  1.00 26.03 ? 152 GLY B O   1 
ATOM   4702  N  N   . LYS B 1 139 ? 39.578  10.965  24.316  1.00 21.47 ? 153 LYS B N   1 
ATOM   4703  C  CA  . LYS B 1 139 ? 39.820  10.057  23.204  1.00 23.37 ? 153 LYS B CA  1 
ATOM   4704  C  C   . LYS B 1 139 ? 41.257  10.170  22.702  1.00 28.86 ? 153 LYS B C   1 
ATOM   4705  O  O   . LYS B 1 139 ? 41.821  11.258  22.696  1.00 27.98 ? 153 LYS B O   1 
ATOM   4706  C  CB  . LYS B 1 139 ? 38.859  10.371  22.053  1.00 20.81 ? 153 LYS B CB  1 
ATOM   4707  C  CG  . LYS B 1 139 ? 37.411  9.976   22.319  1.00 20.42 ? 153 LYS B CG  1 
ATOM   4708  C  CD  . LYS B 1 139 ? 36.576  10.177  21.061  1.00 24.85 ? 153 LYS B CD  1 
ATOM   4709  C  CE  . LYS B 1 139 ? 35.099  9.859   21.297  1.00 28.46 ? 153 LYS B CE  1 
ATOM   4710  N  NZ  . LYS B 1 139 ? 34.358  9.909   20.002  1.00 29.18 ? 153 LYS B NZ  1 
ATOM   4711  N  N   . THR B 1 140 ? 41.848  9.045   22.295  1.00 27.20 ? 154 THR B N   1 
ATOM   4712  C  CA  . THR B 1 140 ? 43.104  9.062   21.535  1.00 25.44 ? 154 THR B CA  1 
ATOM   4713  C  C   . THR B 1 140 ? 42.813  9.538   20.113  1.00 29.48 ? 154 THR B C   1 
ATOM   4714  O  O   . THR B 1 140 ? 41.650  9.548   19.684  1.00 27.03 ? 154 THR B O   1 
ATOM   4715  C  CB  . THR B 1 140 ? 43.702  7.644   21.436  1.00 31.27 ? 154 THR B CB  1 
ATOM   4716  O  OG1 . THR B 1 140 ? 42.736  6.760   20.835  1.00 26.09 ? 154 THR B OG1 1 
ATOM   4717  C  CG2 . THR B 1 140 ? 44.063  7.127   22.821  1.00 30.88 ? 154 THR B CG2 1 
ATOM   4718  N  N   . VAL B 1 141 ? 43.853  9.920   19.372  1.00 26.77 ? 155 VAL B N   1 
ATOM   4719  C  CA  . VAL B 1 141 ? 43.664  10.347  17.984  1.00 26.88 ? 155 VAL B CA  1 
ATOM   4720  C  C   . VAL B 1 141 ? 42.930  9.290   17.134  1.00 28.02 ? 155 VAL B C   1 
ATOM   4721  O  O   . VAL B 1 141 ? 41.948  9.606   16.461  1.00 23.96 ? 155 VAL B O   1 
ATOM   4722  C  CB  . VAL B 1 141 ? 44.987  10.778  17.314  1.00 29.99 ? 155 VAL B CB  1 
ATOM   4723  C  CG1 . VAL B 1 141 ? 46.074  9.754   17.564  1.00 31.90 ? 155 VAL B CG1 1 
ATOM   4724  C  CG2 . VAL B 1 141 ? 44.780  10.988  15.832  1.00 29.64 ? 155 VAL B CG2 1 
ATOM   4725  N  N   . ILE B 1 142 ? 43.383  8.043   17.182  1.00 32.40 ? 156 ILE B N   1 
ATOM   4726  C  CA  . ILE B 1 142 ? 42.725  6.985   16.410  1.00 31.31 ? 156 ILE B CA  1 
ATOM   4727  C  C   . ILE B 1 142 ? 41.276  6.767   16.804  1.00 31.47 ? 156 ILE B C   1 
ATOM   4728  O  O   . ILE B 1 142 ? 40.423  6.580   15.935  1.00 34.03 ? 156 ILE B O   1 
ATOM   4729  C  CB  . ILE B 1 142 ? 43.497  5.650   16.444  1.00 29.94 ? 156 ILE B CB  1 
ATOM   4730  C  CG1 . ILE B 1 142 ? 44.829  5.819   15.726  1.00 40.13 ? 156 ILE B CG1 1 
ATOM   4731  C  CG2 . ILE B 1 142 ? 42.704  4.553   15.752  1.00 37.74 ? 156 ILE B CG2 1 
ATOM   4732  C  CD1 . ILE B 1 142 ? 44.685  6.399   14.332  1.00 45.81 ? 156 ILE B CD1 1 
ATOM   4733  N  N   . GLN B 1 143 ? 40.981  6.797   18.102  1.00 28.85 ? 157 GLN B N   1 
ATOM   4734  C  CA  . GLN B 1 143 ? 39.593  6.666   18.542  1.00 25.81 ? 157 GLN B CA  1 
ATOM   4735  C  C   . GLN B 1 143 ? 38.720  7.828   18.051  1.00 30.75 ? 157 GLN B C   1 
ATOM   4736  O  O   . GLN B 1 143 ? 37.606  7.617   17.540  1.00 25.50 ? 157 GLN B O   1 
ATOM   4737  C  CB  . GLN B 1 143 ? 39.482  6.578   20.063  1.00 23.75 ? 157 GLN B CB  1 
ATOM   4738  C  CG  . GLN B 1 143 ? 38.032  6.390   20.510  1.00 27.31 ? 157 GLN B CG  1 
ATOM   4739  C  CD  . GLN B 1 143 ? 37.441  5.090   19.979  1.00 40.64 ? 157 GLN B CD  1 
ATOM   4740  O  OE1 . GLN B 1 143 ? 38.086  4.043   20.021  1.00 40.13 ? 157 GLN B OE1 1 
ATOM   4741  N  NE2 . GLN B 1 143 ? 36.215  5.156   19.469  1.00 44.23 ? 157 GLN B NE2 1 
ATOM   4742  N  N   . ALA B 1 144 ? 39.221  9.051   18.224  1.00 24.71 ? 158 ALA B N   1 
ATOM   4743  C  CA  . ALA B 1 144 ? 38.491  10.250  17.796  1.00 22.62 ? 158 ALA B CA  1 
ATOM   4744  C  C   . ALA B 1 144 ? 38.238  10.246  16.288  1.00 25.14 ? 158 ALA B C   1 
ATOM   4745  O  O   . ALA B 1 144 ? 37.138  10.562  15.836  1.00 24.15 ? 158 ALA B O   1 
ATOM   4746  C  CB  . ALA B 1 144 ? 39.247  11.499  18.191  1.00 28.48 ? 158 ALA B CB  1 
ATOM   4747  N  N   . GLU B 1 145 ? 39.259  9.888   15.516  1.00 22.37 ? 159 GLU B N   1 
ATOM   4748  C  CA  . GLU B 1 145 ? 39.114  9.804   14.066  1.00 28.72 ? 159 GLU B CA  1 
ATOM   4749  C  C   . GLU B 1 145 ? 38.104  8.747   13.627  1.00 34.58 ? 159 GLU B C   1 
ATOM   4750  O  O   . GLU B 1 145 ? 37.252  9.022   12.784  1.00 35.34 ? 159 GLU B O   1 
ATOM   4751  C  CB  . GLU B 1 145 ? 40.467  9.561   13.390  1.00 29.64 ? 159 GLU B CB  1 
ATOM   4752  C  CG  . GLU B 1 145 ? 40.391  9.188   11.905  1.00 34.49 ? 159 GLU B CG  1 
ATOM   4753  C  CD  . GLU B 1 145 ? 39.907  10.322  10.996  1.00 39.40 ? 159 GLU B CD  1 
ATOM   4754  O  OE1 . GLU B 1 145 ? 39.626  11.437  11.489  1.00 36.07 ? 159 GLU B OE1 1 
ATOM   4755  O  OE2 . GLU B 1 145 ? 39.806  10.090  9.770   1.00 45.07 ? 159 GLU B OE2 1 
ATOM   4756  N  N   . ILE B 1 146 ? 38.212  7.542   14.181  1.00 32.51 ? 160 ILE B N   1 
ATOM   4757  C  CA  . ILE B 1 146 ? 37.292  6.455   13.845  1.00 30.94 ? 160 ILE B CA  1 
ATOM   4758  C  C   . ILE B 1 146 ? 35.847  6.871   14.095  1.00 31.56 ? 160 ILE B C   1 
ATOM   4759  O  O   . ILE B 1 146 ? 34.983  6.740   13.220  1.00 30.83 ? 160 ILE B O   1 
ATOM   4760  C  CB  . ILE B 1 146 ? 37.632  5.181   14.636  1.00 32.40 ? 160 ILE B CB  1 
ATOM   4761  C  CG1 . ILE B 1 146 ? 38.820  4.467   13.981  1.00 33.10 ? 160 ILE B CG1 1 
ATOM   4762  C  CG2 . ILE B 1 146 ? 36.430  4.256   14.733  1.00 35.49 ? 160 ILE B CG2 1 
ATOM   4763  C  CD1 . ILE B 1 146 ? 39.347  3.316   14.793  1.00 40.99 ? 160 ILE B CD1 1 
ATOM   4764  N  N   . ASP B 1 147 ? 35.599  7.406   15.282  1.00 30.31 ? 161 ASP B N   1 
ATOM   4765  C  CA  . ASP B 1 147 ? 34.285  7.923   15.626  1.00 27.09 ? 161 ASP B CA  1 
ATOM   4766  C  C   . ASP B 1 147 ? 33.813  9.091   14.741  1.00 30.77 ? 161 ASP B C   1 
ATOM   4767  O  O   . ASP B 1 147 ? 32.652  9.132   14.341  1.00 26.52 ? 161 ASP B O   1 
ATOM   4768  C  CB  . ASP B 1 147 ? 34.230  8.296   17.108  1.00 25.27 ? 161 ASP B CB  1 
ATOM   4769  C  CG  . ASP B 1 147 ? 34.367  7.083   18.017  1.00 28.71 ? 161 ASP B CG  1 
ATOM   4770  O  OD1 . ASP B 1 147 ? 34.277  5.942   17.511  1.00 33.66 ? 161 ASP B OD1 1 
ATOM   4771  O  OD2 . ASP B 1 147 ? 34.559  7.266   19.239  1.00 28.31 ? 161 ASP B OD2 1 
ATOM   4772  N  N   . ALA B 1 148 ? 34.698  10.032  14.428  1.00 27.27 ? 162 ALA B N   1 
ATOM   4773  C  CA  . ALA B 1 148 ? 34.308  11.162  13.585  1.00 25.44 ? 162 ALA B CA  1 
ATOM   4774  C  C   . ALA B 1 148 ? 33.833  10.698  12.207  1.00 30.06 ? 162 ALA B C   1 
ATOM   4775  O  O   . ALA B 1 148 ? 32.798  11.150  11.720  1.00 29.81 ? 162 ALA B O   1 
ATOM   4776  C  CB  . ALA B 1 148 ? 35.442  12.155  13.449  1.00 25.47 ? 162 ALA B CB  1 
ATOM   4777  N  N   . ALA B 1 149 ? 34.572  9.773   11.600  1.00 26.60 ? 163 ALA B N   1 
ATOM   4778  C  CA  . ALA B 1 149 ? 34.256  9.305   10.248  1.00 30.07 ? 163 ALA B CA  1 
ATOM   4779  C  C   . ALA B 1 149 ? 33.111  8.271   10.198  1.00 34.07 ? 163 ALA B C   1 
ATOM   4780  O  O   . ALA B 1 149 ? 32.153  8.424   9.435   1.00 31.47 ? 163 ALA B O   1 
ATOM   4781  C  CB  . ALA B 1 149 ? 35.518  8.755   9.565   1.00 27.55 ? 163 ALA B CB  1 
ATOM   4782  N  N   . ALA B 1 150 ? 33.208  7.229   11.018  1.00 33.58 ? 164 ALA B N   1 
ATOM   4783  C  CA  . ALA B 1 150 ? 32.280  6.099   10.928  1.00 33.97 ? 164 ALA B CA  1 
ATOM   4784  C  C   . ALA B 1 150 ? 30.938  6.367   11.598  1.00 33.31 ? 164 ALA B C   1 
ATOM   4785  O  O   . ALA B 1 150 ? 29.913  5.799   11.209  1.00 30.88 ? 164 ALA B O   1 
ATOM   4786  C  CB  . ALA B 1 150 ? 32.912  4.853   11.504  1.00 36.97 ? 164 ALA B CB  1 
ATOM   4787  N  N   . GLU B 1 151 ? 30.942  7.228   12.606  1.00 26.82 ? 165 GLU B N   1 
ATOM   4788  C  CA  . GLU B 1 151 ? 29.728  7.503   13.346  1.00 25.60 ? 165 GLU B CA  1 
ATOM   4789  C  C   . GLU B 1 151 ? 29.105  8.825   12.898  1.00 35.66 ? 165 GLU B C   1 
ATOM   4790  O  O   . GLU B 1 151 ? 28.086  8.833   12.201  1.00 30.98 ? 165 GLU B O   1 
ATOM   4791  C  CB  . GLU B 1 151 ? 29.996  7.481   14.856  1.00 24.11 ? 165 GLU B CB  1 
ATOM   4792  C  CG  . GLU B 1 151 ? 28.840  7.975   15.724  1.00 36.03 ? 165 GLU B CG  1 
ATOM   4793  C  CD  . GLU B 1 151 ? 27.642  7.017   15.749  1.00 43.36 ? 165 GLU B CD  1 
ATOM   4794  O  OE1 . GLU B 1 151 ? 27.848  5.782   15.681  1.00 39.02 ? 165 GLU B OE1 1 
ATOM   4795  O  OE2 . GLU B 1 151 ? 26.489  7.505   15.841  1.00 43.75 ? 165 GLU B OE2 1 
ATOM   4796  N  N   . LEU B 1 152 ? 29.739  9.934   13.265  1.00 30.07 ? 166 LEU B N   1 
ATOM   4797  C  CA  . LEU B 1 152 ? 29.193  11.268  13.009  1.00 22.39 ? 166 LEU B CA  1 
ATOM   4798  C  C   . LEU B 1 152 ? 28.999  11.591  11.512  1.00 22.88 ? 166 LEU B C   1 
ATOM   4799  O  O   . LEU B 1 152 ? 27.880  11.896  11.060  1.00 23.93 ? 166 LEU B O   1 
ATOM   4800  C  CB  . LEU B 1 152 ? 30.122  12.309  13.646  1.00 24.78 ? 166 LEU B CB  1 
ATOM   4801  C  CG  . LEU B 1 152 ? 29.764  13.782  13.566  1.00 24.37 ? 166 LEU B CG  1 
ATOM   4802  C  CD1 . LEU B 1 152 ? 28.460  14.071  14.295  1.00 30.31 ? 166 LEU B CD1 1 
ATOM   4803  C  CD2 . LEU B 1 152 ? 30.909  14.632  14.158  1.00 27.75 ? 166 LEU B CD2 1 
ATOM   4804  N  N   . ILE B 1 153 ? 30.088  11.549  10.750  1.00 22.61 ? 167 ILE B N   1 
ATOM   4805  C  CA  . ILE B 1 153 ? 30.049  11.891  9.324   1.00 25.01 ? 167 ILE B CA  1 
ATOM   4806  C  C   . ILE B 1 153 ? 29.222  10.873  8.511   1.00 26.07 ? 167 ILE B C   1 
ATOM   4807  O  O   . ILE B 1 153 ? 28.299  11.255  7.802   1.00 22.16 ? 167 ILE B O   1 
ATOM   4808  C  CB  . ILE B 1 153 ? 31.475  12.028  8.735   1.00 26.75 ? 167 ILE B CB  1 
ATOM   4809  C  CG1 . ILE B 1 153 ? 32.217  13.206  9.386   1.00 31.51 ? 167 ILE B CG1 1 
ATOM   4810  C  CG2 . ILE B 1 153 ? 31.432  12.197  7.209   1.00 22.41 ? 167 ILE B CG2 1 
ATOM   4811  C  CD1 . ILE B 1 153 ? 33.715  13.198  9.135   1.00 27.89 ? 167 ILE B CD1 1 
ATOM   4812  N  N   . ASP B 1 154 ? 29.560  9.589   8.620   1.00 23.77 ? 168 ASP B N   1 
ATOM   4813  C  CA  . ASP B 1 154 ? 28.839  8.540   7.899   1.00 25.89 ? 168 ASP B CA  1 
ATOM   4814  C  C   . ASP B 1 154 ? 27.324  8.550   8.153   1.00 29.53 ? 168 ASP B C   1 
ATOM   4815  O  O   . ASP B 1 154 ? 26.530  8.342   7.232   1.00 29.10 ? 168 ASP B O   1 
ATOM   4816  C  CB  . ASP B 1 154 ? 29.414  7.147   8.226   1.00 25.68 ? 168 ASP B CB  1 
ATOM   4817  C  CG  . ASP B 1 154 ? 30.497  6.711   7.247   1.00 31.24 ? 168 ASP B CG  1 
ATOM   4818  O  OD1 . ASP B 1 154 ? 30.913  7.535   6.400   1.00 31.11 ? 168 ASP B OD1 1 
ATOM   4819  O  OD2 . ASP B 1 154 ? 30.945  5.542   7.330   1.00 29.29 ? 168 ASP B OD2 1 
ATOM   4820  N  N   . PHE B 1 155 ? 26.917  8.787   9.396   1.00 28.84 ? 169 PHE B N   1 
ATOM   4821  C  CA  . PHE B 1 155 ? 25.492  8.833   9.677   1.00 27.98 ? 169 PHE B CA  1 
ATOM   4822  C  C   . PHE B 1 155 ? 24.791  10.002  9.009   1.00 29.21 ? 169 PHE B C   1 
ATOM   4823  O  O   . PHE B 1 155 ? 23.696  9.827   8.498   1.00 23.17 ? 169 PHE B O   1 
ATOM   4824  C  CB  . PHE B 1 155 ? 25.176  8.735   11.171  1.00 24.55 ? 169 PHE B CB  1 
ATOM   4825  C  CG  . PHE B 1 155 ? 24.974  7.322   11.636  1.00 28.81 ? 169 PHE B CG  1 
ATOM   4826  C  CD1 . PHE B 1 155 ? 23.708  6.769   11.669  1.00 29.62 ? 169 PHE B CD1 1 
ATOM   4827  C  CD2 . PHE B 1 155 ? 26.056  6.523   11.980  1.00 30.15 ? 169 PHE B CD2 1 
ATOM   4828  C  CE1 . PHE B 1 155 ? 23.513  5.457   12.078  1.00 33.08 ? 169 PHE B CE1 1 
ATOM   4829  C  CE2 . PHE B 1 155 ? 25.868  5.201   12.391  1.00 30.17 ? 169 PHE B CE2 1 
ATOM   4830  C  CZ  . PHE B 1 155 ? 24.594  4.673   12.439  1.00 31.57 ? 169 PHE B CZ  1 
ATOM   4831  N  N   . PHE B 1 156 ? 25.414  11.179  8.980   1.00 27.33 ? 170 PHE B N   1 
ATOM   4832  C  CA  . PHE B 1 156 ? 24.822  12.300  8.246   1.00 24.07 ? 170 PHE B CA  1 
ATOM   4833  C  C   . PHE B 1 156 ? 24.622  11.955  6.765   1.00 26.50 ? 170 PHE B C   1 
ATOM   4834  O  O   . PHE B 1 156 ? 23.535  12.140  6.224   1.00 25.79 ? 170 PHE B O   1 
ATOM   4835  C  CB  . PHE B 1 156 ? 25.645  13.580  8.381   1.00 24.90 ? 170 PHE B CB  1 
ATOM   4836  C  CG  . PHE B 1 156 ? 25.512  14.259  9.721   1.00 29.48 ? 170 PHE B CG  1 
ATOM   4837  C  CD1 . PHE B 1 156 ? 24.481  13.942  10.578  1.00 28.52 ? 170 PHE B CD1 1 
ATOM   4838  C  CD2 . PHE B 1 156 ? 26.429  15.223  10.115  1.00 32.90 ? 170 PHE B CD2 1 
ATOM   4839  C  CE1 . PHE B 1 156 ? 24.368  14.566  11.810  1.00 28.99 ? 170 PHE B CE1 1 
ATOM   4840  C  CE2 . PHE B 1 156 ? 26.318  15.844  11.346  1.00 30.36 ? 170 PHE B CE2 1 
ATOM   4841  C  CZ  . PHE B 1 156 ? 25.285  15.521  12.184  1.00 25.69 ? 170 PHE B CZ  1 
ATOM   4842  N  N   . ARG B 1 157 ? 25.651  11.422  6.116   1.00 22.80 ? 171 ARG B N   1 
ATOM   4843  C  CA  . ARG B 1 157 ? 25.522  11.083  4.696   1.00 25.76 ? 171 ARG B CA  1 
ATOM   4844  C  C   . ARG B 1 157 ? 24.565  9.907   4.419   1.00 25.32 ? 171 ARG B C   1 
ATOM   4845  O  O   . ARG B 1 157 ? 23.721  9.985   3.518   1.00 28.02 ? 171 ARG B O   1 
ATOM   4846  C  CB  . ARG B 1 157 ? 26.890  10.820  4.059   1.00 23.17 ? 171 ARG B CB  1 
ATOM   4847  C  CG  . ARG B 1 157 ? 27.853  12.013  4.149   1.00 30.42 ? 171 ARG B CG  1 
ATOM   4848  C  CD  . ARG B 1 157 ? 28.814  12.067  2.965   1.00 30.24 ? 171 ARG B CD  1 
ATOM   4849  N  NE  . ARG B 1 157 ? 29.810  13.132  3.119   1.00 32.38 ? 171 ARG B NE  1 
ATOM   4850  C  CZ  . ARG B 1 157 ? 31.033  12.943  3.608   1.00 32.91 ? 171 ARG B CZ  1 
ATOM   4851  N  NH1 . ARG B 1 157 ? 31.416  11.729  3.986   1.00 31.97 ? 171 ARG B NH1 1 
ATOM   4852  N  NH2 . ARG B 1 157 ? 31.880  13.966  3.713   1.00 34.26 ? 171 ARG B NH2 1 
ATOM   4853  N  N   . PHE B 1 158 ? 24.685  8.826   5.188   1.00 24.55 ? 172 PHE B N   1 
ATOM   4854  C  CA  . PHE B 1 158 ? 23.887  7.634   4.899   1.00 27.04 ? 172 PHE B CA  1 
ATOM   4855  C  C   . PHE B 1 158 ? 22.426  7.770   5.318   1.00 31.16 ? 172 PHE B C   1 
ATOM   4856  O  O   . PHE B 1 158 ? 21.536  7.232   4.646   1.00 26.13 ? 172 PHE B O   1 
ATOM   4857  C  CB  . PHE B 1 158 ? 24.539  6.361   5.448   1.00 26.61 ? 172 PHE B CB  1 
ATOM   4858  C  CG  . PHE B 1 158 ? 25.686  5.861   4.602   1.00 29.69 ? 172 PHE B CG  1 
ATOM   4859  C  CD1 . PHE B 1 158 ? 25.460  4.970   3.558   1.00 36.11 ? 172 PHE B CD1 1 
ATOM   4860  C  CD2 . PHE B 1 158 ? 26.985  6.297   4.836   1.00 29.69 ? 172 PHE B CD2 1 
ATOM   4861  C  CE1 . PHE B 1 158 ? 26.513  4.512   2.772   1.00 33.46 ? 172 PHE B CE1 1 
ATOM   4862  C  CE2 . PHE B 1 158 ? 28.044  5.844   4.058   1.00 29.29 ? 172 PHE B CE2 1 
ATOM   4863  C  CZ  . PHE B 1 158 ? 27.808  4.951   3.021   1.00 35.16 ? 172 PHE B CZ  1 
ATOM   4864  N  N   . ASN B 1 159 ? 22.170  8.483   6.413   1.00 26.73 ? 173 ASN B N   1 
ATOM   4865  C  CA  . ASN B 1 159 ? 20.794  8.885   6.726   1.00 28.44 ? 173 ASN B CA  1 
ATOM   4866  C  C   . ASN B 1 159 ? 20.171  9.654   5.554   1.00 27.64 ? 173 ASN B C   1 
ATOM   4867  O  O   . ASN B 1 159 ? 19.062  9.342   5.111   1.00 27.80 ? 173 ASN B O   1 
ATOM   4868  C  CB  . ASN B 1 159 ? 20.742  9.754   7.978   1.00 25.28 ? 173 ASN B CB  1 
ATOM   4869  C  CG  . ASN B 1 159 ? 20.859  8.953   9.258   1.00 28.90 ? 173 ASN B CG  1 
ATOM   4870  O  OD1 . ASN B 1 159 ? 20.988  7.730   9.236   1.00 30.89 ? 173 ASN B OD1 1 
ATOM   4871  N  ND2 . ASN B 1 159 ? 20.830  9.650   10.387  1.00 25.30 ? 173 ASN B ND2 1 
ATOM   4872  N  N   . ALA B 1 160 ? 20.893  10.657  5.054   1.00 25.11 ? 174 ALA B N   1 
ATOM   4873  C  CA  . ALA B 1 160 ? 20.421  11.475  3.935   1.00 26.31 ? 174 ALA B CA  1 
ATOM   4874  C  C   . ALA B 1 160 ? 20.109  10.629  2.704   1.00 30.86 ? 174 ALA B C   1 
ATOM   4875  O  O   . ALA B 1 160 ? 19.059  10.802  2.079   1.00 33.48 ? 174 ALA B O   1 
ATOM   4876  C  CB  . ALA B 1 160 ? 21.425  12.580  3.598   1.00 30.54 ? 174 ALA B CB  1 
ATOM   4877  N  N   . LYS B 1 161 ? 21.008  9.707   2.370   1.00 34.66 ? 175 LYS B N   1 
ATOM   4878  C  CA  . LYS B 1 161 ? 20.769  8.755   1.286   1.00 31.06 ? 175 LYS B CA  1 
ATOM   4879  C  C   . LYS B 1 161 ? 19.501  7.945   1.522   1.00 33.23 ? 175 LYS B C   1 
ATOM   4880  O  O   . LYS B 1 161 ? 18.649  7.843   0.635   1.00 35.98 ? 175 LYS B O   1 
ATOM   4881  C  CB  . LYS B 1 161 ? 21.942  7.787   1.133   1.00 31.32 ? 175 LYS B CB  1 
ATOM   4882  C  CG  . LYS B 1 161 ? 21.670  6.653   0.138   1.00 38.69 ? 175 LYS B CG  1 
ATOM   4883  C  CD  . LYS B 1 161 ? 22.899  5.777   -0.071  1.00 47.62 ? 175 LYS B CD  1 
ATOM   4884  C  CE  . LYS B 1 161 ? 22.547  4.523   -0.861  1.00 56.05 ? 175 LYS B CE  1 
ATOM   4885  N  NZ  . LYS B 1 161 ? 21.842  4.855   -2.132  1.00 61.54 ? 175 LYS B NZ  1 
ATOM   4886  N  N   . TYR B 1 162 ? 19.394  7.357   2.712   1.00 28.86 ? 176 TYR B N   1 
ATOM   4887  C  CA  . TYR B 1 162 ? 18.227  6.549   3.062   1.00 31.79 ? 176 TYR B CA  1 
ATOM   4888  C  C   . TYR B 1 162 ? 16.933  7.353   2.933   1.00 33.87 ? 176 TYR B C   1 
ATOM   4889  O  O   . TYR B 1 162 ? 15.917  6.847   2.431   1.00 36.23 ? 176 TYR B O   1 
ATOM   4890  C  CB  . TYR B 1 162 ? 18.364  5.963   4.473   1.00 27.97 ? 176 TYR B CB  1 
ATOM   4891  N  N   . ALA B 1 163 ? 16.977  8.613   3.355   1.00 30.01 ? 177 ALA B N   1 
ATOM   4892  C  CA  . ALA B 1 163 ? 15.779  9.444   3.340   1.00 33.58 ? 177 ALA B CA  1 
ATOM   4893  C  C   . ALA B 1 163 ? 15.361  9.801   1.917   1.00 39.24 ? 177 ALA B C   1 
ATOM   4894  O  O   . ALA B 1 163 ? 14.177  9.712   1.560   1.00 38.27 ? 177 ALA B O   1 
ATOM   4895  C  CB  . ALA B 1 163 ? 15.985  10.698  4.176   1.00 31.07 ? 177 ALA B CB  1 
ATOM   4896  N  N   . VAL B 1 164 ? 16.335  10.198  1.105   1.00 31.12 ? 178 VAL B N   1 
ATOM   4897  C  CA  . VAL B 1 164 ? 16.074  10.524  -0.290  1.00 36.21 ? 178 VAL B CA  1 
ATOM   4898  C  C   . VAL B 1 164 ? 15.566  9.310   -1.074  1.00 37.50 ? 178 VAL B C   1 
ATOM   4899  O  O   . VAL B 1 164 ? 14.687  9.439   -1.922  1.00 38.11 ? 178 VAL B O   1 
ATOM   4900  C  CB  . VAL B 1 164 ? 17.330  11.111  -0.969  1.00 37.86 ? 178 VAL B CB  1 
ATOM   4901  C  CG1 . VAL B 1 164 ? 17.158  11.151  -2.490  1.00 40.86 ? 178 VAL B CG1 1 
ATOM   4902  C  CG2 . VAL B 1 164 ? 17.624  12.507  -0.415  1.00 33.64 ? 178 VAL B CG2 1 
ATOM   4903  N  N   . GLU B 1 165 ? 16.113  8.134   -0.783  1.00 37.47 ? 179 GLU B N   1 
ATOM   4904  C  CA  . GLU B 1 165 ? 15.726  6.915   -1.487  1.00 41.96 ? 179 GLU B CA  1 
ATOM   4905  C  C   . GLU B 1 165 ? 14.322  6.474   -1.077  1.00 40.33 ? 179 GLU B C   1 
ATOM   4906  O  O   . GLU B 1 165 ? 13.513  6.059   -1.921  1.00 38.61 ? 179 GLU B O   1 
ATOM   4907  C  CB  . GLU B 1 165 ? 16.736  5.794   -1.218  1.00 45.46 ? 179 GLU B CB  1 
ATOM   4908  N  N   . LEU B 1 166 ? 14.050  6.575   0.224   1.00 37.51 ? 180 LEU B N   1 
ATOM   4909  C  CA  . LEU B 1 166 ? 12.749  6.255   0.796   1.00 37.22 ? 180 LEU B CA  1 
ATOM   4910  C  C   . LEU B 1 166 ? 11.674  7.029   0.061   1.00 41.00 ? 180 LEU B C   1 
ATOM   4911  O  O   . LEU B 1 166 ? 10.678  6.457   -0.385  1.00 38.17 ? 180 LEU B O   1 
ATOM   4912  C  CB  . LEU B 1 166 ? 12.718  6.600   2.286   1.00 36.90 ? 180 LEU B CB  1 
ATOM   4913  C  CG  . LEU B 1 166 ? 11.446  6.200   3.033   1.00 41.18 ? 180 LEU B CG  1 
ATOM   4914  C  CD1 . LEU B 1 166 ? 11.192  4.695   2.926   1.00 39.48 ? 180 LEU B CD1 1 
ATOM   4915  C  CD2 . LEU B 1 166 ? 11.525  6.638   4.493   1.00 40.52 ? 180 LEU B CD2 1 
ATOM   4916  N  N   . GLU B 1 167 ? 11.905  8.331   -0.076  1.00 43.93 ? 181 GLU B N   1 
ATOM   4917  C  CA  . GLU B 1 167 ? 11.052  9.222   -0.860  1.00 50.90 ? 181 GLU B CA  1 
ATOM   4918  C  C   . GLU B 1 167 ? 10.722  8.671   -2.253  1.00 55.18 ? 181 GLU B C   1 
ATOM   4919  O  O   . GLU B 1 167 ? 9.623   8.879   -2.761  1.00 54.32 ? 181 GLU B O   1 
ATOM   4920  C  CB  . GLU B 1 167 ? 11.738  10.585  -0.997  1.00 51.44 ? 181 GLU B CB  1 
ATOM   4921  C  CG  . GLU B 1 167 ? 10.920  11.640  -1.710  1.00 55.52 ? 181 GLU B CG  1 
ATOM   4922  C  CD  . GLU B 1 167 ? 9.769   12.139  -0.867  1.00 64.34 ? 181 GLU B CD  1 
ATOM   4923  O  OE1 . GLU B 1 167 ? 8.855   12.776  -1.434  1.00 71.17 ? 181 GLU B OE1 1 
ATOM   4924  O  OE2 . GLU B 1 167 ? 9.780   11.898  0.362   1.00 64.14 ? 181 GLU B OE2 1 
ATOM   4925  N  N   . GLY B 1 168 ? 11.681  7.970   -2.861  1.00 60.39 ? 182 GLY B N   1 
ATOM   4926  C  CA  . GLY B 1 168 ? 11.514  7.412   -4.197  1.00 59.08 ? 182 GLY B CA  1 
ATOM   4927  C  C   . GLY B 1 168 ? 10.773  6.084   -4.252  1.00 56.58 ? 182 GLY B C   1 
ATOM   4928  O  O   . GLY B 1 168 ? 10.380  5.633   -5.326  1.00 60.98 ? 182 GLY B O   1 
ATOM   4929  N  N   . GLN B 1 169 ? 10.597  5.448   -3.098  1.00 56.00 ? 183 GLN B N   1 
ATOM   4930  C  CA  . GLN B 1 169 ? 9.746   4.269   -2.997  1.00 55.82 ? 183 GLN B CA  1 
ATOM   4931  C  C   . GLN B 1 169 ? 8.282   4.705   -3.059  1.00 57.64 ? 183 GLN B C   1 
ATOM   4932  O  O   . GLN B 1 169 ? 7.690   5.075   -2.039  1.00 56.87 ? 183 GLN B O   1 
ATOM   4933  C  CB  . GLN B 1 169 ? 10.023  3.510   -1.695  1.00 52.90 ? 183 GLN B CB  1 
ATOM   4934  N  N   . GLN B 1 170 ? 7.710   4.670   -4.262  1.00 55.19 ? 184 GLN B N   1 
ATOM   4935  C  CA  . GLN B 1 170 ? 6.353   5.169   -4.493  1.00 54.68 ? 184 GLN B CA  1 
ATOM   4936  C  C   . GLN B 1 170 ? 5.428   4.113   -5.105  1.00 59.92 ? 184 GLN B C   1 
ATOM   4937  O  O   . GLN B 1 170 ? 5.840   3.342   -5.977  1.00 56.32 ? 184 GLN B O   1 
ATOM   4938  C  CB  . GLN B 1 170 ? 6.385   6.411   -5.392  1.00 49.45 ? 184 GLN B CB  1 
ATOM   4939  C  CG  . GLN B 1 170 ? 6.979   7.656   -4.739  1.00 47.64 ? 184 GLN B CG  1 
ATOM   4940  C  CD  . GLN B 1 170 ? 6.146   8.166   -3.569  1.00 46.76 ? 184 GLN B CD  1 
ATOM   4941  O  OE1 . GLN B 1 170 ? 4.922   7.979   -3.523  1.00 43.77 ? 184 GLN B OE1 1 
ATOM   4942  N  NE2 . GLN B 1 170 ? 6.807   8.818   -2.618  1.00 40.95 ? 184 GLN B NE2 1 
ATOM   4943  N  N   . PRO B 1 171 ? 4.166   4.083   -4.650  1.00 64.06 ? 185 PRO B N   1 
ATOM   4944  C  CA  . PRO B 1 171 ? 3.180   3.155   -5.211  1.00 66.07 ? 185 PRO B CA  1 
ATOM   4945  C  C   . PRO B 1 171 ? 2.986   3.382   -6.708  1.00 67.58 ? 185 PRO B C   1 
ATOM   4946  O  O   . PRO B 1 171 ? 2.913   4.528   -7.157  1.00 66.35 ? 185 PRO B O   1 
ATOM   4947  C  CB  . PRO B 1 171 ? 1.889   3.516   -4.463  1.00 66.07 ? 185 PRO B CB  1 
ATOM   4948  C  CG  . PRO B 1 171 ? 2.339   4.187   -3.211  1.00 64.94 ? 185 PRO B CG  1 
ATOM   4949  C  CD  . PRO B 1 171 ? 3.598   4.916   -3.576  1.00 63.06 ? 185 PRO B CD  1 
ATOM   4950  N  N   . ILE B 1 172 ? 2.925   2.298   -7.473  1.00 70.52 ? 186 ILE B N   1 
ATOM   4951  C  CA  . ILE B 1 172 ? 2.529   2.399   -8.868  1.00 71.14 ? 186 ILE B CA  1 
ATOM   4952  C  C   . ILE B 1 172 ? 1.063   2.798   -8.871  1.00 68.77 ? 186 ILE B C   1 
ATOM   4953  O  O   . ILE B 1 172 ? 0.254   2.210   -8.151  1.00 67.16 ? 186 ILE B O   1 
ATOM   4954  C  CB  . ILE B 1 172 ? 2.694   1.064   -9.611  1.00 71.54 ? 186 ILE B CB  1 
ATOM   4955  N  N   . SER B 1 173 ? 0.720   3.817   -9.647  1.00 67.22 ? 187 SER B N   1 
ATOM   4956  C  CA  . SER B 1 173 ? -0.668  4.245   -9.721  1.00 71.89 ? 187 SER B CA  1 
ATOM   4957  C  C   . SER B 1 173 ? -1.420  3.406   -10.738 1.00 74.62 ? 187 SER B C   1 
ATOM   4958  O  O   . SER B 1 173 ? -1.020  3.323   -11.899 1.00 76.47 ? 187 SER B O   1 
ATOM   4959  C  CB  . SER B 1 173 ? -0.770  5.731   -10.066 1.00 76.10 ? 187 SER B CB  1 
ATOM   4960  O  OG  . SER B 1 173 ? -0.480  6.535   -8.936  1.00 77.84 ? 187 SER B OG  1 
ATOM   4961  N  N   . VAL B 1 174 ? -2.496  2.768   -10.284 1.00 74.64 ? 188 VAL B N   1 
ATOM   4962  C  CA  . VAL B 1 174 ? -3.364  1.988   -11.156 1.00 77.56 ? 188 VAL B CA  1 
ATOM   4963  C  C   . VAL B 1 174 ? -4.638  2.773   -11.456 1.00 79.68 ? 188 VAL B C   1 
ATOM   4964  O  O   . VAL B 1 174 ? -5.590  2.721   -10.673 1.00 77.33 ? 188 VAL B O   1 
ATOM   4965  C  CB  . VAL B 1 174 ? -3.749  0.640   -10.509 1.00 73.26 ? 188 VAL B CB  1 
ATOM   4966  N  N   . PRO B 1 175 ? -4.653  3.512   -12.583 1.00 81.97 ? 189 PRO B N   1 
ATOM   4967  C  CA  . PRO B 1 175 ? -5.813  4.323   -12.972 1.00 84.66 ? 189 PRO B CA  1 
ATOM   4968  C  C   . PRO B 1 175 ? -7.123  3.534   -12.929 1.00 85.90 ? 189 PRO B C   1 
ATOM   4969  O  O   . PRO B 1 175 ? -7.108  2.325   -13.168 1.00 86.47 ? 189 PRO B O   1 
ATOM   4970  C  CB  . PRO B 1 175 ? -5.461  4.765   -14.393 1.00 84.65 ? 189 PRO B CB  1 
ATOM   4971  C  CG  . PRO B 1 175 ? -3.979  4.862   -14.368 1.00 82.77 ? 189 PRO B CG  1 
ATOM   4972  C  CD  . PRO B 1 175 ? -3.540  3.684   -13.534 1.00 81.66 ? 189 PRO B CD  1 
ATOM   4973  N  N   . PRO B 1 176 ? -8.249  4.205   -12.627 1.00 83.81 ? 190 PRO B N   1 
ATOM   4974  C  CA  . PRO B 1 176 ? -8.437  5.657   -12.480 1.00 80.79 ? 190 PRO B CA  1 
ATOM   4975  C  C   . PRO B 1 176 ? -7.991  6.264   -11.138 1.00 73.10 ? 190 PRO B C   1 
ATOM   4976  O  O   . PRO B 1 176 ? -8.640  7.195   -10.661 1.00 72.34 ? 190 PRO B O   1 
ATOM   4977  C  CB  . PRO B 1 176 ? -9.951  5.813   -12.636 1.00 83.14 ? 190 PRO B CB  1 
ATOM   4978  C  CG  . PRO B 1 176 ? -10.500 4.549   -12.062 1.00 82.65 ? 190 PRO B CG  1 
ATOM   4979  C  CD  . PRO B 1 176 ? -9.509  3.468   -12.416 1.00 83.08 ? 190 PRO B CD  1 
ATOM   4980  N  N   . SER B 1 177 ? -6.906  5.765   -10.552 1.00 65.39 ? 191 SER B N   1 
ATOM   4981  C  CA  . SER B 1 177 ? -6.379  6.328   -9.313  1.00 60.68 ? 191 SER B CA  1 
ATOM   4982  C  C   . SER B 1 177 ? -4.896  6.714   -9.392  1.00 60.91 ? 191 SER B C   1 
ATOM   4983  O  O   . SER B 1 177 ? -4.082  6.002   -9.979  1.00 61.50 ? 191 SER B O   1 
ATOM   4984  C  CB  . SER B 1 177 ? -6.607  5.376   -8.135  1.00 58.90 ? 191 SER B CB  1 
ATOM   4985  O  OG  . SER B 1 177 ? -5.679  4.307   -8.154  1.00 61.41 ? 191 SER B OG  1 
ATOM   4986  N  N   . THR B 1 178 ? -4.569  7.856   -8.795  1.00 53.67 ? 192 THR B N   1 
ATOM   4987  C  CA  . THR B 1 178 ? -3.195  8.299   -8.633  1.00 52.06 ? 192 THR B CA  1 
ATOM   4988  C  C   . THR B 1 178 ? -2.831  8.090   -7.172  1.00 52.62 ? 192 THR B C   1 
ATOM   4989  O  O   . THR B 1 178 ? -3.435  8.697   -6.288  1.00 53.62 ? 192 THR B O   1 
ATOM   4990  C  CB  . THR B 1 178 ? -3.051  9.796   -8.969  1.00 54.32 ? 192 THR B CB  1 
ATOM   4991  O  OG1 . THR B 1 178 ? -3.315  10.004  -10.360 1.00 65.06 ? 192 THR B OG1 1 
ATOM   4992  C  CG2 . THR B 1 178 ? -1.655  10.296  -8.640  1.00 58.96 ? 192 THR B CG2 1 
ATOM   4993  N  N   . ASN B 1 179 ? -1.864  7.222   -6.905  1.00 53.26 ? 193 ASN B N   1 
ATOM   4994  C  CA  . ASN B 1 179 ? -1.447  6.972   -5.528  1.00 49.99 ? 193 ASN B CA  1 
ATOM   4995  C  C   . ASN B 1 179 ? -0.047  7.511   -5.240  1.00 49.68 ? 193 ASN B C   1 
ATOM   4996  O  O   . ASN B 1 179 ? 0.786   7.626   -6.141  1.00 56.44 ? 193 ASN B O   1 
ATOM   4997  C  CB  . ASN B 1 179 ? -1.520  5.478   -5.205  1.00 54.70 ? 193 ASN B CB  1 
ATOM   4998  C  CG  . ASN B 1 179 ? -2.843  4.854   -5.626  1.00 63.69 ? 193 ASN B CG  1 
ATOM   4999  O  OD1 . ASN B 1 179 ? -3.892  5.499   -5.577  1.00 67.23 ? 193 ASN B OD1 1 
ATOM   5000  N  ND2 . ASN B 1 179 ? -2.796  3.595   -6.048  1.00 65.40 ? 193 ASN B ND2 1 
ATOM   5001  N  N   . SER B 1 180 ? 0.201   7.846   -3.981  1.00 39.22 ? 194 SER B N   1 
ATOM   5002  C  CA  . SER B 1 180 ? 1.516   8.313   -3.557  1.00 41.08 ? 194 SER B CA  1 
ATOM   5003  C  C   . SER B 1 180 ? 1.661   8.145   -2.056  1.00 36.55 ? 194 SER B C   1 
ATOM   5004  O  O   . SER B 1 180 ? 0.663   8.044   -1.337  1.00 36.76 ? 194 SER B O   1 
ATOM   5005  C  CB  . SER B 1 180 ? 1.709   9.777   -3.940  1.00 47.23 ? 194 SER B CB  1 
ATOM   5006  O  OG  . SER B 1 180 ? 0.672   10.575  -3.405  1.00 51.86 ? 194 SER B OG  1 
ATOM   5007  N  N   . THR B 1 181 ? 2.905   8.111   -1.584  1.00 35.45 ? 195 THR B N   1 
ATOM   5008  C  CA  . THR B 1 181 ? 3.175   8.021   -0.165  1.00 32.56 ? 195 THR B CA  1 
ATOM   5009  C  C   . THR B 1 181 ? 3.926   9.267   0.288   1.00 36.02 ? 195 THR B C   1 
ATOM   5010  O  O   . THR B 1 181 ? 4.894   9.680   -0.342  1.00 35.00 ? 195 THR B O   1 
ATOM   5011  C  CB  . THR B 1 181 ? 4.023   6.790   0.164   1.00 35.34 ? 195 THR B CB  1 
ATOM   5012  O  OG1 . THR B 1 181 ? 3.410   5.625   -0.392  1.00 34.47 ? 195 THR B OG1 1 
ATOM   5013  C  CG2 . THR B 1 181 ? 4.158   6.623   1.659   1.00 36.25 ? 195 THR B CG2 1 
ATOM   5014  N  N   . VAL B 1 182 ? 3.467   9.861   1.380   1.00 34.34 ? 196 VAL B N   1 
ATOM   5015  C  CA  . VAL B 1 182 ? 4.101   11.044  1.939   1.00 30.23 ? 196 VAL B CA  1 
ATOM   5016  C  C   . VAL B 1 182 ? 4.731   10.667  3.269   1.00 33.12 ? 196 VAL B C   1 
ATOM   5017  O  O   . VAL B 1 182 ? 4.063   10.151  4.168   1.00 32.79 ? 196 VAL B O   1 
ATOM   5018  C  CB  . VAL B 1 182 ? 3.077   12.164  2.150   1.00 34.02 ? 196 VAL B CB  1 
ATOM   5019  C  CG1 . VAL B 1 182 ? 3.664   13.265  3.013   1.00 36.42 ? 196 VAL B CG1 1 
ATOM   5020  C  CG2 . VAL B 1 182 ? 2.610   12.701  0.808   1.00 38.80 ? 196 VAL B CG2 1 
ATOM   5021  N  N   . TYR B 1 183 ? 6.026   10.908  3.403   1.00 30.53 ? 197 TYR B N   1 
ATOM   5022  C  CA  . TYR B 1 183 ? 6.712   10.473  4.601   1.00 23.90 ? 197 TYR B CA  1 
ATOM   5023  C  C   . TYR B 1 183 ? 6.748   11.619  5.604   1.00 28.36 ? 197 TYR B C   1 
ATOM   5024  O  O   . TYR B 1 183 ? 7.656   12.431  5.601   1.00 29.18 ? 197 TYR B O   1 
ATOM   5025  C  CB  . TYR B 1 183 ? 8.095   9.912   4.249   1.00 29.00 ? 197 TYR B CB  1 
ATOM   5026  C  CG  . TYR B 1 183 ? 8.003   8.681   3.367   1.00 30.59 ? 197 TYR B CG  1 
ATOM   5027  C  CD1 . TYR B 1 183 ? 7.860   7.411   3.920   1.00 31.62 ? 197 TYR B CD1 1 
ATOM   5028  C  CD2 . TYR B 1 183 ? 8.026   8.789   1.980   1.00 32.87 ? 197 TYR B CD2 1 
ATOM   5029  C  CE1 . TYR B 1 183 ? 7.758   6.281   3.116   1.00 33.05 ? 197 TYR B CE1 1 
ATOM   5030  C  CE2 . TYR B 1 183 ? 7.929   7.661   1.165   1.00 36.61 ? 197 TYR B CE2 1 
ATOM   5031  C  CZ  . TYR B 1 183 ? 7.793   6.412   1.740   1.00 35.52 ? 197 TYR B CZ  1 
ATOM   5032  O  OH  . TYR B 1 183 ? 7.693   5.289   0.938   1.00 41.25 ? 197 TYR B OH  1 
ATOM   5033  N  N   . ARG B 1 184 ? 5.719   11.676  6.440   1.00 27.94 ? 198 ARG B N   1 
ATOM   5034  C  CA  . ARG B 1 184 ? 5.525   12.761  7.391   1.00 29.84 ? 198 ARG B CA  1 
ATOM   5035  C  C   . ARG B 1 184 ? 6.474   12.619  8.564   1.00 29.97 ? 198 ARG B C   1 
ATOM   5036  O  O   . ARG B 1 184 ? 6.715   11.514  9.040   1.00 25.15 ? 198 ARG B O   1 
ATOM   5037  C  CB  . ARG B 1 184 ? 4.102   12.708  7.964   1.00 30.59 ? 198 ARG B CB  1 
ATOM   5038  C  CG  . ARG B 1 184 ? 2.956   12.795  6.946   1.00 27.75 ? 198 ARG B CG  1 
ATOM   5039  C  CD  . ARG B 1 184 ? 1.614   12.575  7.637   1.00 31.02 ? 198 ARG B CD  1 
ATOM   5040  N  NE  . ARG B 1 184 ? 1.498   11.237  8.221   1.00 31.19 ? 198 ARG B NE  1 
ATOM   5041  C  CZ  . ARG B 1 184 ? 0.387   10.741  8.763   1.00 26.11 ? 198 ARG B CZ  1 
ATOM   5042  N  NH1 . ARG B 1 184 ? -0.730  11.469  8.794   1.00 27.79 ? 198 ARG B NH1 1 
ATOM   5043  N  NH2 . ARG B 1 184 ? 0.388   9.513   9.272   1.00 23.34 ? 198 ARG B NH2 1 
ATOM   5044  N  N   . GLY B 1 185 ? 6.974   13.741  9.063   1.00 30.67 ? 199 GLY B N   1 
ATOM   5045  C  CA  . GLY B 1 185 ? 7.627   13.756  10.360  1.00 27.90 ? 199 GLY B CA  1 
ATOM   5046  C  C   . GLY B 1 185 ? 6.555   13.514  11.408  1.00 27.73 ? 199 GLY B C   1 
ATOM   5047  O  O   . GLY B 1 185 ? 5.368   13.638  11.112  1.00 29.49 ? 199 GLY B O   1 
ATOM   5048  N  N   . LEU B 1 186 ? 6.957   13.181  12.629  1.00 24.83 ? 200 LEU B N   1 
ATOM   5049  C  CA  . LEU B 1 186 ? 5.989   12.912  13.695  1.00 29.22 ? 200 LEU B CA  1 
ATOM   5050  C  C   . LEU B 1 186 ? 5.413   14.217  14.254  1.00 30.81 ? 200 LEU B C   1 
ATOM   5051  O  O   . LEU B 1 186 ? 6.088   15.247  14.259  1.00 26.13 ? 200 LEU B O   1 
ATOM   5052  C  CB  . LEU B 1 186 ? 6.640   12.100  14.817  1.00 24.01 ? 200 LEU B CB  1 
ATOM   5053  C  CG  . LEU B 1 186 ? 7.371   10.817  14.426  1.00 28.22 ? 200 LEU B CG  1 
ATOM   5054  C  CD1 . LEU B 1 186 ? 7.728   10.056  15.688  1.00 25.49 ? 200 LEU B CD1 1 
ATOM   5055  C  CD2 . LEU B 1 186 ? 6.519   9.950   13.482  1.00 26.81 ? 200 LEU B CD2 1 
ATOM   5056  N  N   . GLU B 1 187 ? 4.168   14.176  14.720  1.00 21.04 ? 201 GLU B N   1 
ATOM   5057  C  CA  . GLU B 1 187 ? 3.499   15.395  15.165  1.00 23.85 ? 201 GLU B CA  1 
ATOM   5058  C  C   . GLU B 1 187 ? 3.758   15.622  16.645  1.00 23.37 ? 201 GLU B C   1 
ATOM   5059  O  O   . GLU B 1 187 ? 3.227   14.907  17.487  1.00 27.35 ? 201 GLU B O   1 
ATOM   5060  C  CB  . GLU B 1 187 ? 1.986   15.327  14.891  1.00 31.48 ? 201 GLU B CB  1 
ATOM   5061  C  CG  . GLU B 1 187 ? 1.264   16.638  15.170  1.00 28.10 ? 201 GLU B CG  1 
ATOM   5062  C  CD  . GLU B 1 187 ? -0.255  16.538  15.015  1.00 33.00 ? 201 GLU B CD  1 
ATOM   5063  O  OE1 . GLU B 1 187 ? -0.787  15.416  14.933  1.00 29.75 ? 201 GLU B OE1 1 
ATOM   5064  O  OE2 . GLU B 1 187 ? -0.913  17.590  14.994  1.00 43.51 ? 201 GLU B OE2 1 
ATOM   5065  N  N   . GLY B 1 188 ? 4.585   16.623  16.949  1.00 27.10 ? 202 GLY B N   1 
ATOM   5066  C  CA  . GLY B 1 188 ? 5.031   16.892  18.309  1.00 27.55 ? 202 GLY B CA  1 
ATOM   5067  C  C   . GLY B 1 188 ? 6.510   17.248  18.319  1.00 23.30 ? 202 GLY B C   1 
ATOM   5068  O  O   . GLY B 1 188 ? 7.034   17.732  17.318  1.00 27.94 ? 202 GLY B O   1 
ATOM   5069  N  N   . PHE B 1 189 ? 7.199   17.004  19.432  1.00 24.55 ? 203 PHE B N   1 
ATOM   5070  C  CA  . PHE B 1 189 ? 8.647   17.176  19.450  1.00 20.60 ? 203 PHE B CA  1 
ATOM   5071  C  C   . PHE B 1 189 ? 9.303   15.892  19.936  1.00 22.63 ? 203 PHE B C   1 
ATOM   5072  O  O   . PHE B 1 189 ? 8.724   15.155  20.717  1.00 23.08 ? 203 PHE B O   1 
ATOM   5073  C  CB  . PHE B 1 189 ? 9.080   18.360  20.341  1.00 29.01 ? 203 PHE B CB  1 
ATOM   5074  C  CG  . PHE B 1 189 ? 9.015   18.066  21.813  1.00 28.44 ? 203 PHE B CG  1 
ATOM   5075  C  CD1 . PHE B 1 189 ? 7.828   18.239  22.516  1.00 21.13 ? 203 PHE B CD1 1 
ATOM   5076  C  CD2 . PHE B 1 189 ? 10.142  17.590  22.494  1.00 24.04 ? 203 PHE B CD2 1 
ATOM   5077  C  CE1 . PHE B 1 189 ? 7.755   17.944  23.880  1.00 23.26 ? 203 PHE B CE1 1 
ATOM   5078  C  CE2 . PHE B 1 189 ? 10.078  17.286  23.855  1.00 21.22 ? 203 PHE B CE2 1 
ATOM   5079  C  CZ  . PHE B 1 189 ? 8.889   17.463  24.553  1.00 21.80 ? 203 PHE B CZ  1 
ATOM   5080  N  N   . VAL B 1 190 ? 10.523  15.653  19.476  1.00 19.11 ? 204 VAL B N   1 
ATOM   5081  C  CA  . VAL B 1 190 ? 11.294  14.497  19.894  1.00 20.17 ? 204 VAL B CA  1 
ATOM   5082  C  C   . VAL B 1 190 ? 12.328  14.920  20.935  1.00 23.58 ? 204 VAL B C   1 
ATOM   5083  O  O   . VAL B 1 190 ? 12.999  15.935  20.772  1.00 20.82 ? 204 VAL B O   1 
ATOM   5084  C  CB  . VAL B 1 190 ? 12.014  13.864  18.686  1.00 21.15 ? 204 VAL B CB  1 
ATOM   5085  C  CG1 . VAL B 1 190 ? 12.875  12.682  19.128  1.00 23.68 ? 204 VAL B CG1 1 
ATOM   5086  C  CG2 . VAL B 1 190 ? 10.994  13.422  17.619  1.00 16.52 ? 204 VAL B CG2 1 
ATOM   5087  N  N   . ALA B 1 191 ? 12.451  14.148  22.009  1.00 21.09 ? 205 ALA B N   1 
ATOM   5088  C  CA  . ALA B 1 191 ? 13.482  14.411  23.004  1.00 24.11 ? 205 ALA B CA  1 
ATOM   5089  C  C   . ALA B 1 191 ? 14.702  13.507  22.775  1.00 23.84 ? 205 ALA B C   1 
ATOM   5090  O  O   . ALA B 1 191 ? 14.594  12.289  22.825  1.00 19.76 ? 205 ALA B O   1 
ATOM   5091  C  CB  . ALA B 1 191 ? 12.921  14.214  24.408  1.00 23.10 ? 205 ALA B CB  1 
ATOM   5092  N  N   . ALA B 1 192 ? 15.866  14.100  22.527  1.00 22.36 ? 206 ALA B N   1 
ATOM   5093  C  CA  . ALA B 1 192 ? 17.069  13.295  22.331  1.00 19.66 ? 206 ALA B CA  1 
ATOM   5094  C  C   . ALA B 1 192 ? 17.919  13.345  23.584  1.00 21.08 ? 206 ALA B C   1 
ATOM   5095  O  O   . ALA B 1 192 ? 18.352  14.422  24.021  1.00 20.93 ? 206 ALA B O   1 
ATOM   5096  C  CB  . ALA B 1 192 ? 17.856  13.780  21.113  1.00 15.26 ? 206 ALA B CB  1 
ATOM   5097  N  N   . ILE B 1 193 ? 18.176  12.175  24.154  1.00 22.94 ? 207 ILE B N   1 
ATOM   5098  C  CA  . ILE B 1 193 ? 18.735  12.099  25.498  1.00 19.61 ? 207 ILE B CA  1 
ATOM   5099  C  C   . ILE B 1 193 ? 19.977  11.227  25.582  1.00 27.84 ? 207 ILE B C   1 
ATOM   5100  O  O   . ILE B 1 193 ? 19.943  10.060  25.205  1.00 24.37 ? 207 ILE B O   1 
ATOM   5101  C  CB  . ILE B 1 193 ? 17.679  11.541  26.500  1.00 28.57 ? 207 ILE B CB  1 
ATOM   5102  C  CG1 . ILE B 1 193 ? 16.501  12.506  26.641  1.00 24.36 ? 207 ILE B CG1 1 
ATOM   5103  C  CG2 . ILE B 1 193 ? 18.311  11.237  27.867  1.00 28.42 ? 207 ILE B CG2 1 
ATOM   5104  C  CD1 . ILE B 1 193 ? 15.366  11.973  27.529  1.00 28.00 ? 207 ILE B CD1 1 
ATOM   5105  N  N   . SER B 1 194 ? 21.073  11.793  26.086  1.00 28.79 ? 208 SER B N   1 
ATOM   5106  C  CA  . SER B 1 194 ? 22.213  10.974  26.520  1.00 32.06 ? 208 SER B CA  1 
ATOM   5107  C  C   . SER B 1 194 ? 22.626  11.330  27.957  1.00 35.46 ? 208 SER B C   1 
ATOM   5108  O  O   . SER B 1 194 ? 22.494  12.496  28.379  1.00 39.11 ? 208 SER B O   1 
ATOM   5109  C  CB  . SER B 1 194 ? 23.385  11.110  25.551  1.00 32.95 ? 208 SER B CB  1 
ATOM   5110  O  OG  . SER B 1 194 ? 23.834  12.450  25.514  1.00 37.43 ? 208 SER B OG  1 
ATOM   5111  N  N   . PRO B 1 195 ? 23.120  10.330  28.718  1.00 41.35 ? 209 PRO B N   1 
ATOM   5112  C  CA  . PRO B 1 195 ? 23.436  10.485  30.147  1.00 41.20 ? 209 PRO B CA  1 
ATOM   5113  C  C   . PRO B 1 195 ? 24.423  11.615  30.410  1.00 38.91 ? 209 PRO B C   1 
ATOM   5114  O  O   . PRO B 1 195 ? 25.238  11.914  29.539  1.00 33.41 ? 209 PRO B O   1 
ATOM   5115  C  CB  . PRO B 1 195 ? 24.096  9.147   30.506  1.00 45.70 ? 209 PRO B CB  1 
ATOM   5116  C  CG  . PRO B 1 195 ? 23.604  8.187   29.489  1.00 43.52 ? 209 PRO B CG  1 
ATOM   5117  C  CD  . PRO B 1 195 ? 23.455  8.980   28.231  1.00 41.78 ? 209 PRO B CD  1 
ATOM   5118  N  N   . PHE B 1 196 ? 24.361  12.209  31.600  1.00 38.39 ? 210 PHE B N   1 
ATOM   5119  C  CA  . PHE B 1 196 ? 25.231  13.328  31.962  1.00 35.95 ? 210 PHE B CA  1 
ATOM   5120  C  C   . PHE B 1 196 ? 26.714  13.000  31.770  1.00 44.47 ? 210 PHE B C   1 
ATOM   5121  O  O   . PHE B 1 196 ? 27.500  13.868  31.395  1.00 44.16 ? 210 PHE B O   1 
ATOM   5122  C  CB  . PHE B 1 196 ? 24.985  13.754  33.414  1.00 38.72 ? 210 PHE B CB  1 
ATOM   5123  N  N   . ASN B 1 197 ? 27.104  11.756  32.029  1.00 41.34 ? 211 ASN B N   1 
ATOM   5124  C  CA  . ASN B 1 197 ? 28.508  11.389  31.872  1.00 45.15 ? 211 ASN B CA  1 
ATOM   5125  C  C   . ASN B 1 197 ? 28.762  10.364  30.765  1.00 45.04 ? 211 ASN B C   1 
ATOM   5126  O  O   . ASN B 1 197 ? 29.701  9.572   30.845  1.00 45.22 ? 211 ASN B O   1 
ATOM   5127  C  CB  . ASN B 1 197 ? 29.136  10.956  33.210  1.00 46.59 ? 211 ASN B CB  1 
ATOM   5128  C  CG  . ASN B 1 197 ? 28.536  9.671   33.759  1.00 50.95 ? 211 ASN B CG  1 
ATOM   5129  O  OD1 . ASN B 1 197 ? 27.411  9.298   33.417  1.00 47.01 ? 211 ASN B OD1 1 
ATOM   5130  N  ND2 . ASN B 1 197 ? 29.290  8.987   34.621  1.00 50.23 ? 211 ASN B ND2 1 
ATOM   5131  N  N   . PHE B 1 198 ? 27.932  10.401  29.725  1.00 36.44 ? 212 PHE B N   1 
ATOM   5132  C  CA  . PHE B 1 198 ? 28.116  9.522   28.580  1.00 38.23 ? 212 PHE B CA  1 
ATOM   5133  C  C   . PHE B 1 198 ? 29.376  9.873   27.790  1.00 39.39 ? 212 PHE B C   1 
ATOM   5134  O  O   . PHE B 1 198 ? 29.821  11.033  27.754  1.00 35.25 ? 212 PHE B O   1 
ATOM   5135  C  CB  . PHE B 1 198 ? 26.882  9.518   27.666  1.00 37.95 ? 212 PHE B CB  1 
ATOM   5136  N  N   . THR B 1 199 ? 29.942  8.852   27.158  1.00 38.25 ? 213 THR B N   1 
ATOM   5137  C  CA  . THR B 1 199 ? 31.210  8.976   26.464  1.00 42.69 ? 213 THR B CA  1 
ATOM   5138  C  C   . THR B 1 199 ? 31.053  9.307   24.974  1.00 46.77 ? 213 THR B C   1 
ATOM   5139  O  O   . THR B 1 199 ? 32.035  9.264   24.225  1.00 53.84 ? 213 THR B O   1 
ATOM   5140  C  CB  . THR B 1 199 ? 32.042  7.677   26.613  1.00 47.03 ? 213 THR B CB  1 
ATOM   5141  N  N   . ALA B 1 200 ? 29.839  9.656   24.543  1.00 41.18 ? 214 ALA B N   1 
ATOM   5142  C  CA  . ALA B 1 200 ? 29.590  9.920   23.118  1.00 32.43 ? 214 ALA B CA  1 
ATOM   5143  C  C   . ALA B 1 200 ? 28.754  11.179  22.900  1.00 30.43 ? 214 ALA B C   1 
ATOM   5144  O  O   . ALA B 1 200 ? 27.912  11.516  23.730  1.00 30.59 ? 214 ALA B O   1 
ATOM   5145  C  CB  . ALA B 1 200 ? 28.904  8.713   22.470  1.00 31.54 ? 214 ALA B CB  1 
ATOM   5146  N  N   . ILE B 1 201 ? 28.986  11.876  21.789  1.00 25.68 ? 215 ILE B N   1 
ATOM   5147  C  CA  . ILE B 1 201 ? 28.164  13.050  21.453  1.00 24.85 ? 215 ILE B CA  1 
ATOM   5148  C  C   . ILE B 1 201 ? 26.724  12.576  21.187  1.00 25.24 ? 215 ILE B C   1 
ATOM   5149  O  O   . ILE B 1 201 ? 25.747  13.229  21.572  1.00 25.66 ? 215 ILE B O   1 
ATOM   5150  C  CB  . ILE B 1 201 ? 28.698  13.774  20.208  1.00 23.41 ? 215 ILE B CB  1 
ATOM   5151  C  CG1 . ILE B 1 201 ? 30.120  14.292  20.448  1.00 25.83 ? 215 ILE B CG1 1 
ATOM   5152  C  CG2 . ILE B 1 201 ? 27.773  14.932  19.795  1.00 24.90 ? 215 ILE B CG2 1 
ATOM   5153  C  CD1 . ILE B 1 201 ? 30.841  14.683  19.155  1.00 25.76 ? 215 ILE B CD1 1 
ATOM   5154  N  N   . GLY B 1 202 ? 26.607  11.417  20.551  1.00 25.55 ? 216 GLY B N   1 
ATOM   5155  C  CA  . GLY B 1 202 ? 25.309  10.899  20.156  1.00 30.27 ? 216 GLY B CA  1 
ATOM   5156  C  C   . GLY B 1 202 ? 24.602  11.838  19.190  1.00 34.62 ? 216 GLY B C   1 
ATOM   5157  O  O   . GLY B 1 202 ? 23.389  12.022  19.277  1.00 36.34 ? 216 GLY B O   1 
ATOM   5158  N  N   . GLY B 1 203 ? 25.363  12.439  18.273  1.00 37.30 ? 217 GLY B N   1 
ATOM   5159  C  CA  . GLY B 1 203 ? 24.809  13.350  17.278  1.00 32.87 ? 217 GLY B CA  1 
ATOM   5160  C  C   . GLY B 1 203 ? 23.633  12.777  16.496  1.00 29.94 ? 217 GLY B C   1 
ATOM   5161  O  O   . GLY B 1 203 ? 22.703  13.507  16.148  1.00 28.43 ? 217 GLY B O   1 
ATOM   5162  N  N   . ASN B 1 204 ? 23.666  11.471  16.226  1.00 26.23 ? 218 ASN B N   1 
ATOM   5163  C  CA  . ASN B 1 204 ? 22.575  10.823  15.498  1.00 25.53 ? 218 ASN B CA  1 
ATOM   5164  C  C   . ASN B 1 204 ? 21.255  10.841  16.269  1.00 23.62 ? 218 ASN B C   1 
ATOM   5165  O  O   . ASN B 1 204 ? 20.176  10.774  15.663  1.00 19.32 ? 218 ASN B O   1 
ATOM   5166  C  CB  . ASN B 1 204 ? 22.933  9.387   15.093  1.00 28.04 ? 218 ASN B CB  1 
ATOM   5167  C  CG  . ASN B 1 204 ? 22.038  8.858   13.961  1.00 24.95 ? 218 ASN B CG  1 
ATOM   5168  O  OD1 . ASN B 1 204 ? 21.923  9.475   12.899  1.00 20.73 ? 218 ASN B OD1 1 
ATOM   5169  N  ND2 . ASN B 1 204 ? 21.391  7.729   14.198  1.00 18.99 ? 218 ASN B ND2 1 
ATOM   5170  N  N   . LEU B 1 205 ? 21.342  10.935  17.598  1.00 22.58 ? 219 LEU B N   1 
ATOM   5171  C  CA  . LEU B 1 205 ? 20.147  11.001  18.439  1.00 22.78 ? 219 LEU B CA  1 
ATOM   5172  C  C   . LEU B 1 205 ? 19.263  12.183  18.063  1.00 23.45 ? 219 LEU B C   1 
ATOM   5173  O  O   . LEU B 1 205 ? 18.060  12.040  18.049  1.00 18.92 ? 219 LEU B O   1 
ATOM   5174  C  CB  . LEU B 1 205 ? 20.477  11.060  19.934  1.00 24.68 ? 219 LEU B CB  1 
ATOM   5175  C  CG  . LEU B 1 205 ? 21.038  9.795   20.583  1.00 26.74 ? 219 LEU B CG  1 
ATOM   5176  C  CD1 . LEU B 1 205 ? 21.238  9.992   22.088  1.00 23.19 ? 219 LEU B CD1 1 
ATOM   5177  C  CD2 . LEU B 1 205 ? 20.164  8.555   20.272  1.00 26.09 ? 219 LEU B CD2 1 
ATOM   5178  N  N   . ALA B 1 206 ? 19.864  13.332  17.759  1.00 19.14 ? 220 ALA B N   1 
ATOM   5179  C  CA  . ALA B 1 206 ? 19.086  14.489  17.320  1.00 22.86 ? 220 ALA B CA  1 
ATOM   5180  C  C   . ALA B 1 206 ? 19.059  14.572  15.800  1.00 21.18 ? 220 ALA B C   1 
ATOM   5181  O  O   . ALA B 1 206 ? 18.078  14.999  15.210  1.00 23.13 ? 220 ALA B O   1 
ATOM   5182  C  CB  . ALA B 1 206 ? 19.648  15.794  17.920  1.00 22.46 ? 220 ALA B CB  1 
ATOM   5183  N  N   . GLY B 1 207 ? 20.150  14.152  15.173  1.00 26.43 ? 221 GLY B N   1 
ATOM   5184  C  CA  . GLY B 1 207 ? 20.300  14.237  13.732  1.00 21.11 ? 221 GLY B CA  1 
ATOM   5185  C  C   . GLY B 1 207 ? 19.321  13.406  12.927  1.00 22.82 ? 221 GLY B C   1 
ATOM   5186  O  O   . GLY B 1 207 ? 18.744  13.907  11.962  1.00 26.25 ? 221 GLY B O   1 
ATOM   5187  N  N   . ALA B 1 208 ? 19.140  12.137  13.292  1.00 24.38 ? 222 ALA B N   1 
ATOM   5188  C  CA  . ALA B 1 208 ? 18.201  11.288  12.553  1.00 21.19 ? 222 ALA B CA  1 
ATOM   5189  C  C   . ALA B 1 208 ? 16.746  11.795  12.592  1.00 21.39 ? 222 ALA B C   1 
ATOM   5190  O  O   . ALA B 1 208 ? 16.149  11.988  11.537  1.00 24.04 ? 222 ALA B O   1 
ATOM   5191  C  CB  . ALA B 1 208 ? 18.316  9.786   12.962  1.00 16.59 ? 222 ALA B CB  1 
ATOM   5192  N  N   . PRO B 1 209 ? 16.171  12.016  13.791  1.00 22.21 ? 223 PRO B N   1 
ATOM   5193  C  CA  . PRO B 1 209 ? 14.820  12.594  13.782  1.00 25.27 ? 223 PRO B CA  1 
ATOM   5194  C  C   . PRO B 1 209 ? 14.717  13.930  13.051  1.00 22.98 ? 223 PRO B C   1 
ATOM   5195  O  O   . PRO B 1 209 ? 13.761  14.079  12.288  1.00 21.41 ? 223 PRO B O   1 
ATOM   5196  C  CB  . PRO B 1 209 ? 14.469  12.763  15.269  1.00 23.43 ? 223 PRO B CB  1 
ATOM   5197  C  CG  . PRO B 1 209 ? 15.733  12.490  16.023  1.00 31.62 ? 223 PRO B CG  1 
ATOM   5198  C  CD  . PRO B 1 209 ? 16.606  11.656  15.149  1.00 21.75 ? 223 PRO B CD  1 
ATOM   5199  N  N   . ALA B 1 210 ? 15.673  14.847  13.241  1.00 24.43 ? 224 ALA B N   1 
ATOM   5200  C  CA  . ALA B 1 210 ? 15.634  16.141  12.553  1.00 25.47 ? 224 ALA B CA  1 
ATOM   5201  C  C   . ALA B 1 210 ? 15.558  15.966  11.034  1.00 27.40 ? 224 ALA B C   1 
ATOM   5202  O  O   . ALA B 1 210 ? 14.728  16.584  10.364  1.00 23.23 ? 224 ALA B O   1 
ATOM   5203  C  CB  . ALA B 1 210 ? 16.862  17.031  12.948  1.00 18.54 ? 224 ALA B CB  1 
ATOM   5204  N  N   . LEU B 1 211 ? 16.418  15.103  10.503  1.00 19.51 ? 225 LEU B N   1 
ATOM   5205  C  CA  . LEU B 1 211 ? 16.465  14.842  9.074   1.00 20.07 ? 225 LEU B CA  1 
ATOM   5206  C  C   . LEU B 1 211 ? 15.103  14.412  8.521   1.00 23.04 ? 225 LEU B C   1 
ATOM   5207  O  O   . LEU B 1 211 ? 14.748  14.755  7.393   1.00 22.10 ? 225 LEU B O   1 
ATOM   5208  C  CB  . LEU B 1 211 ? 17.513  13.770  8.762   1.00 22.46 ? 225 LEU B CB  1 
ATOM   5209  C  CG  . LEU B 1 211 ? 17.536  13.301  7.308   1.00 31.97 ? 225 LEU B CG  1 
ATOM   5210  C  CD1 . LEU B 1 211 ? 18.062  14.388  6.363   1.00 27.64 ? 225 LEU B CD1 1 
ATOM   5211  C  CD2 . LEU B 1 211 ? 18.335  12.022  7.175   1.00 31.43 ? 225 LEU B CD2 1 
ATOM   5212  N  N   . MET B 1 212 ? 14.341  13.686  9.338   1.00 21.92 ? 226 MET B N   1 
ATOM   5213  C  CA  . MET B 1 212 ? 13.076  13.102  8.912   1.00 23.49 ? 226 MET B CA  1 
ATOM   5214  C  C   . MET B 1 212 ? 11.897  14.052  9.128   1.00 21.74 ? 226 MET B C   1 
ATOM   5215  O  O   . MET B 1 212 ? 10.756  13.625  9.135   1.00 23.40 ? 226 MET B O   1 
ATOM   5216  C  CB  . MET B 1 212 ? 12.836  11.777  9.645   1.00 23.75 ? 226 MET B CB  1 
ATOM   5217  C  CG  . MET B 1 212 ? 13.971  10.785  9.466   1.00 22.86 ? 226 MET B CG  1 
ATOM   5218  S  SD  . MET B 1 212 ? 14.187  10.339  7.726   1.00 29.06 ? 226 MET B SD  1 
ATOM   5219  C  CE  . MET B 1 212 ? 12.682  9.435   7.419   1.00 28.24 ? 226 MET B CE  1 
ATOM   5220  N  N   . GLY B 1 213 ? 12.184  15.337  9.321   1.00 27.69 ? 227 GLY B N   1 
ATOM   5221  C  CA  . GLY B 1 213 ? 11.142  16.345  9.428   1.00 26.31 ? 227 GLY B CA  1 
ATOM   5222  C  C   . GLY B 1 213 ? 10.635  16.604  10.834  1.00 26.61 ? 227 GLY B C   1 
ATOM   5223  O  O   . GLY B 1 213 ? 9.633   17.296  11.030  1.00 23.51 ? 227 GLY B O   1 
ATOM   5224  N  N   . ASN B 1 214 ? 11.324  16.059  11.827  1.00 22.53 ? 228 ASN B N   1 
ATOM   5225  C  CA  . ASN B 1 214 ? 10.950  16.310  13.221  1.00 23.54 ? 228 ASN B CA  1 
ATOM   5226  C  C   . ASN B 1 214 ? 11.643  17.514  13.822  1.00 19.17 ? 228 ASN B C   1 
ATOM   5227  O  O   . ASN B 1 214 ? 12.639  17.977  13.295  1.00 22.55 ? 228 ASN B O   1 
ATOM   5228  C  CB  . ASN B 1 214 ? 11.267  15.084  14.065  1.00 20.18 ? 228 ASN B CB  1 
ATOM   5229  C  CG  . ASN B 1 214 ? 10.496  13.878  13.604  1.00 24.34 ? 228 ASN B CG  1 
ATOM   5230  O  OD1 . ASN B 1 214 ? 9.312   13.756  13.903  1.00 21.69 ? 228 ASN B OD1 1 
ATOM   5231  N  ND2 . ASN B 1 214 ? 11.145  13.006  12.825  1.00 17.74 ? 228 ASN B ND2 1 
ATOM   5232  N  N   . VAL B 1 215 ? 11.112  18.002  14.935  1.00 24.07 ? 229 VAL B N   1 
ATOM   5233  C  CA  . VAL B 1 215 ? 11.828  18.964  15.760  1.00 28.49 ? 229 VAL B CA  1 
ATOM   5234  C  C   . VAL B 1 215 ? 12.273  18.287  17.057  1.00 24.96 ? 229 VAL B C   1 
ATOM   5235  O  O   . VAL B 1 215 ? 11.619  17.354  17.555  1.00 22.84 ? 229 VAL B O   1 
ATOM   5236  C  CB  . VAL B 1 215 ? 10.986  20.219  16.067  1.00 31.07 ? 229 VAL B CB  1 
ATOM   5237  C  CG1 . VAL B 1 215 ? 10.684  20.990  14.768  1.00 27.10 ? 229 VAL B CG1 1 
ATOM   5238  C  CG2 . VAL B 1 215 ? 9.705   19.832  16.802  1.00 30.90 ? 229 VAL B CG2 1 
ATOM   5239  N  N   . VAL B 1 216 ? 13.397  18.761  17.585  1.00 23.12 ? 230 VAL B N   1 
ATOM   5240  C  CA  . VAL B 1 216 ? 14.101  18.078  18.658  1.00 23.58 ? 230 VAL B CA  1 
ATOM   5241  C  C   . VAL B 1 216 ? 14.561  18.997  19.796  1.00 17.98 ? 230 VAL B C   1 
ATOM   5242  O  O   . VAL B 1 216 ? 15.129  20.083  19.558  1.00 23.44 ? 230 VAL B O   1 
ATOM   5243  C  CB  . VAL B 1 216 ? 15.367  17.366  18.107  1.00 24.42 ? 230 VAL B CB  1 
ATOM   5244  C  CG1 . VAL B 1 216 ? 16.101  16.623  19.222  1.00 22.29 ? 230 VAL B CG1 1 
ATOM   5245  C  CG2 . VAL B 1 216 ? 15.021  16.434  16.937  1.00 25.98 ? 230 VAL B CG2 1 
ATOM   5246  N  N   . LEU B 1 217 ? 14.312  18.557  21.030  1.00 21.27 ? 231 LEU B N   1 
ATOM   5247  C  CA  . LEU B 1 217 ? 15.005  19.091  22.202  1.00 20.87 ? 231 LEU B CA  1 
ATOM   5248  C  C   . LEU B 1 217 ? 16.144  18.145  22.531  1.00 26.38 ? 231 LEU B C   1 
ATOM   5249  O  O   . LEU B 1 217 ? 15.922  16.985  22.896  1.00 21.95 ? 231 LEU B O   1 
ATOM   5250  C  CB  . LEU B 1 217 ? 14.081  19.185  23.411  1.00 20.87 ? 231 LEU B CB  1 
ATOM   5251  C  CG  . LEU B 1 217 ? 13.399  20.536  23.637  1.00 22.35 ? 231 LEU B CG  1 
ATOM   5252  C  CD1 . LEU B 1 217 ? 12.403  20.818  22.523  1.00 24.02 ? 231 LEU B CD1 1 
ATOM   5253  C  CD2 . LEU B 1 217 ? 12.726  20.548  24.991  1.00 22.04 ? 231 LEU B CD2 1 
ATOM   5254  N  N   . TRP B 1 218 ? 17.367  18.635  22.393  1.00 23.97 ? 232 TRP B N   1 
ATOM   5255  C  CA  . TRP B 1 218 ? 18.525  17.786  22.569  1.00 19.15 ? 232 TRP B CA  1 
ATOM   5256  C  C   . TRP B 1 218 ? 19.191  18.095  23.908  1.00 20.48 ? 232 TRP B C   1 
ATOM   5257  O  O   . TRP B 1 218 ? 19.669  19.203  24.130  1.00 25.01 ? 232 TRP B O   1 
ATOM   5258  C  CB  . TRP B 1 218 ? 19.495  17.987  21.404  1.00 18.65 ? 232 TRP B CB  1 
ATOM   5259  C  CG  . TRP B 1 218 ? 20.738  17.159  21.484  1.00 18.66 ? 232 TRP B CG  1 
ATOM   5260  C  CD1 . TRP B 1 218 ? 20.924  15.989  22.204  1.00 20.54 ? 232 TRP B CD1 1 
ATOM   5261  C  CD2 . TRP B 1 218 ? 21.961  17.402  20.794  1.00 21.35 ? 232 TRP B CD2 1 
ATOM   5262  N  NE1 . TRP B 1 218 ? 22.200  15.514  22.001  1.00 20.70 ? 232 TRP B NE1 1 
ATOM   5263  C  CE2 . TRP B 1 218 ? 22.854  16.357  21.137  1.00 21.57 ? 232 TRP B CE2 1 
ATOM   5264  C  CE3 . TRP B 1 218 ? 22.400  18.414  19.924  1.00 23.40 ? 232 TRP B CE3 1 
ATOM   5265  C  CZ2 . TRP B 1 218 ? 24.157  16.300  20.644  1.00 23.58 ? 232 TRP B CZ2 1 
ATOM   5266  C  CZ3 . TRP B 1 218 ? 23.694  18.353  19.436  1.00 26.90 ? 232 TRP B CZ3 1 
ATOM   5267  C  CH2 . TRP B 1 218 ? 24.556  17.300  19.794  1.00 28.30 ? 232 TRP B CH2 1 
ATOM   5268  N  N   . LYS B 1 219 ? 19.176  17.113  24.803  1.00 22.13 ? 233 LYS B N   1 
ATOM   5269  C  CA  . LYS B 1 219 ? 19.918  17.176  26.055  1.00 28.81 ? 233 LYS B CA  1 
ATOM   5270  C  C   . LYS B 1 219 ? 21.206  16.387  25.887  1.00 21.13 ? 233 LYS B C   1 
ATOM   5271  O  O   . LYS B 1 219 ? 21.218  15.173  26.060  1.00 20.73 ? 233 LYS B O   1 
ATOM   5272  C  CB  . LYS B 1 219 ? 19.113  16.568  27.202  1.00 26.90 ? 233 LYS B CB  1 
ATOM   5273  C  CG  . LYS B 1 219 ? 19.659  16.944  28.586  1.00 30.36 ? 233 LYS B CG  1 
ATOM   5274  C  CD  . LYS B 1 219 ? 19.281  15.910  29.651  1.00 32.36 ? 233 LYS B CD  1 
ATOM   5275  C  CE  . LYS B 1 219 ? 20.125  14.670  29.536  1.00 32.67 ? 233 LYS B CE  1 
ATOM   5276  N  NZ  . LYS B 1 219 ? 21.579  14.999  29.678  1.00 34.67 ? 233 LYS B NZ  1 
ATOM   5277  N  N   . PRO B 1 220 ? 22.300  17.075  25.552  1.00 17.84 ? 234 PRO B N   1 
ATOM   5278  C  CA  . PRO B 1 220 ? 23.566  16.387  25.284  1.00 17.60 ? 234 PRO B CA  1 
ATOM   5279  C  C   . PRO B 1 220 ? 24.192  15.904  26.581  1.00 24.32 ? 234 PRO B C   1 
ATOM   5280  O  O   . PRO B 1 220 ? 23.683  16.219  27.653  1.00 23.35 ? 234 PRO B O   1 
ATOM   5281  C  CB  . PRO B 1 220 ? 24.444  17.484  24.654  1.00 23.22 ? 234 PRO B CB  1 
ATOM   5282  C  CG  . PRO B 1 220 ? 23.629  18.748  24.681  1.00 29.94 ? 234 PRO B CG  1 
ATOM   5283  C  CD  . PRO B 1 220 ? 22.475  18.533  25.606  1.00 27.25 ? 234 PRO B CD  1 
ATOM   5284  N  N   . SER B 1 221 ? 25.273  15.137  26.486  1.00 22.16 ? 235 SER B N   1 
ATOM   5285  C  CA  . SER B 1 221 ? 25.973  14.680  27.682  1.00 22.40 ? 235 SER B CA  1 
ATOM   5286  C  C   . SER B 1 221 ? 26.887  15.766  28.245  1.00 22.24 ? 235 SER B C   1 
ATOM   5287  O  O   . SER B 1 221 ? 27.639  16.375  27.495  1.00 24.20 ? 235 SER B O   1 
ATOM   5288  C  CB  . SER B 1 221 ? 26.799  13.436  27.356  1.00 25.08 ? 235 SER B CB  1 
ATOM   5289  O  OG  . SER B 1 221 ? 25.935  12.383  26.960  1.00 34.76 ? 235 SER B OG  1 
ATOM   5290  N  N   . ASP B 1 222 ? 26.841  15.984  29.561  1.00 19.73 ? 236 ASP B N   1 
ATOM   5291  C  CA  . ASP B 1 222 ? 27.702  16.989  30.205  1.00 22.19 ? 236 ASP B CA  1 
ATOM   5292  C  C   . ASP B 1 222 ? 29.176  16.765  29.865  1.00 27.74 ? 236 ASP B C   1 
ATOM   5293  O  O   . ASP B 1 222 ? 29.930  17.716  29.658  1.00 26.59 ? 236 ASP B O   1 
ATOM   5294  C  CB  . ASP B 1 222 ? 27.559  16.938  31.734  1.00 29.29 ? 236 ASP B CB  1 
ATOM   5295  C  CG  . ASP B 1 222 ? 26.137  17.204  32.208  1.00 35.88 ? 236 ASP B CG  1 
ATOM   5296  O  OD1 . ASP B 1 222 ? 25.229  17.292  31.358  1.00 30.19 ? 236 ASP B OD1 1 
ATOM   5297  O  OD2 . ASP B 1 222 ? 25.932  17.315  33.441  1.00 33.48 ? 236 ASP B OD2 1 
ATOM   5298  N  N   . THR B 1 223 ? 29.582  15.498  29.807  1.00 24.33 ? 237 THR B N   1 
ATOM   5299  C  CA  . THR B 1 223 ? 30.985  15.158  29.611  1.00 23.48 ? 237 THR B CA  1 
ATOM   5300  C  C   . THR B 1 223 ? 31.412  15.202  28.151  1.00 20.55 ? 237 THR B C   1 
ATOM   5301  O  O   . THR B 1 223 ? 32.568  14.923  27.821  1.00 23.21 ? 237 THR B O   1 
ATOM   5302  C  CB  . THR B 1 223 ? 31.291  13.765  30.167  1.00 27.92 ? 237 THR B CB  1 
ATOM   5303  O  OG1 . THR B 1 223 ? 30.310  12.836  29.682  1.00 20.58 ? 237 THR B OG1 1 
ATOM   5304  C  CG2 . THR B 1 223 ? 31.269  13.789  31.681  1.00 29.55 ? 237 THR B CG2 1 
ATOM   5305  N  N   . ALA B 1 224 ? 30.487  15.566  27.274  1.00 23.62 ? 238 ALA B N   1 
ATOM   5306  C  CA  . ALA B 1 224 ? 30.820  15.718  25.864  1.00 20.47 ? 238 ALA B CA  1 
ATOM   5307  C  C   . ALA B 1 224 ? 30.359  17.085  25.362  1.00 17.72 ? 238 ALA B C   1 
ATOM   5308  O  O   . ALA B 1 224 ? 30.246  17.313  24.155  1.00 22.76 ? 238 ALA B O   1 
ATOM   5309  C  CB  . ALA B 1 224 ? 30.183  14.568  25.032  1.00 16.79 ? 238 ALA B CB  1 
ATOM   5310  N  N   . MET B 1 225 ? 30.105  17.999  26.295  1.00 19.57 ? 239 MET B N   1 
ATOM   5311  C  CA  . MET B 1 225 ? 29.500  19.287  25.948  1.00 20.72 ? 239 MET B CA  1 
ATOM   5312  C  C   . MET B 1 225 ? 30.257  20.050  24.850  1.00 22.70 ? 239 MET B C   1 
ATOM   5313  O  O   . MET B 1 225 ? 29.644  20.510  23.890  1.00 23.28 ? 239 MET B O   1 
ATOM   5314  C  CB  . MET B 1 225 ? 29.328  20.167  27.191  1.00 19.56 ? 239 MET B CB  1 
ATOM   5315  C  CG  . MET B 1 225 ? 28.352  21.311  26.976  1.00 25.82 ? 239 MET B CG  1 
ATOM   5316  S  SD  . MET B 1 225 ? 26.724  20.692  26.474  1.00 28.05 ? 239 MET B SD  1 
ATOM   5317  C  CE  . MET B 1 225 ? 26.317  19.681  27.900  1.00 22.61 ? 239 MET B CE  1 
ATOM   5318  N  N   . LEU B 1 226 ? 31.582  20.132  24.984  1.00 19.31 ? 240 LEU B N   1 
ATOM   5319  C  CA  . LEU B 1 226 ? 32.442  20.871  24.049  1.00 24.91 ? 240 LEU B CA  1 
ATOM   5320  C  C   . LEU B 1 226 ? 32.248  20.450  22.588  1.00 20.59 ? 240 LEU B C   1 
ATOM   5321  O  O   . LEU B 1 226 ? 31.920  21.278  21.709  1.00 20.00 ? 240 LEU B O   1 
ATOM   5322  C  CB  . LEU B 1 226 ? 33.917  20.716  24.455  1.00 22.22 ? 240 LEU B CB  1 
ATOM   5323  C  CG  . LEU B 1 226 ? 34.961  21.553  23.697  1.00 21.39 ? 240 LEU B CG  1 
ATOM   5324  C  CD1 . LEU B 1 226 ? 34.632  23.031  23.753  1.00 25.61 ? 240 LEU B CD1 1 
ATOM   5325  C  CD2 . LEU B 1 226 ? 36.385  21.287  24.222  1.00 21.42 ? 240 LEU B CD2 1 
ATOM   5326  N  N   . ALA B 1 227 ? 32.437  19.159  22.337  1.00 19.26 ? 241 ALA B N   1 
ATOM   5327  C  CA  . ALA B 1 227 ? 32.274  18.600  21.005  1.00 20.05 ? 241 ALA B CA  1 
ATOM   5328  C  C   . ALA B 1 227 ? 30.800  18.594  20.573  1.00 18.54 ? 241 ALA B C   1 
ATOM   5329  O  O   . ALA B 1 227 ? 30.509  18.810  19.403  1.00 25.19 ? 241 ALA B O   1 
ATOM   5330  C  CB  . ALA B 1 227 ? 32.853  17.180  20.946  1.00 22.08 ? 241 ALA B CB  1 
ATOM   5331  N  N   . SER B 1 228 ? 29.887  18.329  21.507  1.00 19.36 ? 242 SER B N   1 
ATOM   5332  C  CA  . SER B 1 228 ? 28.462  18.317  21.169  1.00 22.96 ? 242 SER B CA  1 
ATOM   5333  C  C   . SER B 1 228 ? 28.044  19.675  20.610  1.00 26.33 ? 242 SER B C   1 
ATOM   5334  O  O   . SER B 1 228 ? 27.420  19.749  19.560  1.00 26.37 ? 242 SER B O   1 
ATOM   5335  C  CB  . SER B 1 228 ? 27.587  17.961  22.383  1.00 17.40 ? 242 SER B CB  1 
ATOM   5336  O  OG  . SER B 1 228 ? 27.847  16.641  22.838  1.00 22.62 ? 242 SER B OG  1 
ATOM   5337  N  N   . TYR B 1 229 ? 28.409  20.746  21.310  1.00 25.55 ? 243 TYR B N   1 
ATOM   5338  C  CA  . TYR B 1 229 ? 28.094  22.094  20.840  1.00 25.73 ? 243 TYR B CA  1 
ATOM   5339  C  C   . TYR B 1 229 ? 28.783  22.391  19.508  1.00 24.90 ? 243 TYR B C   1 
ATOM   5340  O  O   . TYR B 1 229 ? 28.243  23.104  18.665  1.00 23.20 ? 243 TYR B O   1 
ATOM   5341  C  CB  . TYR B 1 229 ? 28.489  23.143  21.884  1.00 23.81 ? 243 TYR B CB  1 
ATOM   5342  C  CG  . TYR B 1 229 ? 27.934  24.523  21.599  1.00 26.40 ? 243 TYR B CG  1 
ATOM   5343  C  CD1 . TYR B 1 229 ? 28.770  25.635  21.482  1.00 30.81 ? 243 TYR B CD1 1 
ATOM   5344  C  CD2 . TYR B 1 229 ? 26.568  24.715  21.456  1.00 23.49 ? 243 TYR B CD2 1 
ATOM   5345  C  CE1 . TYR B 1 229 ? 28.247  26.895  21.231  1.00 34.71 ? 243 TYR B CE1 1 
ATOM   5346  C  CE2 . TYR B 1 229 ? 26.037  25.961  21.203  1.00 25.45 ? 243 TYR B CE2 1 
ATOM   5347  C  CZ  . TYR B 1 229 ? 26.871  27.045  21.090  1.00 27.34 ? 243 TYR B CZ  1 
ATOM   5348  O  OH  . TYR B 1 229 ? 26.317  28.271  20.842  1.00 29.99 ? 243 TYR B OH  1 
ATOM   5349  N  N   . ALA B 1 230 ? 29.974  21.838  19.315  1.00 25.83 ? 244 ALA B N   1 
ATOM   5350  C  CA  . ALA B 1 230 ? 30.691  22.044  18.058  1.00 26.27 ? 244 ALA B CA  1 
ATOM   5351  C  C   . ALA B 1 230 ? 29.885  21.471  16.885  1.00 20.49 ? 244 ALA B C   1 
ATOM   5352  O  O   . ALA B 1 230 ? 29.824  22.074  15.814  1.00 26.84 ? 244 ALA B O   1 
ATOM   5353  C  CB  . ALA B 1 230 ? 32.075  21.415  18.115  1.00 23.63 ? 244 ALA B CB  1 
ATOM   5354  N  N   . VAL B 1 231 ? 29.276  20.305  17.098  1.00 19.88 ? 245 VAL B N   1 
ATOM   5355  C  CA  . VAL B 1 231 ? 28.405  19.704  16.078  1.00 19.50 ? 245 VAL B CA  1 
ATOM   5356  C  C   . VAL B 1 231 ? 27.153  20.565  15.878  1.00 19.74 ? 245 VAL B C   1 
ATOM   5357  O  O   . VAL B 1 231 ? 26.749  20.833  14.745  1.00 20.89 ? 245 VAL B O   1 
ATOM   5358  C  CB  . VAL B 1 231 ? 28.039  18.225  16.405  1.00 19.14 ? 245 VAL B CB  1 
ATOM   5359  C  CG1 . VAL B 1 231 ? 27.066  17.651  15.360  1.00 18.53 ? 245 VAL B CG1 1 
ATOM   5360  C  CG2 . VAL B 1 231 ? 29.324  17.364  16.487  1.00 21.05 ? 245 VAL B CG2 1 
ATOM   5361  N  N   . TYR B 1 232 ? 26.557  21.023  16.972  1.00 24.86 ? 246 TYR B N   1 
ATOM   5362  C  CA  . TYR B 1 232 ? 25.364  21.859  16.857  1.00 27.17 ? 246 TYR B CA  1 
ATOM   5363  C  C   . TYR B 1 232 ? 25.648  23.109  16.019  1.00 29.12 ? 246 TYR B C   1 
ATOM   5364  O  O   . TYR B 1 232 ? 24.893  23.433  15.092  1.00 24.60 ? 246 TYR B O   1 
ATOM   5365  C  CB  . TYR B 1 232 ? 24.832  22.268  18.232  1.00 27.02 ? 246 TYR B CB  1 
ATOM   5366  C  CG  . TYR B 1 232 ? 23.582  23.123  18.158  1.00 27.57 ? 246 TYR B CG  1 
ATOM   5367  C  CD1 . TYR B 1 232 ? 22.330  22.536  17.976  1.00 27.02 ? 246 TYR B CD1 1 
ATOM   5368  C  CD2 . TYR B 1 232 ? 23.651  24.507  18.263  1.00 27.74 ? 246 TYR B CD2 1 
ATOM   5369  C  CE1 . TYR B 1 232 ? 21.187  23.304  17.905  1.00 25.55 ? 246 TYR B CE1 1 
ATOM   5370  C  CE2 . TYR B 1 232 ? 22.510  25.291  18.195  1.00 29.25 ? 246 TYR B CE2 1 
ATOM   5371  C  CZ  . TYR B 1 232 ? 21.281  24.687  18.007  1.00 28.56 ? 246 TYR B CZ  1 
ATOM   5372  O  OH  . TYR B 1 232 ? 20.148  25.460  17.936  1.00 27.50 ? 246 TYR B OH  1 
ATOM   5373  N  N   . ARG B 1 233 ? 26.750  23.790  16.332  1.00 23.90 ? 247 ARG B N   1 
ATOM   5374  C  CA  . ARG B 1 233 ? 27.102  25.030  15.648  1.00 24.46 ? 247 ARG B CA  1 
ATOM   5375  C  C   . ARG B 1 233 ? 27.291  24.762  14.160  1.00 28.05 ? 247 ARG B C   1 
ATOM   5376  O  O   . ARG B 1 233 ? 26.858  25.548  13.319  1.00 27.20 ? 247 ARG B O   1 
ATOM   5377  C  CB  . ARG B 1 233 ? 28.379  25.674  16.250  1.00 22.95 ? 247 ARG B CB  1 
ATOM   5378  N  N   . ILE B 1 234 ? 27.928  23.641  13.845  1.00 27.06 ? 248 ILE B N   1 
ATOM   5379  C  CA  . ILE B 1 234 ? 28.134  23.239  12.456  1.00 28.51 ? 248 ILE B CA  1 
ATOM   5380  C  C   . ILE B 1 234 ? 26.804  22.968  11.710  1.00 26.29 ? 248 ILE B C   1 
ATOM   5381  O  O   . ILE B 1 234 ? 26.622  23.433  10.584  1.00 29.10 ? 248 ILE B O   1 
ATOM   5382  C  CB  . ILE B 1 234 ? 29.116  22.049  12.371  1.00 26.85 ? 248 ILE B CB  1 
ATOM   5383  C  CG1 . ILE B 1 234 ? 30.555  22.541  12.640  1.00 25.63 ? 248 ILE B CG1 1 
ATOM   5384  C  CG2 . ILE B 1 234 ? 29.031  21.364  11.015  1.00 26.88 ? 248 ILE B CG2 1 
ATOM   5385  C  CD1 . ILE B 1 234 ? 31.538  21.415  12.863  1.00 25.38 ? 248 ILE B CD1 1 
ATOM   5386  N  N   . LEU B 1 235 ? 25.877  22.242  12.336  1.00 24.86 ? 249 LEU B N   1 
ATOM   5387  C  CA  . LEU B 1 235 ? 24.552  22.045  11.743  1.00 25.38 ? 249 LEU B CA  1 
ATOM   5388  C  C   . LEU B 1 235 ? 23.883  23.383  11.428  1.00 24.27 ? 249 LEU B C   1 
ATOM   5389  O  O   . LEU B 1 235 ? 23.396  23.590  10.316  1.00 23.81 ? 249 LEU B O   1 
ATOM   5390  C  CB  . LEU B 1 235 ? 23.646  21.165  12.622  1.00 24.53 ? 249 LEU B CB  1 
ATOM   5391  C  CG  . LEU B 1 235 ? 24.021  19.681  12.621  1.00 25.56 ? 249 LEU B CG  1 
ATOM   5392  C  CD1 . LEU B 1 235 ? 23.374  18.942  13.773  1.00 21.58 ? 249 LEU B CD1 1 
ATOM   5393  C  CD2 . LEU B 1 235 ? 23.643  19.038  11.298  1.00 23.94 ? 249 LEU B CD2 1 
ATOM   5394  N  N   . ARG B 1 236 ? 23.883  24.296  12.394  1.00 27.09 ? 250 ARG B N   1 
ATOM   5395  C  CA  . ARG B 1 236 ? 23.329  25.626  12.164  1.00 27.62 ? 250 ARG B CA  1 
ATOM   5396  C  C   . ARG B 1 236 ? 24.026  26.359  11.001  1.00 33.03 ? 250 ARG B C   1 
ATOM   5397  O  O   . ARG B 1 236 ? 23.357  26.884  10.102  1.00 31.77 ? 250 ARG B O   1 
ATOM   5398  C  CB  . ARG B 1 236 ? 23.362  26.472  13.446  1.00 27.73 ? 250 ARG B CB  1 
ATOM   5399  C  CG  . ARG B 1 236 ? 22.673  25.811  14.650  1.00 25.98 ? 250 ARG B CG  1 
ATOM   5400  C  CD  . ARG B 1 236 ? 21.209  25.432  14.360  1.00 25.19 ? 250 ARG B CD  1 
ATOM   5401  N  NE  . ARG B 1 236 ? 20.515  26.524  13.676  1.00 31.18 ? 250 ARG B NE  1 
ATOM   5402  C  CZ  . ARG B 1 236 ? 19.925  27.542  14.291  1.00 34.39 ? 250 ARG B CZ  1 
ATOM   5403  N  NH1 . ARG B 1 236 ? 19.928  27.620  15.616  1.00 26.83 ? 250 ARG B NH1 1 
ATOM   5404  N  NH2 . ARG B 1 236 ? 19.341  28.493  13.577  1.00 39.27 ? 250 ARG B NH2 1 
ATOM   5405  N  N   . GLU B 1 237 ? 25.358  26.370  11.004  1.00 28.85 ? 251 GLU B N   1 
ATOM   5406  C  CA  . GLU B 1 237 ? 26.112  27.061  9.953   1.00 30.81 ? 251 GLU B CA  1 
ATOM   5407  C  C   . GLU B 1 237 ? 25.799  26.455  8.591   1.00 35.31 ? 251 GLU B C   1 
ATOM   5408  O  O   . GLU B 1 237 ? 25.786  27.155  7.567   1.00 28.04 ? 251 GLU B O   1 
ATOM   5409  C  CB  . GLU B 1 237 ? 27.622  26.999  10.210  1.00 28.01 ? 251 GLU B CB  1 
ATOM   5410  C  CG  . GLU B 1 237 ? 28.086  27.805  11.402  1.00 27.94 ? 251 GLU B CG  1 
ATOM   5411  C  CD  . GLU B 1 237 ? 29.598  27.756  11.590  1.00 38.69 ? 251 GLU B CD  1 
ATOM   5412  O  OE1 . GLU B 1 237 ? 30.310  27.385  10.629  1.00 39.89 ? 251 GLU B OE1 1 
ATOM   5413  O  OE2 . GLU B 1 237 ? 30.075  28.092  12.697  1.00 35.39 ? 251 GLU B OE2 1 
ATOM   5414  N  N   . ALA B 1 238 ? 25.532  25.150  8.596   1.00 33.82 ? 252 ALA B N   1 
ATOM   5415  C  CA  . ALA B 1 238 ? 25.193  24.415  7.382   1.00 35.02 ? 252 ALA B CA  1 
ATOM   5416  C  C   . ALA B 1 238 ? 23.780  24.731  6.905   1.00 36.33 ? 252 ALA B C   1 
ATOM   5417  O  O   . ALA B 1 238 ? 23.364  24.273  5.844   1.00 35.46 ? 252 ALA B O   1 
ATOM   5418  C  CB  . ALA B 1 238 ? 25.359  22.901  7.600   1.00 27.38 ? 252 ALA B CB  1 
ATOM   5419  N  N   . GLY B 1 239 ? 23.038  25.504  7.690   1.00 35.25 ? 253 GLY B N   1 
ATOM   5420  C  CA  . GLY B 1 239 ? 21.732  25.963  7.255   1.00 32.35 ? 253 GLY B CA  1 
ATOM   5421  C  C   . GLY B 1 239 ? 20.546  25.321  7.945   1.00 33.29 ? 253 GLY B C   1 
ATOM   5422  O  O   . GLY B 1 239 ? 19.417  25.470  7.486   1.00 34.06 ? 253 GLY B O   1 
ATOM   5423  N  N   . LEU B 1 240 ? 20.785  24.590  9.030   1.00 33.83 ? 254 LEU B N   1 
ATOM   5424  C  CA  . LEU B 1 240 ? 19.682  24.088  9.827   1.00 31.33 ? 254 LEU B CA  1 
ATOM   5425  C  C   . LEU B 1 240 ? 18.937  25.303  10.356  1.00 31.78 ? 254 LEU B C   1 
ATOM   5426  O  O   . LEU B 1 240 ? 19.548  26.169  10.964  1.00 28.62 ? 254 LEU B O   1 
ATOM   5427  C  CB  . LEU B 1 240 ? 20.194  23.258  10.998  1.00 30.12 ? 254 LEU B CB  1 
ATOM   5428  C  CG  . LEU B 1 240 ? 19.067  22.526  11.719  1.00 26.84 ? 254 LEU B CG  1 
ATOM   5429  C  CD1 . LEU B 1 240 ? 18.511  21.425  10.800  1.00 27.97 ? 254 LEU B CD1 1 
ATOM   5430  C  CD2 . LEU B 1 240 ? 19.524  21.953  13.062  1.00 26.79 ? 254 LEU B CD2 1 
ATOM   5431  N  N   . PRO B 1 241 ? 17.623  25.396  10.089  1.00 34.09 ? 255 PRO B N   1 
ATOM   5432  C  CA  . PRO B 1 241 ? 16.890  26.590  10.534  1.00 34.08 ? 255 PRO B CA  1 
ATOM   5433  C  C   . PRO B 1 241 ? 16.697  26.649  12.053  1.00 36.47 ? 255 PRO B C   1 
ATOM   5434  O  O   . PRO B 1 241 ? 16.912  25.646  12.743  1.00 28.98 ? 255 PRO B O   1 
ATOM   5435  C  CB  . PRO B 1 241 ? 15.541  26.481  9.801   1.00 35.64 ? 255 PRO B CB  1 
ATOM   5436  C  CG  . PRO B 1 241 ? 15.434  25.105  9.339   1.00 31.28 ? 255 PRO B CG  1 
ATOM   5437  C  CD  . PRO B 1 241 ? 16.817  24.540  9.202   1.00 28.54 ? 255 PRO B CD  1 
ATOM   5438  N  N   . PRO B 1 242 ? 16.322  27.825  12.581  1.00 38.04 ? 256 PRO B N   1 
ATOM   5439  C  CA  . PRO B 1 242 ? 16.121  27.936  14.030  1.00 33.52 ? 256 PRO B CA  1 
ATOM   5440  C  C   . PRO B 1 242 ? 14.973  27.075  14.522  1.00 33.35 ? 256 PRO B C   1 
ATOM   5441  O  O   . PRO B 1 242 ? 14.029  26.824  13.770  1.00 31.10 ? 256 PRO B O   1 
ATOM   5442  C  CB  . PRO B 1 242 ? 15.777  29.422  14.226  1.00 40.09 ? 256 PRO B CB  1 
ATOM   5443  C  CG  . PRO B 1 242 ? 15.313  29.896  12.892  1.00 41.60 ? 256 PRO B CG  1 
ATOM   5444  C  CD  . PRO B 1 242 ? 16.107  29.113  11.895  1.00 42.31 ? 256 PRO B CD  1 
ATOM   5445  N  N   . ASN B 1 243 ? 15.068  26.632  15.772  1.00 30.59 ? 257 ASN B N   1 
ATOM   5446  C  CA  . ASN B 1 243 ? 14.008  25.877  16.427  1.00 33.31 ? 257 ASN B CA  1 
ATOM   5447  C  C   . ASN B 1 243 ? 13.776  24.479  15.885  1.00 32.86 ? 257 ASN B C   1 
ATOM   5448  O  O   . ASN B 1 243 ? 12.737  23.886  16.164  1.00 30.83 ? 257 ASN B O   1 
ATOM   5449  C  CB  . ASN B 1 243 ? 12.689  26.659  16.393  1.00 27.36 ? 257 ASN B CB  1 
ATOM   5450  C  CG  . ASN B 1 243 ? 12.754  27.914  17.207  1.00 35.90 ? 257 ASN B CG  1 
ATOM   5451  O  OD1 . ASN B 1 243 ? 13.182  27.887  18.359  1.00 31.15 ? 257 ASN B OD1 1 
ATOM   5452  N  ND2 . ASN B 1 243 ? 12.346  29.030  16.614  1.00 38.84 ? 257 ASN B ND2 1 
ATOM   5453  N  N   . ILE B 1 244 ? 14.718  23.953  15.107  1.00 28.26 ? 258 ILE B N   1 
ATOM   5454  C  CA  . ILE B 1 244 ? 14.608  22.565  14.653  1.00 27.02 ? 258 ILE B CA  1 
ATOM   5455  C  C   . ILE B 1 244 ? 15.311  21.649  15.641  1.00 26.77 ? 258 ILE B C   1 
ATOM   5456  O  O   . ILE B 1 244 ? 14.769  20.620  16.035  1.00 28.58 ? 258 ILE B O   1 
ATOM   5457  C  CB  . ILE B 1 244 ? 15.188  22.359  13.250  1.00 27.53 ? 258 ILE B CB  1 
ATOM   5458  C  CG1 . ILE B 1 244 ? 14.577  23.370  12.288  1.00 27.08 ? 258 ILE B CG1 1 
ATOM   5459  C  CG2 . ILE B 1 244 ? 14.910  20.949  12.771  1.00 27.06 ? 258 ILE B CG2 1 
ATOM   5460  C  CD1 . ILE B 1 244 ? 13.067  23.298  12.219  1.00 27.36 ? 258 ILE B CD1 1 
ATOM   5461  N  N   . ILE B 1 245 ? 16.528  22.028  16.033  1.00 23.73 ? 259 ILE B N   1 
ATOM   5462  C  CA  . ILE B 1 245 ? 17.171  21.398  17.180  1.00 21.22 ? 259 ILE B CA  1 
ATOM   5463  C  C   . ILE B 1 245 ? 17.405  22.451  18.245  1.00 22.61 ? 259 ILE B C   1 
ATOM   5464  O  O   . ILE B 1 245 ? 18.083  23.465  18.009  1.00 21.57 ? 259 ILE B O   1 
ATOM   5465  C  CB  . ILE B 1 245 ? 18.493  20.685  16.816  1.00 23.38 ? 259 ILE B CB  1 
ATOM   5466  C  CG1 . ILE B 1 245 ? 18.237  19.602  15.761  1.00 25.67 ? 259 ILE B CG1 1 
ATOM   5467  C  CG2 . ILE B 1 245 ? 19.148  20.084  18.077  1.00 19.87 ? 259 ILE B CG2 1 
ATOM   5468  C  CD1 . ILE B 1 245 ? 19.439  18.771  15.433  1.00 25.07 ? 259 ILE B CD1 1 
ATOM   5469  N  N   . GLN B 1 246 ? 16.793  22.238  19.403  1.00 23.49 ? 260 GLN B N   1 
ATOM   5470  C  CA  . GLN B 1 246 ? 17.016  23.109  20.541  1.00 23.14 ? 260 GLN B CA  1 
ATOM   5471  C  C   . GLN B 1 246 ? 18.144  22.502  21.342  1.00 25.69 ? 260 GLN B C   1 
ATOM   5472  O  O   . GLN B 1 246 ? 18.065  21.326  21.700  1.00 21.70 ? 260 GLN B O   1 
ATOM   5473  C  CB  . GLN B 1 246 ? 15.760  23.177  21.406  1.00 29.39 ? 260 GLN B CB  1 
ATOM   5474  C  CG  . GLN B 1 246 ? 14.477  23.484  20.646  1.00 25.96 ? 260 GLN B CG  1 
ATOM   5475  C  CD  . GLN B 1 246 ? 14.396  24.921  20.153  1.00 30.53 ? 260 GLN B CD  1 
ATOM   5476  O  OE1 . GLN B 1 246 ? 15.406  25.543  19.810  1.00 27.81 ? 260 GLN B OE1 1 
ATOM   5477  N  NE2 . GLN B 1 246 ? 13.178  25.447  20.094  1.00 26.71 ? 260 GLN B NE2 1 
ATOM   5478  N  N   . PHE B 1 247 ? 19.187  23.290  21.606  1.00 21.18 ? 261 PHE B N   1 
ATOM   5479  C  CA  . PHE B 1 247 ? 20.347  22.827  22.379  1.00 27.82 ? 261 PHE B CA  1 
ATOM   5480  C  C   . PHE B 1 247 ? 20.130  23.098  23.861  1.00 23.01 ? 261 PHE B C   1 
ATOM   5481  O  O   . PHE B 1 247 ? 20.320  24.224  24.329  1.00 24.83 ? 261 PHE B O   1 
ATOM   5482  C  CB  . PHE B 1 247 ? 21.627  23.529  21.909  1.00 20.95 ? 261 PHE B CB  1 
ATOM   5483  C  CG  . PHE B 1 247 ? 22.899  22.868  22.396  1.00 25.95 ? 261 PHE B CG  1 
ATOM   5484  C  CD1 . PHE B 1 247 ? 23.401  21.738  21.753  1.00 24.37 ? 261 PHE B CD1 1 
ATOM   5485  C  CD2 . PHE B 1 247 ? 23.592  23.378  23.492  1.00 21.49 ? 261 PHE B CD2 1 
ATOM   5486  C  CE1 . PHE B 1 247 ? 24.576  21.132  22.189  1.00 20.61 ? 261 PHE B CE1 1 
ATOM   5487  C  CE2 . PHE B 1 247 ? 24.769  22.766  23.939  1.00 21.04 ? 261 PHE B CE2 1 
ATOM   5488  C  CZ  . PHE B 1 247 ? 25.257  21.655  23.288  1.00 22.68 ? 261 PHE B CZ  1 
ATOM   5489  N  N   . VAL B 1 248 ? 19.730  22.068  24.599  1.00 25.56 ? 262 VAL B N   1 
ATOM   5490  C  CA  . VAL B 1 248 ? 19.281  22.261  25.967  1.00 27.55 ? 262 VAL B CA  1 
ATOM   5491  C  C   . VAL B 1 248 ? 19.870  21.257  26.963  1.00 27.94 ? 262 VAL B C   1 
ATOM   5492  O  O   . VAL B 1 248 ? 19.200  20.317  27.382  1.00 24.71 ? 262 VAL B O   1 
ATOM   5493  C  CB  . VAL B 1 248 ? 17.721  22.266  26.058  1.00 27.00 ? 262 VAL B CB  1 
ATOM   5494  C  CG1 . VAL B 1 248 ? 17.142  23.566  25.498  1.00 20.38 ? 262 VAL B CG1 1 
ATOM   5495  C  CG2 . VAL B 1 248 ? 17.096  21.048  25.339  1.00 24.37 ? 262 VAL B CG2 1 
ATOM   5496  N  N   . PRO B 1 249 ? 21.135  21.463  27.360  1.00 26.64 ? 263 PRO B N   1 
ATOM   5497  C  CA  . PRO B 1 249 ? 21.684  20.687  28.474  1.00 26.66 ? 263 PRO B CA  1 
ATOM   5498  C  C   . PRO B 1 249 ? 20.814  20.900  29.701  1.00 28.02 ? 263 PRO B C   1 
ATOM   5499  O  O   . PRO B 1 249 ? 20.209  21.960  29.840  1.00 29.93 ? 263 PRO B O   1 
ATOM   5500  C  CB  . PRO B 1 249 ? 23.046  21.332  28.709  1.00 21.11 ? 263 PRO B CB  1 
ATOM   5501  C  CG  . PRO B 1 249 ? 23.395  21.957  27.397  1.00 27.50 ? 263 PRO B CG  1 
ATOM   5502  C  CD  . PRO B 1 249 ? 22.108  22.423  26.813  1.00 26.37 ? 263 PRO B CD  1 
ATOM   5503  N  N   . ALA B 1 250 ? 20.751  19.915  30.580  1.00 27.32 ? 264 ALA B N   1 
ATOM   5504  C  CA  . ALA B 1 250 ? 19.814  19.987  31.689  1.00 29.29 ? 264 ALA B CA  1 
ATOM   5505  C  C   . ALA B 1 250 ? 20.075  18.841  32.623  1.00 24.64 ? 264 ALA B C   1 
ATOM   5506  O  O   . ALA B 1 250 ? 20.672  17.848  32.227  1.00 25.92 ? 264 ALA B O   1 
ATOM   5507  C  CB  . ALA B 1 250 ? 18.370  19.902  31.169  1.00 27.02 ? 264 ALA B CB  1 
ATOM   5508  N  N   . ASP B 1 251 ? 19.624  18.976  33.863  1.00 27.07 ? 265 ASP B N   1 
ATOM   5509  C  CA  . ASP B 1 251 ? 19.626  17.861  34.794  1.00 28.06 ? 265 ASP B CA  1 
ATOM   5510  C  C   . ASP B 1 251 ? 18.845  16.687  34.197  1.00 31.67 ? 265 ASP B C   1 
ATOM   5511  O  O   . ASP B 1 251 ? 17.770  16.882  33.633  1.00 25.85 ? 265 ASP B O   1 
ATOM   5512  C  CB  . ASP B 1 251 ? 18.993  18.284  36.123  1.00 28.10 ? 265 ASP B CB  1 
ATOM   5513  C  CG  . ASP B 1 251 ? 18.857  17.130  37.089  1.00 39.53 ? 265 ASP B CG  1 
ATOM   5514  O  OD1 . ASP B 1 251 ? 19.899  16.594  37.529  1.00 41.87 ? 265 ASP B OD1 1 
ATOM   5515  O  OD2 . ASP B 1 251 ? 17.708  16.755  37.408  1.00 42.46 ? 265 ASP B OD2 1 
ATOM   5516  N  N   . GLY B 1 252 ? 19.403  15.483  34.310  1.00 24.90 ? 266 GLY B N   1 
ATOM   5517  C  CA  . GLY B 1 252 ? 18.806  14.284  33.735  1.00 30.22 ? 266 GLY B CA  1 
ATOM   5518  C  C   . GLY B 1 252 ? 17.367  14.003  34.149  1.00 29.24 ? 266 GLY B C   1 
ATOM   5519  O  O   . GLY B 1 252 ? 16.497  13.863  33.301  1.00 25.91 ? 266 GLY B O   1 
ATOM   5520  N  N   . PRO B 1 253 ? 17.110  13.918  35.458  1.00 30.34 ? 267 PRO B N   1 
ATOM   5521  C  CA  . PRO B 1 253 ? 15.748  13.728  35.972  1.00 33.78 ? 267 PRO B CA  1 
ATOM   5522  C  C   . PRO B 1 253 ? 14.784  14.879  35.653  1.00 33.57 ? 267 PRO B C   1 
ATOM   5523  O  O   . PRO B 1 253 ? 13.623  14.612  35.325  1.00 34.54 ? 267 PRO B O   1 
ATOM   5524  C  CB  . PRO B 1 253 ? 15.969  13.619  37.480  1.00 37.42 ? 267 PRO B CB  1 
ATOM   5525  C  CG  . PRO B 1 253 ? 17.339  13.033  37.597  1.00 37.79 ? 267 PRO B CG  1 
ATOM   5526  C  CD  . PRO B 1 253 ? 18.125  13.686  36.503  1.00 36.79 ? 267 PRO B CD  1 
ATOM   5527  N  N   . LEU B 1 254 ? 15.243  16.125  35.753  1.00 28.56 ? 268 LEU B N   1 
ATOM   5528  C  CA  . LEU B 1 254 ? 14.406  17.271  35.391  1.00 30.53 ? 268 LEU B CA  1 
ATOM   5529  C  C   . LEU B 1 254 ? 13.977  17.239  33.918  1.00 31.59 ? 268 LEU B C   1 
ATOM   5530  O  O   . LEU B 1 254 ? 12.803  17.470  33.598  1.00 32.30 ? 268 LEU B O   1 
ATOM   5531  C  CB  . LEU B 1 254 ? 15.118  18.599  35.674  1.00 27.07 ? 268 LEU B CB  1 
ATOM   5532  C  CG  . LEU B 1 254 ? 14.275  19.802  35.231  1.00 33.06 ? 268 LEU B CG  1 
ATOM   5533  C  CD1 . LEU B 1 254 ? 12.930  19.782  35.938  1.00 36.26 ? 268 LEU B CD1 1 
ATOM   5534  C  CD2 . LEU B 1 254 ? 14.993  21.108  35.509  1.00 42.45 ? 268 LEU B CD2 1 
ATOM   5535  N  N   . PHE B 1 255 ? 14.937  16.985  33.027  1.00 22.49 ? 269 PHE B N   1 
ATOM   5536  C  CA  . PHE B 1 255 ? 14.646  16.913  31.604  1.00 23.26 ? 269 PHE B CA  1 
ATOM   5537  C  C   . PHE B 1 255 ? 13.622  15.811  31.342  1.00 21.99 ? 269 PHE B C   1 
ATOM   5538  O  O   . PHE B 1 255 ? 12.651  16.007  30.610  1.00 26.49 ? 269 PHE B O   1 
ATOM   5539  C  CB  . PHE B 1 255 ? 15.903  16.612  30.812  1.00 22.27 ? 269 PHE B CB  1 
ATOM   5540  C  CG  . PHE B 1 255 ? 15.727  16.758  29.328  1.00 27.93 ? 269 PHE B CG  1 
ATOM   5541  C  CD1 . PHE B 1 255 ? 15.741  18.017  28.735  1.00 30.20 ? 269 PHE B CD1 1 
ATOM   5542  C  CD2 . PHE B 1 255 ? 15.549  15.645  28.527  1.00 23.41 ? 269 PHE B CD2 1 
ATOM   5543  C  CE1 . PHE B 1 255 ? 15.585  18.155  27.363  1.00 28.74 ? 269 PHE B CE1 1 
ATOM   5544  C  CE2 . PHE B 1 255 ? 15.384  15.776  27.162  1.00 23.66 ? 269 PHE B CE2 1 
ATOM   5545  C  CZ  . PHE B 1 255 ? 15.400  17.026  26.577  1.00 25.88 ? 269 PHE B CZ  1 
ATOM   5546  N  N   . GLY B 1 256 ? 13.861  14.656  31.954  1.00 25.46 ? 270 GLY B N   1 
ATOM   5547  C  CA  . GLY B 1 256 ? 12.995  13.498  31.794  1.00 30.57 ? 270 GLY B CA  1 
ATOM   5548  C  C   . GLY B 1 256 ? 11.574  13.785  32.239  1.00 29.00 ? 270 GLY B C   1 
ATOM   5549  O  O   . GLY B 1 256 ? 10.632  13.546  31.487  1.00 23.81 ? 270 GLY B O   1 
ATOM   5550  N  N   . ASP B 1 257 ? 11.424  14.292  33.461  1.00 25.41 ? 271 ASP B N   1 
ATOM   5551  C  CA  . ASP B 1 257 ? 10.109  14.666  33.985  1.00 32.12 ? 271 ASP B CA  1 
ATOM   5552  C  C   . ASP B 1 257 ? 9.375   15.651  33.063  1.00 30.91 ? 271 ASP B C   1 
ATOM   5553  O  O   . ASP B 1 257 ? 8.179   15.513  32.809  1.00 28.29 ? 271 ASP B O   1 
ATOM   5554  C  CB  . ASP B 1 257 ? 10.234  15.291  35.380  1.00 36.72 ? 271 ASP B CB  1 
ATOM   5555  C  CG  . ASP B 1 257 ? 10.695  14.302  36.432  1.00 41.07 ? 271 ASP B CG  1 
ATOM   5556  O  OD1 . ASP B 1 257 ? 10.860  13.105  36.105  1.00 39.29 ? 271 ASP B OD1 1 
ATOM   5557  O  OD2 . ASP B 1 257 ? 10.873  14.724  37.598  1.00 41.65 ? 271 ASP B OD2 1 
ATOM   5558  N  N   . THR B 1 258 ? 10.104  16.633  32.554  1.00 27.49 ? 272 THR B N   1 
ATOM   5559  C  CA  . THR B 1 258 ? 9.493   17.704  31.781  1.00 28.70 ? 272 THR B CA  1 
ATOM   5560  C  C   . THR B 1 258 ? 8.981   17.209  30.433  1.00 31.05 ? 272 THR B C   1 
ATOM   5561  O  O   . THR B 1 258 ? 7.830   17.460  30.080  1.00 31.53 ? 272 THR B O   1 
ATOM   5562  C  CB  . THR B 1 258 ? 10.474  18.881  31.577  1.00 28.53 ? 272 THR B CB  1 
ATOM   5563  O  OG1 . THR B 1 258 ? 10.860  19.402  32.852  1.00 37.54 ? 272 THR B OG1 1 
ATOM   5564  C  CG2 . THR B 1 258 ? 9.828   19.995  30.769  1.00 37.26 ? 272 THR B CG2 1 
ATOM   5565  N  N   . VAL B 1 259 ? 9.816   16.497  29.681  1.00 23.32 ? 273 VAL B N   1 
ATOM   5566  C  CA  . VAL B 1 259 ? 9.389   16.083  28.349  1.00 21.71 ? 273 VAL B CA  1 
ATOM   5567  C  C   . VAL B 1 259 ? 8.288   15.023  28.405  1.00 25.07 ? 273 VAL B C   1 
ATOM   5568  O  O   . VAL B 1 259 ? 7.383   15.036  27.582  1.00 25.19 ? 273 VAL B O   1 
ATOM   5569  C  CB  . VAL B 1 259 ? 10.556  15.644  27.419  1.00 25.13 ? 273 VAL B CB  1 
ATOM   5570  C  CG1 . VAL B 1 259 ? 11.597  16.766  27.296  1.00 27.56 ? 273 VAL B CG1 1 
ATOM   5571  C  CG2 . VAL B 1 259 ? 11.191  14.328  27.877  1.00 23.96 ? 273 VAL B CG2 1 
ATOM   5572  N  N   . THR B 1 260 ? 8.337   14.135  29.393  1.00 23.90 ? 274 THR B N   1 
ATOM   5573  C  CA  . THR B 1 260 ? 7.322   13.080  29.469  1.00 24.50 ? 274 THR B CA  1 
ATOM   5574  C  C   . THR B 1 260 ? 5.993   13.617  30.011  1.00 30.90 ? 274 THR B C   1 
ATOM   5575  O  O   . THR B 1 260 ? 4.949   12.980  29.856  1.00 33.90 ? 274 THR B O   1 
ATOM   5576  C  CB  . THR B 1 260 ? 7.803   11.849  30.264  1.00 20.19 ? 274 THR B CB  1 
ATOM   5577  O  OG1 . THR B 1 260 ? 8.097   12.216  31.619  1.00 22.36 ? 274 THR B OG1 1 
ATOM   5578  C  CG2 . THR B 1 260 ? 9.044   11.262  29.625  1.00 18.69 ? 274 THR B CG2 1 
ATOM   5579  N  N   . SER B 1 261 ? 6.045   14.804  30.617  1.00 34.41 ? 275 SER B N   1 
ATOM   5580  C  CA  . SER B 1 261 ? 4.856   15.506  31.092  1.00 33.73 ? 275 SER B CA  1 
ATOM   5581  C  C   . SER B 1 261 ? 4.210   16.348  29.992  1.00 35.82 ? 275 SER B C   1 
ATOM   5582  O  O   . SER B 1 261 ? 3.063   16.774  30.127  1.00 38.34 ? 275 SER B O   1 
ATOM   5583  C  CB  . SER B 1 261 ? 5.203   16.418  32.279  1.00 32.84 ? 275 SER B CB  1 
ATOM   5584  O  OG  . SER B 1 261 ? 5.372   15.663  33.466  1.00 35.67 ? 275 SER B OG  1 
ATOM   5585  N  N   . SER B 1 262 ? 4.945   16.601  28.913  1.00 34.14 ? 276 SER B N   1 
ATOM   5586  C  CA  . SER B 1 262 ? 4.426   17.443  27.826  1.00 34.45 ? 276 SER B CA  1 
ATOM   5587  C  C   . SER B 1 262 ? 3.402   16.720  26.939  1.00 27.08 ? 276 SER B C   1 
ATOM   5588  O  O   . SER B 1 262 ? 3.654   15.629  26.450  1.00 24.16 ? 276 SER B O   1 
ATOM   5589  C  CB  . SER B 1 262 ? 5.571   17.964  26.960  1.00 30.24 ? 276 SER B CB  1 
ATOM   5590  O  OG  . SER B 1 262 ? 5.078   18.673  25.839  1.00 28.18 ? 276 SER B OG  1 
ATOM   5591  N  N   . GLU B 1 263 ? 2.263   17.355  26.695  1.00 26.54 ? 277 GLU B N   1 
ATOM   5592  C  CA  . GLU B 1 263 ? 1.235   16.749  25.857  1.00 27.34 ? 277 GLU B CA  1 
ATOM   5593  C  C   . GLU B 1 263 ? 1.732   16.594  24.419  1.00 26.24 ? 277 GLU B C   1 
ATOM   5594  O  O   . GLU B 1 263 ? 1.168   15.844  23.627  1.00 29.38 ? 277 GLU B O   1 
ATOM   5595  C  CB  . GLU B 1 263 ? -0.039  17.601  25.890  1.00 28.42 ? 277 GLU B CB  1 
ATOM   5596  C  CG  . GLU B 1 263 ? 0.154   19.016  25.393  1.00 31.60 ? 277 GLU B CG  1 
ATOM   5597  C  CD  . GLU B 1 263 ? -1.046  19.913  25.677  1.00 40.62 ? 277 GLU B CD  1 
ATOM   5598  O  OE1 . GLU B 1 263 ? -1.057  20.583  26.726  1.00 42.44 ? 277 GLU B OE1 1 
ATOM   5599  O  OE2 . GLU B 1 263 ? -1.981  19.950  24.849  1.00 41.75 ? 277 GLU B OE2 1 
ATOM   5600  N  N   . HIS B 1 264 ? 2.813   17.296  24.103  1.00 23.39 ? 278 HIS B N   1 
ATOM   5601  C  CA  . HIS B 1 264 ? 3.335   17.337  22.743  1.00 30.40 ? 278 HIS B CA  1 
ATOM   5602  C  C   . HIS B 1 264 ? 4.535   16.440  22.484  1.00 23.50 ? 278 HIS B C   1 
ATOM   5603  O  O   . HIS B 1 264 ? 5.164   16.533  21.432  1.00 24.30 ? 278 HIS B O   1 
ATOM   5604  C  CB  . HIS B 1 264 ? 3.726   18.767  22.410  1.00 30.91 ? 278 HIS B CB  1 
ATOM   5605  C  CG  . HIS B 1 264 ? 2.616   19.741  22.611  1.00 35.18 ? 278 HIS B CG  1 
ATOM   5606  N  ND1 . HIS B 1 264 ? 1.494   19.757  21.811  1.00 36.01 ? 278 HIS B ND1 1 
ATOM   5607  C  CD2 . HIS B 1 264 ? 2.445   20.728  23.521  1.00 39.12 ? 278 HIS B CD2 1 
ATOM   5608  C  CE1 . HIS B 1 264 ? 0.684   20.718  22.216  1.00 40.26 ? 278 HIS B CE1 1 
ATOM   5609  N  NE2 . HIS B 1 264 ? 1.236   21.322  23.255  1.00 41.85 ? 278 HIS B NE2 1 
ATOM   5610  N  N   . LEU B 1 265 ? 4.875   15.591  23.440  1.00 25.59 ? 279 LEU B N   1 
ATOM   5611  C  CA  . LEU B 1 265 ? 5.937   14.620  23.193  1.00 22.01 ? 279 LEU B CA  1 
ATOM   5612  C  C   . LEU B 1 265 ? 5.482   13.623  22.126  1.00 24.29 ? 279 LEU B C   1 
ATOM   5613  O  O   . LEU B 1 265 ? 4.433   13.004  22.275  1.00 24.56 ? 279 LEU B O   1 
ATOM   5614  C  CB  . LEU B 1 265 ? 6.265   13.871  24.480  1.00 24.67 ? 279 LEU B CB  1 
ATOM   5615  C  CG  . LEU B 1 265 ? 7.417   12.880  24.327  1.00 21.87 ? 279 LEU B CG  1 
ATOM   5616  C  CD1 . LEU B 1 265 ? 8.715   13.672  24.092  1.00 17.05 ? 279 LEU B CD1 1 
ATOM   5617  C  CD2 . LEU B 1 265 ? 7.502   11.969  25.556  1.00 21.15 ? 279 LEU B CD2 1 
ATOM   5618  N  N   . CYS B 1 266 ? 6.253   13.470  21.051  1.00 18.49 ? 280 CYS B N   1 
ATOM   5619  C  CA  . CYS B 1 266 ? 5.971   12.408  20.084  1.00 22.87 ? 280 CYS B CA  1 
ATOM   5620  C  C   . CYS B 1 266 ? 7.067   11.346  20.012  1.00 21.92 ? 280 CYS B C   1 
ATOM   5621  O  O   . CYS B 1 266 ? 6.907   10.335  19.321  1.00 21.78 ? 280 CYS B O   1 
ATOM   5622  C  CB  . CYS B 1 266 ? 5.701   12.971  18.674  1.00 18.92 ? 280 CYS B CB  1 
ATOM   5623  S  SG  . CYS B 1 266 ? 7.065   13.905  17.947  1.00 29.46 ? 280 CYS B SG  1 
ATOM   5624  N  N   . GLY B 1 267 ? 8.183   11.566  20.710  1.00 20.47 ? 281 GLY B N   1 
ATOM   5625  C  CA  . GLY B 1 267 ? 9.254   10.593  20.675  1.00 20.34 ? 281 GLY B CA  1 
ATOM   5626  C  C   . GLY B 1 267 ? 10.396  10.817  21.648  1.00 21.40 ? 281 GLY B C   1 
ATOM   5627  O  O   . GLY B 1 267 ? 10.669  11.939  22.052  1.00 21.23 ? 281 GLY B O   1 
ATOM   5628  N  N   . ILE B 1 268 ? 11.047  9.727   22.043  1.00 19.44 ? 282 ILE B N   1 
ATOM   5629  C  CA  . ILE B 1 268 ? 12.251  9.808   22.861  1.00 19.20 ? 282 ILE B CA  1 
ATOM   5630  C  C   . ILE B 1 268 ? 13.313  8.971   22.181  1.00 19.21 ? 282 ILE B C   1 
ATOM   5631  O  O   . ILE B 1 268 ? 13.093  7.793   21.916  1.00 19.06 ? 282 ILE B O   1 
ATOM   5632  C  CB  . ILE B 1 268 ? 12.018  9.277   24.285  1.00 19.25 ? 282 ILE B CB  1 
ATOM   5633  C  CG1 . ILE B 1 268 ? 11.008  10.154  25.029  1.00 22.46 ? 282 ILE B CG1 1 
ATOM   5634  C  CG2 . ILE B 1 268 ? 13.335  9.222   25.048  1.00 21.66 ? 282 ILE B CG2 1 
ATOM   5635  C  CD1 . ILE B 1 268 ? 10.734  9.692   26.454  1.00 20.90 ? 282 ILE B CD1 1 
ATOM   5636  N  N   . ASN B 1 269 ? 14.443  9.595   21.853  1.00 19.54 ? 283 ASN B N   1 
ATOM   5637  C  CA  . ASN B 1 269 ? 15.563  8.895   21.246  1.00 19.24 ? 283 ASN B CA  1 
ATOM   5638  C  C   . ASN B 1 269 ? 16.685  8.853   22.278  1.00 21.39 ? 283 ASN B C   1 
ATOM   5639  O  O   . ASN B 1 269 ? 17.360  9.857   22.526  1.00 20.09 ? 283 ASN B O   1 
ATOM   5640  C  CB  . ASN B 1 269 ? 16.019  9.616   19.969  1.00 16.75 ? 283 ASN B CB  1 
ATOM   5641  C  CG  . ASN B 1 269 ? 16.681  8.683   18.980  1.00 20.88 ? 283 ASN B CG  1 
ATOM   5642  O  OD1 . ASN B 1 269 ? 16.702  7.460   19.171  1.00 19.66 ? 283 ASN B OD1 1 
ATOM   5643  N  ND2 . ASN B 1 269 ? 17.218  9.252   17.903  1.00 24.99 ? 283 ASN B ND2 1 
ATOM   5644  N  N   . PHE B 1 270 ? 16.877  7.691   22.884  1.00 23.18 ? 284 PHE B N   1 
ATOM   5645  C  CA  . PHE B 1 270 ? 17.679  7.593   24.092  1.00 26.10 ? 284 PHE B CA  1 
ATOM   5646  C  C   . PHE B 1 270 ? 18.860  6.637   23.934  1.00 26.57 ? 284 PHE B C   1 
ATOM   5647  O  O   . PHE B 1 270 ? 18.739  5.588   23.295  1.00 19.97 ? 284 PHE B O   1 
ATOM   5648  C  CB  . PHE B 1 270 ? 16.777  7.166   25.258  1.00 23.51 ? 284 PHE B CB  1 
ATOM   5649  C  CG  . PHE B 1 270 ? 17.526  6.810   26.526  1.00 26.70 ? 284 PHE B CG  1 
ATOM   5650  C  CD1 . PHE B 1 270 ? 17.914  5.494   26.774  1.00 27.05 ? 284 PHE B CD1 1 
ATOM   5651  C  CD2 . PHE B 1 270 ? 17.814  7.774   27.471  1.00 33.40 ? 284 PHE B CD2 1 
ATOM   5652  C  CE1 . PHE B 1 270 ? 18.589  5.164   27.937  1.00 28.70 ? 284 PHE B CE1 1 
ATOM   5653  C  CE2 . PHE B 1 270 ? 18.493  7.450   28.644  1.00 34.76 ? 284 PHE B CE2 1 
ATOM   5654  C  CZ  . PHE B 1 270 ? 18.873  6.143   28.877  1.00 32.55 ? 284 PHE B CZ  1 
ATOM   5655  N  N   . THR B 1 271 ? 20.004  7.025   24.493  1.00 23.61 ? 285 THR B N   1 
ATOM   5656  C  CA  . THR B 1 271 ? 21.088  6.072   24.747  1.00 31.79 ? 285 THR B CA  1 
ATOM   5657  C  C   . THR B 1 271 ? 21.467  6.177   26.215  1.00 29.39 ? 285 THR B C   1 
ATOM   5658  O  O   . THR B 1 271 ? 21.473  7.267   26.771  1.00 31.71 ? 285 THR B O   1 
ATOM   5659  C  CB  . THR B 1 271 ? 22.327  6.307   23.863  1.00 32.84 ? 285 THR B CB  1 
ATOM   5660  O  OG1 . THR B 1 271 ? 21.959  6.184   22.491  1.00 34.48 ? 285 THR B OG1 1 
ATOM   5661  C  CG2 . THR B 1 271 ? 23.388  5.257   24.146  1.00 31.96 ? 285 THR B CG2 1 
ATOM   5662  N  N   . GLY B 1 272 ? 21.744  5.042   26.853  1.00 28.63 ? 286 GLY B N   1 
ATOM   5663  C  CA  . GLY B 1 272 ? 22.086  5.043   28.264  1.00 25.10 ? 286 GLY B CA  1 
ATOM   5664  C  C   . GLY B 1 272 ? 21.718  3.751   28.959  1.00 25.23 ? 286 GLY B C   1 
ATOM   5665  O  O   . GLY B 1 272 ? 21.597  2.714   28.318  1.00 29.43 ? 286 GLY B O   1 
ATOM   5666  N  N   . SER B 1 273 ? 21.525  3.810   30.272  1.00 25.07 ? 287 SER B N   1 
ATOM   5667  C  CA  . SER B 1 273 ? 21.292  2.605   31.054  1.00 28.15 ? 287 SER B CA  1 
ATOM   5668  C  C   . SER B 1 273 ? 19.883  2.046   30.871  1.00 29.88 ? 287 SER B C   1 
ATOM   5669  O  O   . SER B 1 273 ? 18.927  2.788   30.613  1.00 22.48 ? 287 SER B O   1 
ATOM   5670  C  CB  . SER B 1 273 ? 21.546  2.879   32.535  1.00 30.36 ? 287 SER B CB  1 
ATOM   5671  O  OG  . SER B 1 273 ? 20.443  3.543   33.129  1.00 30.52 ? 287 SER B OG  1 
ATOM   5672  N  N   . VAL B 1 274 ? 19.760  0.729   31.012  1.00 28.67 ? 288 VAL B N   1 
ATOM   5673  C  CA  . VAL B 1 274 ? 18.452  0.082   30.974  1.00 27.55 ? 288 VAL B CA  1 
ATOM   5674  C  C   . VAL B 1 274 ? 17.479  0.610   32.037  1.00 29.04 ? 288 VAL B C   1 
ATOM   5675  O  O   . VAL B 1 274 ? 16.321  0.865   31.727  1.00 34.05 ? 288 VAL B O   1 
ATOM   5676  C  CB  . VAL B 1 274 ? 18.551  -1.465  31.028  1.00 38.28 ? 288 VAL B CB  1 
ATOM   5677  C  CG1 . VAL B 1 274 ? 17.158  -2.093  30.946  1.00 29.91 ? 288 VAL B CG1 1 
ATOM   5678  C  CG2 . VAL B 1 274 ? 19.435  -1.978  29.906  1.00 40.51 ? 288 VAL B CG2 1 
ATOM   5679  N  N   . PRO B 1 275 ? 17.940  0.788   33.292  1.00 33.22 ? 289 PRO B N   1 
ATOM   5680  C  CA  . PRO B 1 275 ? 17.047  1.387   34.298  1.00 30.77 ? 289 PRO B CA  1 
ATOM   5681  C  C   . PRO B 1 275 ? 16.487  2.764   33.920  1.00 28.33 ? 289 PRO B C   1 
ATOM   5682  O  O   . PRO B 1 275 ? 15.304  3.034   34.136  1.00 29.36 ? 289 PRO B O   1 
ATOM   5683  C  CB  . PRO B 1 275 ? 17.958  1.523   35.521  1.00 36.78 ? 289 PRO B CB  1 
ATOM   5684  C  CG  . PRO B 1 275 ? 18.912  0.400   35.382  1.00 40.16 ? 289 PRO B CG  1 
ATOM   5685  C  CD  . PRO B 1 275 ? 19.172  0.258   33.911  1.00 34.89 ? 289 PRO B CD  1 
ATOM   5686  N  N   . THR B 1 276 ? 17.333  3.632   33.378  1.00 27.15 ? 290 THR B N   1 
ATOM   5687  C  CA  . THR B 1 276 ? 16.883  4.955   32.965  1.00 27.80 ? 290 THR B CA  1 
ATOM   5688  C  C   . THR B 1 276 ? 15.840  4.873   31.858  1.00 25.17 ? 290 THR B C   1 
ATOM   5689  O  O   . THR B 1 276 ? 14.822  5.552   31.917  1.00 24.84 ? 290 THR B O   1 
ATOM   5690  C  CB  . THR B 1 276 ? 18.059  5.818   32.493  1.00 31.00 ? 290 THR B CB  1 
ATOM   5691  O  OG1 . THR B 1 276 ? 19.065  5.817   33.510  1.00 32.40 ? 290 THR B OG1 1 
ATOM   5692  C  CG2 . THR B 1 276 ? 17.601  7.249   32.237  1.00 37.31 ? 290 THR B CG2 1 
ATOM   5693  N  N   . PHE B 1 277 ? 16.099  4.031   30.860  1.00 25.47 ? 291 PHE B N   1 
ATOM   5694  C  CA  . PHE B 1 277 ? 15.167  3.846   29.748  1.00 23.72 ? 291 PHE B CA  1 
ATOM   5695  C  C   . PHE B 1 277 ? 13.846  3.277   30.255  1.00 22.14 ? 291 PHE B C   1 
ATOM   5696  O  O   . PHE B 1 277 ? 12.777  3.735   29.868  1.00 22.40 ? 291 PHE B O   1 
ATOM   5697  C  CB  . PHE B 1 277 ? 15.763  2.954   28.648  1.00 25.17 ? 291 PHE B CB  1 
ATOM   5698  C  CG  . PHE B 1 277 ? 14.866  2.809   27.440  1.00 25.87 ? 291 PHE B CG  1 
ATOM   5699  C  CD1 . PHE B 1 277 ? 14.571  3.913   26.646  1.00 23.33 ? 291 PHE B CD1 1 
ATOM   5700  C  CD2 . PHE B 1 277 ? 14.313  1.581   27.107  1.00 26.70 ? 291 PHE B CD2 1 
ATOM   5701  C  CE1 . PHE B 1 277 ? 13.731  3.800   25.537  1.00 19.81 ? 291 PHE B CE1 1 
ATOM   5702  C  CE2 . PHE B 1 277 ? 13.476  1.457   25.996  1.00 25.31 ? 291 PHE B CE2 1 
ATOM   5703  C  CZ  . PHE B 1 277 ? 13.189  2.579   25.205  1.00 16.03 ? 291 PHE B CZ  1 
ATOM   5704  N  N   . LYS B 1 278 ? 13.923  2.296   31.147  1.00 21.78 ? 292 LYS B N   1 
ATOM   5705  C  CA  . LYS B 1 278 ? 12.727  1.773   31.796  1.00 26.97 ? 292 LYS B CA  1 
ATOM   5706  C  C   . LYS B 1 278 ? 11.922  2.854   32.537  1.00 28.62 ? 292 LYS B C   1 
ATOM   5707  O  O   . LYS B 1 278 ? 10.681  2.863   32.486  1.00 22.64 ? 292 LYS B O   1 
ATOM   5708  C  CB  . LYS B 1 278 ? 13.083  0.605   32.723  1.00 26.42 ? 292 LYS B CB  1 
ATOM   5709  C  CG  . LYS B 1 278 ? 13.423  -0.687  31.981  1.00 24.68 ? 292 LYS B CG  1 
ATOM   5710  C  CD  . LYS B 1 278 ? 13.507  -1.873  32.938  1.00 24.63 ? 292 LYS B CD  1 
ATOM   5711  N  N   . HIS B 1 279 ? 12.621  3.768   33.210  1.00 25.05 ? 293 HIS B N   1 
ATOM   5712  C  CA  . HIS B 1 279 ? 11.963  4.859   33.922  1.00 22.50 ? 293 HIS B CA  1 
ATOM   5713  C  C   . HIS B 1 279 ? 11.202  5.763   32.964  1.00 25.13 ? 293 HIS B C   1 
ATOM   5714  O  O   . HIS B 1 279 ? 10.059  6.136   33.227  1.00 23.70 ? 293 HIS B O   1 
ATOM   5715  C  CB  . HIS B 1 279 ? 12.976  5.698   34.714  1.00 29.08 ? 293 HIS B CB  1 
ATOM   5716  C  CG  . HIS B 1 279 ? 12.350  6.786   35.532  1.00 33.57 ? 293 HIS B CG  1 
ATOM   5717  N  ND1 . HIS B 1 279 ? 11.570  6.530   36.640  1.00 36.68 ? 293 HIS B ND1 1 
ATOM   5718  C  CD2 . HIS B 1 279 ? 12.392  8.135   35.407  1.00 36.54 ? 293 HIS B CD2 1 
ATOM   5719  C  CE1 . HIS B 1 279 ? 11.157  7.672   37.160  1.00 40.03 ? 293 HIS B CE1 1 
ATOM   5720  N  NE2 . HIS B 1 279 ? 11.640  8.662   36.429  1.00 39.57 ? 293 HIS B NE2 1 
ATOM   5721  N  N   . LEU B 1 280 ? 11.846  6.117   31.854  1.00 24.44 ? 294 LEU B N   1 
ATOM   5722  C  CA  . LEU B 1 280 ? 11.242  7.002   30.862  1.00 23.81 ? 294 LEU B CA  1 
ATOM   5723  C  C   . LEU B 1 280 ? 10.003  6.366   30.236  1.00 21.74 ? 294 LEU B C   1 
ATOM   5724  O  O   . LEU B 1 280 ? 8.972   7.023   30.045  1.00 23.95 ? 294 LEU B O   1 
ATOM   5725  C  CB  . LEU B 1 280 ? 12.256  7.333   29.775  1.00 23.40 ? 294 LEU B CB  1 
ATOM   5726  C  CG  . LEU B 1 280 ? 13.380  8.256   30.238  1.00 22.03 ? 294 LEU B CG  1 
ATOM   5727  C  CD1 . LEU B 1 280 ? 14.468  8.324   29.174  1.00 20.53 ? 294 LEU B CD1 1 
ATOM   5728  C  CD2 . LEU B 1 280 ? 12.830  9.643   30.565  1.00 16.49 ? 294 LEU B CD2 1 
ATOM   5729  N  N   . TRP B 1 281 ? 10.132  5.082   29.929  1.00 20.61 ? 295 TRP B N   1 
ATOM   5730  C  CA  . TRP B 1 281 ? 9.051   4.278   29.367  1.00 19.69 ? 295 TRP B CA  1 
ATOM   5731  C  C   . TRP B 1 281 ? 7.860   4.307   30.313  1.00 20.78 ? 295 TRP B C   1 
ATOM   5732  O  O   . TRP B 1 281 ? 6.737   4.579   29.887  1.00 22.51 ? 295 TRP B O   1 
ATOM   5733  C  CB  . TRP B 1 281 ? 9.566   2.851   29.112  1.00 16.60 ? 295 TRP B CB  1 
ATOM   5734  C  CG  . TRP B 1 281 ? 8.609   1.885   28.440  1.00 24.09 ? 295 TRP B CG  1 
ATOM   5735  C  CD1 . TRP B 1 281 ? 7.244   1.860   28.525  1.00 26.56 ? 295 TRP B CD1 1 
ATOM   5736  C  CD2 . TRP B 1 281 ? 8.976   0.789   27.600  1.00 25.98 ? 295 TRP B CD2 1 
ATOM   5737  N  NE1 . TRP B 1 281 ? 6.741   0.818   27.785  1.00 26.99 ? 295 TRP B NE1 1 
ATOM   5738  C  CE2 . TRP B 1 281 ? 7.785   0.148   27.203  1.00 24.31 ? 295 TRP B CE2 1 
ATOM   5739  C  CE3 . TRP B 1 281 ? 10.203  0.293   27.135  1.00 25.28 ? 295 TRP B CE3 1 
ATOM   5740  C  CZ2 . TRP B 1 281 ? 7.781   -0.974  26.373  1.00 27.62 ? 295 TRP B CZ2 1 
ATOM   5741  C  CZ3 . TRP B 1 281 ? 10.202  -0.818  26.309  1.00 28.99 ? 295 TRP B CZ3 1 
ATOM   5742  C  CH2 . TRP B 1 281 ? 8.996   -1.439  25.931  1.00 34.08 ? 295 TRP B CH2 1 
ATOM   5743  N  N   . LYS B 1 282 ? 8.103   4.067   31.598  1.00 21.12 ? 296 LYS B N   1 
ATOM   5744  C  CA  . LYS B 1 282 ? 7.040   4.131   32.604  1.00 19.74 ? 296 LYS B CA  1 
ATOM   5745  C  C   . LYS B 1 282 ? 6.384   5.499   32.700  1.00 27.30 ? 296 LYS B C   1 
ATOM   5746  O  O   . LYS B 1 282 ? 5.161   5.589   32.839  1.00 22.75 ? 296 LYS B O   1 
ATOM   5747  C  CB  . LYS B 1 282 ? 7.562   3.713   33.986  1.00 24.32 ? 296 LYS B CB  1 
ATOM   5748  C  CG  . LYS B 1 282 ? 7.880   2.226   34.081  1.00 26.96 ? 296 LYS B CG  1 
ATOM   5749  C  CD  . LYS B 1 282 ? 8.370   1.837   35.467  1.00 26.89 ? 296 LYS B CD  1 
ATOM   5750  C  CE  . LYS B 1 282 ? 8.518   0.319   35.578  1.00 31.83 ? 296 LYS B CE  1 
ATOM   5751  N  NZ  . LYS B 1 282 ? 9.065   -0.094  36.898  1.00 36.05 ? 296 LYS B NZ  1 
ATOM   5752  N  N   . GLN B 1 283 ? 7.194   6.561   32.650  1.00 19.60 ? 297 GLN B N   1 
ATOM   5753  C  CA  . GLN B 1 283 ? 6.658   7.913   32.682  1.00 21.03 ? 297 GLN B CA  1 
ATOM   5754  C  C   . GLN B 1 283 ? 5.769   8.191   31.469  1.00 18.75 ? 297 GLN B C   1 
ATOM   5755  O  O   . GLN B 1 283 ? 4.728   8.856   31.587  1.00 24.18 ? 297 GLN B O   1 
ATOM   5756  C  CB  . GLN B 1 283 ? 7.786   8.956   32.770  1.00 23.51 ? 297 GLN B CB  1 
ATOM   5757  C  CG  . GLN B 1 283 ? 8.464   9.041   34.131  1.00 27.84 ? 297 GLN B CG  1 
ATOM   5758  C  CD  . GLN B 1 283 ? 9.556   10.111  34.166  1.00 32.52 ? 297 GLN B CD  1 
ATOM   5759  O  OE1 . GLN B 1 283 ? 10.433  10.142  33.311  1.00 32.09 ? 297 GLN B OE1 1 
ATOM   5760  N  NE2 . GLN B 1 283 ? 9.492   10.994  35.153  1.00 33.70 ? 297 GLN B NE2 1 
ATOM   5761  N  N   . VAL B 1 284 ? 6.185   7.707   30.306  1.00 20.39 ? 298 VAL B N   1 
ATOM   5762  C  CA  . VAL B 1 284 ? 5.388   7.903   29.102  1.00 18.28 ? 298 VAL B CA  1 
ATOM   5763  C  C   . VAL B 1 284 ? 4.059   7.166   29.276  1.00 18.78 ? 298 VAL B C   1 
ATOM   5764  O  O   . VAL B 1 284 ? 2.986   7.710   29.002  1.00 21.90 ? 298 VAL B O   1 
ATOM   5765  C  CB  . VAL B 1 284 ? 6.131   7.428   27.842  1.00 20.03 ? 298 VAL B CB  1 
ATOM   5766  C  CG1 . VAL B 1 284 ? 5.173   7.340   26.666  1.00 24.67 ? 298 VAL B CG1 1 
ATOM   5767  C  CG2 . VAL B 1 284 ? 7.286   8.387   27.509  1.00 18.47 ? 298 VAL B CG2 1 
ATOM   5768  N  N   . ALA B 1 285 ? 4.123   5.941   29.768  1.00 20.43 ? 299 ALA B N   1 
ATOM   5769  C  CA  . ALA B 1 285 ? 2.885   5.196   30.027  1.00 21.15 ? 299 ALA B CA  1 
ATOM   5770  C  C   . ALA B 1 285 ? 1.973   5.915   31.026  1.00 27.92 ? 299 ALA B C   1 
ATOM   5771  O  O   . ALA B 1 285 ? 0.770   6.004   30.811  1.00 24.25 ? 299 ALA B O   1 
ATOM   5772  C  CB  . ALA B 1 285 ? 3.196   3.816   30.509  1.00 22.72 ? 299 ALA B CB  1 
ATOM   5773  N  N   . GLN B 1 286 ? 2.549   6.432   32.109  1.00 29.18 ? 300 GLN B N   1 
ATOM   5774  C  CA  . GLN B 1 286 ? 1.774   7.138   33.130  1.00 29.61 ? 300 GLN B CA  1 
ATOM   5775  C  C   . GLN B 1 286 ? 0.995   8.316   32.525  1.00 34.21 ? 300 GLN B C   1 
ATOM   5776  O  O   . GLN B 1 286 ? -0.153  8.581   32.892  1.00 31.33 ? 300 GLN B O   1 
ATOM   5777  C  CB  . GLN B 1 286 ? 2.701   7.641   34.243  1.00 29.78 ? 300 GLN B CB  1 
ATOM   5778  C  CG  . GLN B 1 286 ? 2.015   8.521   35.278  1.00 40.74 ? 300 GLN B CG  1 
ATOM   5779  C  CD  . GLN B 1 286 ? 2.990   9.127   36.274  1.00 52.63 ? 300 GLN B CD  1 
ATOM   5780  O  OE1 . GLN B 1 286 ? 2.689   9.241   37.461  1.00 58.54 ? 300 GLN B OE1 1 
ATOM   5781  N  NE2 . GLN B 1 286 ? 4.164   9.520   35.793  1.00 57.58 ? 300 GLN B NE2 1 
ATOM   5782  N  N   . ASN B 1 287 ? 1.624   8.999   31.574  1.00 23.40 ? 301 ASN B N   1 
ATOM   5783  C  CA  . ASN B 1 287 ? 1.026   10.170  30.946  1.00 26.38 ? 301 ASN B CA  1 
ATOM   5784  C  C   . ASN B 1 287 ? 0.311   9.876   29.621  1.00 29.50 ? 301 ASN B C   1 
ATOM   5785  O  O   . ASN B 1 287 ? -0.014  10.808  28.874  1.00 28.61 ? 301 ASN B O   1 
ATOM   5786  C  CB  . ASN B 1 287 ? 2.118   11.219  30.706  1.00 28.38 ? 301 ASN B CB  1 
ATOM   5787  C  CG  . ASN B 1 287 ? 2.574   11.893  31.997  1.00 47.03 ? 301 ASN B CG  1 
ATOM   5788  O  OD1 . ASN B 1 287 ? 1.949   12.848  32.463  1.00 58.15 ? 301 ASN B OD1 1 
ATOM   5789  N  ND2 . ASN B 1 287 ? 3.669   11.401  32.575  1.00 48.83 ? 301 ASN B ND2 1 
ATOM   5790  N  N   . LEU B 1 288 ? 0.080   8.596   29.326  1.00 23.56 ? 302 LEU B N   1 
ATOM   5791  C  CA  . LEU B 1 288 ? -0.401  8.175   27.996  1.00 24.03 ? 302 LEU B CA  1 
ATOM   5792  C  C   . LEU B 1 288 ? -1.657  8.930   27.530  1.00 29.51 ? 302 LEU B C   1 
ATOM   5793  O  O   . LEU B 1 288 ? -1.759  9.319   26.371  1.00 28.17 ? 302 LEU B O   1 
ATOM   5794  C  CB  . LEU B 1 288 ? -0.655  6.669   27.954  1.00 25.66 ? 302 LEU B CB  1 
ATOM   5795  C  CG  . LEU B 1 288 ? -0.570  6.012   26.571  1.00 27.23 ? 302 LEU B CG  1 
ATOM   5796  C  CD1 . LEU B 1 288 ? 0.774   6.287   25.888  1.00 25.55 ? 302 LEU B CD1 1 
ATOM   5797  C  CD2 . LEU B 1 288 ? -0.796  4.516   26.685  1.00 29.68 ? 302 LEU B CD2 1 
ATOM   5798  N  N   . ASP B 1 289 ? -2.593  9.153   28.444  1.00 27.43 ? 303 ASP B N   1 
ATOM   5799  C  CA  . ASP B 1 289 ? -3.848  9.819   28.102  1.00 33.59 ? 303 ASP B CA  1 
ATOM   5800  C  C   . ASP B 1 289 ? -3.682  11.308  27.770  1.00 31.42 ? 303 ASP B C   1 
ATOM   5801  O  O   . ASP B 1 289 ? -4.582  11.922  27.209  1.00 40.38 ? 303 ASP B O   1 
ATOM   5802  C  CB  . ASP B 1 289 ? -4.875  9.634   29.226  1.00 36.53 ? 303 ASP B CB  1 
ATOM   5803  C  CG  . ASP B 1 289 ? -5.267  8.173   29.426  1.00 44.22 ? 303 ASP B CG  1 
ATOM   5804  O  OD1 . ASP B 1 289 ? -5.429  7.453   28.416  1.00 44.11 ? 303 ASP B OD1 1 
ATOM   5805  O  OD2 . ASP B 1 289 ? -5.405  7.739   30.590  1.00 42.59 ? 303 ASP B OD2 1 
ATOM   5806  N  N   . ARG B 1 290 ? -2.534  11.889  28.105  1.00 28.20 ? 304 ARG B N   1 
ATOM   5807  C  CA  . ARG B 1 290 ? -2.334  13.329  27.920  1.00 29.97 ? 304 ARG B CA  1 
ATOM   5808  C  C   . ARG B 1 290 ? -1.682  13.697  26.586  1.00 29.43 ? 304 ARG B C   1 
ATOM   5809  O  O   . ARG B 1 290 ? -1.676  14.864  26.203  1.00 29.38 ? 304 ARG B O   1 
ATOM   5810  C  CB  . ARG B 1 290 ? -1.500  13.915  29.067  1.00 35.33 ? 304 ARG B CB  1 
ATOM   5811  C  CG  . ARG B 1 290 ? -2.184  13.873  30.421  1.00 38.90 ? 304 ARG B CG  1 
ATOM   5812  C  CD  . ARG B 1 290 ? -1.350  14.550  31.516  1.00 42.63 ? 304 ARG B CD  1 
ATOM   5813  N  NE  . ARG B 1 290 ? -2.009  14.392  32.809  1.00 53.08 ? 304 ARG B NE  1 
ATOM   5814  C  CZ  . ARG B 1 290 ? -1.650  13.502  33.730  1.00 55.85 ? 304 ARG B CZ  1 
ATOM   5815  N  NH1 . ARG B 1 290 ? -2.326  13.415  34.867  1.00 55.26 ? 304 ARG B NH1 1 
ATOM   5816  N  NH2 . ARG B 1 290 ? -0.612  12.702  33.520  1.00 53.55 ? 304 ARG B NH2 1 
ATOM   5817  N  N   . PHE B 1 291 ? -1.114  12.717  25.891  1.00 27.29 ? 305 PHE B N   1 
ATOM   5818  C  CA  . PHE B 1 291 ? -0.379  13.005  24.659  1.00 26.98 ? 305 PHE B CA  1 
ATOM   5819  C  C   . PHE B 1 291 ? -1.313  13.168  23.466  1.00 30.53 ? 305 PHE B C   1 
ATOM   5820  O  O   . PHE B 1 291 ? -2.281  12.438  23.343  1.00 28.22 ? 305 PHE B O   1 
ATOM   5821  C  CB  . PHE B 1 291 ? 0.612   11.887  24.339  1.00 21.19 ? 305 PHE B CB  1 
ATOM   5822  C  CG  . PHE B 1 291 ? 1.654   11.661  25.399  1.00 25.98 ? 305 PHE B CG  1 
ATOM   5823  C  CD1 . PHE B 1 291 ? 2.539   12.677  25.759  1.00 25.17 ? 305 PHE B CD1 1 
ATOM   5824  C  CD2 . PHE B 1 291 ? 1.781   10.412  26.002  1.00 25.45 ? 305 PHE B CD2 1 
ATOM   5825  C  CE1 . PHE B 1 291 ? 3.506   12.458  26.732  1.00 26.38 ? 305 PHE B CE1 1 
ATOM   5826  C  CE2 . PHE B 1 291 ? 2.739   10.187  26.963  1.00 25.88 ? 305 PHE B CE2 1 
ATOM   5827  C  CZ  . PHE B 1 291 ? 3.613   11.213  27.325  1.00 25.30 ? 305 PHE B CZ  1 
ATOM   5828  N  N   . HIS B 1 292 ? -1.002  14.099  22.569  1.00 26.78 ? 306 HIS B N   1 
ATOM   5829  C  CA  . HIS B 1 292 ? -1.816  14.266  21.372  1.00 34.18 ? 306 HIS B CA  1 
ATOM   5830  C  C   . HIS B 1 292 ? -1.526  13.174  20.354  1.00 34.55 ? 306 HIS B C   1 
ATOM   5831  O  O   . HIS B 1 292 ? -2.362  12.869  19.510  1.00 29.28 ? 306 HIS B O   1 
ATOM   5832  C  CB  . HIS B 1 292 ? -1.635  15.662  20.771  1.00 37.46 ? 306 HIS B CB  1 
ATOM   5833  C  CG  . HIS B 1 292 ? -2.112  16.758  21.667  1.00 44.67 ? 306 HIS B CG  1 
ATOM   5834  N  ND1 . HIS B 1 292 ? -3.439  16.909  22.012  1.00 50.50 ? 306 HIS B ND1 1 
ATOM   5835  C  CD2 . HIS B 1 292 ? -1.443  17.745  22.305  1.00 51.23 ? 306 HIS B CD2 1 
ATOM   5836  C  CE1 . HIS B 1 292 ? -3.566  17.946  22.819  1.00 51.71 ? 306 HIS B CE1 1 
ATOM   5837  N  NE2 . HIS B 1 292 ? -2.370  18.474  23.011  1.00 53.97 ? 306 HIS B NE2 1 
ATOM   5838  N  N   . THR B 1 293 ? -0.343  12.572  20.447  1.00 29.69 ? 307 THR B N   1 
ATOM   5839  C  CA  . THR B 1 293 ? -0.017  11.417  19.622  1.00 35.46 ? 307 THR B CA  1 
ATOM   5840  C  C   . THR B 1 293 ? 0.759   10.381  20.457  1.00 34.89 ? 307 THR B C   1 
ATOM   5841  O  O   . THR B 1 293 ? 1.354   10.738  21.468  1.00 36.82 ? 307 THR B O   1 
ATOM   5842  C  CB  . THR B 1 293 ? 0.755   11.844  18.358  1.00 37.24 ? 307 THR B CB  1 
ATOM   5843  O  OG1 . THR B 1 293 ? 0.574   10.868  17.325  1.00 39.71 ? 307 THR B OG1 1 
ATOM   5844  C  CG2 . THR B 1 293 ? 2.236   12.016  18.653  1.00 36.26 ? 307 THR B CG2 1 
ATOM   5845  N  N   . PHE B 1 294 ? 0.730   9.109   20.056  1.00 32.51 ? 308 PHE B N   1 
ATOM   5846  C  CA  . PHE B 1 294 ? 1.431   8.045   20.787  1.00 30.25 ? 308 PHE B CA  1 
ATOM   5847  C  C   . PHE B 1 294 ? 2.942   8.192   20.655  1.00 23.70 ? 308 PHE B C   1 
ATOM   5848  O  O   . PHE B 1 294 ? 3.476   8.043   19.561  1.00 20.86 ? 308 PHE B O   1 
ATOM   5849  C  CB  . PHE B 1 294 ? 1.058   6.668   20.243  1.00 41.71 ? 308 PHE B CB  1 
ATOM   5850  C  CG  . PHE B 1 294 ? 0.021   5.943   21.057  1.00 46.29 ? 308 PHE B CG  1 
ATOM   5851  C  CD1 . PHE B 1 294 ? -1.313  5.978   20.689  1.00 49.39 ? 308 PHE B CD1 1 
ATOM   5852  C  CD2 . PHE B 1 294 ? 0.388   5.214   22.173  1.00 51.87 ? 308 PHE B CD2 1 
ATOM   5853  C  CE1 . PHE B 1 294 ? -2.269  5.312   21.429  1.00 55.35 ? 308 PHE B CE1 1 
ATOM   5854  C  CE2 . PHE B 1 294 ? -0.558  4.540   22.915  1.00 54.56 ? 308 PHE B CE2 1 
ATOM   5855  C  CZ  . PHE B 1 294 ? -1.890  4.590   22.543  1.00 56.56 ? 308 PHE B CZ  1 
ATOM   5856  N  N   . PRO B 1 295 ? 3.638   8.466   21.765  1.00 25.07 ? 309 PRO B N   1 
ATOM   5857  C  CA  . PRO B 1 295 ? 5.093   8.656   21.663  1.00 24.65 ? 309 PRO B CA  1 
ATOM   5858  C  C   . PRO B 1 295 ? 5.824   7.383   21.272  1.00 25.65 ? 309 PRO B C   1 
ATOM   5859  O  O   . PRO B 1 295 ? 5.534   6.309   21.794  1.00 27.21 ? 309 PRO B O   1 
ATOM   5860  C  CB  . PRO B 1 295 ? 5.494   9.055   23.084  1.00 23.44 ? 309 PRO B CB  1 
ATOM   5861  C  CG  . PRO B 1 295 ? 4.259   9.689   23.643  1.00 27.47 ? 309 PRO B CG  1 
ATOM   5862  C  CD  . PRO B 1 295 ? 3.139   8.821   23.102  1.00 26.17 ? 309 PRO B CD  1 
ATOM   5863  N  N   . ARG B 1 296 ? 6.774   7.509   20.360  1.00 25.02 ? 310 ARG B N   1 
ATOM   5864  C  CA  . ARG B 1 296 ? 7.600   6.381   19.987  1.00 19.80 ? 310 ARG B CA  1 
ATOM   5865  C  C   . ARG B 1 296 ? 8.868   6.415   20.808  1.00 24.58 ? 310 ARG B C   1 
ATOM   5866  O  O   . ARG B 1 296 ? 9.460   7.479   21.002  1.00 24.66 ? 310 ARG B O   1 
ATOM   5867  C  CB  . ARG B 1 296 ? 7.915   6.430   18.497  1.00 20.80 ? 310 ARG B CB  1 
ATOM   5868  C  CG  . ARG B 1 296 ? 6.658   6.569   17.658  1.00 26.54 ? 310 ARG B CG  1 
ATOM   5869  C  CD  . ARG B 1 296 ? 6.943   6.374   16.192  1.00 28.53 ? 310 ARG B CD  1 
ATOM   5870  N  NE  . ARG B 1 296 ? 5.717   6.418   15.403  1.00 29.82 ? 310 ARG B NE  1 
ATOM   5871  C  CZ  . ARG B 1 296 ? 5.693   6.358   14.075  1.00 32.41 ? 310 ARG B CZ  1 
ATOM   5872  N  NH1 . ARG B 1 296 ? 6.831   6.247   13.400  1.00 27.11 ? 310 ARG B NH1 1 
ATOM   5873  N  NH2 . ARG B 1 296 ? 4.539   6.405   13.419  1.00 32.11 ? 310 ARG B NH2 1 
ATOM   5874  N  N   . LEU B 1 297 ? 9.288   5.243   21.276  1.00 17.86 ? 311 LEU B N   1 
ATOM   5875  C  CA  . LEU B 1 297 ? 10.430  5.152   22.166  1.00 25.38 ? 311 LEU B CA  1 
ATOM   5876  C  C   . LEU B 1 297 ? 11.575  4.371   21.522  1.00 26.44 ? 311 LEU B C   1 
ATOM   5877  O  O   . LEU B 1 297 ? 11.389  3.251   21.016  1.00 22.30 ? 311 LEU B O   1 
ATOM   5878  C  CB  . LEU B 1 297 ? 10.021  4.501   23.486  1.00 24.04 ? 311 LEU B CB  1 
ATOM   5879  C  CG  . LEU B 1 297 ? 8.878   5.179   24.238  1.00 30.54 ? 311 LEU B CG  1 
ATOM   5880  C  CD1 . LEU B 1 297 ? 8.566   4.417   25.515  1.00 34.30 ? 311 LEU B CD1 1 
ATOM   5881  C  CD2 . LEU B 1 297 ? 9.224   6.625   24.545  1.00 31.67 ? 311 LEU B CD2 1 
ATOM   5882  N  N   . ALA B 1 298 ? 12.758  4.977   21.536  1.00 19.36 ? 312 ALA B N   1 
ATOM   5883  C  CA  . ALA B 1 298 ? 13.935  4.345   20.964  1.00 25.87 ? 312 ALA B CA  1 
ATOM   5884  C  C   . ALA B 1 298 ? 15.040  4.328   21.998  1.00 24.54 ? 312 ALA B C   1 
ATOM   5885  O  O   . ALA B 1 298 ? 15.520  5.384   22.439  1.00 21.90 ? 312 ALA B O   1 
ATOM   5886  C  CB  . ALA B 1 298 ? 14.383  5.070   19.692  1.00 26.70 ? 312 ALA B CB  1 
ATOM   5887  N  N   . GLY B 1 299 ? 15.437  3.128   22.401  1.00 23.45 ? 313 GLY B N   1 
ATOM   5888  C  CA  . GLY B 1 299 ? 16.415  2.995   23.462  1.00 21.20 ? 313 GLY B CA  1 
ATOM   5889  C  C   . GLY B 1 299 ? 17.563  2.085   23.081  1.00 27.82 ? 313 GLY B C   1 
ATOM   5890  O  O   . GLY B 1 299 ? 17.369  0.938   22.677  1.00 33.12 ? 313 GLY B O   1 
ATOM   5891  N  N   . GLU B 1 300 ? 18.766  2.619   23.207  1.00 30.06 ? 314 GLU B N   1 
ATOM   5892  C  CA  . GLU B 1 300 ? 19.976  1.844   23.013  1.00 35.12 ? 314 GLU B CA  1 
ATOM   5893  C  C   . GLU B 1 300 ? 20.677  1.688   24.363  1.00 31.34 ? 314 GLU B C   1 
ATOM   5894  O  O   . GLU B 1 300 ? 21.224  2.655   24.890  1.00 31.26 ? 314 GLU B O   1 
ATOM   5895  C  CB  . GLU B 1 300 ? 20.889  2.553   22.015  1.00 36.27 ? 314 GLU B CB  1 
ATOM   5896  C  CG  . GLU B 1 300 ? 22.138  1.769   21.677  1.00 41.80 ? 314 GLU B CG  1 
ATOM   5897  C  CD  . GLU B 1 300 ? 23.025  2.492   20.685  1.00 41.76 ? 314 GLU B CD  1 
ATOM   5898  O  OE1 . GLU B 1 300 ? 22.862  3.721   20.527  1.00 30.59 ? 314 GLU B OE1 1 
ATOM   5899  O  OE2 . GLU B 1 300 ? 23.879  1.827   20.061  1.00 46.50 ? 314 GLU B OE2 1 
ATOM   5900  N  N   . CYS B 1 301 ? 20.640  0.473   24.913  1.00 38.64 ? 315 CYS B N   1 
ATOM   5901  C  CA  . CYS B 1 301 ? 21.209  0.176   26.233  1.00 44.63 ? 315 CYS B CA  1 
ATOM   5902  C  C   . CYS B 1 301 ? 21.820  -1.234  26.331  1.00 54.77 ? 315 CYS B C   1 
ATOM   5903  O  O   . CYS B 1 301 ? 21.565  -2.098  25.488  1.00 57.20 ? 315 CYS B O   1 
ATOM   5904  C  CB  . CYS B 1 301 ? 20.160  0.326   27.337  1.00 43.91 ? 315 CYS B CB  1 
ATOM   5905  S  SG  . CYS B 1 301 ? 18.524  0.881   26.842  1.00 44.53 ? 315 CYS B SG  1 
ATOM   5906  N  N   . GLY B 1 302 ? 22.590  -1.464  27.395  1.00 57.08 ? 316 GLY B N   1 
ATOM   5907  C  CA  . GLY B 1 302 ? 23.362  -2.690  27.564  1.00 53.30 ? 316 GLY B CA  1 
ATOM   5908  C  C   . GLY B 1 302 ? 24.818  -2.311  27.383  1.00 53.05 ? 316 GLY B C   1 
ATOM   5909  O  O   . GLY B 1 302 ? 25.104  -1.142  27.143  1.00 58.52 ? 316 GLY B O   1 
ATOM   5910  N  N   . GLY B 1 303 ? 25.748  -3.251  27.516  1.00 52.68 ? 317 GLY B N   1 
ATOM   5911  C  CA  . GLY B 1 303 ? 25.490  -4.604  27.962  1.00 47.49 ? 317 GLY B CA  1 
ATOM   5912  C  C   . GLY B 1 303 ? 26.814  -5.151  28.457  1.00 43.39 ? 317 GLY B C   1 
ATOM   5913  O  O   . GLY B 1 303 ? 27.829  -4.470  28.380  1.00 45.30 ? 317 GLY B O   1 
ATOM   5914  N  N   . LYS B 1 304 ? 26.827  -6.373  28.967  1.00 39.42 ? 318 LYS B N   1 
ATOM   5915  C  CA  . LYS B 1 304 ? 28.074  -6.939  29.474  1.00 35.45 ? 318 LYS B CA  1 
ATOM   5916  C  C   . LYS B 1 304 ? 28.636  -7.833  28.363  1.00 28.21 ? 318 LYS B C   1 
ATOM   5917  O  O   . LYS B 1 304 ? 28.322  -9.008  28.303  1.00 32.47 ? 318 LYS B O   1 
ATOM   5918  C  CB  . LYS B 1 304 ? 27.799  -7.726  30.761  1.00 35.07 ? 318 LYS B CB  1 
ATOM   5919  C  CG  . LYS B 1 304 ? 29.034  -8.210  31.534  1.00 31.69 ? 318 LYS B CG  1 
ATOM   5920  C  CD  . LYS B 1 304 ? 29.742  -7.088  32.324  1.00 32.96 ? 318 LYS B CD  1 
ATOM   5921  C  CE  . LYS B 1 304 ? 30.895  -7.661  33.180  1.00 24.80 ? 318 LYS B CE  1 
ATOM   5922  N  NZ  . LYS B 1 304 ? 31.790  -6.595  33.721  1.00 21.91 ? 318 LYS B NZ  1 
ATOM   5923  N  N   . ASN B 1 305 ? 29.443  -7.263  27.469  1.00 20.42 ? 319 ASN B N   1 
ATOM   5924  C  CA  . ASN B 1 305 ? 29.778  -7.959  26.226  1.00 23.34 ? 319 ASN B CA  1 
ATOM   5925  C  C   . ASN B 1 305 ? 30.896  -8.983  26.381  1.00 24.85 ? 319 ASN B C   1 
ATOM   5926  O  O   . ASN B 1 305 ? 31.798  -8.794  27.199  1.00 22.26 ? 319 ASN B O   1 
ATOM   5927  C  CB  . ASN B 1 305 ? 30.156  -6.963  25.149  1.00 22.65 ? 319 ASN B CB  1 
ATOM   5928  C  CG  . ASN B 1 305 ? 29.138  -5.843  25.009  1.00 19.72 ? 319 ASN B CG  1 
ATOM   5929  O  OD1 . ASN B 1 305 ? 27.994  -6.082  24.632  1.00 23.28 ? 319 ASN B OD1 1 
ATOM   5930  N  ND2 . ASN B 1 305 ? 29.561  -4.613  25.298  1.00 19.50 ? 319 ASN B ND2 1 
ATOM   5931  N  N   . PHE B 1 306 ? 30.861  -10.038 25.563  1.00 24.91 ? 320 PHE B N   1 
ATOM   5932  C  CA  . PHE B 1 306 ? 31.746  -11.193 25.768  1.00 20.41 ? 320 PHE B CA  1 
ATOM   5933  C  C   . PHE B 1 306 ? 32.617  -11.573 24.576  1.00 26.46 ? 320 PHE B C   1 
ATOM   5934  O  O   . PHE B 1 306 ? 32.263  -11.321 23.430  1.00 26.50 ? 320 PHE B O   1 
ATOM   5935  C  CB  . PHE B 1 306 ? 30.898  -12.410 26.129  1.00 20.80 ? 320 PHE B CB  1 
ATOM   5936  C  CG  . PHE B 1 306 ? 30.025  -12.880 25.001  1.00 24.39 ? 320 PHE B CG  1 
ATOM   5937  C  CD1 . PHE B 1 306 ? 30.489  -13.812 24.082  1.00 22.37 ? 320 PHE B CD1 1 
ATOM   5938  C  CD2 . PHE B 1 306 ? 28.740  -12.379 24.850  1.00 22.55 ? 320 PHE B CD2 1 
ATOM   5939  C  CE1 . PHE B 1 306 ? 29.690  -14.237 23.027  1.00 21.73 ? 320 PHE B CE1 1 
ATOM   5940  C  CE2 . PHE B 1 306 ? 27.932  -12.804 23.806  1.00 21.72 ? 320 PHE B CE2 1 
ATOM   5941  C  CZ  . PHE B 1 306 ? 28.410  -13.736 22.890  1.00 23.61 ? 320 PHE B CZ  1 
ATOM   5942  N  N   . HIS B 1 307 ? 33.754  -12.208 24.872  1.00 30.52 ? 321 HIS B N   1 
ATOM   5943  C  CA  . HIS B 1 307 ? 34.518  -12.971 23.887  1.00 25.44 ? 321 HIS B CA  1 
ATOM   5944  C  C   . HIS B 1 307 ? 34.587  -14.403 24.373  1.00 29.63 ? 321 HIS B C   1 
ATOM   5945  O  O   . HIS B 1 307 ? 35.053  -14.670 25.485  1.00 25.14 ? 321 HIS B O   1 
ATOM   5946  C  CB  . HIS B 1 307 ? 35.964  -12.466 23.760  1.00 26.97 ? 321 HIS B CB  1 
ATOM   5947  C  CG  . HIS B 1 307 ? 36.105  -11.173 23.025  1.00 22.32 ? 321 HIS B CG  1 
ATOM   5948  N  ND1 . HIS B 1 307 ? 37.331  -10.575 22.810  1.00 26.22 ? 321 HIS B ND1 1 
ATOM   5949  C  CD2 . HIS B 1 307 ? 35.183  -10.353 22.469  1.00 22.47 ? 321 HIS B CD2 1 
ATOM   5950  C  CE1 . HIS B 1 307 ? 37.155  -9.442  22.151  1.00 25.34 ? 321 HIS B CE1 1 
ATOM   5951  N  NE2 . HIS B 1 307 ? 35.861  -9.283  21.933  1.00 24.49 ? 321 HIS B NE2 1 
ATOM   5952  N  N   . PHE B 1 308 ? 34.129  -15.327 23.540  1.00 24.75 ? 322 PHE B N   1 
ATOM   5953  C  CA  . PHE B 1 308 ? 34.193  -16.725 23.881  1.00 28.26 ? 322 PHE B CA  1 
ATOM   5954  C  C   . PHE B 1 308 ? 35.310  -17.330 23.059  1.00 25.88 ? 322 PHE B C   1 
ATOM   5955  O  O   . PHE B 1 308 ? 35.385  -17.106 21.854  1.00 35.34 ? 322 PHE B O   1 
ATOM   5956  C  CB  . PHE B 1 308 ? 32.877  -17.413 23.540  1.00 24.70 ? 322 PHE B CB  1 
ATOM   5957  C  CG  . PHE B 1 308 ? 32.863  -18.868 23.874  1.00 25.81 ? 322 PHE B CG  1 
ATOM   5958  C  CD1 . PHE B 1 308 ? 32.560  -19.292 25.157  1.00 29.80 ? 322 PHE B CD1 1 
ATOM   5959  C  CD2 . PHE B 1 308 ? 33.156  -19.817 22.907  1.00 27.96 ? 322 PHE B CD2 1 
ATOM   5960  C  CE1 . PHE B 1 308 ? 32.539  -20.646 25.469  1.00 31.66 ? 322 PHE B CE1 1 
ATOM   5961  C  CE2 . PHE B 1 308 ? 33.133  -21.161 23.209  1.00 33.84 ? 322 PHE B CE2 1 
ATOM   5962  C  CZ  . PHE B 1 308 ? 32.834  -21.577 24.493  1.00 36.01 ? 322 PHE B CZ  1 
ATOM   5963  N  N   . VAL B 1 309 ? 36.178  -18.089 23.712  1.00 26.96 ? 323 VAL B N   1 
ATOM   5964  C  CA  . VAL B 1 309 ? 37.304  -18.712 23.029  1.00 31.79 ? 323 VAL B CA  1 
ATOM   5965  C  C   . VAL B 1 309 ? 37.185  -20.222 23.053  1.00 30.41 ? 323 VAL B C   1 
ATOM   5966  O  O   . VAL B 1 309 ? 36.967  -20.823 24.110  1.00 31.17 ? 323 VAL B O   1 
ATOM   5967  C  CB  . VAL B 1 309 ? 38.636  -18.326 23.682  1.00 31.70 ? 323 VAL B CB  1 
ATOM   5968  C  CG1 . VAL B 1 309 ? 39.790  -19.021 22.984  1.00 33.68 ? 323 VAL B CG1 1 
ATOM   5969  C  CG2 . VAL B 1 309 ? 38.817  -16.804 23.645  1.00 27.58 ? 323 VAL B CG2 1 
ATOM   5970  N  N   . HIS B 1 310 ? 37.321  -20.836 21.883  1.00 32.05 ? 324 HIS B N   1 
ATOM   5971  C  CA  . HIS B 1 310 ? 37.395  -22.289 21.803  1.00 36.93 ? 324 HIS B CA  1 
ATOM   5972  C  C   . HIS B 1 310 ? 38.858  -22.695 21.744  1.00 41.22 ? 324 HIS B C   1 
ATOM   5973  O  O   . HIS B 1 310 ? 39.694  -21.897 21.333  1.00 42.57 ? 324 HIS B O   1 
ATOM   5974  C  CB  . HIS B 1 310 ? 36.663  -22.803 20.572  1.00 36.80 ? 324 HIS B CB  1 
ATOM   5975  C  CG  . HIS B 1 310 ? 36.722  -24.289 20.430  1.00 35.00 ? 324 HIS B CG  1 
ATOM   5976  N  ND1 . HIS B 1 310 ? 37.490  -24.916 19.474  1.00 37.89 ? 324 HIS B ND1 1 
ATOM   5977  C  CD2 . HIS B 1 310 ? 36.136  -25.275 21.151  1.00 36.89 ? 324 HIS B CD2 1 
ATOM   5978  C  CE1 . HIS B 1 310 ? 37.362  -26.226 19.601  1.00 43.60 ? 324 HIS B CE1 1 
ATOM   5979  N  NE2 . HIS B 1 310 ? 36.538  -26.468 20.606  1.00 34.92 ? 324 HIS B NE2 1 
ATOM   5980  N  N   . ARG B 1 311 ? 39.185  -23.923 22.139  1.00 44.51 ? 325 ARG B N   1 
ATOM   5981  C  CA  . ARG B 1 311 ? 40.601  -24.295 22.246  1.00 42.59 ? 325 ARG B CA  1 
ATOM   5982  C  C   . ARG B 1 311 ? 41.326  -24.304 20.893  1.00 38.04 ? 325 ARG B C   1 
ATOM   5983  O  O   . ARG B 1 311 ? 42.559  -24.331 20.842  1.00 41.13 ? 325 ARG B O   1 
ATOM   5984  C  CB  . ARG B 1 311 ? 40.799  -25.612 23.017  1.00 46.50 ? 325 ARG B CB  1 
ATOM   5985  C  CG  . ARG B 1 311 ? 40.526  -26.891 22.239  1.00 46.09 ? 325 ARG B CG  1 
ATOM   5986  C  CD  . ARG B 1 311 ? 40.979  -28.119 23.048  1.00 51.00 ? 325 ARG B CD  1 
ATOM   5987  N  NE  . ARG B 1 311 ? 42.433  -28.277 23.066  1.00 54.54 ? 325 ARG B NE  1 
ATOM   5988  C  CZ  . ARG B 1 311 ? 43.109  -29.056 23.913  1.00 56.00 ? 325 ARG B CZ  1 
ATOM   5989  N  NH1 . ARG B 1 311 ? 42.475  -29.766 24.840  1.00 45.49 ? 325 ARG B NH1 1 
ATOM   5990  N  NH2 . ARG B 1 311 ? 44.432  -29.123 23.834  1.00 61.97 ? 325 ARG B NH2 1 
ATOM   5991  N  N   . SER B 1 312 ? 40.558  -24.242 19.808  1.00 36.30 ? 326 SER B N   1 
ATOM   5992  C  CA  . SER B 1 312 ? 41.117  -24.210 18.458  1.00 44.95 ? 326 SER B CA  1 
ATOM   5993  C  C   . SER B 1 312 ? 41.447  -22.791 17.993  1.00 44.60 ? 326 SER B C   1 
ATOM   5994  O  O   . SER B 1 312 ? 41.899  -22.593 16.860  1.00 36.20 ? 326 SER B O   1 
ATOM   5995  C  CB  . SER B 1 312 ? 40.134  -24.827 17.463  1.00 46.02 ? 326 SER B CB  1 
ATOM   5996  O  OG  . SER B 1 312 ? 38.994  -23.992 17.300  1.00 50.38 ? 326 SER B OG  1 
ATOM   5997  N  N   . ALA B 1 313 ? 41.207  -21.806 18.853  1.00 46.35 ? 327 ALA B N   1 
ATOM   5998  C  CA  . ALA B 1 313 ? 41.379  -20.402 18.469  1.00 40.46 ? 327 ALA B CA  1 
ATOM   5999  C  C   . ALA B 1 313 ? 42.832  -20.024 18.221  1.00 38.63 ? 327 ALA B C   1 
ATOM   6000  O  O   . ALA B 1 313 ? 43.742  -20.581 18.834  1.00 37.49 ? 327 ALA B O   1 
ATOM   6001  C  CB  . ALA B 1 313 ? 40.793  -19.475 19.521  1.00 31.38 ? 327 ALA B CB  1 
ATOM   6002  N  N   . ASP B 1 314 ? 43.028  -19.067 17.318  1.00 35.91 ? 328 ASP B N   1 
ATOM   6003  C  CA  . ASP B 1 314 ? 44.324  -18.428 17.135  1.00 45.30 ? 328 ASP B CA  1 
ATOM   6004  C  C   . ASP B 1 314 ? 44.630  -17.581 18.364  1.00 39.87 ? 328 ASP B C   1 
ATOM   6005  O  O   . ASP B 1 314 ? 43.995  -16.549 18.582  1.00 36.18 ? 328 ASP B O   1 
ATOM   6006  C  CB  . ASP B 1 314 ? 44.289  -17.535 15.893  1.00 48.58 ? 328 ASP B CB  1 
ATOM   6007  C  CG  . ASP B 1 314 ? 45.620  -16.872 15.617  1.00 54.41 ? 328 ASP B CG  1 
ATOM   6008  O  OD1 . ASP B 1 314 ? 45.630  -15.675 15.277  1.00 54.59 ? 328 ASP B OD1 1 
ATOM   6009  O  OD2 . ASP B 1 314 ? 46.658  -17.548 15.729  1.00 58.14 ? 328 ASP B OD2 1 
ATOM   6010  N  N   . VAL B 1 315 ? 45.596  -18.017 19.168  1.00 37.06 ? 329 VAL B N   1 
ATOM   6011  C  CA  . VAL B 1 315 ? 45.917  -17.342 20.431  1.00 44.16 ? 329 VAL B CA  1 
ATOM   6012  C  C   . VAL B 1 315 ? 46.177  -15.831 20.299  1.00 49.17 ? 329 VAL B C   1 
ATOM   6013  O  O   . VAL B 1 315 ? 45.732  -15.033 21.132  1.00 50.14 ? 329 VAL B O   1 
ATOM   6014  C  CB  . VAL B 1 315 ? 47.112  -18.009 21.126  1.00 43.29 ? 329 VAL B CB  1 
ATOM   6015  C  CG1 . VAL B 1 315 ? 47.563  -17.185 22.339  1.00 41.36 ? 329 VAL B CG1 1 
ATOM   6016  C  CG2 . VAL B 1 315 ? 46.755  -19.437 21.531  1.00 52.05 ? 329 VAL B CG2 1 
ATOM   6017  N  N   . GLU B 1 316 ? 46.875  -15.438 19.240  1.00 48.54 ? 330 GLU B N   1 
ATOM   6018  C  CA  . GLU B 1 316 ? 47.230  -14.028 19.047  1.00 42.27 ? 330 GLU B CA  1 
ATOM   6019  C  C   . GLU B 1 316 ? 46.034  -13.181 18.638  1.00 43.15 ? 330 GLU B C   1 
ATOM   6020  O  O   . GLU B 1 316 ? 45.940  -12.005 19.012  1.00 40.57 ? 330 GLU B O   1 
ATOM   6021  C  CB  . GLU B 1 316 ? 48.354  -13.902 18.020  1.00 37.80 ? 330 GLU B CB  1 
ATOM   6022  C  CG  . GLU B 1 316 ? 49.663  -14.546 18.472  1.00 41.97 ? 330 GLU B CG  1 
ATOM   6023  C  CD  . GLU B 1 316 ? 50.300  -13.804 19.646  1.00 48.41 ? 330 GLU B CD  1 
ATOM   6024  O  OE1 . GLU B 1 316 ? 50.438  -12.565 19.562  1.00 49.86 ? 330 GLU B OE1 1 
ATOM   6025  O  OE2 . GLU B 1 316 ? 50.647  -14.452 20.656  1.00 49.18 ? 330 GLU B OE2 1 
ATOM   6026  N  N   . SER B 1 317 ? 45.134  -13.772 17.855  1.00 38.27 ? 331 SER B N   1 
ATOM   6027  C  CA  . SER B 1 317 ? 43.884  -13.120 17.509  1.00 41.04 ? 331 SER B CA  1 
ATOM   6028  C  C   . SER B 1 317 ? 43.084  -12.871 18.774  1.00 38.24 ? 331 SER B C   1 
ATOM   6029  O  O   . SER B 1 317 ? 42.530  -11.792 18.964  1.00 31.77 ? 331 SER B O   1 
ATOM   6030  C  CB  . SER B 1 317 ? 43.054  -13.979 16.551  1.00 45.95 ? 331 SER B CB  1 
ATOM   6031  O  OG  . SER B 1 317 ? 43.601  -13.976 15.244  1.00 52.55 ? 331 SER B OG  1 
ATOM   6032  N  N   . VAL B 1 318 ? 43.013  -13.884 19.634  1.00 36.48 ? 332 VAL B N   1 
ATOM   6033  C  CA  . VAL B 1 318 ? 42.319  -13.746 20.912  1.00 34.25 ? 332 VAL B CA  1 
ATOM   6034  C  C   . VAL B 1 318 ? 42.907  -12.597 21.745  1.00 32.80 ? 332 VAL B C   1 
ATOM   6035  O  O   . VAL B 1 318 ? 42.213  -11.630 22.094  1.00 28.78 ? 332 VAL B O   1 
ATOM   6036  C  CB  . VAL B 1 318 ? 42.410  -15.051 21.714  1.00 31.92 ? 332 VAL B CB  1 
ATOM   6037  C  CG1 . VAL B 1 318 ? 41.998  -14.829 23.163  1.00 32.79 ? 332 VAL B CG1 1 
ATOM   6038  C  CG2 . VAL B 1 318 ? 41.571  -16.143 21.045  1.00 29.57 ? 332 VAL B CG2 1 
ATOM   6039  N  N   . VAL B 1 319 ? 44.200  -12.702 22.033  1.00 34.15 ? 333 VAL B N   1 
ATOM   6040  C  CA  . VAL B 1 319 ? 44.885  -11.725 22.871  1.00 35.12 ? 333 VAL B CA  1 
ATOM   6041  C  C   . VAL B 1 319 ? 44.781  -10.304 22.315  1.00 33.80 ? 333 VAL B C   1 
ATOM   6042  O  O   . VAL B 1 319 ? 44.449  -9.362  23.045  1.00 30.00 ? 333 VAL B O   1 
ATOM   6043  C  CB  . VAL B 1 319 ? 46.366  -12.108 23.103  1.00 31.13 ? 333 VAL B CB  1 
ATOM   6044  C  CG1 . VAL B 1 319 ? 47.122  -10.946 23.765  1.00 33.19 ? 333 VAL B CG1 1 
ATOM   6045  C  CG2 . VAL B 1 319 ? 46.456  -13.355 23.958  1.00 37.01 ? 333 VAL B CG2 1 
ATOM   6046  N  N   . SER B 1 320 ? 45.037  -10.151 21.020  1.00 35.34 ? 334 SER B N   1 
ATOM   6047  C  CA  . SER B 1 320 ? 45.015  -8.826  20.413  1.00 33.70 ? 334 SER B CA  1 
ATOM   6048  C  C   . SER B 1 320 ? 43.601  -8.257  20.411  1.00 34.63 ? 334 SER B C   1 
ATOM   6049  O  O   . SER B 1 320 ? 43.363  -7.112  20.838  1.00 32.86 ? 334 SER B O   1 
ATOM   6050  C  CB  . SER B 1 320 ? 45.571  -8.869  18.988  1.00 38.26 ? 334 SER B CB  1 
ATOM   6051  O  OG  . SER B 1 320 ? 45.534  -7.584  18.388  1.00 42.83 ? 334 SER B OG  1 
ATOM   6052  N  N   . GLY B 1 321 ? 42.667  -9.056  19.912  1.00 30.10 ? 335 GLY B N   1 
ATOM   6053  C  CA  . GLY B 1 321 ? 41.282  -8.644  19.861  1.00 32.50 ? 335 GLY B CA  1 
ATOM   6054  C  C   . GLY B 1 321 ? 40.694  -8.313  21.216  1.00 28.35 ? 335 GLY B C   1 
ATOM   6055  O  O   . GLY B 1 321 ? 39.881  -7.388  21.326  1.00 28.62 ? 335 GLY B O   1 
ATOM   6056  N  N   . THR B 1 322 ? 41.086  -9.068  22.241  1.00 28.14 ? 336 THR B N   1 
ATOM   6057  C  CA  . THR B 1 322 ? 40.501  -8.917  23.574  1.00 26.41 ? 336 THR B CA  1 
ATOM   6058  C  C   . THR B 1 322 ? 41.055  -7.710  24.323  1.00 28.92 ? 336 THR B C   1 
ATOM   6059  O  O   . THR B 1 322 ? 40.299  -6.960  24.933  1.00 31.10 ? 336 THR B O   1 
ATOM   6060  C  CB  . THR B 1 322 ? 40.634  -10.197 24.425  1.00 28.60 ? 336 THR B CB  1 
ATOM   6061  O  OG1 . THR B 1 322 ? 40.020  -11.291 23.734  1.00 28.71 ? 336 THR B OG1 1 
ATOM   6062  C  CG2 . THR B 1 322 ? 39.942  -10.038 25.778  1.00 24.08 ? 336 THR B CG2 1 
ATOM   6063  N  N   . LEU B 1 323 ? 42.368  -7.513  24.270  1.00 28.71 ? 337 LEU B N   1 
ATOM   6064  C  CA  . LEU B 1 323 ? 42.960  -6.328  24.872  1.00 27.09 ? 337 LEU B CA  1 
ATOM   6065  C  C   . LEU B 1 323 ? 42.389  -5.070  24.234  1.00 27.40 ? 337 LEU B C   1 
ATOM   6066  O  O   . LEU B 1 323 ? 42.024  -4.124  24.925  1.00 25.14 ? 337 LEU B O   1 
ATOM   6067  C  CB  . LEU B 1 323 ? 44.485  -6.348  24.736  1.00 29.60 ? 337 LEU B CB  1 
ATOM   6068  C  CG  . LEU B 1 323 ? 45.171  -7.424  25.578  1.00 35.69 ? 337 LEU B CG  1 
ATOM   6069  C  CD1 . LEU B 1 323 ? 46.658  -7.464  25.274  1.00 33.47 ? 337 LEU B CD1 1 
ATOM   6070  C  CD2 . LEU B 1 323 ? 44.912  -7.205  27.068  1.00 30.64 ? 337 LEU B CD2 1 
ATOM   6071  N  N   . ARG B 1 324 ? 42.288  -5.069  22.911  1.00 29.02 ? 338 ARG B N   1 
ATOM   6072  C  CA  . ARG B 1 324 ? 41.791  -3.887  22.219  1.00 26.20 ? 338 ARG B CA  1 
ATOM   6073  C  C   . ARG B 1 324 ? 40.322  -3.633  22.518  1.00 27.66 ? 338 ARG B C   1 
ATOM   6074  O  O   . ARG B 1 324 ? 39.931  -2.503  22.816  1.00 28.47 ? 338 ARG B O   1 
ATOM   6075  C  CB  . ARG B 1 324 ? 42.066  -3.979  20.722  1.00 27.48 ? 338 ARG B CB  1 
ATOM   6076  C  CG  . ARG B 1 324 ? 43.543  -3.741  20.406  1.00 32.29 ? 338 ARG B CG  1 
ATOM   6077  C  CD  . ARG B 1 324 ? 43.933  -4.192  19.008  1.00 41.51 ? 338 ARG B CD  1 
ATOM   6078  N  NE  . ARG B 1 324 ? 43.182  -3.484  17.980  1.00 53.35 ? 338 ARG B NE  1 
ATOM   6079  C  CZ  . ARG B 1 324 ? 43.301  -3.719  16.678  1.00 62.35 ? 338 ARG B CZ  1 
ATOM   6080  N  NH1 . ARG B 1 324 ? 44.150  -4.644  16.244  1.00 67.77 ? 338 ARG B NH1 1 
ATOM   6081  N  NH2 . ARG B 1 324 ? 42.574  -3.026  15.811  1.00 64.24 ? 338 ARG B NH2 1 
ATOM   6082  N  N   . SER B 1 325 ? 39.510  -4.686  22.475  1.00 21.33 ? 339 SER B N   1 
ATOM   6083  C  CA  . SER B 1 325 ? 38.105  -4.506  22.776  1.00 24.74 ? 339 SER B CA  1 
ATOM   6084  C  C   . SER B 1 325 ? 37.886  -4.050  24.214  1.00 25.54 ? 339 SER B C   1 
ATOM   6085  O  O   . SER B 1 325 ? 37.056  -3.166  24.475  1.00 22.47 ? 339 SER B O   1 
ATOM   6086  C  CB  . SER B 1 325 ? 37.276  -5.774  22.473  1.00 20.44 ? 339 SER B CB  1 
ATOM   6087  O  OG  . SER B 1 325 ? 35.901  -5.474  22.690  1.00 20.51 ? 339 SER B OG  1 
ATOM   6088  N  N   . ALA B 1 326 ? 38.635  -4.633  25.145  1.00 22.78 ? 340 ALA B N   1 
ATOM   6089  C  CA  . ALA B 1 326 ? 38.447  -4.337  26.568  1.00 23.55 ? 340 ALA B CA  1 
ATOM   6090  C  C   . ALA B 1 326 ? 38.990  -2.964  26.979  1.00 25.53 ? 340 ALA B C   1 
ATOM   6091  O  O   . ALA B 1 326 ? 38.453  -2.317  27.874  1.00 25.62 ? 340 ALA B O   1 
ATOM   6092  C  CB  . ALA B 1 326 ? 39.096  -5.436  27.433  1.00 24.44 ? 340 ALA B CB  1 
ATOM   6093  N  N   . PHE B 1 327 ? 40.050  -2.517  26.319  1.00 23.70 ? 341 PHE B N   1 
ATOM   6094  C  CA  . PHE B 1 327 ? 40.807  -1.369  26.826  1.00 27.01 ? 341 PHE B CA  1 
ATOM   6095  C  C   . PHE B 1 327 ? 40.837  -0.134  25.935  1.00 24.55 ? 341 PHE B C   1 
ATOM   6096  O  O   . PHE B 1 327 ? 41.242  0.936   26.384  1.00 27.39 ? 341 PHE B O   1 
ATOM   6097  C  CB  . PHE B 1 327 ? 42.235  -1.806  27.193  1.00 28.37 ? 341 PHE B CB  1 
ATOM   6098  C  CG  . PHE B 1 327 ? 42.272  -2.857  28.256  1.00 29.66 ? 341 PHE B CG  1 
ATOM   6099  C  CD1 . PHE B 1 327 ? 41.445  -2.750  29.365  1.00 28.45 ? 341 PHE B CD1 1 
ATOM   6100  C  CD2 . PHE B 1 327 ? 43.106  -3.966  28.143  1.00 23.78 ? 341 PHE B CD2 1 
ATOM   6101  C  CE1 . PHE B 1 327 ? 41.457  -3.719  30.350  1.00 27.73 ? 341 PHE B CE1 1 
ATOM   6102  C  CE2 . PHE B 1 327 ? 43.117  -4.932  29.119  1.00 25.22 ? 341 PHE B CE2 1 
ATOM   6103  C  CZ  . PHE B 1 327 ? 42.300  -4.808  30.228  1.00 28.42 ? 341 PHE B CZ  1 
ATOM   6104  N  N   . GLU B 1 328 ? 40.428  -0.263  24.678  1.00 27.42 ? 342 GLU B N   1 
ATOM   6105  C  CA  . GLU B 1 328 ? 40.343  0.925   23.834  1.00 29.22 ? 342 GLU B CA  1 
ATOM   6106  C  C   . GLU B 1 328 ? 39.334  1.873   24.458  1.00 31.18 ? 342 GLU B C   1 
ATOM   6107  O  O   . GLU B 1 328 ? 38.263  1.446   24.920  1.00 19.04 ? 342 GLU B O   1 
ATOM   6108  C  CB  . GLU B 1 328 ? 39.988  0.571   22.382  1.00 37.32 ? 342 GLU B CB  1 
ATOM   6109  C  CG  . GLU B 1 328 ? 41.220  0.138   21.568  1.00 45.82 ? 342 GLU B CG  1 
ATOM   6110  C  CD  . GLU B 1 328 ? 40.900  -0.317  20.149  1.00 50.83 ? 342 GLU B CD  1 
ATOM   6111  O  OE1 . GLU B 1 328 ? 39.727  -0.651  19.870  1.00 50.50 ? 342 GLU B OE1 1 
ATOM   6112  O  OE2 . GLU B 1 328 ? 41.838  -0.347  19.314  1.00 50.91 ? 342 GLU B OE2 1 
ATOM   6113  N  N   . TYR B 1 329 ? 39.720  3.145   24.533  1.00 29.30 ? 343 TYR B N   1 
ATOM   6114  C  CA  . TYR B 1 329 ? 38.905  4.198   25.136  1.00 27.45 ? 343 TYR B CA  1 
ATOM   6115  C  C   . TYR B 1 329 ? 38.555  3.845   26.577  1.00 21.34 ? 343 TYR B C   1 
ATOM   6116  O  O   . TYR B 1 329 ? 37.497  4.204   27.072  1.00 23.83 ? 343 TYR B O   1 
ATOM   6117  C  CB  . TYR B 1 329 ? 37.637  4.440   24.315  1.00 22.29 ? 343 TYR B CB  1 
ATOM   6118  C  CG  . TYR B 1 329 ? 36.952  5.757   24.624  1.00 24.92 ? 343 TYR B CG  1 
ATOM   6119  C  CD1 . TYR B 1 329 ? 37.658  6.805   25.207  1.00 24.27 ? 343 TYR B CD1 1 
ATOM   6120  C  CD2 . TYR B 1 329 ? 35.603  5.947   24.346  1.00 32.51 ? 343 TYR B CD2 1 
ATOM   6121  C  CE1 . TYR B 1 329 ? 37.049  8.000   25.502  1.00 23.49 ? 343 TYR B CE1 1 
ATOM   6122  C  CE2 . TYR B 1 329 ? 34.982  7.142   24.637  1.00 36.11 ? 343 TYR B CE2 1 
ATOM   6123  C  CZ  . TYR B 1 329 ? 35.717  8.172   25.214  1.00 33.25 ? 343 TYR B CZ  1 
ATOM   6124  O  OH  . TYR B 1 329 ? 35.113  9.379   25.511  1.00 37.13 ? 343 TYR B OH  1 
ATOM   6125  N  N   . GLY B 1 330 ? 39.451  3.118   27.238  1.00 21.02 ? 344 GLY B N   1 
ATOM   6126  C  CA  . GLY B 1 330 ? 39.237  2.716   28.619  1.00 23.10 ? 344 GLY B CA  1 
ATOM   6127  C  C   . GLY B 1 330 ? 38.060  1.782   28.821  1.00 27.45 ? 344 GLY B C   1 
ATOM   6128  O  O   . GLY B 1 330 ? 37.477  1.747   29.899  1.00 27.73 ? 344 GLY B O   1 
ATOM   6129  N  N   . GLY B 1 331 ? 37.703  1.025   27.786  1.00 25.57 ? 345 GLY B N   1 
ATOM   6130  C  CA  . GLY B 1 331 ? 36.536  0.151   27.851  1.00 23.25 ? 345 GLY B CA  1 
ATOM   6131  C  C   . GLY B 1 331 ? 35.215  0.907   27.928  1.00 27.31 ? 345 GLY B C   1 
ATOM   6132  O  O   . GLY B 1 331 ? 34.186  0.334   28.294  1.00 24.56 ? 345 GLY B O   1 
ATOM   6133  N  N   . GLN B 1 332 ? 35.237  2.192   27.578  1.00 20.45 ? 346 GLN B N   1 
ATOM   6134  C  CA  . GLN B 1 332 ? 34.041  3.036   27.672  1.00 25.00 ? 346 GLN B CA  1 
ATOM   6135  C  C   . GLN B 1 332 ? 33.262  3.071   26.355  1.00 25.84 ? 346 GLN B C   1 
ATOM   6136  O  O   . GLN B 1 332 ? 32.893  4.140   25.860  1.00 25.25 ? 346 GLN B O   1 
ATOM   6137  C  CB  . GLN B 1 332 ? 34.404  4.467   28.092  1.00 25.90 ? 346 GLN B CB  1 
ATOM   6138  C  CG  . GLN B 1 332 ? 35.232  4.590   29.380  1.00 23.83 ? 346 GLN B CG  1 
ATOM   6139  C  CD  . GLN B 1 332 ? 35.655  6.027   29.628  1.00 21.84 ? 346 GLN B CD  1 
ATOM   6140  O  OE1 . GLN B 1 332 ? 35.245  6.648   30.605  1.00 20.36 ? 346 GLN B OE1 1 
ATOM   6141  N  NE2 . GLN B 1 332 ? 36.461  6.565   28.724  1.00 22.14 ? 346 GLN B NE2 1 
ATOM   6142  N  N   . LYS B 1 333 ? 33.034  1.896   25.783  1.00 27.89 ? 347 LYS B N   1 
ATOM   6143  C  CA  . LYS B 1 333 ? 32.176  1.769   24.618  1.00 25.96 ? 347 LYS B CA  1 
ATOM   6144  C  C   . LYS B 1 333 ? 31.032  0.839   24.976  1.00 27.36 ? 347 LYS B C   1 
ATOM   6145  O  O   . LYS B 1 333 ? 31.225  -0.147  25.696  1.00 29.11 ? 347 LYS B O   1 
ATOM   6146  C  CB  . LYS B 1 333 ? 32.938  1.166   23.443  1.00 31.23 ? 347 LYS B CB  1 
ATOM   6147  C  CG  . LYS B 1 333 ? 34.079  1.996   22.916  1.00 29.30 ? 347 LYS B CG  1 
ATOM   6148  C  CD  . LYS B 1 333 ? 34.779  1.250   21.788  1.00 35.51 ? 347 LYS B CD  1 
ATOM   6149  C  CE  . LYS B 1 333 ? 36.029  1.982   21.336  1.00 36.50 ? 347 LYS B CE  1 
ATOM   6150  N  NZ  . LYS B 1 333 ? 36.658  1.316   20.168  1.00 32.22 ? 347 LYS B NZ  1 
ATOM   6151  N  N   . CYS B 1 334 ? 29.841  1.144   24.470  1.00 21.17 ? 348 CYS B N   1 
ATOM   6152  C  CA  . CYS B 1 334 ? 28.700  0.255   24.620  1.00 25.53 ? 348 CYS B CA  1 
ATOM   6153  C  C   . CYS B 1 334 ? 29.027  -1.163  24.152  1.00 25.14 ? 348 CYS B C   1 
ATOM   6154  O  O   . CYS B 1 334 ? 28.409  -2.121  24.595  1.00 25.13 ? 348 CYS B O   1 
ATOM   6155  C  CB  . CYS B 1 334 ? 27.501  0.814   23.842  1.00 26.62 ? 348 CYS B CB  1 
ATOM   6156  S  SG  . CYS B 1 334 ? 26.749  2.219   24.692  1.00 39.91 ? 348 CYS B SG  1 
ATOM   6157  N  N   . SER B 1 335 ? 30.014  -1.279  23.268  1.00 23.07 ? 349 SER B N   1 
ATOM   6158  C  CA  . SER B 1 335 ? 30.355  -2.546  22.628  1.00 25.06 ? 349 SER B CA  1 
ATOM   6159  C  C   . SER B 1 335 ? 31.606  -3.230  23.210  1.00 27.02 ? 349 SER B C   1 
ATOM   6160  O  O   . SER B 1 335 ? 31.979  -4.320  22.772  1.00 24.56 ? 349 SER B O   1 
ATOM   6161  C  CB  . SER B 1 335 ? 30.564  -2.302  21.129  1.00 26.09 ? 349 SER B CB  1 
ATOM   6162  O  OG  . SER B 1 335 ? 31.581  -1.332  20.927  1.00 32.03 ? 349 SER B OG  1 
ATOM   6163  N  N   . ALA B 1 336 ? 32.259  -2.591  24.177  1.00 23.78 ? 350 ALA B N   1 
ATOM   6164  C  CA  . ALA B 1 336 ? 33.490  -3.134  24.753  1.00 21.26 ? 350 ALA B CA  1 
ATOM   6165  C  C   . ALA B 1 336 ? 33.340  -4.520  25.376  1.00 22.33 ? 350 ALA B C   1 
ATOM   6166  O  O   . ALA B 1 336 ? 32.323  -4.835  26.015  1.00 23.36 ? 350 ALA B O   1 
ATOM   6167  C  CB  . ALA B 1 336 ? 34.058  -2.169  25.792  1.00 23.21 ? 350 ALA B CB  1 
ATOM   6168  N  N   . CYS B 1 337 ? 34.366  -5.346  25.189  1.00 21.99 ? 351 CYS B N   1 
ATOM   6169  C  CA  . CYS B 1 337 ? 34.417  -6.659  25.830  1.00 23.85 ? 351 CYS B CA  1 
ATOM   6170  C  C   . CYS B 1 337 ? 34.809  -6.519  27.302  1.00 24.00 ? 351 CYS B C   1 
ATOM   6171  O  O   . CYS B 1 337 ? 35.829  -5.906  27.619  1.00 25.49 ? 351 CYS B O   1 
ATOM   6172  C  CB  . CYS B 1 337 ? 35.473  -7.534  25.152  1.00 26.13 ? 351 CYS B CB  1 
ATOM   6173  S  SG  . CYS B 1 337 ? 35.738  -9.099  26.013  1.00 27.01 ? 351 CYS B SG  1 
ATOM   6174  N  N   . SER B 1 338 ? 34.016  -7.089  28.197  1.00 24.67 ? 352 SER B N   1 
ATOM   6175  C  CA  . SER B 1 338 ? 34.399  -7.103  29.601  1.00 31.24 ? 352 SER B CA  1 
ATOM   6176  C  C   . SER B 1 338 ? 34.402  -8.503  30.192  1.00 29.08 ? 352 SER B C   1 
ATOM   6177  O  O   . SER B 1 338 ? 34.712  -8.671  31.371  1.00 28.88 ? 352 SER B O   1 
ATOM   6178  C  CB  . SER B 1 338 ? 33.500  -6.192  30.435  1.00 24.68 ? 352 SER B CB  1 
ATOM   6179  O  OG  . SER B 1 338 ? 32.138  -6.511  30.228  1.00 25.16 ? 352 SER B OG  1 
ATOM   6180  N  N   . ARG B 1 339 ? 34.034  -9.509  29.401  1.00 21.31 ? 353 ARG B N   1 
ATOM   6181  C  CA  . ARG B 1 339 ? 34.183  -10.881 29.876  1.00 28.04 ? 353 ARG B CA  1 
ATOM   6182  C  C   . ARG B 1 339 ? 34.804  -11.796 28.832  1.00 28.40 ? 353 ARG B C   1 
ATOM   6183  O  O   . ARG B 1 339 ? 34.439  -11.761 27.658  1.00 28.63 ? 353 ARG B O   1 
ATOM   6184  C  CB  . ARG B 1 339 ? 32.868  -11.454 30.409  1.00 29.01 ? 353 ARG B CB  1 
ATOM   6185  C  CG  . ARG B 1 339 ? 31.686  -11.157 29.575  1.00 27.91 ? 353 ARG B CG  1 
ATOM   6186  C  CD  . ARG B 1 339 ? 30.442  -11.741 30.192  1.00 30.18 ? 353 ARG B CD  1 
ATOM   6187  N  NE  . ARG B 1 339 ? 29.291  -11.366 29.394  1.00 25.89 ? 353 ARG B NE  1 
ATOM   6188  C  CZ  . ARG B 1 339 ? 28.237  -12.136 29.172  1.00 28.36 ? 353 ARG B CZ  1 
ATOM   6189  N  NH1 . ARG B 1 339 ? 27.243  -11.669 28.418  1.00 26.82 ? 353 ARG B NH1 1 
ATOM   6190  N  NH2 . ARG B 1 339 ? 28.173  -13.363 29.696  1.00 26.77 ? 353 ARG B NH2 1 
ATOM   6191  N  N   . LEU B 1 340 ? 35.771  -12.592 29.282  1.00 26.57 ? 354 LEU B N   1 
ATOM   6192  C  CA  . LEU B 1 340 ? 36.503  -13.517 28.422  1.00 29.08 ? 354 LEU B CA  1 
ATOM   6193  C  C   . LEU B 1 340 ? 36.368  -14.927 28.973  1.00 28.18 ? 354 LEU B C   1 
ATOM   6194  O  O   . LEU B 1 340 ? 36.663  -15.158 30.145  1.00 28.19 ? 354 LEU B O   1 
ATOM   6195  C  CB  . LEU B 1 340 ? 37.983  -13.125 28.367  1.00 26.83 ? 354 LEU B CB  1 
ATOM   6196  C  CG  . LEU B 1 340 ? 38.927  -14.078 27.619  1.00 26.85 ? 354 LEU B CG  1 
ATOM   6197  C  CD1 . LEU B 1 340 ? 38.645  -14.065 26.116  1.00 28.13 ? 354 LEU B CD1 1 
ATOM   6198  C  CD2 . LEU B 1 340 ? 40.376  -13.728 27.908  1.00 32.69 ? 354 LEU B CD2 1 
ATOM   6199  N  N   . TYR B 1 341 ? 35.904  -15.851 28.128  1.00 25.73 ? 355 TYR B N   1 
ATOM   6200  C  CA  . TYR B 1 341 ? 35.768  -17.260 28.481  1.00 26.77 ? 355 TYR B CA  1 
ATOM   6201  C  C   . TYR B 1 341 ? 36.832  -18.064 27.746  1.00 27.81 ? 355 TYR B C   1 
ATOM   6202  O  O   . TYR B 1 341 ? 36.853  -18.086 26.524  1.00 27.61 ? 355 TYR B O   1 
ATOM   6203  C  CB  . TYR B 1 341 ? 34.368  -17.769 28.110  1.00 26.33 ? 355 TYR B CB  1 
ATOM   6204  C  CG  . TYR B 1 341 ? 33.274  -17.050 28.866  1.00 25.45 ? 355 TYR B CG  1 
ATOM   6205  C  CD1 . TYR B 1 341 ? 32.716  -17.599 30.018  1.00 30.46 ? 355 TYR B CD1 1 
ATOM   6206  C  CD2 . TYR B 1 341 ? 32.826  -15.808 28.448  1.00 27.11 ? 355 TYR B CD2 1 
ATOM   6207  C  CE1 . TYR B 1 341 ? 31.728  -16.924 30.720  1.00 30.21 ? 355 TYR B CE1 1 
ATOM   6208  C  CE2 . TYR B 1 341 ? 31.844  -15.128 29.138  1.00 29.73 ? 355 TYR B CE2 1 
ATOM   6209  C  CZ  . TYR B 1 341 ? 31.299  -15.688 30.265  1.00 30.42 ? 355 TYR B CZ  1 
ATOM   6210  O  OH  . TYR B 1 341 ? 30.329  -14.993 30.935  1.00 36.50 ? 355 TYR B OH  1 
ATOM   6211  N  N   . VAL B 1 342 ? 37.735  -18.691 28.491  1.00 29.29 ? 356 VAL B N   1 
ATOM   6212  C  CA  . VAL B 1 342 ? 38.840  -19.437 27.884  1.00 30.17 ? 356 VAL B CA  1 
ATOM   6213  C  C   . VAL B 1 342 ? 38.880  -20.840 28.434  1.00 31.52 ? 356 VAL B C   1 
ATOM   6214  O  O   . VAL B 1 342 ? 38.604  -21.040 29.616  1.00 33.30 ? 356 VAL B O   1 
ATOM   6215  C  CB  . VAL B 1 342 ? 40.208  -18.768 28.156  1.00 37.40 ? 356 VAL B CB  1 
ATOM   6216  C  CG1 . VAL B 1 342 ? 40.255  -17.405 27.525  1.00 30.10 ? 356 VAL B CG1 1 
ATOM   6217  C  CG2 . VAL B 1 342 ? 40.459  -18.657 29.645  1.00 39.59 ? 356 VAL B CG2 1 
ATOM   6218  N  N   . PRO B 1 343 ? 39.197  -21.828 27.572  1.00 32.43 ? 357 PRO B N   1 
ATOM   6219  C  CA  . PRO B 1 343 ? 39.261  -23.234 27.973  1.00 33.87 ? 357 PRO B CA  1 
ATOM   6220  C  C   . PRO B 1 343 ? 40.520  -23.503 28.777  1.00 41.89 ? 357 PRO B C   1 
ATOM   6221  O  O   . PRO B 1 343 ? 41.569  -22.910 28.499  1.00 37.52 ? 357 PRO B O   1 
ATOM   6222  C  CB  . PRO B 1 343 ? 39.324  -23.979 26.638  1.00 38.52 ? 357 PRO B CB  1 
ATOM   6223  C  CG  . PRO B 1 343 ? 39.963  -23.025 25.710  1.00 33.77 ? 357 PRO B CG  1 
ATOM   6224  C  CD  . PRO B 1 343 ? 39.468  -21.655 26.133  1.00 32.21 ? 357 PRO B CD  1 
ATOM   6225  N  N   . HIS B 1 344 ? 40.400  -24.372 29.772  1.00 36.23 ? 358 HIS B N   1 
ATOM   6226  C  CA  . HIS B 1 344 ? 41.516  -24.688 30.661  1.00 44.48 ? 358 HIS B CA  1 
ATOM   6227  C  C   . HIS B 1 344 ? 42.805  -24.965 29.889  1.00 41.70 ? 358 HIS B C   1 
ATOM   6228  O  O   . HIS B 1 344 ? 43.857  -24.454 30.246  1.00 39.01 ? 358 HIS B O   1 
ATOM   6229  C  CB  . HIS B 1 344 ? 41.163  -25.868 31.574  1.00 51.94 ? 358 HIS B CB  1 
ATOM   6230  C  CG  . HIS B 1 344 ? 42.178  -26.125 32.647  1.00 59.82 ? 358 HIS B CG  1 
ATOM   6231  N  ND1 . HIS B 1 344 ? 43.034  -27.202 32.618  1.00 61.86 ? 358 HIS B ND1 1 
ATOM   6232  C  CD2 . HIS B 1 344 ? 42.477  -25.431 33.773  1.00 63.77 ? 358 HIS B CD2 1 
ATOM   6233  C  CE1 . HIS B 1 344 ? 43.817  -27.168 33.685  1.00 63.37 ? 358 HIS B CE1 1 
ATOM   6234  N  NE2 . HIS B 1 344 ? 43.498  -26.106 34.400  1.00 65.42 ? 358 HIS B NE2 1 
ATOM   6235  N  N   . SER B 1 345 ? 42.707  -25.727 28.800  1.00 43.98 ? 359 SER B N   1 
ATOM   6236  C  CA  . SER B 1 345 ? 43.892  -26.143 28.039  1.00 52.06 ? 359 SER B CA  1 
ATOM   6237  C  C   . SER B 1 345 ? 44.693  -24.991 27.426  1.00 46.50 ? 359 SER B C   1 
ATOM   6238  O  O   . SER B 1 345 ? 45.925  -25.059 27.355  1.00 42.15 ? 359 SER B O   1 
ATOM   6239  C  CB  . SER B 1 345 ? 43.497  -27.109 26.925  1.00 49.59 ? 359 SER B CB  1 
ATOM   6240  O  OG  . SER B 1 345 ? 42.811  -26.417 25.895  1.00 50.35 ? 359 SER B OG  1 
ATOM   6241  N  N   . LEU B 1 346 ? 43.988  -23.953 26.975  1.00 41.22 ? 360 LEU B N   1 
ATOM   6242  C  CA  . LEU B 1 346 ? 44.610  -22.823 26.278  1.00 43.43 ? 360 LEU B CA  1 
ATOM   6243  C  C   . LEU B 1 346 ? 44.982  -21.680 27.207  1.00 43.68 ? 360 LEU B C   1 
ATOM   6244  O  O   . LEU B 1 346 ? 45.720  -20.778 26.815  1.00 44.26 ? 360 LEU B O   1 
ATOM   6245  C  CB  . LEU B 1 346 ? 43.679  -22.264 25.203  1.00 42.12 ? 360 LEU B CB  1 
ATOM   6246  C  CG  . LEU B 1 346 ? 44.044  -22.451 23.731  1.00 45.06 ? 360 LEU B CG  1 
ATOM   6247  C  CD1 . LEU B 1 346 ? 43.375  -21.364 22.884  1.00 38.96 ? 360 LEU B CD1 1 
ATOM   6248  C  CD2 . LEU B 1 346 ? 45.543  -22.452 23.526  1.00 50.22 ? 360 LEU B CD2 1 
ATOM   6249  N  N   . TRP B 1 347 ? 44.452  -21.714 28.425  1.00 42.86 ? 361 TRP B N   1 
ATOM   6250  C  CA  . TRP B 1 347 ? 44.673  -20.649 29.402  1.00 40.40 ? 361 TRP B CA  1 
ATOM   6251  C  C   . TRP B 1 347 ? 46.146  -20.267 29.663  1.00 45.91 ? 361 TRP B C   1 
ATOM   6252  O  O   . TRP B 1 347 ? 46.463  -19.081 29.687  1.00 45.10 ? 361 TRP B O   1 
ATOM   6253  C  CB  . TRP B 1 347 ? 43.943  -20.968 30.713  1.00 39.09 ? 361 TRP B CB  1 
ATOM   6254  C  CG  . TRP B 1 347 ? 44.099  -19.931 31.790  1.00 37.93 ? 361 TRP B CG  1 
ATOM   6255  C  CD1 . TRP B 1 347 ? 44.443  -20.154 33.096  1.00 37.44 ? 361 TRP B CD1 1 
ATOM   6256  C  CD2 . TRP B 1 347 ? 43.919  -18.510 31.659  1.00 39.35 ? 361 TRP B CD2 1 
ATOM   6257  N  NE1 . TRP B 1 347 ? 44.482  -18.961 33.783  1.00 35.69 ? 361 TRP B NE1 1 
ATOM   6258  C  CE2 . TRP B 1 347 ? 44.164  -17.941 32.926  1.00 36.62 ? 361 TRP B CE2 1 
ATOM   6259  C  CE3 . TRP B 1 347 ? 43.575  -17.667 30.595  1.00 36.26 ? 361 TRP B CE3 1 
ATOM   6260  C  CZ2 . TRP B 1 347 ? 44.081  -16.560 33.154  1.00 35.64 ? 361 TRP B CZ2 1 
ATOM   6261  C  CZ3 . TRP B 1 347 ? 43.488  -16.300 30.826  1.00 35.25 ? 361 TRP B CZ3 1 
ATOM   6262  C  CH2 . TRP B 1 347 ? 43.741  -15.762 32.094  1.00 33.63 ? 361 TRP B CH2 1 
ATOM   6263  N  N   . PRO B 1 348 ? 47.050  -21.256 29.849  1.00 46.19 ? 362 PRO B N   1 
ATOM   6264  C  CA  . PRO B 1 348 ? 48.435  -20.852 30.144  1.00 48.34 ? 362 PRO B CA  1 
ATOM   6265  C  C   . PRO B 1 348 ? 49.085  -20.005 29.044  1.00 43.69 ? 362 PRO B C   1 
ATOM   6266  O  O   . PRO B 1 348 ? 49.764  -19.030 29.357  1.00 49.31 ? 362 PRO B O   1 
ATOM   6267  C  CB  . PRO B 1 348 ? 49.161  -22.193 30.296  1.00 47.80 ? 362 PRO B CB  1 
ATOM   6268  C  CG  . PRO B 1 348 ? 48.094  -23.145 30.710  1.00 47.04 ? 362 PRO B CG  1 
ATOM   6269  C  CD  . PRO B 1 348 ? 46.883  -22.720 29.945  1.00 44.24 ? 362 PRO B CD  1 
ATOM   6270  N  N   . GLN B 1 349 ? 48.855  -20.360 27.784  1.00 41.96 ? 363 GLN B N   1 
ATOM   6271  C  CA  . GLN B 1 349 ? 49.396  -19.614 26.650  1.00 43.19 ? 363 GLN B CA  1 
ATOM   6272  C  C   . GLN B 1 349 ? 48.722  -18.253 26.504  1.00 44.29 ? 363 GLN B C   1 
ATOM   6273  O  O   . GLN B 1 349 ? 49.382  -17.242 26.269  1.00 40.65 ? 363 GLN B O   1 
ATOM   6274  C  CB  . GLN B 1 349 ? 49.229  -20.414 25.356  1.00 46.87 ? 363 GLN B CB  1 
ATOM   6275  C  CG  . GLN B 1 349 ? 49.895  -19.782 24.134  1.00 56.36 ? 363 GLN B CG  1 
ATOM   6276  C  CD  . GLN B 1 349 ? 49.853  -20.686 22.904  1.00 64.64 ? 363 GLN B CD  1 
ATOM   6277  O  OE1 . GLN B 1 349 ? 49.455  -21.852 22.982  1.00 65.24 ? 363 GLN B OE1 1 
ATOM   6278  N  NE2 . GLN B 1 349 ? 50.263  -20.144 21.760  1.00 67.32 ? 363 GLN B NE2 1 
ATOM   6279  N  N   . ILE B 1 350 ? 47.399  -18.239 26.633  1.00 38.68 ? 364 ILE B N   1 
ATOM   6280  C  CA  . ILE B 1 350 ? 46.653  -17.000 26.550  1.00 40.07 ? 364 ILE B CA  1 
ATOM   6281  C  C   . ILE B 1 350 ? 47.019  -16.087 27.714  1.00 38.34 ? 364 ILE B C   1 
ATOM   6282  O  O   . ILE B 1 350 ? 47.355  -14.927 27.503  1.00 35.85 ? 364 ILE B O   1 
ATOM   6283  C  CB  . ILE B 1 350 ? 45.140  -17.261 26.494  1.00 36.33 ? 364 ILE B CB  1 
ATOM   6284  C  CG1 . ILE B 1 350 ? 44.800  -17.924 25.157  1.00 37.16 ? 364 ILE B CG1 1 
ATOM   6285  C  CG2 . ILE B 1 350 ? 44.370  -15.959 26.685  1.00 35.05 ? 364 ILE B CG2 1 
ATOM   6286  C  CD1 . ILE B 1 350 ? 43.353  -18.348 24.999  1.00 36.69 ? 364 ILE B CD1 1 
ATOM   6287  N  N   . LYS B 1 351 ? 46.979  -16.624 28.932  1.00 38.96 ? 365 LYS B N   1 
ATOM   6288  C  CA  . LYS B 1 351 ? 47.294  -15.848 30.132  1.00 40.26 ? 365 LYS B CA  1 
ATOM   6289  C  C   . LYS B 1 351 ? 48.670  -15.214 30.024  1.00 45.63 ? 365 LYS B C   1 
ATOM   6290  O  O   . LYS B 1 351 ? 48.847  -14.044 30.346  1.00 42.74 ? 365 LYS B O   1 
ATOM   6291  C  CB  . LYS B 1 351 ? 47.260  -16.730 31.376  1.00 39.08 ? 365 LYS B CB  1 
ATOM   6292  C  CG  . LYS B 1 351 ? 47.558  -16.013 32.677  1.00 42.58 ? 365 LYS B CG  1 
ATOM   6293  C  CD  . LYS B 1 351 ? 47.710  -17.013 33.822  1.00 47.22 ? 365 LYS B CD  1 
ATOM   6294  C  CE  . LYS B 1 351 ? 48.076  -16.316 35.125  1.00 48.30 ? 365 LYS B CE  1 
ATOM   6295  N  NZ  . LYS B 1 351 ? 48.241  -17.273 36.249  1.00 49.70 ? 365 LYS B NZ  1 
ATOM   6296  N  N   . GLY B 1 352 ? 49.637  -16.008 29.571  1.00 48.99 ? 366 GLY B N   1 
ATOM   6297  C  CA  . GLY B 1 352 ? 50.995  -15.543 29.380  1.00 47.82 ? 366 GLY B CA  1 
ATOM   6298  C  C   . GLY B 1 352 ? 51.093  -14.394 28.392  1.00 50.30 ? 366 GLY B C   1 
ATOM   6299  O  O   . GLY B 1 352 ? 51.685  -13.354 28.697  1.00 52.11 ? 366 GLY B O   1 
ATOM   6300  N  N   . ARG B 1 353 ? 50.523  -14.574 27.206  1.00 45.35 ? 367 ARG B N   1 
ATOM   6301  C  CA  . ARG B 1 353 ? 50.564  -13.521 26.194  1.00 47.46 ? 367 ARG B CA  1 
ATOM   6302  C  C   . ARG B 1 353 ? 49.799  -12.260 26.615  1.00 47.89 ? 367 ARG B C   1 
ATOM   6303  O  O   . ARG B 1 353 ? 50.277  -11.139 26.387  1.00 43.57 ? 367 ARG B O   1 
ATOM   6304  C  CB  . ARG B 1 353 ? 50.057  -14.041 24.851  1.00 44.59 ? 367 ARG B CB  1 
ATOM   6305  C  CG  . ARG B 1 353 ? 50.989  -15.070 24.226  1.00 51.03 ? 367 ARG B CG  1 
ATOM   6306  C  CD  . ARG B 1 353 ? 52.257  -14.400 23.716  1.00 52.73 ? 367 ARG B CD  1 
ATOM   6307  N  NE  . ARG B 1 353 ? 51.974  -13.470 22.623  1.00 54.57 ? 367 ARG B NE  1 
ATOM   6308  C  CZ  . ARG B 1 353 ? 52.198  -12.157 22.666  1.00 52.52 ? 367 ARG B CZ  1 
ATOM   6309  N  NH1 . ARG B 1 353 ? 51.898  -11.395 21.617  1.00 46.93 ? 367 ARG B NH1 1 
ATOM   6310  N  NH2 . ARG B 1 353 ? 52.714  -11.601 23.753  1.00 50.04 ? 367 ARG B NH2 1 
ATOM   6311  N  N   . LEU B 1 354 ? 48.624  -12.447 27.222  1.00 42.41 ? 368 LEU B N   1 
ATOM   6312  C  CA  . LEU B 1 354 ? 47.830  -11.325 27.730  1.00 40.41 ? 368 LEU B CA  1 
ATOM   6313  C  C   . LEU B 1 354 ? 48.676  -10.421 28.603  1.00 42.32 ? 368 LEU B C   1 
ATOM   6314  O  O   . LEU B 1 354 ? 48.649  -9.201  28.457  1.00 39.50 ? 368 LEU B O   1 
ATOM   6315  C  CB  . LEU B 1 354 ? 46.655  -11.814 28.564  1.00 40.38 ? 368 LEU B CB  1 
ATOM   6316  C  CG  . LEU B 1 354 ? 45.323  -12.038 27.853  1.00 41.88 ? 368 LEU B CG  1 
ATOM   6317  C  CD1 . LEU B 1 354 ? 44.221  -12.300 28.876  1.00 40.69 ? 368 LEU B CD1 1 
ATOM   6318  C  CD2 . LEU B 1 354 ? 44.980  -10.854 26.964  1.00 39.34 ? 368 LEU B CD2 1 
ATOM   6319  N  N   . LEU B 1 355 ? 49.429  -11.036 29.508  1.00 40.42 ? 369 LEU B N   1 
ATOM   6320  C  CA  . LEU B 1 355 ? 50.212  -10.295 30.488  1.00 46.21 ? 369 LEU B CA  1 
ATOM   6321  C  C   . LEU B 1 355 ? 51.387  -9.576  29.834  1.00 52.04 ? 369 LEU B C   1 
ATOM   6322  O  O   . LEU B 1 355 ? 51.655  -8.417  30.137  1.00 50.65 ? 369 LEU B O   1 
ATOM   6323  C  CB  . LEU B 1 355 ? 50.684  -11.226 31.609  1.00 49.01 ? 369 LEU B CB  1 
ATOM   6324  C  CG  . LEU B 1 355 ? 49.774  -11.301 32.842  1.00 47.38 ? 369 LEU B CG  1 
ATOM   6325  C  CD1 . LEU B 1 355 ? 48.294  -11.396 32.469  1.00 43.21 ? 369 LEU B CD1 1 
ATOM   6326  C  CD2 . LEU B 1 355 ? 50.173  -12.464 33.738  1.00 49.78 ? 369 LEU B CD2 1 
ATOM   6327  N  N   . GLU B 1 356 ? 52.073  -10.271 28.931  1.00 56.12 ? 370 GLU B N   1 
ATOM   6328  C  CA  . GLU B 1 356 ? 53.158  -9.679  28.152  1.00 53.59 ? 370 GLU B CA  1 
ATOM   6329  C  C   . GLU B 1 356 ? 52.674  -8.495  27.315  1.00 45.99 ? 370 GLU B C   1 
ATOM   6330  O  O   . GLU B 1 356 ? 53.306  -7.444  27.303  1.00 48.13 ? 370 GLU B O   1 
ATOM   6331  C  CB  . GLU B 1 356 ? 53.825  -10.735 27.256  1.00 58.71 ? 370 GLU B CB  1 
ATOM   6332  C  CG  . GLU B 1 356 ? 54.486  -11.884 28.023  1.00 61.67 ? 370 GLU B CG  1 
ATOM   6333  C  CD  . GLU B 1 356 ? 54.813  -13.081 27.144  1.00 64.27 ? 370 GLU B CD  1 
ATOM   6334  O  OE1 . GLU B 1 356 ? 54.757  -12.956 25.900  1.00 62.12 ? 370 GLU B OE1 1 
ATOM   6335  O  OE2 . GLU B 1 356 ? 55.118  -14.156 27.700  1.00 68.21 ? 370 GLU B OE2 1 
ATOM   6336  N  N   . GLU B 1 357 ? 51.548  -8.660  26.626  1.00 47.17 ? 371 GLU B N   1 
ATOM   6337  C  CA  . GLU B 1 357 ? 50.997  -7.589  25.792  1.00 44.79 ? 371 GLU B CA  1 
ATOM   6338  C  C   . GLU B 1 357 ? 50.385  -6.455  26.620  1.00 44.41 ? 371 GLU B C   1 
ATOM   6339  O  O   . GLU B 1 357 ? 50.431  -5.284  26.219  1.00 36.10 ? 371 GLU B O   1 
ATOM   6340  C  CB  . GLU B 1 357 ? 49.972  -8.140  24.806  1.00 46.92 ? 371 GLU B CB  1 
ATOM   6341  C  CG  . GLU B 1 357 ? 50.566  -8.932  23.661  1.00 54.66 ? 371 GLU B CG  1 
ATOM   6342  C  CD  . GLU B 1 357 ? 51.492  -8.101  22.799  1.00 62.02 ? 371 GLU B CD  1 
ATOM   6343  O  OE1 . GLU B 1 357 ? 51.273  -6.876  22.697  1.00 67.78 ? 371 GLU B OE1 1 
ATOM   6344  O  OE2 . GLU B 1 357 ? 52.442  -8.672  22.225  1.00 63.37 ? 371 GLU B OE2 1 
ATOM   6345  N  N   . HIS B 1 358 ? 49.824  -6.808  27.775  1.00 40.79 ? 372 HIS B N   1 
ATOM   6346  C  CA  . HIS B 1 358 ? 49.338  -5.821  28.738  1.00 39.30 ? 372 HIS B CA  1 
ATOM   6347  C  C   . HIS B 1 358 ? 50.438  -4.819  29.086  1.00 40.20 ? 372 HIS B C   1 
ATOM   6348  O  O   . HIS B 1 358 ? 50.170  -3.648  29.331  1.00 42.00 ? 372 HIS B O   1 
ATOM   6349  C  CB  . HIS B 1 358 ? 48.862  -6.529  30.011  1.00 36.85 ? 372 HIS B CB  1 
ATOM   6350  C  CG  . HIS B 1 358 ? 48.376  -5.606  31.089  1.00 41.07 ? 372 HIS B CG  1 
ATOM   6351  N  ND1 . HIS B 1 358 ? 49.217  -5.033  32.020  1.00 42.57 ? 372 HIS B ND1 1 
ATOM   6352  C  CD2 . HIS B 1 358 ? 47.129  -5.176  31.397  1.00 41.91 ? 372 HIS B CD2 1 
ATOM   6353  C  CE1 . HIS B 1 358 ? 48.509  -4.291  32.854  1.00 40.08 ? 372 HIS B CE1 1 
ATOM   6354  N  NE2 . HIS B 1 358 ? 47.239  -4.362  32.498  1.00 35.14 ? 372 HIS B NE2 1 
ATOM   6355  N  N   . SER B 1 359 ? 51.682  -5.289  29.108  1.00 42.07 ? 373 SER B N   1 
ATOM   6356  C  CA  . SER B 1 359 ? 52.814  -4.445  29.502  1.00 40.76 ? 373 SER B CA  1 
ATOM   6357  C  C   . SER B 1 359 ? 53.149  -3.368  28.484  1.00 42.60 ? 373 SER B C   1 
ATOM   6358  O  O   . SER B 1 359 ? 53.838  -2.402  28.803  1.00 45.30 ? 373 SER B O   1 
ATOM   6359  C  CB  . SER B 1 359 ? 54.059  -5.300  29.767  1.00 43.53 ? 373 SER B CB  1 
ATOM   6360  O  OG  . SER B 1 359 ? 54.124  -5.689  31.128  1.00 51.71 ? 373 SER B OG  1 
ATOM   6361  N  N   . ARG B 1 360 ? 52.671  -3.543  27.257  1.00 42.41 ? 374 ARG B N   1 
ATOM   6362  C  CA  . ARG B 1 360 ? 52.957  -2.601  26.180  1.00 47.79 ? 374 ARG B CA  1 
ATOM   6363  C  C   . ARG B 1 360 ? 51.952  -1.449  26.146  1.00 44.08 ? 374 ARG B C   1 
ATOM   6364  O  O   . ARG B 1 360 ? 52.164  -0.461  25.452  1.00 46.59 ? 374 ARG B O   1 
ATOM   6365  C  CB  . ARG B 1 360 ? 52.951  -3.324  24.829  1.00 49.32 ? 374 ARG B CB  1 
ATOM   6366  N  N   . ILE B 1 361 ? 50.862  -1.586  26.895  1.00 38.14 ? 375 ILE B N   1 
ATOM   6367  C  CA  . ILE B 1 361 ? 49.753  -0.632  26.824  1.00 37.29 ? 375 ILE B CA  1 
ATOM   6368  C  C   . ILE B 1 361 ? 50.101  0.685   27.507  1.00 38.03 ? 375 ILE B C   1 
ATOM   6369  O  O   . ILE B 1 361 ? 50.284  0.735   28.723  1.00 40.38 ? 375 ILE B O   1 
ATOM   6370  C  CB  . ILE B 1 361 ? 48.454  -1.212  27.428  1.00 33.54 ? 375 ILE B CB  1 
ATOM   6371  C  CG1 . ILE B 1 361 ? 48.059  -2.505  26.703  1.00 26.75 ? 375 ILE B CG1 1 
ATOM   6372  C  CG2 . ILE B 1 361 ? 47.330  -0.186  27.369  1.00 36.82 ? 375 ILE B CG2 1 
ATOM   6373  C  CD1 . ILE B 1 361 ? 46.684  -3.047  27.088  1.00 30.22 ? 375 ILE B CD1 1 
ATOM   6374  N  N   . LYS B 1 362 ? 50.195  1.740   26.705  1.00 31.22 ? 376 LYS B N   1 
ATOM   6375  C  CA  . LYS B 1 362 ? 50.537  3.073   27.205  1.00 35.15 ? 376 LYS B CA  1 
ATOM   6376  C  C   . LYS B 1 362 ? 49.303  3.873   27.605  1.00 34.85 ? 376 LYS B C   1 
ATOM   6377  O  O   . LYS B 1 362 ? 48.412  4.119   26.786  1.00 33.31 ? 376 LYS B O   1 
ATOM   6378  C  CB  . LYS B 1 362 ? 51.350  3.849   26.164  1.00 36.48 ? 376 LYS B CB  1 
ATOM   6379  N  N   . VAL B 1 363 ? 49.257  4.264   28.873  1.00 30.19 ? 377 VAL B N   1 
ATOM   6380  C  CA  . VAL B 1 363 ? 48.171  5.067   29.403  1.00 31.94 ? 377 VAL B CA  1 
ATOM   6381  C  C   . VAL B 1 363 ? 48.698  6.461   29.690  1.00 37.05 ? 377 VAL B C   1 
ATOM   6382  O  O   . VAL B 1 363 ? 49.672  6.603   30.420  1.00 31.86 ? 377 VAL B O   1 
ATOM   6383  C  CB  . VAL B 1 363 ? 47.661  4.511   30.732  1.00 34.22 ? 377 VAL B CB  1 
ATOM   6384  C  CG1 . VAL B 1 363 ? 46.569  5.423   31.297  1.00 29.92 ? 377 VAL B CG1 1 
ATOM   6385  C  CG2 . VAL B 1 363 ? 47.148  3.103   30.557  1.00 42.67 ? 377 VAL B CG2 1 
ATOM   6386  N  N   . GLY B 1 364 ? 48.059  7.487   29.132  1.00 38.77 ? 378 GLY B N   1 
ATOM   6387  C  CA  . GLY B 1 364 ? 48.509  8.852   29.368  1.00 42.16 ? 378 GLY B CA  1 
ATOM   6388  C  C   . GLY B 1 364 ? 47.711  9.926   28.651  1.00 35.72 ? 378 GLY B C   1 
ATOM   6389  O  O   . GLY B 1 364 ? 46.572  9.700   28.262  1.00 30.61 ? 378 GLY B O   1 
ATOM   6390  N  N   . ASP B 1 365 ? 48.335  11.095  28.494  1.00 35.91 ? 379 ASP B N   1 
ATOM   6391  C  CA  . ASP B 1 365 ? 47.767  12.267  27.833  1.00 30.67 ? 379 ASP B CA  1 
ATOM   6392  C  C   . ASP B 1 365 ? 47.738  12.026  26.326  1.00 31.35 ? 379 ASP B C   1 
ATOM   6393  O  O   . ASP B 1 365 ? 48.797  11.952  25.702  1.00 32.99 ? 379 ASP B O   1 
ATOM   6394  C  CB  . ASP B 1 365 ? 48.663  13.478  28.165  1.00 29.04 ? 379 ASP B CB  1 
ATOM   6395  C  CG  . ASP B 1 365 ? 48.176  14.792  27.561  1.00 25.97 ? 379 ASP B CG  1 
ATOM   6396  O  OD1 . ASP B 1 365 ? 47.519  14.790  26.502  1.00 29.14 ? 379 ASP B OD1 1 
ATOM   6397  O  OD2 . ASP B 1 365 ? 48.488  15.858  28.143  1.00 27.44 ? 379 ASP B OD2 1 
ATOM   6398  N  N   . PRO B 1 366 ? 46.532  11.931  25.728  1.00 28.19 ? 380 PRO B N   1 
ATOM   6399  C  CA  . PRO B 1 366 ? 46.433  11.573  24.306  1.00 25.59 ? 380 PRO B CA  1 
ATOM   6400  C  C   . PRO B 1 366 ? 46.825  12.740  23.400  1.00 29.60 ? 380 PRO B C   1 
ATOM   6401  O  O   . PRO B 1 366 ? 47.262  12.521  22.270  1.00 28.20 ? 380 PRO B O   1 
ATOM   6402  C  CB  . PRO B 1 366 ? 44.942  11.243  24.131  1.00 30.36 ? 380 PRO B CB  1 
ATOM   6403  C  CG  . PRO B 1 366 ? 44.254  12.145  25.119  1.00 25.98 ? 380 PRO B CG  1 
ATOM   6404  C  CD  . PRO B 1 366 ? 45.217  12.269  26.304  1.00 29.65 ? 380 PRO B CD  1 
ATOM   6405  N  N   . ALA B 1 367 ? 46.679  13.966  23.896  1.00 28.12 ? 381 ALA B N   1 
ATOM   6406  C  CA  . ALA B 1 367 ? 47.053  15.140  23.125  1.00 30.03 ? 381 ALA B CA  1 
ATOM   6407  C  C   . ALA B 1 367 ? 48.569  15.266  23.043  1.00 35.48 ? 381 ALA B C   1 
ATOM   6408  O  O   . ALA B 1 367 ? 49.110  15.672  22.013  1.00 38.89 ? 381 ALA B O   1 
ATOM   6409  C  CB  . ALA B 1 367 ? 46.458  16.389  23.741  1.00 33.88 ? 381 ALA B CB  1 
ATOM   6410  N  N   . GLU B 1 368 ? 49.251  14.922  24.133  1.00 29.30 ? 382 GLU B N   1 
ATOM   6411  C  CA  . GLU B 1 368 ? 50.707  15.052  24.195  1.00 33.89 ? 382 GLU B CA  1 
ATOM   6412  C  C   . GLU B 1 368 ? 51.409  13.891  23.508  1.00 33.61 ? 382 GLU B C   1 
ATOM   6413  O  O   . GLU B 1 368 ? 52.464  14.067  22.916  1.00 34.32 ? 382 GLU B O   1 
ATOM   6414  C  CB  . GLU B 1 368 ? 51.184  15.168  25.646  1.00 34.17 ? 382 GLU B CB  1 
ATOM   6415  N  N   . ASP B 1 369 ? 50.809  12.704  23.570  1.00 37.76 ? 383 ASP B N   1 
ATOM   6416  C  CA  . ASP B 1 369 ? 51.460  11.503  23.062  1.00 39.92 ? 383 ASP B CA  1 
ATOM   6417  C  C   . ASP B 1 369 ? 50.530  10.671  22.177  1.00 33.68 ? 383 ASP B C   1 
ATOM   6418  O  O   . ASP B 1 369 ? 49.682  9.936   22.677  1.00 33.25 ? 383 ASP B O   1 
ATOM   6419  C  CB  . ASP B 1 369 ? 51.974  10.658  24.235  1.00 40.20 ? 383 ASP B CB  1 
ATOM   6420  C  CG  . ASP B 1 369 ? 52.859  9.505   23.791  1.00 40.30 ? 383 ASP B CG  1 
ATOM   6421  O  OD1 . ASP B 1 369 ? 52.930  9.218   22.575  1.00 42.27 ? 383 ASP B OD1 1 
ATOM   6422  O  OD2 . ASP B 1 369 ? 53.494  8.884   24.669  1.00 38.46 ? 383 ASP B OD2 1 
ATOM   6423  N  N   . PHE B 1 370 ? 50.719  10.757  20.860  1.00 33.72 ? 384 PHE B N   1 
ATOM   6424  C  CA  . PHE B 1 370 ? 49.892  9.980   19.928  1.00 41.77 ? 384 PHE B CA  1 
ATOM   6425  C  C   . PHE B 1 370 ? 50.170  8.470   20.005  1.00 47.18 ? 384 PHE B C   1 
ATOM   6426  O  O   . PHE B 1 370 ? 49.495  7.675   19.356  1.00 49.32 ? 384 PHE B O   1 
ATOM   6427  C  CB  . PHE B 1 370 ? 50.049  10.477  18.484  1.00 41.15 ? 384 PHE B CB  1 
ATOM   6428  C  CG  . PHE B 1 370 ? 49.370  11.794  18.206  1.00 38.16 ? 384 PHE B CG  1 
ATOM   6429  C  CD1 . PHE B 1 370 ? 48.763  12.517  19.223  1.00 37.99 ? 384 PHE B CD1 1 
ATOM   6430  C  CD2 . PHE B 1 370 ? 49.327  12.300  16.918  1.00 40.13 ? 384 PHE B CD2 1 
ATOM   6431  C  CE1 . PHE B 1 370 ? 48.142  13.737  18.964  1.00 31.92 ? 384 PHE B CE1 1 
ATOM   6432  C  CE2 . PHE B 1 370 ? 48.700  13.511  16.651  1.00 40.91 ? 384 PHE B CE2 1 
ATOM   6433  C  CZ  . PHE B 1 370 ? 48.112  14.232  17.680  1.00 35.09 ? 384 PHE B CZ  1 
ATOM   6434  N  N   . GLY B 1 371 ? 51.165  8.080   20.796  1.00 47.98 ? 385 GLY B N   1 
ATOM   6435  C  CA  . GLY B 1 371 ? 51.423  6.675   21.052  1.00 44.58 ? 385 GLY B CA  1 
ATOM   6436  C  C   . GLY B 1 371 ? 50.528  6.098   22.139  1.00 41.55 ? 385 GLY B C   1 
ATOM   6437  O  O   . GLY B 1 371 ? 50.565  4.895   22.423  1.00 35.63 ? 385 GLY B O   1 
ATOM   6438  N  N   . THR B 1 372 ? 49.715  6.959   22.743  1.00 41.44 ? 386 THR B N   1 
ATOM   6439  C  CA  . THR B 1 372 ? 48.851  6.561   23.845  1.00 36.78 ? 386 THR B CA  1 
ATOM   6440  C  C   . THR B 1 372 ? 47.819  5.529   23.400  1.00 35.72 ? 386 THR B C   1 
ATOM   6441  O  O   . THR B 1 372 ? 47.162  5.712   22.373  1.00 35.21 ? 386 THR B O   1 
ATOM   6442  C  CB  . THR B 1 372 ? 48.118  7.779   24.423  1.00 34.59 ? 386 THR B CB  1 
ATOM   6443  O  OG1 . THR B 1 372 ? 49.078  8.743   24.866  1.00 32.60 ? 386 THR B OG1 1 
ATOM   6444  C  CG2 . THR B 1 372 ? 47.244  7.375   25.585  1.00 33.32 ? 386 THR B CG2 1 
ATOM   6445  N  N   . PHE B 1 373 ? 47.689  4.450   24.177  1.00 32.21 ? 387 PHE B N   1 
ATOM   6446  C  CA  . PHE B 1 373 ? 46.736  3.370   23.885  1.00 32.62 ? 387 PHE B CA  1 
ATOM   6447  C  C   . PHE B 1 373 ? 45.347  3.812   24.307  1.00 23.13 ? 387 PHE B C   1 
ATOM   6448  O  O   . PHE B 1 373 ? 44.415  3.755   23.515  1.00 22.65 ? 387 PHE B O   1 
ATOM   6449  C  CB  . PHE B 1 373 ? 47.132  2.083   24.627  1.00 36.87 ? 387 PHE B CB  1 
ATOM   6450  C  CG  . PHE B 1 373 ? 46.340  0.849   24.224  1.00 44.47 ? 387 PHE B CG  1 
ATOM   6451  C  CD1 . PHE B 1 373 ? 46.976  -0.230  23.626  1.00 50.16 ? 387 PHE B CD1 1 
ATOM   6452  C  CD2 . PHE B 1 373 ? 44.977  0.748   24.485  1.00 42.19 ? 387 PHE B CD2 1 
ATOM   6453  C  CE1 . PHE B 1 373 ? 46.264  -1.374  23.272  1.00 47.11 ? 387 PHE B CE1 1 
ATOM   6454  C  CE2 . PHE B 1 373 ? 44.260  -0.385  24.130  1.00 43.80 ? 387 PHE B CE2 1 
ATOM   6455  C  CZ  . PHE B 1 373 ? 44.903  -1.447  23.526  1.00 41.03 ? 387 PHE B CZ  1 
ATOM   6456  N  N   . PHE B 1 374 ? 45.207  4.206   25.570  1.00 28.60 ? 388 PHE B N   1 
ATOM   6457  C  CA  . PHE B 1 374 ? 44.010  4.915   26.025  1.00 27.45 ? 388 PHE B CA  1 
ATOM   6458  C  C   . PHE B 1 374 ? 44.348  5.870   27.163  1.00 29.82 ? 388 PHE B C   1 
ATOM   6459  O  O   . PHE B 1 374 ? 45.468  5.871   27.695  1.00 33.51 ? 388 PHE B O   1 
ATOM   6460  C  CB  . PHE B 1 374 ? 42.860  3.968   26.403  1.00 26.18 ? 388 PHE B CB  1 
ATOM   6461  C  CG  . PHE B 1 374 ? 43.054  3.244   27.714  1.00 30.36 ? 388 PHE B CG  1 
ATOM   6462  C  CD1 . PHE B 1 374 ? 43.831  2.092   27.787  1.00 30.82 ? 388 PHE B CD1 1 
ATOM   6463  C  CD2 . PHE B 1 374 ? 42.437  3.697   28.864  1.00 21.69 ? 388 PHE B CD2 1 
ATOM   6464  C  CE1 . PHE B 1 374 ? 43.997  1.425   28.987  1.00 29.06 ? 388 PHE B CE1 1 
ATOM   6465  C  CE2 . PHE B 1 374 ? 42.599  3.033   30.075  1.00 22.17 ? 388 PHE B CE2 1 
ATOM   6466  C  CZ  . PHE B 1 374 ? 43.380  1.891   30.132  1.00 29.48 ? 388 PHE B CZ  1 
ATOM   6467  N  N   . SER B 1 375 ? 43.386  6.702   27.527  1.00 24.47 ? 389 SER B N   1 
ATOM   6468  C  CA  . SER B 1 375 ? 43.671  7.775   28.471  1.00 30.79 ? 389 SER B CA  1 
ATOM   6469  C  C   . SER B 1 375 ? 42.804  7.620   29.706  1.00 31.16 ? 389 SER B C   1 
ATOM   6470  O  O   . SER B 1 375 ? 42.249  6.552   29.948  1.00 34.15 ? 389 SER B O   1 
ATOM   6471  C  CB  . SER B 1 375 ? 43.432  9.133   27.813  1.00 29.73 ? 389 SER B CB  1 
ATOM   6472  O  OG  . SER B 1 375 ? 44.062  10.169  28.537  1.00 30.28 ? 389 SER B OG  1 
ATOM   6473  N  N   . ALA B 1 376 ? 42.686  8.691   30.479  1.00 26.10 ? 390 ALA B N   1 
ATOM   6474  C  CA  . ALA B 1 376 ? 41.855  8.688   31.676  1.00 25.68 ? 390 ALA B CA  1 
ATOM   6475  C  C   . ALA B 1 376 ? 40.404  8.381   31.345  1.00 28.62 ? 390 ALA B C   1 
ATOM   6476  O  O   . ALA B 1 376 ? 39.952  8.623   30.215  1.00 25.24 ? 390 ALA B O   1 
ATOM   6477  C  CB  . ALA B 1 376 ? 41.942  10.036  32.349  1.00 24.22 ? 390 ALA B CB  1 
ATOM   6478  N  N   . VAL B 1 377 ? 39.667  7.876   32.337  1.00 24.93 ? 391 VAL B N   1 
ATOM   6479  C  CA  . VAL B 1 377 ? 38.232  7.663   32.167  1.00 26.19 ? 391 VAL B CA  1 
ATOM   6480  C  C   . VAL B 1 377 ? 37.498  9.001   32.272  1.00 26.22 ? 391 VAL B C   1 
ATOM   6481  O  O   . VAL B 1 377 ? 38.087  10.014  32.643  1.00 28.47 ? 391 VAL B O   1 
ATOM   6482  C  CB  . VAL B 1 377 ? 37.654  6.625   33.170  1.00 29.82 ? 391 VAL B CB  1 
ATOM   6483  C  CG1 . VAL B 1 377 ? 38.238  5.227   32.903  1.00 25.66 ? 391 VAL B CG1 1 
ATOM   6484  C  CG2 . VAL B 1 377 ? 37.940  7.055   34.609  1.00 25.52 ? 391 VAL B CG2 1 
ATOM   6485  N  N   . ILE B 1 378 ? 36.210  8.984   31.947  1.00 27.21 ? 392 ILE B N   1 
ATOM   6486  C  CA  . ILE B 1 378 ? 35.463  10.193  31.620  1.00 19.03 ? 392 ILE B CA  1 
ATOM   6487  C  C   . ILE B 1 378 ? 35.316  11.237  32.742  1.00 35.51 ? 392 ILE B C   1 
ATOM   6488  O  O   . ILE B 1 378 ? 35.491  12.437  32.496  1.00 27.81 ? 392 ILE B O   1 
ATOM   6489  C  CB  . ILE B 1 378 ? 34.086  9.844   31.005  1.00 25.14 ? 392 ILE B CB  1 
ATOM   6490  C  CG1 . ILE B 1 378 ? 33.439  11.091  30.421  1.00 27.48 ? 392 ILE B CG1 1 
ATOM   6491  C  CG2 . ILE B 1 378 ? 33.172  9.153   32.029  1.00 25.06 ? 392 ILE B CG2 1 
ATOM   6492  C  CD1 . ILE B 1 378 ? 34.264  11.758  29.332  1.00 25.41 ? 392 ILE B CD1 1 
ATOM   6493  N  N   . ASP B 1 379 ? 35.013  10.805  33.963  1.00 29.90 ? 393 ASP B N   1 
ATOM   6494  C  CA  . ASP B 1 379 ? 34.799  11.769  35.049  1.00 26.53 ? 393 ASP B CA  1 
ATOM   6495  C  C   . ASP B 1 379 ? 35.002  11.193  36.447  1.00 26.65 ? 393 ASP B C   1 
ATOM   6496  O  O   . ASP B 1 379 ? 35.330  10.013  36.604  1.00 27.18 ? 393 ASP B O   1 
ATOM   6497  C  CB  . ASP B 1 379 ? 33.414  12.419  34.937  1.00 33.55 ? 393 ASP B CB  1 
ATOM   6498  C  CG  . ASP B 1 379 ? 32.279  11.473  35.308  1.00 37.65 ? 393 ASP B CG  1 
ATOM   6499  O  OD1 . ASP B 1 379 ? 32.509  10.249  35.390  1.00 42.82 ? 393 ASP B OD1 1 
ATOM   6500  O  OD2 . ASP B 1 379 ? 31.146  11.957  35.510  1.00 32.14 ? 393 ASP B OD2 1 
ATOM   6501  N  N   . ALA B 1 380 ? 34.798  12.032  37.459  1.00 25.79 ? 394 ALA B N   1 
ATOM   6502  C  CA  . ALA B 1 380 ? 35.025  11.628  38.844  1.00 31.95 ? 394 ALA B CA  1 
ATOM   6503  C  C   . ALA B 1 380 ? 34.082  10.509  39.269  1.00 25.58 ? 394 ALA B C   1 
ATOM   6504  O  O   . ALA B 1 380 ? 34.507  9.541   39.901  1.00 31.41 ? 394 ALA B O   1 
ATOM   6505  C  CB  . ALA B 1 380 ? 34.900  12.824  39.789  1.00 34.90 ? 394 ALA B CB  1 
ATOM   6506  N  N   . LYS B 1 381 ? 32.807  10.658  38.948  1.00 28.42 ? 395 LYS B N   1 
ATOM   6507  C  CA  . LYS B 1 381 ? 31.827  9.612   39.242  1.00 36.97 ? 395 LYS B CA  1 
ATOM   6508  C  C   . LYS B 1 381 ? 32.274  8.241   38.711  1.00 38.36 ? 395 LYS B C   1 
ATOM   6509  O  O   . LYS B 1 381 ? 32.237  7.243   39.435  1.00 33.72 ? 395 LYS B O   1 
ATOM   6510  C  CB  . LYS B 1 381 ? 30.453  9.991   38.688  1.00 40.53 ? 395 LYS B CB  1 
ATOM   6511  N  N   . SER B 1 382 ? 32.734  8.194   37.464  1.00 32.78 ? 396 SER B N   1 
ATOM   6512  C  CA  . SER B 1 382 ? 33.166  6.927   36.886  1.00 30.96 ? 396 SER B CA  1 
ATOM   6513  C  C   . SER B 1 382 ? 34.463  6.411   37.487  1.00 30.89 ? 396 SER B C   1 
ATOM   6514  O  O   . SER B 1 382 ? 34.633  5.197   37.644  1.00 32.38 ? 396 SER B O   1 
ATOM   6515  C  CB  . SER B 1 382 ? 33.293  7.033   35.367  1.00 36.50 ? 396 SER B CB  1 
ATOM   6516  O  OG  . SER B 1 382 ? 32.053  7.415   34.817  1.00 37.18 ? 396 SER B OG  1 
ATOM   6517  N  N   . PHE B 1 383 ? 35.374  7.327   37.822  1.00 28.72 ? 397 PHE B N   1 
ATOM   6518  C  CA  . PHE B 1 383 ? 36.617  6.951   38.481  1.00 31.95 ? 397 PHE B CA  1 
ATOM   6519  C  C   . PHE B 1 383 ? 36.278  6.241   39.778  1.00 37.52 ? 397 PHE B C   1 
ATOM   6520  O  O   . PHE B 1 383 ? 36.881  5.223   40.109  1.00 33.53 ? 397 PHE B O   1 
ATOM   6521  C  CB  . PHE B 1 383 ? 37.492  8.175   38.781  1.00 30.86 ? 397 PHE B CB  1 
ATOM   6522  C  CG  . PHE B 1 383 ? 38.808  7.827   39.422  1.00 31.53 ? 397 PHE B CG  1 
ATOM   6523  C  CD1 . PHE B 1 383 ? 38.929  7.733   40.807  1.00 26.48 ? 397 PHE B CD1 1 
ATOM   6524  C  CD2 . PHE B 1 383 ? 39.922  7.575   38.640  1.00 31.03 ? 397 PHE B CD2 1 
ATOM   6525  C  CE1 . PHE B 1 383 ? 40.142  7.402   41.389  1.00 31.32 ? 397 PHE B CE1 1 
ATOM   6526  C  CE2 . PHE B 1 383 ? 41.128  7.247   39.215  1.00 35.86 ? 397 PHE B CE2 1 
ATOM   6527  C  CZ  . PHE B 1 383 ? 41.239  7.158   40.596  1.00 39.01 ? 397 PHE B CZ  1 
ATOM   6528  N  N   . ALA B 1 384 ? 35.303  6.785   40.502  1.00 42.23 ? 398 ALA B N   1 
ATOM   6529  C  CA  . ALA B 1 384 ? 34.901  6.237   41.792  1.00 44.59 ? 398 ALA B CA  1 
ATOM   6530  C  C   . ALA B 1 384 ? 34.346  4.822   41.642  1.00 40.82 ? 398 ALA B C   1 
ATOM   6531  O  O   . ALA B 1 384 ? 34.783  3.903   42.342  1.00 40.22 ? 398 ALA B O   1 
ATOM   6532  C  CB  . ALA B 1 384 ? 33.883  7.143   42.461  1.00 45.39 ? 398 ALA B CB  1 
ATOM   6533  N  N   . ARG B 1 385 ? 33.395  4.659   40.723  1.00 38.28 ? 399 ARG B N   1 
ATOM   6534  C  CA  . ARG B 1 385 ? 32.770  3.363   40.438  1.00 36.35 ? 399 ARG B CA  1 
ATOM   6535  C  C   . ARG B 1 385 ? 33.806  2.294   40.095  1.00 38.42 ? 399 ARG B C   1 
ATOM   6536  O  O   . ARG B 1 385 ? 33.838  1.213   40.694  1.00 35.50 ? 399 ARG B O   1 
ATOM   6537  C  CB  . ARG B 1 385 ? 31.779  3.504   39.286  1.00 39.40 ? 399 ARG B CB  1 
ATOM   6538  C  CG  . ARG B 1 385 ? 31.010  2.233   38.942  1.00 41.69 ? 399 ARG B CG  1 
ATOM   6539  C  CD  . ARG B 1 385 ? 29.974  2.486   37.843  1.00 47.85 ? 399 ARG B CD  1 
ATOM   6540  N  NE  . ARG B 1 385 ? 30.605  2.738   36.549  1.00 49.91 ? 399 ARG B NE  1 
ATOM   6541  C  CZ  . ARG B 1 385 ? 30.572  3.900   35.902  1.00 44.20 ? 399 ARG B CZ  1 
ATOM   6542  N  NH1 . ARG B 1 385 ? 31.188  4.021   34.734  1.00 40.21 ? 399 ARG B NH1 1 
ATOM   6543  N  NH2 . ARG B 1 385 ? 29.921  4.936   36.411  1.00 43.18 ? 399 ARG B NH2 1 
ATOM   6544  N  N   . ILE B 1 386 ? 34.665  2.614   39.137  1.00 31.10 ? 400 ILE B N   1 
ATOM   6545  C  CA  . ILE B 1 386 ? 35.713  1.702   38.714  1.00 32.35 ? 400 ILE B CA  1 
ATOM   6546  C  C   . ILE B 1 386 ? 36.656  1.331   39.866  1.00 32.05 ? 400 ILE B C   1 
ATOM   6547  O  O   . ILE B 1 386 ? 37.050  0.172   40.000  1.00 36.45 ? 400 ILE B O   1 
ATOM   6548  C  CB  . ILE B 1 386 ? 36.485  2.282   37.510  1.00 28.64 ? 400 ILE B CB  1 
ATOM   6549  C  CG1 . ILE B 1 386 ? 35.539  2.408   36.312  1.00 27.92 ? 400 ILE B CG1 1 
ATOM   6550  C  CG2 . ILE B 1 386 ? 37.700  1.414   37.168  1.00 26.69 ? 400 ILE B CG2 1 
ATOM   6551  C  CD1 . ILE B 1 386 ? 35.933  3.507   35.316  1.00 27.46 ? 400 ILE B CD1 1 
ATOM   6552  N  N   . LYS B 1 387 ? 36.999  2.305   40.706  1.00 33.38 ? 401 LYS B N   1 
ATOM   6553  C  CA  . LYS B 1 387 ? 37.898  2.051   41.833  1.00 34.76 ? 401 LYS B CA  1 
ATOM   6554  C  C   . LYS B 1 387 ? 37.281  1.039   42.802  1.00 35.37 ? 401 LYS B C   1 
ATOM   6555  O  O   . LYS B 1 387 ? 37.979  0.182   43.356  1.00 34.06 ? 401 LYS B O   1 
ATOM   6556  C  CB  . LYS B 1 387 ? 38.233  3.357   42.566  1.00 36.02 ? 401 LYS B CB  1 
ATOM   6557  C  CG  . LYS B 1 387 ? 39.292  3.239   43.650  1.00 36.71 ? 401 LYS B CG  1 
ATOM   6558  N  N   . LYS B 1 388 ? 35.971  1.145   43.003  1.00 27.65 ? 402 LYS B N   1 
ATOM   6559  C  CA  . LYS B 1 388 ? 35.254  0.203   43.857  1.00 35.69 ? 402 LYS B CA  1 
ATOM   6560  C  C   . LYS B 1 388 ? 35.349  -1.202  43.271  1.00 35.11 ? 402 LYS B C   1 
ATOM   6561  O  O   . LYS B 1 388 ? 35.523  -2.188  43.993  1.00 36.49 ? 402 LYS B O   1 
ATOM   6562  C  CB  . LYS B 1 388 ? 33.787  0.618   43.994  1.00 37.37 ? 402 LYS B CB  1 
ATOM   6563  N  N   . TRP B 1 389 ? 35.251  -1.286  41.950  1.00 26.63 ? 403 TRP B N   1 
ATOM   6564  C  CA  . TRP B 1 389 ? 35.370  -2.573  41.272  1.00 32.42 ? 403 TRP B CA  1 
ATOM   6565  C  C   . TRP B 1 389 ? 36.773  -3.164  41.395  1.00 34.30 ? 403 TRP B C   1 
ATOM   6566  O  O   . TRP B 1 389 ? 36.929  -4.374  41.587  1.00 40.94 ? 403 TRP B O   1 
ATOM   6567  C  CB  . TRP B 1 389 ? 34.916  -2.454  39.810  1.00 30.17 ? 403 TRP B CB  1 
ATOM   6568  C  CG  . TRP B 1 389 ? 33.423  -2.553  39.676  1.00 28.29 ? 403 TRP B CG  1 
ATOM   6569  C  CD1 . TRP B 1 389 ? 32.546  -1.542  39.412  1.00 34.41 ? 403 TRP B CD1 1 
ATOM   6570  C  CD2 . TRP B 1 389 ? 32.632  -3.736  39.833  1.00 29.56 ? 403 TRP B CD2 1 
ATOM   6571  N  NE1 . TRP B 1 389 ? 31.256  -2.025  39.380  1.00 28.65 ? 403 TRP B NE1 1 
ATOM   6572  C  CE2 . TRP B 1 389 ? 31.283  -3.373  39.642  1.00 27.82 ? 403 TRP B CE2 1 
ATOM   6573  C  CE3 . TRP B 1 389 ? 32.936  -5.075  40.117  1.00 31.12 ? 403 TRP B CE3 1 
ATOM   6574  C  CZ2 . TRP B 1 389 ? 30.241  -4.293  39.712  1.00 28.61 ? 403 TRP B CZ2 1 
ATOM   6575  C  CZ3 . TRP B 1 389 ? 31.896  -5.989  40.195  1.00 33.17 ? 403 TRP B CZ3 1 
ATOM   6576  C  CH2 . TRP B 1 389 ? 30.566  -5.593  39.992  1.00 32.43 ? 403 TRP B CH2 1 
ATOM   6577  N  N   . LEU B 1 390 ? 37.791  -2.313  41.302  1.00 32.12 ? 404 LEU B N   1 
ATOM   6578  C  CA  . LEU B 1 390 ? 39.164  -2.762  41.487  1.00 35.31 ? 404 LEU B CA  1 
ATOM   6579  C  C   . LEU B 1 390 ? 39.352  -3.297  42.898  1.00 43.47 ? 404 LEU B C   1 
ATOM   6580  O  O   . LEU B 1 390 ? 40.040  -4.298  43.106  1.00 46.53 ? 404 LEU B O   1 
ATOM   6581  C  CB  . LEU B 1 390 ? 40.159  -1.624  41.229  1.00 27.72 ? 404 LEU B CB  1 
ATOM   6582  C  CG  . LEU B 1 390 ? 40.231  -1.054  39.811  1.00 31.70 ? 404 LEU B CG  1 
ATOM   6583  C  CD1 . LEU B 1 390 ? 41.178  0.144   39.765  1.00 36.10 ? 404 LEU B CD1 1 
ATOM   6584  C  CD2 . LEU B 1 390 ? 40.646  -2.122  38.790  1.00 27.38 ? 404 LEU B CD2 1 
ATOM   6585  N  N   . GLU B 1 391 ? 38.744  -2.622  43.869  1.00 42.42 ? 405 GLU B N   1 
ATOM   6586  C  CA  . GLU B 1 391 ? 38.843  -3.055  45.261  1.00 42.73 ? 405 GLU B CA  1 
ATOM   6587  C  C   . GLU B 1 391 ? 38.141  -4.402  45.443  1.00 45.40 ? 405 GLU B C   1 
ATOM   6588  O  O   . GLU B 1 391 ? 38.603  -5.263  46.203  1.00 43.48 ? 405 GLU B O   1 
ATOM   6589  C  CB  . GLU B 1 391 ? 38.248  -2.005  46.199  1.00 41.86 ? 405 GLU B CB  1 
ATOM   6590  C  CG  . GLU B 1 391 ? 39.055  -0.708  46.283  1.00 48.01 ? 405 GLU B CG  1 
ATOM   6591  C  CD  . GLU B 1 391 ? 38.309  0.402   47.018  1.00 59.23 ? 405 GLU B CD  1 
ATOM   6592  O  OE1 . GLU B 1 391 ? 37.060  0.342   47.080  1.00 59.20 ? 405 GLU B OE1 1 
ATOM   6593  O  OE2 . GLU B 1 391 ? 38.969  1.332   47.534  1.00 65.27 ? 405 GLU B OE2 1 
ATOM   6594  N  N   . HIS B 1 392 ? 37.033  -4.575  44.728  1.00 42.55 ? 406 HIS B N   1 
ATOM   6595  C  CA  . HIS B 1 392 ? 36.262  -5.809  44.785  1.00 40.43 ? 406 HIS B CA  1 
ATOM   6596  C  C   . HIS B 1 392 ? 37.079  -6.959  44.216  1.00 40.64 ? 406 HIS B C   1 
ATOM   6597  O  O   . HIS B 1 392 ? 37.111  -8.049  44.790  1.00 41.15 ? 406 HIS B O   1 
ATOM   6598  C  CB  . HIS B 1 392 ? 34.949  -5.651  44.020  1.00 38.22 ? 406 HIS B CB  1 
ATOM   6599  C  CG  . HIS B 1 392 ? 34.166  -6.920  43.886  1.00 41.06 ? 406 HIS B CG  1 
ATOM   6600  N  ND1 . HIS B 1 392 ? 33.551  -7.532  44.957  1.00 40.77 ? 406 HIS B ND1 1 
ATOM   6601  C  CD2 . HIS B 1 392 ? 33.890  -7.690  42.806  1.00 38.15 ? 406 HIS B CD2 1 
ATOM   6602  C  CE1 . HIS B 1 392 ? 32.937  -8.626  44.543  1.00 43.04 ? 406 HIS B CE1 1 
ATOM   6603  N  NE2 . HIS B 1 392 ? 33.128  -8.745  43.240  1.00 37.43 ? 406 HIS B NE2 1 
ATOM   6604  N  N   . ALA B 1 393 ? 37.752  -6.716  43.092  1.00 39.37 ? 407 ALA B N   1 
ATOM   6605  C  CA  . ALA B 1 393 ? 38.598  -7.753  42.503  1.00 42.21 ? 407 ALA B CA  1 
ATOM   6606  C  C   . ALA B 1 393 ? 39.704  -8.147  43.478  1.00 41.52 ? 407 ALA B C   1 
ATOM   6607  O  O   . ALA B 1 393 ? 40.045  -9.320  43.598  1.00 40.54 ? 407 ALA B O   1 
ATOM   6608  C  CB  . ALA B 1 393 ? 39.191  -7.292  41.179  1.00 39.65 ? 407 ALA B CB  1 
ATOM   6609  N  N   . ARG B 1 394 ? 40.247  -7.162  44.187  1.00 40.54 ? 408 ARG B N   1 
ATOM   6610  C  CA  . ARG B 1 394 ? 41.368  -7.417  45.088  1.00 48.88 ? 408 ARG B CA  1 
ATOM   6611  C  C   . ARG B 1 394 ? 40.955  -8.056  46.420  1.00 52.29 ? 408 ARG B C   1 
ATOM   6612  O  O   . ARG B 1 394 ? 41.809  -8.481  47.199  1.00 65.31 ? 408 ARG B O   1 
ATOM   6613  C  CB  . ARG B 1 394 ? 42.173  -6.132  45.332  1.00 49.99 ? 408 ARG B CB  1 
ATOM   6614  C  CG  . ARG B 1 394 ? 43.633  -6.388  45.684  1.00 56.53 ? 408 ARG B CG  1 
ATOM   6615  C  CD  . ARG B 1 394 ? 44.429  -5.100  45.836  1.00 57.41 ? 408 ARG B CD  1 
ATOM   6616  N  NE  . ARG B 1 394 ? 44.643  -4.411  44.567  1.00 58.89 ? 408 ARG B NE  1 
ATOM   6617  C  CZ  . ARG B 1 394 ? 44.065  -3.259  44.233  1.00 59.08 ? 408 ARG B CZ  1 
ATOM   6618  N  NH1 . ARG B 1 394 ? 43.231  -2.656  45.075  1.00 60.17 ? 408 ARG B NH1 1 
ATOM   6619  N  NH2 . ARG B 1 394 ? 44.321  -2.708  43.055  1.00 54.71 ? 408 ARG B NH2 1 
ATOM   6620  N  N   . SER B 1 395 ? 39.655  -8.135  46.680  1.00 43.00 ? 409 SER B N   1 
ATOM   6621  C  CA  . SER B 1 395 ? 39.178  -8.694  47.944  1.00 38.20 ? 409 SER B CA  1 
ATOM   6622  C  C   . SER B 1 395 ? 38.346  -9.981  47.804  1.00 43.13 ? 409 SER B C   1 
ATOM   6623  O  O   . SER B 1 395 ? 38.497  -10.902 48.603  1.00 47.53 ? 409 SER B O   1 
ATOM   6624  C  CB  . SER B 1 395 ? 38.397  -7.640  48.730  1.00 46.69 ? 409 SER B CB  1 
ATOM   6625  O  OG  . SER B 1 395 ? 37.199  -7.293  48.056  1.00 51.02 ? 409 SER B OG  1 
ATOM   6626  N  N   . SER B 1 396 ? 37.475  -10.048 46.801  1.00 43.76 ? 410 SER B N   1 
ATOM   6627  C  CA  . SER B 1 396 ? 36.608  -11.223 46.620  1.00 49.94 ? 410 SER B CA  1 
ATOM   6628  C  C   . SER B 1 396 ? 37.411  -12.509 46.462  1.00 49.96 ? 410 SER B C   1 
ATOM   6629  O  O   . SER B 1 396 ? 38.358  -12.556 45.671  1.00 45.00 ? 410 SER B O   1 
ATOM   6630  C  CB  . SER B 1 396 ? 35.693  -11.045 45.405  1.00 51.24 ? 410 SER B CB  1 
ATOM   6631  O  OG  . SER B 1 396 ? 35.078  -12.273 45.050  1.00 49.79 ? 410 SER B OG  1 
ATOM   6632  N  N   . PRO B 1 397 ? 37.028  -13.562 47.207  1.00 54.17 ? 411 PRO B N   1 
ATOM   6633  C  CA  . PRO B 1 397 ? 37.776  -14.825 47.229  1.00 55.14 ? 411 PRO B CA  1 
ATOM   6634  C  C   . PRO B 1 397 ? 37.713  -15.550 45.888  1.00 51.36 ? 411 PRO B C   1 
ATOM   6635  O  O   . PRO B 1 397 ? 38.480  -16.486 45.656  1.00 48.20 ? 411 PRO B O   1 
ATOM   6636  C  CB  . PRO B 1 397 ? 37.052  -15.641 48.304  1.00 57.90 ? 411 PRO B CB  1 
ATOM   6637  C  CG  . PRO B 1 397 ? 35.663  -15.098 48.316  1.00 58.85 ? 411 PRO B CG  1 
ATOM   6638  C  CD  . PRO B 1 397 ? 35.807  -13.627 48.031  1.00 56.19 ? 411 PRO B CD  1 
ATOM   6639  N  N   . SER B 1 398 ? 36.803  -15.111 45.024  1.00 42.97 ? 412 SER B N   1 
ATOM   6640  C  CA  . SER B 1 398 ? 36.653  -15.689 43.702  1.00 43.04 ? 412 SER B CA  1 
ATOM   6641  C  C   . SER B 1 398 ? 37.553  -14.993 42.697  1.00 38.24 ? 412 SER B C   1 
ATOM   6642  O  O   . SER B 1 398 ? 37.772  -15.501 41.592  1.00 38.13 ? 412 SER B O   1 
ATOM   6643  C  CB  . SER B 1 398 ? 35.197  -15.568 43.236  1.00 47.40 ? 412 SER B CB  1 
ATOM   6644  O  OG  . SER B 1 398 ? 34.309  -16.144 44.180  1.00 56.56 ? 412 SER B OG  1 
ATOM   6645  N  N   . LEU B 1 399 ? 38.073  -13.829 43.078  1.00 35.54 ? 413 LEU B N   1 
ATOM   6646  C  CA  . LEU B 1 399 ? 38.768  -12.966 42.125  1.00 35.88 ? 413 LEU B CA  1 
ATOM   6647  C  C   . LEU B 1 399 ? 40.277  -12.799 42.370  1.00 35.97 ? 413 LEU B C   1 
ATOM   6648  O  O   . LEU B 1 399 ? 40.729  -12.635 43.503  1.00 41.11 ? 413 LEU B O   1 
ATOM   6649  C  CB  . LEU B 1 399 ? 38.077  -11.594 42.065  1.00 31.69 ? 413 LEU B CB  1 
ATOM   6650  C  CG  . LEU B 1 399 ? 36.569  -11.655 41.785  1.00 31.10 ? 413 LEU B CG  1 
ATOM   6651  C  CD1 . LEU B 1 399 ? 35.930  -10.266 41.824  1.00 33.37 ? 413 LEU B CD1 1 
ATOM   6652  C  CD2 . LEU B 1 399 ? 36.279  -12.308 40.449  1.00 31.01 ? 413 LEU B CD2 1 
ATOM   6653  N  N   . THR B 1 400 ? 41.037  -12.838 41.280  1.00 40.14 ? 414 THR B N   1 
ATOM   6654  C  CA  . THR B 1 400 ? 42.467  -12.566 41.300  1.00 44.56 ? 414 THR B CA  1 
ATOM   6655  C  C   . THR B 1 400 ? 42.805  -11.552 40.221  1.00 41.88 ? 414 THR B C   1 
ATOM   6656  O  O   . THR B 1 400 ? 42.532  -11.796 39.043  1.00 37.50 ? 414 THR B O   1 
ATOM   6657  C  CB  . THR B 1 400 ? 43.282  -13.830 40.989  1.00 43.10 ? 414 THR B CB  1 
ATOM   6658  O  OG1 . THR B 1 400 ? 42.913  -14.882 41.884  1.00 47.79 ? 414 THR B OG1 1 
ATOM   6659  C  CG2 . THR B 1 400 ? 44.768  -13.547 41.110  1.00 41.78 ? 414 THR B CG2 1 
ATOM   6660  N  N   . ILE B 1 401 ? 43.397  -10.421 40.608  1.00 41.08 ? 415 ILE B N   1 
ATOM   6661  C  CA  . ILE B 1 401 ? 43.912  -9.467  39.631  1.00 35.71 ? 415 ILE B CA  1 
ATOM   6662  C  C   . ILE B 1 401 ? 45.195  -10.028 39.047  1.00 36.86 ? 415 ILE B C   1 
ATOM   6663  O  O   . ILE B 1 401 ? 46.128  -10.336 39.773  1.00 34.51 ? 415 ILE B O   1 
ATOM   6664  C  CB  . ILE B 1 401 ? 44.247  -8.108  40.262  1.00 39.46 ? 415 ILE B CB  1 
ATOM   6665  C  CG1 . ILE B 1 401 ? 43.002  -7.483  40.898  1.00 36.99 ? 415 ILE B CG1 1 
ATOM   6666  C  CG2 . ILE B 1 401 ? 44.870  -7.175  39.212  1.00 33.96 ? 415 ILE B CG2 1 
ATOM   6667  C  CD1 . ILE B 1 401 ? 43.310  -6.216  41.692  1.00 43.68 ? 415 ILE B CD1 1 
ATOM   6668  N  N   . LEU B 1 402 ? 45.241  -10.149 37.731  1.00 38.69 ? 416 LEU B N   1 
ATOM   6669  C  CA  . LEU B 1 402 ? 46.385  -10.738 37.065  1.00 37.07 ? 416 LEU B CA  1 
ATOM   6670  C  C   . LEU B 1 402 ? 47.295  -9.644  36.529  1.00 42.09 ? 416 LEU B C   1 
ATOM   6671  O  O   . LEU B 1 402 ? 48.496  -9.850  36.366  1.00 48.20 ? 416 LEU B O   1 
ATOM   6672  C  CB  . LEU B 1 402 ? 45.911  -11.641 35.924  1.00 32.43 ? 416 LEU B CB  1 
ATOM   6673  C  CG  . LEU B 1 402 ? 44.934  -12.745 36.345  1.00 39.24 ? 416 LEU B CG  1 
ATOM   6674  C  CD1 . LEU B 1 402 ? 44.569  -13.624 35.159  1.00 44.46 ? 416 LEU B CD1 1 
ATOM   6675  C  CD2 . LEU B 1 402 ? 45.512  -13.585 37.481  1.00 35.83 ? 416 LEU B CD2 1 
ATOM   6676  N  N   . ALA B 1 403 ? 46.712  -8.480  36.258  1.00 38.40 ? 417 ALA B N   1 
ATOM   6677  C  CA  . ALA B 1 403 ? 47.449  -7.367  35.667  1.00 40.12 ? 417 ALA B CA  1 
ATOM   6678  C  C   . ALA B 1 403 ? 46.774  -6.029  35.948  1.00 42.34 ? 417 ALA B C   1 
ATOM   6679  O  O   . ALA B 1 403 ? 45.552  -5.952  36.062  1.00 35.17 ? 417 ALA B O   1 
ATOM   6680  C  CB  . ALA B 1 403 ? 47.597  -7.575  34.162  1.00 40.81 ? 417 ALA B CB  1 
ATOM   6681  N  N   . GLY B 1 404 ? 47.577  -4.969  36.037  1.00 38.92 ? 418 GLY B N   1 
ATOM   6682  C  CA  . GLY B 1 404 ? 47.057  -3.659  36.377  1.00 34.36 ? 418 GLY B CA  1 
ATOM   6683  C  C   . GLY B 1 404 ? 46.517  -3.645  37.796  1.00 36.86 ? 418 GLY B C   1 
ATOM   6684  O  O   . GLY B 1 404 ? 47.060  -4.324  38.671  1.00 38.02 ? 418 GLY B O   1 
ATOM   6685  N  N   . GLY B 1 405 ? 45.445  -2.886  38.019  1.00 34.40 ? 419 GLY B N   1 
ATOM   6686  C  CA  . GLY B 1 405 ? 44.809  -2.817  39.323  1.00 39.20 ? 419 GLY B CA  1 
ATOM   6687  C  C   . GLY B 1 405 ? 44.892  -1.454  40.002  1.00 45.08 ? 419 GLY B C   1 
ATOM   6688  O  O   . GLY B 1 405 ? 44.107  -1.169  40.911  1.00 44.79 ? 419 GLY B O   1 
ATOM   6689  N  N   . LYS B 1 406 ? 45.831  -0.614  39.569  1.00 29.67 ? 420 LYS B N   1 
ATOM   6690  C  CA  . LYS B 1 406 ? 46.065  0.674   40.231  1.00 31.00 ? 420 LYS B CA  1 
ATOM   6691  C  C   . LYS B 1 406 ? 45.326  1.791   39.539  1.00 37.40 ? 420 LYS B C   1 
ATOM   6692  O  O   . LYS B 1 406 ? 45.087  1.728   38.330  1.00 34.59 ? 420 LYS B O   1 
ATOM   6693  C  CB  . LYS B 1 406 ? 47.562  1.010   40.287  1.00 38.10 ? 420 LYS B CB  1 
ATOM   6694  N  N   . CYS B 1 407 ? 44.969  2.813   40.314  1.00 39.27 ? 421 CYS B N   1 
ATOM   6695  C  CA  . CYS B 1 407 ? 44.387  4.034   39.769  1.00 39.04 ? 421 CYS B CA  1 
ATOM   6696  C  C   . CYS B 1 407 ? 44.934  5.243   40.514  1.00 41.50 ? 421 CYS B C   1 
ATOM   6697  O  O   . CYS B 1 407 ? 45.350  5.133   41.666  1.00 41.00 ? 421 CYS B O   1 
ATOM   6698  C  CB  . CYS B 1 407 ? 42.860  4.002   39.857  1.00 38.93 ? 421 CYS B CB  1 
ATOM   6699  S  SG  . CYS B 1 407 ? 42.213  3.846   41.531  1.00 44.59 ? 421 CYS B SG  1 
ATOM   6700  N  N   . ASP B 1 408 ? 44.946  6.391   39.845  1.00 37.42 ? 422 ASP B N   1 
ATOM   6701  C  CA  . ASP B 1 408 ? 45.417  7.627   40.457  1.00 38.05 ? 422 ASP B CA  1 
ATOM   6702  C  C   . ASP B 1 408 ? 44.661  8.823   39.880  1.00 38.35 ? 422 ASP B C   1 
ATOM   6703  O  O   . ASP B 1 408 ? 44.667  9.039   38.666  1.00 38.31 ? 422 ASP B O   1 
ATOM   6704  C  CB  . ASP B 1 408 ? 46.922  7.790   40.231  1.00 41.77 ? 422 ASP B CB  1 
ATOM   6705  C  CG  . ASP B 1 408 ? 47.459  9.102   40.788  1.00 49.79 ? 422 ASP B CG  1 
ATOM   6706  O  OD1 . ASP B 1 408 ? 46.956  9.551   41.841  1.00 47.14 ? 422 ASP B OD1 1 
ATOM   6707  O  OD2 . ASP B 1 408 ? 48.376  9.684   40.167  1.00 53.19 ? 422 ASP B OD2 1 
ATOM   6708  N  N   . ASP B 1 409 ? 44.004  9.592   40.744  1.00 36.64 ? 423 ASP B N   1 
ATOM   6709  C  CA  . ASP B 1 409 ? 43.192  10.716  40.284  1.00 39.15 ? 423 ASP B CA  1 
ATOM   6710  C  C   . ASP B 1 409 ? 43.803  12.080  40.618  1.00 37.35 ? 423 ASP B C   1 
ATOM   6711  O  O   . ASP B 1 409 ? 43.091  13.074  40.706  1.00 38.80 ? 423 ASP B O   1 
ATOM   6712  C  CB  . ASP B 1 409 ? 41.768  10.628  40.845  1.00 38.96 ? 423 ASP B CB  1 
ATOM   6713  C  CG  . ASP B 1 409 ? 41.701  10.902  42.347  1.00 43.66 ? 423 ASP B CG  1 
ATOM   6714  O  OD1 . ASP B 1 409 ? 42.756  10.884  43.018  1.00 44.12 ? 423 ASP B OD1 1 
ATOM   6715  O  OD2 . ASP B 1 409 ? 40.583  11.133  42.854  1.00 44.55 ? 423 ASP B OD2 1 
ATOM   6716  N  N   . SER B 1 410 ? 45.117  12.132  40.800  1.00 39.93 ? 424 SER B N   1 
ATOM   6717  C  CA  . SER B 1 410 ? 45.745  13.391  41.201  1.00 41.47 ? 424 SER B CA  1 
ATOM   6718  C  C   . SER B 1 410 ? 45.800  14.438  40.069  1.00 43.05 ? 424 SER B C   1 
ATOM   6719  O  O   . SER B 1 410 ? 45.604  15.627  40.313  1.00 46.28 ? 424 SER B O   1 
ATOM   6720  C  CB  . SER B 1 410 ? 47.116  13.162  41.860  1.00 45.31 ? 424 SER B CB  1 
ATOM   6721  O  OG  . SER B 1 410 ? 48.028  12.501  41.002  1.00 50.37 ? 424 SER B OG  1 
ATOM   6722  N  N   . VAL B 1 411 ? 46.031  13.993  38.835  1.00 31.31 ? 425 VAL B N   1 
ATOM   6723  C  CA  . VAL B 1 411 ? 46.128  14.913  37.704  1.00 31.49 ? 425 VAL B CA  1 
ATOM   6724  C  C   . VAL B 1 411 ? 44.969  14.681  36.734  1.00 36.51 ? 425 VAL B C   1 
ATOM   6725  O  O   . VAL B 1 411 ? 44.372  15.631  36.209  1.00 30.75 ? 425 VAL B O   1 
ATOM   6726  C  CB  . VAL B 1 411 ? 47.481  14.760  36.967  1.00 35.68 ? 425 VAL B CB  1 
ATOM   6727  C  CG1 . VAL B 1 411 ? 47.496  15.558  35.675  1.00 38.79 ? 425 VAL B CG1 1 
ATOM   6728  C  CG2 . VAL B 1 411 ? 48.628  15.187  37.871  1.00 45.89 ? 425 VAL B CG2 1 
ATOM   6729  N  N   . GLY B 1 412 ? 44.652  13.406  36.515  1.00 29.95 ? 426 GLY B N   1 
ATOM   6730  C  CA  . GLY B 1 412 ? 43.546  13.019  35.656  1.00 27.62 ? 426 GLY B CA  1 
ATOM   6731  C  C   . GLY B 1 412 ? 42.854  11.791  36.214  1.00 28.72 ? 426 GLY B C   1 
ATOM   6732  O  O   . GLY B 1 412 ? 43.319  11.210  37.194  1.00 32.35 ? 426 GLY B O   1 
ATOM   6733  N  N   . TYR B 1 413 ? 41.753  11.367  35.596  1.00 26.94 ? 427 TYR B N   1 
ATOM   6734  C  CA  . TYR B 1 413 ? 41.038  10.202  36.115  1.00 26.01 ? 427 TYR B CA  1 
ATOM   6735  C  C   . TYR B 1 413 ? 41.663  8.912   35.589  1.00 29.20 ? 427 TYR B C   1 
ATOM   6736  O  O   . TYR B 1 413 ? 41.046  8.175   34.815  1.00 26.94 ? 427 TYR B O   1 
ATOM   6737  C  CB  . TYR B 1 413 ? 39.543  10.291  35.794  1.00 28.27 ? 427 TYR B CB  1 
ATOM   6738  C  CG  . TYR B 1 413 ? 38.935  11.564  36.329  1.00 31.56 ? 427 TYR B CG  1 
ATOM   6739  C  CD1 . TYR B 1 413 ? 38.934  11.832  37.692  1.00 34.39 ? 427 TYR B CD1 1 
ATOM   6740  C  CD2 . TYR B 1 413 ? 38.390  12.518  35.471  1.00 30.74 ? 427 TYR B CD2 1 
ATOM   6741  C  CE1 . TYR B 1 413 ? 38.396  13.012  38.198  1.00 33.93 ? 427 TYR B CE1 1 
ATOM   6742  C  CE2 . TYR B 1 413 ? 37.848  13.703  35.965  1.00 27.22 ? 427 TYR B CE2 1 
ATOM   6743  C  CZ  . TYR B 1 413 ? 37.853  13.944  37.328  1.00 34.57 ? 427 TYR B CZ  1 
ATOM   6744  O  OH  . TYR B 1 413 ? 37.320  15.114  37.824  1.00 36.98 ? 427 TYR B OH  1 
ATOM   6745  N  N   . PHE B 1 414 ? 42.890  8.636   36.028  1.00 29.92 ? 428 PHE B N   1 
ATOM   6746  C  CA  . PHE B 1 414 ? 43.701  7.602   35.398  1.00 30.42 ? 428 PHE B CA  1 
ATOM   6747  C  C   . PHE B 1 414 ? 43.570  6.226   36.044  1.00 31.47 ? 428 PHE B C   1 
ATOM   6748  O  O   . PHE B 1 414 ? 43.752  6.072   37.254  1.00 31.47 ? 428 PHE B O   1 
ATOM   6749  C  CB  . PHE B 1 414 ? 45.175  8.018   35.348  1.00 25.55 ? 428 PHE B CB  1 
ATOM   6750  C  CG  . PHE B 1 414 ? 45.502  8.991   34.242  1.00 34.31 ? 428 PHE B CG  1 
ATOM   6751  C  CD1 . PHE B 1 414 ? 45.543  8.569   32.919  1.00 31.66 ? 428 PHE B CD1 1 
ATOM   6752  C  CD2 . PHE B 1 414 ? 45.790  10.320  34.527  1.00 35.08 ? 428 PHE B CD2 1 
ATOM   6753  C  CE1 . PHE B 1 414 ? 45.850  9.459   31.895  1.00 27.76 ? 428 PHE B CE1 1 
ATOM   6754  C  CE2 . PHE B 1 414 ? 46.103  11.220  33.513  1.00 34.89 ? 428 PHE B CE2 1 
ATOM   6755  C  CZ  . PHE B 1 414 ? 46.142  10.792  32.196  1.00 28.91 ? 428 PHE B CZ  1 
ATOM   6756  N  N   . VAL B 1 415 ? 43.276  5.232   35.210  1.00 26.50 ? 429 VAL B N   1 
ATOM   6757  C  CA  . VAL B 1 415 ? 43.109  3.854   35.654  1.00 29.65 ? 429 VAL B CA  1 
ATOM   6758  C  C   . VAL B 1 415 ? 43.907  2.914   34.753  1.00 29.74 ? 429 VAL B C   1 
ATOM   6759  O  O   . VAL B 1 415 ? 43.741  2.920   33.533  1.00 33.99 ? 429 VAL B O   1 
ATOM   6760  C  CB  . VAL B 1 415 ? 41.626  3.429   35.618  1.00 31.12 ? 429 VAL B CB  1 
ATOM   6761  C  CG1 . VAL B 1 415 ? 41.474  1.967   36.029  1.00 29.13 ? 429 VAL B CG1 1 
ATOM   6762  C  CG2 . VAL B 1 415 ? 40.797  4.333   36.523  1.00 31.58 ? 429 VAL B CG2 1 
ATOM   6763  N  N   . GLU B 1 416 ? 44.776  2.108   35.352  1.00 25.79 ? 430 GLU B N   1 
ATOM   6764  C  CA  . GLU B 1 416 ? 45.535  1.134   34.583  1.00 29.01 ? 430 GLU B CA  1 
ATOM   6765  C  C   . GLU B 1 416 ? 44.550  0.136   33.997  1.00 28.98 ? 430 GLU B C   1 
ATOM   6766  O  O   . GLU B 1 416 ? 43.518  -0.131  34.610  1.00 31.16 ? 430 GLU B O   1 
ATOM   6767  C  CB  . GLU B 1 416 ? 46.569  0.420   35.471  1.00 33.11 ? 430 GLU B CB  1 
ATOM   6768  N  N   . PRO B 1 417 ? 44.840  -0.378  32.791  1.00 30.11 ? 431 PRO B N   1 
ATOM   6769  C  CA  . PRO B 1 417 ? 44.049  -1.490  32.250  1.00 28.46 ? 431 PRO B CA  1 
ATOM   6770  C  C   . PRO B 1 417 ? 44.139  -2.652  33.224  1.00 37.23 ? 431 PRO B C   1 
ATOM   6771  O  O   . PRO B 1 417 ? 45.235  -2.972  33.690  1.00 37.50 ? 431 PRO B O   1 
ATOM   6772  C  CB  . PRO B 1 417 ? 44.759  -1.828  30.933  1.00 31.67 ? 431 PRO B CB  1 
ATOM   6773  C  CG  . PRO B 1 417 ? 46.151  -1.226  31.062  1.00 31.31 ? 431 PRO B CG  1 
ATOM   6774  C  CD  . PRO B 1 417 ? 45.971  -0.013  31.917  1.00 34.38 ? 431 PRO B CD  1 
ATOM   6775  N  N   . CYS B 1 418 ? 43.004  -3.252  33.556  1.00 38.65 ? 432 CYS B N   1 
ATOM   6776  C  CA  . CYS B 1 418 ? 42.976  -4.288  34.577  1.00 36.55 ? 432 CYS B CA  1 
ATOM   6777  C  C   . CYS B 1 418 ? 42.392  -5.607  34.070  1.00 30.92 ? 432 CYS B C   1 
ATOM   6778  O  O   . CYS B 1 418 ? 41.302  -5.642  33.486  1.00 27.19 ? 432 CYS B O   1 
ATOM   6779  C  CB  . CYS B 1 418 ? 42.188  -3.802  35.793  1.00 38.42 ? 432 CYS B CB  1 
ATOM   6780  S  SG  . CYS B 1 418 ? 42.325  -4.901  37.204  1.00 36.99 ? 432 CYS B SG  1 
ATOM   6781  N  N   . ILE B 1 419 ? 43.134  -6.686  34.292  1.00 31.27 ? 433 ILE B N   1 
ATOM   6782  C  CA  . ILE B 1 419 ? 42.692  -8.032  33.936  1.00 30.05 ? 433 ILE B CA  1 
ATOM   6783  C  C   . ILE B 1 419 ? 42.479  -8.833  35.206  1.00 33.51 ? 433 ILE B C   1 
ATOM   6784  O  O   . ILE B 1 419 ? 43.387  -8.950  36.037  1.00 34.46 ? 433 ILE B O   1 
ATOM   6785  C  CB  . ILE B 1 419 ? 43.731  -8.759  33.068  1.00 31.71 ? 433 ILE B CB  1 
ATOM   6786  C  CG1 . ILE B 1 419 ? 44.011  -7.959  31.796  1.00 31.84 ? 433 ILE B CG1 1 
ATOM   6787  C  CG2 . ILE B 1 419 ? 43.239  -10.157 32.707  1.00 37.12 ? 433 ILE B CG2 1 
ATOM   6788  C  CD1 . ILE B 1 419 ? 45.098  -8.578  30.917  1.00 35.83 ? 433 ILE B CD1 1 
ATOM   6789  N  N   . VAL B 1 420 ? 41.285  -9.400  35.344  1.00 30.91 ? 434 VAL B N   1 
ATOM   6790  C  CA  . VAL B 1 420 ? 40.873  -10.074 36.568  1.00 32.69 ? 434 VAL B CA  1 
ATOM   6791  C  C   . VAL B 1 420 ? 40.332  -11.480 36.291  1.00 31.32 ? 434 VAL B C   1 
ATOM   6792  O  O   . VAL B 1 420 ? 39.407  -11.635 35.497  1.00 30.15 ? 434 VAL B O   1 
ATOM   6793  C  CB  . VAL B 1 420 ? 39.752  -9.277  37.246  1.00 32.79 ? 434 VAL B CB  1 
ATOM   6794  C  CG1 . VAL B 1 420 ? 39.246  -10.016 38.473  1.00 35.72 ? 434 VAL B CG1 1 
ATOM   6795  C  CG2 . VAL B 1 420 ? 40.234  -7.875  37.597  1.00 33.41 ? 434 VAL B CG2 1 
ATOM   6796  N  N   . GLU B 1 421 ? 40.894  -12.509 36.925  1.00 32.19 ? 435 GLU B N   1 
ATOM   6797  C  CA  . GLU B 1 421 ? 40.325  -13.844 36.755  1.00 34.12 ? 435 GLU B CA  1 
ATOM   6798  C  C   . GLU B 1 421 ? 39.273  -14.132 37.806  1.00 35.56 ? 435 GLU B C   1 
ATOM   6799  O  O   . GLU B 1 421 ? 39.487  -13.872 38.986  1.00 34.39 ? 435 GLU B O   1 
ATOM   6800  C  CB  . GLU B 1 421 ? 41.382  -14.954 36.784  1.00 35.98 ? 435 GLU B CB  1 
ATOM   6801  C  CG  . GLU B 1 421 ? 40.764  -16.321 36.494  1.00 35.19 ? 435 GLU B CG  1 
ATOM   6802  C  CD  . GLU B 1 421 ? 41.749  -17.462 36.600  1.00 42.73 ? 435 GLU B CD  1 
ATOM   6803  O  OE1 . GLU B 1 421 ? 42.939  -17.201 36.880  1.00 46.83 ? 435 GLU B OE1 1 
ATOM   6804  O  OE2 . GLU B 1 421 ? 41.326  -18.622 36.398  1.00 36.01 ? 435 GLU B OE2 1 
ATOM   6805  N  N   . SER B 1 422 ? 38.139  -14.678 37.372  1.00 34.46 ? 436 SER B N   1 
ATOM   6806  C  CA  . SER B 1 422 ? 37.110  -15.135 38.295  1.00 35.94 ? 436 SER B CA  1 
ATOM   6807  C  C   . SER B 1 422 ? 36.992  -16.648 38.275  1.00 38.27 ? 436 SER B C   1 
ATOM   6808  O  O   . SER B 1 422 ? 36.931  -17.247 37.202  1.00 40.67 ? 436 SER B O   1 
ATOM   6809  C  CB  . SER B 1 422 ? 35.748  -14.553 37.928  1.00 31.60 ? 436 SER B CB  1 
ATOM   6810  O  OG  . SER B 1 422 ? 34.787  -15.024 38.856  1.00 33.30 ? 436 SER B OG  1 
ATOM   6811  N  N   . LYS B 1 423 ? 36.949  -17.261 39.457  1.00 40.67 ? 437 LYS B N   1 
ATOM   6812  C  CA  . LYS B 1 423 ? 36.672  -18.690 39.577  1.00 41.22 ? 437 LYS B CA  1 
ATOM   6813  C  C   . LYS B 1 423 ? 35.164  -18.950 39.487  1.00 45.63 ? 437 LYS B C   1 
ATOM   6814  O  O   . LYS B 1 423 ? 34.730  -20.085 39.308  1.00 45.49 ? 437 LYS B O   1 
ATOM   6815  C  CB  . LYS B 1 423 ? 37.228  -19.254 40.895  1.00 35.75 ? 437 LYS B CB  1 
ATOM   6816  N  N   . ASP B 1 424 ? 34.371  -17.887 39.600  1.00 44.55 ? 438 ASP B N   1 
ATOM   6817  C  CA  . ASP B 1 424 ? 32.912  -18.007 39.628  1.00 42.99 ? 438 ASP B CA  1 
ATOM   6818  C  C   . ASP B 1 424 ? 32.252  -17.335 38.421  1.00 36.73 ? 438 ASP B C   1 
ATOM   6819  O  O   . ASP B 1 424 ? 32.279  -16.108 38.292  1.00 34.21 ? 438 ASP B O   1 
ATOM   6820  C  CB  . ASP B 1 424 ? 32.376  -17.400 40.926  1.00 44.38 ? 438 ASP B CB  1 
ATOM   6821  C  CG  . ASP B 1 424 ? 30.869  -17.509 41.057  1.00 45.63 ? 438 ASP B CG  1 
ATOM   6822  O  OD1 . ASP B 1 424 ? 30.226  -18.241 40.266  1.00 46.88 ? 438 ASP B OD1 1 
ATOM   6823  O  OD2 . ASP B 1 424 ? 30.328  -16.862 41.977  1.00 43.77 ? 438 ASP B OD2 1 
ATOM   6824  N  N   . PRO B 1 425 ? 31.637  -18.138 37.542  1.00 34.52 ? 439 PRO B N   1 
ATOM   6825  C  CA  . PRO B 1 425 ? 31.038  -17.590 36.318  1.00 36.32 ? 439 PRO B CA  1 
ATOM   6826  C  C   . PRO B 1 425 ? 29.814  -16.731 36.618  1.00 34.00 ? 439 PRO B C   1 
ATOM   6827  O  O   . PRO B 1 425 ? 29.344  -15.983 35.754  1.00 35.55 ? 439 PRO B O   1 
ATOM   6828  C  CB  . PRO B 1 425 ? 30.642  -18.843 35.537  1.00 34.76 ? 439 PRO B CB  1 
ATOM   6829  C  CG  . PRO B 1 425 ? 30.429  -19.885 36.587  1.00 35.65 ? 439 PRO B CG  1 
ATOM   6830  C  CD  . PRO B 1 425 ? 31.432  -19.593 37.658  1.00 38.32 ? 439 PRO B CD  1 
ATOM   6831  N  N   . GLN B 1 426 ? 29.318  -16.829 37.846  1.00 36.78 ? 440 GLN B N   1 
ATOM   6832  C  CA  . GLN B 1 426 ? 28.159  -16.054 38.286  1.00 39.33 ? 440 GLN B CA  1 
ATOM   6833  C  C   . GLN B 1 426 ? 28.564  -14.860 39.147  1.00 35.19 ? 440 GLN B C   1 
ATOM   6834  O  O   . GLN B 1 426 ? 27.705  -14.181 39.695  1.00 36.63 ? 440 GLN B O   1 
ATOM   6835  C  CB  . GLN B 1 426 ? 27.196  -16.944 39.082  1.00 44.51 ? 440 GLN B CB  1 
ATOM   6836  C  CG  . GLN B 1 426 ? 26.650  -18.146 38.322  1.00 44.33 ? 440 GLN B CG  1 
ATOM   6837  C  CD  . GLN B 1 426 ? 25.550  -17.776 37.348  1.00 48.75 ? 440 GLN B CD  1 
ATOM   6838  O  OE1 . GLN B 1 426 ? 25.124  -16.619 37.274  1.00 48.65 ? 440 GLN B OE1 1 
ATOM   6839  N  NE2 . GLN B 1 426 ? 25.080  -18.759 36.596  1.00 48.98 ? 440 GLN B NE2 1 
ATOM   6840  N  N   . GLU B 1 427 ? 29.867  -14.619 39.283  1.00 33.80 ? 441 GLU B N   1 
ATOM   6841  C  CA  . GLU B 1 427 ? 30.358  -13.503 40.089  1.00 30.10 ? 441 GLU B CA  1 
ATOM   6842  C  C   . GLU B 1 427 ? 29.794  -12.188 39.564  1.00 32.42 ? 441 GLU B C   1 
ATOM   6843  O  O   . GLU B 1 427 ? 29.635  -12.025 38.357  1.00 34.13 ? 441 GLU B O   1 
ATOM   6844  C  CB  . GLU B 1 427 ? 31.887  -13.451 40.053  1.00 35.51 ? 441 GLU B CB  1 
ATOM   6845  C  CG  . GLU B 1 427 ? 32.562  -13.437 41.421  1.00 35.65 ? 441 GLU B CG  1 
ATOM   6846  C  CD  . GLU B 1 427 ? 32.635  -12.045 42.043  1.00 40.90 ? 441 GLU B CD  1 
ATOM   6847  O  OE1 . GLU B 1 427 ? 32.552  -11.035 41.297  1.00 39.23 ? 441 GLU B OE1 1 
ATOM   6848  O  OE2 . GLU B 1 427 ? 32.778  -11.966 43.284  1.00 42.51 ? 441 GLU B OE2 1 
ATOM   6849  N  N   . PRO B 1 428 ? 29.469  -11.253 40.468  1.00 32.68 ? 442 PRO B N   1 
ATOM   6850  C  CA  . PRO B 1 428 ? 29.014  -9.920  40.046  1.00 30.49 ? 442 PRO B CA  1 
ATOM   6851  C  C   . PRO B 1 428 ? 29.911  -9.299  38.986  1.00 31.75 ? 442 PRO B C   1 
ATOM   6852  O  O   . PRO B 1 428 ? 29.385  -8.700  38.051  1.00 32.08 ? 442 PRO B O   1 
ATOM   6853  C  CB  . PRO B 1 428 ? 29.087  -9.109  41.338  1.00 32.83 ? 442 PRO B CB  1 
ATOM   6854  C  CG  . PRO B 1 428 ? 28.777  -10.100 42.394  1.00 37.27 ? 442 PRO B CG  1 
ATOM   6855  C  CD  . PRO B 1 428 ? 29.344  -11.433 41.924  1.00 39.37 ? 442 PRO B CD  1 
ATOM   6856  N  N   . ILE B 1 429 ? 31.232  -9.444  39.112  1.00 30.32 ? 443 ILE B N   1 
ATOM   6857  C  CA  . ILE B 1 429 ? 32.135  -8.844  38.132  1.00 24.53 ? 443 ILE B CA  1 
ATOM   6858  C  C   . ILE B 1 429 ? 31.952  -9.445  36.724  1.00 28.81 ? 443 ILE B C   1 
ATOM   6859  O  O   . ILE B 1 429 ? 32.427  -8.877  35.746  1.00 26.72 ? 443 ILE B O   1 
ATOM   6860  C  CB  . ILE B 1 429 ? 33.609  -8.902  38.560  1.00 29.02 ? 443 ILE B CB  1 
ATOM   6861  C  CG1 . ILE B 1 429 ? 34.403  -7.751  37.910  1.00 25.74 ? 443 ILE B CG1 1 
ATOM   6862  C  CG2 . ILE B 1 429 ? 34.207  -10.268 38.233  1.00 32.51 ? 443 ILE B CG2 1 
ATOM   6863  C  CD1 . ILE B 1 429 ? 35.751  -7.488  38.571  1.00 31.46 ? 443 ILE B CD1 1 
ATOM   6864  N  N   . MET B 1 430 ? 31.260  -10.585 36.635  1.00 27.54 ? 444 MET B N   1 
ATOM   6865  C  CA  . MET B 1 430 ? 30.975  -11.234 35.355  1.00 30.66 ? 444 MET B CA  1 
ATOM   6866  C  C   . MET B 1 430 ? 29.676  -10.724 34.742  1.00 28.69 ? 444 MET B C   1 
ATOM   6867  O  O   . MET B 1 430 ? 29.442  -10.884 33.539  1.00 25.56 ? 444 MET B O   1 
ATOM   6868  C  CB  . MET B 1 430 ? 30.871  -12.768 35.512  1.00 30.70 ? 444 MET B CB  1 
ATOM   6869  C  CG  . MET B 1 430 ? 32.180  -13.460 35.875  1.00 31.49 ? 444 MET B CG  1 
ATOM   6870  S  SD  . MET B 1 430 ? 33.454  -13.334 34.598  1.00 34.15 ? 444 MET B SD  1 
ATOM   6871  C  CE  . MET B 1 430 ? 32.667  -14.178 33.214  1.00 28.15 ? 444 MET B CE  1 
ATOM   6872  N  N   . LYS B 1 431 ? 28.830  -10.111 35.564  1.00 31.61 ? 445 LYS B N   1 
ATOM   6873  C  CA  . LYS B 1 431 ? 27.483  -9.759  35.121  1.00 35.54 ? 445 LYS B CA  1 
ATOM   6874  C  C   . LYS B 1 431 ? 27.151  -8.263  35.101  1.00 41.09 ? 445 LYS B C   1 
ATOM   6875  O  O   . LYS B 1 431 ? 26.263  -7.838  34.365  1.00 41.01 ? 445 LYS B O   1 
ATOM   6876  C  CB  . LYS B 1 431 ? 26.436  -10.533 35.933  1.00 34.19 ? 445 LYS B CB  1 
ATOM   6877  C  CG  . LYS B 1 431 ? 26.437  -12.026 35.625  1.00 43.42 ? 445 LYS B CG  1 
ATOM   6878  C  CD  . LYS B 1 431 ? 25.265  -12.771 36.255  1.00 48.46 ? 445 LYS B CD  1 
ATOM   6879  C  CE  . LYS B 1 431 ? 25.371  -12.798 37.766  1.00 48.87 ? 445 LYS B CE  1 
ATOM   6880  N  NZ  . LYS B 1 431 ? 24.606  -13.952 38.330  1.00 51.11 ? 445 LYS B NZ  1 
ATOM   6881  N  N   . GLU B 1 432 ? 27.855  -7.464  35.893  1.00 37.14 ? 446 GLU B N   1 
ATOM   6882  C  CA  . GLU B 1 432 ? 27.511  -6.043  36.010  1.00 32.21 ? 446 GLU B CA  1 
ATOM   6883  C  C   . GLU B 1 432 ? 28.425  -5.159  35.174  1.00 30.73 ? 446 GLU B C   1 
ATOM   6884  O  O   . GLU B 1 432 ? 29.637  -5.358  35.152  1.00 30.07 ? 446 GLU B O   1 
ATOM   6885  C  CB  . GLU B 1 432 ? 27.533  -5.613  37.484  1.00 30.22 ? 446 GLU B CB  1 
ATOM   6886  C  CG  . GLU B 1 432 ? 26.591  -6.445  38.347  1.00 42.66 ? 446 GLU B CG  1 
ATOM   6887  C  CD  . GLU B 1 432 ? 26.684  -6.114  39.822  1.00 54.00 ? 446 GLU B CD  1 
ATOM   6888  O  OE1 . GLU B 1 432 ? 27.146  -5.003  40.153  1.00 56.82 ? 446 GLU B OE1 1 
ATOM   6889  O  OE2 . GLU B 1 432 ? 26.300  -6.970  40.650  1.00 60.71 ? 446 GLU B OE2 1 
ATOM   6890  N  N   . GLU B 1 433 ? 27.839  -4.180  34.490  1.00 32.14 ? 447 GLU B N   1 
ATOM   6891  C  CA  . GLU B 1 433 ? 28.590  -3.290  33.605  1.00 30.36 ? 447 GLU B CA  1 
ATOM   6892  C  C   . GLU B 1 433 ? 29.442  -2.300  34.401  1.00 31.85 ? 447 GLU B C   1 
ATOM   6893  O  O   . GLU B 1 433 ? 28.942  -1.627  35.301  1.00 33.91 ? 447 GLU B O   1 
ATOM   6894  C  CB  . GLU B 1 433 ? 27.634  -2.543  32.658  1.00 32.07 ? 447 GLU B CB  1 
ATOM   6895  N  N   . ILE B 1 434 ? 30.733  -2.231  34.079  1.00 29.66 ? 448 ILE B N   1 
ATOM   6896  C  CA  . ILE B 1 434 ? 31.669  -1.359  34.794  1.00 27.46 ? 448 ILE B CA  1 
ATOM   6897  C  C   . ILE B 1 434 ? 31.876  -0.089  33.971  1.00 31.40 ? 448 ILE B C   1 
ATOM   6898  O  O   . ILE B 1 434 ? 32.024  1.000   34.524  1.00 30.32 ? 448 ILE B O   1 
ATOM   6899  C  CB  . ILE B 1 434 ? 33.011  -2.095  35.084  1.00 25.83 ? 448 ILE B CB  1 
ATOM   6900  C  CG1 . ILE B 1 434 ? 32.754  -3.331  35.963  1.00 26.85 ? 448 ILE B CG1 1 
ATOM   6901  C  CG2 . ILE B 1 434 ? 34.026  -1.175  35.735  1.00 29.20 ? 448 ILE B CG2 1 
ATOM   6902  C  CD1 . ILE B 1 434 ? 33.956  -4.238  36.167  1.00 32.13 ? 448 ILE B CD1 1 
ATOM   6903  N  N   . PHE B 1 435 ? 31.827  -0.246  32.650  1.00 27.50 ? 449 PHE B N   1 
ATOM   6904  C  CA  . PHE B 1 435 ? 32.090  0.831   31.710  1.00 21.90 ? 449 PHE B CA  1 
ATOM   6905  C  C   . PHE B 1 435 ? 33.447  1.444   32.062  1.00 27.63 ? 449 PHE B C   1 
ATOM   6906  O  O   . PHE B 1 435 ? 33.562  2.646   32.295  1.00 28.08 ? 449 PHE B O   1 
ATOM   6907  C  CB  . PHE B 1 435 ? 30.945  1.881   31.723  1.00 29.29 ? 449 PHE B CB  1 
ATOM   6908  C  CG  . PHE B 1 435 ? 30.620  2.455   30.364  1.00 38.07 ? 449 PHE B CG  1 
ATOM   6909  C  CD1 . PHE B 1 435 ? 30.924  3.773   30.057  1.00 40.17 ? 449 PHE B CD1 1 
ATOM   6910  C  CD2 . PHE B 1 435 ? 30.013  1.673   29.387  1.00 39.23 ? 449 PHE B CD2 1 
ATOM   6911  C  CE1 . PHE B 1 435 ? 30.620  4.303   28.804  1.00 39.76 ? 449 PHE B CE1 1 
ATOM   6912  C  CE2 . PHE B 1 435 ? 29.716  2.197   28.140  1.00 37.72 ? 449 PHE B CE2 1 
ATOM   6913  C  CZ  . PHE B 1 435 ? 30.019  3.509   27.848  1.00 39.92 ? 449 PHE B CZ  1 
ATOM   6914  N  N   . GLY B 1 436 ? 34.467  0.591   32.113  1.00 27.36 ? 450 GLY B N   1 
ATOM   6915  C  CA  . GLY B 1 436 ? 35.809  0.993   32.509  1.00 24.08 ? 450 GLY B CA  1 
ATOM   6916  C  C   . GLY B 1 436 ? 36.766  -0.073  32.017  1.00 21.45 ? 450 GLY B C   1 
ATOM   6917  O  O   . GLY B 1 436 ? 36.320  -1.081  31.430  1.00 22.30 ? 450 GLY B O   1 
ATOM   6918  N  N   . PRO B 1 437 ? 38.074  0.146   32.207  1.00 23.35 ? 451 PRO B N   1 
ATOM   6919  C  CA  . PRO B 1 437 ? 39.090  -0.744  31.642  1.00 22.82 ? 451 PRO B CA  1 
ATOM   6920  C  C   . PRO B 1 437 ? 39.323  -1.966  32.527  1.00 27.16 ? 451 PRO B C   1 
ATOM   6921  O  O   . PRO B 1 437 ? 40.428  -2.192  33.042  1.00 25.86 ? 451 PRO B O   1 
ATOM   6922  C  CB  . PRO B 1 437 ? 40.327  0.155   31.582  1.00 28.41 ? 451 PRO B CB  1 
ATOM   6923  C  CG  . PRO B 1 437 ? 40.159  1.062   32.751  1.00 26.31 ? 451 PRO B CG  1 
ATOM   6924  C  CD  . PRO B 1 437 ? 38.676  1.364   32.786  1.00 23.99 ? 451 PRO B CD  1 
ATOM   6925  N  N   . VAL B 1 438 ? 38.271  -2.765  32.685  1.00 24.11 ? 452 VAL B N   1 
ATOM   6926  C  CA  . VAL B 1 438 ? 38.321  -3.928  33.567  1.00 23.81 ? 452 VAL B CA  1 
ATOM   6927  C  C   . VAL B 1 438 ? 37.795  -5.158  32.856  1.00 28.13 ? 452 VAL B C   1 
ATOM   6928  O  O   . VAL B 1 438 ? 36.603  -5.261  32.568  1.00 28.76 ? 452 VAL B O   1 
ATOM   6929  C  CB  . VAL B 1 438 ? 37.489  -3.705  34.847  1.00 29.33 ? 452 VAL B CB  1 
ATOM   6930  C  CG1 . VAL B 1 438 ? 37.479  -4.967  35.707  1.00 32.18 ? 452 VAL B CG1 1 
ATOM   6931  C  CG2 . VAL B 1 438 ? 38.025  -2.511  35.628  1.00 30.58 ? 452 VAL B CG2 1 
ATOM   6932  N  N   . LEU B 1 439 ? 38.698  -6.089  32.571  1.00 25.70 ? 453 LEU B N   1 
ATOM   6933  C  CA  . LEU B 1 439 ? 38.350  -7.306  31.859  1.00 23.98 ? 453 LEU B CA  1 
ATOM   6934  C  C   . LEU B 1 439 ? 38.293  -8.473  32.833  1.00 28.92 ? 453 LEU B C   1 
ATOM   6935  O  O   . LEU B 1 439 ? 39.239  -8.692  33.588  1.00 31.81 ? 453 LEU B O   1 
ATOM   6936  C  CB  . LEU B 1 439 ? 39.380  -7.579  30.770  1.00 23.59 ? 453 LEU B CB  1 
ATOM   6937  C  CG  . LEU B 1 439 ? 39.302  -8.951  30.098  1.00 26.17 ? 453 LEU B CG  1 
ATOM   6938  C  CD1 . LEU B 1 439 ? 38.004  -9.060  29.259  1.00 24.04 ? 453 LEU B CD1 1 
ATOM   6939  C  CD2 . LEU B 1 439 ? 40.539  -9.207  29.257  1.00 26.40 ? 453 LEU B CD2 1 
ATOM   6940  N  N   . SER B 1 440 ? 37.183  -9.209  32.835  1.00 29.74 ? 454 SER B N   1 
ATOM   6941  C  CA  . SER B 1 440 ? 37.079  -10.415 33.669  1.00 24.91 ? 454 SER B CA  1 
ATOM   6942  C  C   . SER B 1 440 ? 37.284  -11.690 32.834  1.00 31.65 ? 454 SER B C   1 
ATOM   6943  O  O   . SER B 1 440 ? 36.862  -11.766 31.684  1.00 27.23 ? 454 SER B O   1 
ATOM   6944  C  CB  . SER B 1 440 ? 35.722  -10.468 34.381  1.00 33.91 ? 454 SER B CB  1 
ATOM   6945  O  OG  . SER B 1 440 ? 35.474  -9.278  35.113  1.00 34.70 ? 454 SER B OG  1 
ATOM   6946  N  N   . VAL B 1 441 ? 37.939  -12.688 33.415  1.00 32.39 ? 455 VAL B N   1 
ATOM   6947  C  CA  . VAL B 1 441 ? 38.233  -13.910 32.680  1.00 35.17 ? 455 VAL B CA  1 
ATOM   6948  C  C   . VAL B 1 441 ? 37.679  -15.100 33.430  1.00 37.34 ? 455 VAL B C   1 
ATOM   6949  O  O   . VAL B 1 441 ? 37.921  -15.250 34.629  1.00 41.32 ? 455 VAL B O   1 
ATOM   6950  C  CB  . VAL B 1 441 ? 39.759  -14.091 32.474  1.00 30.39 ? 455 VAL B CB  1 
ATOM   6951  C  CG1 . VAL B 1 441 ? 40.059  -15.376 31.714  1.00 34.44 ? 455 VAL B CG1 1 
ATOM   6952  C  CG2 . VAL B 1 441 ? 40.341  -12.891 31.735  1.00 30.69 ? 455 VAL B CG2 1 
ATOM   6953  N  N   . TYR B 1 442 ? 36.918  -15.940 32.733  1.00 30.39 ? 456 TYR B N   1 
ATOM   6954  C  CA  . TYR B 1 442 ? 36.523  -17.219 33.302  1.00 32.97 ? 456 TYR B CA  1 
ATOM   6955  C  C   . TYR B 1 442 ? 37.155  -18.377 32.539  1.00 33.87 ? 456 TYR B C   1 
ATOM   6956  O  O   . TYR B 1 442 ? 36.964  -18.518 31.329  1.00 30.60 ? 456 TYR B O   1 
ATOM   6957  C  CB  . TYR B 1 442 ? 35.007  -17.367 33.329  1.00 28.21 ? 456 TYR B CB  1 
ATOM   6958  C  CG  . TYR B 1 442 ? 34.557  -18.687 33.884  1.00 34.40 ? 456 TYR B CG  1 
ATOM   6959  C  CD1 . TYR B 1 442 ? 34.698  -18.984 35.235  1.00 34.06 ? 456 TYR B CD1 1 
ATOM   6960  C  CD2 . TYR B 1 442 ? 33.996  -19.651 33.055  1.00 33.52 ? 456 TYR B CD2 1 
ATOM   6961  C  CE1 . TYR B 1 442 ? 34.284  -20.209 35.738  1.00 41.42 ? 456 TYR B CE1 1 
ATOM   6962  C  CE2 . TYR B 1 442 ? 33.586  -20.858 33.545  1.00 32.80 ? 456 TYR B CE2 1 
ATOM   6963  C  CZ  . TYR B 1 442 ? 33.725  -21.138 34.881  1.00 40.47 ? 456 TYR B CZ  1 
ATOM   6964  O  OH  . TYR B 1 442 ? 33.304  -22.364 35.342  1.00 40.16 ? 456 TYR B OH  1 
ATOM   6965  N  N   . VAL B 1 443 ? 37.911  -19.203 33.255  1.00 34.19 ? 457 VAL B N   1 
ATOM   6966  C  CA  . VAL B 1 443 ? 38.518  -20.383 32.657  1.00 32.31 ? 457 VAL B CA  1 
ATOM   6967  C  C   . VAL B 1 443 ? 37.605  -21.590 32.832  1.00 32.91 ? 457 VAL B C   1 
ATOM   6968  O  O   . VAL B 1 443 ? 37.320  -22.027 33.945  1.00 33.94 ? 457 VAL B O   1 
ATOM   6969  C  CB  . VAL B 1 443 ? 39.896  -20.686 33.276  1.00 33.72 ? 457 VAL B CB  1 
ATOM   6970  C  CG1 . VAL B 1 443 ? 40.527  -21.888 32.590  1.00 34.93 ? 457 VAL B CG1 1 
ATOM   6971  C  CG2 . VAL B 1 443 ? 40.801  -19.465 33.171  1.00 37.43 ? 457 VAL B CG2 1 
ATOM   6972  N  N   . TYR B 1 444 ? 37.136  -22.133 31.723  1.00 38.29 ? 458 TYR B N   1 
ATOM   6973  C  CA  . TYR B 1 444 ? 36.200  -23.247 31.792  1.00 38.96 ? 458 TYR B CA  1 
ATOM   6974  C  C   . TYR B 1 444 ? 36.868  -24.569 31.412  1.00 39.89 ? 458 TYR B C   1 
ATOM   6975  O  O   . TYR B 1 444 ? 37.867  -24.581 30.697  1.00 40.26 ? 458 TYR B O   1 
ATOM   6976  C  CB  . TYR B 1 444 ? 34.987  -22.971 30.908  1.00 36.86 ? 458 TYR B CB  1 
ATOM   6977  C  CG  . TYR B 1 444 ? 35.283  -22.965 29.428  1.00 36.56 ? 458 TYR B CG  1 
ATOM   6978  C  CD1 . TYR B 1 444 ? 35.158  -24.128 28.678  1.00 38.19 ? 458 TYR B CD1 1 
ATOM   6979  C  CD2 . TYR B 1 444 ? 35.680  -21.800 28.778  1.00 33.69 ? 458 TYR B CD2 1 
ATOM   6980  C  CE1 . TYR B 1 444 ? 35.415  -24.132 27.325  1.00 37.61 ? 458 TYR B CE1 1 
ATOM   6981  C  CE2 . TYR B 1 444 ? 35.939  -21.794 27.416  1.00 30.36 ? 458 TYR B CE2 1 
ATOM   6982  C  CZ  . TYR B 1 444 ? 35.805  -22.971 26.699  1.00 31.23 ? 458 TYR B CZ  1 
ATOM   6983  O  OH  . TYR B 1 444 ? 36.052  -22.998 25.349  1.00 37.06 ? 458 TYR B OH  1 
ATOM   6984  N  N   . PRO B 1 445 ? 36.331  -25.688 31.914  1.00 38.85 ? 459 PRO B N   1 
ATOM   6985  C  CA  . PRO B 1 445 ? 36.912  -26.986 31.543  1.00 46.76 ? 459 PRO B CA  1 
ATOM   6986  C  C   . PRO B 1 445 ? 36.673  -27.338 30.070  1.00 42.92 ? 459 PRO B C   1 
ATOM   6987  O  O   . PRO B 1 445 ? 35.567  -27.170 29.557  1.00 38.42 ? 459 PRO B O   1 
ATOM   6988  C  CB  . PRO B 1 445 ? 36.190  -27.970 32.473  1.00 49.20 ? 459 PRO B CB  1 
ATOM   6989  C  CG  . PRO B 1 445 ? 35.794  -27.139 33.660  1.00 46.63 ? 459 PRO B CG  1 
ATOM   6990  C  CD  . PRO B 1 445 ? 35.415  -25.799 33.062  1.00 40.27 ? 459 PRO B CD  1 
ATOM   6991  N  N   . ASP B 1 446 ? 37.715  -27.825 29.405  1.00 44.96 ? 460 ASP B N   1 
ATOM   6992  C  CA  . ASP B 1 446 ? 37.650  -28.123 27.974  1.00 47.19 ? 460 ASP B CA  1 
ATOM   6993  C  C   . ASP B 1 446 ? 36.529  -29.095 27.614  1.00 45.22 ? 460 ASP B C   1 
ATOM   6994  O  O   . ASP B 1 446 ? 35.951  -29.016 26.527  1.00 48.27 ? 460 ASP B O   1 
ATOM   6995  C  CB  . ASP B 1 446 ? 38.989  -28.682 27.490  1.00 53.28 ? 460 ASP B CB  1 
ATOM   6996  C  CG  . ASP B 1 446 ? 40.099  -27.664 27.562  1.00 50.63 ? 460 ASP B CG  1 
ATOM   6997  O  OD1 . ASP B 1 446 ? 40.614  -27.425 28.671  1.00 58.64 ? 460 ASP B OD1 1 
ATOM   6998  O  OD2 . ASP B 1 446 ? 40.454  -27.105 26.507  1.00 42.96 ? 460 ASP B OD2 1 
ATOM   6999  N  N   . ASP B 1 447 ? 36.208  -30.005 28.527  1.00 39.25 ? 461 ASP B N   1 
ATOM   7000  C  CA  . ASP B 1 447 ? 35.134  -30.960 28.250  1.00 51.05 ? 461 ASP B CA  1 
ATOM   7001  C  C   . ASP B 1 447 ? 33.752  -30.339 28.494  1.00 47.58 ? 461 ASP B C   1 
ATOM   7002  O  O   . ASP B 1 447 ? 32.725  -31.003 28.363  1.00 44.31 ? 461 ASP B O   1 
ATOM   7003  C  CB  . ASP B 1 447 ? 35.312  -32.238 29.066  1.00 51.46 ? 461 ASP B CB  1 
ATOM   7004  C  CG  . ASP B 1 447 ? 35.068  -32.030 30.547  1.00 53.23 ? 461 ASP B CG  1 
ATOM   7005  O  OD1 . ASP B 1 447 ? 35.485  -30.987 31.088  1.00 45.65 ? 461 ASP B OD1 1 
ATOM   7006  O  OD2 . ASP B 1 447 ? 34.454  -32.918 31.173  1.00 62.48 ? 461 ASP B OD2 1 
ATOM   7007  N  N   . LYS B 1 448 ? 33.728  -29.057 28.838  1.00 44.70 ? 462 LYS B N   1 
ATOM   7008  C  CA  . LYS B 1 448 ? 32.464  -28.398 29.142  1.00 44.00 ? 462 LYS B CA  1 
ATOM   7009  C  C   . LYS B 1 448 ? 32.201  -27.163 28.279  1.00 44.25 ? 462 LYS B C   1 
ATOM   7010  O  O   . LYS B 1 448 ? 31.541  -26.220 28.721  1.00 39.38 ? 462 LYS B O   1 
ATOM   7011  C  CB  . LYS B 1 448 ? 32.400  -28.045 30.635  1.00 43.74 ? 462 LYS B CB  1 
ATOM   7012  C  CG  . LYS B 1 448 ? 32.183  -29.252 31.562  1.00 40.08 ? 462 LYS B CG  1 
ATOM   7013  N  N   . TYR B 1 449 ? 32.693  -27.170 27.043  1.00 44.40 ? 463 TYR B N   1 
ATOM   7014  C  CA  . TYR B 1 449 ? 32.559  -25.980 26.205  1.00 43.88 ? 463 TYR B CA  1 
ATOM   7015  C  C   . TYR B 1 449 ? 31.118  -25.705 25.813  1.00 39.12 ? 463 TYR B C   1 
ATOM   7016  O  O   . TYR B 1 449 ? 30.675  -24.560 25.842  1.00 37.28 ? 463 TYR B O   1 
ATOM   7017  C  CB  . TYR B 1 449 ? 33.475  -26.028 24.972  1.00 47.89 ? 463 TYR B CB  1 
ATOM   7018  C  CG  . TYR B 1 449 ? 32.880  -26.632 23.714  1.00 52.55 ? 463 TYR B CG  1 
ATOM   7019  C  CD1 . TYR B 1 449 ? 32.152  -25.854 22.816  1.00 52.90 ? 463 TYR B CD1 1 
ATOM   7020  C  CD2 . TYR B 1 449 ? 33.083  -27.971 23.405  1.00 56.69 ? 463 TYR B CD2 1 
ATOM   7021  C  CE1 . TYR B 1 449 ? 31.619  -26.403 21.662  1.00 54.43 ? 463 TYR B CE1 1 
ATOM   7022  C  CE2 . TYR B 1 449 ? 32.561  -28.526 22.253  1.00 60.35 ? 463 TYR B CE2 1 
ATOM   7023  C  CZ  . TYR B 1 449 ? 31.830  -27.741 21.384  1.00 59.03 ? 463 TYR B CZ  1 
ATOM   7024  O  OH  . TYR B 1 449 ? 31.311  -28.307 20.239  1.00 64.22 ? 463 TYR B OH  1 
ATOM   7025  N  N   . LYS B 1 450 ? 30.401  -26.761 25.441  1.00 41.37 ? 464 LYS B N   1 
ATOM   7026  C  CA  . LYS B 1 450 ? 28.996  -26.650 25.074  1.00 39.44 ? 464 LYS B CA  1 
ATOM   7027  C  C   . LYS B 1 450 ? 28.206  -26.067 26.234  1.00 33.23 ? 464 LYS B C   1 
ATOM   7028  O  O   . LYS B 1 450 ? 27.432  -25.117 26.063  1.00 30.19 ? 464 LYS B O   1 
ATOM   7029  C  CB  . LYS B 1 450 ? 28.430  -28.023 24.684  1.00 37.10 ? 464 LYS B CB  1 
ATOM   7030  N  N   . GLU B 1 451 ? 28.405  -26.634 27.420  1.00 31.38 ? 465 GLU B N   1 
ATOM   7031  C  CA  . GLU B 1 451 ? 27.742  -26.114 28.605  1.00 39.47 ? 465 GLU B CA  1 
ATOM   7032  C  C   . GLU B 1 451 ? 28.125  -24.653 28.847  1.00 32.70 ? 465 GLU B C   1 
ATOM   7033  O  O   . GLU B 1 451 ? 27.299  -23.857 29.294  1.00 32.32 ? 465 GLU B O   1 
ATOM   7034  C  CB  . GLU B 1 451 ? 28.050  -26.969 29.831  1.00 39.95 ? 465 GLU B CB  1 
ATOM   7035  N  N   . THR B 1 452 ? 29.368  -24.293 28.539  1.00 29.76 ? 466 THR B N   1 
ATOM   7036  C  CA  . THR B 1 452 ? 29.817  -22.934 28.797  1.00 28.75 ? 466 THR B CA  1 
ATOM   7037  C  C   . THR B 1 452 ? 29.177  -21.958 27.818  1.00 28.39 ? 466 THR B C   1 
ATOM   7038  O  O   . THR B 1 452 ? 28.826  -20.837 28.189  1.00 26.37 ? 466 THR B O   1 
ATOM   7039  C  CB  . THR B 1 452 ? 31.360  -22.822 28.788  1.00 34.11 ? 466 THR B CB  1 
ATOM   7040  O  OG1 . THR B 1 452 ? 31.900  -23.708 29.776  1.00 35.81 ? 466 THR B OG1 1 
ATOM   7041  C  CG2 . THR B 1 452 ? 31.800  -21.398 29.101  1.00 34.61 ? 466 THR B CG2 1 
ATOM   7042  N  N   . LEU B 1 453 ? 29.009  -22.384 26.569  1.00 32.52 ? 467 LEU B N   1 
ATOM   7043  C  CA  . LEU B 1 453 ? 28.284  -21.553 25.609  1.00 33.84 ? 467 LEU B CA  1 
ATOM   7044  C  C   . LEU B 1 453 ? 26.914  -21.171 26.162  1.00 27.77 ? 467 LEU B C   1 
ATOM   7045  O  O   . LEU B 1 453 ? 26.550  -19.997 26.159  1.00 26.44 ? 467 LEU B O   1 
ATOM   7046  C  CB  . LEU B 1 453 ? 28.133  -22.272 24.272  1.00 40.00 ? 467 LEU B CB  1 
ATOM   7047  C  CG  . LEU B 1 453 ? 29.367  -22.203 23.380  1.00 41.10 ? 467 LEU B CG  1 
ATOM   7048  C  CD1 . LEU B 1 453 ? 29.233  -23.190 22.237  1.00 38.51 ? 467 LEU B CD1 1 
ATOM   7049  C  CD2 . LEU B 1 453 ? 29.574  -20.771 22.882  1.00 25.83 ? 467 LEU B CD2 1 
ATOM   7050  N  N   . GLN B 1 454 ? 26.180  -22.170 26.660  1.00 33.25 ? 468 GLN B N   1 
ATOM   7051  C  CA  . GLN B 1 454 ? 24.863  -21.954 27.271  1.00 37.08 ? 468 GLN B CA  1 
ATOM   7052  C  C   . GLN B 1 454 ? 24.967  -21.016 28.475  1.00 37.18 ? 468 GLN B C   1 
ATOM   7053  O  O   . GLN B 1 454 ? 24.093  -20.163 28.703  1.00 33.70 ? 468 GLN B O   1 
ATOM   7054  C  CB  . GLN B 1 454 ? 24.233  -23.293 27.682  1.00 46.54 ? 468 GLN B CB  1 
ATOM   7055  C  CG  . GLN B 1 454 ? 23.022  -23.703 26.852  1.00 53.15 ? 468 GLN B CG  1 
ATOM   7056  N  N   . LEU B 1 455 ? 26.055  -21.162 29.227  1.00 31.79 ? 469 LEU B N   1 
ATOM   7057  C  CA  . LEU B 1 455 ? 26.340  -20.289 30.361  1.00 36.38 ? 469 LEU B CA  1 
ATOM   7058  C  C   . LEU B 1 455 ? 26.529  -18.817 29.948  1.00 33.84 ? 469 LEU B C   1 
ATOM   7059  O  O   . LEU B 1 455 ? 26.050  -17.889 30.632  1.00 28.45 ? 469 LEU B O   1 
ATOM   7060  C  CB  . LEU B 1 455 ? 27.580  -20.795 31.096  1.00 41.73 ? 469 LEU B CB  1 
ATOM   7061  C  CG  . LEU B 1 455 ? 27.964  -20.131 32.413  1.00 44.08 ? 469 LEU B CG  1 
ATOM   7062  C  CD1 . LEU B 1 455 ? 26.799  -20.167 33.377  1.00 43.28 ? 469 LEU B CD1 1 
ATOM   7063  C  CD2 . LEU B 1 455 ? 29.178  -20.847 33.007  1.00 46.61 ? 469 LEU B CD2 1 
ATOM   7064  N  N   . VAL B 1 456 ? 27.223  -18.599 28.832  1.00 24.22 ? 470 VAL B N   1 
ATOM   7065  C  CA  . VAL B 1 456 ? 27.447  -17.240 28.358  1.00 23.15 ? 470 VAL B CA  1 
ATOM   7066  C  C   . VAL B 1 456 ? 26.092  -16.582 28.104  1.00 29.31 ? 470 VAL B C   1 
ATOM   7067  O  O   . VAL B 1 456 ? 25.842  -15.454 28.537  1.00 29.67 ? 470 VAL B O   1 
ATOM   7068  C  CB  . VAL B 1 456 ? 28.293  -17.212 27.081  1.00 25.93 ? 470 VAL B CB  1 
ATOM   7069  C  CG1 . VAL B 1 456 ? 28.256  -15.823 26.435  1.00 26.38 ? 470 VAL B CG1 1 
ATOM   7070  C  CG2 . VAL B 1 456 ? 29.738  -17.619 27.407  1.00 29.21 ? 470 VAL B CG2 1 
ATOM   7071  N  N   . ASP B 1 457 ? 25.211  -17.315 27.432  1.00 28.06 ? 471 ASP B N   1 
ATOM   7072  C  CA  . ASP B 1 457 ? 23.882  -16.801 27.130  1.00 28.44 ? 471 ASP B CA  1 
ATOM   7073  C  C   . ASP B 1 457 ? 23.060  -16.553 28.391  1.00 29.51 ? 471 ASP B C   1 
ATOM   7074  O  O   . ASP B 1 457 ? 22.464  -15.493 28.539  1.00 31.10 ? 471 ASP B O   1 
ATOM   7075  C  CB  . ASP B 1 457 ? 23.129  -17.753 26.213  1.00 27.89 ? 471 ASP B CB  1 
ATOM   7076  C  CG  . ASP B 1 457 ? 21.757  -17.229 25.848  1.00 34.34 ? 471 ASP B CG  1 
ATOM   7077  O  OD1 . ASP B 1 457 ? 21.693  -16.258 25.070  1.00 37.51 ? 471 ASP B OD1 1 
ATOM   7078  O  OD2 . ASP B 1 457 ? 20.753  -17.774 26.346  1.00 35.02 ? 471 ASP B OD2 1 
ATOM   7079  N  N   . SER B 1 458 ? 23.053  -17.518 29.308  1.00 31.76 ? 472 SER B N   1 
ATOM   7080  C  CA  . SER B 1 458 ? 22.174  -17.447 30.475  1.00 34.82 ? 472 SER B CA  1 
ATOM   7081  C  C   . SER B 1 458 ? 22.618  -16.391 31.480  1.00 34.21 ? 472 SER B C   1 
ATOM   7082  O  O   . SER B 1 458 ? 21.836  -15.967 32.330  1.00 36.70 ? 472 SER B O   1 
ATOM   7083  C  CB  . SER B 1 458 ? 22.055  -18.809 31.161  1.00 32.79 ? 472 SER B CB  1 
ATOM   7084  O  OG  . SER B 1 458 ? 23.242  -19.125 31.860  1.00 37.63 ? 472 SER B OG  1 
ATOM   7085  N  N   . THR B 1 459 ? 23.871  -15.965 31.389  1.00 34.07 ? 473 THR B N   1 
ATOM   7086  C  CA  . THR B 1 459 ? 24.352  -14.918 32.271  1.00 31.56 ? 473 THR B CA  1 
ATOM   7087  C  C   . THR B 1 459 ? 24.420  -13.594 31.518  1.00 37.37 ? 473 THR B C   1 
ATOM   7088  O  O   . THR B 1 459 ? 25.022  -12.637 31.985  1.00 33.03 ? 473 THR B O   1 
ATOM   7089  C  CB  . THR B 1 459 ? 25.715  -15.255 32.916  1.00 40.04 ? 473 THR B CB  1 
ATOM   7090  O  OG1 . THR B 1 459 ? 26.705  -15.469 31.903  1.00 39.38 ? 473 THR B OG1 1 
ATOM   7091  C  CG2 . THR B 1 459 ? 25.601  -16.497 33.765  1.00 39.65 ? 473 THR B CG2 1 
ATOM   7092  N  N   . THR B 1 460 ? 23.788  -13.552 30.351  1.00 31.89 ? 474 THR B N   1 
ATOM   7093  C  CA  . THR B 1 460 ? 23.716  -12.327 29.572  1.00 36.48 ? 474 THR B CA  1 
ATOM   7094  C  C   . THR B 1 460 ? 22.386  -11.639 29.857  1.00 37.66 ? 474 THR B C   1 
ATOM   7095  O  O   . THR B 1 460 ? 21.323  -12.194 29.581  1.00 38.40 ? 474 THR B O   1 
ATOM   7096  C  CB  . THR B 1 460 ? 23.842  -12.604 28.054  1.00 30.08 ? 474 THR B CB  1 
ATOM   7097  O  OG1 . THR B 1 460 ? 25.150  -13.112 27.767  1.00 33.00 ? 474 THR B OG1 1 
ATOM   7098  C  CG2 . THR B 1 460 ? 23.637  -11.324 27.265  1.00 36.21 ? 474 THR B CG2 1 
ATOM   7099  N  N   . SER B 1 461 ? 22.436  -10.447 30.433  1.00 38.94 ? 475 SER B N   1 
ATOM   7100  C  CA  . SER B 1 461 ? 21.193  -9.718  30.681  1.00 42.21 ? 475 SER B CA  1 
ATOM   7101  C  C   . SER B 1 461 ? 20.774  -8.849  29.492  1.00 39.87 ? 475 SER B C   1 
ATOM   7102  O  O   . SER B 1 461 ? 19.698  -9.039  28.931  1.00 38.29 ? 475 SER B O   1 
ATOM   7103  C  CB  . SER B 1 461 ? 21.273  -8.904  31.975  1.00 43.19 ? 475 SER B CB  1 
ATOM   7104  O  OG  . SER B 1 461 ? 22.411  -8.061  31.992  1.00 42.98 ? 475 SER B OG  1 
ATOM   7105  N  N   . TYR B 1 462 ? 21.616  -7.900  29.095  1.00 35.34 ? 476 TYR B N   1 
ATOM   7106  C  CA  . TYR B 1 462 ? 21.247  -7.025  27.986  1.00 44.49 ? 476 TYR B CA  1 
ATOM   7107  C  C   . TYR B 1 462 ? 22.360  -6.996  26.961  1.00 46.87 ? 476 TYR B C   1 
ATOM   7108  O  O   . TYR B 1 462 ? 23.007  -5.971  26.761  1.00 55.78 ? 476 TYR B O   1 
ATOM   7109  C  CB  . TYR B 1 462 ? 20.935  -5.608  28.484  1.00 45.61 ? 476 TYR B CB  1 
ATOM   7110  N  N   . GLY B 1 463 ? 22.566  -8.129  26.303  1.00 40.56 ? 477 GLY B N   1 
ATOM   7111  C  CA  . GLY B 1 463 ? 23.733  -8.330  25.468  1.00 42.73 ? 477 GLY B CA  1 
ATOM   7112  C  C   . GLY B 1 463 ? 23.746  -7.650  24.115  1.00 41.71 ? 477 GLY B C   1 
ATOM   7113  O  O   . GLY B 1 463 ? 22.955  -7.966  23.227  1.00 50.91 ? 477 GLY B O   1 
ATOM   7114  N  N   . LEU B 1 464 ? 24.700  -6.743  23.959  1.00 33.91 ? 478 LEU B N   1 
ATOM   7115  C  CA  . LEU B 1 464 ? 24.849  -5.931  22.766  1.00 25.86 ? 478 LEU B CA  1 
ATOM   7116  C  C   . LEU B 1 464 ? 25.740  -6.593  21.732  1.00 25.33 ? 478 LEU B C   1 
ATOM   7117  O  O   . LEU B 1 464 ? 25.342  -6.789  20.587  1.00 26.69 ? 478 LEU B O   1 
ATOM   7118  C  CB  . LEU B 1 464 ? 25.495  -4.603  23.155  1.00 22.66 ? 478 LEU B CB  1 
ATOM   7119  C  CG  . LEU B 1 464 ? 24.903  -3.304  22.626  1.00 40.76 ? 478 LEU B CG  1 
ATOM   7120  C  CD1 . LEU B 1 464 ? 24.284  -3.479  21.253  1.00 41.31 ? 478 LEU B CD1 1 
ATOM   7121  C  CD2 . LEU B 1 464 ? 23.897  -2.782  23.624  1.00 46.95 ? 478 LEU B CD2 1 
ATOM   7122  N  N   . THR B 1 465 ? 26.977  -6.889  22.127  1.00 17.88 ? 479 THR B N   1 
ATOM   7123  C  CA  . THR B 1 465 ? 27.947  -7.445  21.202  1.00 17.99 ? 479 THR B CA  1 
ATOM   7124  C  C   . THR B 1 465 ? 28.606  -8.657  21.820  1.00 22.39 ? 479 THR B C   1 
ATOM   7125  O  O   . THR B 1 465 ? 28.500  -8.894  23.022  1.00 22.12 ? 479 THR B O   1 
ATOM   7126  C  CB  . THR B 1 465 ? 29.037  -6.434  20.810  1.00 20.63 ? 479 THR B CB  1 
ATOM   7127  O  OG1 . THR B 1 465 ? 29.832  -6.105  21.958  1.00 21.28 ? 479 THR B OG1 1 
ATOM   7128  C  CG2 . THR B 1 465 ? 28.418  -5.165  20.231  1.00 20.53 ? 479 THR B CG2 1 
ATOM   7129  N  N   . GLY B 1 466 ? 29.293  -9.422  20.987  1.00 20.80 ? 480 GLY B N   1 
ATOM   7130  C  CA  . GLY B 1 466 ? 29.906  -10.651 21.429  1.00 25.89 ? 480 GLY B CA  1 
ATOM   7131  C  C   . GLY B 1 466 ? 30.744  -11.194 20.298  1.00 28.89 ? 480 GLY B C   1 
ATOM   7132  O  O   . GLY B 1 466 ? 30.574  -10.798 19.143  1.00 27.32 ? 480 GLY B O   1 
ATOM   7133  N  N   . ALA B 1 467 ? 31.646  -12.109 20.628  1.00 24.26 ? 481 ALA B N   1 
ATOM   7134  C  CA  . ALA B 1 467 ? 32.511  -12.702 19.627  1.00 25.15 ? 481 ALA B CA  1 
ATOM   7135  C  C   . ALA B 1 467 ? 32.883  -14.106 20.030  1.00 25.41 ? 481 ALA B C   1 
ATOM   7136  O  O   . ALA B 1 467 ? 32.936  -14.423 21.221  1.00 23.74 ? 481 ALA B O   1 
ATOM   7137  C  CB  . ALA B 1 467 ? 33.770  -11.854 19.457  1.00 28.57 ? 481 ALA B CB  1 
ATOM   7138  N  N   . VAL B 1 468 ? 33.115  -14.948 19.026  1.00 23.41 ? 482 VAL B N   1 
ATOM   7139  C  CA  . VAL B 1 468 ? 33.636  -16.276 19.227  1.00 26.32 ? 482 VAL B CA  1 
ATOM   7140  C  C   . VAL B 1 468 ? 34.950  -16.403 18.480  1.00 29.39 ? 482 VAL B C   1 
ATOM   7141  O  O   . VAL B 1 468 ? 35.050  -16.034 17.308  1.00 28.32 ? 482 VAL B O   1 
ATOM   7142  C  CB  . VAL B 1 468 ? 32.658  -17.337 18.699  1.00 29.95 ? 482 VAL B CB  1 
ATOM   7143  C  CG1 . VAL B 1 468 ? 33.297  -18.720 18.739  1.00 33.27 ? 482 VAL B CG1 1 
ATOM   7144  C  CG2 . VAL B 1 468 ? 31.392  -17.315 19.522  1.00 33.86 ? 482 VAL B CG2 1 
ATOM   7145  N  N   . PHE B 1 469 ? 35.964  -16.910 19.170  1.00 31.58 ? 483 PHE B N   1 
ATOM   7146  C  CA  . PHE B 1 469 ? 37.218  -17.260 18.524  1.00 28.71 ? 483 PHE B CA  1 
ATOM   7147  C  C   . PHE B 1 469 ? 37.370  -18.778 18.428  1.00 32.19 ? 483 PHE B C   1 
ATOM   7148  O  O   . PHE B 1 469 ? 37.349  -19.499 19.435  1.00 33.09 ? 483 PHE B O   1 
ATOM   7149  C  CB  . PHE B 1 469 ? 38.404  -16.630 19.253  1.00 27.56 ? 483 PHE B CB  1 
ATOM   7150  C  CG  . PHE B 1 469 ? 38.458  -15.132 19.131  1.00 27.87 ? 483 PHE B CG  1 
ATOM   7151  C  CD1 . PHE B 1 469 ? 37.698  -14.325 19.966  1.00 32.64 ? 483 PHE B CD1 1 
ATOM   7152  C  CD2 . PHE B 1 469 ? 39.267  -14.526 18.178  1.00 32.89 ? 483 PHE B CD2 1 
ATOM   7153  C  CE1 . PHE B 1 469 ? 37.750  -12.922 19.858  1.00 33.77 ? 483 PHE B CE1 1 
ATOM   7154  C  CE2 . PHE B 1 469 ? 39.316  -13.138 18.060  1.00 32.92 ? 483 PHE B CE2 1 
ATOM   7155  C  CZ  . PHE B 1 469 ? 38.558  -12.336 18.904  1.00 32.32 ? 483 PHE B CZ  1 
ATOM   7156  N  N   . SER B 1 470 ? 37.511  -19.258 17.201  1.00 36.94 ? 484 SER B N   1 
ATOM   7157  C  CA  . SER B 1 470 ? 37.603  -20.683 16.942  1.00 38.70 ? 484 SER B CA  1 
ATOM   7158  C  C   . SER B 1 470 ? 38.003  -20.891 15.496  1.00 43.17 ? 484 SER B C   1 
ATOM   7159  O  O   . SER B 1 470 ? 37.493  -20.205 14.600  1.00 40.44 ? 484 SER B O   1 
ATOM   7160  C  CB  . SER B 1 470 ? 36.262  -21.374 17.215  1.00 37.01 ? 484 SER B CB  1 
ATOM   7161  O  OG  . SER B 1 470 ? 36.247  -22.676 16.649  1.00 40.69 ? 484 SER B OG  1 
ATOM   7162  N  N   . GLN B 1 471 ? 38.924  -21.829 15.276  1.00 33.25 ? 485 GLN B N   1 
ATOM   7163  C  CA  . GLN B 1 471 ? 39.316  -22.207 13.929  1.00 40.06 ? 485 GLN B CA  1 
ATOM   7164  C  C   . GLN B 1 471 ? 38.413  -23.337 13.475  1.00 50.55 ? 485 GLN B C   1 
ATOM   7165  O  O   . GLN B 1 471 ? 38.239  -23.573 12.283  1.00 59.86 ? 485 GLN B O   1 
ATOM   7166  C  CB  . GLN B 1 471 ? 40.781  -22.648 13.891  1.00 38.85 ? 485 GLN B CB  1 
ATOM   7167  N  N   . ASP B 1 472 ? 37.831  -24.028 14.446  1.00 48.13 ? 486 ASP B N   1 
ATOM   7168  C  CA  . ASP B 1 472 ? 36.905  -25.116 14.173  1.00 46.22 ? 486 ASP B CA  1 
ATOM   7169  C  C   . ASP B 1 472 ? 35.577  -24.564 13.654  1.00 47.92 ? 486 ASP B C   1 
ATOM   7170  O  O   . ASP B 1 472 ? 34.849  -23.892 14.383  1.00 52.17 ? 486 ASP B O   1 
ATOM   7171  C  CB  . ASP B 1 472 ? 36.703  -25.946 15.446  1.00 43.63 ? 486 ASP B CB  1 
ATOM   7172  C  CG  . ASP B 1 472 ? 35.852  -27.188 15.218  1.00 48.31 ? 486 ASP B CG  1 
ATOM   7173  O  OD1 . ASP B 1 472 ? 34.687  -27.057 14.783  1.00 43.96 ? 486 ASP B OD1 1 
ATOM   7174  O  OD2 . ASP B 1 472 ? 36.359  -28.298 15.483  1.00 55.39 ? 486 ASP B OD2 1 
ATOM   7175  N  N   . LYS B 1 473 ? 35.262  -24.860 12.394  1.00 49.58 ? 487 LYS B N   1 
ATOM   7176  C  CA  . LYS B 1 473 ? 34.040  -24.357 11.766  1.00 49.16 ? 487 LYS B CA  1 
ATOM   7177  C  C   . LYS B 1 473 ? 32.776  -24.908 12.428  1.00 43.79 ? 487 LYS B C   1 
ATOM   7178  O  O   . LYS B 1 473 ? 31.783  -24.195 12.570  1.00 41.46 ? 487 LYS B O   1 
ATOM   7179  C  CB  . LYS B 1 473 ? 34.034  -24.673 10.267  1.00 53.33 ? 487 LYS B CB  1 
ATOM   7180  N  N   . ASP B 1 474 ? 32.814  -26.179 12.822  1.00 46.09 ? 488 ASP B N   1 
ATOM   7181  C  CA  . ASP B 1 474 ? 31.689  -26.804 13.512  1.00 45.70 ? 488 ASP B CA  1 
ATOM   7182  C  C   . ASP B 1 474 ? 31.330  -26.040 14.794  1.00 45.88 ? 488 ASP B C   1 
ATOM   7183  O  O   . ASP B 1 474 ? 30.162  -25.727 15.037  1.00 41.46 ? 488 ASP B O   1 
ATOM   7184  C  CB  . ASP B 1 474 ? 32.002  -28.269 13.828  1.00 49.67 ? 488 ASP B CB  1 
ATOM   7185  N  N   . VAL B 1 475 ? 32.345  -25.727 15.597  1.00 40.26 ? 489 VAL B N   1 
ATOM   7186  C  CA  . VAL B 1 475 ? 32.153  -24.994 16.846  1.00 35.53 ? 489 VAL B CA  1 
ATOM   7187  C  C   . VAL B 1 475 ? 31.529  -23.609 16.600  1.00 33.96 ? 489 VAL B C   1 
ATOM   7188  O  O   . VAL B 1 475 ? 30.645  -23.167 17.342  1.00 31.44 ? 489 VAL B O   1 
ATOM   7189  C  CB  . VAL B 1 475 ? 33.497  -24.858 17.610  1.00 37.14 ? 489 VAL B CB  1 
ATOM   7190  C  CG1 . VAL B 1 475 ? 33.362  -23.924 18.807  1.00 36.63 ? 489 VAL B CG1 1 
ATOM   7191  C  CG2 . VAL B 1 475 ? 33.986  -26.220 18.055  1.00 41.12 ? 489 VAL B CG2 1 
ATOM   7192  N  N   . VAL B 1 476 ? 31.976  -22.938 15.541  1.00 39.98 ? 490 VAL B N   1 
ATOM   7193  C  CA  . VAL B 1 476 ? 31.446  -21.617 15.186  1.00 32.64 ? 490 VAL B CA  1 
ATOM   7194  C  C   . VAL B 1 476 ? 29.949  -21.662 14.884  1.00 34.72 ? 490 VAL B C   1 
ATOM   7195  O  O   . VAL B 1 476 ? 29.184  -20.825 15.369  1.00 36.16 ? 490 VAL B O   1 
ATOM   7196  C  CB  . VAL B 1 476 ? 32.215  -20.994 13.999  1.00 33.69 ? 490 VAL B CB  1 
ATOM   7197  C  CG1 . VAL B 1 476 ? 31.486  -19.773 13.473  1.00 28.80 ? 490 VAL B CG1 1 
ATOM   7198  C  CG2 . VAL B 1 476 ? 33.625  -20.615 14.430  1.00 30.43 ? 490 VAL B CG2 1 
ATOM   7199  N  N   . GLN B 1 477 ? 29.535  -22.654 14.098  1.00 35.75 ? 491 GLN B N   1 
ATOM   7200  C  CA  . GLN B 1 477 ? 28.126  -22.854 13.804  1.00 36.15 ? 491 GLN B CA  1 
ATOM   7201  C  C   . GLN B 1 477 ? 27.343  -23.070 15.099  1.00 35.74 ? 491 GLN B C   1 
ATOM   7202  O  O   . GLN B 1 477 ? 26.309  -22.439 15.322  1.00 35.42 ? 491 GLN B O   1 
ATOM   7203  C  CB  . GLN B 1 477 ? 27.939  -24.032 12.842  1.00 33.50 ? 491 GLN B CB  1 
ATOM   7204  N  N   . GLU B 1 478 ? 27.859  -23.942 15.961  1.00 42.27 ? 492 GLU B N   1 
ATOM   7205  C  CA  . GLU B 1 478 ? 27.225  -24.223 17.247  1.00 42.03 ? 492 GLU B CA  1 
ATOM   7206  C  C   . GLU B 1 478 ? 27.025  -22.943 18.052  1.00 39.21 ? 492 GLU B C   1 
ATOM   7207  O  O   . GLU B 1 478 ? 25.890  -22.595 18.414  1.00 34.93 ? 492 GLU B O   1 
ATOM   7208  C  CB  . GLU B 1 478 ? 28.062  -25.243 18.028  1.00 50.43 ? 492 GLU B CB  1 
ATOM   7209  C  CG  . GLU B 1 478 ? 27.374  -25.864 19.230  1.00 53.96 ? 492 GLU B CG  1 
ATOM   7210  C  CD  . GLU B 1 478 ? 28.184  -27.014 19.820  1.00 64.15 ? 492 GLU B CD  1 
ATOM   7211  O  OE1 . GLU B 1 478 ? 29.281  -27.307 19.291  1.00 64.10 ? 492 GLU B OE1 1 
ATOM   7212  O  OE2 . GLU B 1 478 ? 27.725  -27.630 20.807  1.00 69.10 ? 492 GLU B OE2 1 
ATOM   7213  N  N   . ALA B 1 479 ? 28.123  -22.222 18.291  1.00 37.58 ? 493 ALA B N   1 
ATOM   7214  C  CA  . ALA B 1 479 ? 28.089  -20.973 19.054  1.00 37.86 ? 493 ALA B CA  1 
ATOM   7215  C  C   . ALA B 1 479 ? 27.146  -19.927 18.457  1.00 38.35 ? 493 ALA B C   1 
ATOM   7216  O  O   . ALA B 1 479 ? 26.443  -19.229 19.182  1.00 36.89 ? 493 ALA B O   1 
ATOM   7217  C  CB  . ALA B 1 479 ? 29.499  -20.401 19.202  1.00 34.80 ? 493 ALA B CB  1 
ATOM   7218  N  N   . THR B 1 480 ? 27.127  -19.830 17.132  1.00 39.15 ? 494 THR B N   1 
ATOM   7219  C  CA  . THR B 1 480 ? 26.238  -18.894 16.449  1.00 37.91 ? 494 THR B CA  1 
ATOM   7220  C  C   . THR B 1 480 ? 24.766  -19.168 16.770  1.00 37.26 ? 494 THR B C   1 
ATOM   7221  O  O   . THR B 1 480 ? 23.966  -18.238 16.910  1.00 38.09 ? 494 THR B O   1 
ATOM   7222  C  CB  . THR B 1 480 ? 26.470  -18.919 14.925  1.00 40.91 ? 494 THR B CB  1 
ATOM   7223  O  OG1 . THR B 1 480 ? 27.846  -18.618 14.650  1.00 45.46 ? 494 THR B OG1 1 
ATOM   7224  C  CG2 . THR B 1 480 ? 25.581  -17.907 14.224  1.00 39.55 ? 494 THR B CG2 1 
ATOM   7225  N  N   . LYS B 1 481 ? 24.410  -20.443 16.898  1.00 33.96 ? 495 LYS B N   1 
ATOM   7226  C  CA  . LYS B 1 481 ? 23.052  -20.790 17.272  1.00 32.68 ? 495 LYS B CA  1 
ATOM   7227  C  C   . LYS B 1 481 ? 22.790  -20.546 18.754  1.00 26.99 ? 495 LYS B C   1 
ATOM   7228  O  O   . LYS B 1 481 ? 21.787  -19.944 19.121  1.00 28.85 ? 495 LYS B O   1 
ATOM   7229  C  CB  . LYS B 1 481 ? 22.733  -22.242 16.910  1.00 33.41 ? 495 LYS B CB  1 
ATOM   7230  C  CG  . LYS B 1 481 ? 22.789  -22.527 15.421  1.00 37.98 ? 495 LYS B CG  1 
ATOM   7231  N  N   . VAL B 1 482 ? 23.687  -21.017 19.610  1.00 30.77 ? 496 VAL B N   1 
ATOM   7232  C  CA  . VAL B 1 482 ? 23.447  -20.928 21.050  1.00 23.93 ? 496 VAL B CA  1 
ATOM   7233  C  C   . VAL B 1 482 ? 23.421  -19.486 21.521  1.00 29.37 ? 496 VAL B C   1 
ATOM   7234  O  O   . VAL B 1 482 ? 22.640  -19.117 22.410  1.00 33.79 ? 496 VAL B O   1 
ATOM   7235  C  CB  . VAL B 1 482 ? 24.495  -21.757 21.831  1.00 28.97 ? 496 VAL B CB  1 
ATOM   7236  C  CG1 . VAL B 1 482 ? 24.229  -21.679 23.327  1.00 35.96 ? 496 VAL B CG1 1 
ATOM   7237  C  CG2 . VAL B 1 482 ? 24.464  -23.201 21.352  1.00 32.02 ? 496 VAL B CG2 1 
ATOM   7238  N  N   . LEU B 1 483 ? 24.252  -18.661 20.889  1.00 26.57 ? 497 LEU B N   1 
ATOM   7239  C  CA  . LEU B 1 483 ? 24.426  -17.277 21.305  1.00 21.44 ? 497 LEU B CA  1 
ATOM   7240  C  C   . LEU B 1 483 ? 23.584  -16.313 20.465  1.00 21.18 ? 497 LEU B C   1 
ATOM   7241  O  O   . LEU B 1 483 ? 23.799  -15.110 20.493  1.00 23.30 ? 497 LEU B O   1 
ATOM   7242  C  CB  . LEU B 1 483 ? 25.895  -16.882 21.201  1.00 27.31 ? 497 LEU B CB  1 
ATOM   7243  C  CG  . LEU B 1 483 ? 26.869  -17.734 22.008  1.00 26.48 ? 497 LEU B CG  1 
ATOM   7244  C  CD1 . LEU B 1 483 ? 28.288  -17.290 21.708  1.00 26.31 ? 497 LEU B CD1 1 
ATOM   7245  C  CD2 . LEU B 1 483 ? 26.550  -17.577 23.486  1.00 28.63 ? 497 LEU B CD2 1 
ATOM   7246  N  N   . ARG B 1 484 ? 22.629  -16.867 19.727  1.00 27.07 ? 498 ARG B N   1 
ATOM   7247  C  CA  . ARG B 1 484 ? 21.804  -16.108 18.789  1.00 22.71 ? 498 ARG B CA  1 
ATOM   7248  C  C   . ARG B 1 484 ? 21.141  -14.875 19.380  1.00 23.11 ? 498 ARG B C   1 
ATOM   7249  O  O   . ARG B 1 484 ? 21.015  -13.852 18.706  1.00 23.83 ? 498 ARG B O   1 
ATOM   7250  C  CB  . ARG B 1 484 ? 20.739  -17.040 18.194  1.00 27.76 ? 498 ARG B CB  1 
ATOM   7251  C  CG  . ARG B 1 484 ? 19.785  -16.402 17.200  1.00 29.61 ? 498 ARG B CG  1 
ATOM   7252  C  CD  . ARG B 1 484 ? 18.949  -17.505 16.555  1.00 33.03 ? 498 ARG B CD  1 
ATOM   7253  N  NE  . ARG B 1 484 ? 18.004  -17.023 15.553  1.00 28.97 ? 498 ARG B NE  1 
ATOM   7254  C  CZ  . ARG B 1 484 ? 18.225  -17.038 14.241  1.00 27.45 ? 498 ARG B CZ  1 
ATOM   7255  N  NH1 . ARG B 1 484 ? 17.290  -16.602 13.415  1.00 27.89 ? 498 ARG B NH1 1 
ATOM   7256  N  NH2 . ARG B 1 484 ? 19.373  -17.488 13.752  1.00 28.00 ? 498 ARG B NH2 1 
ATOM   7257  N  N   . ASN B 1 485 ? 20.727  -14.953 20.641  1.00 22.43 ? 499 ASN B N   1 
ATOM   7258  C  CA  . ASN B 1 485 ? 20.171  -13.774 21.307  1.00 19.98 ? 499 ASN B CA  1 
ATOM   7259  C  C   . ASN B 1 485 ? 21.027  -13.243 22.440  1.00 26.08 ? 499 ASN B C   1 
ATOM   7260  O  O   . ASN B 1 485 ? 20.573  -12.454 23.270  1.00 24.99 ? 499 ASN B O   1 
ATOM   7261  C  CB  . ASN B 1 485 ? 18.754  -14.043 21.791  1.00 27.90 ? 499 ASN B CB  1 
ATOM   7262  C  CG  . ASN B 1 485 ? 17.766  -14.038 20.653  1.00 28.78 ? 499 ASN B CG  1 
ATOM   7263  O  OD1 . ASN B 1 485 ? 17.477  -12.988 20.074  1.00 30.74 ? 499 ASN B OD1 1 
ATOM   7264  N  ND2 . ASN B 1 485 ? 17.267  -15.207 20.305  1.00 26.90 ? 499 ASN B ND2 1 
ATOM   7265  N  N   . ALA B 1 486 ? 22.286  -13.654 22.444  1.00 23.11 ? 500 ALA B N   1 
ATOM   7266  C  CA  . ALA B 1 486 ? 23.235  -13.144 23.421  1.00 19.71 ? 500 ALA B CA  1 
ATOM   7267  C  C   . ALA B 1 486 ? 23.997  -11.914 22.908  1.00 26.04 ? 500 ALA B C   1 
ATOM   7268  O  O   . ALA B 1 486 ? 24.732  -11.287 23.666  1.00 25.35 ? 500 ALA B O   1 
ATOM   7269  C  CB  . ALA B 1 486 ? 24.207  -14.256 23.835  1.00 19.50 ? 500 ALA B CB  1 
ATOM   7270  N  N   . ALA B 1 487 ? 23.834  -11.577 21.629  1.00 24.11 ? 501 ALA B N   1 
ATOM   7271  C  CA  . ALA B 1 487 ? 24.475  -10.384 21.059  1.00 30.22 ? 501 ALA B CA  1 
ATOM   7272  C  C   . ALA B 1 487 ? 23.815  -9.935  19.761  1.00 29.36 ? 501 ALA B C   1 
ATOM   7273  O  O   . ALA B 1 487 ? 23.554  -10.749 18.880  1.00 34.29 ? 501 ALA B O   1 
ATOM   7274  C  CB  . ALA B 1 487 ? 25.977  -10.627 20.824  1.00 31.23 ? 501 ALA B CB  1 
ATOM   7275  N  N   . GLY B 1 488 ? 23.572  -8.636  19.636  1.00 25.01 ? 502 GLY B N   1 
ATOM   7276  C  CA  . GLY B 1 488 ? 23.006  -8.084  18.415  1.00 29.38 ? 502 GLY B CA  1 
ATOM   7277  C  C   . GLY B 1 488 ? 24.045  -7.950  17.308  1.00 29.52 ? 502 GLY B C   1 
ATOM   7278  O  O   . GLY B 1 488 ? 23.768  -8.210  16.137  1.00 26.51 ? 502 GLY B O   1 
ATOM   7279  N  N   . ASN B 1 489 ? 25.245  -7.515  17.680  1.00 23.12 ? 503 ASN B N   1 
ATOM   7280  C  CA  . ASN B 1 489 ? 26.386  -7.540  16.763  1.00 25.75 ? 503 ASN B CA  1 
ATOM   7281  C  C   . ASN B 1 489 ? 27.318  -8.661  17.199  1.00 24.74 ? 503 ASN B C   1 
ATOM   7282  O  O   . ASN B 1 489 ? 27.904  -8.607  18.281  1.00 20.43 ? 503 ASN B O   1 
ATOM   7283  C  CB  . ASN B 1 489 ? 27.111  -6.190  16.750  1.00 23.33 ? 503 ASN B CB  1 
ATOM   7284  C  CG  . ASN B 1 489 ? 26.241  -5.064  16.205  1.00 28.46 ? 503 ASN B CG  1 
ATOM   7285  O  OD1 . ASN B 1 489 ? 25.451  -5.274  15.290  1.00 31.46 ? 503 ASN B OD1 1 
ATOM   7286  N  ND2 . ASN B 1 489 ? 26.385  -3.863  16.768  1.00 30.81 ? 503 ASN B ND2 1 
ATOM   7287  N  N   . PHE B 1 490 ? 27.420  -9.688  16.362  1.00 22.60 ? 504 PHE B N   1 
ATOM   7288  C  CA  . PHE B 1 490 ? 28.136  -10.908 16.688  1.00 19.48 ? 504 PHE B CA  1 
ATOM   7289  C  C   . PHE B 1 490 ? 29.301  -11.068 15.733  1.00 28.09 ? 504 PHE B C   1 
ATOM   7290  O  O   . PHE B 1 490 ? 29.123  -10.963 14.521  1.00 27.55 ? 504 PHE B O   1 
ATOM   7291  C  CB  . PHE B 1 490 ? 27.168  -12.095 16.569  1.00 22.03 ? 504 PHE B CB  1 
ATOM   7292  C  CG  . PHE B 1 490 ? 27.770  -13.424 16.941  1.00 30.38 ? 504 PHE B CG  1 
ATOM   7293  C  CD1 . PHE B 1 490 ? 28.045  -13.732 18.264  1.00 39.57 ? 504 PHE B CD1 1 
ATOM   7294  C  CD2 . PHE B 1 490 ? 28.041  -14.370 15.973  1.00 32.47 ? 504 PHE B CD2 1 
ATOM   7295  C  CE1 . PHE B 1 490 ? 28.588  -14.966 18.612  1.00 39.51 ? 504 PHE B CE1 1 
ATOM   7296  C  CE2 . PHE B 1 490 ? 28.576  -15.609 16.312  1.00 33.95 ? 504 PHE B CE2 1 
ATOM   7297  C  CZ  . PHE B 1 490 ? 28.851  -15.902 17.633  1.00 35.11 ? 504 PHE B CZ  1 
ATOM   7298  N  N   . TYR B 1 491 ? 30.491  -11.324 16.281  1.00 25.97 ? 505 TYR B N   1 
ATOM   7299  C  CA  . TYR B 1 491 ? 31.718  -11.399 15.486  1.00 28.71 ? 505 TYR B CA  1 
ATOM   7300  C  C   . TYR B 1 491 ? 32.354  -12.778 15.563  1.00 34.86 ? 505 TYR B C   1 
ATOM   7301  O  O   . TYR B 1 491 ? 32.361  -13.415 16.622  1.00 32.17 ? 505 TYR B O   1 
ATOM   7302  C  CB  . TYR B 1 491 ? 32.739  -10.342 15.951  1.00 25.18 ? 505 TYR B CB  1 
ATOM   7303  C  CG  . TYR B 1 491 ? 32.227  -8.933  15.808  1.00 21.55 ? 505 TYR B CG  1 
ATOM   7304  C  CD1 . TYR B 1 491 ? 31.458  -8.349  16.806  1.00 19.55 ? 505 TYR B CD1 1 
ATOM   7305  C  CD2 . TYR B 1 491 ? 32.490  -8.192  14.663  1.00 26.78 ? 505 TYR B CD2 1 
ATOM   7306  C  CE1 . TYR B 1 491 ? 30.957  -7.053  16.660  1.00 26.64 ? 505 TYR B CE1 1 
ATOM   7307  C  CE2 . TYR B 1 491 ? 32.011  -6.900  14.514  1.00 28.74 ? 505 TYR B CE2 1 
ATOM   7308  C  CZ  . TYR B 1 491 ? 31.247  -6.334  15.515  1.00 30.87 ? 505 TYR B CZ  1 
ATOM   7309  O  OH  . TYR B 1 491 ? 30.765  -5.053  15.353  1.00 29.82 ? 505 TYR B OH  1 
ATOM   7310  N  N   . ILE B 1 492 ? 32.899  -13.224 14.435  1.00 23.51 ? 506 ILE B N   1 
ATOM   7311  C  CA  . ILE B 1 492 ? 33.615  -14.486 14.368  1.00 29.45 ? 506 ILE B CA  1 
ATOM   7312  C  C   . ILE B 1 492 ? 35.097  -14.224 14.083  1.00 34.80 ? 506 ILE B C   1 
ATOM   7313  O  O   . ILE B 1 492 ? 35.454  -13.694 13.024  1.00 34.25 ? 506 ILE B O   1 
ATOM   7314  C  CB  . ILE B 1 492 ? 33.008  -15.403 13.289  1.00 32.05 ? 506 ILE B CB  1 
ATOM   7315  C  CG1 . ILE B 1 492 ? 31.557  -15.731 13.654  1.00 32.15 ? 506 ILE B CG1 1 
ATOM   7316  C  CG2 . ILE B 1 492 ? 33.850  -16.667 13.129  1.00 28.45 ? 506 ILE B CG2 1 
ATOM   7317  C  CD1 . ILE B 1 492 ? 30.676  -16.035 12.476  1.00 38.04 ? 506 ILE B CD1 1 
ATOM   7318  N  N   . ASN B 1 493 ? 35.946  -14.588 15.045  1.00 33.81 ? 507 ASN B N   1 
ATOM   7319  C  CA  . ASN B 1 493 ? 37.391  -14.368 14.959  1.00 34.57 ? 507 ASN B CA  1 
ATOM   7320  C  C   . ASN B 1 493 ? 37.766  -12.899 14.753  1.00 36.92 ? 507 ASN B C   1 
ATOM   7321  O  O   . ASN B 1 493 ? 38.677  -12.581 13.992  1.00 32.97 ? 507 ASN B O   1 
ATOM   7322  C  CB  . ASN B 1 493 ? 38.036  -15.280 13.895  1.00 28.00 ? 507 ASN B CB  1 
ATOM   7323  C  CG  . ASN B 1 493 ? 37.930  -16.761 14.256  1.00 33.40 ? 507 ASN B CG  1 
ATOM   7324  O  OD1 . ASN B 1 493 ? 38.093  -17.141 15.417  1.00 29.27 ? 507 ASN B OD1 1 
ATOM   7325  N  ND2 . ASN B 1 493 ? 37.635  -17.595 13.264  1.00 33.95 ? 507 ASN B ND2 1 
ATOM   7326  N  N   . ASP B 1 494 ? 37.039  -12.012 15.432  1.00 38.26 ? 508 ASP B N   1 
ATOM   7327  C  CA  . ASP B 1 494 ? 37.395  -10.598 15.502  1.00 37.16 ? 508 ASP B CA  1 
ATOM   7328  C  C   . ASP B 1 494 ? 36.769  -9.977  16.749  1.00 35.94 ? 508 ASP B C   1 
ATOM   7329  O  O   . ASP B 1 494 ? 36.009  -10.637 17.445  1.00 31.99 ? 508 ASP B O   1 
ATOM   7330  C  CB  . ASP B 1 494 ? 36.969  -9.840  14.246  1.00 36.65 ? 508 ASP B CB  1 
ATOM   7331  C  CG  . ASP B 1 494 ? 37.871  -8.641  13.957  1.00 39.31 ? 508 ASP B CG  1 
ATOM   7332  O  OD1 . ASP B 1 494 ? 38.435  -8.060  14.911  1.00 35.12 ? 508 ASP B OD1 1 
ATOM   7333  O  OD2 . ASP B 1 494 ? 38.028  -8.286  12.771  1.00 44.75 ? 508 ASP B OD2 1 
ATOM   7334  N  N   . LYS B 1 495 ? 37.086  -8.716  17.038  1.00 29.29 ? 509 LYS B N   1 
ATOM   7335  C  CA  . LYS B 1 495 ? 36.738  -8.162  18.342  1.00 28.82 ? 509 LYS B CA  1 
ATOM   7336  C  C   . LYS B 1 495 ? 35.342  -7.554  18.419  1.00 28.30 ? 509 LYS B C   1 
ATOM   7337  O  O   . LYS B 1 495 ? 34.800  -7.066  17.422  1.00 31.19 ? 509 LYS B O   1 
ATOM   7338  C  CB  . LYS B 1 495 ? 37.787  -7.156  18.813  1.00 31.02 ? 509 LYS B CB  1 
ATOM   7339  C  CG  . LYS B 1 495 ? 38.008  -5.978  17.882  1.00 38.48 ? 509 LYS B CG  1 
ATOM   7340  C  CD  . LYS B 1 495 ? 38.722  -4.838  18.632  1.00 42.97 ? 509 LYS B CD  1 
ATOM   7341  C  CE  . LYS B 1 495 ? 39.641  -4.029  17.730  1.00 38.28 ? 509 LYS B CE  1 
ATOM   7342  N  NZ  . LYS B 1 495 ? 39.025  -3.664  16.433  1.00 34.49 ? 509 LYS B NZ  1 
ATOM   7343  N  N   . SER B 1 496 ? 34.782  -7.566  19.626  1.00 24.31 ? 510 SER B N   1 
ATOM   7344  C  CA  . SER B 1 496 ? 33.382  -7.198  19.845  1.00 20.71 ? 510 SER B CA  1 
ATOM   7345  C  C   . SER B 1 496 ? 33.097  -5.727  19.568  1.00 26.56 ? 510 SER B C   1 
ATOM   7346  O  O   . SER B 1 496 ? 31.941  -5.354  19.401  1.00 23.50 ? 510 SER B O   1 
ATOM   7347  C  CB  . SER B 1 496 ? 32.937  -7.542  21.276  1.00 22.98 ? 510 SER B CB  1 
ATOM   7348  O  OG  . SER B 1 496 ? 33.516  -6.644  22.230  1.00 28.91 ? 510 SER B OG  1 
ATOM   7349  N  N   . THR B 1 497 ? 34.139  -4.894  19.545  1.00 23.59 ? 511 THR B N   1 
ATOM   7350  C  CA  . THR B 1 497 ? 33.960  -3.474  19.244  1.00 23.26 ? 511 THR B CA  1 
ATOM   7351  C  C   . THR B 1 497 ? 33.987  -3.200  17.736  1.00 29.20 ? 511 THR B C   1 
ATOM   7352  O  O   . THR B 1 497 ? 33.884  -2.045  17.306  1.00 28.51 ? 511 THR B O   1 
ATOM   7353  C  CB  . THR B 1 497 ? 35.039  -2.601  19.921  1.00 26.55 ? 511 THR B CB  1 
ATOM   7354  O  OG1 . THR B 1 497 ? 36.330  -3.154  19.657  1.00 23.93 ? 511 THR B OG1 1 
ATOM   7355  C  CG2 . THR B 1 497 ? 34.835  -2.530  21.429  1.00 25.94 ? 511 THR B CG2 1 
ATOM   7356  N  N   . GLY B 1 498 ? 34.143  -4.255  16.938  1.00 33.98 ? 512 GLY B N   1 
ATOM   7357  C  CA  . GLY B 1 498 ? 34.160  -4.124  15.488  1.00 36.30 ? 512 GLY B CA  1 
ATOM   7358  C  C   . GLY B 1 498 ? 35.552  -3.805  14.967  1.00 39.22 ? 512 GLY B C   1 
ATOM   7359  O  O   . GLY B 1 498 ? 36.476  -3.644  15.748  1.00 33.69 ? 512 GLY B O   1 
ATOM   7360  N  N   . SER B 1 499 ? 35.702  -3.730  13.649  1.00 46.66 ? 513 SER B N   1 
ATOM   7361  C  CA  . SER B 1 499 ? 36.992  -3.426  13.030  1.00 46.71 ? 513 SER B CA  1 
ATOM   7362  C  C   . SER B 1 499 ? 36.811  -2.500  11.828  1.00 49.71 ? 513 SER B C   1 
ATOM   7363  O  O   . SER B 1 499 ? 35.703  -2.336  11.321  1.00 51.76 ? 513 SER B O   1 
ATOM   7364  C  CB  . SER B 1 499 ? 37.700  -4.712  12.597  1.00 39.33 ? 513 SER B CB  1 
ATOM   7365  N  N   . ILE B 1 500 ? 37.901  -1.893  11.376  1.00 51.69 ? 514 ILE B N   1 
ATOM   7366  C  CA  . ILE B 1 500 ? 37.854  -1.018  10.210  1.00 53.97 ? 514 ILE B CA  1 
ATOM   7367  C  C   . ILE B 1 500 ? 38.534  -1.678  9.011   1.00 54.62 ? 514 ILE B C   1 
ATOM   7368  O  O   . ILE B 1 500 ? 37.872  -2.075  8.048   1.00 53.24 ? 514 ILE B O   1 
ATOM   7369  C  CB  . ILE B 1 500 ? 38.514  0.354   10.494  1.00 53.23 ? 514 ILE B CB  1 
ATOM   7370  N  N   . GLY B 1 508 ? 26.552  0.742   4.194   1.00 39.67 ? 522 GLY B N   1 
ATOM   7371  C  CA  . GLY B 1 508 ? 25.972  1.737   5.082   1.00 37.87 ? 522 GLY B CA  1 
ATOM   7372  C  C   . GLY B 1 508 ? 27.029  2.503   5.858   1.00 34.79 ? 522 GLY B C   1 
ATOM   7373  O  O   . GLY B 1 508 ? 28.212  2.417   5.537   1.00 38.69 ? 522 GLY B O   1 
ATOM   7374  N  N   . ALA B 1 509 ? 26.600  3.267   6.861   1.00 30.26 ? 523 ALA B N   1 
ATOM   7375  C  CA  . ALA B 1 509 ? 27.529  3.929   7.776   1.00 36.29 ? 523 ALA B CA  1 
ATOM   7376  C  C   . ALA B 1 509 ? 28.455  2.875   8.377   1.00 36.83 ? 523 ALA B C   1 
ATOM   7377  O  O   . ALA B 1 509 ? 27.991  1.811   8.821   1.00 32.69 ? 523 ALA B O   1 
ATOM   7378  C  CB  . ALA B 1 509 ? 26.768  4.670   8.883   1.00 37.79 ? 523 ALA B CB  1 
ATOM   7379  N  N   . ARG B 1 510 ? 29.758  3.159   8.373   1.00 32.77 ? 524 ARG B N   1 
ATOM   7380  C  CA  . ARG B 1 510 ? 30.751  2.205   8.868   1.00 34.81 ? 524 ARG B CA  1 
ATOM   7381  C  C   . ARG B 1 510 ? 30.488  1.784   10.321  1.00 34.64 ? 524 ARG B C   1 
ATOM   7382  O  O   . ARG B 1 510 ? 30.777  0.656   10.704  1.00 35.89 ? 524 ARG B O   1 
ATOM   7383  C  CB  . ARG B 1 510 ? 32.171  2.763   8.702   1.00 33.25 ? 524 ARG B CB  1 
ATOM   7384  N  N   . ALA B 1 511 ? 29.929  2.686   11.127  1.00 35.15 ? 525 ALA B N   1 
ATOM   7385  C  CA  . ALA B 1 511 ? 29.601  2.339   12.509  1.00 32.10 ? 525 ALA B CA  1 
ATOM   7386  C  C   . ALA B 1 511 ? 28.166  1.834   12.670  1.00 28.72 ? 525 ALA B C   1 
ATOM   7387  O  O   . ALA B 1 511 ? 27.689  1.670   13.795  1.00 36.66 ? 525 ALA B O   1 
ATOM   7388  C  CB  . ALA B 1 511 ? 29.869  3.515   13.457  1.00 29.13 ? 525 ALA B CB  1 
ATOM   7389  N  N   . SER B 1 512 ? 27.472  1.589   11.564  1.00 30.90 ? 526 SER B N   1 
ATOM   7390  C  CA  . SER B 1 512 ? 26.124  1.015   11.670  1.00 33.48 ? 526 SER B CA  1 
ATOM   7391  C  C   . SER B 1 512 ? 26.157  -0.450  12.124  1.00 37.05 ? 526 SER B C   1 
ATOM   7392  O  O   . SER B 1 512 ? 27.142  -1.167  11.916  1.00 35.52 ? 526 SER B O   1 
ATOM   7393  C  CB  . SER B 1 512 ? 25.320  1.167   10.366  1.00 40.18 ? 526 SER B CB  1 
ATOM   7394  O  OG  . SER B 1 512 ? 25.900  0.432   9.299   1.00 42.24 ? 526 SER B OG  1 
ATOM   7395  N  N   . GLY B 1 513 ? 25.074  -0.888  12.756  1.00 33.31 ? 527 GLY B N   1 
ATOM   7396  C  CA  . GLY B 1 513 ? 24.974  -2.260  13.198  1.00 32.20 ? 527 GLY B CA  1 
ATOM   7397  C  C   . GLY B 1 513 ? 23.540  -2.679  13.425  1.00 35.32 ? 527 GLY B C   1 
ATOM   7398  O  O   . GLY B 1 513 ? 22.621  -2.182  12.753  1.00 30.71 ? 527 GLY B O   1 
ATOM   7399  N  N   . THR B 1 514 ? 23.355  -3.594  14.377  1.00 33.62 ? 528 THR B N   1 
ATOM   7400  C  CA  . THR B 1 514 ? 22.048  -4.161  14.683  1.00 30.43 ? 528 THR B CA  1 
ATOM   7401  C  C   . THR B 1 514 ? 21.003  -3.070  14.918  1.00 30.19 ? 528 THR B C   1 
ATOM   7402  O  O   . THR B 1 514 ? 19.892  -3.134  14.379  1.00 38.35 ? 528 THR B O   1 
ATOM   7403  C  CB  . THR B 1 514 ? 22.104  -5.072  15.931  1.00 35.03 ? 528 THR B CB  1 
ATOM   7404  N  N   . ASN B 1 515 ? 21.365  -2.062  15.710  1.00 29.94 ? 529 ASN B N   1 
ATOM   7405  C  CA  . ASN B 1 515 ? 20.416  -1.000  16.085  1.00 34.61 ? 529 ASN B CA  1 
ATOM   7406  C  C   . ASN B 1 515 ? 19.878  -0.170  14.911  1.00 28.85 ? 529 ASN B C   1 
ATOM   7407  O  O   . ASN B 1 515 ? 18.842  0.474   15.034  1.00 30.38 ? 529 ASN B O   1 
ATOM   7408  C  CB  . ASN B 1 515 ? 21.028  -0.071  17.140  1.00 39.62 ? 529 ASN B CB  1 
ATOM   7409  N  N   . ASP B 1 516 ? 20.587  -0.189  13.784  1.00 27.79 ? 530 ASP B N   1 
ATOM   7410  C  CA  . ASP B 1 516 ? 20.233  0.626   12.623  1.00 28.38 ? 530 ASP B CA  1 
ATOM   7411  C  C   . ASP B 1 516 ? 19.546  -0.169  11.512  1.00 32.96 ? 530 ASP B C   1 
ATOM   7412  O  O   . ASP B 1 516 ? 19.076  0.403   10.519  1.00 30.83 ? 530 ASP B O   1 
ATOM   7413  C  CB  . ASP B 1 516 ? 21.483  1.299   12.065  1.00 30.09 ? 530 ASP B CB  1 
ATOM   7414  C  CG  . ASP B 1 516 ? 22.319  1.946   13.150  1.00 34.31 ? 530 ASP B CG  1 
ATOM   7415  O  OD1 . ASP B 1 516 ? 21.917  3.031   13.640  1.00 34.18 ? 530 ASP B OD1 1 
ATOM   7416  O  OD2 . ASP B 1 516 ? 23.366  1.360   13.513  1.00 27.55 ? 530 ASP B OD2 1 
ATOM   7417  N  N   . LYS B 1 517 ? 19.497  -1.487  11.680  1.00 25.21 ? 531 LYS B N   1 
ATOM   7418  C  CA  . LYS B 1 517 ? 18.905  -2.351  10.665  1.00 29.64 ? 531 LYS B CA  1 
ATOM   7419  C  C   . LYS B 1 517 ? 17.375  -2.374  10.779  1.00 27.64 ? 531 LYS B C   1 
ATOM   7420  O  O   . LYS B 1 517 ? 16.813  -2.036  11.826  1.00 25.14 ? 531 LYS B O   1 
ATOM   7421  C  CB  . LYS B 1 517 ? 19.499  -3.765  10.761  1.00 29.06 ? 531 LYS B CB  1 
ATOM   7422  N  N   . PRO B 1 518 ? 16.691  -2.754  9.695   1.00 33.59 ? 532 PRO B N   1 
ATOM   7423  C  CA  . PRO B 1 518 ? 15.227  -2.835  9.822   1.00 34.80 ? 532 PRO B CA  1 
ATOM   7424  C  C   . PRO B 1 518 ? 14.800  -3.781  10.964  1.00 31.97 ? 532 PRO B C   1 
ATOM   7425  O  O   . PRO B 1 518 ? 15.287  -4.907  11.049  1.00 29.54 ? 532 PRO B O   1 
ATOM   7426  C  CB  . PRO B 1 518 ? 14.770  -3.337  8.442   1.00 34.59 ? 532 PRO B CB  1 
ATOM   7427  C  CG  . PRO B 1 518 ? 16.017  -3.750  7.711   1.00 40.40 ? 532 PRO B CG  1 
ATOM   7428  C  CD  . PRO B 1 518 ? 17.162  -3.009  8.321   1.00 32.91 ? 532 PRO B CD  1 
ATOM   7429  N  N   . GLY B 1 519 ? 13.930  -3.300  11.852  1.00 30.22 ? 533 GLY B N   1 
ATOM   7430  C  CA  . GLY B 1 519 ? 13.537  -4.056  13.035  1.00 24.12 ? 533 GLY B CA  1 
ATOM   7431  C  C   . GLY B 1 519 ? 14.297  -3.578  14.262  1.00 24.26 ? 533 GLY B C   1 
ATOM   7432  O  O   . GLY B 1 519 ? 13.901  -3.841  15.404  1.00 24.97 ? 533 GLY B O   1 
ATOM   7433  N  N   . GLY B 1 520 ? 15.403  -2.875  14.017  1.00 25.79 ? 534 GLY B N   1 
ATOM   7434  C  CA  . GLY B 1 520 ? 16.235  -2.336  15.084  1.00 28.67 ? 534 GLY B CA  1 
ATOM   7435  C  C   . GLY B 1 520 ? 15.584  -1.117  15.729  1.00 27.56 ? 534 GLY B C   1 
ATOM   7436  O  O   . GLY B 1 520 ? 14.760  -0.453  15.102  1.00 24.41 ? 534 GLY B O   1 
ATOM   7437  N  N   . PRO B 1 521 ? 15.938  -0.834  16.995  1.00 26.86 ? 535 PRO B N   1 
ATOM   7438  C  CA  . PRO B 1 521 ? 15.368  0.290   17.751  1.00 30.31 ? 535 PRO B CA  1 
ATOM   7439  C  C   . PRO B 1 521 ? 15.653  1.660   17.121  1.00 34.21 ? 535 PRO B C   1 
ATOM   7440  O  O   . PRO B 1 521 ? 14.829  2.565   17.253  1.00 31.61 ? 535 PRO B O   1 
ATOM   7441  C  CB  . PRO B 1 521 ? 16.039  0.176   19.135  1.00 26.33 ? 535 PRO B CB  1 
ATOM   7442  C  CG  . PRO B 1 521 ? 17.235  -0.683  18.934  1.00 29.33 ? 535 PRO B CG  1 
ATOM   7443  C  CD  . PRO B 1 521 ? 16.895  -1.623  17.797  1.00 27.84 ? 535 PRO B CD  1 
ATOM   7444  N  N   . HIS B 1 522 ? 16.784  1.804   16.437  1.00 28.02 ? 536 HIS B N   1 
ATOM   7445  C  CA  . HIS B 1 522 ? 17.177  3.100   15.872  1.00 26.48 ? 536 HIS B CA  1 
ATOM   7446  C  C   . HIS B 1 522 ? 17.015  3.176   14.343  1.00 29.02 ? 536 HIS B C   1 
ATOM   7447  O  O   . HIS B 1 522 ? 17.565  4.070   13.687  1.00 26.28 ? 536 HIS B O   1 
ATOM   7448  C  CB  . HIS B 1 522 ? 18.607  3.462   16.297  1.00 35.20 ? 536 HIS B CB  1 
ATOM   7449  N  N   . TYR B 1 523 ? 16.251  2.237   13.785  1.00 23.71 ? 537 TYR B N   1 
ATOM   7450  C  CA  . TYR B 1 523 ? 15.954  2.231   12.356  1.00 26.55 ? 537 TYR B CA  1 
ATOM   7451  C  C   . TYR B 1 523 ? 15.279  3.558   12.022  1.00 29.94 ? 537 TYR B C   1 
ATOM   7452  O  O   . TYR B 1 523 ? 14.316  3.956   12.686  1.00 27.12 ? 537 TYR B O   1 
ATOM   7453  C  CB  . TYR B 1 523 ? 15.036  1.053   12.024  1.00 27.38 ? 537 TYR B CB  1 
ATOM   7454  C  CG  . TYR B 1 523 ? 14.787  0.845   10.544  1.00 35.99 ? 537 TYR B CG  1 
ATOM   7455  C  CD1 . TYR B 1 523 ? 13.504  0.625   10.064  1.00 41.63 ? 537 TYR B CD1 1 
ATOM   7456  C  CD2 . TYR B 1 523 ? 15.837  0.859   9.630   1.00 39.30 ? 537 TYR B CD2 1 
ATOM   7457  C  CE1 . TYR B 1 523 ? 13.270  0.427   8.713   1.00 44.51 ? 537 TYR B CE1 1 
ATOM   7458  C  CE2 . TYR B 1 523 ? 15.611  0.659   8.279   1.00 41.99 ? 537 TYR B CE2 1 
ATOM   7459  C  CZ  . TYR B 1 523 ? 14.323  0.446   7.826   1.00 43.94 ? 537 TYR B CZ  1 
ATOM   7460  O  OH  . TYR B 1 523 ? 14.085  0.251   6.483   1.00 45.11 ? 537 TYR B OH  1 
ATOM   7461  N  N   . ILE B 1 524 ? 15.808  4.259   11.025  1.00 33.83 ? 538 ILE B N   1 
ATOM   7462  C  CA  . ILE B 1 524 ? 15.451  5.661   10.793  1.00 28.07 ? 538 ILE B CA  1 
ATOM   7463  C  C   . ILE B 1 524 ? 13.966  5.852   10.415  1.00 28.38 ? 538 ILE B C   1 
ATOM   7464  O  O   . ILE B 1 524 ? 13.381  6.922   10.630  1.00 25.98 ? 538 ILE B O   1 
ATOM   7465  C  CB  . ILE B 1 524 ? 16.393  6.299   9.734   1.00 33.47 ? 538 ILE B CB  1 
ATOM   7466  C  CG1 . ILE B 1 524 ? 16.106  7.794   9.585   1.00 32.91 ? 538 ILE B CG1 1 
ATOM   7467  C  CG2 . ILE B 1 524 ? 16.266  5.575   8.401   1.00 25.42 ? 538 ILE B CG2 1 
ATOM   7468  C  CD1 . ILE B 1 524 ? 17.329  8.626   9.255   1.00 32.22 ? 538 ILE B CD1 1 
ATOM   7469  N  N   . LEU B 1 525 ? 13.361  4.786   9.896   1.00 26.41 ? 539 LEU B N   1 
ATOM   7470  C  CA  . LEU B 1 525 ? 11.952  4.775   9.502   1.00 32.15 ? 539 LEU B CA  1 
ATOM   7471  C  C   . LEU B 1 525 ? 11.031  5.025   10.684  1.00 27.61 ? 539 LEU B C   1 
ATOM   7472  O  O   . LEU B 1 525 ? 9.894   5.465   10.521  1.00 26.38 ? 539 LEU B O   1 
ATOM   7473  C  CB  . LEU B 1 525 ? 11.592  3.435   8.864   1.00 30.88 ? 539 LEU B CB  1 
ATOM   7474  C  CG  . LEU B 1 525 ? 11.479  3.404   7.342   1.00 42.19 ? 539 LEU B CG  1 
ATOM   7475  C  CD1 . LEU B 1 525 ? 10.209  4.096   6.908   1.00 39.68 ? 539 LEU B CD1 1 
ATOM   7476  C  CD2 . LEU B 1 525 ? 12.701  4.049   6.696   1.00 48.17 ? 539 LEU B CD2 1 
ATOM   7477  N  N   . ARG B 1 526 ? 11.528  4.746   11.879  1.00 23.45 ? 540 ARG B N   1 
ATOM   7478  C  CA  . ARG B 1 526 ? 10.743  4.983   13.084  1.00 26.28 ? 540 ARG B CA  1 
ATOM   7479  C  C   . ARG B 1 526 ? 10.436  6.457   13.304  1.00 22.24 ? 540 ARG B C   1 
ATOM   7480  O  O   . ARG B 1 526 ? 9.529   6.785   14.055  1.00 23.20 ? 540 ARG B O   1 
ATOM   7481  C  CB  . ARG B 1 526 ? 11.455  4.408   14.302  1.00 28.87 ? 540 ARG B CB  1 
ATOM   7482  C  CG  . ARG B 1 526 ? 11.614  2.909   14.240  1.00 36.32 ? 540 ARG B CG  1 
ATOM   7483  C  CD  . ARG B 1 526 ? 10.975  2.262   15.451  1.00 41.41 ? 540 ARG B CD  1 
ATOM   7484  N  NE  . ARG B 1 526 ? 11.831  2.386   16.615  1.00 42.19 ? 540 ARG B NE  1 
ATOM   7485  C  CZ  . ARG B 1 526 ? 11.394  2.474   17.864  1.00 34.93 ? 540 ARG B CZ  1 
ATOM   7486  N  NH1 . ARG B 1 526 ? 10.097  2.472   18.131  1.00 29.77 ? 540 ARG B NH1 1 
ATOM   7487  N  NH2 . ARG B 1 526 ? 12.266  2.575   18.846  1.00 32.63 ? 540 ARG B NH2 1 
ATOM   7488  N  N   . TRP B 1 527 ? 11.194  7.342   12.656  1.00 20.48 ? 541 TRP B N   1 
ATOM   7489  C  CA  . TRP B 1 527 ? 10.993  8.778   12.821  1.00 21.79 ? 541 TRP B CA  1 
ATOM   7490  C  C   . TRP B 1 527 ? 10.109  9.393   11.729  1.00 27.04 ? 541 TRP B C   1 
ATOM   7491  O  O   . TRP B 1 527 ? 10.036  10.617  11.588  1.00 25.83 ? 541 TRP B O   1 
ATOM   7492  C  CB  . TRP B 1 527 ? 12.348  9.507   12.945  1.00 17.30 ? 541 TRP B CB  1 
ATOM   7493  C  CG  . TRP B 1 527 ? 13.120  8.959   14.097  1.00 20.26 ? 541 TRP B CG  1 
ATOM   7494  C  CD1 . TRP B 1 527 ? 14.305  8.284   14.046  1.00 22.30 ? 541 TRP B CD1 1 
ATOM   7495  C  CD2 . TRP B 1 527 ? 12.722  8.975   15.476  1.00 21.67 ? 541 TRP B CD2 1 
ATOM   7496  N  NE1 . TRP B 1 527 ? 14.672  7.885   15.308  1.00 22.65 ? 541 TRP B NE1 1 
ATOM   7497  C  CE2 . TRP B 1 527 ? 13.718  8.287   16.203  1.00 22.45 ? 541 TRP B CE2 1 
ATOM   7498  C  CE3 . TRP B 1 527 ? 11.613  9.484   16.162  1.00 25.46 ? 541 TRP B CE3 1 
ATOM   7499  C  CZ2 . TRP B 1 527 ? 13.648  8.118   17.588  1.00 26.06 ? 541 TRP B CZ2 1 
ATOM   7500  C  CZ3 . TRP B 1 527 ? 11.542  9.311   17.532  1.00 24.11 ? 541 TRP B CZ3 1 
ATOM   7501  C  CH2 . TRP B 1 527 ? 12.556  8.637   18.234  1.00 23.78 ? 541 TRP B CH2 1 
ATOM   7502  N  N   . THR B 1 528 ? 9.448   8.539   10.955  1.00 27.72 ? 542 THR B N   1 
ATOM   7503  C  CA  . THR B 1 528 ? 8.451   9.007   9.994   1.00 26.32 ? 542 THR B CA  1 
ATOM   7504  C  C   . THR B 1 528 ? 7.129   8.249   10.175  1.00 27.35 ? 542 THR B C   1 
ATOM   7505  O  O   . THR B 1 528 ? 7.119   7.084   10.568  1.00 23.34 ? 542 THR B O   1 
ATOM   7506  C  CB  . THR B 1 528 ? 8.933   8.862   8.530   1.00 29.83 ? 542 THR B CB  1 
ATOM   7507  O  OG1 . THR B 1 528 ? 7.946   9.419   7.650   1.00 35.26 ? 542 THR B OG1 1 
ATOM   7508  C  CG2 . THR B 1 528 ? 9.127   7.394   8.160   1.00 29.00 ? 542 THR B CG2 1 
ATOM   7509  N  N   . SER B 1 529 ? 6.010   8.916   9.915   1.00 25.13 ? 543 SER B N   1 
ATOM   7510  C  CA  . SER B 1 529 ? 4.730   8.216   9.822   1.00 24.74 ? 543 SER B CA  1 
ATOM   7511  C  C   . SER B 1 529 ? 4.229   8.355   8.400   1.00 26.48 ? 543 SER B C   1 
ATOM   7512  O  O   . SER B 1 529 ? 3.823   9.439   7.982   1.00 29.44 ? 543 SER B O   1 
ATOM   7513  C  CB  . SER B 1 529 ? 3.700   8.776   10.808  1.00 29.91 ? 543 SER B CB  1 
ATOM   7514  O  OG  . SER B 1 529 ? 2.461   8.078   10.694  1.00 28.90 ? 543 SER B OG  1 
ATOM   7515  N  N   . PRO B 1 530 ? 4.277   7.259   7.635   1.00 33.82 ? 544 PRO B N   1 
ATOM   7516  C  CA  . PRO B 1 530 ? 3.878   7.349   6.231   1.00 33.66 ? 544 PRO B CA  1 
ATOM   7517  C  C   . PRO B 1 530 ? 2.386   7.622   6.084   1.00 31.31 ? 544 PRO B C   1 
ATOM   7518  O  O   . PRO B 1 530 ? 1.555   7.017   6.767   1.00 29.03 ? 544 PRO B O   1 
ATOM   7519  C  CB  . PRO B 1 530 ? 4.238   5.968   5.675   1.00 36.85 ? 544 PRO B CB  1 
ATOM   7520  C  CG  . PRO B 1 530 ? 5.312   5.458   6.608   1.00 39.21 ? 544 PRO B CG  1 
ATOM   7521  C  CD  . PRO B 1 530 ? 4.863   5.949   7.958   1.00 38.43 ? 544 PRO B CD  1 
ATOM   7522  N  N   . GLN B 1 531 ? 2.065   8.563   5.210   1.00 25.35 ? 545 GLN B N   1 
ATOM   7523  C  CA  . GLN B 1 531 ? 0.683   8.833   4.849   1.00 28.86 ? 545 GLN B CA  1 
ATOM   7524  C  C   . GLN B 1 531 ? 0.448   8.335   3.430   1.00 31.30 ? 545 GLN B C   1 
ATOM   7525  O  O   . GLN B 1 531 ? 1.234   8.648   2.534   1.00 30.38 ? 545 GLN B O   1 
ATOM   7526  C  CB  . GLN B 1 531 ? 0.423   10.335  4.913   1.00 34.39 ? 545 GLN B CB  1 
ATOM   7527  C  CG  . GLN B 1 531 ? -0.996  10.756  4.563   1.00 38.18 ? 545 GLN B CG  1 
ATOM   7528  C  CD  . GLN B 1 531 ? -1.150  12.264  4.527   1.00 48.61 ? 545 GLN B CD  1 
ATOM   7529  O  OE1 . GLN B 1 531 ? -0.332  12.971  3.943   1.00 52.85 ? 545 GLN B OE1 1 
ATOM   7530  N  NE2 . GLN B 1 531 ? -2.197  12.764  5.164   1.00 54.29 ? 545 GLN B NE2 1 
ATOM   7531  N  N   . VAL B 1 532 ? -0.624  7.564   3.219   1.00 25.72 ? 546 VAL B N   1 
ATOM   7532  C  CA  . VAL B 1 532 ? -0.986  7.137   1.876   1.00 26.89 ? 546 VAL B CA  1 
ATOM   7533  C  C   . VAL B 1 532 ? -2.080  8.044   1.305   1.00 33.35 ? 546 VAL B C   1 
ATOM   7534  O  O   . VAL B 1 532 ? -3.161  8.155   1.884   1.00 31.66 ? 546 VAL B O   1 
ATOM   7535  C  CB  . VAL B 1 532 ? -1.520  5.680   1.870   1.00 32.60 ? 546 VAL B CB  1 
ATOM   7536  C  CG1 . VAL B 1 532 ? -1.825  5.240   0.456   1.00 33.31 ? 546 VAL B CG1 1 
ATOM   7537  C  CG2 . VAL B 1 532 ? -0.506  4.746   2.521   1.00 41.36 ? 546 VAL B CG2 1 
ATOM   7538  N  N   . ILE B 1 533 ? -1.800  8.695   0.179   1.00 29.84 ? 547 ILE B N   1 
ATOM   7539  C  CA  . ILE B 1 533 ? -2.789  9.555   -0.467  1.00 30.54 ? 547 ILE B CA  1 
ATOM   7540  C  C   . ILE B 1 533 ? -3.313  8.907   -1.743  1.00 39.55 ? 547 ILE B C   1 
ATOM   7541  O  O   . ILE B 1 533 ? -2.528  8.515   -2.610  1.00 38.06 ? 547 ILE B O   1 
ATOM   7542  C  CB  . ILE B 1 533 ? -2.200  10.939  -0.796  1.00 35.81 ? 547 ILE B CB  1 
ATOM   7543  C  CG1 . ILE B 1 533 ? -1.695  11.603  0.487   1.00 37.69 ? 547 ILE B CG1 1 
ATOM   7544  C  CG2 . ILE B 1 533 ? -3.248  11.808  -1.523  1.00 40.04 ? 547 ILE B CG2 1 
ATOM   7545  C  CD1 . ILE B 1 533 ? -1.084  12.964  0.292   1.00 40.78 ? 547 ILE B CD1 1 
ATOM   7546  N  N   . LYS B 1 534 ? -4.635  8.780   -1.861  1.00 36.41 ? 548 LYS B N   1 
ATOM   7547  C  CA  . LYS B 1 534 ? -5.214  8.145   -3.041  1.00 38.38 ? 548 LYS B CA  1 
ATOM   7548  C  C   . LYS B 1 534 ? -6.240  9.042   -3.709  1.00 47.11 ? 548 LYS B C   1 
ATOM   7549  O  O   . LYS B 1 534 ? -7.240  9.429   -3.103  1.00 46.42 ? 548 LYS B O   1 
ATOM   7550  C  CB  . LYS B 1 534 ? -5.824  6.777   -2.694  1.00 38.85 ? 548 LYS B CB  1 
ATOM   7551  N  N   . GLU B 1 535 ? -5.982  9.372   -4.967  1.00 49.81 ? 549 GLU B N   1 
ATOM   7552  C  CA  . GLU B 1 535 ? -6.870  10.237  -5.721  1.00 52.04 ? 549 GLU B CA  1 
ATOM   7553  C  C   . GLU B 1 535 ? -7.564  9.464   -6.826  1.00 58.00 ? 549 GLU B C   1 
ATOM   7554  O  O   . GLU B 1 535 ? -6.916  8.773   -7.601  1.00 60.80 ? 549 GLU B O   1 
ATOM   7555  C  CB  . GLU B 1 535 ? -6.092  11.402  -6.322  1.00 49.11 ? 549 GLU B CB  1 
ATOM   7556  C  CG  . GLU B 1 535 ? -6.920  12.271  -7.235  1.00 54.58 ? 549 GLU B CG  1 
ATOM   7557  C  CD  . GLU B 1 535 ? -6.253  13.592  -7.524  1.00 57.88 ? 549 GLU B CD  1 
ATOM   7558  O  OE1 . GLU B 1 535 ? -5.032  13.716  -7.258  1.00 60.48 ? 549 GLU B OE1 1 
ATOM   7559  O  OE2 . GLU B 1 535 ? -6.953  14.507  -8.006  1.00 53.66 ? 549 GLU B OE2 1 
ATOM   7560  N  N   . THR B 1 536 ? -8.885  9.584   -6.893  1.00 57.17 ? 550 THR B N   1 
ATOM   7561  C  CA  . THR B 1 536 ? -9.648  8.948   -7.960  1.00 55.77 ? 550 THR B CA  1 
ATOM   7562  C  C   . THR B 1 536 ? -10.062 9.979   -9.015  1.00 56.89 ? 550 THR B C   1 
ATOM   7563  O  O   . THR B 1 536 ? -10.473 11.096  -8.684  1.00 54.79 ? 550 THR B O   1 
ATOM   7564  C  CB  . THR B 1 536 ? -10.884 8.202   -7.407  1.00 53.93 ? 550 THR B CB  1 
ATOM   7565  O  OG1 . THR B 1 536 ? -10.455 7.151   -6.532  1.00 55.04 ? 550 THR B OG1 1 
ATOM   7566  C  CG2 . THR B 1 536 ? -11.694 7.598   -8.534  1.00 51.33 ? 550 THR B CG2 1 
ATOM   7567  N  N   . HIS B 1 537 ? -9.917  9.606   -10.284 1.00 62.41 ? 551 HIS B N   1 
ATOM   7568  C  CA  . HIS B 1 537 ? -10.293 10.469  -11.401 1.00 64.16 ? 551 HIS B CA  1 
ATOM   7569  C  C   . HIS B 1 537 ? -11.418 9.823   -12.196 1.00 62.12 ? 551 HIS B C   1 
ATOM   7570  O  O   . HIS B 1 537 ? -12.444 10.446  -12.456 1.00 66.39 ? 551 HIS B O   1 
ATOM   7571  C  CB  . HIS B 1 537 ? -9.091  10.727  -12.317 1.00 66.22 ? 551 HIS B CB  1 
ATOM   7572  C  CG  . HIS B 1 537 ? -7.855  11.165  -11.593 1.00 66.22 ? 551 HIS B CG  1 
ATOM   7573  N  ND1 . HIS B 1 537 ? -7.534  12.495  -11.395 1.00 67.29 ? 551 HIS B ND1 1 
ATOM   7574  C  CD2 . HIS B 1 537 ? -6.849  10.454  -11.027 1.00 64.09 ? 551 HIS B CD2 1 
ATOM   7575  C  CE1 . HIS B 1 537 ? -6.394  12.579  -10.736 1.00 62.87 ? 551 HIS B CE1 1 
ATOM   7576  N  NE2 . HIS B 1 537 ? -5.956  11.353  -10.499 1.00 59.80 ? 551 HIS B NE2 1 
ATOM   7577  N  N   . ARG C 1 9   ? -24.987 -14.794 82.295  1.00 64.21 ? 23  ARG C N   1 
ATOM   7578  C  CA  . ARG C 1 9   ? -24.177 -15.765 83.016  1.00 59.44 ? 23  ARG C CA  1 
ATOM   7579  C  C   . ARG C 1 9   ? -22.732 -15.303 83.238  1.00 53.65 ? 23  ARG C C   1 
ATOM   7580  O  O   . ARG C 1 9   ? -22.470 -14.103 83.361  1.00 47.87 ? 23  ARG C O   1 
ATOM   7581  C  CB  . ARG C 1 9   ? -24.197 -17.124 82.312  1.00 50.90 ? 23  ARG C CB  1 
ATOM   7582  C  CG  . ARG C 1 9   ? -23.777 -17.114 80.844  1.00 50.27 ? 23  ARG C CG  1 
ATOM   7583  C  CD  . ARG C 1 9   ? -23.511 -18.534 80.389  1.00 54.80 ? 23  ARG C CD  1 
ATOM   7584  N  NE  . ARG C 1 9   ? -24.409 -19.470 81.065  1.00 63.83 ? 23  ARG C NE  1 
ATOM   7585  C  CZ  . ARG C 1 9   ? -24.033 -20.323 82.015  1.00 68.40 ? 23  ARG C CZ  1 
ATOM   7586  N  NH1 . ARG C 1 9   ? -22.764 -20.367 82.405  1.00 67.73 ? 23  ARG C NH1 1 
ATOM   7587  N  NH2 . ARG C 1 9   ? -24.928 -21.127 82.577  1.00 70.70 ? 23  ARG C NH2 1 
ATOM   7588  N  N   . TRP C 1 10  ? -21.806 -16.265 83.278  1.00 48.53 ? 24  TRP C N   1 
ATOM   7589  C  CA  . TRP C 1 10  ? -20.419 -16.004 83.659  1.00 50.47 ? 24  TRP C CA  1 
ATOM   7590  C  C   . TRP C 1 10  ? -19.412 -16.954 83.002  1.00 51.80 ? 24  TRP C C   1 
ATOM   7591  O  O   . TRP C 1 10  ? -19.790 -18.003 82.479  1.00 48.98 ? 24  TRP C O   1 
ATOM   7592  C  CB  . TRP C 1 10  ? -20.278 -16.131 85.175  1.00 48.95 ? 24  TRP C CB  1 
ATOM   7593  C  CG  . TRP C 1 10  ? -20.573 -17.509 85.668  1.00 50.92 ? 24  TRP C CG  1 
ATOM   7594  C  CD1 . TRP C 1 10  ? -21.799 -18.014 86.008  1.00 53.19 ? 24  TRP C CD1 1 
ATOM   7595  C  CD2 . TRP C 1 10  ? -19.631 -18.570 85.874  1.00 50.91 ? 24  TRP C CD2 1 
ATOM   7596  N  NE1 . TRP C 1 10  ? -21.675 -19.319 86.415  1.00 54.62 ? 24  TRP C NE1 1 
ATOM   7597  C  CE2 . TRP C 1 10  ? -20.358 -19.686 86.339  1.00 53.25 ? 24  TRP C CE2 1 
ATOM   7598  C  CE3 . TRP C 1 10  ? -18.246 -18.684 85.709  1.00 49.22 ? 24  TRP C CE3 1 
ATOM   7599  C  CZ2 . TRP C 1 10  ? -19.743 -20.902 86.648  1.00 54.20 ? 24  TRP C CZ2 1 
ATOM   7600  C  CZ3 . TRP C 1 10  ? -17.637 -19.893 86.016  1.00 52.97 ? 24  TRP C CZ3 1 
ATOM   7601  C  CH2 . TRP C 1 10  ? -18.385 -20.986 86.479  1.00 52.62 ? 24  TRP C CH2 1 
ATOM   7602  N  N   . LYS C 1 11  ? -18.128 -16.593 83.069  1.00 44.43 ? 25  LYS C N   1 
ATOM   7603  C  CA  . LYS C 1 11  ? -17.054 -17.418 82.518  1.00 43.27 ? 25  LYS C CA  1 
ATOM   7604  C  C   . LYS C 1 11  ? -15.689 -17.046 83.111  1.00 42.24 ? 25  LYS C C   1 
ATOM   7605  O  O   . LYS C 1 11  ? -15.382 -15.871 83.289  1.00 41.33 ? 25  LYS C O   1 
ATOM   7606  C  CB  . LYS C 1 11  ? -16.999 -17.275 80.993  1.00 48.06 ? 25  LYS C CB  1 
ATOM   7607  N  N   . HIS C 1 12  ? -14.870 -18.048 83.408  1.00 44.62 ? 26  HIS C N   1 
ATOM   7608  C  CA  . HIS C 1 12  ? -13.520 -17.797 83.905  1.00 48.63 ? 26  HIS C CA  1 
ATOM   7609  C  C   . HIS C 1 12  ? -12.604 -17.371 82.756  1.00 53.70 ? 26  HIS C C   1 
ATOM   7610  O  O   . HIS C 1 12  ? -12.538 -18.039 81.725  1.00 58.54 ? 26  HIS C O   1 
ATOM   7611  C  CB  . HIS C 1 12  ? -12.962 -19.030 84.621  1.00 50.17 ? 26  HIS C CB  1 
ATOM   7612  N  N   . THR C 1 13  ? -11.920 -16.243 82.930  1.00 50.17 ? 27  THR C N   1 
ATOM   7613  C  CA  . THR C 1 13  ? -10.987 -15.745 81.922  1.00 47.95 ? 27  THR C CA  1 
ATOM   7614  C  C   . THR C 1 13  ? -9.559  -15.774 82.453  1.00 47.55 ? 27  THR C C   1 
ATOM   7615  O  O   . THR C 1 13  ? -9.326  -16.067 83.628  1.00 48.39 ? 27  THR C O   1 
ATOM   7616  C  CB  . THR C 1 13  ? -11.328 -14.311 81.467  1.00 49.68 ? 27  THR C CB  1 
ATOM   7617  O  OG1 . THR C 1 13  ? -11.289 -13.424 82.591  1.00 54.34 ? 27  THR C OG1 1 
ATOM   7618  C  CG2 . THR C 1 13  ? -12.711 -14.263 80.838  1.00 55.32 ? 27  THR C CG2 1 
ATOM   7619  N  N   . SER C 1 14  ? -8.602  -15.471 81.582  1.00 49.71 ? 28  SER C N   1 
ATOM   7620  C  CA  . SER C 1 14  ? -7.196  -15.574 81.945  1.00 47.20 ? 28  SER C CA  1 
ATOM   7621  C  C   . SER C 1 14  ? -6.302  -14.718 81.048  1.00 44.86 ? 28  SER C C   1 
ATOM   7622  O  O   . SER C 1 14  ? -6.455  -14.703 79.819  1.00 39.06 ? 28  SER C O   1 
ATOM   7623  C  CB  . SER C 1 14  ? -6.744  -17.034 81.899  1.00 45.33 ? 28  SER C CB  1 
ATOM   7624  O  OG  . SER C 1 14  ? -5.567  -17.208 82.657  1.00 47.37 ? 28  SER C OG  1 
ATOM   7625  N  N   . SER C 1 15  ? -5.382  -13.996 81.686  1.00 37.85 ? 29  SER C N   1 
ATOM   7626  C  CA  . SER C 1 15  ? -4.399  -13.182 80.991  1.00 40.07 ? 29  SER C CA  1 
ATOM   7627  C  C   . SER C 1 15  ? -3.006  -13.555 81.498  1.00 38.34 ? 29  SER C C   1 
ATOM   7628  O  O   . SER C 1 15  ? -2.863  -14.469 82.299  1.00 36.53 ? 29  SER C O   1 
ATOM   7629  C  CB  . SER C 1 15  ? -4.675  -11.696 81.223  1.00 46.25 ? 29  SER C CB  1 
ATOM   7630  O  OG  . SER C 1 15  ? -3.823  -10.887 80.427  1.00 49.31 ? 29  SER C OG  1 
ATOM   7631  N  N   . LEU C 1 16  ? -1.988  -12.833 81.048  1.00 35.97 ? 30  LEU C N   1 
ATOM   7632  C  CA  . LEU C 1 16  ? -0.616  -13.146 81.422  1.00 36.96 ? 30  LEU C CA  1 
ATOM   7633  C  C   . LEU C 1 16  ? 0.068   -11.956 82.071  1.00 39.94 ? 30  LEU C C   1 
ATOM   7634  O  O   . LEU C 1 16  ? -0.122  -10.811 81.655  1.00 46.91 ? 30  LEU C O   1 
ATOM   7635  C  CB  . LEU C 1 16  ? 0.183   -13.551 80.184  1.00 39.10 ? 30  LEU C CB  1 
ATOM   7636  C  CG  . LEU C 1 16  ? 0.430   -15.017 79.842  1.00 41.00 ? 30  LEU C CG  1 
ATOM   7637  C  CD1 . LEU C 1 16  ? -0.670  -15.930 80.322  1.00 44.66 ? 30  LEU C CD1 1 
ATOM   7638  C  CD2 . LEU C 1 16  ? 0.594   -15.128 78.341  1.00 43.05 ? 30  LEU C CD2 1 
ATOM   7639  N  N   . LYS C 1 17  ? 0.864   -12.229 83.095  1.00 37.68 ? 31  LYS C N   1 
ATOM   7640  C  CA  . LYS C 1 17  ? 1.800   -11.236 83.608  1.00 40.94 ? 31  LYS C CA  1 
ATOM   7641  C  C   . LYS C 1 17  ? 3.205   -11.766 83.346  1.00 34.35 ? 31  LYS C C   1 
ATOM   7642  O  O   . LYS C 1 17  ? 3.464   -12.963 83.498  1.00 34.41 ? 31  LYS C O   1 
ATOM   7643  C  CB  . LYS C 1 17  ? 1.578   -10.992 85.103  1.00 39.94 ? 31  LYS C CB  1 
ATOM   7644  N  N   . VAL C 1 18  ? 4.109   -10.901 82.907  1.00 34.22 ? 32  VAL C N   1 
ATOM   7645  C  CA  . VAL C 1 18  ? 5.477   -11.353 82.664  1.00 36.38 ? 32  VAL C CA  1 
ATOM   7646  C  C   . VAL C 1 18  ? 6.481   -10.334 83.170  1.00 35.85 ? 32  VAL C C   1 
ATOM   7647  O  O   . VAL C 1 18  ? 6.212   -9.133  83.165  1.00 31.18 ? 32  VAL C O   1 
ATOM   7648  C  CB  . VAL C 1 18  ? 5.760   -11.642 81.159  1.00 41.26 ? 32  VAL C CB  1 
ATOM   7649  C  CG1 . VAL C 1 18  ? 4.818   -12.694 80.615  1.00 28.79 ? 32  VAL C CG1 1 
ATOM   7650  C  CG2 . VAL C 1 18  ? 5.647   -10.388 80.349  1.00 42.55 ? 32  VAL C CG2 1 
ATOM   7651  N  N   . ALA C 1 19  ? 7.632   -10.837 83.610  1.00 37.71 ? 33  ALA C N   1 
ATOM   7652  C  CA  . ALA C 1 19  ? 8.745   -10.009 84.051  1.00 41.76 ? 33  ALA C CA  1 
ATOM   7653  C  C   . ALA C 1 19  ? 9.881   -10.112 83.048  1.00 40.75 ? 33  ALA C C   1 
ATOM   7654  O  O   . ALA C 1 19  ? 9.942   -11.065 82.275  1.00 39.50 ? 33  ALA C O   1 
ATOM   7655  C  CB  . ALA C 1 19  ? 9.238   -10.471 85.422  1.00 38.30 ? 33  ALA C CB  1 
ATOM   7656  N  N   . ASN C 1 20  ? 10.785  -9.136  83.074  1.00 35.29 ? 34  ASN C N   1 
ATOM   7657  C  CA  . ASN C 1 20  ? 11.977  -9.186  82.240  1.00 30.19 ? 34  ASN C CA  1 
ATOM   7658  C  C   . ASN C 1 20  ? 12.890  -10.342 82.650  1.00 29.56 ? 34  ASN C C   1 
ATOM   7659  O  O   . ASN C 1 20  ? 12.975  -10.695 83.831  1.00 28.66 ? 34  ASN C O   1 
ATOM   7660  C  CB  . ASN C 1 20  ? 12.732  -7.851  82.302  1.00 30.28 ? 34  ASN C CB  1 
ATOM   7661  C  CG  . ASN C 1 20  ? 12.025  -6.745  81.540  1.00 36.01 ? 34  ASN C CG  1 
ATOM   7662  O  OD1 . ASN C 1 20  ? 11.400  -5.854  82.131  1.00 39.35 ? 34  ASN C OD1 1 
ATOM   7663  N  ND2 . ASN C 1 20  ? 12.113  -6.798  80.215  1.00 30.50 ? 34  ASN C ND2 1 
ATOM   7664  N  N   . GLU C 1 21  ? 13.549  -10.945 81.664  1.00 26.80 ? 35  GLU C N   1 
ATOM   7665  C  CA  . GLU C 1 21  ? 14.548  -11.976 81.909  1.00 28.58 ? 35  GLU C CA  1 
ATOM   7666  C  C   . GLU C 1 21  ? 15.804  -11.344 82.507  1.00 28.55 ? 35  GLU C C   1 
ATOM   7667  O  O   . GLU C 1 21  ? 16.341  -10.381 81.957  1.00 29.41 ? 35  GLU C O   1 
ATOM   7668  C  CB  . GLU C 1 21  ? 14.895  -12.700 80.604  1.00 24.13 ? 35  GLU C CB  1 
ATOM   7669  C  CG  . GLU C 1 21  ? 15.880  -13.871 80.752  1.00 22.62 ? 35  GLU C CG  1 
ATOM   7670  C  CD  . GLU C 1 21  ? 15.340  -15.027 81.589  1.00 30.16 ? 35  GLU C CD  1 
ATOM   7671  O  OE1 . GLU C 1 21  ? 14.133  -15.047 81.888  1.00 29.46 ? 35  GLU C OE1 1 
ATOM   7672  O  OE2 . GLU C 1 21  ? 16.135  -15.920 81.968  1.00 32.02 ? 35  GLU C OE2 1 
ATOM   7673  N  N   . PRO C 1 22  ? 16.266  -11.876 83.646  1.00 32.98 ? 36  PRO C N   1 
ATOM   7674  C  CA  . PRO C 1 22  ? 17.481  -11.363 84.293  1.00 35.49 ? 36  PRO C CA  1 
ATOM   7675  C  C   . PRO C 1 22  ? 18.710  -11.505 83.395  1.00 33.07 ? 36  PRO C C   1 
ATOM   7676  O  O   . PRO C 1 22  ? 18.859  -12.526 82.736  1.00 38.82 ? 36  PRO C O   1 
ATOM   7677  C  CB  . PRO C 1 22  ? 17.642  -12.281 85.509  1.00 40.62 ? 36  PRO C CB  1 
ATOM   7678  C  CG  . PRO C 1 22  ? 16.303  -12.902 85.725  1.00 41.66 ? 36  PRO C CG  1 
ATOM   7679  C  CD  . PRO C 1 22  ? 15.690  -13.022 84.369  1.00 33.65 ? 36  PRO C CD  1 
ATOM   7680  N  N   . VAL C 1 23  ? 19.571  -10.493 83.381  1.00 33.02 ? 37  VAL C N   1 
ATOM   7681  C  CA  . VAL C 1 23  ? 20.846  -10.556 82.669  1.00 33.55 ? 37  VAL C CA  1 
ATOM   7682  C  C   . VAL C 1 23  ? 21.932  -11.030 83.646  1.00 35.02 ? 37  VAL C C   1 
ATOM   7683  O  O   . VAL C 1 23  ? 22.251  -10.324 84.603  1.00 32.22 ? 37  VAL C O   1 
ATOM   7684  C  CB  . VAL C 1 23  ? 21.199  -9.170  82.044  1.00 29.76 ? 37  VAL C CB  1 
ATOM   7685  C  CG1 . VAL C 1 23  ? 22.596  -9.158  81.471  1.00 33.39 ? 37  VAL C CG1 1 
ATOM   7686  C  CG2 . VAL C 1 23  ? 20.196  -8.813  80.950  1.00 29.05 ? 37  VAL C CG2 1 
ATOM   7687  N  N   . LEU C 1 24  ? 22.476  -12.228 83.414  1.00 30.59 ? 38  LEU C N   1 
ATOM   7688  C  CA  . LEU C 1 24  ? 23.440  -12.831 84.337  1.00 36.53 ? 38  LEU C CA  1 
ATOM   7689  C  C   . LEU C 1 24  ? 24.819  -12.179 84.257  1.00 36.09 ? 38  LEU C C   1 
ATOM   7690  O  O   . LEU C 1 24  ? 25.206  -11.632 83.220  1.00 33.46 ? 38  LEU C O   1 
ATOM   7691  C  CB  . LEU C 1 24  ? 23.558  -14.332 84.091  1.00 32.52 ? 38  LEU C CB  1 
ATOM   7692  C  CG  . LEU C 1 24  ? 22.226  -15.080 84.051  1.00 39.02 ? 38  LEU C CG  1 
ATOM   7693  C  CD1 . LEU C 1 24  ? 22.450  -16.525 83.657  1.00 40.34 ? 38  LEU C CD1 1 
ATOM   7694  C  CD2 . LEU C 1 24  ? 21.537  -14.993 85.399  1.00 47.40 ? 38  LEU C CD2 1 
ATOM   7695  N  N   . ALA C 1 25  ? 25.562  -12.258 85.356  1.00 36.44 ? 39  ALA C N   1 
ATOM   7696  C  CA  . ALA C 1 25  ? 26.814  -11.513 85.481  1.00 39.83 ? 39  ALA C CA  1 
ATOM   7697  C  C   . ALA C 1 25  ? 28.025  -12.257 84.900  1.00 40.47 ? 39  ALA C C   1 
ATOM   7698  O  O   . ALA C 1 25  ? 28.943  -11.626 84.360  1.00 40.36 ? 39  ALA C O   1 
ATOM   7699  C  CB  . ALA C 1 25  ? 27.059  -11.135 86.937  1.00 38.87 ? 39  ALA C CB  1 
ATOM   7700  N  N   . PHE C 1 26  ? 28.002  -13.589 85.000  1.00 35.25 ? 40  PHE C N   1 
ATOM   7701  C  CA  . PHE C 1 26  ? 29.100  -14.448 84.543  1.00 38.96 ? 40  PHE C CA  1 
ATOM   7702  C  C   . PHE C 1 26  ? 30.434  -14.068 85.194  1.00 43.04 ? 40  PHE C C   1 
ATOM   7703  O  O   . PHE C 1 26  ? 31.485  -14.074 84.547  1.00 39.29 ? 40  PHE C O   1 
ATOM   7704  C  CB  . PHE C 1 26  ? 29.207  -14.473 83.011  1.00 39.18 ? 40  PHE C CB  1 
ATOM   7705  C  CG  . PHE C 1 26  ? 28.024  -15.110 82.337  1.00 36.90 ? 40  PHE C CG  1 
ATOM   7706  C  CD1 . PHE C 1 26  ? 28.018  -16.471 82.060  1.00 34.06 ? 40  PHE C CD1 1 
ATOM   7707  C  CD2 . PHE C 1 26  ? 26.908  -14.349 81.999  1.00 32.68 ? 40  PHE C CD2 1 
ATOM   7708  C  CE1 . PHE C 1 26  ? 26.919  -17.071 81.460  1.00 34.77 ? 40  PHE C CE1 1 
ATOM   7709  C  CE2 . PHE C 1 26  ? 25.805  -14.938 81.390  1.00 37.72 ? 40  PHE C CE2 1 
ATOM   7710  C  CZ  . PHE C 1 26  ? 25.809  -16.301 81.121  1.00 35.51 ? 40  PHE C CZ  1 
ATOM   7711  N  N   . THR C 1 27  ? 30.370  -13.734 86.480  1.00 42.04 ? 41  THR C N   1 
ATOM   7712  C  CA  . THR C 1 27  ? 31.561  -13.421 87.259  1.00 49.09 ? 41  THR C CA  1 
ATOM   7713  C  C   . THR C 1 27  ? 32.382  -14.684 87.437  1.00 49.89 ? 41  THR C C   1 
ATOM   7714  O  O   . THR C 1 27  ? 31.845  -15.794 87.362  1.00 42.24 ? 41  THR C O   1 
ATOM   7715  C  CB  . THR C 1 27  ? 31.196  -12.920 88.662  1.00 46.21 ? 41  THR C CB  1 
ATOM   7716  O  OG1 . THR C 1 27  ? 30.517  -13.967 89.372  1.00 43.15 ? 41  THR C OG1 1 
ATOM   7717  C  CG2 . THR C 1 27  ? 30.302  -11.686 88.577  1.00 44.71 ? 41  THR C CG2 1 
ATOM   7718  N  N   . GLN C 1 28  ? 33.678  -14.509 87.689  1.00 53.23 ? 42  GLN C N   1 
ATOM   7719  C  CA  . GLN C 1 28  ? 34.575  -15.638 87.893  1.00 55.34 ? 42  GLN C CA  1 
ATOM   7720  C  C   . GLN C 1 28  ? 34.062  -16.562 88.999  1.00 54.84 ? 42  GLN C C   1 
ATOM   7721  O  O   . GLN C 1 28  ? 33.822  -16.123 90.123  1.00 56.10 ? 42  GLN C O   1 
ATOM   7722  C  CB  . GLN C 1 28  ? 35.987  -15.143 88.228  1.00 59.99 ? 42  GLN C CB  1 
ATOM   7723  N  N   . GLY C 1 29  ? 33.881  -17.836 88.666  1.00 50.75 ? 43  GLY C N   1 
ATOM   7724  C  CA  . GLY C 1 29  ? 33.467  -18.825 89.644  1.00 46.97 ? 43  GLY C CA  1 
ATOM   7725  C  C   . GLY C 1 29  ? 31.983  -19.125 89.640  1.00 49.02 ? 43  GLY C C   1 
ATOM   7726  O  O   . GLY C 1 29  ? 31.564  -20.139 90.197  1.00 49.37 ? 43  GLY C O   1 
ATOM   7727  N  N   . SER C 1 30  ? 31.192  -18.251 89.011  1.00 50.38 ? 44  SER C N   1 
ATOM   7728  C  CA  . SER C 1 30  ? 29.728  -18.390 88.980  1.00 51.54 ? 44  SER C CA  1 
ATOM   7729  C  C   . SER C 1 30  ? 29.291  -19.696 88.307  1.00 51.27 ? 44  SER C C   1 
ATOM   7730  O  O   . SER C 1 30  ? 30.076  -20.302 87.579  1.00 49.79 ? 44  SER C O   1 
ATOM   7731  C  CB  . SER C 1 30  ? 29.080  -17.174 88.292  1.00 48.40 ? 44  SER C CB  1 
ATOM   7732  O  OG  . SER C 1 30  ? 29.401  -17.094 86.910  1.00 39.12 ? 44  SER C OG  1 
ATOM   7733  N  N   . PRO C 1 31  ? 28.041  -20.144 88.554  1.00 49.00 ? 45  PRO C N   1 
ATOM   7734  C  CA  . PRO C 1 31  ? 27.604  -21.387 87.901  1.00 46.40 ? 45  PRO C CA  1 
ATOM   7735  C  C   . PRO C 1 31  ? 27.284  -21.187 86.417  1.00 45.92 ? 45  PRO C C   1 
ATOM   7736  O  O   . PRO C 1 31  ? 27.490  -22.094 85.609  1.00 43.47 ? 45  PRO C O   1 
ATOM   7737  C  CB  . PRO C 1 31  ? 26.320  -21.766 88.661  1.00 46.33 ? 45  PRO C CB  1 
ATOM   7738  C  CG  . PRO C 1 31  ? 26.290  -20.898 89.881  1.00 48.44 ? 45  PRO C CG  1 
ATOM   7739  C  CD  . PRO C 1 31  ? 27.027  -19.642 89.497  1.00 48.87 ? 45  PRO C CD  1 
ATOM   7740  N  N   . GLU C 1 32  ? 26.769  -20.014 86.060  1.00 42.68 ? 46  GLU C N   1 
ATOM   7741  C  CA  . GLU C 1 32  ? 26.485  -19.741 84.658  1.00 39.15 ? 46  GLU C CA  1 
ATOM   7742  C  C   . GLU C 1 32  ? 27.791  -19.736 83.867  1.00 36.69 ? 46  GLU C C   1 
ATOM   7743  O  O   . GLU C 1 32  ? 27.835  -20.176 82.720  1.00 36.16 ? 46  GLU C O   1 
ATOM   7744  C  CB  . GLU C 1 32  ? 25.699  -18.434 84.476  1.00 37.67 ? 46  GLU C CB  1 
ATOM   7745  C  CG  . GLU C 1 32  ? 26.413  -17.163 84.914  1.00 42.35 ? 46  GLU C CG  1 
ATOM   7746  C  CD  . GLU C 1 32  ? 26.113  -16.769 86.349  1.00 45.21 ? 46  GLU C CD  1 
ATOM   7747  O  OE1 . GLU C 1 32  ? 26.277  -15.572 86.680  1.00 44.80 ? 46  GLU C OE1 1 
ATOM   7748  O  OE2 . GLU C 1 32  ? 25.715  -17.659 87.133  1.00 43.14 ? 46  GLU C OE2 1 
ATOM   7749  N  N   . ARG C 1 33  ? 28.861  -19.264 84.497  1.00 39.35 ? 47  ARG C N   1 
ATOM   7750  C  CA  . ARG C 1 33  ? 30.175  -19.261 83.865  1.00 42.31 ? 47  ARG C CA  1 
ATOM   7751  C  C   . ARG C 1 33  ? 30.683  -20.682 83.593  1.00 39.23 ? 47  ARG C C   1 
ATOM   7752  O  O   . ARG C 1 33  ? 31.164  -20.981 82.494  1.00 31.02 ? 47  ARG C O   1 
ATOM   7753  C  CB  . ARG C 1 33  ? 31.168  -18.495 84.725  1.00 42.24 ? 47  ARG C CB  1 
ATOM   7754  C  CG  . ARG C 1 33  ? 32.513  -18.295 84.094  1.00 43.10 ? 47  ARG C CG  1 
ATOM   7755  C  CD  . ARG C 1 33  ? 32.927  -16.846 84.247  1.00 44.89 ? 47  ARG C CD  1 
ATOM   7756  N  NE  . ARG C 1 33  ? 34.371  -16.703 84.247  1.00 43.28 ? 47  ARG C NE  1 
ATOM   7757  C  CZ  . ARG C 1 33  ? 35.005  -15.540 84.160  1.00 47.77 ? 47  ARG C CZ  1 
ATOM   7758  N  NH1 . ARG C 1 33  ? 34.317  -14.406 84.055  1.00 49.39 ? 47  ARG C NH1 1 
ATOM   7759  N  NH2 . ARG C 1 33  ? 36.331  -15.514 84.180  1.00 42.96 ? 47  ARG C NH2 1 
ATOM   7760  N  N   . ASP C 1 34  ? 30.560  -21.555 84.587  1.00 37.67 ? 48  ASP C N   1 
ATOM   7761  C  CA  . ASP C 1 34  ? 30.949  -22.946 84.402  1.00 47.91 ? 48  ASP C CA  1 
ATOM   7762  C  C   . ASP C 1 34  ? 30.124  -23.582 83.287  1.00 43.41 ? 48  ASP C C   1 
ATOM   7763  O  O   . ASP C 1 34  ? 30.675  -24.254 82.415  1.00 37.06 ? 48  ASP C O   1 
ATOM   7764  C  CB  . ASP C 1 34  ? 30.800  -23.754 85.699  1.00 57.01 ? 48  ASP C CB  1 
ATOM   7765  C  CG  . ASP C 1 34  ? 31.847  -23.394 86.745  1.00 62.07 ? 48  ASP C CG  1 
ATOM   7766  O  OD1 . ASP C 1 34  ? 32.845  -22.722 86.397  1.00 59.17 ? 48  ASP C OD1 1 
ATOM   7767  O  OD2 . ASP C 1 34  ? 31.674  -23.798 87.917  1.00 66.41 ? 48  ASP C OD2 1 
ATOM   7768  N  N   . ALA C 1 35  ? 28.810  -23.355 83.316  1.00 41.82 ? 49  ALA C N   1 
ATOM   7769  C  CA  . ALA C 1 35  ? 27.898  -23.925 82.317  1.00 34.78 ? 49  ALA C CA  1 
ATOM   7770  C  C   . ALA C 1 35  ? 28.214  -23.443 80.896  1.00 27.54 ? 49  ALA C C   1 
ATOM   7771  O  O   . ALA C 1 35  ? 28.251  -24.233 79.950  1.00 24.82 ? 49  ALA C O   1 
ATOM   7772  C  CB  . ALA C 1 35  ? 26.456  -23.614 82.674  1.00 40.33 ? 49  ALA C CB  1 
ATOM   7773  N  N   . LEU C 1 36  ? 28.421  -22.140 80.751  1.00 27.54 ? 50  LEU C N   1 
ATOM   7774  C  CA  . LEU C 1 36  ? 28.842  -21.586 79.476  1.00 27.15 ? 50  LEU C CA  1 
ATOM   7775  C  C   . LEU C 1 36  ? 30.168  -22.217 79.044  1.00 30.09 ? 50  LEU C C   1 
ATOM   7776  O  O   . LEU C 1 36  ? 30.338  -22.585 77.888  1.00 24.98 ? 50  LEU C O   1 
ATOM   7777  C  CB  . LEU C 1 36  ? 29.005  -20.083 79.581  1.00 23.84 ? 50  LEU C CB  1 
ATOM   7778  C  CG  . LEU C 1 36  ? 29.468  -19.396 78.301  1.00 25.79 ? 50  LEU C CG  1 
ATOM   7779  C  CD1 . LEU C 1 36  ? 28.556  -19.778 77.136  1.00 22.24 ? 50  LEU C CD1 1 
ATOM   7780  C  CD2 . LEU C 1 36  ? 29.439  -17.900 78.523  1.00 29.14 ? 50  LEU C CD2 1 
ATOM   7781  N  N   . GLN C 1 37  ? 31.102  -22.338 79.982  1.00 29.37 ? 51  GLN C N   1 
ATOM   7782  C  CA  . GLN C 1 37  ? 32.412  -22.907 79.677  1.00 35.74 ? 51  GLN C CA  1 
ATOM   7783  C  C   . GLN C 1 37  ? 32.274  -24.309 79.096  1.00 30.65 ? 51  GLN C C   1 
ATOM   7784  O  O   . GLN C 1 37  ? 32.976  -24.666 78.159  1.00 29.38 ? 51  GLN C O   1 
ATOM   7785  C  CB  . GLN C 1 37  ? 33.309  -22.922 80.918  1.00 38.92 ? 51  GLN C CB  1 
ATOM   7786  N  N   . LYS C 1 38  ? 31.346  -25.091 79.635  1.00 29.23 ? 52  LYS C N   1 
ATOM   7787  C  CA  . LYS C 1 38  ? 31.116  -26.443 79.142  1.00 31.35 ? 52  LYS C CA  1 
ATOM   7788  C  C   . LYS C 1 38  ? 30.518  -26.443 77.735  1.00 32.50 ? 52  LYS C C   1 
ATOM   7789  O  O   . LYS C 1 38  ? 30.911  -27.244 76.885  1.00 26.37 ? 52  LYS C O   1 
ATOM   7790  C  CB  . LYS C 1 38  ? 30.199  -27.216 80.098  1.00 34.75 ? 52  LYS C CB  1 
ATOM   7791  N  N   . ALA C 1 39  ? 29.555  -25.553 77.494  1.00 26.31 ? 53  ALA C N   1 
ATOM   7792  C  CA  . ALA C 1 39  ? 28.895  -25.494 76.187  1.00 24.37 ? 53  ALA C CA  1 
ATOM   7793  C  C   . ALA C 1 39  ? 29.848  -24.977 75.111  1.00 22.41 ? 53  ALA C C   1 
ATOM   7794  O  O   . ALA C 1 39  ? 29.742  -25.350 73.948  1.00 24.34 ? 53  ALA C O   1 
ATOM   7795  C  CB  . ALA C 1 39  ? 27.618  -24.631 76.257  1.00 28.58 ? 53  ALA C CB  1 
ATOM   7796  N  N   . LEU C 1 40  ? 30.782  -24.114 75.506  1.00 22.05 ? 54  LEU C N   1 
ATOM   7797  C  CA  . LEU C 1 40  ? 31.792  -23.609 74.578  1.00 23.59 ? 54  LEU C CA  1 
ATOM   7798  C  C   . LEU C 1 40  ? 32.774  -24.726 74.201  1.00 27.42 ? 54  LEU C C   1 
ATOM   7799  O  O   . LEU C 1 40  ? 33.167  -24.870 73.039  1.00 25.58 ? 54  LEU C O   1 
ATOM   7800  C  CB  . LEU C 1 40  ? 32.557  -22.434 75.199  1.00 24.41 ? 54  LEU C CB  1 
ATOM   7801  C  CG  . LEU C 1 40  ? 31.827  -21.085 75.307  1.00 25.00 ? 54  LEU C CG  1 
ATOM   7802  C  CD1 . LEU C 1 40  ? 32.657  -20.103 76.154  1.00 23.56 ? 54  LEU C CD1 1 
ATOM   7803  C  CD2 . LEU C 1 40  ? 31.548  -20.500 73.926  1.00 17.46 ? 54  LEU C CD2 1 
ATOM   7804  N  N   . LYS C 1 41  ? 33.166  -25.518 75.191  1.00 25.07 ? 55  LYS C N   1 
ATOM   7805  C  CA  . LYS C 1 41  ? 34.019  -26.676 74.927  1.00 30.24 ? 55  LYS C CA  1 
ATOM   7806  C  C   . LYS C 1 41  ? 33.323  -27.635 73.970  1.00 30.25 ? 55  LYS C C   1 
ATOM   7807  O  O   . LYS C 1 41  ? 33.950  -28.170 73.062  1.00 33.91 ? 55  LYS C O   1 
ATOM   7808  C  CB  . LYS C 1 41  ? 34.391  -27.395 76.230  1.00 35.52 ? 55  LYS C CB  1 
ATOM   7809  N  N   . ASP C 1 42  ? 32.017  -27.829 74.160  1.00 29.90 ? 56  ASP C N   1 
ATOM   7810  C  CA  . ASP C 1 42  ? 31.234  -28.706 73.288  1.00 36.00 ? 56  ASP C CA  1 
ATOM   7811  C  C   . ASP C 1 42  ? 31.248  -28.273 71.812  1.00 32.41 ? 56  ASP C C   1 
ATOM   7812  O  O   . ASP C 1 42  ? 30.974  -29.081 70.923  1.00 33.96 ? 56  ASP C O   1 
ATOM   7813  C  CB  . ASP C 1 42  ? 29.791  -28.812 73.791  1.00 42.07 ? 56  ASP C CB  1 
ATOM   7814  N  N   . LEU C 1 43  ? 31.580  -27.011 71.549  1.00 25.87 ? 57  LEU C N   1 
ATOM   7815  C  CA  . LEU C 1 43  ? 31.594  -26.504 70.176  1.00 25.10 ? 57  LEU C CA  1 
ATOM   7816  C  C   . LEU C 1 43  ? 32.976  -26.477 69.526  1.00 25.71 ? 57  LEU C C   1 
ATOM   7817  O  O   . LEU C 1 43  ? 33.077  -26.405 68.300  1.00 28.55 ? 57  LEU C O   1 
ATOM   7818  C  CB  . LEU C 1 43  ? 30.982  -25.090 70.110  1.00 23.08 ? 57  LEU C CB  1 
ATOM   7819  C  CG  . LEU C 1 43  ? 29.480  -25.013 70.387  1.00 20.57 ? 57  LEU C CG  1 
ATOM   7820  C  CD1 . LEU C 1 43  ? 28.983  -23.555 70.283  1.00 24.97 ? 57  LEU C CD1 1 
ATOM   7821  C  CD2 . LEU C 1 43  ? 28.711  -25.902 69.425  1.00 21.61 ? 57  LEU C CD2 1 
ATOM   7822  N  N   . LYS C 1 44  ? 34.032  -26.509 70.334  1.00 26.24 ? 58  LYS C N   1 
ATOM   7823  C  CA  . LYS C 1 44  ? 35.388  -26.328 69.812  1.00 31.53 ? 58  LYS C CA  1 
ATOM   7824  C  C   . LYS C 1 44  ? 35.696  -27.409 68.791  1.00 25.05 ? 58  LYS C C   1 
ATOM   7825  O  O   . LYS C 1 44  ? 35.507  -28.586 69.069  1.00 26.61 ? 58  LYS C O   1 
ATOM   7826  C  CB  . LYS C 1 44  ? 36.429  -26.356 70.940  1.00 40.37 ? 58  LYS C CB  1 
ATOM   7827  N  N   . GLY C 1 45  ? 36.131  -26.999 67.600  1.00 25.02 ? 59  GLY C N   1 
ATOM   7828  C  CA  . GLY C 1 45  ? 36.434  -27.924 66.521  1.00 27.98 ? 59  GLY C CA  1 
ATOM   7829  C  C   . GLY C 1 45  ? 35.240  -28.623 65.874  1.00 28.49 ? 59  GLY C C   1 
ATOM   7830  O  O   . GLY C 1 45  ? 35.420  -29.458 64.987  1.00 29.12 ? 59  GLY C O   1 
ATOM   7831  N  N   . ARG C 1 46  ? 34.018  -28.298 66.288  1.00 19.83 ? 60  ARG C N   1 
ATOM   7832  C  CA  . ARG C 1 46  ? 32.884  -29.057 65.761  1.00 19.96 ? 60  ARG C CA  1 
ATOM   7833  C  C   . ARG C 1 46  ? 31.976  -28.295 64.800  1.00 20.50 ? 60  ARG C C   1 
ATOM   7834  O  O   . ARG C 1 46  ? 31.824  -27.081 64.903  1.00 22.03 ? 60  ARG C O   1 
ATOM   7835  C  CB  . ARG C 1 46  ? 32.074  -29.672 66.898  1.00 27.71 ? 60  ARG C CB  1 
ATOM   7836  C  CG  . ARG C 1 46  ? 32.901  -30.666 67.714  1.00 37.12 ? 60  ARG C CG  1 
ATOM   7837  C  CD  . ARG C 1 46  ? 32.157  -31.107 68.933  1.00 43.06 ? 60  ARG C CD  1 
ATOM   7838  N  NE  . ARG C 1 46  ? 31.209  -32.169 68.635  1.00 43.39 ? 60  ARG C NE  1 
ATOM   7839  C  CZ  . ARG C 1 46  ? 30.229  -32.532 69.453  1.00 46.97 ? 60  ARG C CZ  1 
ATOM   7840  N  NH1 . ARG C 1 46  ? 29.427  -33.532 69.120  1.00 41.68 ? 60  ARG C NH1 1 
ATOM   7841  N  NH2 . ARG C 1 46  ? 30.057  -31.894 70.606  1.00 46.96 ? 60  ARG C NH2 1 
ATOM   7842  N  N   . MET C 1 47  ? 31.371  -29.040 63.878  1.00 22.09 ? 61  MET C N   1 
ATOM   7843  C  CA  . MET C 1 47  ? 30.502  -28.474 62.852  1.00 25.73 ? 61  MET C CA  1 
ATOM   7844  C  C   . MET C 1 47  ? 29.165  -29.203 62.856  1.00 29.22 ? 61  MET C C   1 
ATOM   7845  O  O   . MET C 1 47  ? 29.130  -30.435 62.951  1.00 25.72 ? 61  MET C O   1 
ATOM   7846  C  CB  . MET C 1 47  ? 31.159  -28.648 61.485  1.00 27.49 ? 61  MET C CB  1 
ATOM   7847  C  CG  . MET C 1 47  ? 30.387  -28.016 60.334  1.00 30.57 ? 61  MET C CG  1 
ATOM   7848  S  SD  . MET C 1 47  ? 31.171  -28.357 58.741  1.00 28.21 ? 61  MET C SD  1 
ATOM   7849  C  CE  . MET C 1 47  ? 30.477  -29.973 58.393  1.00 29.22 ? 61  MET C CE  1 
ATOM   7850  N  N   . GLU C 1 48  ? 28.067  -28.454 62.757  1.00 21.94 ? 62  GLU C N   1 
ATOM   7851  C  CA  . GLU C 1 48  ? 26.760  -29.073 62.600  1.00 25.94 ? 62  GLU C CA  1 
ATOM   7852  C  C   . GLU C 1 48  ? 26.299  -28.921 61.153  1.00 22.51 ? 62  GLU C C   1 
ATOM   7853  O  O   . GLU C 1 48  ? 26.485  -27.869 60.534  1.00 24.25 ? 62  GLU C O   1 
ATOM   7854  C  CB  . GLU C 1 48  ? 25.728  -28.474 63.571  1.00 26.51 ? 62  GLU C CB  1 
ATOM   7855  C  CG  . GLU C 1 48  ? 24.337  -29.105 63.442  1.00 29.12 ? 62  GLU C CG  1 
ATOM   7856  C  CD  . GLU C 1 48  ? 23.295  -28.461 64.350  1.00 34.05 ? 62  GLU C CD  1 
ATOM   7857  O  OE1 . GLU C 1 48  ? 22.139  -28.953 64.393  1.00 32.05 ? 62  GLU C OE1 1 
ATOM   7858  O  OE2 . GLU C 1 48  ? 23.626  -27.456 65.013  1.00 25.68 ? 62  GLU C OE2 1 
ATOM   7859  N  N   . ALA C 1 49  ? 25.725  -29.990 60.612  1.00 24.61 ? 63  ALA C N   1 
ATOM   7860  C  CA  . ALA C 1 49  ? 25.163  -29.963 59.279  1.00 28.27 ? 63  ALA C CA  1 
ATOM   7861  C  C   . ALA C 1 49  ? 23.690  -29.585 59.423  1.00 28.50 ? 63  ALA C C   1 
ATOM   7862  O  O   . ALA C 1 49  ? 22.903  -30.332 60.012  1.00 27.12 ? 63  ALA C O   1 
ATOM   7863  C  CB  . ALA C 1 49  ? 25.324  -31.320 58.602  1.00 33.02 ? 63  ALA C CB  1 
ATOM   7864  N  N   . ILE C 1 50  ? 23.338  -28.412 58.904  1.00 22.15 ? 64  ILE C N   1 
ATOM   7865  C  CA  . ILE C 1 50  ? 22.003  -27.851 59.104  1.00 25.25 ? 64  ILE C CA  1 
ATOM   7866  C  C   . ILE C 1 50  ? 21.226  -27.840 57.801  1.00 27.68 ? 64  ILE C C   1 
ATOM   7867  O  O   . ILE C 1 50  ? 21.593  -27.144 56.855  1.00 22.27 ? 64  ILE C O   1 
ATOM   7868  C  CB  . ILE C 1 50  ? 22.086  -26.428 59.723  1.00 23.73 ? 64  ILE C CB  1 
ATOM   7869  C  CG1 . ILE C 1 50  ? 22.674  -26.520 61.140  1.00 22.37 ? 64  ILE C CG1 1 
ATOM   7870  C  CG2 . ILE C 1 50  ? 20.710  -25.766 59.777  1.00 22.99 ? 64  ILE C CG2 1 
ATOM   7871  C  CD1 . ILE C 1 50  ? 22.948  -25.158 61.783  1.00 21.54 ? 64  ILE C CD1 1 
ATOM   7872  N  N   . PRO C 1 51  ? 20.163  -28.652 57.736  1.00 23.66 ? 65  PRO C N   1 
ATOM   7873  C  CA  . PRO C 1 51  ? 19.401  -28.822 56.504  1.00 24.44 ? 65  PRO C CA  1 
ATOM   7874  C  C   . PRO C 1 51  ? 18.342  -27.731 56.415  1.00 26.63 ? 65  PRO C C   1 
ATOM   7875  O  O   . PRO C 1 51  ? 18.070  -27.090 57.426  1.00 30.10 ? 65  PRO C O   1 
ATOM   7876  C  CB  . PRO C 1 51  ? 18.713  -30.170 56.724  1.00 26.81 ? 65  PRO C CB  1 
ATOM   7877  C  CG  . PRO C 1 51  ? 18.440  -30.195 58.199  1.00 27.08 ? 65  PRO C CG  1 
ATOM   7878  C  CD  . PRO C 1 51  ? 19.615  -29.462 58.844  1.00 28.66 ? 65  PRO C CD  1 
ATOM   7879  N  N   . CYS C 1 52  ? 17.763  -27.521 55.238  1.00 21.02 ? 66  CYS C N   1 
ATOM   7880  C  CA  . CYS C 1 52  ? 16.507  -26.779 55.177  1.00 28.43 ? 66  CYS C CA  1 
ATOM   7881  C  C   . CYS C 1 52  ? 15.463  -27.658 55.853  1.00 30.09 ? 66  CYS C C   1 
ATOM   7882  O  O   . CYS C 1 52  ? 15.571  -28.884 55.820  1.00 27.95 ? 66  CYS C O   1 
ATOM   7883  C  CB  . CYS C 1 52  ? 16.096  -26.511 53.735  1.00 24.81 ? 66  CYS C CB  1 
ATOM   7884  S  SG  . CYS C 1 52  ? 17.141  -25.352 52.820  1.00 32.14 ? 66  CYS C SG  1 
ATOM   7885  N  N   . VAL C 1 53  ? 14.472  -27.045 56.491  1.00 30.79 ? 67  VAL C N   1 
ATOM   7886  C  CA  . VAL C 1 53  ? 13.370  -27.799 57.070  1.00 29.31 ? 67  VAL C CA  1 
ATOM   7887  C  C   . VAL C 1 53  ? 12.039  -27.293 56.515  1.00 34.40 ? 67  VAL C C   1 
ATOM   7888  O  O   . VAL C 1 53  ? 11.664  -26.122 56.703  1.00 27.68 ? 67  VAL C O   1 
ATOM   7889  C  CB  . VAL C 1 53  ? 13.333  -27.745 58.608  1.00 28.86 ? 67  VAL C CB  1 
ATOM   7890  C  CG1 . VAL C 1 53  ? 12.188  -28.607 59.128  1.00 24.82 ? 67  VAL C CG1 1 
ATOM   7891  C  CG2 . VAL C 1 53  ? 14.672  -28.204 59.233  1.00 26.42 ? 67  VAL C CG2 1 
ATOM   7892  N  N   . VAL C 1 54  ? 11.348  -28.180 55.805  1.00 32.08 ? 68  VAL C N   1 
ATOM   7893  C  CA  . VAL C 1 54  ? 10.004  -27.914 55.295  1.00 33.21 ? 68  VAL C CA  1 
ATOM   7894  C  C   . VAL C 1 54  ? 9.066   -28.917 55.949  1.00 33.67 ? 68  VAL C C   1 
ATOM   7895  O  O   . VAL C 1 54  ? 9.188   -30.128 55.722  1.00 36.59 ? 68  VAL C O   1 
ATOM   7896  C  CB  . VAL C 1 54  ? 9.952   -28.076 53.769  1.00 35.38 ? 68  VAL C CB  1 
ATOM   7897  C  CG1 . VAL C 1 54  ? 8.547   -27.779 53.235  1.00 33.26 ? 68  VAL C CG1 1 
ATOM   7898  C  CG2 . VAL C 1 54  ? 10.982  -27.181 53.111  1.00 29.13 ? 68  VAL C CG2 1 
ATOM   7899  N  N   . GLY C 1 55  ? 8.144   -28.427 56.773  1.00 25.85 ? 69  GLY C N   1 
ATOM   7900  C  CA  . GLY C 1 55  ? 7.359   -29.311 57.620  1.00 31.73 ? 69  GLY C CA  1 
ATOM   7901  C  C   . GLY C 1 55  ? 8.267   -30.023 58.608  1.00 35.76 ? 69  GLY C C   1 
ATOM   7902  O  O   . GLY C 1 55  ? 8.935   -29.377 59.407  1.00 29.94 ? 69  GLY C O   1 
ATOM   7903  N  N   . ASP C 1 56  ? 8.298   -31.355 58.551  1.00 35.54 ? 70  ASP C N   1 
ATOM   7904  C  CA  . ASP C 1 56  ? 9.243   -32.121 59.357  1.00 35.92 ? 70  ASP C CA  1 
ATOM   7905  C  C   . ASP C 1 56  ? 10.335  -32.742 58.481  1.00 33.86 ? 70  ASP C C   1 
ATOM   7906  O  O   . ASP C 1 56  ? 11.162  -33.517 58.961  1.00 36.49 ? 70  ASP C O   1 
ATOM   7907  C  CB  . ASP C 1 56  ? 8.531   -33.211 60.172  1.00 40.00 ? 70  ASP C CB  1 
ATOM   7908  C  CG  . ASP C 1 56  ? 7.763   -32.657 61.361  1.00 41.18 ? 70  ASP C CG  1 
ATOM   7909  O  OD1 . ASP C 1 56  ? 8.055   -31.527 61.799  1.00 40.82 ? 70  ASP C OD1 1 
ATOM   7910  O  OD2 . ASP C 1 56  ? 6.865   -33.358 61.874  1.00 40.83 ? 70  ASP C OD2 1 
ATOM   7911  N  N   . GLU C 1 57  ? 10.343  -32.401 57.198  1.00 32.99 ? 71  GLU C N   1 
ATOM   7912  C  CA  . GLU C 1 57  ? 11.321  -32.972 56.285  1.00 36.13 ? 71  GLU C CA  1 
ATOM   7913  C  C   . GLU C 1 57  ? 12.620  -32.183 56.309  1.00 41.67 ? 71  GLU C C   1 
ATOM   7914  O  O   . GLU C 1 57  ? 12.604  -30.971 56.085  1.00 32.63 ? 71  GLU C O   1 
ATOM   7915  C  CB  . GLU C 1 57  ? 10.762  -32.998 54.868  1.00 30.54 ? 71  GLU C CB  1 
ATOM   7916  N  N   . GLU C 1 58  ? 13.736  -32.858 56.601  1.00 37.22 ? 72  GLU C N   1 
ATOM   7917  C  CA  . GLU C 1 58  ? 15.059  -32.245 56.450  1.00 37.96 ? 72  GLU C CA  1 
ATOM   7918  C  C   . GLU C 1 58  ? 15.479  -32.367 54.983  1.00 38.37 ? 72  GLU C C   1 
ATOM   7919  O  O   . GLU C 1 58  ? 15.566  -33.474 54.458  1.00 40.74 ? 72  GLU C O   1 
ATOM   7920  C  CB  . GLU C 1 58  ? 16.096  -32.933 57.355  1.00 40.73 ? 72  GLU C CB  1 
ATOM   7921  C  CG  . GLU C 1 58  ? 15.753  -32.920 58.843  1.00 41.70 ? 72  GLU C CG  1 
ATOM   7922  C  CD  . GLU C 1 58  ? 16.885  -33.445 59.734  1.00 47.14 ? 72  GLU C CD  1 
ATOM   7923  O  OE1 . GLU C 1 58  ? 18.060  -33.464 59.294  1.00 45.47 ? 72  GLU C OE1 1 
ATOM   7924  O  OE2 . GLU C 1 58  ? 16.598  -33.829 60.887  1.00 47.51 ? 72  GLU C OE2 1 
ATOM   7925  N  N   . VAL C 1 59  ? 15.729  -31.238 54.321  1.00 30.70 ? 73  VAL C N   1 
ATOM   7926  C  CA  . VAL C 1 59  ? 16.004  -31.229 52.881  1.00 25.97 ? 73  VAL C CA  1 
ATOM   7927  C  C   . VAL C 1 59  ? 17.371  -30.642 52.546  1.00 33.47 ? 73  VAL C C   1 
ATOM   7928  O  O   . VAL C 1 59  ? 17.734  -29.566 53.034  1.00 31.24 ? 73  VAL C O   1 
ATOM   7929  C  CB  . VAL C 1 59  ? 14.941  -30.408 52.101  1.00 32.68 ? 73  VAL C CB  1 
ATOM   7930  C  CG1 . VAL C 1 59  ? 15.209  -30.467 50.602  1.00 35.58 ? 73  VAL C CG1 1 
ATOM   7931  C  CG2 . VAL C 1 59  ? 13.519  -30.875 52.428  1.00 32.73 ? 73  VAL C CG2 1 
ATOM   7932  N  N   . TRP C 1 60  ? 18.117  -31.339 51.693  1.00 29.76 ? 74  TRP C N   1 
ATOM   7933  C  CA  . TRP C 1 60  ? 19.424  -30.872 51.251  1.00 31.61 ? 74  TRP C CA  1 
ATOM   7934  C  C   . TRP C 1 60  ? 19.421  -30.545 49.765  1.00 40.12 ? 74  TRP C C   1 
ATOM   7935  O  O   . TRP C 1 60  ? 18.862  -31.289 48.966  1.00 45.06 ? 74  TRP C O   1 
ATOM   7936  C  CB  . TRP C 1 60  ? 20.503  -31.922 51.575  1.00 33.62 ? 74  TRP C CB  1 
ATOM   7937  C  CG  . TRP C 1 60  ? 20.855  -31.906 53.033  1.00 34.11 ? 74  TRP C CG  1 
ATOM   7938  C  CD1 . TRP C 1 60  ? 20.327  -32.691 54.017  1.00 34.00 ? 74  TRP C CD1 1 
ATOM   7939  C  CD2 . TRP C 1 60  ? 21.761  -31.003 53.682  1.00 33.57 ? 74  TRP C CD2 1 
ATOM   7940  N  NE1 . TRP C 1 60  ? 20.868  -32.346 55.235  1.00 32.94 ? 74  TRP C NE1 1 
ATOM   7941  C  CE2 . TRP C 1 60  ? 21.752  -31.312 55.053  1.00 30.00 ? 74  TRP C CE2 1 
ATOM   7942  C  CE3 . TRP C 1 60  ? 22.590  -29.972 53.231  1.00 33.56 ? 74  TRP C CE3 1 
ATOM   7943  C  CZ2 . TRP C 1 60  ? 22.526  -30.620 55.979  1.00 22.86 ? 74  TRP C CZ2 1 
ATOM   7944  C  CZ3 . TRP C 1 60  ? 23.373  -29.295 54.153  1.00 29.70 ? 74  TRP C CZ3 1 
ATOM   7945  C  CH2 . TRP C 1 60  ? 23.330  -29.619 55.505  1.00 26.37 ? 74  TRP C CH2 1 
ATOM   7946  N  N   . THR C 1 61  ? 20.030  -29.422 49.398  1.00 35.74 ? 75  THR C N   1 
ATOM   7947  C  CA  . THR C 1 61  ? 20.268  -29.108 47.986  1.00 35.89 ? 75  THR C CA  1 
ATOM   7948  C  C   . THR C 1 61  ? 21.762  -29.247 47.728  1.00 37.89 ? 75  THR C C   1 
ATOM   7949  O  O   . THR C 1 61  ? 22.534  -29.502 48.657  1.00 32.48 ? 75  THR C O   1 
ATOM   7950  C  CB  . THR C 1 61  ? 19.826  -27.672 47.608  1.00 33.55 ? 75  THR C CB  1 
ATOM   7951  O  OG1 . THR C 1 61  ? 20.736  -26.721 48.170  1.00 26.55 ? 75  THR C OG1 1 
ATOM   7952  C  CG2 . THR C 1 61  ? 18.419  -27.385 48.108  1.00 35.17 ? 75  THR C CG2 1 
ATOM   7953  N  N   . SER C 1 62  ? 22.165  -29.069 46.476  1.00 36.91 ? 76  SER C N   1 
ATOM   7954  C  CA  . SER C 1 62  ? 23.571  -29.175 46.096  1.00 38.80 ? 76  SER C CA  1 
ATOM   7955  C  C   . SER C 1 62  ? 24.319  -27.887 46.373  1.00 33.90 ? 76  SER C C   1 
ATOM   7956  O  O   . SER C 1 62  ? 25.552  -27.839 46.282  1.00 33.78 ? 76  SER C O   1 
ATOM   7957  C  CB  . SER C 1 62  ? 23.694  -29.510 44.609  1.00 49.24 ? 76  SER C CB  1 
ATOM   7958  O  OG  . SER C 1 62  ? 23.264  -28.418 43.811  1.00 55.78 ? 76  SER C OG  1 
ATOM   7959  N  N   . ASP C 1 63  ? 23.567  -26.840 46.709  1.00 28.46 ? 77  ASP C N   1 
ATOM   7960  C  CA  . ASP C 1 63  ? 24.147  -25.531 46.954  1.00 32.51 ? 77  ASP C CA  1 
ATOM   7961  C  C   . ASP C 1 63  ? 24.587  -25.416 48.407  1.00 32.64 ? 77  ASP C C   1 
ATOM   7962  O  O   . ASP C 1 63  ? 23.951  -24.739 49.220  1.00 32.77 ? 77  ASP C O   1 
ATOM   7963  C  CB  . ASP C 1 63  ? 23.149  -24.426 46.599  1.00 25.56 ? 77  ASP C CB  1 
ATOM   7964  C  CG  . ASP C 1 63  ? 23.829  -23.124 46.298  1.00 30.46 ? 77  ASP C CG  1 
ATOM   7965  O  OD1 . ASP C 1 63  ? 25.037  -23.025 46.594  1.00 31.88 ? 77  ASP C OD1 1 
ATOM   7966  O  OD2 . ASP C 1 63  ? 23.162  -22.199 45.777  1.00 35.14 ? 77  ASP C OD2 1 
ATOM   7967  N  N   . VAL C 1 64  ? 25.686  -26.091 48.717  1.00 27.98 ? 78  VAL C N   1 
ATOM   7968  C  CA  . VAL C 1 64  ? 26.197  -26.189 50.074  1.00 22.81 ? 78  VAL C CA  1 
ATOM   7969  C  C   . VAL C 1 64  ? 26.929  -24.914 50.492  1.00 25.80 ? 78  VAL C C   1 
ATOM   7970  O  O   . VAL C 1 64  ? 27.653  -24.306 49.701  1.00 25.06 ? 78  VAL C O   1 
ATOM   7971  C  CB  . VAL C 1 64  ? 27.094  -27.455 50.230  1.00 28.75 ? 78  VAL C CB  1 
ATOM   7972  C  CG1 . VAL C 1 64  ? 27.585  -27.600 51.658  1.00 35.38 ? 78  VAL C CG1 1 
ATOM   7973  C  CG2 . VAL C 1 64  ? 26.310  -28.700 49.832  1.00 28.18 ? 78  VAL C CG2 1 
ATOM   7974  N  N   . GLN C 1 65  ? 26.710  -24.489 51.732  1.00 25.39 ? 79  GLN C N   1 
ATOM   7975  C  CA  . GLN C 1 65  ? 27.351  -23.279 52.237  1.00 27.95 ? 79  GLN C CA  1 
ATOM   7976  C  C   . GLN C 1 65  ? 27.878  -23.551 53.630  1.00 27.25 ? 79  GLN C C   1 
ATOM   7977  O  O   . GLN C 1 65  ? 27.410  -24.470 54.306  1.00 29.66 ? 79  GLN C O   1 
ATOM   7978  C  CB  . GLN C 1 65  ? 26.342  -22.117 52.310  1.00 25.84 ? 79  GLN C CB  1 
ATOM   7979  C  CG  . GLN C 1 65  ? 25.586  -21.854 51.036  1.00 22.61 ? 79  GLN C CG  1 
ATOM   7980  C  CD  . GLN C 1 65  ? 26.468  -21.260 49.960  1.00 30.85 ? 79  GLN C CD  1 
ATOM   7981  O  OE1 . GLN C 1 65  ? 27.409  -20.524 50.255  1.00 30.80 ? 79  GLN C OE1 1 
ATOM   7982  N  NE2 . GLN C 1 65  ? 26.181  -21.589 48.701  1.00 30.97 ? 79  GLN C NE2 1 
ATOM   7983  N  N   . TYR C 1 66  ? 28.825  -22.734 54.079  1.00 29.54 ? 80  TYR C N   1 
ATOM   7984  C  CA  . TYR C 1 66  ? 29.356  -22.899 55.426  1.00 28.70 ? 80  TYR C CA  1 
ATOM   7985  C  C   . TYR C 1 66  ? 29.315  -21.606 56.231  1.00 27.27 ? 80  TYR C C   1 
ATOM   7986  O  O   . TYR C 1 66  ? 29.444  -20.515 55.688  1.00 29.31 ? 80  TYR C O   1 
ATOM   7987  C  CB  . TYR C 1 66  ? 30.797  -23.410 55.380  1.00 21.87 ? 80  TYR C CB  1 
ATOM   7988  C  CG  . TYR C 1 66  ? 30.970  -24.780 54.764  1.00 25.09 ? 80  TYR C CG  1 
ATOM   7989  C  CD1 . TYR C 1 66  ? 31.204  -24.924 53.401  1.00 30.33 ? 80  TYR C CD1 1 
ATOM   7990  C  CD2 . TYR C 1 66  ? 30.929  -25.926 55.551  1.00 21.88 ? 80  TYR C CD2 1 
ATOM   7991  C  CE1 . TYR C 1 66  ? 31.370  -26.178 52.836  1.00 30.50 ? 80  TYR C CE1 1 
ATOM   7992  C  CE2 . TYR C 1 66  ? 31.091  -27.182 54.993  1.00 28.41 ? 80  TYR C CE2 1 
ATOM   7993  C  CZ  . TYR C 1 66  ? 31.309  -27.301 53.635  1.00 32.50 ? 80  TYR C CZ  1 
ATOM   7994  O  OH  . TYR C 1 66  ? 31.468  -28.558 53.078  1.00 39.02 ? 80  TYR C OH  1 
ATOM   7995  N  N   . GLN C 1 67  ? 29.152  -21.753 57.540  1.00 23.19 ? 81  GLN C N   1 
ATOM   7996  C  CA  . GLN C 1 67  ? 29.343  -20.647 58.457  1.00 20.48 ? 81  GLN C CA  1 
ATOM   7997  C  C   . GLN C 1 67  ? 30.656  -20.883 59.205  1.00 24.02 ? 81  GLN C C   1 
ATOM   7998  O  O   . GLN C 1 67  ? 30.900  -21.983 59.682  1.00 23.76 ? 81  GLN C O   1 
ATOM   7999  C  CB  . GLN C 1 67  ? 28.192  -20.604 59.449  1.00 23.15 ? 81  GLN C CB  1 
ATOM   8000  C  CG  . GLN C 1 67  ? 28.316  -19.513 60.514  1.00 19.55 ? 81  GLN C CG  1 
ATOM   8001  C  CD  . GLN C 1 67  ? 27.312  -19.718 61.623  1.00 22.56 ? 81  GLN C CD  1 
ATOM   8002  O  OE1 . GLN C 1 67  ? 26.502  -20.653 61.576  1.00 21.38 ? 81  GLN C OE1 1 
ATOM   8003  N  NE2 . GLN C 1 67  ? 27.343  -18.841 62.623  1.00 19.57 ? 81  GLN C NE2 1 
ATOM   8004  N  N   . VAL C 1 68  ? 31.513  -19.869 59.292  1.00 19.75 ? 82  VAL C N   1 
ATOM   8005  C  CA  . VAL C 1 68  ? 32.757  -20.038 60.049  1.00 23.96 ? 82  VAL C CA  1 
ATOM   8006  C  C   . VAL C 1 68  ? 32.769  -19.153 61.292  1.00 24.06 ? 82  VAL C C   1 
ATOM   8007  O  O   . VAL C 1 68  ? 32.033  -18.151 61.370  1.00 24.29 ? 82  VAL C O   1 
ATOM   8008  C  CB  . VAL C 1 68  ? 34.023  -19.739 59.202  1.00 23.11 ? 82  VAL C CB  1 
ATOM   8009  C  CG1 . VAL C 1 68  ? 34.014  -20.564 57.926  1.00 27.31 ? 82  VAL C CG1 1 
ATOM   8010  C  CG2 . VAL C 1 68  ? 34.131  -18.248 58.899  1.00 21.67 ? 82  VAL C CG2 1 
ATOM   8011  N  N   . SER C 1 69  ? 33.598  -19.530 62.260  1.00 18.88 ? 83  SER C N   1 
ATOM   8012  C  CA  . SER C 1 69  ? 33.777  -18.752 63.477  1.00 18.07 ? 83  SER C CA  1 
ATOM   8013  C  C   . SER C 1 69  ? 34.565  -17.504 63.130  1.00 21.44 ? 83  SER C C   1 
ATOM   8014  O  O   . SER C 1 69  ? 35.676  -17.608 62.612  1.00 22.69 ? 83  SER C O   1 
ATOM   8015  C  CB  . SER C 1 69  ? 34.557  -19.566 64.518  1.00 18.66 ? 83  SER C CB  1 
ATOM   8016  O  OG  . SER C 1 69  ? 34.676  -18.863 65.740  1.00 22.07 ? 83  SER C OG  1 
ATOM   8017  N  N   . PRO C 1 70  ? 33.998  -16.320 63.410  1.00 21.12 ? 84  PRO C N   1 
ATOM   8018  C  CA  . PRO C 1 70  ? 34.661  -15.074 62.993  1.00 20.29 ? 84  PRO C CA  1 
ATOM   8019  C  C   . PRO C 1 70  ? 36.099  -14.927 63.514  1.00 18.57 ? 84  PRO C C   1 
ATOM   8020  O  O   . PRO C 1 70  ? 36.966  -14.458 62.777  1.00 20.57 ? 84  PRO C O   1 
ATOM   8021  C  CB  . PRO C 1 70  ? 33.751  -13.985 63.576  1.00 21.92 ? 84  PRO C CB  1 
ATOM   8022  C  CG  . PRO C 1 70  ? 32.402  -14.630 63.624  1.00 22.35 ? 84  PRO C CG  1 
ATOM   8023  C  CD  . PRO C 1 70  ? 32.656  -16.073 63.974  1.00 21.48 ? 84  PRO C CD  1 
ATOM   8024  N  N   . PHE C 1 71  ? 36.350  -15.344 64.747  1.00 20.49 ? 85  PHE C N   1 
ATOM   8025  C  CA  . PHE C 1 71  ? 37.690  -15.199 65.337  1.00 23.58 ? 85  PHE C CA  1 
ATOM   8026  C  C   . PHE C 1 71  ? 38.609  -16.373 64.996  1.00 23.47 ? 85  PHE C C   1 
ATOM   8027  O  O   . PHE C 1 71  ? 39.767  -16.416 65.413  1.00 21.31 ? 85  PHE C O   1 
ATOM   8028  C  CB  . PHE C 1 71  ? 37.620  -15.015 66.858  1.00 20.89 ? 85  PHE C CB  1 
ATOM   8029  C  CG  . PHE C 1 71  ? 36.756  -16.034 67.567  1.00 21.70 ? 85  PHE C CG  1 
ATOM   8030  C  CD1 . PHE C 1 71  ? 37.314  -17.191 68.099  1.00 26.04 ? 85  PHE C CD1 1 
ATOM   8031  C  CD2 . PHE C 1 71  ? 35.392  -15.815 67.730  1.00 19.82 ? 85  PHE C CD2 1 
ATOM   8032  C  CE1 . PHE C 1 71  ? 36.521  -18.134 68.763  1.00 29.43 ? 85  PHE C CE1 1 
ATOM   8033  C  CE2 . PHE C 1 71  ? 34.588  -16.734 68.387  1.00 20.16 ? 85  PHE C CE2 1 
ATOM   8034  C  CZ  . PHE C 1 71  ? 35.156  -17.912 68.906  1.00 23.54 ? 85  PHE C CZ  1 
ATOM   8035  N  N   . ASN C 1 72  ? 38.095  -17.324 64.233  1.00 20.89 ? 86  ASN C N   1 
ATOM   8036  C  CA  . ASN C 1 72  ? 38.921  -18.458 63.802  1.00 26.44 ? 86  ASN C CA  1 
ATOM   8037  C  C   . ASN C 1 72  ? 38.254  -19.097 62.608  1.00 23.41 ? 86  ASN C C   1 
ATOM   8038  O  O   . ASN C 1 72  ? 37.530  -20.072 62.751  1.00 23.55 ? 86  ASN C O   1 
ATOM   8039  C  CB  . ASN C 1 72  ? 39.080  -19.467 64.939  1.00 26.71 ? 86  ASN C CB  1 
ATOM   8040  C  CG  . ASN C 1 72  ? 39.924  -20.671 64.543  1.00 34.88 ? 86  ASN C CG  1 
ATOM   8041  O  OD1 . ASN C 1 72  ? 40.634  -20.649 63.534  1.00 36.09 ? 86  ASN C OD1 1 
ATOM   8042  N  ND2 . ASN C 1 72  ? 39.841  -21.729 65.338  1.00 29.89 ? 86  ASN C ND2 1 
ATOM   8043  N  N   . HIS C 1 73  ? 38.473  -18.514 61.435  1.00 24.05 ? 87  HIS C N   1 
ATOM   8044  C  CA  . HIS C 1 73  ? 37.674  -18.859 60.262  1.00 23.73 ? 87  HIS C CA  1 
ATOM   8045  C  C   . HIS C 1 73  ? 38.041  -20.215 59.678  1.00 26.73 ? 87  HIS C C   1 
ATOM   8046  O  O   . HIS C 1 73  ? 37.389  -20.695 58.750  1.00 28.94 ? 87  HIS C O   1 
ATOM   8047  C  CB  . HIS C 1 73  ? 37.732  -17.751 59.198  1.00 24.83 ? 87  HIS C CB  1 
ATOM   8048  C  CG  . HIS C 1 73  ? 39.111  -17.246 58.921  1.00 26.61 ? 87  HIS C CG  1 
ATOM   8049  N  ND1 . HIS C 1 73  ? 40.144  -18.076 58.544  1.00 30.69 ? 87  HIS C ND1 1 
ATOM   8050  C  CD2 . HIS C 1 73  ? 39.633  -15.994 58.970  1.00 32.51 ? 87  HIS C CD2 1 
ATOM   8051  C  CE1 . HIS C 1 73  ? 41.244  -17.360 58.376  1.00 28.94 ? 87  HIS C CE1 1 
ATOM   8052  N  NE2 . HIS C 1 73  ? 40.963  -16.095 58.633  1.00 28.81 ? 87  HIS C NE2 1 
ATOM   8053  N  N   . GLY C 1 74  ? 39.072  -20.834 60.240  1.00 26.20 ? 88  GLY C N   1 
ATOM   8054  C  CA  . GLY C 1 74  ? 39.380  -22.221 59.945  1.00 27.22 ? 88  GLY C CA  1 
ATOM   8055  C  C   . GLY C 1 74  ? 38.350  -23.153 60.566  1.00 27.71 ? 88  GLY C C   1 
ATOM   8056  O  O   . GLY C 1 74  ? 38.193  -24.297 60.138  1.00 26.57 ? 88  GLY C O   1 
ATOM   8057  N  N   . HIS C 1 75  ? 37.645  -22.656 61.580  1.00 23.42 ? 89  HIS C N   1 
ATOM   8058  C  CA  . HIS C 1 75  ? 36.616  -23.431 62.267  1.00 25.30 ? 89  HIS C CA  1 
ATOM   8059  C  C   . HIS C 1 75  ? 35.276  -23.241 61.568  1.00 25.01 ? 89  HIS C C   1 
ATOM   8060  O  O   . HIS C 1 75  ? 34.606  -22.215 61.738  1.00 28.32 ? 89  HIS C O   1 
ATOM   8061  C  CB  . HIS C 1 75  ? 36.528  -23.007 63.739  1.00 28.61 ? 89  HIS C CB  1 
ATOM   8062  C  CG  . HIS C 1 75  ? 35.473  -23.727 64.525  1.00 23.72 ? 89  HIS C CG  1 
ATOM   8063  N  ND1 . HIS C 1 75  ? 35.103  -23.337 65.797  1.00 19.51 ? 89  HIS C ND1 1 
ATOM   8064  C  CD2 . HIS C 1 75  ? 34.709  -24.803 64.227  1.00 26.82 ? 89  HIS C CD2 1 
ATOM   8065  C  CE1 . HIS C 1 75  ? 34.167  -24.148 66.250  1.00 24.10 ? 89  HIS C CE1 1 
ATOM   8066  N  NE2 . HIS C 1 75  ? 33.903  -25.045 65.315  1.00 25.79 ? 89  HIS C NE2 1 
ATOM   8067  N  N   . LYS C 1 76  ? 34.891  -24.226 60.767  1.00 23.15 ? 90  LYS C N   1 
ATOM   8068  C  CA  . LYS C 1 76  ? 33.567  -24.232 60.167  1.00 28.80 ? 90  LYS C CA  1 
ATOM   8069  C  C   . LYS C 1 76  ? 32.583  -24.719 61.237  1.00 28.97 ? 90  LYS C C   1 
ATOM   8070  O  O   . LYS C 1 76  ? 32.669  -25.865 61.693  1.00 24.44 ? 90  LYS C O   1 
ATOM   8071  C  CB  . LYS C 1 76  ? 33.538  -25.147 58.939  1.00 30.14 ? 90  LYS C CB  1 
ATOM   8072  C  CG  . LYS C 1 76  ? 34.043  -24.502 57.637  1.00 33.36 ? 90  LYS C CG  1 
ATOM   8073  C  CD  . LYS C 1 76  ? 35.462  -23.932 57.740  1.00 35.15 ? 90  LYS C CD  1 
ATOM   8074  N  N   . VAL C 1 77  ? 31.673  -23.842 61.660  1.00 25.43 ? 91  VAL C N   1 
ATOM   8075  C  CA  . VAL C 1 77  ? 30.755  -24.189 62.742  1.00 21.56 ? 91  VAL C CA  1 
ATOM   8076  C  C   . VAL C 1 77  ? 29.472  -24.788 62.212  1.00 17.37 ? 91  VAL C C   1 
ATOM   8077  O  O   . VAL C 1 77  ? 28.725  -25.422 62.954  1.00 22.75 ? 91  VAL C O   1 
ATOM   8078  C  CB  . VAL C 1 77  ? 30.382  -22.977 63.642  1.00 20.09 ? 91  VAL C CB  1 
ATOM   8079  C  CG1 . VAL C 1 77  ? 31.613  -22.257 64.108  1.00 24.22 ? 91  VAL C CG1 1 
ATOM   8080  C  CG2 . VAL C 1 77  ? 29.441  -22.021 62.896  1.00 20.02 ? 91  VAL C CG2 1 
ATOM   8081  N  N   . ALA C 1 78  ? 29.197  -24.578 60.931  1.00 17.90 ? 92  ALA C N   1 
ATOM   8082  C  CA  . ALA C 1 78  ? 27.964  -25.099 60.375  1.00 15.98 ? 92  ALA C CA  1 
ATOM   8083  C  C   . ALA C 1 78  ? 28.097  -25.342 58.896  1.00 24.87 ? 92  ALA C C   1 
ATOM   8084  O  O   . ALA C 1 78  ? 28.743  -24.575 58.188  1.00 25.09 ? 92  ALA C O   1 
ATOM   8085  C  CB  . ALA C 1 78  ? 26.785  -24.130 60.652  1.00 19.84 ? 92  ALA C CB  1 
ATOM   8086  N  N   . LYS C 1 79  ? 27.486  -26.433 58.442  1.00 24.13 ? 93  LYS C N   1 
ATOM   8087  C  CA  . LYS C 1 79  ? 27.334  -26.692 57.033  1.00 21.64 ? 93  LYS C CA  1 
ATOM   8088  C  C   . LYS C 1 79  ? 25.842  -26.632 56.777  1.00 26.54 ? 93  LYS C C   1 
ATOM   8089  O  O   . LYS C 1 79  ? 25.053  -27.261 57.499  1.00 29.09 ? 93  LYS C O   1 
ATOM   8090  C  CB  . LYS C 1 79  ? 27.851  -28.092 56.665  1.00 25.13 ? 93  LYS C CB  1 
ATOM   8091  C  CG  . LYS C 1 79  ? 27.707  -28.419 55.168  1.00 23.65 ? 93  LYS C CG  1 
ATOM   8092  C  CD  . LYS C 1 79  ? 28.199  -29.838 54.788  1.00 34.55 ? 93  LYS C CD  1 
ATOM   8093  C  CE  . LYS C 1 79  ? 27.268  -30.933 55.327  1.00 35.18 ? 93  LYS C CE  1 
ATOM   8094  N  NZ  . LYS C 1 79  ? 27.666  -32.357 54.956  1.00 32.80 ? 93  LYS C NZ  1 
ATOM   8095  N  N   . PHE C 1 80  ? 25.456  -25.862 55.767  1.00 23.57 ? 94  PHE C N   1 
ATOM   8096  C  CA  . PHE C 1 80  ? 24.051  -25.751 55.401  1.00 26.37 ? 94  PHE C CA  1 
ATOM   8097  C  C   . PHE C 1 80  ? 23.940  -25.629 53.890  1.00 27.87 ? 94  PHE C C   1 
ATOM   8098  O  O   . PHE C 1 80  ? 24.928  -25.808 53.161  1.00 26.06 ? 94  PHE C O   1 
ATOM   8099  C  CB  . PHE C 1 80  ? 23.366  -24.587 56.152  1.00 21.44 ? 94  PHE C CB  1 
ATOM   8100  C  CG  . PHE C 1 80  ? 23.849  -23.216 55.754  1.00 21.18 ? 94  PHE C CG  1 
ATOM   8101  C  CD1 . PHE C 1 80  ? 23.134  -22.456 54.837  1.00 22.72 ? 94  PHE C CD1 1 
ATOM   8102  C  CD2 . PHE C 1 80  ? 24.989  -22.669 56.319  1.00 21.51 ? 94  PHE C CD2 1 
ATOM   8103  C  CE1 . PHE C 1 80  ? 23.566  -21.186 54.477  1.00 22.56 ? 94  PHE C CE1 1 
ATOM   8104  C  CE2 . PHE C 1 80  ? 25.433  -21.407 55.961  1.00 26.01 ? 94  PHE C CE2 1 
ATOM   8105  C  CZ  . PHE C 1 80  ? 24.711  -20.656 55.032  1.00 23.01 ? 94  PHE C CZ  1 
ATOM   8106  N  N   . CYS C 1 81  ? 22.742  -25.343 53.405  1.00 27.39 ? 95  CYS C N   1 
ATOM   8107  C  CA  . CYS C 1 81  ? 22.548  -25.241 51.969  1.00 29.84 ? 95  CYS C CA  1 
ATOM   8108  C  C   . CYS C 1 81  ? 21.471  -24.217 51.675  1.00 24.89 ? 95  CYS C C   1 
ATOM   8109  O  O   . CYS C 1 81  ? 20.642  -23.923 52.528  1.00 25.16 ? 95  CYS C O   1 
ATOM   8110  C  CB  . CYS C 1 81  ? 22.164  -26.590 51.358  1.00 33.56 ? 95  CYS C CB  1 
ATOM   8111  S  SG  . CYS C 1 81  ? 20.496  -27.187 51.802  1.00 34.05 ? 95  CYS C SG  1 
ATOM   8112  N  N   . TYR C 1 82  ? 21.512  -23.687 50.463  1.00 21.27 ? 96  TYR C N   1 
ATOM   8113  C  CA  . TYR C 1 82  ? 20.524  -22.712 49.994  1.00 26.95 ? 96  TYR C CA  1 
ATOM   8114  C  C   . TYR C 1 82  ? 19.326  -23.382 49.314  1.00 31.24 ? 96  TYR C C   1 
ATOM   8115  O  O   . TYR C 1 82  ? 19.489  -24.122 48.336  1.00 28.55 ? 96  TYR C O   1 
ATOM   8116  C  CB  . TYR C 1 82  ? 21.179  -21.787 48.979  1.00 22.49 ? 96  TYR C CB  1 
ATOM   8117  C  CG  . TYR C 1 82  ? 22.008  -20.640 49.539  1.00 25.35 ? 96  TYR C CG  1 
ATOM   8118  C  CD1 . TYR C 1 82  ? 21.944  -20.271 50.883  1.00 21.54 ? 96  TYR C CD1 1 
ATOM   8119  C  CD2 . TYR C 1 82  ? 22.845  -19.924 48.708  1.00 24.48 ? 96  TYR C CD2 1 
ATOM   8120  C  CE1 . TYR C 1 82  ? 22.685  -19.204 51.363  1.00 22.27 ? 96  TYR C CE1 1 
ATOM   8121  C  CE2 . TYR C 1 82  ? 23.593  -18.876 49.175  1.00 27.79 ? 96  TYR C CE2 1 
ATOM   8122  C  CZ  . TYR C 1 82  ? 23.514  -18.519 50.496  1.00 26.85 ? 96  TYR C CZ  1 
ATOM   8123  O  OH  . TYR C 1 82  ? 24.281  -17.470 50.923  1.00 27.96 ? 96  TYR C OH  1 
ATOM   8124  N  N   . ALA C 1 83  ? 18.121  -23.115 49.805  1.00 29.39 ? 97  ALA C N   1 
ATOM   8125  C  CA  . ALA C 1 83  ? 16.925  -23.612 49.128  1.00 31.88 ? 97  ALA C CA  1 
ATOM   8126  C  C   . ALA C 1 83  ? 16.875  -23.061 47.704  1.00 34.20 ? 97  ALA C C   1 
ATOM   8127  O  O   . ALA C 1 83  ? 17.245  -21.906 47.472  1.00 37.72 ? 97  ALA C O   1 
ATOM   8128  C  CB  . ALA C 1 83  ? 15.679  -23.223 49.890  1.00 24.09 ? 97  ALA C CB  1 
ATOM   8129  N  N   . ASP C 1 84  ? 16.453  -23.895 46.752  1.00 30.78 ? 98  ASP C N   1 
ATOM   8130  C  CA  . ASP C 1 84  ? 16.252  -23.442 45.374  1.00 29.65 ? 98  ASP C CA  1 
ATOM   8131  C  C   . ASP C 1 84  ? 14.802  -22.991 45.179  1.00 31.67 ? 98  ASP C C   1 
ATOM   8132  O  O   . ASP C 1 84  ? 13.982  -23.160 46.080  1.00 31.35 ? 98  ASP C O   1 
ATOM   8133  C  CB  . ASP C 1 84  ? 16.611  -24.544 44.355  1.00 36.83 ? 98  ASP C CB  1 
ATOM   8134  C  CG  . ASP C 1 84  ? 15.863  -25.852 44.600  1.00 42.86 ? 98  ASP C CG  1 
ATOM   8135  O  OD1 . ASP C 1 84  ? 14.919  -25.876 45.415  1.00 41.69 ? 98  ASP C OD1 1 
ATOM   8136  O  OD2 . ASP C 1 84  ? 16.220  -26.871 43.967  1.00 53.08 ? 98  ASP C OD2 1 
ATOM   8137  N  N   . LYS C 1 85  ? 14.488  -22.447 44.001  1.00 33.04 ? 99  LYS C N   1 
ATOM   8138  C  CA  . LYS C 1 85  ? 13.150  -21.905 43.742  1.00 38.48 ? 99  LYS C CA  1 
ATOM   8139  C  C   . LYS C 1 85  ? 12.086  -22.974 43.963  1.00 36.59 ? 99  LYS C C   1 
ATOM   8140  O  O   . LYS C 1 85  ? 11.030  -22.708 44.538  1.00 32.73 ? 99  LYS C O   1 
ATOM   8141  C  CB  . LYS C 1 85  ? 13.045  -21.320 42.324  1.00 42.31 ? 99  LYS C CB  1 
ATOM   8142  N  N   . SER C 1 86  ? 12.389  -24.195 43.528  1.00 38.87 ? 100 SER C N   1 
ATOM   8143  C  CA  . SER C 1 86  ? 11.457  -25.311 43.646  1.00 35.53 ? 100 SER C CA  1 
ATOM   8144  C  C   . SER C 1 86  ? 11.142  -25.625 45.108  1.00 29.37 ? 100 SER C C   1 
ATOM   8145  O  O   . SER C 1 86  ? 9.990   -25.816 45.479  1.00 34.81 ? 100 SER C O   1 
ATOM   8146  C  CB  . SER C 1 86  ? 12.041  -26.558 42.966  1.00 45.77 ? 100 SER C CB  1 
ATOM   8147  O  OG  . SER C 1 86  ? 11.239  -27.698 43.224  1.00 47.08 ? 100 SER C OG  1 
ATOM   8148  N  N   . LEU C 1 87  ? 12.180  -25.679 45.937  1.00 29.70 ? 101 LEU C N   1 
ATOM   8149  C  CA  . LEU C 1 87  ? 11.998  -25.991 47.345  1.00 30.71 ? 101 LEU C CA  1 
ATOM   8150  C  C   . LEU C 1 87  ? 11.233  -24.866 48.058  1.00 28.78 ? 101 LEU C C   1 
ATOM   8151  O  O   . LEU C 1 87  ? 10.427  -25.121 48.954  1.00 30.14 ? 101 LEU C O   1 
ATOM   8152  C  CB  . LEU C 1 87  ? 13.363  -26.234 48.014  1.00 28.50 ? 101 LEU C CB  1 
ATOM   8153  C  CG  . LEU C 1 87  ? 13.376  -26.531 49.509  1.00 30.17 ? 101 LEU C CG  1 
ATOM   8154  C  CD1 . LEU C 1 87  ? 12.427  -27.667 49.842  1.00 33.86 ? 101 LEU C CD1 1 
ATOM   8155  C  CD2 . LEU C 1 87  ? 14.789  -26.869 49.955  1.00 33.86 ? 101 LEU C CD2 1 
ATOM   8156  N  N   . LEU C 1 88  ? 11.505  -23.624 47.667  1.00 32.46 ? 102 LEU C N   1 
ATOM   8157  C  CA  . LEU C 1 88  ? 10.836  -22.475 48.272  1.00 26.45 ? 102 LEU C CA  1 
ATOM   8158  C  C   . LEU C 1 88  ? 9.350   -22.536 47.970  1.00 27.03 ? 102 LEU C C   1 
ATOM   8159  O  O   . LEU C 1 88  ? 8.508   -22.380 48.857  1.00 31.48 ? 102 LEU C O   1 
ATOM   8160  C  CB  . LEU C 1 88  ? 11.423  -21.184 47.735  1.00 20.04 ? 102 LEU C CB  1 
ATOM   8161  C  CG  . LEU C 1 88  ? 12.810  -20.827 48.270  1.00 25.85 ? 102 LEU C CG  1 
ATOM   8162  C  CD1 . LEU C 1 88  ? 13.268  -19.491 47.687  1.00 28.08 ? 102 LEU C CD1 1 
ATOM   8163  C  CD2 . LEU C 1 88  ? 12.775  -20.796 49.792  1.00 23.52 ? 102 LEU C CD2 1 
ATOM   8164  N  N   . ASN C 1 89  ? 9.034   -22.796 46.710  1.00 26.12 ? 103 ASN C N   1 
ATOM   8165  C  CA  . ASN C 1 89  ? 7.638   -22.894 46.312  1.00 31.65 ? 103 ASN C CA  1 
ATOM   8166  C  C   . ASN C 1 89  ? 6.918   -24.011 47.055  1.00 30.22 ? 103 ASN C C   1 
ATOM   8167  O  O   . ASN C 1 89  ? 5.759   -23.869 47.452  1.00 30.54 ? 103 ASN C O   1 
ATOM   8168  C  CB  . ASN C 1 89  ? 7.536   -23.060 44.802  1.00 37.35 ? 103 ASN C CB  1 
ATOM   8169  C  CG  . ASN C 1 89  ? 7.616   -21.740 44.081  1.00 42.36 ? 103 ASN C CG  1 
ATOM   8170  O  OD1 . ASN C 1 89  ? 6.986   -20.763 44.493  1.00 39.70 ? 103 ASN C OD1 1 
ATOM   8171  N  ND2 . ASN C 1 89  ? 8.387   -21.696 42.999  1.00 42.45 ? 103 ASN C ND2 1 
ATOM   8172  N  N   . LYS C 1 90  ? 7.626   -25.114 47.279  1.00 27.92 ? 104 LYS C N   1 
ATOM   8173  C  CA  . LYS C 1 90  ? 7.059   -26.241 48.004  1.00 26.96 ? 104 LYS C CA  1 
ATOM   8174  C  C   . LYS C 1 90  ? 6.800   -25.874 49.451  1.00 30.40 ? 104 LYS C C   1 
ATOM   8175  O  O   . LYS C 1 90  ? 5.800   -26.274 50.046  1.00 27.34 ? 104 LYS C O   1 
ATOM   8176  C  CB  . LYS C 1 90  ? 8.019   -27.442 47.946  1.00 29.03 ? 104 LYS C CB  1 
ATOM   8177  N  N   . ALA C 1 91  ? 7.740   -25.142 50.036  1.00 31.22 ? 105 ALA C N   1 
ATOM   8178  C  CA  . ALA C 1 91  ? 7.617   -24.721 51.423  1.00 29.18 ? 105 ALA C CA  1 
ATOM   8179  C  C   . ALA C 1 91  ? 6.412   -23.799 51.564  1.00 25.53 ? 105 ALA C C   1 
ATOM   8180  O  O   . ALA C 1 91  ? 5.684   -23.849 52.556  1.00 25.01 ? 105 ALA C O   1 
ATOM   8181  C  CB  . ALA C 1 91  ? 8.917   -24.015 51.886  1.00 23.87 ? 105 ALA C CB  1 
ATOM   8182  N  N   . ILE C 1 92  ? 6.200   -22.966 50.554  1.00 25.34 ? 106 ILE C N   1 
ATOM   8183  C  CA  . ILE C 1 92  ? 5.038   -22.088 50.555  1.00 27.59 ? 106 ILE C CA  1 
ATOM   8184  C  C   . ILE C 1 92  ? 3.759   -22.923 50.544  1.00 32.43 ? 106 ILE C C   1 
ATOM   8185  O  O   . ILE C 1 92  ? 2.894   -22.748 51.407  1.00 29.85 ? 106 ILE C O   1 
ATOM   8186  C  CB  . ILE C 1 92  ? 5.055   -21.121 49.365  1.00 25.80 ? 106 ILE C CB  1 
ATOM   8187  C  CG1 . ILE C 1 92  ? 6.126   -20.040 49.601  1.00 23.46 ? 106 ILE C CG1 1 
ATOM   8188  C  CG2 . ILE C 1 92  ? 3.678   -20.466 49.194  1.00 22.81 ? 106 ILE C CG2 1 
ATOM   8189  C  CD1 . ILE C 1 92  ? 6.610   -19.352 48.347  1.00 22.55 ? 106 ILE C CD1 1 
ATOM   8190  N  N   . GLU C 1 93  ? 3.655   -23.840 49.579  1.00 24.12 ? 107 GLU C N   1 
ATOM   8191  C  CA  . GLU C 1 93  ? 2.457   -24.677 49.452  1.00 32.79 ? 107 GLU C CA  1 
ATOM   8192  C  C   . GLU C 1 93  ? 2.211   -25.434 50.750  1.00 36.03 ? 107 GLU C C   1 
ATOM   8193  O  O   . GLU C 1 93  ? 1.083   -25.517 51.233  1.00 30.84 ? 107 GLU C O   1 
ATOM   8194  C  CB  . GLU C 1 93  ? 2.595   -25.659 48.281  1.00 34.43 ? 107 GLU C CB  1 
ATOM   8195  N  N   . ALA C 1 94  ? 3.283   -25.955 51.339  1.00 32.49 ? 108 ALA C N   1 
ATOM   8196  C  CA  . ALA C 1 94  ? 3.156   -26.686 52.588  1.00 37.15 ? 108 ALA C CA  1 
ATOM   8197  C  C   . ALA C 1 94  ? 2.686   -25.793 53.737  1.00 35.38 ? 108 ALA C C   1 
ATOM   8198  O  O   . ALA C 1 94  ? 1.802   -26.175 54.496  1.00 35.66 ? 108 ALA C O   1 
ATOM   8199  C  CB  . ALA C 1 94  ? 4.465   -27.382 52.931  1.00 40.20 ? 108 ALA C CB  1 
ATOM   8200  N  N   . ALA C 1 95  ? 3.274   -24.607 53.871  1.00 30.93 ? 109 ALA C N   1 
ATOM   8201  C  CA  . ALA C 1 95  ? 2.865   -23.693 54.936  1.00 27.05 ? 109 ALA C CA  1 
ATOM   8202  C  C   . ALA C 1 95  ? 1.405   -23.295 54.800  1.00 28.17 ? 109 ALA C C   1 
ATOM   8203  O  O   . ALA C 1 95  ? 0.656   -23.271 55.779  1.00 29.20 ? 109 ALA C O   1 
ATOM   8204  C  CB  . ALA C 1 95  ? 3.782   -22.437 54.981  1.00 22.16 ? 109 ALA C CB  1 
ATOM   8205  N  N   . LEU C 1 96  ? 0.992   -22.987 53.582  1.00 28.13 ? 110 LEU C N   1 
ATOM   8206  C  CA  . LEU C 1 96  ? -0.401  -22.599 53.356  1.00 25.50 ? 110 LEU C CA  1 
ATOM   8207  C  C   . LEU C 1 96  ? -1.385  -23.700 53.790  1.00 33.58 ? 110 LEU C C   1 
ATOM   8208  O  O   . LEU C 1 96  ? -2.462  -23.408 54.315  1.00 32.79 ? 110 LEU C O   1 
ATOM   8209  C  CB  . LEU C 1 96  ? -0.599  -22.239 51.899  1.00 25.24 ? 110 LEU C CB  1 
ATOM   8210  C  CG  . LEU C 1 96  ? 0.236   -21.044 51.458  1.00 31.64 ? 110 LEU C CG  1 
ATOM   8211  C  CD1 . LEU C 1 96  ? 0.110   -20.882 49.966  1.00 33.18 ? 110 LEU C CD1 1 
ATOM   8212  C  CD2 . LEU C 1 96  ? -0.227  -19.802 52.192  1.00 26.21 ? 110 LEU C CD2 1 
ATOM   8213  N  N   . ALA C 1 97  ? -0.996  -24.961 53.611  1.00 36.78 ? 111 ALA C N   1 
ATOM   8214  C  CA  . ALA C 1 97  ? -1.878  -26.079 53.971  1.00 36.70 ? 111 ALA C CA  1 
ATOM   8215  C  C   . ALA C 1 97  ? -2.151  -26.127 55.470  1.00 39.10 ? 111 ALA C C   1 
ATOM   8216  O  O   . ALA C 1 97  ? -3.222  -26.532 55.896  1.00 40.63 ? 111 ALA C O   1 
ATOM   8217  C  CB  . ALA C 1 97  ? -1.300  -27.403 53.494  1.00 34.28 ? 111 ALA C CB  1 
ATOM   8218  N  N   . ALA C 1 98  ? -1.178  -25.699 56.270  1.00 33.46 ? 112 ALA C N   1 
ATOM   8219  C  CA  . ALA C 1 98  ? -1.293  -25.799 57.720  1.00 30.68 ? 112 ALA C CA  1 
ATOM   8220  C  C   . ALA C 1 98  ? -1.850  -24.537 58.383  1.00 30.80 ? 112 ALA C C   1 
ATOM   8221  O  O   . ALA C 1 98  ? -2.208  -24.556 59.564  1.00 29.51 ? 112 ALA C O   1 
ATOM   8222  C  CB  . ALA C 1 98  ? 0.076   -26.150 58.325  1.00 38.22 ? 112 ALA C CB  1 
ATOM   8223  N  N   . ARG C 1 99  ? -1.909  -23.442 57.626  1.00 30.02 ? 113 ARG C N   1 
ATOM   8224  C  CA  . ARG C 1 99  ? -2.227  -22.124 58.186  1.00 29.26 ? 113 ARG C CA  1 
ATOM   8225  C  C   . ARG C 1 99  ? -3.581  -22.010 58.875  1.00 33.43 ? 113 ARG C C   1 
ATOM   8226  O  O   . ARG C 1 99  ? -3.686  -21.434 59.964  1.00 27.38 ? 113 ARG C O   1 
ATOM   8227  C  CB  . ARG C 1 99  ? -2.160  -21.050 57.101  1.00 31.13 ? 113 ARG C CB  1 
ATOM   8228  C  CG  . ARG C 1 99  ? -2.483  -19.656 57.637  1.00 30.61 ? 113 ARG C CG  1 
ATOM   8229  C  CD  . ARG C 1 99  ? -2.618  -18.645 56.528  1.00 30.32 ? 113 ARG C CD  1 
ATOM   8230  N  NE  . ARG C 1 99  ? -3.845  -18.837 55.771  1.00 32.31 ? 113 ARG C NE  1 
ATOM   8231  C  CZ  . ARG C 1 99  ? -5.052  -18.488 56.203  1.00 32.15 ? 113 ARG C CZ  1 
ATOM   8232  N  NH1 . ARG C 1 99  ? -5.201  -17.926 57.398  1.00 33.15 ? 113 ARG C NH1 1 
ATOM   8233  N  NH2 . ARG C 1 99  ? -6.111  -18.699 55.437  1.00 31.20 ? 113 ARG C NH2 1 
ATOM   8234  N  N   . LYS C 1 100 ? -4.618  -22.541 58.227  1.00 38.04 ? 114 LYS C N   1 
ATOM   8235  C  CA  . LYS C 1 100 ? -5.986  -22.369 58.706  1.00 35.62 ? 114 LYS C CA  1 
ATOM   8236  C  C   . LYS C 1 100 ? -6.149  -22.914 60.118  1.00 34.24 ? 114 LYS C C   1 
ATOM   8237  O  O   . LYS C 1 100 ? -6.636  -22.212 61.004  1.00 34.53 ? 114 LYS C O   1 
ATOM   8238  C  CB  . LYS C 1 100 ? -6.993  -23.034 57.753  1.00 37.94 ? 114 LYS C CB  1 
ATOM   8239  N  N   . GLU C 1 101 ? -5.725  -24.161 60.324  1.00 33.40 ? 115 GLU C N   1 
ATOM   8240  C  CA  . GLU C 1 101 ? -5.783  -24.775 61.648  1.00 38.41 ? 115 GLU C CA  1 
ATOM   8241  C  C   . GLU C 1 101 ? -5.023  -23.934 62.676  1.00 38.42 ? 115 GLU C C   1 
ATOM   8242  O  O   . GLU C 1 101 ? -5.502  -23.720 63.790  1.00 35.85 ? 115 GLU C O   1 
ATOM   8243  C  CB  . GLU C 1 101 ? -5.227  -26.205 61.613  1.00 40.02 ? 115 GLU C CB  1 
ATOM   8244  N  N   . TRP C 1 102 ? -3.846  -23.447 62.286  1.00 37.28 ? 116 TRP C N   1 
ATOM   8245  C  CA  . TRP C 1 102 ? -2.995  -22.658 63.178  1.00 31.19 ? 116 TRP C CA  1 
ATOM   8246  C  C   . TRP C 1 102 ? -3.674  -21.351 63.590  1.00 30.17 ? 116 TRP C C   1 
ATOM   8247  O  O   . TRP C 1 102 ? -3.757  -21.024 64.774  1.00 31.45 ? 116 TRP C O   1 
ATOM   8248  C  CB  . TRP C 1 102 ? -1.645  -22.394 62.493  1.00 33.69 ? 116 TRP C CB  1 
ATOM   8249  C  CG  . TRP C 1 102 ? -0.672  -21.527 63.269  1.00 31.80 ? 116 TRP C CG  1 
ATOM   8250  C  CD1 . TRP C 1 102 ? -0.242  -20.272 62.928  1.00 30.66 ? 116 TRP C CD1 1 
ATOM   8251  C  CD2 . TRP C 1 102 ? -0.011  -21.855 64.496  1.00 29.41 ? 116 TRP C CD2 1 
ATOM   8252  N  NE1 . TRP C 1 102 ? 0.645   -19.804 63.868  1.00 30.04 ? 116 TRP C NE1 1 
ATOM   8253  C  CE2 . TRP C 1 102 ? 0.803   -20.756 64.843  1.00 30.04 ? 116 TRP C CE2 1 
ATOM   8254  C  CE3 . TRP C 1 102 ? -0.020  -22.975 65.337  1.00 30.81 ? 116 TRP C CE3 1 
ATOM   8255  C  CZ2 . TRP C 1 102 ? 1.593   -20.739 65.995  1.00 25.82 ? 116 TRP C CZ2 1 
ATOM   8256  C  CZ3 . TRP C 1 102 ? 0.767   -22.955 66.486  1.00 25.89 ? 116 TRP C CZ3 1 
ATOM   8257  C  CH2 . TRP C 1 102 ? 1.561   -21.853 66.801  1.00 25.81 ? 116 TRP C CH2 1 
ATOM   8258  N  N   . ASP C 1 103 ? -4.178  -20.620 62.601  1.00 30.04 ? 117 ASP C N   1 
ATOM   8259  C  CA  . ASP C 1 103 ? -4.919  -19.384 62.831  1.00 34.24 ? 117 ASP C CA  1 
ATOM   8260  C  C   . ASP C 1 103 ? -6.090  -19.634 63.784  1.00 35.39 ? 117 ASP C C   1 
ATOM   8261  O  O   . ASP C 1 103 ? -6.386  -18.815 64.658  1.00 31.44 ? 117 ASP C O   1 
ATOM   8262  C  CB  . ASP C 1 103 ? -5.386  -18.825 61.474  1.00 31.76 ? 117 ASP C CB  1 
ATOM   8263  C  CG  . ASP C 1 103 ? -6.295  -17.607 61.593  1.00 34.91 ? 117 ASP C CG  1 
ATOM   8264  O  OD1 . ASP C 1 103 ? -6.112  -16.772 62.508  1.00 37.49 ? 117 ASP C OD1 1 
ATOM   8265  O  OD2 . ASP C 1 103 ? -7.195  -17.482 60.731  1.00 31.24 ? 117 ASP C OD2 1 
ATOM   8266  N  N   . LEU C 1 104 ? -6.726  -20.793 63.647  1.00 34.54 ? 118 LEU C N   1 
ATOM   8267  C  CA  . LEU C 1 104 ? -7.878  -21.107 64.479  1.00 36.36 ? 118 LEU C CA  1 
ATOM   8268  C  C   . LEU C 1 104 ? -7.515  -21.569 65.897  1.00 42.03 ? 118 LEU C C   1 
ATOM   8269  O  O   . LEU C 1 104 ? -8.346  -21.484 66.803  1.00 43.35 ? 118 LEU C O   1 
ATOM   8270  C  CB  . LEU C 1 104 ? -8.798  -22.116 63.776  1.00 35.86 ? 118 LEU C CB  1 
ATOM   8271  C  CG  . LEU C 1 104 ? -9.534  -21.573 62.543  1.00 33.13 ? 118 LEU C CG  1 
ATOM   8272  C  CD1 . LEU C 1 104 ? -10.367 -22.663 61.863  1.00 34.91 ? 118 LEU C CD1 1 
ATOM   8273  C  CD2 . LEU C 1 104 ? -10.408 -20.384 62.921  1.00 30.76 ? 118 LEU C CD2 1 
ATOM   8274  N  N   . LYS C 1 105 ? -6.288  -22.053 66.090  1.00 39.05 ? 119 LYS C N   1 
ATOM   8275  C  CA  . LYS C 1 105 ? -5.826  -22.413 67.430  1.00 40.72 ? 119 LYS C CA  1 
ATOM   8276  C  C   . LYS C 1 105 ? -5.931  -21.187 68.331  1.00 40.42 ? 119 LYS C C   1 
ATOM   8277  O  O   . LYS C 1 105 ? -5.493  -20.101 67.950  1.00 42.32 ? 119 LYS C O   1 
ATOM   8278  C  CB  . LYS C 1 105 ? -4.378  -22.921 67.402  1.00 33.95 ? 119 LYS C CB  1 
ATOM   8279  N  N   . PRO C 1 106 ? -6.517  -21.353 69.527  1.00 37.11 ? 120 PRO C N   1 
ATOM   8280  C  CA  . PRO C 1 106 ? -6.670  -20.238 70.471  1.00 35.73 ? 120 PRO C CA  1 
ATOM   8281  C  C   . PRO C 1 106 ? -5.338  -19.566 70.798  1.00 40.16 ? 120 PRO C C   1 
ATOM   8282  O  O   . PRO C 1 106 ? -4.328  -20.254 70.972  1.00 41.59 ? 120 PRO C O   1 
ATOM   8283  C  CB  . PRO C 1 106 ? -7.239  -20.914 71.718  1.00 41.67 ? 120 PRO C CB  1 
ATOM   8284  C  CG  . PRO C 1 106 ? -7.946  -22.135 71.198  1.00 41.49 ? 120 PRO C CG  1 
ATOM   8285  C  CD  . PRO C 1 106 ? -7.144  -22.596 70.018  1.00 39.41 ? 120 PRO C CD  1 
ATOM   8286  N  N   . ILE C 1 107 ? -5.342  -18.238 70.877  1.00 39.62 ? 121 ILE C N   1 
ATOM   8287  C  CA  . ILE C 1 107 ? -4.118  -17.481 71.091  1.00 39.36 ? 121 ILE C CA  1 
ATOM   8288  C  C   . ILE C 1 107 ? -3.378  -17.930 72.353  1.00 39.94 ? 121 ILE C C   1 
ATOM   8289  O  O   . ILE C 1 107 ? -2.151  -17.999 72.365  1.00 37.38 ? 121 ILE C O   1 
ATOM   8290  C  CB  . ILE C 1 107 ? -4.383  -15.955 71.120  1.00 41.63 ? 121 ILE C CB  1 
ATOM   8291  C  CG1 . ILE C 1 107 ? -3.070  -15.185 71.296  1.00 39.24 ? 121 ILE C CG1 1 
ATOM   8292  C  CG2 . ILE C 1 107 ? -5.391  -15.593 72.205  1.00 41.82 ? 121 ILE C CG2 1 
ATOM   8293  C  CD1 . ILE C 1 107 ? -2.032  -15.502 70.233  1.00 40.12 ? 121 ILE C CD1 1 
ATOM   8294  N  N   . ALA C 1 108 ? -4.129  -18.274 73.395  1.00 38.44 ? 122 ALA C N   1 
ATOM   8295  C  CA  . ALA C 1 108 ? -3.544  -18.782 74.632  1.00 38.05 ? 122 ALA C CA  1 
ATOM   8296  C  C   . ALA C 1 108 ? -2.711  -20.046 74.403  1.00 36.33 ? 122 ALA C C   1 
ATOM   8297  O  O   . ALA C 1 108 ? -1.675  -20.238 75.046  1.00 34.08 ? 122 ALA C O   1 
ATOM   8298  C  CB  . ALA C 1 108 ? -4.635  -19.043 75.669  1.00 42.61 ? 122 ALA C CB  1 
ATOM   8299  N  N   . ASP C 1 109 ? -3.157  -20.897 73.484  1.00 34.42 ? 123 ASP C N   1 
ATOM   8300  C  CA  . ASP C 1 109 ? -2.438  -22.129 73.175  1.00 37.64 ? 123 ASP C CA  1 
ATOM   8301  C  C   . ASP C 1 109 ? -1.211  -21.862 72.302  1.00 36.85 ? 123 ASP C C   1 
ATOM   8302  O  O   . ASP C 1 109 ? -0.196  -22.544 72.436  1.00 32.09 ? 123 ASP C O   1 
ATOM   8303  C  CB  . ASP C 1 109 ? -3.354  -23.136 72.485  1.00 41.34 ? 123 ASP C CB  1 
ATOM   8304  C  CG  . ASP C 1 109 ? -4.512  -23.579 73.369  1.00 42.63 ? 123 ASP C CG  1 
ATOM   8305  O  OD1 . ASP C 1 109 ? -4.330  -23.661 74.601  1.00 39.27 ? 123 ASP C OD1 1 
ATOM   8306  O  OD2 . ASP C 1 109 ? -5.608  -23.839 72.830  1.00 50.62 ? 123 ASP C OD2 1 
ATOM   8307  N  N   . ARG C 1 110 ? -1.309  -20.881 71.404  1.00 34.23 ? 124 ARG C N   1 
ATOM   8308  C  CA  . ARG C 1 110 ? -0.153  -20.480 70.606  1.00 32.06 ? 124 ARG C CA  1 
ATOM   8309  C  C   . ARG C 1 110 ? 0.896   -19.828 71.507  1.00 31.09 ? 124 ARG C C   1 
ATOM   8310  O  O   . ARG C 1 110 ? 2.095   -20.098 71.386  1.00 29.64 ? 124 ARG C O   1 
ATOM   8311  C  CB  . ARG C 1 110 ? -0.557  -19.533 69.464  1.00 32.31 ? 124 ARG C CB  1 
ATOM   8312  C  CG  . ARG C 1 110 ? -1.448  -20.180 68.404  1.00 34.15 ? 124 ARG C CG  1 
ATOM   8313  C  CD  . ARG C 1 110 ? -1.477  -19.384 67.103  1.00 32.53 ? 124 ARG C CD  1 
ATOM   8314  N  NE  . ARG C 1 110 ? -1.934  -18.005 67.272  1.00 40.13 ? 124 ARG C NE  1 
ATOM   8315  C  CZ  . ARG C 1 110 ? -3.095  -17.527 66.825  1.00 37.46 ? 124 ARG C CZ  1 
ATOM   8316  N  NH1 . ARG C 1 110 ? -3.949  -18.320 66.179  1.00 39.53 ? 124 ARG C NH1 1 
ATOM   8317  N  NH2 . ARG C 1 110 ? -3.406  -16.252 67.032  1.00 35.78 ? 124 ARG C NH2 1 
ATOM   8318  N  N   . ALA C 1 111 ? 0.435   -18.983 72.424  1.00 28.34 ? 125 ALA C N   1 
ATOM   8319  C  CA  . ALA C 1 111 ? 1.336   -18.266 73.315  1.00 25.50 ? 125 ALA C CA  1 
ATOM   8320  C  C   . ALA C 1 111 ? 2.114   -19.222 74.219  1.00 30.43 ? 125 ALA C C   1 
ATOM   8321  O  O   . ALA C 1 111 ? 3.287   -18.976 74.523  1.00 29.45 ? 125 ALA C O   1 
ATOM   8322  C  CB  . ALA C 1 111 ? 0.565   -17.245 74.147  1.00 32.22 ? 125 ALA C CB  1 
ATOM   8323  N  N   . GLN C 1 112 ? 1.462   -20.310 74.633  1.00 32.44 ? 126 GLN C N   1 
ATOM   8324  C  CA  . GLN C 1 112 ? 2.088   -21.306 75.500  1.00 38.19 ? 126 GLN C CA  1 
ATOM   8325  C  C   . GLN C 1 112 ? 3.323   -21.923 74.859  1.00 34.76 ? 126 GLN C C   1 
ATOM   8326  O  O   . GLN C 1 112 ? 4.295   -22.256 75.552  1.00 28.25 ? 126 GLN C O   1 
ATOM   8327  C  CB  . GLN C 1 112 ? 1.100   -22.413 75.883  1.00 43.00 ? 126 GLN C CB  1 
ATOM   8328  C  CG  . GLN C 1 112 ? 0.158   -22.046 77.019  1.00 48.27 ? 126 GLN C CG  1 
ATOM   8329  C  CD  . GLN C 1 112 ? 0.886   -21.592 78.272  1.00 49.18 ? 126 GLN C CD  1 
ATOM   8330  O  OE1 . GLN C 1 112 ? 0.538   -20.569 78.866  1.00 52.99 ? 126 GLN C OE1 1 
ATOM   8331  N  NE2 . GLN C 1 112 ? 1.894   -22.353 78.686  1.00 45.95 ? 126 GLN C NE2 1 
ATOM   8332  N  N   . ILE C 1 113 ? 3.286   -22.082 73.540  1.00 30.27 ? 127 ILE C N   1 
ATOM   8333  C  CA  . ILE C 1 113 ? 4.437   -22.632 72.836  1.00 31.04 ? 127 ILE C CA  1 
ATOM   8334  C  C   . ILE C 1 113 ? 5.613   -21.676 72.967  1.00 31.73 ? 127 ILE C C   1 
ATOM   8335  O  O   . ILE C 1 113 ? 6.742   -22.089 73.255  1.00 25.66 ? 127 ILE C O   1 
ATOM   8336  C  CB  . ILE C 1 113 ? 4.120   -22.859 71.362  1.00 35.27 ? 127 ILE C CB  1 
ATOM   8337  C  CG1 . ILE C 1 113 ? 3.091   -23.983 71.213  1.00 31.40 ? 127 ILE C CG1 1 
ATOM   8338  C  CG2 . ILE C 1 113 ? 5.389   -23.164 70.583  1.00 31.50 ? 127 ILE C CG2 1 
ATOM   8339  C  CD1 . ILE C 1 113 ? 2.568   -24.118 69.802  1.00 34.87 ? 127 ILE C CD1 1 
ATOM   8340  N  N   . PHE C 1 114 ? 5.336   -20.387 72.792  1.00 29.35 ? 128 PHE C N   1 
ATOM   8341  C  CA  . PHE C 1 114 ? 6.383   -19.379 72.896  1.00 27.55 ? 128 PHE C CA  1 
ATOM   8342  C  C   . PHE C 1 114 ? 6.869   -19.146 74.322  1.00 25.65 ? 128 PHE C C   1 
ATOM   8343  O  O   . PHE C 1 114 ? 8.041   -18.842 74.532  1.00 25.99 ? 128 PHE C O   1 
ATOM   8344  C  CB  . PHE C 1 114 ? 5.958   -18.076 72.210  1.00 23.32 ? 128 PHE C CB  1 
ATOM   8345  C  CG  . PHE C 1 114 ? 5.857   -18.211 70.726  1.00 28.13 ? 128 PHE C CG  1 
ATOM   8346  C  CD1 . PHE C 1 114 ? 4.712   -18.725 70.142  1.00 32.29 ? 128 PHE C CD1 1 
ATOM   8347  C  CD2 . PHE C 1 114 ? 6.929   -17.887 69.915  1.00 33.22 ? 128 PHE C CD2 1 
ATOM   8348  C  CE1 . PHE C 1 114 ? 4.625   -18.880 68.777  1.00 31.68 ? 128 PHE C CE1 1 
ATOM   8349  C  CE2 . PHE C 1 114 ? 6.844   -18.039 68.544  1.00 31.63 ? 128 PHE C CE2 1 
ATOM   8350  C  CZ  . PHE C 1 114 ? 5.690   -18.531 67.978  1.00 27.00 ? 128 PHE C CZ  1 
ATOM   8351  N  N   . LEU C 1 115 ? 5.979   -19.276 75.299  1.00 23.72 ? 129 LEU C N   1 
ATOM   8352  C  CA  . LEU C 1 115 ? 6.415   -19.185 76.688  1.00 27.71 ? 129 LEU C CA  1 
ATOM   8353  C  C   . LEU C 1 115 ? 7.355   -20.339 77.040  1.00 32.08 ? 129 LEU C C   1 
ATOM   8354  O  O   . LEU C 1 115 ? 8.374   -20.129 77.700  1.00 33.33 ? 129 LEU C O   1 
ATOM   8355  C  CB  . LEU C 1 115 ? 5.226   -19.127 77.645  1.00 24.69 ? 129 LEU C CB  1 
ATOM   8356  C  CG  . LEU C 1 115 ? 4.434   -17.821 77.547  1.00 28.90 ? 129 LEU C CG  1 
ATOM   8357  C  CD1 . LEU C 1 115 ? 3.112   -17.938 78.312  1.00 31.35 ? 129 LEU C CD1 1 
ATOM   8358  C  CD2 . LEU C 1 115 ? 5.262   -16.641 78.051  1.00 29.09 ? 129 LEU C CD2 1 
ATOM   8359  N  N   . LYS C 1 116 ? 7.017   -21.541 76.572  1.00 28.46 ? 130 LYS C N   1 
ATOM   8360  C  CA  . LYS C 1 116 ? 7.838   -22.723 76.796  1.00 29.70 ? 130 LYS C CA  1 
ATOM   8361  C  C   . LYS C 1 116 ? 9.208   -22.565 76.140  1.00 31.31 ? 130 LYS C C   1 
ATOM   8362  O  O   . LYS C 1 116 ? 10.234  -22.852 76.762  1.00 30.44 ? 130 LYS C O   1 
ATOM   8363  C  CB  . LYS C 1 116 ? 7.146   -23.985 76.272  1.00 28.42 ? 130 LYS C CB  1 
ATOM   8364  N  N   . ALA C 1 117 ? 9.222   -22.108 74.888  1.00 27.22 ? 131 ALA C N   1 
ATOM   8365  C  CA  . ALA C 1 117 ? 10.486  -21.881 74.182  1.00 28.95 ? 131 ALA C CA  1 
ATOM   8366  C  C   . ALA C 1 117 ? 11.352  -20.879 74.936  1.00 26.35 ? 131 ALA C C   1 
ATOM   8367  O  O   . ALA C 1 117 ? 12.559  -21.078 75.079  1.00 25.18 ? 131 ALA C O   1 
ATOM   8368  C  CB  . ALA C 1 117 ? 10.233  -21.411 72.746  1.00 26.19 ? 131 ALA C CB  1 
ATOM   8369  N  N   . ALA C 1 118 ? 10.723  -19.819 75.441  1.00 24.66 ? 132 ALA C N   1 
ATOM   8370  C  CA  . ALA C 1 118 ? 11.421  -18.803 76.234  1.00 24.25 ? 132 ALA C CA  1 
ATOM   8371  C  C   . ALA C 1 118 ? 12.052  -19.381 77.506  1.00 33.49 ? 132 ALA C C   1 
ATOM   8372  O  O   . ALA C 1 118 ? 13.207  -19.056 77.858  1.00 29.21 ? 132 ALA C O   1 
ATOM   8373  C  CB  . ALA C 1 118 ? 10.473  -17.671 76.590  1.00 27.49 ? 132 ALA C CB  1 
ATOM   8374  N  N   . ASP C 1 119 ? 11.286  -20.226 78.194  1.00 33.16 ? 133 ASP C N   1 
ATOM   8375  C  CA  . ASP C 1 119 ? 11.746  -20.867 79.418  1.00 31.77 ? 133 ASP C CA  1 
ATOM   8376  C  C   . ASP C 1 119 ? 12.887  -21.854 79.146  1.00 32.47 ? 133 ASP C C   1 
ATOM   8377  O  O   . ASP C 1 119 ? 13.832  -21.936 79.925  1.00 25.63 ? 133 ASP C O   1 
ATOM   8378  C  CB  . ASP C 1 119 ? 10.584  -21.576 80.129  1.00 32.21 ? 133 ASP C CB  1 
ATOM   8379  C  CG  . ASP C 1 119 ? 9.614   -20.604 80.783  1.00 40.04 ? 133 ASP C CG  1 
ATOM   8380  O  OD1 . ASP C 1 119 ? 9.954   -19.405 80.925  1.00 35.94 ? 133 ASP C OD1 1 
ATOM   8381  O  OD2 . ASP C 1 119 ? 8.505   -21.039 81.166  1.00 41.91 ? 133 ASP C OD2 1 
ATOM   8382  N  N   . MET C 1 120 ? 12.799  -22.604 78.049  1.00 33.04 ? 134 MET C N   1 
ATOM   8383  C  CA  . MET C 1 120 ? 13.897  -23.492 77.674  1.00 29.46 ? 134 MET C CA  1 
ATOM   8384  C  C   . MET C 1 120 ? 15.174  -22.690 77.431  1.00 30.69 ? 134 MET C C   1 
ATOM   8385  O  O   . MET C 1 120 ? 16.226  -22.987 78.001  1.00 28.71 ? 134 MET C O   1 
ATOM   8386  C  CB  . MET C 1 120 ? 13.546  -24.315 76.444  1.00 26.30 ? 134 MET C CB  1 
ATOM   8387  C  CG  . MET C 1 120 ? 12.384  -25.270 76.676  1.00 31.38 ? 134 MET C CG  1 
ATOM   8388  S  SD  . MET C 1 120 ? 11.721  -25.921 75.133  1.00 33.83 ? 134 MET C SD  1 
ATOM   8389  C  CE  . MET C 1 120 ? 13.088  -26.934 74.570  1.00 30.45 ? 134 MET C CE  1 
ATOM   8390  N  N   . LEU C 1 121 ? 15.059  -21.660 76.600  1.00 32.04 ? 135 LEU C N   1 
ATOM   8391  C  CA  . LEU C 1 121 ? 16.165  -20.754 76.317  1.00 28.92 ? 135 LEU C CA  1 
ATOM   8392  C  C   . LEU C 1 121 ? 16.689  -20.108 77.592  1.00 28.50 ? 135 LEU C C   1 
ATOM   8393  O  O   . LEU C 1 121 ? 17.883  -19.863 77.729  1.00 29.97 ? 135 LEU C O   1 
ATOM   8394  C  CB  . LEU C 1 121 ? 15.720  -19.681 75.324  1.00 27.83 ? 135 LEU C CB  1 
ATOM   8395  C  CG  . LEU C 1 121 ? 15.635  -20.123 73.864  1.00 25.45 ? 135 LEU C CG  1 
ATOM   8396  C  CD1 . LEU C 1 121 ? 14.843  -19.117 73.029  1.00 28.26 ? 135 LEU C CD1 1 
ATOM   8397  C  CD2 . LEU C 1 121 ? 17.043  -20.268 73.322  1.00 26.35 ? 135 LEU C CD2 1 
ATOM   8398  N  N   . SER C 1 122 ? 15.787  -19.846 78.532  1.00 25.85 ? 136 SER C N   1 
ATOM   8399  C  CA  . SER C 1 122 ? 16.146  -19.183 79.778  1.00 27.19 ? 136 SER C CA  1 
ATOM   8400  C  C   . SER C 1 122 ? 16.945  -20.091 80.736  1.00 32.09 ? 136 SER C C   1 
ATOM   8401  O  O   . SER C 1 122 ? 17.815  -19.614 81.474  1.00 26.05 ? 136 SER C O   1 
ATOM   8402  C  CB  . SER C 1 122 ? 14.884  -18.680 80.479  1.00 27.12 ? 136 SER C CB  1 
ATOM   8403  O  OG  . SER C 1 122 ? 15.177  -18.205 81.775  1.00 36.08 ? 136 SER C OG  1 
ATOM   8404  N  N   . GLY C 1 123 ? 16.631  -21.384 80.729  1.00 31.83 ? 137 GLY C N   1 
ATOM   8405  C  CA  . GLY C 1 123 ? 17.205  -22.319 81.687  1.00 30.80 ? 137 GLY C CA  1 
ATOM   8406  C  C   . GLY C 1 123 ? 18.128  -23.346 81.060  1.00 28.45 ? 137 GLY C C   1 
ATOM   8407  O  O   . GLY C 1 123 ? 19.312  -23.086 80.861  1.00 33.48 ? 137 GLY C O   1 
ATOM   8408  N  N   . PRO C 1 124 ? 17.588  -24.518 80.716  1.00 33.57 ? 138 PRO C N   1 
ATOM   8409  C  CA  . PRO C 1 124 ? 18.396  -25.644 80.228  1.00 34.63 ? 138 PRO C CA  1 
ATOM   8410  C  C   . PRO C 1 124 ? 19.127  -25.393 78.909  1.00 30.49 ? 138 PRO C C   1 
ATOM   8411  O  O   . PRO C 1 124 ? 20.119  -26.075 78.649  1.00 33.19 ? 138 PRO C O   1 
ATOM   8412  C  CB  . PRO C 1 124 ? 17.358  -26.757 80.042  1.00 39.78 ? 138 PRO C CB  1 
ATOM   8413  C  CG  . PRO C 1 124 ? 16.071  -26.016 79.819  1.00 37.64 ? 138 PRO C CG  1 
ATOM   8414  C  CD  . PRO C 1 124 ? 16.155  -24.850 80.753  1.00 35.15 ? 138 PRO C CD  1 
ATOM   8415  N  N   . ARG C 1 125 ? 18.666  -24.446 78.096  1.00 28.97 ? 139 ARG C N   1 
ATOM   8416  C  CA  . ARG C 1 125 ? 19.299  -24.207 76.790  1.00 30.46 ? 139 ARG C CA  1 
ATOM   8417  C  C   . ARG C 1 125 ? 20.059  -22.882 76.690  1.00 27.32 ? 139 ARG C C   1 
ATOM   8418  O  O   . ARG C 1 125 ? 20.526  -22.524 75.607  1.00 22.89 ? 139 ARG C O   1 
ATOM   8419  C  CB  . ARG C 1 125 ? 18.271  -24.269 75.650  1.00 28.80 ? 139 ARG C CB  1 
ATOM   8420  C  CG  . ARG C 1 125 ? 17.428  -25.534 75.602  1.00 31.39 ? 139 ARG C CG  1 
ATOM   8421  C  CD  . ARG C 1 125 ? 18.268  -26.759 75.264  1.00 34.21 ? 139 ARG C CD  1 
ATOM   8422  N  NE  . ARG C 1 125 ? 18.294  -27.024 73.829  1.00 34.11 ? 139 ARG C NE  1 
ATOM   8423  C  CZ  . ARG C 1 125 ? 17.375  -27.745 73.198  1.00 33.98 ? 139 ARG C CZ  1 
ATOM   8424  N  NH1 . ARG C 1 125 ? 17.457  -27.948 71.886  1.00 29.54 ? 139 ARG C NH1 1 
ATOM   8425  N  NH2 . ARG C 1 125 ? 16.370  -28.268 73.889  1.00 33.71 ? 139 ARG C NH2 1 
ATOM   8426  N  N   . ARG C 1 126 ? 20.171  -22.160 77.801  1.00 22.55 ? 140 ARG C N   1 
ATOM   8427  C  CA  . ARG C 1 126 ? 20.836  -20.858 77.812  1.00 24.27 ? 140 ARG C CA  1 
ATOM   8428  C  C   . ARG C 1 126 ? 22.307  -20.975 77.427  1.00 24.67 ? 140 ARG C C   1 
ATOM   8429  O  O   . ARG C 1 126 ? 22.783  -20.241 76.566  1.00 25.11 ? 140 ARG C O   1 
ATOM   8430  C  CB  . ARG C 1 126 ? 20.726  -20.210 79.188  1.00 26.94 ? 140 ARG C CB  1 
ATOM   8431  C  CG  . ARG C 1 126 ? 20.906  -18.709 79.173  1.00 31.92 ? 140 ARG C CG  1 
ATOM   8432  C  CD  . ARG C 1 126 ? 21.127  -18.187 80.579  1.00 33.48 ? 140 ARG C CD  1 
ATOM   8433  N  NE  . ARG C 1 126 ? 20.980  -16.734 80.676  1.00 37.81 ? 140 ARG C NE  1 
ATOM   8434  C  CZ  . ARG C 1 126 ? 19.828  -16.125 80.933  1.00 38.01 ? 140 ARG C CZ  1 
ATOM   8435  N  NH1 . ARG C 1 126 ? 19.776  -14.801 81.021  1.00 35.47 ? 140 ARG C NH1 1 
ATOM   8436  N  NH2 . ARG C 1 126 ? 18.723  -16.849 81.099  1.00 33.10 ? 140 ARG C NH2 1 
ATOM   8437  N  N   . ALA C 1 127 ? 23.028  -21.894 78.075  1.00 22.89 ? 141 ALA C N   1 
ATOM   8438  C  CA  . ALA C 1 127 ? 24.443  -22.072 77.770  1.00 24.67 ? 141 ALA C CA  1 
ATOM   8439  C  C   . ALA C 1 127 ? 24.632  -22.383 76.289  1.00 25.66 ? 141 ALA C C   1 
ATOM   8440  O  O   . ALA C 1 127 ? 25.536  -21.856 75.651  1.00 22.71 ? 141 ALA C O   1 
ATOM   8441  C  CB  . ALA C 1 127 ? 25.060  -23.173 78.638  1.00 26.11 ? 141 ALA C CB  1 
ATOM   8442  N  N   . GLU C 1 128 ? 23.762  -23.226 75.742  1.00 28.34 ? 142 GLU C N   1 
ATOM   8443  C  CA  . GLU C 1 128 ? 23.852  -23.592 74.330  1.00 29.38 ? 142 GLU C CA  1 
ATOM   8444  C  C   . GLU C 1 128 ? 23.692  -22.381 73.395  1.00 27.05 ? 142 GLU C C   1 
ATOM   8445  O  O   . GLU C 1 128 ? 24.492  -22.193 72.475  1.00 25.62 ? 142 GLU C O   1 
ATOM   8446  C  CB  . GLU C 1 128 ? 22.810  -24.657 73.974  1.00 28.37 ? 142 GLU C CB  1 
ATOM   8447  C  CG  . GLU C 1 128 ? 22.739  -24.937 72.483  1.00 25.76 ? 142 GLU C CG  1 
ATOM   8448  C  CD  . GLU C 1 128 ? 21.482  -25.666 72.082  1.00 28.69 ? 142 GLU C CD  1 
ATOM   8449  O  OE1 . GLU C 1 128 ? 20.781  -26.174 72.982  1.00 29.48 ? 142 GLU C OE1 1 
ATOM   8450  O  OE2 . GLU C 1 128 ? 21.200  -25.737 70.863  1.00 26.34 ? 142 GLU C OE2 1 
ATOM   8451  N  N   . ILE C 1 129 ? 22.659  -21.566 73.622  1.00 24.25 ? 143 ILE C N   1 
ATOM   8452  C  CA  . ILE C 1 129 ? 22.412  -20.428 72.742  1.00 20.25 ? 143 ILE C CA  1 
ATOM   8453  C  C   . ILE C 1 129 ? 23.554  -19.388 72.847  1.00 24.32 ? 143 ILE C C   1 
ATOM   8454  O  O   . ILE C 1 129 ? 24.008  -18.842 71.841  1.00 21.30 ? 143 ILE C O   1 
ATOM   8455  C  CB  . ILE C 1 129 ? 20.970  -19.804 72.932  1.00 26.88 ? 143 ILE C CB  1 
ATOM   8456  C  CG1 . ILE C 1 129 ? 20.610  -18.873 71.765  1.00 25.23 ? 143 ILE C CG1 1 
ATOM   8457  C  CG2 . ILE C 1 129 ? 20.820  -19.058 74.277  1.00 25.07 ? 143 ILE C CG2 1 
ATOM   8458  C  CD1 . ILE C 1 129 ? 20.478  -19.602 70.431  1.00 28.54 ? 143 ILE C CD1 1 
ATOM   8459  N  N   . LEU C 1 130 ? 24.041  -19.158 74.061  1.00 20.93 ? 144 LEU C N   1 
ATOM   8460  C  CA  . LEU C 1 130 ? 25.144  -18.229 74.274  1.00 26.79 ? 144 LEU C CA  1 
ATOM   8461  C  C   . LEU C 1 130 ? 26.388  -18.702 73.537  1.00 21.91 ? 144 LEU C C   1 
ATOM   8462  O  O   . LEU C 1 130 ? 27.015  -17.939 72.803  1.00 19.99 ? 144 LEU C O   1 
ATOM   8463  C  CB  . LEU C 1 130 ? 25.443  -18.076 75.767  1.00 28.94 ? 144 LEU C CB  1 
ATOM   8464  C  CG  . LEU C 1 130 ? 24.299  -17.461 76.581  1.00 34.57 ? 144 LEU C CG  1 
ATOM   8465  C  CD1 . LEU C 1 130 ? 24.632  -17.315 78.051  1.00 25.60 ? 144 LEU C CD1 1 
ATOM   8466  C  CD2 . LEU C 1 130 ? 23.889  -16.128 76.009  1.00 27.61 ? 144 LEU C CD2 1 
ATOM   8467  N  N   . ALA C 1 131 ? 26.724  -19.973 73.727  1.00 22.45 ? 145 ALA C N   1 
ATOM   8468  C  CA  . ALA C 1 131 ? 27.926  -20.527 73.124  1.00 22.29 ? 145 ALA C CA  1 
ATOM   8469  C  C   . ALA C 1 131 ? 27.839  -20.493 71.607  1.00 21.87 ? 145 ALA C C   1 
ATOM   8470  O  O   . ALA C 1 131 ? 28.842  -20.251 70.935  1.00 20.69 ? 145 ALA C O   1 
ATOM   8471  C  CB  . ALA C 1 131 ? 28.170  -21.954 73.621  1.00 21.63 ? 145 ALA C CB  1 
ATOM   8472  N  N   . LYS C 1 132 ? 26.642  -20.717 71.060  1.00 17.66 ? 146 LYS C N   1 
ATOM   8473  C  CA  . LYS C 1 132 ? 26.487  -20.722 69.611  1.00 19.66 ? 146 LYS C CA  1 
ATOM   8474  C  C   . LYS C 1 132 ? 26.582  -19.304 68.987  1.00 20.04 ? 146 LYS C C   1 
ATOM   8475  O  O   . LYS C 1 132 ? 27.070  -19.147 67.858  1.00 16.79 ? 146 LYS C O   1 
ATOM   8476  C  CB  . LYS C 1 132 ? 25.199  -21.468 69.194  1.00 17.35 ? 146 LYS C CB  1 
ATOM   8477  C  CG  . LYS C 1 132 ? 25.343  -23.002 69.330  1.00 18.43 ? 146 LYS C CG  1 
ATOM   8478  C  CD  . LYS C 1 132 ? 24.034  -23.746 69.109  1.00 21.70 ? 146 LYS C CD  1 
ATOM   8479  C  CE  . LYS C 1 132 ? 24.263  -25.268 69.165  1.00 22.87 ? 146 LYS C CE  1 
ATOM   8480  N  NZ  . LYS C 1 132 ? 22.999  -26.035 68.940  1.00 21.46 ? 146 LYS C NZ  1 
ATOM   8481  N  N   . THR C 1 133 ? 26.139  -18.285 69.720  1.00 19.62 ? 147 THR C N   1 
ATOM   8482  C  CA  . THR C 1 133 ? 26.263  -16.907 69.226  1.00 20.16 ? 147 THR C CA  1 
ATOM   8483  C  C   . THR C 1 133 ? 27.680  -16.394 69.410  1.00 21.97 ? 147 THR C C   1 
ATOM   8484  O  O   . THR C 1 133 ? 28.195  -15.668 68.563  1.00 18.78 ? 147 THR C O   1 
ATOM   8485  C  CB  . THR C 1 133 ? 25.209  -15.930 69.845  1.00 23.04 ? 147 THR C CB  1 
ATOM   8486  O  OG1 . THR C 1 133 ? 25.383  -15.838 71.261  1.00 26.12 ? 147 THR C OG1 1 
ATOM   8487  C  CG2 . THR C 1 133 ? 23.795  -16.432 69.562  1.00 24.52 ? 147 THR C CG2 1 
ATOM   8488  N  N   . MET C 1 134 ? 28.321  -16.791 70.509  1.00 19.35 ? 148 MET C N   1 
ATOM   8489  C  CA  . MET C 1 134 ? 29.711  -16.404 70.750  1.00 18.49 ? 148 MET C CA  1 
ATOM   8490  C  C   . MET C 1 134 ? 30.611  -17.023 69.683  1.00 18.01 ? 148 MET C C   1 
ATOM   8491  O  O   . MET C 1 134 ? 31.346  -16.321 68.997  1.00 20.02 ? 148 MET C O   1 
ATOM   8492  C  CB  . MET C 1 134 ? 30.168  -16.834 72.149  1.00 20.93 ? 148 MET C CB  1 
ATOM   8493  C  CG  . MET C 1 134 ? 29.562  -16.025 73.292  1.00 20.48 ? 148 MET C CG  1 
ATOM   8494  S  SD  . MET C 1 134 ? 30.061  -16.669 74.923  1.00 22.60 ? 148 MET C SD  1 
ATOM   8495  C  CE  . MET C 1 134 ? 31.813  -16.235 74.930  1.00 16.57 ? 148 MET C CE  1 
ATOM   8496  N  N   . VAL C 1 135 ? 30.534  -18.342 69.532  1.00 20.09 ? 149 VAL C N   1 
ATOM   8497  C  CA  . VAL C 1 135 ? 31.404  -19.046 68.586  1.00 24.94 ? 149 VAL C CA  1 
ATOM   8498  C  C   . VAL C 1 135 ? 31.032  -18.789 67.132  1.00 21.36 ? 149 VAL C C   1 
ATOM   8499  O  O   . VAL C 1 135 ? 31.908  -18.563 66.296  1.00 21.23 ? 149 VAL C O   1 
ATOM   8500  C  CB  . VAL C 1 135 ? 31.420  -20.548 68.865  1.00 23.03 ? 149 VAL C CB  1 
ATOM   8501  C  CG1 . VAL C 1 135 ? 32.215  -21.287 67.801  1.00 28.14 ? 149 VAL C CG1 1 
ATOM   8502  C  CG2 . VAL C 1 135 ? 31.992  -20.786 70.256  1.00 19.31 ? 149 VAL C CG2 1 
ATOM   8503  N  N   . GLY C 1 136 ? 29.731  -18.779 66.852  1.00 23.74 ? 150 GLY C N   1 
ATOM   8504  C  CA  . GLY C 1 136 ? 29.238  -18.541 65.508  1.00 26.80 ? 150 GLY C CA  1 
ATOM   8505  C  C   . GLY C 1 136 ? 29.247  -17.102 65.014  1.00 20.47 ? 150 GLY C C   1 
ATOM   8506  O  O   . GLY C 1 136 ? 29.464  -16.860 63.823  1.00 21.62 ? 150 GLY C O   1 
ATOM   8507  N  N   . GLN C 1 137 ? 28.978  -16.148 65.905  1.00 19.10 ? 151 GLN C N   1 
ATOM   8508  C  CA  . GLN C 1 137 ? 28.844  -14.747 65.507  1.00 18.35 ? 151 GLN C CA  1 
ATOM   8509  C  C   . GLN C 1 137 ? 29.896  -13.824 66.133  1.00 18.44 ? 151 GLN C C   1 
ATOM   8510  O  O   . GLN C 1 137 ? 29.921  -12.616 65.860  1.00 18.00 ? 151 GLN C O   1 
ATOM   8511  C  CB  . GLN C 1 137 ? 27.427  -14.236 65.801  1.00 18.95 ? 151 GLN C CB  1 
ATOM   8512  C  CG  . GLN C 1 137 ? 26.362  -15.014 65.039  1.00 18.99 ? 151 GLN C CG  1 
ATOM   8513  C  CD  . GLN C 1 137 ? 25.020  -15.049 65.732  1.00 22.02 ? 151 GLN C CD  1 
ATOM   8514  O  OE1 . GLN C 1 137 ? 24.475  -16.130 65.965  1.00 22.07 ? 151 GLN C OE1 1 
ATOM   8515  N  NE2 . GLN C 1 137 ? 24.465  -13.873 66.054  1.00 18.34 ? 151 GLN C NE2 1 
ATOM   8516  N  N   . GLY C 1 138 ? 30.756  -14.393 66.969  1.00 20.57 ? 152 GLY C N   1 
ATOM   8517  C  CA  . GLY C 1 138 ? 31.878  -13.649 67.516  1.00 18.86 ? 152 GLY C CA  1 
ATOM   8518  C  C   . GLY C 1 138 ? 31.515  -12.778 68.701  1.00 20.89 ? 152 GLY C C   1 
ATOM   8519  O  O   . GLY C 1 138 ? 32.306  -11.938 69.107  1.00 21.89 ? 152 GLY C O   1 
ATOM   8520  N  N   . LYS C 1 139 ? 30.319  -12.963 69.254  1.00 20.34 ? 153 LYS C N   1 
ATOM   8521  C  CA  . LYS C 1 139 ? 29.909  -12.177 70.414  1.00 23.82 ? 153 LYS C CA  1 
ATOM   8522  C  C   . LYS C 1 139 ? 30.736  -12.510 71.658  1.00 25.72 ? 153 LYS C C   1 
ATOM   8523  O  O   . LYS C 1 139 ? 31.131  -13.660 71.869  1.00 20.53 ? 153 LYS C O   1 
ATOM   8524  C  CB  . LYS C 1 139 ? 28.431  -12.399 70.732  1.00 22.58 ? 153 LYS C CB  1 
ATOM   8525  C  CG  . LYS C 1 139 ? 27.450  -11.943 69.638  1.00 22.74 ? 153 LYS C CG  1 
ATOM   8526  C  CD  . LYS C 1 139 ? 26.007  -12.097 70.130  1.00 18.06 ? 153 LYS C CD  1 
ATOM   8527  C  CE  . LYS C 1 139 ? 24.988  -11.744 69.049  1.00 30.00 ? 153 LYS C CE  1 
ATOM   8528  N  NZ  . LYS C 1 139 ? 23.576  -11.914 69.546  1.00 35.15 ? 153 LYS C NZ  1 
ATOM   8529  N  N   . THR C 1 140 ? 30.996  -11.499 72.482  1.00 19.86 ? 154 THR C N   1 
ATOM   8530  C  CA  . THR C 1 140 ? 31.510  -11.729 73.833  1.00 18.88 ? 154 THR C CA  1 
ATOM   8531  C  C   . THR C 1 140 ? 30.395  -12.311 74.713  1.00 21.44 ? 154 THR C C   1 
ATOM   8532  O  O   . THR C 1 140 ? 29.208  -12.251 74.352  1.00 22.03 ? 154 THR C O   1 
ATOM   8533  C  CB  . THR C 1 140 ? 31.941  -10.399 74.481  1.00 22.12 ? 154 THR C CB  1 
ATOM   8534  O  OG1 . THR C 1 140 ? 30.815  -9.509  74.521  1.00 19.20 ? 154 THR C OG1 1 
ATOM   8535  C  CG2 . THR C 1 140 ? 33.068  -9.755  73.682  1.00 25.72 ? 154 THR C CG2 1 
ATOM   8536  N  N   . VAL C 1 141 ? 30.760  -12.838 75.880  1.00 21.05 ? 155 VAL C N   1 
ATOM   8537  C  CA  . VAL C 1 141 ? 29.771  -13.436 76.772  1.00 22.86 ? 155 VAL C CA  1 
ATOM   8538  C  C   . VAL C 1 141 ? 28.681  -12.427 77.147  1.00 24.83 ? 155 VAL C C   1 
ATOM   8539  O  O   . VAL C 1 141 ? 27.501  -12.753 77.138  1.00 27.20 ? 155 VAL C O   1 
ATOM   8540  C  CB  . VAL C 1 141 ? 30.431  -14.008 78.047  1.00 26.47 ? 155 VAL C CB  1 
ATOM   8541  C  CG1 . VAL C 1 141 ? 31.366  -12.985 78.663  1.00 30.16 ? 155 VAL C CG1 1 
ATOM   8542  C  CG2 . VAL C 1 141 ? 29.374  -14.434 79.055  1.00 26.65 ? 155 VAL C CG2 1 
ATOM   8543  N  N   . ILE C 1 142 ? 29.067  -11.189 77.438  1.00 24.58 ? 156 ILE C N   1 
ATOM   8544  C  CA  . ILE C 1 142 ? 28.074  -10.200 77.861  1.00 27.64 ? 156 ILE C CA  1 
ATOM   8545  C  C   . ILE C 1 142 ? 27.141  -9.787  76.723  1.00 21.90 ? 156 ILE C C   1 
ATOM   8546  O  O   . ILE C 1 142 ? 25.935  -9.607  76.918  1.00 25.48 ? 156 ILE C O   1 
ATOM   8547  C  CB  . ILE C 1 142 ? 28.723  -8.955  78.476  1.00 22.96 ? 156 ILE C CB  1 
ATOM   8548  C  CG1 . ILE C 1 142 ? 29.427  -9.329  79.772  1.00 31.78 ? 156 ILE C CG1 1 
ATOM   8549  C  CG2 . ILE C 1 142 ? 27.663  -7.923  78.800  1.00 26.34 ? 156 ILE C CG2 1 
ATOM   8550  C  CD1 . ILE C 1 142 ? 28.521  -10.028 80.766  1.00 37.20 ? 156 ILE C CD1 1 
ATOM   8551  N  N   . GLN C 1 143 ? 27.704  -9.642  75.530  1.00 25.41 ? 157 GLN C N   1 
ATOM   8552  C  CA  . GLN C 1 143 ? 26.913  -9.295  74.362  1.00 20.68 ? 157 GLN C CA  1 
ATOM   8553  C  C   . GLN C 1 143 ? 25.936  -10.424 74.043  1.00 21.99 ? 157 GLN C C   1 
ATOM   8554  O  O   . GLN C 1 143 ? 24.759  -10.166 73.772  1.00 26.40 ? 157 GLN C O   1 
ATOM   8555  C  CB  . GLN C 1 143 ? 27.834  -9.004  73.167  1.00 22.47 ? 157 GLN C CB  1 
ATOM   8556  C  CG  . GLN C 1 143 ? 27.133  -8.482  71.940  1.00 28.52 ? 157 GLN C CG  1 
ATOM   8557  C  CD  . GLN C 1 143 ? 26.360  -7.197  72.227  1.00 33.28 ? 157 GLN C CD  1 
ATOM   8558  O  OE1 . GLN C 1 143 ? 26.905  -6.229  72.773  1.00 31.59 ? 157 GLN C OE1 1 
ATOM   8559  N  NE2 . GLN C 1 143 ? 25.088  -7.190  71.870  1.00 38.87 ? 157 GLN C NE2 1 
ATOM   8560  N  N   . ALA C 1 144 ? 26.423  -11.672 74.065  1.00 18.60 ? 158 ALA C N   1 
ATOM   8561  C  CA  . ALA C 1 144 ? 25.567  -12.823 73.796  1.00 18.00 ? 158 ALA C CA  1 
ATOM   8562  C  C   . ALA C 1 144 ? 24.442  -12.894 74.820  1.00 18.36 ? 158 ALA C C   1 
ATOM   8563  O  O   . ALA C 1 144 ? 23.274  -13.174 74.482  1.00 21.13 ? 158 ALA C O   1 
ATOM   8564  C  CB  . ALA C 1 144 ? 26.387  -14.130 73.821  1.00 13.73 ? 158 ALA C CB  1 
ATOM   8565  N  N   . GLU C 1 145 ? 24.804  -12.651 76.073  1.00 21.56 ? 159 GLU C N   1 
ATOM   8566  C  CA  . GLU C 1 145 ? 23.860  -12.743 77.178  1.00 26.67 ? 159 GLU C CA  1 
ATOM   8567  C  C   . GLU C 1 145 ? 22.781  -11.656 77.109  1.00 26.62 ? 159 GLU C C   1 
ATOM   8568  O  O   . GLU C 1 145 ? 21.599  -11.962 77.278  1.00 28.93 ? 159 GLU C O   1 
ATOM   8569  C  CB  . GLU C 1 145 ? 24.590  -12.700 78.524  1.00 26.70 ? 159 GLU C CB  1 
ATOM   8570  C  CG  . GLU C 1 145 ? 23.693  -12.430 79.733  1.00 36.03 ? 159 GLU C CG  1 
ATOM   8571  C  CD  . GLU C 1 145 ? 22.756  -13.586 80.073  1.00 41.50 ? 159 GLU C CD  1 
ATOM   8572  O  OE1 . GLU C 1 145 ? 22.882  -14.678 79.474  1.00 41.58 ? 159 GLU C OE1 1 
ATOM   8573  O  OE2 . GLU C 1 145 ? 21.889  -13.398 80.951  1.00 44.14 ? 159 GLU C OE2 1 
ATOM   8574  N  N   . ILE C 1 146 ? 23.188  -10.407 76.871  1.00 23.03 ? 160 ILE C N   1 
ATOM   8575  C  CA  . ILE C 1 146 ? 22.232  -9.301  76.750  1.00 25.10 ? 160 ILE C CA  1 
ATOM   8576  C  C   . ILE C 1 146 ? 21.249  -9.577  75.623  1.00 26.89 ? 160 ILE C C   1 
ATOM   8577  O  O   . ILE C 1 146 ? 20.046  -9.395  75.787  1.00 26.65 ? 160 ILE C O   1 
ATOM   8578  C  CB  . ILE C 1 146 ? 22.933  -7.939  76.517  1.00 25.61 ? 160 ILE C CB  1 
ATOM   8579  C  CG1 . ILE C 1 146 ? 23.634  -7.479  77.797  1.00 31.09 ? 160 ILE C CG1 1 
ATOM   8580  C  CG2 . ILE C 1 146 ? 21.929  -6.874  76.065  1.00 33.96 ? 160 ILE C CG2 1 
ATOM   8581  C  CD1 . ILE C 1 146 ? 24.549  -6.285  77.592  1.00 33.57 ? 160 ILE C CD1 1 
ATOM   8582  N  N   . ASP C 1 147 ? 21.769  -10.035 74.486  1.00 27.70 ? 161 ASP C N   1 
ATOM   8583  C  CA  . ASP C 1 147 ? 20.941  -10.342 73.325  1.00 27.09 ? 161 ASP C CA  1 
ATOM   8584  C  C   . ASP C 1 147 ? 19.988  -11.516 73.575  1.00 30.99 ? 161 ASP C C   1 
ATOM   8585  O  O   . ASP C 1 147 ? 18.838  -11.480 73.138  1.00 30.21 ? 161 ASP C O   1 
ATOM   8586  C  CB  . ASP C 1 147 ? 21.806  -10.588 72.081  1.00 24.46 ? 161 ASP C CB  1 
ATOM   8587  C  CG  . ASP C 1 147 ? 22.549  -9.325  71.631  1.00 31.31 ? 161 ASP C CG  1 
ATOM   8588  O  OD1 . ASP C 1 147 ? 22.255  -8.241  72.177  1.00 30.95 ? 161 ASP C OD1 1 
ATOM   8589  O  OD2 . ASP C 1 147 ? 23.421  -9.405  70.740  1.00 29.43 ? 161 ASP C OD2 1 
ATOM   8590  N  N   . ALA C 1 148 ? 20.459  -12.539 74.289  1.00 29.26 ? 162 ALA C N   1 
ATOM   8591  C  CA  . ALA C 1 148 ? 19.621  -13.692 74.612  1.00 30.18 ? 162 ALA C CA  1 
ATOM   8592  C  C   . ALA C 1 148 ? 18.471  -13.293 75.535  1.00 28.81 ? 162 ALA C C   1 
ATOM   8593  O  O   . ALA C 1 148 ? 17.312  -13.659 75.297  1.00 23.85 ? 162 ALA C O   1 
ATOM   8594  C  CB  . ALA C 1 148 ? 20.444  -14.796 75.236  1.00 28.81 ? 162 ALA C CB  1 
ATOM   8595  N  N   . ALA C 1 149 ? 18.797  -12.532 76.576  1.00 20.72 ? 163 ALA C N   1 
ATOM   8596  C  CA  . ALA C 1 149 ? 17.799  -12.075 77.547  1.00 24.95 ? 163 ALA C CA  1 
ATOM   8597  C  C   . ALA C 1 149 ? 16.859  -11.002 76.997  1.00 33.42 ? 163 ALA C C   1 
ATOM   8598  O  O   . ALA C 1 149 ? 15.637  -11.205 76.907  1.00 28.70 ? 163 ALA C O   1 
ATOM   8599  C  CB  . ALA C 1 149 ? 18.479  -11.545 78.783  1.00 27.06 ? 163 ALA C CB  1 
ATOM   8600  N  N   . ALA C 1 150 ? 17.451  -9.862  76.651  1.00 32.00 ? 164 ALA C N   1 
ATOM   8601  C  CA  . ALA C 1 150 ? 16.723  -8.636  76.349  1.00 33.24 ? 164 ALA C CA  1 
ATOM   8602  C  C   . ALA C 1 150 ? 16.002  -8.721  75.024  1.00 34.91 ? 164 ALA C C   1 
ATOM   8603  O  O   . ALA C 1 150 ? 15.009  -8.022  74.809  1.00 34.00 ? 164 ALA C O   1 
ATOM   8604  C  CB  . ALA C 1 150 ? 17.670  -7.430  76.350  1.00 33.95 ? 164 ALA C CB  1 
ATOM   8605  N  N   . GLU C 1 151 ? 16.496  -9.566  74.128  1.00 32.90 ? 165 GLU C N   1 
ATOM   8606  C  CA  . GLU C 1 151 ? 15.869  -9.673  72.815  1.00 31.36 ? 165 GLU C CA  1 
ATOM   8607  C  C   . GLU C 1 151 ? 15.089  -10.967 72.641  1.00 35.21 ? 165 GLU C C   1 
ATOM   8608  O  O   . GLU C 1 151 ? 13.866  -10.954 72.612  1.00 44.06 ? 165 GLU C O   1 
ATOM   8609  C  CB  . GLU C 1 151 ? 16.891  -9.487  71.689  1.00 26.91 ? 165 GLU C CB  1 
ATOM   8610  N  N   . LEU C 1 152 ? 15.798  -12.085 72.539  1.00 30.74 ? 166 LEU C N   1 
ATOM   8611  C  CA  . LEU C 1 152 ? 15.184  -13.370 72.224  1.00 20.44 ? 166 LEU C CA  1 
ATOM   8612  C  C   . LEU C 1 152 ? 14.125  -13.848 73.249  1.00 25.71 ? 166 LEU C C   1 
ATOM   8613  O  O   . LEU C 1 152 ? 12.951  -14.065 72.906  1.00 21.37 ? 166 LEU C O   1 
ATOM   8614  C  CB  . LEU C 1 152 ? 16.308  -14.408 72.077  1.00 23.26 ? 166 LEU C CB  1 
ATOM   8615  C  CG  . LEU C 1 152 ? 15.972  -15.826 71.667  1.00 25.52 ? 166 LEU C CG  1 
ATOM   8616  C  CD1 . LEU C 1 152 ? 15.324  -15.823 70.309  1.00 31.99 ? 166 LEU C CD1 1 
ATOM   8617  C  CD2 . LEU C 1 152 ? 17.240  -16.695 71.668  1.00 24.29 ? 166 LEU C CD2 1 
ATOM   8618  N  N   . ILE C 1 153 ? 14.535  -14.010 74.507  1.00 21.34 ? 167 ILE C N   1 
ATOM   8619  C  CA  . ILE C 1 153 ? 13.631  -14.504 75.553  1.00 22.44 ? 167 ILE C CA  1 
ATOM   8620  C  C   . ILE C 1 153 ? 12.529  -13.484 75.890  1.00 20.27 ? 167 ILE C C   1 
ATOM   8621  O  O   . ILE C 1 153 ? 11.343  -13.812 75.914  1.00 23.48 ? 167 ILE C O   1 
ATOM   8622  C  CB  . ILE C 1 153 ? 14.422  -14.893 76.824  1.00 24.76 ? 167 ILE C CB  1 
ATOM   8623  C  CG1 . ILE C 1 153 ? 15.297  -16.107 76.539  1.00 20.75 ? 167 ILE C CG1 1 
ATOM   8624  C  CG2 . ILE C 1 153 ? 13.480  -15.211 77.995  1.00 25.06 ? 167 ILE C CG2 1 
ATOM   8625  C  CD1 . ILE C 1 153 ? 16.407  -16.286 77.536  1.00 20.56 ? 167 ILE C CD1 1 
ATOM   8626  N  N   . ASP C 1 154 ? 12.924  -12.244 76.124  1.00 18.17 ? 168 ASP C N   1 
ATOM   8627  C  CA  . ASP C 1 154 ? 11.946  -11.201 76.418  1.00 22.20 ? 168 ASP C CA  1 
ATOM   8628  C  C   . ASP C 1 154 ? 10.919  -11.006 75.291  1.00 24.49 ? 168 ASP C C   1 
ATOM   8629  O  O   . ASP C 1 154 ? 9.743   -10.746 75.556  1.00 23.71 ? 168 ASP C O   1 
ATOM   8630  C  CB  . ASP C 1 154 ? 12.650  -9.879  76.723  1.00 22.88 ? 168 ASP C CB  1 
ATOM   8631  C  CG  . ASP C 1 154 ? 12.970  -9.716  78.198  1.00 29.13 ? 168 ASP C CG  1 
ATOM   8632  O  OD1 . ASP C 1 154 ? 12.764  -10.691 78.961  1.00 23.42 ? 168 ASP C OD1 1 
ATOM   8633  O  OD2 . ASP C 1 154 ? 13.440  -8.621  78.582  1.00 32.56 ? 168 ASP C OD2 1 
ATOM   8634  N  N   . PHE C 1 155 ? 11.340  -11.128 74.037  1.00 19.72 ? 169 PHE C N   1 
ATOM   8635  C  CA  . PHE C 1 155 ? 10.366  -10.927 72.968  1.00 20.08 ? 169 PHE C CA  1 
ATOM   8636  C  C   . PHE C 1 155 ? 9.350   -12.049 72.887  1.00 26.09 ? 169 PHE C C   1 
ATOM   8637  O  O   . PHE C 1 155 ? 8.169   -11.811 72.619  1.00 23.12 ? 169 PHE C O   1 
ATOM   8638  C  CB  . PHE C 1 155 ? 11.028  -10.631 71.617  1.00 25.34 ? 169 PHE C CB  1 
ATOM   8639  C  CG  . PHE C 1 155 ? 11.175  -9.156  71.347  1.00 38.14 ? 169 PHE C CG  1 
ATOM   8640  C  CD1 . PHE C 1 155 ? 10.169  -8.453  70.699  1.00 33.73 ? 169 PHE C CD1 1 
ATOM   8641  C  CD2 . PHE C 1 155 ? 12.298  -8.458  71.790  1.00 38.23 ? 169 PHE C CD2 1 
ATOM   8642  C  CE1 . PHE C 1 155 ? 10.291  -7.082  70.469  1.00 35.30 ? 169 PHE C CE1 1 
ATOM   8643  C  CE2 . PHE C 1 155 ? 12.432  -7.094  71.558  1.00 34.70 ? 169 PHE C CE2 1 
ATOM   8644  C  CZ  . PHE C 1 155 ? 11.427  -6.404  70.903  1.00 34.21 ? 169 PHE C CZ  1 
ATOM   8645  N  N   . PHE C 1 156 ? 9.810   -13.267 73.131  1.00 19.21 ? 170 PHE C N   1 
ATOM   8646  C  CA  . PHE C 1 156 ? 8.905   -14.402 73.194  1.00 22.37 ? 170 PHE C CA  1 
ATOM   8647  C  C   . PHE C 1 156 ? 7.861   -14.180 74.286  1.00 24.56 ? 170 PHE C C   1 
ATOM   8648  O  O   . PHE C 1 156 ? 6.666   -14.273 74.027  1.00 26.33 ? 170 PHE C O   1 
ATOM   8649  C  CB  . PHE C 1 156 ? 9.677   -15.711 73.422  1.00 20.56 ? 170 PHE C CB  1 
ATOM   8650  C  CG  . PHE C 1 156 ? 10.266  -16.307 72.164  1.00 27.08 ? 170 PHE C CG  1 
ATOM   8651  C  CD1 . PHE C 1 156 ? 10.020  -15.749 70.925  1.00 23.44 ? 170 PHE C CD1 1 
ATOM   8652  C  CD2 . PHE C 1 156 ? 11.071  -17.438 72.230  1.00 36.81 ? 170 PHE C CD2 1 
ATOM   8653  C  CE1 . PHE C 1 156 ? 10.555  -16.310 69.770  1.00 28.62 ? 170 PHE C CE1 1 
ATOM   8654  C  CE2 . PHE C 1 156 ? 11.614  -17.998 71.079  1.00 35.63 ? 170 PHE C CE2 1 
ATOM   8655  C  CZ  . PHE C 1 156 ? 11.351  -17.441 69.850  1.00 27.78 ? 170 PHE C CZ  1 
ATOM   8656  N  N   . ARG C 1 157 ? 8.305   -13.853 75.493  1.00 27.01 ? 171 ARG C N   1 
ATOM   8657  C  CA  . ARG C 1 157 ? 7.379   -13.697 76.621  1.00 31.24 ? 171 ARG C CA  1 
ATOM   8658  C  C   . ARG C 1 157 ? 6.432   -12.499 76.496  1.00 26.64 ? 171 ARG C C   1 
ATOM   8659  O  O   . ARG C 1 157 ? 5.225   -12.622 76.724  1.00 22.96 ? 171 ARG C O   1 
ATOM   8660  C  CB  . ARG C 1 157 ? 8.137   -13.607 77.952  1.00 28.42 ? 171 ARG C CB  1 
ATOM   8661  C  CG  . ARG C 1 157 ? 8.965   -14.854 78.287  1.00 26.09 ? 171 ARG C CG  1 
ATOM   8662  C  CD  . ARG C 1 157 ? 8.942   -15.149 79.784  1.00 26.51 ? 171 ARG C CD  1 
ATOM   8663  N  NE  . ARG C 1 157 ? 9.818   -16.260 80.151  1.00 29.44 ? 171 ARG C NE  1 
ATOM   8664  C  CZ  . ARG C 1 157 ? 11.062  -16.117 80.596  1.00 26.12 ? 171 ARG C CZ  1 
ATOM   8665  N  NH1 . ARG C 1 157 ? 11.588  -14.906 80.728  1.00 24.79 ? 171 ARG C NH1 1 
ATOM   8666  N  NH2 . ARG C 1 157 ? 11.787  -17.190 80.914  1.00 27.83 ? 171 ARG C NH2 1 
ATOM   8667  N  N   . PHE C 1 158 ? 6.979   -11.338 76.164  1.00 23.74 ? 172 PHE C N   1 
ATOM   8668  C  CA  . PHE C 1 158 ? 6.166   -10.125 76.088  1.00 29.33 ? 172 PHE C CA  1 
ATOM   8669  C  C   . PHE C 1 158 ? 5.223   -10.089 74.887  1.00 34.26 ? 172 PHE C C   1 
ATOM   8670  O  O   . PHE C 1 158 ? 4.126   -9.518  74.971  1.00 29.91 ? 172 PHE C O   1 
ATOM   8671  C  CB  . PHE C 1 158 ? 7.038   -8.878  76.137  1.00 29.57 ? 172 PHE C CB  1 
ATOM   8672  C  CG  . PHE C 1 158 ? 7.518   -8.538  77.518  1.00 30.34 ? 172 PHE C CG  1 
ATOM   8673  C  CD1 . PHE C 1 158 ? 6.743   -7.751  78.359  1.00 29.43 ? 172 PHE C CD1 1 
ATOM   8674  C  CD2 . PHE C 1 158 ? 8.731   -9.018  77.984  1.00 34.56 ? 172 PHE C CD2 1 
ATOM   8675  C  CE1 . PHE C 1 158 ? 7.172   -7.438  79.642  1.00 30.66 ? 172 PHE C CE1 1 
ATOM   8676  C  CE2 . PHE C 1 158 ? 9.172   -8.704  79.262  1.00 31.46 ? 172 PHE C CE2 1 
ATOM   8677  C  CZ  . PHE C 1 158 ? 8.389   -7.924  80.095  1.00 33.19 ? 172 PHE C CZ  1 
ATOM   8678  N  N   . ASN C 1 159 ? 5.645   -10.677 73.767  1.00 30.69 ? 173 ASN C N   1 
ATOM   8679  C  CA  . ASN C 1 159 ? 4.743   -10.804 72.631  1.00 26.25 ? 173 ASN C CA  1 
ATOM   8680  C  C   . ASN C 1 159 ? 3.581   -11.675 73.048  1.00 27.16 ? 173 ASN C C   1 
ATOM   8681  O  O   . ASN C 1 159 ? 2.433   -11.409 72.698  1.00 30.41 ? 173 ASN C O   1 
ATOM   8682  C  CB  . ASN C 1 159 ? 5.430   -11.438 71.430  1.00 22.72 ? 173 ASN C CB  1 
ATOM   8683  C  CG  . ASN C 1 159 ? 6.325   -10.472 70.693  1.00 27.66 ? 173 ASN C CG  1 
ATOM   8684  O  OD1 . ASN C 1 159 ? 6.281   -9.267  70.930  1.00 28.64 ? 173 ASN C OD1 1 
ATOM   8685  N  ND2 . ASN C 1 159 ? 7.149   -11.002 69.785  1.00 28.37 ? 173 ASN C ND2 1 
ATOM   8686  N  N   . ALA C 1 160 ? 3.888   -12.716 73.813  1.00 27.41 ? 174 ALA C N   1 
ATOM   8687  C  CA  . ALA C 1 160 ? 2.866   -13.661 74.229  1.00 31.05 ? 174 ALA C CA  1 
ATOM   8688  C  C   . ALA C 1 160 ? 1.852   -12.945 75.108  1.00 34.96 ? 174 ALA C C   1 
ATOM   8689  O  O   . ALA C 1 160 ? 0.647   -13.106 74.936  1.00 30.85 ? 174 ALA C O   1 
ATOM   8690  C  CB  . ALA C 1 160 ? 3.491   -14.846 74.952  1.00 28.18 ? 174 ALA C CB  1 
ATOM   8691  N  N   . LYS C 1 161 ? 2.354   -12.126 76.025  1.00 34.97 ? 175 LYS C N   1 
ATOM   8692  C  CA  . LYS C 1 161 ? 1.499   -11.318 76.878  1.00 35.69 ? 175 LYS C CA  1 
ATOM   8693  C  C   . LYS C 1 161 ? 0.636   -10.346 76.062  1.00 32.94 ? 175 LYS C C   1 
ATOM   8694  O  O   . LYS C 1 161 ? -0.576  -10.281 76.253  1.00 31.82 ? 175 LYS C O   1 
ATOM   8695  C  CB  . LYS C 1 161 ? 2.345   -10.554 77.899  1.00 35.01 ? 175 LYS C CB  1 
ATOM   8696  C  CG  . LYS C 1 161 ? 1.566   -9.563  78.759  1.00 37.68 ? 175 LYS C CG  1 
ATOM   8697  C  CD  . LYS C 1 161 ? 2.511   -8.619  79.491  1.00 39.79 ? 175 LYS C CD  1 
ATOM   8698  C  CE  . LYS C 1 161 ? 1.832   -7.304  79.863  1.00 42.58 ? 175 LYS C CE  1 
ATOM   8699  N  NZ  . LYS C 1 161 ? 1.192   -7.344  81.204  1.00 41.68 ? 175 LYS C NZ  1 
ATOM   8700  N  N   . TYR C 1 162 ? 1.255   -9.594  75.155  1.00 27.85 ? 176 TYR C N   1 
ATOM   8701  C  CA  . TYR C 1 162 ? 0.508   -8.634  74.344  1.00 30.08 ? 176 TYR C CA  1 
ATOM   8702  C  C   . TYR C 1 162 ? -0.596  -9.299  73.528  1.00 29.80 ? 176 TYR C C   1 
ATOM   8703  O  O   . TYR C 1 162 ? -1.714  -8.774  73.424  1.00 30.43 ? 176 TYR C O   1 
ATOM   8704  C  CB  . TYR C 1 162 ? 1.443   -7.866  73.410  1.00 27.78 ? 176 TYR C CB  1 
ATOM   8705  N  N   . ALA C 1 163 ? -0.290  -10.448 72.945  1.00 27.71 ? 177 ALA C N   1 
ATOM   8706  C  CA  . ALA C 1 163 ? -1.272  -11.122 72.112  1.00 32.79 ? 177 ALA C CA  1 
ATOM   8707  C  C   . ALA C 1 163 ? -2.459  -11.546 72.960  1.00 35.33 ? 177 ALA C C   1 
ATOM   8708  O  O   . ALA C 1 163 ? -3.610  -11.365 72.563  1.00 35.51 ? 177 ALA C O   1 
ATOM   8709  C  CB  . ALA C 1 163 ? -0.656  -12.319 71.411  1.00 26.46 ? 177 ALA C CB  1 
ATOM   8710  N  N   . VAL C 1 164 ? -2.177  -12.090 74.141  1.00 35.61 ? 178 VAL C N   1 
ATOM   8711  C  CA  . VAL C 1 164 ? -3.242  -12.567 75.020  1.00 37.28 ? 178 VAL C CA  1 
ATOM   8712  C  C   . VAL C 1 164 ? -4.067  -11.406 75.583  1.00 37.41 ? 178 VAL C C   1 
ATOM   8713  O  O   . VAL C 1 164 ? -5.293  -11.495 75.673  1.00 41.81 ? 178 VAL C O   1 
ATOM   8714  C  CB  . VAL C 1 164 ? -2.677  -13.454 76.147  1.00 41.20 ? 178 VAL C CB  1 
ATOM   8715  C  CG1 . VAL C 1 164 ? -3.705  -13.660 77.245  1.00 40.81 ? 178 VAL C CG1 1 
ATOM   8716  C  CG2 . VAL C 1 164 ? -2.214  -14.795 75.579  1.00 39.40 ? 178 VAL C CG2 1 
ATOM   8717  N  N   . GLU C 1 165 ? -3.400  -10.311 75.939  1.00 31.86 ? 179 GLU C N   1 
ATOM   8718  C  CA  . GLU C 1 165 ? -4.092  -9.120  76.433  1.00 39.45 ? 179 GLU C CA  1 
ATOM   8719  C  C   . GLU C 1 165 ? -4.944  -8.488  75.338  1.00 41.41 ? 179 GLU C C   1 
ATOM   8720  O  O   . GLU C 1 165 ? -6.009  -7.922  75.606  1.00 41.74 ? 179 GLU C O   1 
ATOM   8721  C  CB  . GLU C 1 165 ? -3.097  -8.082  76.959  1.00 37.13 ? 179 GLU C CB  1 
ATOM   8722  N  N   . LEU C 1 166 ? -4.460  -8.574  74.105  1.00 39.35 ? 180 LEU C N   1 
ATOM   8723  C  CA  . LEU C 1 166 ? -5.173  -8.006  72.973  1.00 46.37 ? 180 LEU C CA  1 
ATOM   8724  C  C   . LEU C 1 166 ? -6.467  -8.778  72.759  1.00 48.24 ? 180 LEU C C   1 
ATOM   8725  O  O   . LEU C 1 166 ? -7.513  -8.200  72.456  1.00 50.16 ? 180 LEU C O   1 
ATOM   8726  C  CB  . LEU C 1 166 ? -4.306  -8.052  71.717  1.00 46.58 ? 180 LEU C CB  1 
ATOM   8727  C  CG  . LEU C 1 166 ? -4.961  -7.554  70.432  1.00 45.38 ? 180 LEU C CG  1 
ATOM   8728  C  CD1 . LEU C 1 166 ? -5.184  -6.047  70.484  1.00 42.39 ? 180 LEU C CD1 1 
ATOM   8729  C  CD2 . LEU C 1 166 ? -4.116  -7.941  69.232  1.00 49.33 ? 180 LEU C CD2 1 
ATOM   8730  N  N   . GLU C 1 167 ? -6.389  -10.090 72.937  1.00 48.41 ? 181 GLU C N   1 
ATOM   8731  C  CA  . GLU C 1 167 ? -7.563  -10.941 72.851  1.00 49.68 ? 181 GLU C CA  1 
ATOM   8732  C  C   . GLU C 1 167 ? -8.606  -10.492 73.866  1.00 49.51 ? 181 GLU C C   1 
ATOM   8733  O  O   . GLU C 1 167 ? -9.803  -10.449 73.571  1.00 46.51 ? 181 GLU C O   1 
ATOM   8734  C  CB  . GLU C 1 167 ? -7.184  -12.397 73.110  1.00 55.01 ? 181 GLU C CB  1 
ATOM   8735  C  CG  . GLU C 1 167 ? -8.224  -13.383 72.624  1.00 60.10 ? 181 GLU C CG  1 
ATOM   8736  C  CD  . GLU C 1 167 ? -8.404  -13.310 71.122  1.00 61.46 ? 181 GLU C CD  1 
ATOM   8737  O  OE1 . GLU C 1 167 ? -9.520  -13.603 70.644  1.00 65.98 ? 181 GLU C OE1 1 
ATOM   8738  O  OE2 . GLU C 1 167 ? -7.427  -12.959 70.421  1.00 55.96 ? 181 GLU C OE2 1 
ATOM   8739  N  N   . GLY C 1 168 ? -8.135  -10.149 75.061  1.00 49.34 ? 182 GLY C N   1 
ATOM   8740  C  CA  . GLY C 1 168 ? -9.002  -9.676  76.125  1.00 52.13 ? 182 GLY C CA  1 
ATOM   8741  C  C   . GLY C 1 168 ? -9.662  -8.341  75.831  1.00 50.05 ? 182 GLY C C   1 
ATOM   8742  O  O   . GLY C 1 168 ? -10.657 -7.990  76.463  1.00 51.55 ? 182 GLY C O   1 
ATOM   8743  N  N   . GLN C 1 169 ? -9.109  -7.593  74.878  1.00 49.78 ? 183 GLN C N   1 
ATOM   8744  C  CA  . GLN C 1 169 ? -9.649  -6.284  74.516  1.00 50.10 ? 183 GLN C CA  1 
ATOM   8745  C  C   . GLN C 1 169 ? -10.896 -6.432  73.642  1.00 52.15 ? 183 GLN C C   1 
ATOM   8746  O  O   . GLN C 1 169 ? -10.798 -6.573  72.422  1.00 50.38 ? 183 GLN C O   1 
ATOM   8747  C  CB  . GLN C 1 169 ? -8.590  -5.440  73.803  1.00 42.62 ? 183 GLN C CB  1 
ATOM   8748  N  N   . GLN C 1 170 ? -12.062 -6.392  74.282  1.00 55.73 ? 184 GLN C N   1 
ATOM   8749  C  CA  . GLN C 1 170 ? -13.334 -6.674  73.617  1.00 58.19 ? 184 GLN C CA  1 
ATOM   8750  C  C   . GLN C 1 170 ? -14.333 -5.530  73.807  1.00 62.75 ? 184 GLN C C   1 
ATOM   8751  O  O   . GLN C 1 170 ? -14.360 -4.903  74.865  1.00 61.54 ? 184 GLN C O   1 
ATOM   8752  C  CB  . GLN C 1 170 ? -13.926 -7.986  74.148  1.00 52.78 ? 184 GLN C CB  1 
ATOM   8753  C  CG  . GLN C 1 170 ? -13.134 -9.235  73.770  1.00 44.19 ? 184 GLN C CG  1 
ATOM   8754  C  CD  . GLN C 1 170 ? -13.153 -9.518  72.272  1.00 42.88 ? 184 GLN C CD  1 
ATOM   8755  O  OE1 . GLN C 1 170 ? -14.147 -9.260  71.590  1.00 43.31 ? 184 GLN C OE1 1 
ATOM   8756  N  NE2 . GLN C 1 170 ? -12.052 -10.054 71.755  1.00 37.69 ? 184 GLN C NE2 1 
ATOM   8757  N  N   . PRO C 1 171 ? -15.165 -5.262  72.781  1.00 65.84 ? 185 PRO C N   1 
ATOM   8758  C  CA  . PRO C 1 171 ? -16.111 -4.140  72.832  1.00 65.95 ? 185 PRO C CA  1 
ATOM   8759  C  C   . PRO C 1 171 ? -17.284 -4.396  73.779  1.00 65.72 ? 185 PRO C C   1 
ATOM   8760  O  O   . PRO C 1 171 ? -17.577 -5.554  74.103  1.00 62.16 ? 185 PRO C O   1 
ATOM   8761  C  CB  . PRO C 1 171 ? -16.613 -4.046  71.388  1.00 65.27 ? 185 PRO C CB  1 
ATOM   8762  C  CG  . PRO C 1 171 ? -16.518 -5.440  70.880  1.00 67.95 ? 185 PRO C CG  1 
ATOM   8763  C  CD  . PRO C 1 171 ? -15.293 -6.032  71.529  1.00 66.93 ? 185 PRO C CD  1 
ATOM   8764  N  N   . ILE C 1 172 ? -17.934 -3.319  74.218  1.00 68.84 ? 186 ILE C N   1 
ATOM   8765  C  CA  . ILE C 1 172 ? -19.125 -3.413  75.058  1.00 68.86 ? 186 ILE C CA  1 
ATOM   8766  C  C   . ILE C 1 172 ? -20.330 -3.806  74.209  1.00 68.49 ? 186 ILE C C   1 
ATOM   8767  O  O   . ILE C 1 172 ? -20.495 -3.319  73.090  1.00 65.03 ? 186 ILE C O   1 
ATOM   8768  C  CB  . ILE C 1 172 ? -19.420 -2.084  75.781  1.00 66.69 ? 186 ILE C CB  1 
ATOM   8769  N  N   . SER C 1 173 ? -21.167 -4.692  74.743  1.00 70.55 ? 187 SER C N   1 
ATOM   8770  C  CA  . SER C 1 173 ? -22.305 -5.221  73.997  1.00 74.20 ? 187 SER C CA  1 
ATOM   8771  C  C   . SER C 1 173 ? -23.649 -4.710  74.521  1.00 77.53 ? 187 SER C C   1 
ATOM   8772  O  O   . SER C 1 173 ? -24.226 -5.280  75.450  1.00 79.42 ? 187 SER C O   1 
ATOM   8773  C  CB  . SER C 1 173 ? -22.282 -6.751  74.006  1.00 74.24 ? 187 SER C CB  1 
ATOM   8774  O  OG  . SER C 1 173 ? -21.070 -7.239  73.460  1.00 73.27 ? 187 SER C OG  1 
ATOM   8775  N  N   . VAL C 1 174 ? -24.140 -3.636  73.913  1.00 77.16 ? 188 VAL C N   1 
ATOM   8776  C  CA  . VAL C 1 174 ? -25.435 -3.071  74.275  1.00 80.13 ? 188 VAL C CA  1 
ATOM   8777  C  C   . VAL C 1 174 ? -26.538 -3.647  73.388  1.00 83.17 ? 188 VAL C C   1 
ATOM   8778  O  O   . VAL C 1 174 ? -26.513 -3.458  72.170  1.00 83.20 ? 188 VAL C O   1 
ATOM   8779  C  CB  . VAL C 1 174 ? -25.431 -1.535  74.148  1.00 76.61 ? 188 VAL C CB  1 
ATOM   8780  N  N   . PRO C 1 175 ? -27.503 -4.360  74.001  1.00 84.63 ? 189 PRO C N   1 
ATOM   8781  C  CA  . PRO C 1 175 ? -28.650 -4.985  73.327  1.00 83.65 ? 189 PRO C CA  1 
ATOM   8782  C  C   . PRO C 1 175 ? -29.345 -4.090  72.287  1.00 79.01 ? 189 PRO C C   1 
ATOM   8783  O  O   . PRO C 1 175 ? -29.243 -2.864  72.361  1.00 76.11 ? 189 PRO C O   1 
ATOM   8784  C  CB  . PRO C 1 175 ? -29.584 -5.318  74.493  1.00 84.74 ? 189 PRO C CB  1 
ATOM   8785  C  CG  . PRO C 1 175 ? -28.647 -5.661  75.588  1.00 85.75 ? 189 PRO C CG  1 
ATOM   8786  C  CD  . PRO C 1 175 ? -27.472 -4.710  75.433  1.00 85.31 ? 189 PRO C CD  1 
ATOM   8787  N  N   . PRO C 1 176 ? -30.039 -4.701  71.312  1.00 77.89 ? 190 PRO C N   1 
ATOM   8788  C  CA  . PRO C 1 176 ? -30.240 -6.150  71.185  1.00 78.00 ? 190 PRO C CA  1 
ATOM   8789  C  C   . PRO C 1 176 ? -29.077 -6.832  70.466  1.00 72.85 ? 190 PRO C C   1 
ATOM   8790  O  O   . PRO C 1 176 ? -29.262 -7.884  69.851  1.00 71.52 ? 190 PRO C O   1 
ATOM   8791  C  CB  . PRO C 1 176 ? -31.512 -6.238  70.340  1.00 80.15 ? 190 PRO C CB  1 
ATOM   8792  C  CG  . PRO C 1 176 ? -31.431 -5.033  69.443  1.00 78.14 ? 190 PRO C CG  1 
ATOM   8793  C  CD  . PRO C 1 176 ? -30.683 -3.959  70.212  1.00 76.32 ? 190 PRO C CD  1 
ATOM   8794  N  N   . SER C 1 177 ? -27.890 -6.241  70.547  1.00 66.95 ? 191 SER C N   1 
ATOM   8795  C  CA  . SER C 1 177 ? -26.758 -6.753  69.796  1.00 66.45 ? 191 SER C CA  1 
ATOM   8796  C  C   . SER C 1 177 ? -25.516 -7.075  70.625  1.00 65.04 ? 191 SER C C   1 
ATOM   8797  O  O   . SER C 1 177 ? -25.179 -6.368  71.573  1.00 66.37 ? 191 SER C O   1 
ATOM   8798  C  CB  . SER C 1 177 ? -26.403 -5.815  68.637  1.00 68.95 ? 191 SER C CB  1 
ATOM   8799  O  OG  . SER C 1 177 ? -25.945 -4.564  69.109  1.00 71.16 ? 191 SER C OG  1 
ATOM   8800  N  N   . THR C 1 178 ? -24.847 -8.160  70.243  1.00 64.12 ? 192 THR C N   1 
ATOM   8801  C  CA  . THR C 1 178 ? -23.576 -8.570  70.832  1.00 61.48 ? 192 THR C CA  1 
ATOM   8802  C  C   . THR C 1 178 ? -22.434 -8.167  69.899  1.00 55.69 ? 192 THR C C   1 
ATOM   8803  O  O   . THR C 1 178 ? -22.585 -8.209  68.676  1.00 52.11 ? 192 THR C O   1 
ATOM   8804  C  CB  . THR C 1 178 ? -23.528 -10.106 71.046  1.00 51.80 ? 192 THR C CB  1 
ATOM   8805  O  OG1 . THR C 1 178 ? -24.597 -10.510 71.911  1.00 55.42 ? 192 THR C OG1 1 
ATOM   8806  C  CG2 . THR C 1 178 ? -22.207 -10.533 71.659  1.00 52.08 ? 192 THR C CG2 1 
ATOM   8807  N  N   . ASN C 1 179 ? -21.300 -7.772  70.472  1.00 50.51 ? 193 ASN C N   1 
ATOM   8808  C  CA  . ASN C 1 179 ? -20.125 -7.434  69.681  1.00 41.52 ? 193 ASN C CA  1 
ATOM   8809  C  C   . ASN C 1 179 ? -18.886 -8.216  70.111  1.00 52.36 ? 193 ASN C C   1 
ATOM   8810  O  O   . ASN C 1 179 ? -18.620 -8.384  71.303  1.00 59.81 ? 193 ASN C O   1 
ATOM   8811  C  CB  . ASN C 1 179 ? -19.848 -5.935  69.744  1.00 39.86 ? 193 ASN C CB  1 
ATOM   8812  N  N   . SER C 1 180 ? -18.128 -8.687  69.128  1.00 46.48 ? 194 SER C N   1 
ATOM   8813  C  CA  . SER C 1 180 ? -16.911 -9.432  69.381  1.00 43.86 ? 194 SER C CA  1 
ATOM   8814  C  C   . SER C 1 180 ? -15.873 -9.020  68.363  1.00 41.09 ? 194 SER C C   1 
ATOM   8815  O  O   . SER C 1 180 ? -16.201 -8.675  67.232  1.00 37.83 ? 194 SER C O   1 
ATOM   8816  C  CB  . SER C 1 180 ? -17.169 -10.931 69.276  1.00 48.91 ? 194 SER C CB  1 
ATOM   8817  O  OG  . SER C 1 180 ? -18.249 -11.315 70.107  1.00 57.05 ? 194 SER C OG  1 
ATOM   8818  N  N   . THR C 1 181 ? -14.618 -9.046  68.781  1.00 41.80 ? 195 THR C N   1 
ATOM   8819  C  CA  . THR C 1 181 ? -13.506 -8.782  67.887  1.00 40.77 ? 195 THR C CA  1 
ATOM   8820  C  C   . THR C 1 181 ? -12.665 -10.045 67.806  1.00 36.62 ? 195 THR C C   1 
ATOM   8821  O  O   . THR C 1 181 ? -12.275 -10.611 68.829  1.00 35.95 ? 195 THR C O   1 
ATOM   8822  C  CB  . THR C 1 181 ? -12.658 -7.608  68.387  1.00 40.05 ? 195 THR C CB  1 
ATOM   8823  O  OG1 . THR C 1 181 ? -13.506 -6.479  68.610  1.00 40.96 ? 195 THR C OG1 1 
ATOM   8824  C  CG2 . THR C 1 181 ? -11.586 -7.241  67.373  1.00 37.41 ? 195 THR C CG2 1 
ATOM   8825  N  N   . VAL C 1 182 ? -12.422 -10.502 66.583  1.00 32.00 ? 196 VAL C N   1 
ATOM   8826  C  CA  . VAL C 1 182 ? -11.633 -11.699 66.348  1.00 32.26 ? 196 VAL C CA  1 
ATOM   8827  C  C   . VAL C 1 182 ? -10.336 -11.273 65.674  1.00 32.47 ? 196 VAL C C   1 
ATOM   8828  O  O   . VAL C 1 182 ? -10.353 -10.630 64.626  1.00 31.28 ? 196 VAL C O   1 
ATOM   8829  C  CB  . VAL C 1 182 ? -12.387 -12.705 65.453  1.00 35.24 ? 196 VAL C CB  1 
ATOM   8830  C  CG1 . VAL C 1 182 ? -11.506 -13.905 65.139  1.00 38.82 ? 196 VAL C CG1 1 
ATOM   8831  C  CG2 . VAL C 1 182 ? -13.663 -13.153 66.128  1.00 35.97 ? 196 VAL C CG2 1 
ATOM   8832  N  N   . TYR C 1 183 ? -9.203  -11.602 66.281  1.00 29.38 ? 197 TYR C N   1 
ATOM   8833  C  CA  . TYR C 1 183 ? -7.942  -11.176 65.700  1.00 30.65 ? 197 TYR C CA  1 
ATOM   8834  C  C   . TYR C 1 183 ? -7.415  -12.250 64.758  1.00 29.62 ? 197 TYR C C   1 
ATOM   8835  O  O   . TYR C 1 183 ? -6.877  -13.258 65.197  1.00 39.26 ? 197 TYR C O   1 
ATOM   8836  C  CB  . TYR C 1 183 ? -6.934  -10.808 66.800  1.00 31.85 ? 197 TYR C CB  1 
ATOM   8837  C  CG  . TYR C 1 183 ? -7.407  -9.636  67.617  1.00 31.89 ? 197 TYR C CG  1 
ATOM   8838  C  CD1 . TYR C 1 183 ? -7.107  -8.332  67.241  1.00 31.76 ? 197 TYR C CD1 1 
ATOM   8839  C  CD2 . TYR C 1 183 ? -8.187  -9.828  68.748  1.00 33.54 ? 197 TYR C CD2 1 
ATOM   8840  C  CE1 . TYR C 1 183 ? -7.566  -7.253  67.979  1.00 33.76 ? 197 TYR C CE1 1 
ATOM   8841  C  CE2 . TYR C 1 183 ? -8.642  -8.761  69.487  1.00 36.29 ? 197 TYR C CE2 1 
ATOM   8842  C  CZ  . TYR C 1 183 ? -8.331  -7.475  69.100  1.00 38.82 ? 197 TYR C CZ  1 
ATOM   8843  O  OH  . TYR C 1 183 ? -8.794  -6.413  69.848  1.00 46.00 ? 197 TYR C OH  1 
ATOM   8844  N  N   . ARG C 1 184 ? -7.597  -12.035 63.458  1.00 26.87 ? 198 ARG C N   1 
ATOM   8845  C  CA  . ARG C 1 184 ? -7.208  -13.034 62.467  1.00 26.30 ? 198 ARG C CA  1 
ATOM   8846  C  C   . ARG C 1 184 ? -5.743  -12.924 62.075  1.00 26.83 ? 198 ARG C C   1 
ATOM   8847  O  O   . ARG C 1 184 ? -5.222  -11.829 61.859  1.00 26.24 ? 198 ARG C O   1 
ATOM   8848  C  CB  . ARG C 1 184 ? -8.063  -12.895 61.205  1.00 28.98 ? 198 ARG C CB  1 
ATOM   8849  C  CG  . ARG C 1 184 ? -9.569  -13.014 61.433  1.00 25.70 ? 198 ARG C CG  1 
ATOM   8850  C  CD  . ARG C 1 184 ? -10.337 -12.552 60.198  1.00 24.81 ? 198 ARG C CD  1 
ATOM   8851  N  NE  . ARG C 1 184 ? -10.022 -11.168 59.859  1.00 28.59 ? 198 ARG C NE  1 
ATOM   8852  C  CZ  . ARG C 1 184 ? -10.621 -10.475 58.894  1.00 28.85 ? 198 ARG C CZ  1 
ATOM   8853  N  NH1 . ARG C 1 184 ? -11.571 -11.037 58.154  1.00 23.04 ? 198 ARG C NH1 1 
ATOM   8854  N  NH2 . ARG C 1 184 ? -10.262 -9.222  58.658  1.00 24.03 ? 198 ARG C NH2 1 
ATOM   8855  N  N   . GLY C 1 185 ? -5.083  -14.070 61.970  1.00 23.53 ? 199 GLY C N   1 
ATOM   8856  C  CA  . GLY C 1 185 ? -3.811  -14.129 61.288  1.00 26.70 ? 199 GLY C CA  1 
ATOM   8857  C  C   . GLY C 1 185 ? -4.020  -13.755 59.833  1.00 25.95 ? 199 GLY C C   1 
ATOM   8858  O  O   . GLY C 1 185 ? -5.127  -13.881 59.290  1.00 27.81 ? 199 GLY C O   1 
ATOM   8859  N  N   . LEU C 1 186 ? -2.957  -13.303 59.185  1.00 26.18 ? 200 LEU C N   1 
ATOM   8860  C  CA  . LEU C 1 186 ? -3.066  -12.858 57.801  1.00 27.01 ? 200 LEU C CA  1 
ATOM   8861  C  C   . LEU C 1 186 ? -3.207  -14.029 56.857  1.00 30.66 ? 200 LEU C C   1 
ATOM   8862  O  O   . LEU C 1 186 ? -2.586  -15.087 57.051  1.00 28.58 ? 200 LEU C O   1 
ATOM   8863  C  CB  . LEU C 1 186 ? -1.844  -12.031 57.416  1.00 23.86 ? 200 LEU C CB  1 
ATOM   8864  C  CG  . LEU C 1 186 ? -1.575  -10.821 58.295  1.00 26.30 ? 200 LEU C CG  1 
ATOM   8865  C  CD1 . LEU C 1 186 ? -0.306  -10.137 57.829  1.00 25.68 ? 200 LEU C CD1 1 
ATOM   8866  C  CD2 . LEU C 1 186 ? -2.777  -9.868  58.254  1.00 23.25 ? 200 LEU C CD2 1 
ATOM   8867  N  N   . GLU C 1 187 ? -4.022  -13.844 55.827  1.00 28.63 ? 201 GLU C N   1 
ATOM   8868  C  CA  . GLU C 1 187 ? -4.305  -14.916 54.879  1.00 31.35 ? 201 GLU C CA  1 
ATOM   8869  C  C   . GLU C 1 187 ? -3.223  -15.021 53.812  1.00 31.46 ? 201 GLU C C   1 
ATOM   8870  O  O   . GLU C 1 187 ? -3.143  -14.189 52.913  1.00 32.64 ? 201 GLU C O   1 
ATOM   8871  C  CB  . GLU C 1 187 ? -5.687  -14.721 54.233  1.00 30.80 ? 201 GLU C CB  1 
ATOM   8872  C  CG  . GLU C 1 187 ? -6.044  -15.818 53.254  1.00 35.33 ? 201 GLU C CG  1 
ATOM   8873  C  CD  . GLU C 1 187 ? -7.476  -15.728 52.753  1.00 43.26 ? 201 GLU C CD  1 
ATOM   8874  O  OE1 . GLU C 1 187 ? -8.100  -14.651 52.894  1.00 36.37 ? 201 GLU C OE1 1 
ATOM   8875  O  OE2 . GLU C 1 187 ? -7.970  -16.743 52.220  1.00 43.50 ? 201 GLU C OE2 1 
ATOM   8876  N  N   . GLY C 1 188 ? -2.386  -16.048 53.925  1.00 25.20 ? 202 GLY C N   1 
ATOM   8877  C  CA  . GLY C 1 188 ? -1.257  -16.229 53.032  1.00 28.24 ? 202 GLY C CA  1 
ATOM   8878  C  C   . GLY C 1 188 ? -0.047  -16.692 53.829  1.00 26.68 ? 202 GLY C C   1 
ATOM   8879  O  O   . GLY C 1 188 ? -0.228  -17.317 54.873  1.00 22.29 ? 202 GLY C O   1 
ATOM   8880  N  N   . PHE C 1 189 ? 1.169   -16.393 53.357  1.00 24.23 ? 203 PHE C N   1 
ATOM   8881  C  CA  . PHE C 1 189 ? 2.379   -16.623 54.170  1.00 22.55 ? 203 PHE C CA  1 
ATOM   8882  C  C   . PHE C 1 189 ? 3.192   -15.342 54.343  1.00 23.68 ? 203 PHE C C   1 
ATOM   8883  O  O   . PHE C 1 189 ? 3.156   -14.447 53.495  1.00 23.88 ? 203 PHE C O   1 
ATOM   8884  C  CB  . PHE C 1 189 ? 3.275   -17.731 53.585  1.00 20.85 ? 203 PHE C CB  1 
ATOM   8885  C  CG  . PHE C 1 189 ? 4.094   -17.296 52.391  1.00 19.55 ? 203 PHE C CG  1 
ATOM   8886  C  CD1 . PHE C 1 189 ? 3.551   -17.300 51.125  1.00 20.96 ? 203 PHE C CD1 1 
ATOM   8887  C  CD2 . PHE C 1 189 ? 5.406   -16.879 52.543  1.00 16.43 ? 203 PHE C CD2 1 
ATOM   8888  C  CE1 . PHE C 1 189 ? 4.289   -16.883 50.027  1.00 23.01 ? 203 PHE C CE1 1 
ATOM   8889  C  CE2 . PHE C 1 189 ? 6.153   -16.472 51.450  1.00 19.06 ? 203 PHE C CE2 1 
ATOM   8890  C  CZ  . PHE C 1 189 ? 5.596   -16.470 50.194  1.00 19.69 ? 203 PHE C CZ  1 
ATOM   8891  N  N   . VAL C 1 190 ? 3.939   -15.281 55.439  1.00 24.64 ? 204 VAL C N   1 
ATOM   8892  C  CA  . VAL C 1 190 ? 4.835   -14.174 55.702  1.00 18.80 ? 204 VAL C CA  1 
ATOM   8893  C  C   . VAL C 1 190 ? 6.274   -14.626 55.457  1.00 26.78 ? 204 VAL C C   1 
ATOM   8894  O  O   . VAL C 1 190 ? 6.664   -15.720 55.879  1.00 24.73 ? 204 VAL C O   1 
ATOM   8895  C  CB  . VAL C 1 190 ? 4.682   -13.686 57.167  1.00 20.48 ? 204 VAL C CB  1 
ATOM   8896  C  CG1 . VAL C 1 190 ? 5.781   -12.667 57.529  1.00 19.36 ? 204 VAL C CG1 1 
ATOM   8897  C  CG2 . VAL C 1 190 ? 3.306   -13.076 57.391  1.00 23.50 ? 204 VAL C CG2 1 
ATOM   8898  N  N   . ALA C 1 191 ? 7.064   -13.800 54.776  1.00 20.90 ? 205 ALA C N   1 
ATOM   8899  C  CA  . ALA C 1 191 ? 8.488   -14.099 54.606  1.00 19.63 ? 205 ALA C CA  1 
ATOM   8900  C  C   . ALA C 1 191 ? 9.331   -13.333 55.634  1.00 20.29 ? 205 ALA C C   1 
ATOM   8901  O  O   . ALA C 1 191 ? 9.274   -12.107 55.704  1.00 20.94 ? 205 ALA C O   1 
ATOM   8902  C  CB  . ALA C 1 191 ? 8.956   -13.779 53.180  1.00 21.20 ? 205 ALA C CB  1 
ATOM   8903  N  N   . ALA C 1 192 ? 10.102  -14.062 56.431  1.00 19.56 ? 206 ALA C N   1 
ATOM   8904  C  CA  . ALA C 1 192 ? 10.972  -13.440 57.422  1.00 22.05 ? 206 ALA C CA  1 
ATOM   8905  C  C   . ALA C 1 192 ? 12.400  -13.440 56.880  1.00 21.14 ? 206 ALA C C   1 
ATOM   8906  O  O   . ALA C 1 192 ? 12.982  -14.504 56.642  1.00 20.58 ? 206 ALA C O   1 
ATOM   8907  C  CB  . ALA C 1 192 ? 10.896  -14.192 58.735  1.00 21.81 ? 206 ALA C CB  1 
ATOM   8908  N  N   . ILE C 1 193 ? 12.951  -12.245 56.676  1.00 19.75 ? 207 ILE C N   1 
ATOM   8909  C  CA  . ILE C 1 193 ? 14.189  -12.105 55.935  1.00 23.52 ? 207 ILE C CA  1 
ATOM   8910  C  C   . ILE C 1 193 ? 15.267  -11.348 56.698  1.00 24.38 ? 207 ILE C C   1 
ATOM   8911  O  O   . ILE C 1 193 ? 15.082  -10.192 57.079  1.00 20.95 ? 207 ILE C O   1 
ATOM   8912  C  CB  . ILE C 1 193 ? 13.953  -11.385 54.593  1.00 21.83 ? 207 ILE C CB  1 
ATOM   8913  C  CG1 . ILE C 1 193 ? 12.908  -12.129 53.762  1.00 23.42 ? 207 ILE C CG1 1 
ATOM   8914  C  CG2 . ILE C 1 193 ? 15.233  -11.282 53.813  1.00 24.08 ? 207 ILE C CG2 1 
ATOM   8915  C  CD1 . ILE C 1 193 ? 12.438  -11.350 52.532  1.00 29.75 ? 207 ILE C CD1 1 
ATOM   8916  N  N   . SER C 1 194 ? 16.406  -11.993 56.908  1.00 22.00 ? 208 SER C N   1 
ATOM   8917  C  CA  . SER C 1 194 ? 17.588  -11.246 57.362  1.00 33.45 ? 208 SER C CA  1 
ATOM   8918  C  C   . SER C 1 194 ? 18.757  -11.511 56.428  1.00 40.30 ? 208 SER C C   1 
ATOM   8919  O  O   . SER C 1 194 ? 18.915  -12.633 55.944  1.00 43.48 ? 208 SER C O   1 
ATOM   8920  C  CB  . SER C 1 194 ? 17.945  -11.606 58.797  1.00 33.88 ? 208 SER C CB  1 
ATOM   8921  O  OG  . SER C 1 194 ? 18.185  -12.993 58.913  1.00 36.31 ? 208 SER C OG  1 
ATOM   8922  N  N   . PRO C 1 195 ? 19.593  -10.488 56.177  1.00 44.23 ? 209 PRO C N   1 
ATOM   8923  C  CA  . PRO C 1 195 ? 20.613  -10.626 55.127  1.00 46.75 ? 209 PRO C CA  1 
ATOM   8924  C  C   . PRO C 1 195 ? 21.644  -11.704 55.462  1.00 50.81 ? 209 PRO C C   1 
ATOM   8925  O  O   . PRO C 1 195 ? 21.838  -12.016 56.646  1.00 41.49 ? 209 PRO C O   1 
ATOM   8926  C  CB  . PRO C 1 195 ? 21.264  -9.243  55.086  1.00 52.65 ? 209 PRO C CB  1 
ATOM   8927  C  CG  . PRO C 1 195 ? 21.085  -8.707  56.471  1.00 51.50 ? 209 PRO C CG  1 
ATOM   8928  C  CD  . PRO C 1 195 ? 19.774  -9.259  56.969  1.00 49.30 ? 209 PRO C CD  1 
ATOM   8929  N  N   . PHE C 1 196 ? 22.279  -12.259 54.427  1.00 55.83 ? 210 PHE C N   1 
ATOM   8930  C  CA  . PHE C 1 196 ? 23.228  -13.371 54.564  1.00 53.53 ? 210 PHE C CA  1 
ATOM   8931  C  C   . PHE C 1 196 ? 24.326  -13.121 55.598  1.00 56.94 ? 210 PHE C C   1 
ATOM   8932  O  O   . PHE C 1 196 ? 24.706  -14.027 56.330  1.00 58.50 ? 210 PHE C O   1 
ATOM   8933  C  CB  . PHE C 1 196 ? 23.870  -13.706 53.210  1.00 48.59 ? 210 PHE C CB  1 
ATOM   8934  N  N   . ASN C 1 197 ? 24.837  -11.898 55.668  1.00 58.65 ? 211 ASN C N   1 
ATOM   8935  C  CA  . ASN C 1 197 ? 25.919  -11.624 56.608  1.00 59.91 ? 211 ASN C CA  1 
ATOM   8936  C  C   . ASN C 1 197 ? 25.509  -10.765 57.813  1.00 59.61 ? 211 ASN C C   1 
ATOM   8937  O  O   . ASN C 1 197 ? 26.319  -10.018 58.363  1.00 58.11 ? 211 ASN C O   1 
ATOM   8938  C  CB  . ASN C 1 197 ? 27.158  -11.066 55.885  1.00 62.16 ? 211 ASN C CB  1 
ATOM   8939  C  CG  . ASN C 1 197 ? 27.058  -9.577  55.587  1.00 64.25 ? 211 ASN C CG  1 
ATOM   8940  O  OD1 . ASN C 1 197 ? 25.967  -9.033  55.383  1.00 59.17 ? 211 ASN C OD1 1 
ATOM   8941  N  ND2 . ASN C 1 197 ? 28.209  -8.907  55.566  1.00 67.17 ? 211 ASN C ND2 1 
ATOM   8942  N  N   . PHE C 1 198 ? 24.252  -10.890 58.230  1.00 57.87 ? 212 PHE C N   1 
ATOM   8943  C  CA  . PHE C 1 198 ? 23.780  -10.163 59.404  1.00 56.13 ? 212 PHE C CA  1 
ATOM   8944  C  C   . PHE C 1 198 ? 24.353  -10.722 60.709  1.00 50.45 ? 212 PHE C C   1 
ATOM   8945  O  O   . PHE C 1 198 ? 24.700  -11.907 60.819  1.00 46.26 ? 212 PHE C O   1 
ATOM   8946  C  CB  . PHE C 1 198 ? 22.247  -10.119 59.477  1.00 59.54 ? 212 PHE C CB  1 
ATOM   8947  C  CG  . PHE C 1 198 ? 21.718  -9.008  60.351  1.00 64.26 ? 212 PHE C CG  1 
ATOM   8948  C  CD1 . PHE C 1 198 ? 22.464  -7.850  60.553  1.00 64.98 ? 212 PHE C CD1 1 
ATOM   8949  C  CD2 . PHE C 1 198 ? 20.492  -9.124  60.979  1.00 64.64 ? 212 PHE C CD2 1 
ATOM   8950  C  CE1 . PHE C 1 198 ? 21.995  -6.831  61.360  1.00 62.54 ? 212 PHE C CE1 1 
ATOM   8951  C  CE2 . PHE C 1 198 ? 20.016  -8.105  61.787  1.00 64.45 ? 212 PHE C CE2 1 
ATOM   8952  C  CZ  . PHE C 1 198 ? 20.770  -6.957  61.977  1.00 62.94 ? 212 PHE C CZ  1 
ATOM   8953  N  N   . THR C 1 199 ? 24.429  -9.848  61.702  1.00 46.65 ? 213 THR C N   1 
ATOM   8954  C  CA  . THR C 1 199 ? 25.021  -10.176 62.981  1.00 54.38 ? 213 THR C CA  1 
ATOM   8955  C  C   . THR C 1 199 ? 24.005  -10.710 63.988  1.00 53.64 ? 213 THR C C   1 
ATOM   8956  O  O   . THR C 1 199 ? 24.384  -11.099 65.101  1.00 51.83 ? 213 THR C O   1 
ATOM   8957  C  CB  . THR C 1 199 ? 25.714  -8.940  63.567  1.00 58.43 ? 213 THR C CB  1 
ATOM   8958  O  OG1 . THR C 1 199 ? 24.849  -7.803  63.440  1.00 61.27 ? 213 THR C OG1 1 
ATOM   8959  C  CG2 . THR C 1 199 ? 27.022  -8.666  62.822  1.00 57.04 ? 213 THR C CG2 1 
ATOM   8960  N  N   . ALA C 1 200 ? 22.730  -10.749 63.591  1.00 45.07 ? 214 ALA C N   1 
ATOM   8961  C  CA  . ALA C 1 200 ? 21.652  -11.127 64.511  1.00 40.90 ? 214 ALA C CA  1 
ATOM   8962  C  C   . ALA C 1 200 ? 20.822  -12.330 64.055  1.00 37.55 ? 214 ALA C C   1 
ATOM   8963  O  O   . ALA C 1 200 ? 20.672  -12.583 62.858  1.00 34.43 ? 214 ALA C O   1 
ATOM   8964  C  CB  . ALA C 1 200 ? 20.739  -9.925  64.791  1.00 39.29 ? 214 ALA C CB  1 
ATOM   8965  N  N   . ILE C 1 201 ? 20.285  -13.072 65.020  1.00 37.01 ? 215 ILE C N   1 
ATOM   8966  C  CA  . ILE C 1 201 ? 19.356  -14.154 64.708  1.00 35.49 ? 215 ILE C CA  1 
ATOM   8967  C  C   . ILE C 1 201 ? 18.074  -13.571 64.096  1.00 39.29 ? 215 ILE C C   1 
ATOM   8968  O  O   . ILE C 1 201 ? 17.578  -14.053 63.075  1.00 36.21 ? 215 ILE C O   1 
ATOM   8969  C  CB  . ILE C 1 201 ? 19.010  -14.988 65.960  1.00 32.02 ? 215 ILE C CB  1 
ATOM   8970  C  CG1 . ILE C 1 201 ? 20.260  -15.718 66.475  1.00 33.96 ? 215 ILE C CG1 1 
ATOM   8971  C  CG2 . ILE C 1 201 ? 17.893  -15.985 65.652  1.00 29.76 ? 215 ILE C CG2 1 
ATOM   8972  C  CD1 . ILE C 1 201 ? 20.043  -16.483 67.779  1.00 31.74 ? 215 ILE C CD1 1 
ATOM   8973  N  N   . GLY C 1 202 ? 17.561  -12.513 64.716  1.00 32.35 ? 216 GLY C N   1 
ATOM   8974  C  CA  . GLY C 1 202 ? 16.293  -11.933 64.319  1.00 33.93 ? 216 GLY C CA  1 
ATOM   8975  C  C   . GLY C 1 202 ? 15.149  -12.908 64.546  1.00 42.01 ? 216 GLY C C   1 
ATOM   8976  O  O   . GLY C 1 202 ? 14.211  -12.974 63.742  1.00 42.91 ? 216 GLY C O   1 
ATOM   8977  N  N   . GLY C 1 203 ? 15.231  -13.660 65.645  1.00 40.72 ? 217 GLY C N   1 
ATOM   8978  C  CA  . GLY C 1 203 ? 14.217  -14.634 66.009  1.00 37.96 ? 217 GLY C CA  1 
ATOM   8979  C  C   . GLY C 1 203 ? 12.816  -14.048 66.025  1.00 38.66 ? 217 GLY C C   1 
ATOM   8980  O  O   . GLY C 1 203 ? 11.841  -14.738 65.707  1.00 35.71 ? 217 GLY C O   1 
ATOM   8981  N  N   . ASN C 1 204 ? 12.713  -12.766 66.372  1.00 33.92 ? 218 ASN C N   1 
ATOM   8982  C  CA  . ASN C 1 204 ? 11.418  -12.100 66.417  1.00 30.17 ? 218 ASN C CA  1 
ATOM   8983  C  C   . ASN C 1 204 ? 10.822  -11.878 65.021  1.00 27.56 ? 218 ASN C C   1 
ATOM   8984  O  O   . ASN C 1 204 ? 9.593   -11.694 64.869  1.00 22.94 ? 218 ASN C O   1 
ATOM   8985  C  CB  . ASN C 1 204 ? 11.503  -10.782 67.204  1.00 29.20 ? 218 ASN C CB  1 
ATOM   8986  C  CG  . ASN C 1 204 ? 10.123  -10.261 67.622  1.00 26.64 ? 218 ASN C CG  1 
ATOM   8987  O  OD1 . ASN C 1 204 ? 9.378   -10.946 68.321  1.00 26.67 ? 218 ASN C OD1 1 
ATOM   8988  N  ND2 . ASN C 1 204 ? 9.791   -9.048  67.201  1.00 28.25 ? 218 ASN C ND2 1 
ATOM   8989  N  N   . LEU C 1 205 ? 11.684  -11.886 64.001  1.00 23.28 ? 219 LEU C N   1 
ATOM   8990  C  CA  . LEU C 1 205 ? 11.207  -11.718 62.618  1.00 19.71 ? 219 LEU C CA  1 
ATOM   8991  C  C   . LEU C 1 205 ? 10.220  -12.821 62.225  1.00 17.46 ? 219 LEU C C   1 
ATOM   8992  O  O   . LEU C 1 205 ? 9.213   -12.573 61.550  1.00 17.96 ? 219 LEU C O   1 
ATOM   8993  C  CB  . LEU C 1 205 ? 12.365  -11.685 61.617  1.00 21.34 ? 219 LEU C CB  1 
ATOM   8994  C  CG  . LEU C 1 205 ? 13.238  -10.433 61.578  1.00 27.54 ? 219 LEU C CG  1 
ATOM   8995  C  CD1 . LEU C 1 205 ? 14.193  -10.512 60.400  1.00 28.01 ? 219 LEU C CD1 1 
ATOM   8996  C  CD2 . LEU C 1 205 ? 12.403  -9.140  61.535  1.00 28.78 ? 219 LEU C CD2 1 
ATOM   8997  N  N   . ALA C 1 206 ? 10.531  -14.031 62.653  1.00 18.06 ? 220 ALA C N   1 
ATOM   8998  C  CA  . ALA C 1 206 ? 9.675   -15.186 62.403  1.00 22.81 ? 220 ALA C CA  1 
ATOM   8999  C  C   . ALA C 1 206 ? 8.725   -15.429 63.580  1.00 24.68 ? 220 ALA C C   1 
ATOM   9000  O  O   . ALA C 1 206 ? 7.589   -15.844 63.385  1.00 21.06 ? 220 ALA C O   1 
ATOM   9001  C  CB  . ALA C 1 206 ? 10.511  -16.404 62.114  1.00 19.08 ? 220 ALA C CB  1 
ATOM   9002  N  N   . GLY C 1 207 ? 9.186   -15.143 64.795  1.00 22.06 ? 221 GLY C N   1 
ATOM   9003  C  CA  . GLY C 1 207 ? 8.413   -15.408 66.001  1.00 21.55 ? 221 GLY C CA  1 
ATOM   9004  C  C   . GLY C 1 207 ? 7.120   -14.631 66.163  1.00 26.44 ? 221 GLY C C   1 
ATOM   9005  O  O   . GLY C 1 207 ? 6.072   -15.201 66.495  1.00 24.67 ? 221 GLY C O   1 
ATOM   9006  N  N   . ALA C 1 208 ? 7.188   -13.321 65.941  1.00 22.04 ? 222 ALA C N   1 
ATOM   9007  C  CA  . ALA C 1 208 ? 6.023   -12.463 66.121  1.00 21.85 ? 222 ALA C CA  1 
ATOM   9008  C  C   . ALA C 1 208 ? 4.857   -12.787 65.170  1.00 22.02 ? 222 ALA C C   1 
ATOM   9009  O  O   . ALA C 1 208 ? 3.735   -12.949 65.639  1.00 21.15 ? 222 ALA C O   1 
ATOM   9010  C  CB  . ALA C 1 208 ? 6.416   -10.955 66.061  1.00 23.70 ? 222 ALA C CB  1 
ATOM   9011  N  N   . PRO C 1 209 ? 5.118   -12.905 63.846  1.00 20.54 ? 223 PRO C N   1 
ATOM   9012  C  CA  . PRO C 1 209 ? 4.032   -13.288 62.921  1.00 25.06 ? 223 PRO C CA  1 
ATOM   9013  C  C   . PRO C 1 209 ? 3.470   -14.681 63.212  1.00 25.76 ? 223 PRO C C   1 
ATOM   9014  O  O   . PRO C 1 209 ? 2.260   -14.872 63.165  1.00 25.14 ? 223 PRO C O   1 
ATOM   9015  C  CB  . PRO C 1 209 ? 4.714   -13.297 61.545  1.00 24.44 ? 223 PRO C CB  1 
ATOM   9016  C  CG  . PRO C 1 209 ? 5.933   -12.420 61.706  1.00 24.45 ? 223 PRO C CG  1 
ATOM   9017  C  CD  . PRO C 1 209 ? 6.379   -12.633 63.124  1.00 20.70 ? 223 PRO C CD  1 
ATOM   9018  N  N   . ALA C 1 210 ? 4.346   -15.639 63.500  1.00 25.31 ? 224 ALA C N   1 
ATOM   9019  C  CA  . ALA C 1 210 ? 3.901   -16.987 63.809  1.00 23.28 ? 224 ALA C CA  1 
ATOM   9020  C  C   . ALA C 1 210 ? 2.969   -16.965 65.018  1.00 23.81 ? 224 ALA C C   1 
ATOM   9021  O  O   . ALA C 1 210 ? 1.914   -17.599 65.010  1.00 27.47 ? 224 ALA C O   1 
ATOM   9022  C  CB  . ALA C 1 210 ? 5.104   -17.901 64.047  1.00 21.00 ? 224 ALA C CB  1 
ATOM   9023  N  N   . LEU C 1 211 ? 3.339   -16.194 66.036  1.00 23.26 ? 225 LEU C N   1 
ATOM   9024  C  CA  . LEU C 1 211 ? 2.522   -16.090 67.238  1.00 27.93 ? 225 LEU C CA  1 
ATOM   9025  C  C   . LEU C 1 211 ? 1.116   -15.581 66.912  1.00 27.69 ? 225 LEU C C   1 
ATOM   9026  O  O   . LEU C 1 211 ? 0.128   -16.067 67.470  1.00 26.90 ? 225 LEU C O   1 
ATOM   9027  C  CB  . LEU C 1 211 ? 3.189   -15.200 68.294  1.00 27.73 ? 225 LEU C CB  1 
ATOM   9028  C  CG  . LEU C 1 211 ? 2.305   -14.800 69.481  1.00 29.32 ? 225 LEU C CG  1 
ATOM   9029  C  CD1 . LEU C 1 211 ? 1.943   -15.996 70.343  1.00 29.65 ? 225 LEU C CD1 1 
ATOM   9030  C  CD2 . LEU C 1 211 ? 2.951   -13.723 70.309  1.00 32.60 ? 225 LEU C CD2 1 
ATOM   9031  N  N   . MET C 1 212 ? 1.029   -14.629 65.987  1.00 22.76 ? 226 MET C N   1 
ATOM   9032  C  CA  . MET C 1 212 ? -0.247  -14.016 65.648  1.00 25.93 ? 226 MET C CA  1 
ATOM   9033  C  C   . MET C 1 212 ? -1.024  -14.856 64.640  1.00 28.80 ? 226 MET C C   1 
ATOM   9034  O  O   . MET C 1 212 ? -1.940  -14.366 63.979  1.00 24.26 ? 226 MET C O   1 
ATOM   9035  C  CB  . MET C 1 212 ? -0.037  -12.586 65.132  1.00 29.42 ? 226 MET C CB  1 
ATOM   9036  C  CG  . MET C 1 212 ? 0.731   -11.676 66.107  1.00 26.22 ? 226 MET C CG  1 
ATOM   9037  S  SD  . MET C 1 212 ? -0.061  -11.468 67.718  1.00 30.82 ? 226 MET C SD  1 
ATOM   9038  C  CE  . MET C 1 212 ? -1.510  -10.501 67.268  1.00 31.70 ? 226 MET C CE  1 
ATOM   9039  N  N   . GLY C 1 213 ? -0.657  -16.128 64.512  1.00 23.76 ? 227 GLY C N   1 
ATOM   9040  C  CA  . GLY C 1 213 ? -1.447  -17.038 63.709  1.00 24.72 ? 227 GLY C CA  1 
ATOM   9041  C  C   . GLY C 1 213 ? -1.052  -17.094 62.250  1.00 26.38 ? 227 GLY C C   1 
ATOM   9042  O  O   . GLY C 1 213 ? -1.805  -17.596 61.409  1.00 28.30 ? 227 GLY C O   1 
ATOM   9043  N  N   . ASN C 1 214 ? 0.135   -16.587 61.940  1.00 26.00 ? 228 ASN C N   1 
ATOM   9044  C  CA  . ASN C 1 214 ? 0.648   -16.676 60.576  1.00 23.16 ? 228 ASN C CA  1 
ATOM   9045  C  C   . ASN C 1 214 ? 1.557   -17.874 60.360  1.00 19.96 ? 228 ASN C C   1 
ATOM   9046  O  O   . ASN C 1 214 ? 2.032   -18.499 61.311  1.00 26.92 ? 228 ASN C O   1 
ATOM   9047  C  CB  . ASN C 1 214 ? 1.376   -15.380 60.193  1.00 21.26 ? 228 ASN C CB  1 
ATOM   9048  C  CG  . ASN C 1 214 ? 0.467   -14.185 60.256  1.00 23.93 ? 228 ASN C CG  1 
ATOM   9049  O  OD1 . ASN C 1 214 ? -0.333  -13.970 59.349  1.00 29.15 ? 228 ASN C OD1 1 
ATOM   9050  N  ND2 . ASN C 1 214 ? 0.566   -13.405 61.336  1.00 21.68 ? 228 ASN C ND2 1 
ATOM   9051  N  N   . VAL C 1 215 ? 1.774   -18.193 59.091  1.00 23.68 ? 229 VAL C N   1 
ATOM   9052  C  CA  . VAL C 1 215 ? 2.759   -19.168 58.689  1.00 23.54 ? 229 VAL C CA  1 
ATOM   9053  C  C   . VAL C 1 215 ? 3.880   -18.420 57.993  1.00 21.27 ? 229 VAL C C   1 
ATOM   9054  O  O   . VAL C 1 215 ? 3.651   -17.405 57.343  1.00 21.55 ? 229 VAL C O   1 
ATOM   9055  C  CB  . VAL C 1 215 ? 2.170   -20.291 57.790  1.00 29.41 ? 229 VAL C CB  1 
ATOM   9056  C  CG1 . VAL C 1 215 ? 1.253   -21.177 58.607  1.00 32.36 ? 229 VAL C CG1 1 
ATOM   9057  C  CG2 . VAL C 1 215 ? 1.421   -19.717 56.598  1.00 30.81 ? 229 VAL C CG2 1 
ATOM   9058  N  N   . VAL C 1 216 ? 5.094   -18.943 58.130  1.00 25.07 ? 230 VAL C N   1 
ATOM   9059  C  CA  . VAL C 1 216 ? 6.293   -18.178 57.849  1.00 21.51 ? 230 VAL C CA  1 
ATOM   9060  C  C   . VAL C 1 216 ? 7.338   -18.980 57.091  1.00 17.38 ? 230 VAL C C   1 
ATOM   9061  O  O   . VAL C 1 216 ? 7.684   -20.108 57.477  1.00 20.15 ? 230 VAL C O   1 
ATOM   9062  C  CB  . VAL C 1 216 ? 6.933   -17.702 59.165  1.00 23.48 ? 230 VAL C CB  1 
ATOM   9063  C  CG1 . VAL C 1 216 ? 8.236   -16.952 58.905  1.00 20.58 ? 230 VAL C CG1 1 
ATOM   9064  C  CG2 . VAL C 1 216 ? 5.966   -16.846 59.973  1.00 18.76 ? 230 VAL C CG2 1 
ATOM   9065  N  N   . LEU C 1 217 ? 7.845   -18.402 56.008  1.00 18.30 ? 231 LEU C N   1 
ATOM   9066  C  CA  . LEU C 1 217 ? 9.105   -18.870 55.436  1.00 22.58 ? 231 LEU C CA  1 
ATOM   9067  C  C   . LEU C 1 217 ? 10.240  -18.033 56.028  1.00 24.75 ? 231 LEU C C   1 
ATOM   9068  O  O   . LEU C 1 217 ? 10.326  -16.824 55.776  1.00 21.86 ? 231 LEU C O   1 
ATOM   9069  C  CB  . LEU C 1 217 ? 9.119   -18.752 53.918  1.00 22.39 ? 231 LEU C CB  1 
ATOM   9070  C  CG  . LEU C 1 217 ? 8.752   -20.040 53.189  1.00 25.35 ? 231 LEU C CG  1 
ATOM   9071  C  CD1 . LEU C 1 217 ? 7.311   -20.401 53.503  1.00 23.18 ? 231 LEU C CD1 1 
ATOM   9072  C  CD2 . LEU C 1 217 ? 8.995   -19.888 51.694  1.00 23.76 ? 231 LEU C CD2 1 
ATOM   9073  N  N   . TRP C 1 218 ? 11.096  -18.669 56.820  1.00 19.54 ? 232 TRP C N   1 
ATOM   9074  C  CA  . TRP C 1 218 ? 12.201  -17.943 57.463  1.00 21.53 ? 232 TRP C CA  1 
ATOM   9075  C  C   . TRP C 1 218 ? 13.526  -18.167 56.731  1.00 19.73 ? 232 TRP C C   1 
ATOM   9076  O  O   . TRP C 1 218 ? 14.033  -19.285 56.663  1.00 21.05 ? 232 TRP C O   1 
ATOM   9077  C  CB  . TRP C 1 218 ? 12.306  -18.332 58.942  1.00 20.12 ? 232 TRP C CB  1 
ATOM   9078  C  CG  . TRP C 1 218 ? 13.396  -17.609 59.723  1.00 22.45 ? 232 TRP C CG  1 
ATOM   9079  C  CD1 . TRP C 1 218 ? 13.999  -16.424 59.398  1.00 20.77 ? 232 TRP C CD1 1 
ATOM   9080  C  CD2 . TRP C 1 218 ? 13.993  -18.036 60.959  1.00 20.87 ? 232 TRP C CD2 1 
ATOM   9081  N  NE1 . TRP C 1 218 ? 14.945  -16.093 60.354  1.00 17.82 ? 232 TRP C NE1 1 
ATOM   9082  C  CE2 . TRP C 1 218 ? 14.954  -17.061 61.320  1.00 22.10 ? 232 TRP C CE2 1 
ATOM   9083  C  CE3 . TRP C 1 218 ? 13.819  -19.151 61.787  1.00 23.19 ? 232 TRP C CE3 1 
ATOM   9084  C  CZ2 . TRP C 1 218 ? 15.728  -17.170 62.476  1.00 22.30 ? 232 TRP C CZ2 1 
ATOM   9085  C  CZ3 . TRP C 1 218 ? 14.584  -19.253 62.933  1.00 27.40 ? 232 TRP C CZ3 1 
ATOM   9086  C  CH2 . TRP C 1 218 ? 15.533  -18.271 63.266  1.00 25.22 ? 232 TRP C CH2 1 
ATOM   9087  N  N   . LYS C 1 219 ? 14.076  -17.097 56.163  1.00 17.08 ? 233 LYS C N   1 
ATOM   9088  C  CA  . LYS C 1 219 ? 15.400  -17.147 55.576  1.00 19.96 ? 233 LYS C CA  1 
ATOM   9089  C  C   . LYS C 1 219 ? 16.368  -16.548 56.589  1.00 23.00 ? 233 LYS C C   1 
ATOM   9090  O  O   . LYS C 1 219 ? 16.486  -15.334 56.684  1.00 23.06 ? 233 LYS C O   1 
ATOM   9091  C  CB  . LYS C 1 219 ? 15.479  -16.353 54.276  1.00 25.68 ? 233 LYS C CB  1 
ATOM   9092  C  CG  . LYS C 1 219 ? 16.831  -16.491 53.572  1.00 28.89 ? 233 LYS C CG  1 
ATOM   9093  C  CD  . LYS C 1 219 ? 17.165  -15.277 52.714  1.00 26.89 ? 233 LYS C CD  1 
ATOM   9094  C  CE  . LYS C 1 219 ? 17.947  -14.225 53.493  1.00 30.80 ? 233 LYS C CE  1 
ATOM   9095  N  NZ  . LYS C 1 219 ? 19.282  -14.742 54.002  1.00 26.96 ? 233 LYS C NZ  1 
ATOM   9096  N  N   . PRO C 1 220 ? 17.040  -17.403 57.371  1.00 20.83 ? 234 PRO C N   1 
ATOM   9097  C  CA  . PRO C 1 220 ? 17.914  -16.885 58.436  1.00 20.52 ? 234 PRO C CA  1 
ATOM   9098  C  C   . PRO C 1 220 ? 19.180  -16.284 57.857  1.00 20.82 ? 234 PRO C C   1 
ATOM   9099  O  O   . PRO C 1 220 ? 19.419  -16.405 56.662  1.00 16.48 ? 234 PRO C O   1 
ATOM   9100  C  CB  . PRO C 1 220 ? 18.214  -18.126 59.292  1.00 17.96 ? 234 PRO C CB  1 
ATOM   9101  C  CG  . PRO C 1 220 ? 17.982  -19.300 58.388  1.00 25.70 ? 234 PRO C CG  1 
ATOM   9102  C  CD  . PRO C 1 220 ? 17.037  -18.876 57.297  1.00 21.76 ? 234 PRO C CD  1 
ATOM   9103  N  N   . SER C 1 221 ? 19.970  -15.610 58.686  1.00 15.95 ? 235 SER C N   1 
ATOM   9104  C  CA  . SER C 1 221 ? 21.226  -15.040 58.216  1.00 18.68 ? 235 SER C CA  1 
ATOM   9105  C  C   . SER C 1 221 ? 22.314  -16.131 58.133  1.00 18.94 ? 235 SER C C   1 
ATOM   9106  O  O   . SER C 1 221 ? 22.514  -16.867 59.104  1.00 20.37 ? 235 SER C O   1 
ATOM   9107  C  CB  . SER C 1 221 ? 21.655  -13.936 59.183  1.00 26.49 ? 235 SER C CB  1 
ATOM   9108  O  OG  . SER C 1 221 ? 22.965  -13.491 58.898  1.00 35.46 ? 235 SER C OG  1 
ATOM   9109  N  N   . ASP C 1 222 ? 23.016  -16.222 56.998  1.00 17.59 ? 236 ASP C N   1 
ATOM   9110  C  CA  . ASP C 1 222 ? 24.124  -17.190 56.827  1.00 21.02 ? 236 ASP C CA  1 
ATOM   9111  C  C   . ASP C 1 222 ? 25.141  -17.144 57.972  1.00 22.57 ? 236 ASP C C   1 
ATOM   9112  O  O   . ASP C 1 222 ? 25.653  -18.176 58.413  1.00 24.21 ? 236 ASP C O   1 
ATOM   9113  C  CB  . ASP C 1 222 ? 24.895  -16.913 55.524  1.00 20.74 ? 236 ASP C CB  1 
ATOM   9114  C  CG  . ASP C 1 222 ? 24.033  -17.037 54.283  1.00 27.34 ? 236 ASP C CG  1 
ATOM   9115  O  OD1 . ASP C 1 222 ? 22.803  -17.184 54.407  1.00 26.64 ? 236 ASP C OD1 1 
ATOM   9116  O  OD2 . ASP C 1 222 ? 24.598  -16.962 53.180  1.00 32.09 ? 236 ASP C OD2 1 
ATOM   9117  N  N   . THR C 1 223 ? 25.436  -15.941 58.457  1.00 15.73 ? 237 THR C N   1 
ATOM   9118  C  CA  . THR C 1 223 ? 26.467  -15.785 59.482  1.00 17.89 ? 237 THR C CA  1 
ATOM   9119  C  C   . THR C 1 223 ? 25.939  -16.011 60.900  1.00 19.13 ? 237 THR C C   1 
ATOM   9120  O  O   . THR C 1 223 ? 26.675  -15.855 61.877  1.00 24.22 ? 237 THR C O   1 
ATOM   9121  C  CB  . THR C 1 223 ? 27.126  -14.400 59.377  1.00 24.45 ? 237 THR C CB  1 
ATOM   9122  O  OG1 . THR C 1 223 ? 26.109  -13.377 59.359  1.00 18.57 ? 237 THR C OG1 1 
ATOM   9123  C  CG2 . THR C 1 223 ? 27.944  -14.307 58.091  1.00 28.41 ? 237 THR C CG2 1 
ATOM   9124  N  N   . ALA C 1 224 ? 24.667  -16.385 61.016  1.00 17.01 ? 238 ALA C N   1 
ATOM   9125  C  CA  . ALA C 1 224 ? 24.102  -16.709 62.320  1.00 15.71 ? 238 ALA C CA  1 
ATOM   9126  C  C   . ALA C 1 224 ? 23.367  -18.051 62.288  1.00 19.66 ? 238 ALA C C   1 
ATOM   9127  O  O   . ALA C 1 224 ? 22.542  -18.344 63.160  1.00 21.10 ? 238 ALA C O   1 
ATOM   9128  C  CB  . ALA C 1 224 ? 23.157  -15.584 62.788  1.00 19.99 ? 238 ALA C CB  1 
ATOM   9129  N  N   . MET C 1 225 ? 23.695  -18.863 61.284  1.00 19.26 ? 239 MET C N   1 
ATOM   9130  C  CA  . MET C 1 225 ? 22.984  -20.116 60.993  1.00 18.22 ? 239 MET C CA  1 
ATOM   9131  C  C   . MET C 1 225 ? 22.937  -21.079 62.172  1.00 20.62 ? 239 MET C C   1 
ATOM   9132  O  O   . MET C 1 225 ? 21.889  -21.628 62.490  1.00 19.50 ? 239 MET C O   1 
ATOM   9133  C  CB  . MET C 1 225 ? 23.614  -20.813 59.777  1.00 20.95 ? 239 MET C CB  1 
ATOM   9134  C  CG  . MET C 1 225 ? 22.736  -21.905 59.146  1.00 24.69 ? 239 MET C CG  1 
ATOM   9135  S  SD  . MET C 1 225 ? 21.083  -21.311 58.706  1.00 28.70 ? 239 MET C SD  1 
ATOM   9136  C  CE  . MET C 1 225 ? 21.492  -20.055 57.487  1.00 21.32 ? 239 MET C CE  1 
ATOM   9137  N  N   . LEU C 1 226 ? 24.081  -21.265 62.829  1.00 19.23 ? 240 LEU C N   1 
ATOM   9138  C  CA  . LEU C 1 226 ? 24.186  -22.204 63.930  1.00 19.20 ? 240 LEU C CA  1 
ATOM   9139  C  C   . LEU C 1 226 ? 23.192  -21.891 65.053  1.00 16.61 ? 240 LEU C C   1 
ATOM   9140  O  O   . LEU C 1 226 ? 22.434  -22.761 65.498  1.00 20.88 ? 240 LEU C O   1 
ATOM   9141  C  CB  . LEU C 1 226 ? 25.634  -22.209 64.460  1.00 21.54 ? 240 LEU C CB  1 
ATOM   9142  C  CG  . LEU C 1 226 ? 25.977  -23.164 65.591  1.00 22.48 ? 240 LEU C CG  1 
ATOM   9143  C  CD1 . LEU C 1 226 ? 25.924  -24.616 65.114  1.00 27.44 ? 240 LEU C CD1 1 
ATOM   9144  C  CD2 . LEU C 1 226 ? 27.361  -22.820 66.204  1.00 22.95 ? 240 LEU C CD2 1 
ATOM   9145  N  N   . ALA C 1 227 ? 23.200  -20.650 65.524  1.00 19.74 ? 241 ALA C N   1 
ATOM   9146  C  CA  . ALA C 1 227 ? 22.311  -20.289 66.610  1.00 21.31 ? 241 ALA C CA  1 
ATOM   9147  C  C   . ALA C 1 227 ? 20.871  -20.171 66.125  1.00 19.65 ? 241 ALA C C   1 
ATOM   9148  O  O   . ALA C 1 227 ? 19.942  -20.444 66.883  1.00 21.47 ? 241 ALA C O   1 
ATOM   9149  C  CB  . ALA C 1 227 ? 22.765  -18.987 67.288  1.00 15.20 ? 241 ALA C CB  1 
ATOM   9150  N  N   . SER C 1 228 ? 20.684  -19.751 64.874  1.00 20.29 ? 242 SER C N   1 
ATOM   9151  C  CA  . SER C 1 228 ? 19.326  -19.604 64.337  1.00 22.82 ? 242 SER C CA  1 
ATOM   9152  C  C   . SER C 1 228 ? 18.621  -20.955 64.333  1.00 22.33 ? 242 SER C C   1 
ATOM   9153  O  O   . SER C 1 228 ? 17.451  -21.056 64.692  1.00 20.63 ? 242 SER C O   1 
ATOM   9154  C  CB  . SER C 1 228 ? 19.337  -19.022 62.920  1.00 19.19 ? 242 SER C CB  1 
ATOM   9155  O  OG  . SER C 1 228 ? 19.760  -17.665 62.897  1.00 18.71 ? 242 SER C OG  1 
ATOM   9156  N  N   . TYR C 1 229 ? 19.346  -21.999 63.936  1.00 17.22 ? 243 TYR C N   1 
ATOM   9157  C  CA  . TYR C 1 229 ? 18.751  -23.338 63.893  1.00 20.34 ? 243 TYR C CA  1 
ATOM   9158  C  C   . TYR C 1 229 ? 18.491  -23.826 65.322  1.00 20.40 ? 243 TYR C C   1 
ATOM   9159  O  O   . TYR C 1 229 ? 17.531  -24.531 65.584  1.00 23.13 ? 243 TYR C O   1 
ATOM   9160  C  CB  . TYR C 1 229 ? 19.654  -24.307 63.121  1.00 21.82 ? 243 TYR C CB  1 
ATOM   9161  C  CG  . TYR C 1 229 ? 19.025  -25.659 62.822  1.00 22.09 ? 243 TYR C CG  1 
ATOM   9162  C  CD1 . TYR C 1 229 ? 19.641  -26.839 63.227  1.00 23.99 ? 243 TYR C CD1 1 
ATOM   9163  C  CD2 . TYR C 1 229 ? 17.820  -25.746 62.130  1.00 25.25 ? 243 TYR C CD2 1 
ATOM   9164  C  CE1 . TYR C 1 229 ? 19.061  -28.088 62.954  1.00 33.65 ? 243 TYR C CE1 1 
ATOM   9165  C  CE2 . TYR C 1 229 ? 17.233  -26.970 61.848  1.00 32.00 ? 243 TYR C CE2 1 
ATOM   9166  C  CZ  . TYR C 1 229 ? 17.856  -28.142 62.260  1.00 30.90 ? 243 TYR C CZ  1 
ATOM   9167  O  OH  . TYR C 1 229 ? 17.262  -29.345 61.970  1.00 33.72 ? 243 TYR C OH  1 
ATOM   9168  N  N   . ALA C 1 230 ? 19.351  -23.428 66.250  1.00 20.02 ? 244 ALA C N   1 
ATOM   9169  C  CA  . ALA C 1 230 ? 19.174  -23.818 67.643  1.00 19.98 ? 244 ALA C CA  1 
ATOM   9170  C  C   . ALA C 1 230 ? 17.853  -23.279 68.174  1.00 22.25 ? 244 ALA C C   1 
ATOM   9171  O  O   . ALA C 1 230 ? 17.123  -23.973 68.880  1.00 24.48 ? 244 ALA C O   1 
ATOM   9172  C  CB  . ALA C 1 230 ? 20.353  -23.334 68.491  1.00 19.64 ? 244 ALA C CB  1 
ATOM   9173  N  N   . VAL C 1 231 ? 17.522  -22.048 67.793  1.00 21.41 ? 245 VAL C N   1 
ATOM   9174  C  CA  . VAL C 1 231 ? 16.253  -21.462 68.203  1.00 19.20 ? 245 VAL C CA  1 
ATOM   9175  C  C   . VAL C 1 231 ? 15.083  -22.185 67.523  1.00 19.82 ? 245 VAL C C   1 
ATOM   9176  O  O   . VAL C 1 231 ? 14.088  -22.502 68.171  1.00 20.37 ? 245 VAL C O   1 
ATOM   9177  C  CB  . VAL C 1 231 ? 16.232  -19.925 67.929  1.00 19.62 ? 245 VAL C CB  1 
ATOM   9178  C  CG1 . VAL C 1 231 ? 14.855  -19.334 68.166  1.00 20.92 ? 245 VAL C CG1 1 
ATOM   9179  C  CG2 . VAL C 1 231 ? 17.256  -19.236 68.812  1.00 18.99 ? 245 VAL C CG2 1 
ATOM   9180  N  N   . TYR C 1 232 ? 15.239  -22.480 66.232  1.00 16.81 ? 246 TYR C N   1 
ATOM   9181  C  CA  . TYR C 1 232 ? 14.220  -23.190 65.467  1.00 24.25 ? 246 TYR C CA  1 
ATOM   9182  C  C   . TYR C 1 232 ? 13.916  -24.545 66.091  1.00 27.87 ? 246 TYR C C   1 
ATOM   9183  O  O   . TYR C 1 232 ? 12.755  -24.906 66.271  1.00 24.86 ? 246 TYR C O   1 
ATOM   9184  C  CB  . TYR C 1 232 ? 14.656  -23.388 64.011  1.00 21.31 ? 246 TYR C CB  1 
ATOM   9185  C  CG  . TYR C 1 232 ? 13.604  -24.122 63.201  1.00 27.19 ? 246 TYR C CG  1 
ATOM   9186  C  CD1 . TYR C 1 232 ? 12.449  -23.474 62.785  1.00 25.88 ? 246 TYR C CD1 1 
ATOM   9187  C  CD2 . TYR C 1 232 ? 13.752  -25.465 62.876  1.00 28.69 ? 246 TYR C CD2 1 
ATOM   9188  C  CE1 . TYR C 1 232 ? 11.481  -24.131 62.055  1.00 29.25 ? 246 TYR C CE1 1 
ATOM   9189  C  CE2 . TYR C 1 232 ? 12.785  -26.137 62.140  1.00 28.47 ? 246 TYR C CE2 1 
ATOM   9190  C  CZ  . TYR C 1 232 ? 11.650  -25.469 61.738  1.00 32.49 ? 246 TYR C CZ  1 
ATOM   9191  O  OH  . TYR C 1 232 ? 10.683  -26.132 61.006  1.00 29.89 ? 246 TYR C OH  1 
ATOM   9192  N  N   . ARG C 1 233 ? 14.965  -25.288 66.428  1.00 25.70 ? 247 ARG C N   1 
ATOM   9193  C  CA  . ARG C 1 233 ? 14.788  -26.611 67.019  1.00 23.83 ? 247 ARG C CA  1 
ATOM   9194  C  C   . ARG C 1 233 ? 14.081  -26.506 68.360  1.00 25.88 ? 247 ARG C C   1 
ATOM   9195  O  O   . ARG C 1 233 ? 13.220  -27.328 68.676  1.00 28.26 ? 247 ARG C O   1 
ATOM   9196  C  CB  . ARG C 1 233 ? 16.136  -27.325 67.191  1.00 25.90 ? 247 ARG C CB  1 
ATOM   9197  C  CG  . ARG C 1 233 ? 16.772  -27.748 65.891  1.00 35.71 ? 247 ARG C CG  1 
ATOM   9198  C  CD  . ARG C 1 233 ? 16.610  -29.249 65.646  1.00 47.28 ? 247 ARG C CD  1 
ATOM   9199  N  NE  . ARG C 1 233 ? 15.347  -29.586 65.001  1.00 52.81 ? 247 ARG C NE  1 
ATOM   9200  C  CZ  . ARG C 1 233 ? 14.319  -30.158 65.619  1.00 52.50 ? 247 ARG C CZ  1 
ATOM   9201  N  NH1 . ARG C 1 233 ? 13.208  -30.432 64.942  1.00 50.61 ? 247 ARG C NH1 1 
ATOM   9202  N  NH2 . ARG C 1 233 ? 14.401  -30.461 66.911  1.00 48.28 ? 247 ARG C NH2 1 
ATOM   9203  N  N   . ILE C 1 234 ? 14.436  -25.487 69.137  1.00 21.59 ? 248 ILE C N   1 
ATOM   9204  C  CA  . ILE C 1 234 ? 13.781  -25.254 70.422  1.00 25.74 ? 248 ILE C CA  1 
ATOM   9205  C  C   . ILE C 1 234 ? 12.289  -24.933 70.276  1.00 25.50 ? 248 ILE C C   1 
ATOM   9206  O  O   . ILE C 1 234 ? 11.454  -25.444 71.034  1.00 27.63 ? 248 ILE C O   1 
ATOM   9207  C  CB  . ILE C 1 234 ? 14.499  -24.169 71.240  1.00 26.76 ? 248 ILE C CB  1 
ATOM   9208  C  CG1 . ILE C 1 234 ? 15.834  -24.708 71.766  1.00 26.92 ? 248 ILE C CG1 1 
ATOM   9209  C  CG2 . ILE C 1 234 ? 13.647  -23.735 72.413  1.00 30.52 ? 248 ILE C CG2 1 
ATOM   9210  C  CD1 . ILE C 1 234 ? 16.714  -23.633 72.341  1.00 27.75 ? 248 ILE C CD1 1 
ATOM   9211  N  N   . LEU C 1 235 ? 11.949  -24.102 69.297  1.00 23.10 ? 249 LEU C N   1 
ATOM   9212  C  CA  . LEU C 1 235 ? 10.536  -23.822 69.012  1.00 23.63 ? 249 LEU C CA  1 
ATOM   9213  C  C   . LEU C 1 235 ? 9.782   -25.113 68.698  1.00 29.69 ? 249 LEU C C   1 
ATOM   9214  O  O   . LEU C 1 235 ? 8.716   -25.374 69.252  1.00 34.47 ? 249 LEU C O   1 
ATOM   9215  C  CB  . LEU C 1 235 ? 10.400  -22.827 67.847  1.00 24.71 ? 249 LEU C CB  1 
ATOM   9216  C  CG  . LEU C 1 235 ? 10.668  -21.353 68.174  1.00 25.42 ? 249 LEU C CG  1 
ATOM   9217  C  CD1 . LEU C 1 235 ? 10.792  -20.531 66.887  1.00 24.84 ? 249 LEU C CD1 1 
ATOM   9218  C  CD2 . LEU C 1 235 ? 9.565   -20.795 69.069  1.00 28.31 ? 249 LEU C CD2 1 
ATOM   9219  N  N   . ARG C 1 236 ? 10.349  -25.923 67.813  1.00 31.37 ? 250 ARG C N   1 
ATOM   9220  C  CA  . ARG C 1 236 ? 9.708   -27.166 67.431  1.00 32.27 ? 250 ARG C CA  1 
ATOM   9221  C  C   . ARG C 1 236 ? 9.575   -28.074 68.659  1.00 31.78 ? 250 ARG C C   1 
ATOM   9222  O  O   . ARG C 1 236 ? 8.487   -28.573 68.944  1.00 37.22 ? 250 ARG C O   1 
ATOM   9223  C  CB  . ARG C 1 236 ? 10.469  -27.849 66.289  1.00 31.01 ? 250 ARG C CB  1 
ATOM   9224  C  CG  . ARG C 1 236 ? 10.533  -27.034 64.983  1.00 19.57 ? 250 ARG C CG  1 
ATOM   9225  C  CD  . ARG C 1 236 ? 9.150   -26.625 64.471  1.00 26.50 ? 250 ARG C CD  1 
ATOM   9226  N  NE  . ARG C 1 236 ? 8.245   -27.764 64.450  1.00 27.29 ? 250 ARG C NE  1 
ATOM   9227  C  CZ  . ARG C 1 236 ? 8.172   -28.637 63.453  1.00 32.63 ? 250 ARG C CZ  1 
ATOM   9228  N  NH1 . ARG C 1 236 ? 8.924   -28.478 62.374  1.00 31.41 ? 250 ARG C NH1 1 
ATOM   9229  N  NH2 . ARG C 1 236 ? 7.328   -29.663 63.529  1.00 33.79 ? 250 ARG C NH2 1 
ATOM   9230  N  N   . GLU C 1 237 ? 10.665  -28.245 69.406  1.00 26.65 ? 251 GLU C N   1 
ATOM   9231  C  CA  . GLU C 1 237 ? 10.621  -29.056 70.619  1.00 32.20 ? 251 GLU C CA  1 
ATOM   9232  C  C   . GLU C 1 237 ? 9.623   -28.500 71.620  1.00 31.74 ? 251 GLU C C   1 
ATOM   9233  O  O   . GLU C 1 237 ? 9.023   -29.252 72.387  1.00 33.84 ? 251 GLU C O   1 
ATOM   9234  C  CB  . GLU C 1 237 ? 12.006  -29.166 71.273  1.00 33.39 ? 251 GLU C CB  1 
ATOM   9235  C  CG  . GLU C 1 237 ? 12.997  -30.007 70.492  1.00 33.76 ? 251 GLU C CG  1 
ATOM   9236  C  CD  . GLU C 1 237 ? 14.412  -29.927 71.063  1.00 41.02 ? 251 GLU C CD  1 
ATOM   9237  O  OE1 . GLU C 1 237 ? 14.566  -29.863 72.306  1.00 37.20 ? 251 GLU C OE1 1 
ATOM   9238  O  OE2 . GLU C 1 237 ? 15.369  -29.924 70.261  1.00 41.38 ? 251 GLU C OE2 1 
ATOM   9239  N  N   . ALA C 1 238 ? 9.427   -27.187 71.612  1.00 31.36 ? 252 ALA C N   1 
ATOM   9240  C  CA  . ALA C 1 238 ? 8.504   -26.586 72.569  1.00 31.60 ? 252 ALA C CA  1 
ATOM   9241  C  C   . ALA C 1 238 ? 7.059   -26.771 72.128  1.00 32.97 ? 252 ALA C C   1 
ATOM   9242  O  O   . ALA C 1 238 ? 6.141   -26.415 72.853  1.00 35.24 ? 252 ALA C O   1 
ATOM   9243  C  CB  . ALA C 1 238 ? 8.825   -25.113 72.814  1.00 24.96 ? 252 ALA C CB  1 
ATOM   9244  N  N   . GLY C 1 239 ? 6.864   -27.328 70.936  1.00 34.99 ? 253 GLY C N   1 
ATOM   9245  C  CA  . GLY C 1 239 ? 5.528   -27.650 70.471  1.00 33.32 ? 253 GLY C CA  1 
ATOM   9246  C  C   . GLY C 1 239 ? 5.022   -26.960 69.214  1.00 35.32 ? 253 GLY C C   1 
ATOM   9247  O  O   . GLY C 1 239 ? 3.877   -27.173 68.825  1.00 35.34 ? 253 GLY C O   1 
ATOM   9248  N  N   . LEU C 1 240 ? 5.848   -26.137 68.572  1.00 30.17 ? 254 LEU C N   1 
ATOM   9249  C  CA  . LEU C 1 240 ? 5.437   -25.534 67.308  1.00 30.60 ? 254 LEU C CA  1 
ATOM   9250  C  C   . LEU C 1 240 ? 5.167   -26.650 66.300  1.00 34.19 ? 254 LEU C C   1 
ATOM   9251  O  O   . LEU C 1 240 ? 6.027   -27.499 66.066  1.00 29.83 ? 254 LEU C O   1 
ATOM   9252  C  CB  . LEU C 1 240 ? 6.513   -24.580 66.766  1.00 25.65 ? 254 LEU C CB  1 
ATOM   9253  C  CG  . LEU C 1 240 ? 6.038   -23.673 65.615  1.00 26.36 ? 254 LEU C CG  1 
ATOM   9254  C  CD1 . LEU C 1 240 ? 5.027   -22.638 66.098  1.00 22.82 ? 254 LEU C CD1 1 
ATOM   9255  C  CD2 . LEU C 1 240 ? 7.203   -22.990 64.898  1.00 25.07 ? 254 LEU C CD2 1 
ATOM   9256  N  N   . PRO C 1 241 ? 3.954   -26.671 65.722  1.00 34.10 ? 255 PRO C N   1 
ATOM   9257  C  CA  . PRO C 1 241 ? 3.567   -27.715 64.769  1.00 34.64 ? 255 PRO C CA  1 
ATOM   9258  C  C   . PRO C 1 241 ? 4.356   -27.589 63.476  1.00 31.19 ? 255 PRO C C   1 
ATOM   9259  O  O   . PRO C 1 241 ? 4.909   -26.518 63.207  1.00 35.85 ? 255 PRO C O   1 
ATOM   9260  C  CB  . PRO C 1 241 ? 2.087   -27.409 64.506  1.00 38.51 ? 255 PRO C CB  1 
ATOM   9261  C  CG  . PRO C 1 241 ? 1.639   -26.658 65.696  1.00 38.32 ? 255 PRO C CG  1 
ATOM   9262  C  CD  . PRO C 1 241 ? 2.815   -25.814 66.084  1.00 35.37 ? 255 PRO C CD  1 
ATOM   9263  N  N   . PRO C 1 242 ? 4.409   -28.663 62.677  1.00 39.54 ? 256 PRO C N   1 
ATOM   9264  C  CA  . PRO C 1 242 ? 5.105   -28.577 61.388  1.00 38.95 ? 256 PRO C CA  1 
ATOM   9265  C  C   . PRO C 1 242 ? 4.431   -27.601 60.436  1.00 36.00 ? 256 PRO C C   1 
ATOM   9266  O  O   . PRO C 1 242 ? 3.231   -27.335 60.559  1.00 31.24 ? 256 PRO C O   1 
ATOM   9267  C  CB  . PRO C 1 242 ? 5.034   -30.008 60.835  1.00 38.60 ? 256 PRO C CB  1 
ATOM   9268  C  CG  . PRO C 1 242 ? 3.968   -30.671 61.601  1.00 41.40 ? 256 PRO C CG  1 
ATOM   9269  C  CD  . PRO C 1 242 ? 3.900   -30.019 62.946  1.00 38.17 ? 256 PRO C CD  1 
ATOM   9270  N  N   . ASN C 1 243 ? 5.231   -27.060 59.521  1.00 32.39 ? 257 ASN C N   1 
ATOM   9271  C  CA  . ASN C 1 243 ? 4.782   -26.116 58.505  1.00 29.03 ? 257 ASN C CA  1 
ATOM   9272  C  C   . ASN C 1 243 ? 4.318   -24.738 58.998  1.00 31.20 ? 257 ASN C C   1 
ATOM   9273  O  O   . ASN C 1 243 ? 3.751   -23.967 58.224  1.00 33.29 ? 257 ASN C O   1 
ATOM   9274  C  CB  . ASN C 1 243 ? 3.724   -26.751 57.592  1.00 29.36 ? 257 ASN C CB  1 
ATOM   9275  C  CG  . ASN C 1 243 ? 4.229   -27.994 56.886  1.00 35.51 ? 257 ASN C CG  1 
ATOM   9276  O  OD1 . ASN C 1 243 ? 5.119   -27.925 56.031  1.00 33.80 ? 257 ASN C OD1 1 
ATOM   9277  N  ND2 . ASN C 1 243 ? 3.638   -29.138 57.217  1.00 39.30 ? 257 ASN C ND2 1 
ATOM   9278  N  N   . ILE C 1 244 ? 4.552   -24.422 60.270  1.00 23.15 ? 258 ILE C N   1 
ATOM   9279  C  CA  . ILE C 1 244 ? 4.272   -23.076 60.778  1.00 19.90 ? 258 ILE C CA  1 
ATOM   9280  C  C   . ILE C 1 244 ? 5.445   -22.125 60.508  1.00 28.90 ? 258 ILE C C   1 
ATOM   9281  O  O   . ILE C 1 244 ? 5.249   -20.986 60.074  1.00 28.85 ? 258 ILE C O   1 
ATOM   9282  C  CB  . ILE C 1 244 ? 3.933   -23.099 62.266  1.00 22.55 ? 258 ILE C CB  1 
ATOM   9283  C  CG1 . ILE C 1 244 ? 2.819   -24.117 62.520  1.00 27.72 ? 258 ILE C CG1 1 
ATOM   9284  C  CG2 . ILE C 1 244 ? 3.504   -21.722 62.740  1.00 24.93 ? 258 ILE C CG2 1 
ATOM   9285  C  CD1 . ILE C 1 244 ? 1.544   -23.833 61.734  1.00 21.36 ? 258 ILE C CD1 1 
ATOM   9286  N  N   . ILE C 1 245 ? 6.662   -22.589 60.780  1.00 27.48 ? 259 ILE C N   1 
ATOM   9287  C  CA  . ILE C 1 245 ? 7.857   -21.888 60.322  1.00 20.27 ? 259 ILE C CA  1 
ATOM   9288  C  C   . ILE C 1 245 ? 8.707   -22.836 59.489  1.00 21.60 ? 259 ILE C C   1 
ATOM   9289  O  O   . ILE C 1 245 ? 9.135   -23.881 59.977  1.00 23.59 ? 259 ILE C O   1 
ATOM   9290  C  CB  . ILE C 1 245 ? 8.685   -21.320 61.498  1.00 25.41 ? 259 ILE C CB  1 
ATOM   9291  C  CG1 . ILE C 1 245 ? 7.857   -20.308 62.302  1.00 21.74 ? 259 ILE C CG1 1 
ATOM   9292  C  CG2 . ILE C 1 245 ? 9.941   -20.633 60.981  1.00 20.03 ? 259 ILE C CG2 1 
ATOM   9293  C  CD1 . ILE C 1 245 ? 8.528   -19.872 63.592  1.00 24.14 ? 259 ILE C CD1 1 
ATOM   9294  N  N   . GLN C 1 246 ? 8.912   -22.501 58.219  1.00 22.54 ? 260 GLN C N   1 
ATOM   9295  C  CA  . GLN C 1 246 ? 9.796   -23.281 57.365  1.00 23.89 ? 260 GLN C CA  1 
ATOM   9296  C  C   . GLN C 1 246 ? 11.212  -22.711 57.476  1.00 21.25 ? 260 GLN C C   1 
ATOM   9297  O  O   . GLN C 1 246 ? 11.429  -21.503 57.282  1.00 23.19 ? 260 GLN C O   1 
ATOM   9298  C  CB  . GLN C 1 246 ? 9.311   -23.243 55.909  1.00 24.12 ? 260 GLN C CB  1 
ATOM   9299  C  CG  . GLN C 1 246 ? 7.790   -23.478 55.719  1.00 18.18 ? 260 GLN C CG  1 
ATOM   9300  C  CD  . GLN C 1 246 ? 7.319   -24.908 56.051  1.00 25.95 ? 260 GLN C CD  1 
ATOM   9301  O  OE1 . GLN C 1 246 ? 7.776   -25.531 57.011  1.00 29.23 ? 260 GLN C OE1 1 
ATOM   9302  N  NE2 . GLN C 1 246 ? 6.383   -25.420 55.248  1.00 24.10 ? 260 GLN C NE2 1 
ATOM   9303  N  N   . PHE C 1 247 ? 12.172  -23.562 57.817  1.00 23.62 ? 261 PHE C N   1 
ATOM   9304  C  CA  . PHE C 1 247 ? 13.555  -23.111 57.978  1.00 21.75 ? 261 PHE C CA  1 
ATOM   9305  C  C   . PHE C 1 247 ? 14.222  -23.208 56.631  1.00 24.16 ? 261 PHE C C   1 
ATOM   9306  O  O   . PHE C 1 247 ? 14.620  -24.298 56.204  1.00 22.61 ? 261 PHE C O   1 
ATOM   9307  C  CB  . PHE C 1 247 ? 14.294  -23.971 59.015  1.00 17.14 ? 261 PHE C CB  1 
ATOM   9308  C  CG  . PHE C 1 247 ? 15.608  -23.391 59.483  1.00 23.38 ? 261 PHE C CG  1 
ATOM   9309  C  CD1 . PHE C 1 247 ? 15.639  -22.445 60.495  1.00 20.75 ? 261 PHE C CD1 1 
ATOM   9310  C  CD2 . PHE C 1 247 ? 16.813  -23.817 58.931  1.00 20.87 ? 261 PHE C CD2 1 
ATOM   9311  C  CE1 . PHE C 1 247 ? 16.848  -21.910 60.939  1.00 27.17 ? 261 PHE C CE1 1 
ATOM   9312  C  CE2 . PHE C 1 247 ? 18.036  -23.287 59.370  1.00 19.62 ? 261 PHE C CE2 1 
ATOM   9313  C  CZ  . PHE C 1 247 ? 18.043  -22.330 60.378  1.00 24.71 ? 261 PHE C CZ  1 
ATOM   9314  N  N   . VAL C 1 248 ? 14.341  -22.071 55.945  1.00 24.73 ? 262 VAL C N   1 
ATOM   9315  C  CA  . VAL C 1 248 ? 14.815  -22.094 54.561  1.00 21.99 ? 262 VAL C CA  1 
ATOM   9316  C  C   . VAL C 1 248 ? 15.899  -21.069 54.229  1.00 25.60 ? 262 VAL C C   1 
ATOM   9317  O  O   . VAL C 1 248 ? 15.630  -20.031 53.618  1.00 22.73 ? 262 VAL C O   1 
ATOM   9318  C  CB  . VAL C 1 248 ? 13.640  -21.959 53.565  1.00 20.96 ? 262 VAL C CB  1 
ATOM   9319  C  CG1 . VAL C 1 248 ? 12.833  -23.249 53.530  1.00 27.41 ? 262 VAL C CG1 1 
ATOM   9320  C  CG2 . VAL C 1 248 ? 12.739  -20.767 53.951  1.00 19.67 ? 262 VAL C CG2 1 
ATOM   9321  N  N   . PRO C 1 249 ? 17.142  -21.371 54.624  1.00 24.31 ? 263 PRO C N   1 
ATOM   9322  C  CA  . PRO C 1 249 ? 18.273  -20.590 54.132  1.00 24.95 ? 263 PRO C CA  1 
ATOM   9323  C  C   . PRO C 1 249 ? 18.238  -20.560 52.607  1.00 22.27 ? 263 PRO C C   1 
ATOM   9324  O  O   . PRO C 1 249 ? 17.843  -21.547 51.977  1.00 27.80 ? 263 PRO C O   1 
ATOM   9325  C  CB  . PRO C 1 249 ? 19.486  -21.396 54.613  1.00 25.91 ? 263 PRO C CB  1 
ATOM   9326  C  CG  . PRO C 1 249 ? 18.982  -22.193 55.762  1.00 25.84 ? 263 PRO C CG  1 
ATOM   9327  C  CD  . PRO C 1 249 ? 17.562  -22.501 55.473  1.00 22.34 ? 263 PRO C CD  1 
ATOM   9328  N  N   . ALA C 1 250 ? 18.654  -19.444 52.027  1.00 22.05 ? 264 ALA C N   1 
ATOM   9329  C  CA  . ALA C 1 250 ? 18.640  -19.302 50.584  1.00 23.45 ? 264 ALA C CA  1 
ATOM   9330  C  C   . ALA C 1 250 ? 19.453  -18.083 50.205  1.00 25.82 ? 264 ALA C C   1 
ATOM   9331  O  O   . ALA C 1 250 ? 19.752  -17.235 51.054  1.00 22.26 ? 264 ALA C O   1 
ATOM   9332  C  CB  . ALA C 1 250 ? 17.185  -19.166 50.068  1.00 20.50 ? 264 ALA C CB  1 
ATOM   9333  N  N   . ASP C 1 251 ? 19.819  -17.995 48.931  1.00 22.01 ? 265 ASP C N   1 
ATOM   9334  C  CA  . ASP C 1 251 ? 20.438  -16.790 48.402  1.00 24.66 ? 265 ASP C CA  1 
ATOM   9335  C  C   . ASP C 1 251 ? 19.407  -15.677 48.548  1.00 24.15 ? 265 ASP C C   1 
ATOM   9336  O  O   . ASP C 1 251 ? 18.216  -15.892 48.274  1.00 21.10 ? 265 ASP C O   1 
ATOM   9337  C  CB  . ASP C 1 251 ? 20.812  -17.011 46.941  1.00 29.44 ? 265 ASP C CB  1 
ATOM   9338  C  CG  . ASP C 1 251 ? 21.265  -15.753 46.254  1.00 37.25 ? 265 ASP C CG  1 
ATOM   9339  O  OD1 . ASP C 1 251 ? 22.437  -15.366 46.431  1.00 38.36 ? 265 ASP C OD1 1 
ATOM   9340  O  OD2 . ASP C 1 251 ? 20.450  -15.162 45.515  1.00 41.15 ? 265 ASP C OD2 1 
ATOM   9341  N  N   . GLY C 1 252 ? 19.852  -14.518 49.035  1.00 22.56 ? 266 GLY C N   1 
ATOM   9342  C  CA  . GLY C 1 252 ? 18.967  -13.386 49.261  1.00 29.49 ? 266 GLY C CA  1 
ATOM   9343  C  C   . GLY C 1 252 ? 18.128  -12.990 48.053  1.00 29.05 ? 266 GLY C C   1 
ATOM   9344  O  O   . GLY C 1 252 ? 16.901  -12.995 48.119  1.00 26.67 ? 266 GLY C O   1 
ATOM   9345  N  N   . PRO C 1 253 ? 18.786  -12.634 46.942  1.00 28.25 ? 267 PRO C N   1 
ATOM   9346  C  CA  . PRO C 1 253 ? 18.034  -12.211 45.755  1.00 29.34 ? 267 PRO C CA  1 
ATOM   9347  C  C   . PRO C 1 253 ? 17.053  -13.276 45.263  1.00 30.36 ? 267 PRO C C   1 
ATOM   9348  O  O   . PRO C 1 253 ? 15.912  -12.932 44.927  1.00 27.57 ? 267 PRO C O   1 
ATOM   9349  C  CB  . PRO C 1 253 ? 19.133  -11.954 44.720  1.00 34.64 ? 267 PRO C CB  1 
ATOM   9350  C  CG  . PRO C 1 253 ? 20.317  -11.535 45.535  1.00 30.37 ? 267 PRO C CG  1 
ATOM   9351  C  CD  . PRO C 1 253 ? 20.219  -12.296 46.842  1.00 34.55 ? 267 PRO C CD  1 
ATOM   9352  N  N   . LEU C 1 254 ? 17.469  -14.545 45.245  1.00 29.03 ? 268 LEU C N   1 
ATOM   9353  C  CA  . LEU C 1 254 ? 16.591  -15.606 44.777  1.00 26.66 ? 268 LEU C CA  1 
ATOM   9354  C  C   . LEU C 1 254 ? 15.402  -15.760 45.710  1.00 23.73 ? 268 LEU C C   1 
ATOM   9355  O  O   . LEU C 1 254 ? 14.275  -15.968 45.252  1.00 27.98 ? 268 LEU C O   1 
ATOM   9356  C  CB  . LEU C 1 254 ? 17.342  -16.942 44.646  1.00 30.40 ? 268 LEU C CB  1 
ATOM   9357  C  CG  . LEU C 1 254 ? 16.624  -18.178 44.079  1.00 36.62 ? 268 LEU C CG  1 
ATOM   9358  C  CD1 . LEU C 1 254 ? 17.654  -19.197 43.577  1.00 36.42 ? 268 LEU C CD1 1 
ATOM   9359  C  CD2 . LEU C 1 254 ? 15.687  -18.853 45.076  1.00 31.90 ? 268 LEU C CD2 1 
ATOM   9360  N  N   . PHE C 1 255 ? 15.666  -15.703 47.012  1.00 20.27 ? 269 PHE C N   1 
ATOM   9361  C  CA  . PHE C 1 255 ? 14.610  -15.839 48.003  1.00 22.41 ? 269 PHE C CA  1 
ATOM   9362  C  C   . PHE C 1 255 ? 13.609  -14.691 47.835  1.00 23.30 ? 269 PHE C C   1 
ATOM   9363  O  O   . PHE C 1 255 ? 12.397  -14.915 47.840  1.00 18.53 ? 269 PHE C O   1 
ATOM   9364  C  CB  . PHE C 1 255 ? 15.165  -15.828 49.423  1.00 19.41 ? 269 PHE C CB  1 
ATOM   9365  C  CG  . PHE C 1 255 ? 14.110  -16.065 50.486  1.00 20.94 ? 269 PHE C CG  1 
ATOM   9366  C  CD1 . PHE C 1 255 ? 13.781  -17.353 50.879  1.00 19.44 ? 269 PHE C CD1 1 
ATOM   9367  C  CD2 . PHE C 1 255 ? 13.441  -14.997 51.076  1.00 22.23 ? 269 PHE C CD2 1 
ATOM   9368  C  CE1 . PHE C 1 255 ? 12.820  -17.579 51.843  1.00 21.92 ? 269 PHE C CE1 1 
ATOM   9369  C  CE2 . PHE C 1 255 ? 12.475  -15.217 52.037  1.00 23.49 ? 269 PHE C CE2 1 
ATOM   9370  C  CZ  . PHE C 1 255 ? 12.159  -16.499 52.421  1.00 25.03 ? 269 PHE C CZ  1 
ATOM   9371  N  N   . GLY C 1 256 ? 14.129  -13.473 47.705  1.00 22.84 ? 270 GLY C N   1 
ATOM   9372  C  CA  . GLY C 1 256 ? 13.293  -12.299 47.483  1.00 22.17 ? 270 GLY C CA  1 
ATOM   9373  C  C   . GLY C 1 256 ? 12.435  -12.448 46.232  1.00 29.88 ? 270 GLY C C   1 
ATOM   9374  O  O   . GLY C 1 256 ? 11.240  -12.143 46.244  1.00 26.37 ? 270 GLY C O   1 
ATOM   9375  N  N   . ASP C 1 257 ? 13.042  -12.920 45.146  1.00 29.54 ? 271 ASP C N   1 
ATOM   9376  C  CA  . ASP C 1 257 ? 12.315  -13.072 43.886  1.00 33.79 ? 271 ASP C CA  1 
ATOM   9377  C  C   . ASP C 1 257 ? 11.157  -14.054 44.024  1.00 33.30 ? 271 ASP C C   1 
ATOM   9378  O  O   . ASP C 1 257 ? 10.049  -13.816 43.524  1.00 29.36 ? 271 ASP C O   1 
ATOM   9379  C  CB  . ASP C 1 257 ? 13.254  -13.544 42.774  1.00 35.65 ? 271 ASP C CB  1 
ATOM   9380  C  CG  . ASP C 1 257 ? 14.275  -12.498 42.392  1.00 40.40 ? 271 ASP C CG  1 
ATOM   9381  O  OD1 . ASP C 1 257 ? 14.112  -11.319 42.785  1.00 42.13 ? 271 ASP C OD1 1 
ATOM   9382  O  OD2 . ASP C 1 257 ? 15.242  -12.853 41.689  1.00 40.12 ? 271 ASP C OD2 1 
ATOM   9383  N  N   . THR C 1 258 ? 11.425  -15.158 44.712  1.00 26.63 ? 272 THR C N   1 
ATOM   9384  C  CA  . THR C 1 258 ? 10.455  -16.236 44.834  1.00 27.74 ? 272 THR C CA  1 
ATOM   9385  C  C   . THR C 1 258 ? 9.242   -15.842 45.667  1.00 26.52 ? 272 THR C C   1 
ATOM   9386  O  O   . THR C 1 258 ? 8.104   -16.075 45.257  1.00 23.13 ? 272 THR C O   1 
ATOM   9387  C  CB  . THR C 1 258 ? 11.085  -17.524 45.446  1.00 30.46 ? 272 THR C CB  1 
ATOM   9388  O  OG1 . THR C 1 258 ? 12.204  -17.956 44.653  1.00 29.73 ? 272 THR C OG1 1 
ATOM   9389  C  CG2 . THR C 1 258 ? 10.053  -18.632 45.520  1.00 30.02 ? 272 THR C CG2 1 
ATOM   9390  N  N   . VAL C 1 259 ? 9.471   -15.266 46.845  1.00 22.74 ? 273 VAL C N   1 
ATOM   9391  C  CA  . VAL C 1 259 ? 8.346   -14.982 47.723  1.00 26.73 ? 273 VAL C CA  1 
ATOM   9392  C  C   . VAL C 1 259 ? 7.491   -13.836 47.156  1.00 29.80 ? 273 VAL C C   1 
ATOM   9393  O  O   . VAL C 1 259 ? 6.261   -13.873 47.268  1.00 23.37 ? 273 VAL C O   1 
ATOM   9394  C  CB  . VAL C 1 259 ? 8.747   -14.707 49.203  1.00 21.89 ? 273 VAL C CB  1 
ATOM   9395  C  CG1 . VAL C 1 259 ? 9.506   -15.906 49.804  1.00 18.42 ? 273 VAL C CG1 1 
ATOM   9396  C  CG2 . VAL C 1 259 ? 9.547   -13.399 49.334  1.00 21.22 ? 273 VAL C CG2 1 
ATOM   9397  N  N   . THR C 1 260 ? 8.130   -12.850 46.531  1.00 24.31 ? 274 THR C N   1 
ATOM   9398  C  CA  . THR C 1 260 ? 7.374   -11.733 45.946  1.00 27.02 ? 274 THR C CA  1 
ATOM   9399  C  C   . THR C 1 260 ? 6.635   -12.099 44.648  1.00 28.65 ? 274 THR C C   1 
ATOM   9400  O  O   . THR C 1 260 ? 5.776   -11.351 44.194  1.00 29.35 ? 274 THR C O   1 
ATOM   9401  C  CB  . THR C 1 260 ? 8.232   -10.467 45.747  1.00 23.40 ? 274 THR C CB  1 
ATOM   9402  O  OG1 . THR C 1 260 ? 9.223   -10.673 44.727  1.00 23.40 ? 274 THR C OG1 1 
ATOM   9403  C  CG2 . THR C 1 260 ? 8.905   -10.062 47.061  1.00 22.21 ? 274 THR C CG2 1 
ATOM   9404  N  N   . SER C 1 261 ? 6.968   -13.248 44.069  1.00 33.65 ? 275 SER C N   1 
ATOM   9405  C  CA  . SER C 1 261 ? 6.263   -13.766 42.890  1.00 31.70 ? 275 SER C CA  1 
ATOM   9406  C  C   . SER C 1 261 ? 5.094   -14.656 43.285  1.00 33.25 ? 275 SER C C   1 
ATOM   9407  O  O   . SER C 1 261 ? 4.304   -15.067 42.434  1.00 36.09 ? 275 SER C O   1 
ATOM   9408  C  CB  . SER C 1 261 ? 7.209   -14.589 42.004  1.00 35.51 ? 275 SER C CB  1 
ATOM   9409  O  OG  . SER C 1 261 ? 8.244   -13.795 41.459  1.00 35.12 ? 275 SER C OG  1 
ATOM   9410  N  N   . SER C 1 262 ? 4.999   -14.991 44.568  1.00 36.44 ? 276 SER C N   1 
ATOM   9411  C  CA  . SER C 1 262 ? 3.934   -15.878 45.037  1.00 36.51 ? 276 SER C CA  1 
ATOM   9412  C  C   . SER C 1 262 ? 2.661   -15.102 45.310  1.00 35.54 ? 276 SER C C   1 
ATOM   9413  O  O   . SER C 1 262 ? 2.658   -14.147 46.079  1.00 25.68 ? 276 SER C O   1 
ATOM   9414  C  CB  . SER C 1 262 ? 4.348   -16.626 46.304  1.00 30.16 ? 276 SER C CB  1 
ATOM   9415  O  OG  . SER C 1 262 ? 3.269   -17.405 46.812  1.00 30.68 ? 276 SER C OG  1 
ATOM   9416  N  N   . GLU C 1 263 ? 1.571   -15.541 44.700  1.00 31.14 ? 277 GLU C N   1 
ATOM   9417  C  CA  . GLU C 1 263 ? 0.297   -14.874 44.871  1.00 32.93 ? 277 GLU C CA  1 
ATOM   9418  C  C   . GLU C 1 263 ? -0.187  -15.045 46.306  1.00 31.00 ? 277 GLU C C   1 
ATOM   9419  O  O   . GLU C 1 263 ? -1.157  -14.414 46.727  1.00 32.48 ? 277 GLU C O   1 
ATOM   9420  C  CB  . GLU C 1 263 ? -0.725  -15.452 43.888  1.00 37.23 ? 277 GLU C CB  1 
ATOM   9421  C  CG  . GLU C 1 263 ? -0.912  -16.933 44.040  1.00 40.01 ? 277 GLU C CG  1 
ATOM   9422  C  CD  . GLU C 1 263 ? -1.879  -17.518 43.019  1.00 48.23 ? 277 GLU C CD  1 
ATOM   9423  O  OE1 . GLU C 1 263 ? -2.179  -18.721 43.129  1.00 46.42 ? 277 GLU C OE1 1 
ATOM   9424  O  OE2 . GLU C 1 263 ? -2.334  -16.780 42.119  1.00 51.86 ? 277 GLU C OE2 1 
ATOM   9425  N  N   . HIS C 1 264 ? 0.493   -15.902 47.063  1.00 29.37 ? 278 HIS C N   1 
ATOM   9426  C  CA  . HIS C 1 264 ? 0.102   -16.140 48.447  1.00 30.90 ? 278 HIS C CA  1 
ATOM   9427  C  C   . HIS C 1 264 ? 0.876   -15.297 49.483  1.00 27.23 ? 278 HIS C C   1 
ATOM   9428  O  O   . HIS C 1 264 ? 0.658   -15.434 50.688  1.00 30.65 ? 278 HIS C O   1 
ATOM   9429  C  CB  . HIS C 1 264 ? 0.208   -17.628 48.763  1.00 28.61 ? 278 HIS C CB  1 
ATOM   9430  C  CG  . HIS C 1 264 ? -0.495  -18.494 47.763  1.00 38.12 ? 278 HIS C CG  1 
ATOM   9431  N  ND1 . HIS C 1 264 ? -1.871  -18.539 47.659  1.00 36.47 ? 278 HIS C ND1 1 
ATOM   9432  C  CD2 . HIS C 1 264 ? -0.019  -19.328 46.808  1.00 42.00 ? 278 HIS C CD2 1 
ATOM   9433  C  CE1 . HIS C 1 264 ? -2.210  -19.371 46.690  1.00 42.17 ? 278 HIS C CE1 1 
ATOM   9434  N  NE2 . HIS C 1 264 ? -1.104  -19.866 46.158  1.00 47.71 ? 278 HIS C NE2 1 
ATOM   9435  N  N   . LEU C 1 265 ? 1.756   -14.417 49.024  1.00 26.36 ? 279 LEU C N   1 
ATOM   9436  C  CA  . LEU C 1 265 ? 2.494   -13.577 49.972  1.00 28.28 ? 279 LEU C CA  1 
ATOM   9437  C  C   . LEU C 1 265 ? 1.544   -12.636 50.699  1.00 21.60 ? 279 LEU C C   1 
ATOM   9438  O  O   . LEU C 1 265 ? 0.789   -11.912 50.053  1.00 24.42 ? 279 LEU C O   1 
ATOM   9439  C  CB  . LEU C 1 265 ? 3.552   -12.754 49.251  1.00 26.11 ? 279 LEU C CB  1 
ATOM   9440  C  CG  . LEU C 1 265 ? 4.370   -11.856 50.173  1.00 21.07 ? 279 LEU C CG  1 
ATOM   9441  C  CD1 . LEU C 1 265 ? 5.355   -12.725 50.947  1.00 17.79 ? 279 LEU C CD1 1 
ATOM   9442  C  CD2 . LEU C 1 265 ? 5.096   -10.816 49.354  1.00 21.84 ? 279 LEU C CD2 1 
ATOM   9443  N  N   . CYS C 1 266 ? 1.561   -12.640 52.030  1.00 21.55 ? 280 CYS C N   1 
ATOM   9444  C  CA  . CYS C 1 266 ? 0.788   -11.636 52.775  1.00 24.81 ? 280 CYS C CA  1 
ATOM   9445  C  C   . CYS C 1 266 ? 1.656   -10.710 53.643  1.00 28.09 ? 280 CYS C C   1 
ATOM   9446  O  O   . CYS C 1 266 ? 1.157   -9.767  54.251  1.00 25.36 ? 280 CYS C O   1 
ATOM   9447  C  CB  . CYS C 1 266 ? -0.314  -12.276 53.616  1.00 28.82 ? 280 CYS C CB  1 
ATOM   9448  S  SG  . CYS C 1 266 ? 0.254   -13.383 54.918  1.00 27.31 ? 280 CYS C SG  1 
ATOM   9449  N  N   . GLY C 1 267 ? 2.956   -10.971 53.701  1.00 24.44 ? 281 GLY C N   1 
ATOM   9450  C  CA  . GLY C 1 267 ? 3.824   -10.088 54.454  1.00 20.97 ? 281 GLY C CA  1 
ATOM   9451  C  C   . GLY C 1 267 ? 5.311   -10.362 54.327  1.00 19.61 ? 281 GLY C C   1 
ATOM   9452  O  O   . GLY C 1 267 ? 5.742   -11.477 54.018  1.00 19.43 ? 281 GLY C O   1 
ATOM   9453  N  N   . ILE C 1 268 ? 6.098   -9.318  54.558  1.00 24.57 ? 282 ILE C N   1 
ATOM   9454  C  CA  . ILE C 1 268 ? 7.541   -9.438  54.631  1.00 20.59 ? 282 ILE C CA  1 
ATOM   9455  C  C   . ILE C 1 268 ? 7.968   -8.737  55.900  1.00 17.16 ? 282 ILE C C   1 
ATOM   9456  O  O   . ILE C 1 268 ? 7.622   -7.570  56.129  1.00 15.47 ? 282 ILE C O   1 
ATOM   9457  C  CB  . ILE C 1 268 ? 8.240   -8.747  53.446  1.00 21.82 ? 282 ILE C CB  1 
ATOM   9458  C  CG1 . ILE C 1 268 ? 7.827   -9.400  52.120  1.00 23.29 ? 282 ILE C CG1 1 
ATOM   9459  C  CG2 . ILE C 1 268 ? 9.755   -8.757  53.633  1.00 25.57 ? 282 ILE C CG2 1 
ATOM   9460  C  CD1 . ILE C 1 268 ? 8.505   -8.808  50.894  1.00 23.23 ? 282 ILE C CD1 1 
ATOM   9461  N  N   . ASN C 1 269 ? 8.691   -9.467  56.734  1.00 18.48 ? 283 ASN C N   1 
ATOM   9462  C  CA  . ASN C 1 269 ? 9.243   -8.921  57.953  1.00 17.62 ? 283 ASN C CA  1 
ATOM   9463  C  C   . ASN C 1 269 ? 10.750  -8.944  57.752  1.00 19.84 ? 283 ASN C C   1 
ATOM   9464  O  O   . ASN C 1 269 ? 11.358  -10.011 57.660  1.00 18.99 ? 283 ASN C O   1 
ATOM   9465  C  CB  . ASN C 1 269 ? 8.808   -9.770  59.149  1.00 15.52 ? 283 ASN C CB  1 
ATOM   9466  C  CG  . ASN C 1 269 ? 8.844   -9.002  60.470  1.00 15.97 ? 283 ASN C CG  1 
ATOM   9467  O  OD1 . ASN C 1 269 ? 9.017   -7.782  60.492  1.00 19.27 ? 283 ASN C OD1 1 
ATOM   9468  N  ND2 . ASN C 1 269 ? 8.646   -9.718  61.572  1.00 15.81 ? 283 ASN C ND2 1 
ATOM   9469  N  N   . PHE C 1 270 ? 11.343  -7.758  57.644  1.00 19.37 ? 284 PHE C N   1 
ATOM   9470  C  CA  . PHE C 1 270 ? 12.707  -7.645  57.157  1.00 19.28 ? 284 PHE C CA  1 
ATOM   9471  C  C   . PHE C 1 270 ? 13.556  -6.810  58.091  1.00 19.58 ? 284 PHE C C   1 
ATOM   9472  O  O   . PHE C 1 270 ? 13.098  -5.786  58.587  1.00 20.03 ? 284 PHE C O   1 
ATOM   9473  C  CB  . PHE C 1 270 ? 12.691  -7.001  55.770  1.00 20.10 ? 284 PHE C CB  1 
ATOM   9474  C  CG  . PHE C 1 270 ? 14.056  -6.672  55.227  1.00 25.20 ? 284 PHE C CG  1 
ATOM   9475  C  CD1 . PHE C 1 270 ? 14.599  -5.408  55.394  1.00 26.61 ? 284 PHE C CD1 1 
ATOM   9476  C  CD2 . PHE C 1 270 ? 14.786  -7.624  54.531  1.00 24.41 ? 284 PHE C CD2 1 
ATOM   9477  C  CE1 . PHE C 1 270 ? 15.855  -5.101  54.881  1.00 30.46 ? 284 PHE C CE1 1 
ATOM   9478  C  CE2 . PHE C 1 270 ? 16.045  -7.329  54.020  1.00 32.31 ? 284 PHE C CE2 1 
ATOM   9479  C  CZ  . PHE C 1 270 ? 16.581  -6.065  54.189  1.00 28.52 ? 284 PHE C CZ  1 
ATOM   9480  N  N   . THR C 1 271 ? 14.789  -7.248  58.324  1.00 20.20 ? 285 THR C N   1 
ATOM   9481  C  CA  . THR C 1 271 ? 15.805  -6.364  58.887  1.00 24.79 ? 285 THR C CA  1 
ATOM   9482  C  C   . THR C 1 271 ? 17.014  -6.397  57.956  1.00 30.70 ? 285 THR C C   1 
ATOM   9483  O  O   . THR C 1 271 ? 17.378  -7.455  57.442  1.00 29.84 ? 285 THR C O   1 
ATOM   9484  C  CB  . THR C 1 271 ? 16.204  -6.747  60.334  1.00 30.30 ? 285 THR C CB  1 
ATOM   9485  O  OG1 . THR C 1 271 ? 15.047  -6.691  61.176  1.00 35.51 ? 285 THR C OG1 1 
ATOM   9486  C  CG2 . THR C 1 271 ? 17.235  -5.750  60.883  1.00 26.29 ? 285 THR C CG2 1 
ATOM   9487  N  N   . GLY C 1 272 ? 17.614  -5.236  57.710  1.00 33.32 ? 286 GLY C N   1 
ATOM   9488  C  CA  . GLY C 1 272 ? 18.753  -5.150  56.812  1.00 32.51 ? 286 GLY C CA  1 
ATOM   9489  C  C   . GLY C 1 272 ? 18.868  -3.778  56.183  1.00 34.56 ? 286 GLY C C   1 
ATOM   9490  O  O   . GLY C 1 272 ? 18.434  -2.797  56.772  1.00 32.71 ? 286 GLY C O   1 
ATOM   9491  N  N   . SER C 1 273 ? 19.423  -3.711  54.976  1.00 32.09 ? 287 SER C N   1 
ATOM   9492  C  CA  . SER C 1 273 ? 19.746  -2.427  54.352  1.00 37.40 ? 287 SER C CA  1 
ATOM   9493  C  C   . SER C 1 273 ? 18.549  -1.787  53.664  1.00 35.24 ? 287 SER C C   1 
ATOM   9494  O  O   . SER C 1 273 ? 17.624  -2.476  53.219  1.00 37.16 ? 287 SER C O   1 
ATOM   9495  C  CB  . SER C 1 273 ? 20.857  -2.612  53.317  1.00 37.24 ? 287 SER C CB  1 
ATOM   9496  O  OG  . SER C 1 273 ? 20.307  -3.042  52.081  1.00 36.48 ? 287 SER C OG  1 
ATOM   9497  N  N   . VAL C 1 274 ? 18.581  -0.463  53.553  1.00 32.53 ? 288 VAL C N   1 
ATOM   9498  C  CA  . VAL C 1 274 ? 17.529  0.262   52.860  1.00 29.39 ? 288 VAL C CA  1 
ATOM   9499  C  C   . VAL C 1 274 ? 17.378  -0.110  51.378  1.00 37.34 ? 288 VAL C C   1 
ATOM   9500  O  O   . VAL C 1 274 ? 16.252  -0.335  50.913  1.00 39.00 ? 288 VAL C O   1 
ATOM   9501  C  CB  . VAL C 1 274 ? 17.678  1.805   53.014  1.00 36.74 ? 288 VAL C CB  1 
ATOM   9502  C  CG1 . VAL C 1 274 ? 16.635  2.514   52.176  1.00 38.10 ? 288 VAL C CG1 1 
ATOM   9503  C  CG2 . VAL C 1 274 ? 17.562  2.210   54.465  1.00 32.28 ? 288 VAL C CG2 1 
ATOM   9504  N  N   . PRO C 1 275 ? 18.494  -0.170  50.617  1.00 42.34 ? 289 PRO C N   1 
ATOM   9505  C  CA  . PRO C 1 275 ? 18.264  -0.539  49.212  1.00 39.99 ? 289 PRO C CA  1 
ATOM   9506  C  C   . PRO C 1 275 ? 17.658  -1.938  49.033  1.00 27.14 ? 289 PRO C C   1 
ATOM   9507  O  O   . PRO C 1 275 ? 16.862  -2.156  48.113  1.00 34.10 ? 289 PRO C O   1 
ATOM   9508  C  CB  . PRO C 1 275 ? 19.659  -0.440  48.575  1.00 46.04 ? 289 PRO C CB  1 
ATOM   9509  C  CG  . PRO C 1 275 ? 20.624  -0.362  49.704  1.00 41.28 ? 289 PRO C CG  1 
ATOM   9510  C  CD  . PRO C 1 275 ? 19.892  0.227   50.863  1.00 42.29 ? 289 PRO C CD  1 
ATOM   9511  N  N   . THR C 1 276 ? 18.000  -2.872  49.908  1.00 32.05 ? 290 THR C N   1 
ATOM   9512  C  CA  . THR C 1 276 ? 17.378  -4.189  49.836  1.00 28.72 ? 290 THR C CA  1 
ATOM   9513  C  C   . THR C 1 276 ? 15.879  -4.078  50.117  1.00 26.94 ? 290 THR C C   1 
ATOM   9514  O  O   . THR C 1 276 ? 15.054  -4.601  49.362  1.00 30.68 ? 290 THR C O   1 
ATOM   9515  C  CB  . THR C 1 276 ? 18.014  -5.188  50.824  1.00 30.80 ? 290 THR C CB  1 
ATOM   9516  O  OG1 . THR C 1 276 ? 19.417  -5.281  50.561  1.00 34.34 ? 290 THR C OG1 1 
ATOM   9517  C  CG2 . THR C 1 276 ? 17.374  -6.565  50.668  1.00 31.03 ? 290 THR C CG2 1 
ATOM   9518  N  N   . PHE C 1 277 ? 15.529  -3.382  51.196  1.00 31.25 ? 291 PHE C N   1 
ATOM   9519  C  CA  . PHE C 1 277 ? 14.120  -3.238  51.564  1.00 28.40 ? 291 PHE C CA  1 
ATOM   9520  C  C   . PHE C 1 277 ? 13.328  -2.536  50.465  1.00 23.61 ? 291 PHE C C   1 
ATOM   9521  O  O   . PHE C 1 277 ? 12.212  -2.958  50.119  1.00 27.45 ? 291 PHE C O   1 
ATOM   9522  C  CB  . PHE C 1 277 ? 13.971  -2.522  52.913  1.00 25.42 ? 291 PHE C CB  1 
ATOM   9523  C  CG  . PHE C 1 277 ? 12.544  -2.432  53.399  1.00 28.11 ? 291 PHE C CG  1 
ATOM   9524  C  CD1 . PHE C 1 277 ? 11.854  -3.576  53.775  1.00 30.95 ? 291 PHE C CD1 1 
ATOM   9525  C  CD2 . PHE C 1 277 ? 11.902  -1.209  53.496  1.00 30.26 ? 291 PHE C CD2 1 
ATOM   9526  C  CE1 . PHE C 1 277 ? 10.535  -3.504  54.216  1.00 29.83 ? 291 PHE C CE1 1 
ATOM   9527  C  CE2 . PHE C 1 277 ? 10.589  -1.129  53.939  1.00 32.90 ? 291 PHE C CE2 1 
ATOM   9528  C  CZ  . PHE C 1 277 ? 9.905   -2.282  54.302  1.00 32.63 ? 291 PHE C CZ  1 
ATOM   9529  N  N   . LYS C 1 278 ? 13.910  -1.484  49.887  1.00 25.66 ? 292 LYS C N   1 
ATOM   9530  C  CA  . LYS C 1 278 ? 13.266  -0.799  48.763  1.00 28.67 ? 292 LYS C CA  1 
ATOM   9531  C  C   . LYS C 1 278 ? 13.073  -1.730  47.575  1.00 26.51 ? 292 LYS C C   1 
ATOM   9532  O  O   . LYS C 1 278 ? 12.020  -1.720  46.932  1.00 31.43 ? 292 LYS C O   1 
ATOM   9533  C  CB  . LYS C 1 278 ? 14.058  0.443   48.344  1.00 32.10 ? 292 LYS C CB  1 
ATOM   9534  C  CG  . LYS C 1 278 ? 13.978  1.572   49.359  1.00 34.92 ? 292 LYS C CG  1 
ATOM   9535  C  CD  . LYS C 1 278 ? 14.768  2.802   48.921  1.00 42.38 ? 292 LYS C CD  1 
ATOM   9536  C  CE  . LYS C 1 278 ? 14.365  4.018   49.761  1.00 51.58 ? 292 LYS C CE  1 
ATOM   9537  N  NZ  . LYS C 1 278 ? 14.914  5.305   49.246  1.00 55.59 ? 292 LYS C NZ  1 
ATOM   9538  N  N   . HIS C 1 279 ? 14.082  -2.558  47.295  1.00 36.21 ? 293 HIS C N   1 
ATOM   9539  C  CA  . HIS C 1 279 ? 13.975  -3.542  46.216  1.00 28.31 ? 293 HIS C CA  1 
ATOM   9540  C  C   . HIS C 1 279 ? 12.794  -4.476  46.448  1.00 23.38 ? 293 HIS C C   1 
ATOM   9541  O  O   . HIS C 1 279 ? 11.985  -4.706  45.547  1.00 27.59 ? 293 HIS C O   1 
ATOM   9542  C  CB  . HIS C 1 279 ? 15.274  -4.351  46.077  1.00 31.37 ? 293 HIS C CB  1 
ATOM   9543  C  CG  . HIS C 1 279 ? 15.250  -5.346  44.955  1.00 30.93 ? 293 HIS C CG  1 
ATOM   9544  N  ND1 . HIS C 1 279 ? 15.033  -4.983  43.642  1.00 38.76 ? 293 HIS C ND1 1 
ATOM   9545  C  CD2 . HIS C 1 279 ? 15.411  -6.689  44.951  1.00 34.54 ? 293 HIS C CD2 1 
ATOM   9546  C  CE1 . HIS C 1 279 ? 15.063  -6.060  42.878  1.00 43.08 ? 293 HIS C CE1 1 
ATOM   9547  N  NE2 . HIS C 1 279 ? 15.291  -7.109  43.646  1.00 40.81 ? 293 HIS C NE2 1 
ATOM   9548  N  N   . LEU C 1 280 ? 12.684  -4.995  47.670  1.00 26.18 ? 294 LEU C N   1 
ATOM   9549  C  CA  . LEU C 1 280 ? 11.598  -5.908  48.008  1.00 28.58 ? 294 LEU C CA  1 
ATOM   9550  C  C   . LEU C 1 280 ? 10.232  -5.211  47.852  1.00 28.06 ? 294 LEU C C   1 
ATOM   9551  O  O   . LEU C 1 280 ? 9.298   -5.762  47.272  1.00 30.12 ? 294 LEU C O   1 
ATOM   9552  C  CB  . LEU C 1 280 ? 11.773  -6.421  49.436  1.00 24.53 ? 294 LEU C CB  1 
ATOM   9553  C  CG  . LEU C 1 280 ? 12.885  -7.453  49.670  1.00 24.88 ? 294 LEU C CG  1 
ATOM   9554  C  CD1 . LEU C 1 280 ? 13.176  -7.568  51.159  1.00 29.04 ? 294 LEU C CD1 1 
ATOM   9555  C  CD2 . LEU C 1 280 ? 12.478  -8.816  49.092  1.00 21.66 ? 294 LEU C CD2 1 
ATOM   9556  N  N   . TRP C 1 281 ? 10.143  -3.998  48.383  1.00 27.36 ? 295 TRP C N   1 
ATOM   9557  C  CA  . TRP C 1 281 ? 8.949   -3.157  48.259  1.00 28.53 ? 295 TRP C CA  1 
ATOM   9558  C  C   . TRP C 1 281 ? 8.535   -3.003  46.797  1.00 23.05 ? 295 TRP C C   1 
ATOM   9559  O  O   . TRP C 1 281 ? 7.368   -3.212  46.435  1.00 29.06 ? 295 TRP C O   1 
ATOM   9560  C  CB  . TRP C 1 281 ? 9.254   -1.801  48.874  1.00 25.51 ? 295 TRP C CB  1 
ATOM   9561  C  CG  . TRP C 1 281 ? 8.104   -0.819  48.931  1.00 32.44 ? 295 TRP C CG  1 
ATOM   9562  C  CD1 . TRP C 1 281 ? 7.061   -0.694  48.053  1.00 35.88 ? 295 TRP C CD1 1 
ATOM   9563  C  CD2 . TRP C 1 281 ? 7.912   0.182   49.923  1.00 35.64 ? 295 TRP C CD2 1 
ATOM   9564  N  NE1 . TRP C 1 281 ? 6.234   0.329   48.441  1.00 38.16 ? 295 TRP C NE1 1 
ATOM   9565  C  CE2 . TRP C 1 281 ? 6.733   0.882   49.591  1.00 41.59 ? 295 TRP C CE2 1 
ATOM   9566  C  CE3 . TRP C 1 281 ? 8.623   0.557   51.066  1.00 37.94 ? 295 TRP C CE3 1 
ATOM   9567  C  CZ2 . TRP C 1 281 ? 6.251   1.932   50.361  1.00 44.84 ? 295 TRP C CZ2 1 
ATOM   9568  C  CZ3 . TRP C 1 281 ? 8.146   1.603   51.826  1.00 47.87 ? 295 TRP C CZ3 1 
ATOM   9569  C  CH2 . TRP C 1 281 ? 6.971   2.279   51.471  1.00 47.51 ? 295 TRP C CH2 1 
ATOM   9570  N  N   . LYS C 1 282 ? 9.500   -2.659  45.950  1.00 29.44 ? 296 LYS C N   1 
ATOM   9571  C  CA  . LYS C 1 282 ? 9.242   -2.527  44.517  1.00 28.18 ? 296 LYS C CA  1 
ATOM   9572  C  C   . LYS C 1 282 ? 8.762   -3.831  43.895  1.00 30.02 ? 296 LYS C C   1 
ATOM   9573  O  O   . LYS C 1 282 ? 7.885   -3.831  43.023  1.00 29.63 ? 296 LYS C O   1 
ATOM   9574  C  CB  . LYS C 1 282 ? 10.500  -2.037  43.785  1.00 33.45 ? 296 LYS C CB  1 
ATOM   9575  C  CG  . LYS C 1 282 ? 10.860  -0.579  44.040  1.00 38.53 ? 296 LYS C CG  1 
ATOM   9576  C  CD  . LYS C 1 282 ? 12.192  -0.220  43.388  1.00 41.08 ? 296 LYS C CD  1 
ATOM   9577  C  CE  . LYS C 1 282 ? 12.364  1.284   43.264  1.00 48.40 ? 296 LYS C CE  1 
ATOM   9578  N  NZ  . LYS C 1 282 ? 13.741  1.643   42.807  1.00 52.86 ? 296 LYS C NZ  1 
ATOM   9579  N  N   . GLN C 1 283 ? 9.348   -4.951  44.322  1.00 29.61 ? 297 GLN C N   1 
ATOM   9580  C  CA  . GLN C 1 283 ? 8.947   -6.217  43.739  1.00 27.80 ? 297 GLN C CA  1 
ATOM   9581  C  C   . GLN C 1 283 ? 7.512   -6.492  44.112  1.00 25.82 ? 297 GLN C C   1 
ATOM   9582  O  O   . GLN C 1 283 ? 6.744   -6.960  43.293  1.00 29.46 ? 297 GLN C O   1 
ATOM   9583  C  CB  . GLN C 1 283 ? 9.843   -7.365  44.192  1.00 25.41 ? 297 GLN C CB  1 
ATOM   9584  C  CG  . GLN C 1 283 ? 11.240  -7.330  43.600  1.00 27.99 ? 297 GLN C CG  1 
ATOM   9585  C  CD  . GLN C 1 283 ? 12.022  -8.607  43.913  1.00 33.89 ? 297 GLN C CD  1 
ATOM   9586  O  OE1 . GLN C 1 283 ? 12.143  -9.001  45.070  1.00 33.38 ? 297 GLN C OE1 1 
ATOM   9587  N  NE2 . GLN C 1 283 ? 12.541  -9.256  42.877  1.00 31.45 ? 297 GLN C NE2 1 
ATOM   9588  N  N   . VAL C 1 284 ? 7.153   -6.197  45.357  1.00 26.36 ? 298 VAL C N   1 
ATOM   9589  C  CA  . VAL C 1 284 ? 5.790   -6.441  45.793  1.00 23.96 ? 298 VAL C CA  1 
ATOM   9590  C  C   . VAL C 1 284 ? 4.843   -5.591  44.953  1.00 20.64 ? 298 VAL C C   1 
ATOM   9591  O  O   . VAL C 1 284 ? 3.821   -6.074  44.453  1.00 23.38 ? 298 VAL C O   1 
ATOM   9592  C  CB  . VAL C 1 284 ? 5.612   -6.171  47.308  1.00 27.67 ? 298 VAL C CB  1 
ATOM   9593  C  CG1 . VAL C 1 284 ? 4.166   -6.039  47.649  1.00 24.18 ? 298 VAL C CG1 1 
ATOM   9594  C  CG2 . VAL C 1 284 ? 6.237   -7.323  48.122  1.00 27.09 ? 298 VAL C CG2 1 
ATOM   9595  N  N   . ALA C 1 285 ? 5.229   -4.342  44.751  1.00 26.77 ? 299 ALA C N   1 
ATOM   9596  C  CA  . ALA C 1 285 ? 4.410   -3.390  44.000  1.00 28.17 ? 299 ALA C CA  1 
ATOM   9597  C  C   . ALA C 1 285 ? 4.152   -3.830  42.558  1.00 28.39 ? 299 ALA C C   1 
ATOM   9598  O  O   . ALA C 1 285 ? 3.019   -3.766  42.081  1.00 30.18 ? 299 ALA C O   1 
ATOM   9599  C  CB  . ALA C 1 285 ? 5.080   -2.056  44.008  1.00 25.85 ? 299 ALA C CB  1 
ATOM   9600  N  N   . GLN C 1 286 ? 5.212   -4.260  41.875  1.00 36.98 ? 300 GLN C N   1 
ATOM   9601  C  CA  . GLN C 1 286 ? 5.114   -4.763  40.503  1.00 39.07 ? 300 GLN C CA  1 
ATOM   9602  C  C   . GLN C 1 286 ? 4.149   -5.931  40.420  1.00 34.17 ? 300 GLN C C   1 
ATOM   9603  O  O   . GLN C 1 286 ? 3.445   -6.104  39.428  1.00 32.64 ? 300 GLN C O   1 
ATOM   9604  C  CB  . GLN C 1 286 ? 6.483   -5.220  40.000  1.00 41.25 ? 300 GLN C CB  1 
ATOM   9605  N  N   . ASN C 1 287 ? 4.125   -6.743  41.467  1.00 28.91 ? 301 ASN C N   1 
ATOM   9606  C  CA  . ASN C 1 287 ? 3.303   -7.939  41.455  1.00 26.90 ? 301 ASN C CA  1 
ATOM   9607  C  C   . ASN C 1 287 ? 1.977   -7.766  42.177  1.00 34.20 ? 301 ASN C C   1 
ATOM   9608  O  O   . ASN C 1 287 ? 1.341   -8.752  42.530  1.00 34.57 ? 301 ASN C O   1 
ATOM   9609  C  CB  . ASN C 1 287 ? 4.084   -9.139  42.024  1.00 31.39 ? 301 ASN C CB  1 
ATOM   9610  C  CG  . ASN C 1 287 ? 5.174   -9.635  41.073  1.00 36.56 ? 301 ASN C CG  1 
ATOM   9611  O  OD1 . ASN C 1 287 ? 5.202   -9.268  39.894  1.00 39.94 ? 301 ASN C OD1 1 
ATOM   9612  N  ND2 . ASN C 1 287 ? 6.063   -10.489 41.579  1.00 32.71 ? 301 ASN C ND2 1 
ATOM   9613  N  N   . LEU C 1 288 ? 1.539   -6.519  42.371  1.00 29.26 ? 302 LEU C N   1 
ATOM   9614  C  CA  . LEU C 1 288 ? 0.354   -6.264  43.185  1.00 31.92 ? 302 LEU C CA  1 
ATOM   9615  C  C   . LEU C 1 288 ? -0.908  -7.026  42.751  1.00 30.83 ? 302 LEU C C   1 
ATOM   9616  O  O   . LEU C 1 288 ? -1.681  -7.486  43.595  1.00 31.88 ? 302 LEU C O   1 
ATOM   9617  C  CB  . LEU C 1 288 ? 0.051   -4.767  43.256  1.00 29.29 ? 302 LEU C CB  1 
ATOM   9618  C  CG  . LEU C 1 288 ? 0.502   -4.043  44.513  1.00 39.79 ? 302 LEU C CG  1 
ATOM   9619  C  CD1 . LEU C 1 288 ? -0.201  -2.700  44.578  1.00 40.92 ? 302 LEU C CD1 1 
ATOM   9620  C  CD2 . LEU C 1 288 ? 0.233   -4.869  45.766  1.00 35.36 ? 302 LEU C CD2 1 
ATOM   9621  N  N   . ASP C 1 289 ? -1.114  -7.158  41.447  1.00 36.06 ? 303 ASP C N   1 
ATOM   9622  C  CA  . ASP C 1 289 ? -2.343  -7.767  40.930  1.00 42.65 ? 303 ASP C CA  1 
ATOM   9623  C  C   . ASP C 1 289 ? -2.537  -9.227  41.356  1.00 44.30 ? 303 ASP C C   1 
ATOM   9624  O  O   . ASP C 1 289 ? -3.669  -9.679  41.554  1.00 45.66 ? 303 ASP C O   1 
ATOM   9625  C  CB  . ASP C 1 289 ? -2.397  -7.659  39.404  1.00 47.41 ? 303 ASP C CB  1 
ATOM   9626  N  N   . ARG C 1 290 ? -1.438  -9.959  41.506  1.00 39.91 ? 304 ARG C N   1 
ATOM   9627  C  CA  . ARG C 1 290 ? -1.533  -11.397 41.756  1.00 41.13 ? 304 ARG C CA  1 
ATOM   9628  C  C   . ARG C 1 290 ? -1.850  -11.764 43.203  1.00 40.83 ? 304 ARG C C   1 
ATOM   9629  O  O   . ARG C 1 290 ? -2.333  -12.869 43.470  1.00 39.36 ? 304 ARG C O   1 
ATOM   9630  C  CB  . ARG C 1 290 ? -0.262  -12.107 41.303  1.00 36.07 ? 304 ARG C CB  1 
ATOM   9631  C  CG  . ARG C 1 290 ? 0.953   -11.767 42.124  1.00 34.89 ? 304 ARG C CG  1 
ATOM   9632  C  CD  . ARG C 1 290 ? 2.162   -12.511 41.625  1.00 43.31 ? 304 ARG C CD  1 
ATOM   9633  N  NE  . ARG C 1 290 ? 2.590   -12.075 40.301  1.00 44.12 ? 304 ARG C NE  1 
ATOM   9634  C  CZ  . ARG C 1 290 ? 3.484   -12.737 39.573  1.00 41.28 ? 304 ARG C CZ  1 
ATOM   9635  N  NH1 . ARG C 1 290 ? 4.008   -13.857 40.051  1.00 40.32 ? 304 ARG C NH1 1 
ATOM   9636  N  NH2 . ARG C 1 290 ? 3.845   -12.299 38.373  1.00 44.98 ? 304 ARG C NH2 1 
ATOM   9637  N  N   . PHE C 1 291 ? -1.589  -10.851 44.136  1.00 32.31 ? 305 PHE C N   1 
ATOM   9638  C  CA  . PHE C 1 291 ? -1.768  -11.176 45.546  1.00 27.43 ? 305 PHE C CA  1 
ATOM   9639  C  C   . PHE C 1 291 ? -3.233  -11.230 45.928  1.00 31.13 ? 305 PHE C C   1 
ATOM   9640  O  O   . PHE C 1 291 ? -4.014  -10.342 45.580  1.00 31.62 ? 305 PHE C O   1 
ATOM   9641  C  CB  . PHE C 1 291 ? -1.043  -10.172 46.447  1.00 25.06 ? 305 PHE C CB  1 
ATOM   9642  C  CG  . PHE C 1 291 ? 0.409   -10.010 46.127  1.00 24.43 ? 305 PHE C CG  1 
ATOM   9643  C  CD1 . PHE C 1 291 ? 1.256   -11.107 46.117  1.00 22.98 ? 305 PHE C CD1 1 
ATOM   9644  C  CD2 . PHE C 1 291 ? 0.932   -8.757  45.862  1.00 23.00 ? 305 PHE C CD2 1 
ATOM   9645  C  CE1 . PHE C 1 291 ? 2.597   -10.947 45.845  1.00 25.25 ? 305 PHE C CE1 1 
ATOM   9646  C  CE2 . PHE C 1 291 ? 2.264   -8.594  45.580  1.00 25.24 ? 305 PHE C CE2 1 
ATOM   9647  C  CZ  . PHE C 1 291 ? 3.097   -9.699  45.568  1.00 25.38 ? 305 PHE C CZ  1 
ATOM   9648  N  N   . HIS C 1 292 ? -3.597  -12.269 46.667  1.00 35.41 ? 306 HIS C N   1 
ATOM   9649  C  CA  . HIS C 1 292 ? -4.974  -12.438 47.097  1.00 46.16 ? 306 HIS C CA  1 
ATOM   9650  C  C   . HIS C 1 292 ? -5.291  -11.507 48.267  1.00 45.29 ? 306 HIS C C   1 
ATOM   9651  O  O   . HIS C 1 292 ? -6.460  -11.280 48.580  1.00 38.53 ? 306 HIS C O   1 
ATOM   9652  C  CB  . HIS C 1 292 ? -5.267  -13.906 47.425  1.00 49.02 ? 306 HIS C CB  1 
ATOM   9653  C  CG  . HIS C 1 292 ? -5.039  -14.834 46.268  1.00 56.56 ? 306 HIS C CG  1 
ATOM   9654  N  ND1 . HIS C 1 292 ? -5.905  -14.918 45.199  1.00 61.16 ? 306 HIS C ND1 1 
ATOM   9655  C  CD2 . HIS C 1 292 ? -4.035  -15.706 46.008  1.00 58.60 ? 306 HIS C CD2 1 
ATOM   9656  C  CE1 . HIS C 1 292 ? -5.447  -15.804 44.331  1.00 62.72 ? 306 HIS C CE1 1 
ATOM   9657  N  NE2 . HIS C 1 292 ? -4.314  -16.297 44.798  1.00 61.09 ? 306 HIS C NE2 1 
ATOM   9658  N  N   . THR C 1 293 ? -4.247  -10.981 48.913  1.00 36.57 ? 307 THR C N   1 
ATOM   9659  C  CA  . THR C 1 293 ? -4.407  -9.852  49.828  1.00 39.28 ? 307 THR C CA  1 
ATOM   9660  C  C   . THR C 1 293 ? -3.210  -8.918  49.734  1.00 33.59 ? 307 THR C C   1 
ATOM   9661  O  O   . THR C 1 293 ? -2.138  -9.342  49.312  1.00 41.42 ? 307 THR C O   1 
ATOM   9662  C  CB  . THR C 1 293 ? -4.592  -10.291 51.289  1.00 45.81 ? 307 THR C CB  1 
ATOM   9663  O  OG1 . THR C 1 293 ? -4.731  -9.124  52.115  1.00 48.62 ? 307 THR C OG1 1 
ATOM   9664  C  CG2 . THR C 1 293 ? -3.401  -11.099 51.764  1.00 39.09 ? 307 THR C CG2 1 
ATOM   9665  N  N   . PHE C 1 294 ? -3.389  -7.656  50.125  1.00 27.04 ? 308 PHE C N   1 
ATOM   9666  C  CA  . PHE C 1 294 ? -2.294  -6.681  50.127  1.00 26.64 ? 308 PHE C CA  1 
ATOM   9667  C  C   . PHE C 1 294 ? -1.216  -7.068  51.146  1.00 26.41 ? 308 PHE C C   1 
ATOM   9668  O  O   . PHE C 1 294 ? -1.484  -7.087  52.344  1.00 25.06 ? 308 PHE C O   1 
ATOM   9669  C  CB  . PHE C 1 294 ? -2.804  -5.283  50.492  1.00 32.21 ? 308 PHE C CB  1 
ATOM   9670  C  CG  . PHE C 1 294 ? -3.503  -4.563  49.372  1.00 43.61 ? 308 PHE C CG  1 
ATOM   9671  C  CD1 . PHE C 1 294 ? -4.856  -4.767  49.134  1.00 56.01 ? 308 PHE C CD1 1 
ATOM   9672  C  CD2 . PHE C 1 294 ? -2.818  -3.659  48.579  1.00 47.20 ? 308 PHE C CD2 1 
ATOM   9673  C  CE1 . PHE C 1 294 ? -5.511  -4.095  48.113  1.00 59.29 ? 308 PHE C CE1 1 
ATOM   9674  C  CE2 . PHE C 1 294 ? -3.460  -2.983  47.560  1.00 54.44 ? 308 PHE C CE2 1 
ATOM   9675  C  CZ  . PHE C 1 294 ? -4.811  -3.202  47.324  1.00 57.39 ? 308 PHE C CZ  1 
ATOM   9676  N  N   . PRO C 1 295 ? 0.011   -7.352  50.679  1.00 25.13 ? 309 PRO C N   1 
ATOM   9677  C  CA  . PRO C 1 295 ? 1.086   -7.735  51.611  1.00 21.12 ? 309 PRO C CA  1 
ATOM   9678  C  C   . PRO C 1 295 ? 1.514   -6.592  52.519  1.00 24.90 ? 309 PRO C C   1 
ATOM   9679  O  O   . PRO C 1 295 ? 1.590   -5.450  52.082  1.00 26.40 ? 309 PRO C O   1 
ATOM   9680  C  CB  . PRO C 1 295 ? 2.246   -8.096  50.681  1.00 20.15 ? 309 PRO C CB  1 
ATOM   9681  C  CG  . PRO C 1 295 ? 1.569   -8.481  49.389  1.00 24.76 ? 309 PRO C CG  1 
ATOM   9682  C  CD  . PRO C 1 295 ? 0.420   -7.520  49.276  1.00 22.72 ? 309 PRO C CD  1 
ATOM   9683  N  N   . ARG C 1 296 ? 1.803   -6.919  53.773  1.00 18.28 ? 310 ARG C N   1 
ATOM   9684  C  CA  . ARG C 1 296 ? 2.259   -5.946  54.741  1.00 17.70 ? 310 ARG C CA  1 
ATOM   9685  C  C   . ARG C 1 296 ? 3.773   -6.023  54.831  1.00 24.29 ? 310 ARG C C   1 
ATOM   9686  O  O   . ARG C 1 296 ? 4.344   -7.098  55.043  1.00 20.42 ? 310 ARG C O   1 
ATOM   9687  C  CB  . ARG C 1 296 ? 1.617   -6.226  56.094  1.00 23.77 ? 310 ARG C CB  1 
ATOM   9688  C  CG  . ARG C 1 296 ? 0.100   -6.098  56.015  1.00 30.65 ? 310 ARG C CG  1 
ATOM   9689  C  CD  . ARG C 1 296 ? -0.552  -6.201  57.356  1.00 27.08 ? 310 ARG C CD  1 
ATOM   9690  N  NE  . ARG C 1 296 ? -2.000  -6.076  57.237  1.00 29.93 ? 310 ARG C NE  1 
ATOM   9691  C  CZ  . ARG C 1 296 ? -2.817  -6.028  58.280  1.00 32.72 ? 310 ARG C CZ  1 
ATOM   9692  N  NH1 . ARG C 1 296 ? -4.129  -5.908  58.098  1.00 33.90 ? 310 ARG C NH1 1 
ATOM   9693  N  NH2 . ARG C 1 296 ? -2.316  -6.085  59.506  1.00 24.87 ? 310 ARG C NH2 1 
ATOM   9694  N  N   . LEU C 1 297 ? 4.418   -4.878  54.651  1.00 21.29 ? 311 LEU C N   1 
ATOM   9695  C  CA  . LEU C 1 297 ? 5.875   -4.813  54.661  1.00 21.56 ? 311 LEU C CA  1 
ATOM   9696  C  C   . LEU C 1 297 ? 6.340   -4.135  55.930  1.00 23.90 ? 311 LEU C C   1 
ATOM   9697  O  O   . LEU C 1 297 ? 5.859   -3.064  56.278  1.00 25.52 ? 311 LEU C O   1 
ATOM   9698  C  CB  . LEU C 1 297 ? 6.369   -4.032  53.444  1.00 31.46 ? 311 LEU C CB  1 
ATOM   9699  C  CG  . LEU C 1 297 ? 6.298   -4.771  52.109  1.00 39.08 ? 311 LEU C CG  1 
ATOM   9700  C  CD1 . LEU C 1 297 ? 6.137   -3.808  50.948  1.00 38.05 ? 311 LEU C CD1 1 
ATOM   9701  C  CD2 . LEU C 1 297 ? 7.569   -5.585  51.934  1.00 41.80 ? 311 LEU C CD2 1 
ATOM   9702  N  N   . ALA C 1 298 ? 7.263   -4.782  56.626  1.00 16.77 ? 312 ALA C N   1 
ATOM   9703  C  CA  . ALA C 1 298 ? 7.864   -4.237  57.819  1.00 24.60 ? 312 ALA C CA  1 
ATOM   9704  C  C   . ALA C 1 298 ? 9.363   -4.304  57.622  1.00 29.40 ? 312 ALA C C   1 
ATOM   9705  O  O   . ALA C 1 298 ? 9.932   -5.380  57.380  1.00 22.18 ? 312 ALA C O   1 
ATOM   9706  C  CB  . ALA C 1 298 ? 7.441   -5.028  59.059  1.00 18.45 ? 312 ALA C CB  1 
ATOM   9707  N  N   . GLY C 1 299 ? 9.998   -3.145  57.690  1.00 29.25 ? 313 GLY C N   1 
ATOM   9708  C  CA  . GLY C 1 299 ? 11.428  -3.068  57.494  1.00 25.12 ? 313 GLY C CA  1 
ATOM   9709  C  C   . GLY C 1 299 ? 12.126  -2.275  58.572  1.00 30.77 ? 313 GLY C C   1 
ATOM   9710  O  O   . GLY C 1 299 ? 11.778  -1.131  58.849  1.00 30.74 ? 313 GLY C O   1 
ATOM   9711  N  N   . GLU C 1 300 ? 13.119  -2.907  59.174  1.00 32.62 ? 314 GLU C N   1 
ATOM   9712  C  CA  . GLU C 1 300 ? 13.985  -2.265  60.130  1.00 38.44 ? 314 GLU C CA  1 
ATOM   9713  C  C   . GLU C 1 300 ? 15.352  -2.126  59.477  1.00 35.89 ? 314 GLU C C   1 
ATOM   9714  O  O   . GLU C 1 300 ? 16.072  -3.116  59.293  1.00 33.26 ? 314 GLU C O   1 
ATOM   9715  C  CB  . GLU C 1 300 ? 14.074  -3.125  61.389  1.00 41.80 ? 314 GLU C CB  1 
ATOM   9716  C  CG  . GLU C 1 300 ? 14.981  -2.575  62.455  1.00 52.45 ? 314 GLU C CG  1 
ATOM   9717  C  CD  . GLU C 1 300 ? 14.977  -3.440  63.693  1.00 58.28 ? 314 GLU C CD  1 
ATOM   9718  O  OE1 . GLU C 1 300 ? 14.666  -4.648  63.572  1.00 58.55 ? 314 GLU C OE1 1 
ATOM   9719  O  OE2 . GLU C 1 300 ? 15.268  -2.908  64.784  1.00 58.96 ? 314 GLU C OE2 1 
ATOM   9720  N  N   . CYS C 1 301 ? 15.696  -0.903  59.090  1.00 36.20 ? 315 CYS C N   1 
ATOM   9721  C  CA  . CYS C 1 301 ? 16.967  -0.664  58.418  1.00 41.13 ? 315 CYS C CA  1 
ATOM   9722  C  C   . CYS C 1 301 ? 17.842  0.302   59.200  1.00 53.88 ? 315 CYS C C   1 
ATOM   9723  O  O   . CYS C 1 301 ? 17.456  1.455   59.416  1.00 55.74 ? 315 CYS C O   1 
ATOM   9724  C  CB  . CYS C 1 301 ? 16.732  -0.135  57.007  1.00 42.26 ? 315 CYS C CB  1 
ATOM   9725  S  SG  . CYS C 1 301 ? 15.321  -0.878  56.168  1.00 45.15 ? 315 CYS C SG  1 
ATOM   9726  N  N   . GLY C 1 302 ? 19.019  -0.181  59.610  1.00 55.64 ? 316 GLY C N   1 
ATOM   9727  C  CA  . GLY C 1 302 ? 19.980  0.591   60.386  1.00 53.86 ? 316 GLY C CA  1 
ATOM   9728  C  C   . GLY C 1 302 ? 20.392  1.939   59.812  1.00 51.58 ? 316 GLY C C   1 
ATOM   9729  O  O   . GLY C 1 302 ? 19.955  2.340   58.733  1.00 53.74 ? 316 GLY C O   1 
ATOM   9730  N  N   . GLY C 1 303 ? 21.246  2.647   60.542  1.00 47.40 ? 317 GLY C N   1 
ATOM   9731  C  CA  . GLY C 1 303 ? 21.617  3.993   60.163  1.00 42.29 ? 317 GLY C CA  1 
ATOM   9732  C  C   . GLY C 1 303 ? 23.028  4.378   60.556  1.00 40.43 ? 317 GLY C C   1 
ATOM   9733  O  O   . GLY C 1 303 ? 23.798  3.573   61.064  1.00 46.76 ? 317 GLY C O   1 
ATOM   9734  N  N   . LYS C 1 304 ? 23.365  5.633   60.312  1.00 39.65 ? 318 LYS C N   1 
ATOM   9735  C  CA  . LYS C 1 304 ? 24.695  6.153   60.614  1.00 30.28 ? 318 LYS C CA  1 
ATOM   9736  C  C   . LYS C 1 304 ? 24.524  6.946   61.896  1.00 21.20 ? 318 LYS C C   1 
ATOM   9737  O  O   . LYS C 1 304 ? 24.293  8.141   61.854  1.00 27.15 ? 318 LYS C O   1 
ATOM   9738  C  CB  . LYS C 1 304 ? 25.148  7.053   59.463  1.00 26.25 ? 318 LYS C CB  1 
ATOM   9739  C  CG  . LYS C 1 304 ? 26.545  7.633   59.580  1.00 26.06 ? 318 LYS C CG  1 
ATOM   9740  C  CD  . LYS C 1 304 ? 27.597  6.636   59.140  1.00 27.74 ? 318 LYS C CD  1 
ATOM   9741  C  CE  . LYS C 1 304 ? 29.016  7.176   59.347  1.00 23.65 ? 318 LYS C CE  1 
ATOM   9742  N  NZ  . LYS C 1 304 ? 30.022  6.066   59.171  1.00 26.40 ? 318 LYS C NZ  1 
ATOM   9743  N  N   . ASN C 1 305 ? 24.585  6.262   63.038  1.00 22.33 ? 319 ASN C N   1 
ATOM   9744  C  CA  . ASN C 1 305 ? 24.163  6.859   64.311  1.00 23.72 ? 319 ASN C CA  1 
ATOM   9745  C  C   . ASN C 1 305 ? 25.182  7.809   64.942  1.00 23.81 ? 319 ASN C C   1 
ATOM   9746  O  O   . ASN C 1 305 ? 26.380  7.602   64.812  1.00 26.57 ? 319 ASN C O   1 
ATOM   9747  C  CB  . ASN C 1 305 ? 23.781  5.745   65.276  1.00 23.83 ? 319 ASN C CB  1 
ATOM   9748  C  CG  . ASN C 1 305 ? 22.831  4.747   64.635  1.00 23.88 ? 319 ASN C CG  1 
ATOM   9749  O  OD1 . ASN C 1 305 ? 21.764  5.136   64.155  1.00 22.20 ? 319 ASN C OD1 1 
ATOM   9750  N  ND2 . ASN C 1 305 ? 23.242  3.465   64.562  1.00 21.91 ? 319 ASN C ND2 1 
ATOM   9751  N  N   . PHE C 1 306 ? 24.696  8.839   65.635  1.00 22.13 ? 320 PHE C N   1 
ATOM   9752  C  CA  . PHE C 1 306 ? 25.561  9.925   66.102  1.00 23.29 ? 320 PHE C CA  1 
ATOM   9753  C  C   . PHE C 1 306 ? 25.577  10.108  67.620  1.00 22.21 ? 320 PHE C C   1 
ATOM   9754  O  O   . PHE C 1 306 ? 24.599  9.804   68.314  1.00 21.60 ? 320 PHE C O   1 
ATOM   9755  C  CB  . PHE C 1 306 ? 25.116  11.250  65.463  1.00 23.12 ? 320 PHE C CB  1 
ATOM   9756  C  CG  . PHE C 1 306 ? 23.744  11.690  65.897  1.00 24.31 ? 320 PHE C CG  1 
ATOM   9757  C  CD1 . PHE C 1 306 ? 23.566  12.392  67.084  1.00 28.42 ? 320 PHE C CD1 1 
ATOM   9758  C  CD2 . PHE C 1 306 ? 22.623  11.380  65.131  1.00 18.49 ? 320 PHE C CD2 1 
ATOM   9759  C  CE1 . PHE C 1 306 ? 22.310  12.778  67.503  1.00 27.27 ? 320 PHE C CE1 1 
ATOM   9760  C  CE2 . PHE C 1 306 ? 21.370  11.766  65.547  1.00 24.13 ? 320 PHE C CE2 1 
ATOM   9761  C  CZ  . PHE C 1 306 ? 21.212  12.472  66.729  1.00 28.87 ? 320 PHE C CZ  1 
ATOM   9762  N  N   . HIS C 1 307 ? 26.694  10.635  68.122  1.00 21.85 ? 321 HIS C N   1 
ATOM   9763  C  CA  . HIS C 1 307 ? 26.763  11.192  69.465  1.00 26.26 ? 321 HIS C CA  1 
ATOM   9764  C  C   . HIS C 1 307 ? 27.093  12.680  69.296  1.00 26.83 ? 321 HIS C C   1 
ATOM   9765  O  O   . HIS C 1 307 ? 28.095  13.030  68.673  1.00 29.18 ? 321 HIS C O   1 
ATOM   9766  C  CB  . HIS C 1 307 ? 27.863  10.500  70.303  1.00 24.11 ? 321 HIS C CB  1 
ATOM   9767  C  CG  . HIS C 1 307 ? 27.443  9.194   70.912  1.00 24.25 ? 321 HIS C CG  1 
ATOM   9768  N  ND1 . HIS C 1 307 ? 28.211  8.526   71.846  1.00 24.23 ? 321 HIS C ND1 1 
ATOM   9769  C  CD2 . HIS C 1 307 ? 26.337  8.431   70.724  1.00 24.94 ? 321 HIS C CD2 1 
ATOM   9770  C  CE1 . HIS C 1 307 ? 27.598  7.411   72.201  1.00 24.20 ? 321 HIS C CE1 1 
ATOM   9771  N  NE2 . HIS C 1 307 ? 26.454  7.332   71.541  1.00 23.22 ? 321 HIS C NE2 1 
ATOM   9772  N  N   . PHE C 1 308 ? 26.242  13.558  69.811  1.00 23.51 ? 322 PHE C N   1 
ATOM   9773  C  CA  . PHE C 1 308 ? 26.523  14.989  69.728  1.00 27.19 ? 322 PHE C CA  1 
ATOM   9774  C  C   . PHE C 1 308 ? 26.905  15.488  71.102  1.00 27.26 ? 322 PHE C C   1 
ATOM   9775  O  O   . PHE C 1 308 ? 26.185  15.266  72.079  1.00 32.17 ? 322 PHE C O   1 
ATOM   9776  C  CB  . PHE C 1 308 ? 25.321  15.785  69.191  1.00 23.25 ? 322 PHE C CB  1 
ATOM   9777  C  CG  . PHE C 1 308 ? 25.575  17.274  69.109  1.00 27.57 ? 322 PHE C CG  1 
ATOM   9778  C  CD1 . PHE C 1 308 ? 26.063  17.845  67.943  1.00 27.14 ? 322 PHE C CD1 1 
ATOM   9779  C  CD2 . PHE C 1 308 ? 25.330  18.096  70.197  1.00 25.29 ? 322 PHE C CD2 1 
ATOM   9780  C  CE1 . PHE C 1 308 ? 26.302  19.216  67.868  1.00 27.62 ? 322 PHE C CE1 1 
ATOM   9781  C  CE2 . PHE C 1 308 ? 25.573  19.468  70.128  1.00 30.30 ? 322 PHE C CE2 1 
ATOM   9782  C  CZ  . PHE C 1 308 ? 26.056  20.022  68.964  1.00 27.35 ? 322 PHE C CZ  1 
ATOM   9783  N  N   . VAL C 1 309 ? 28.036  16.174  71.180  1.00 31.21 ? 323 VAL C N   1 
ATOM   9784  C  CA  . VAL C 1 309 ? 28.539  16.636  72.458  1.00 24.77 ? 323 VAL C CA  1 
ATOM   9785  C  C   . VAL C 1 309 ? 28.470  18.152  72.517  1.00 28.86 ? 323 VAL C C   1 
ATOM   9786  O  O   . VAL C 1 309 ? 28.935  18.819  71.602  1.00 29.94 ? 323 VAL C O   1 
ATOM   9787  C  CB  . VAL C 1 309 ? 29.985  16.203  72.653  1.00 25.46 ? 323 VAL C CB  1 
ATOM   9788  C  CG1 . VAL C 1 309 ? 30.528  16.731  73.986  1.00 27.45 ? 323 VAL C CG1 1 
ATOM   9789  C  CG2 . VAL C 1 309 ? 30.092  14.676  72.567  1.00 26.92 ? 323 VAL C CG2 1 
ATOM   9790  N  N   . HIS C 1 310 ? 27.836  18.678  73.562  1.00 32.49 ? 324 HIS C N   1 
ATOM   9791  C  CA  . HIS C 1 310 ? 27.869  20.114  73.856  1.00 31.38 ? 324 HIS C CA  1 
ATOM   9792  C  C   . HIS C 1 310 ? 29.075  20.385  74.763  1.00 35.78 ? 324 HIS C C   1 
ATOM   9793  O  O   . HIS C 1 310 ? 29.636  19.450  75.356  1.00 30.25 ? 324 HIS C O   1 
ATOM   9794  C  CB  . HIS C 1 310 ? 26.572  20.559  74.536  1.00 33.11 ? 324 HIS C CB  1 
ATOM   9795  C  CG  . HIS C 1 310 ? 26.488  22.040  74.764  1.00 40.81 ? 324 HIS C CG  1 
ATOM   9796  N  ND1 . HIS C 1 310 ? 26.773  22.623  75.980  1.00 37.54 ? 324 HIS C ND1 1 
ATOM   9797  C  CD2 . HIS C 1 310 ? 26.179  23.054  73.921  1.00 39.10 ? 324 HIS C CD2 1 
ATOM   9798  C  CE1 . HIS C 1 310 ? 26.615  23.935  75.884  1.00 35.07 ? 324 HIS C CE1 1 
ATOM   9799  N  NE2 . HIS C 1 310 ? 26.262  24.221  74.646  1.00 33.72 ? 324 HIS C NE2 1 
ATOM   9800  N  N   . ARG C 1 311 ? 29.494  21.645  74.869  1.00 33.81 ? 325 ARG C N   1 
ATOM   9801  C  CA  . ARG C 1 311 ? 30.715  21.965  75.614  1.00 38.17 ? 325 ARG C CA  1 
ATOM   9802  C  C   . ARG C 1 311 ? 30.528  21.782  77.120  1.00 38.05 ? 325 ARG C C   1 
ATOM   9803  O  O   . ARG C 1 311 ? 31.497  21.714  77.867  1.00 39.89 ? 325 ARG C O   1 
ATOM   9804  C  CB  . ARG C 1 311 ? 31.232  23.375  75.282  1.00 40.11 ? 325 ARG C CB  1 
ATOM   9805  C  CG  . ARG C 1 311 ? 30.224  24.512  75.489  1.00 40.45 ? 325 ARG C CG  1 
ATOM   9806  C  CD  . ARG C 1 311 ? 30.898  25.884  75.364  1.00 44.72 ? 325 ARG C CD  1 
ATOM   9807  N  N   . SER C 1 312 ? 29.278  21.675  77.555  1.00 34.39 ? 326 SER C N   1 
ATOM   9808  C  CA  . SER C 1 312 ? 28.985  21.510  78.971  1.00 38.55 ? 326 SER C CA  1 
ATOM   9809  C  C   . SER C 1 312 ? 28.996  20.055  79.426  1.00 40.58 ? 326 SER C C   1 
ATOM   9810  O  O   . SER C 1 312 ? 28.745  19.776  80.597  1.00 35.02 ? 326 SER C O   1 
ATOM   9811  C  CB  . SER C 1 312 ? 27.613  22.090  79.281  1.00 42.35 ? 326 SER C CB  1 
ATOM   9812  O  OG  . SER C 1 312 ? 26.592  21.314  78.667  1.00 41.88 ? 326 SER C OG  1 
ATOM   9813  N  N   . ALA C 1 313 ? 29.259  19.130  78.503  1.00 39.85 ? 327 ALA C N   1 
ATOM   9814  C  CA  . ALA C 1 313 ? 29.082  17.699  78.780  1.00 39.17 ? 327 ALA C CA  1 
ATOM   9815  C  C   . ALA C 1 313 ? 30.068  17.136  79.800  1.00 41.77 ? 327 ALA C C   1 
ATOM   9816  O  O   . ALA C 1 313 ? 31.178  17.648  79.965  1.00 38.74 ? 327 ALA C O   1 
ATOM   9817  C  CB  . ALA C 1 313 ? 29.152  16.879  77.478  1.00 33.38 ? 327 ALA C CB  1 
ATOM   9818  N  N   . ASP C 1 314 ? 29.649  16.072  80.477  1.00 38.88 ? 328 ASP C N   1 
ATOM   9819  C  CA  . ASP C 1 314 ? 30.549  15.308  81.325  1.00 41.23 ? 328 ASP C CA  1 
ATOM   9820  C  C   . ASP C 1 314 ? 31.484  14.493  80.432  1.00 38.99 ? 328 ASP C C   1 
ATOM   9821  O  O   . ASP C 1 314 ? 31.043  13.574  79.745  1.00 33.12 ? 328 ASP C O   1 
ATOM   9822  C  CB  . ASP C 1 314 ? 29.745  14.389  82.237  1.00 47.67 ? 328 ASP C CB  1 
ATOM   9823  C  CG  . ASP C 1 314 ? 30.616  13.640  83.216  1.00 58.54 ? 328 ASP C CG  1 
ATOM   9824  O  OD1 . ASP C 1 314 ? 31.180  12.593  82.834  1.00 63.55 ? 328 ASP C OD1 1 
ATOM   9825  O  OD2 . ASP C 1 314 ? 30.733  14.095  84.371  1.00 62.08 ? 328 ASP C OD2 1 
ATOM   9826  N  N   . VAL C 1 315 ? 32.769  14.838  80.426  1.00 36.31 ? 329 VAL C N   1 
ATOM   9827  C  CA  . VAL C 1 315 ? 33.718  14.218  79.493  1.00 41.07 ? 329 VAL C CA  1 
ATOM   9828  C  C   . VAL C 1 315 ? 33.890  12.709  79.699  1.00 41.45 ? 329 VAL C C   1 
ATOM   9829  O  O   . VAL C 1 315 ? 33.931  11.928  78.734  1.00 32.68 ? 329 VAL C O   1 
ATOM   9830  C  CB  . VAL C 1 315 ? 35.091  14.926  79.520  1.00 46.21 ? 329 VAL C CB  1 
ATOM   9831  C  CG1 . VAL C 1 315 ? 36.171  14.045  78.916  1.00 48.49 ? 329 VAL C CG1 1 
ATOM   9832  C  CG2 . VAL C 1 315 ? 35.016  16.249  78.779  1.00 47.49 ? 329 VAL C CG2 1 
ATOM   9833  N  N   . GLU C 1 316 ? 33.974  12.286  80.952  1.00 40.12 ? 330 GLU C N   1 
ATOM   9834  C  CA  . GLU C 1 316 ? 34.121  10.870  81.215  1.00 43.00 ? 330 GLU C CA  1 
ATOM   9835  C  C   . GLU C 1 316 ? 32.904  10.076  80.693  1.00 42.07 ? 330 GLU C C   1 
ATOM   9836  O  O   . GLU C 1 316 ? 33.044  8.952   80.207  1.00 44.89 ? 330 GLU C O   1 
ATOM   9837  C  CB  . GLU C 1 316 ? 34.403  10.628  82.693  1.00 45.80 ? 330 GLU C CB  1 
ATOM   9838  C  CG  . GLU C 1 316 ? 35.779  11.149  83.127  1.00 42.17 ? 330 GLU C CG  1 
ATOM   9839  C  CD  . GLU C 1 316 ? 36.912  10.638  82.238  1.00 41.37 ? 330 GLU C CD  1 
ATOM   9840  O  OE1 . GLU C 1 316 ? 37.076  9.408   82.120  1.00 46.72 ? 330 GLU C OE1 1 
ATOM   9841  O  OE2 . GLU C 1 316 ? 37.644  11.463  81.654  1.00 42.81 ? 330 GLU C OE2 1 
ATOM   9842  N  N   . SER C 1 317 ? 31.724  10.683  80.760  1.00 42.74 ? 331 SER C N   1 
ATOM   9843  C  CA  . SER C 1 317 ? 30.520  10.072  80.205  1.00 42.57 ? 331 SER C CA  1 
ATOM   9844  C  C   . SER C 1 317 ? 30.559  10.026  78.677  1.00 32.17 ? 331 SER C C   1 
ATOM   9845  O  O   . SER C 1 317 ? 30.165  9.032   78.077  1.00 32.97 ? 331 SER C O   1 
ATOM   9846  C  CB  . SER C 1 317 ? 29.264  10.803  80.687  1.00 47.03 ? 331 SER C CB  1 
ATOM   9847  O  OG  . SER C 1 317 ? 28.855  10.334  81.963  1.00 47.94 ? 331 SER C OG  1 
ATOM   9848  N  N   . VAL C 1 318 ? 31.017  11.108  78.056  1.00 33.46 ? 332 VAL C N   1 
ATOM   9849  C  CA  . VAL C 1 318 ? 31.186  11.143  76.611  1.00 31.12 ? 332 VAL C CA  1 
ATOM   9850  C  C   . VAL C 1 318 ? 32.110  10.016  76.174  1.00 29.74 ? 332 VAL C C   1 
ATOM   9851  O  O   . VAL C 1 318 ? 31.773  9.211   75.297  1.00 27.37 ? 332 VAL C O   1 
ATOM   9852  C  CB  . VAL C 1 318 ? 31.749  12.501  76.138  1.00 33.61 ? 332 VAL C CB  1 
ATOM   9853  C  CG1 . VAL C 1 318 ? 32.132  12.450  74.667  1.00 31.16 ? 332 VAL C CG1 1 
ATOM   9854  C  CG2 . VAL C 1 318 ? 30.727  13.603  76.376  1.00 32.21 ? 332 VAL C CG2 1 
ATOM   9855  N  N   . VAL C 1 319 ? 33.261  9.930   76.827  1.00 30.72 ? 333 VAL C N   1 
ATOM   9856  C  CA  . VAL C 1 319 ? 34.288  8.966   76.446  1.00 31.91 ? 333 VAL C CA  1 
ATOM   9857  C  C   . VAL C 1 319 ? 33.851  7.518   76.607  1.00 31.66 ? 333 VAL C C   1 
ATOM   9858  O  O   . VAL C 1 319 ? 33.951  6.726   75.667  1.00 27.23 ? 333 VAL C O   1 
ATOM   9859  C  CB  . VAL C 1 319 ? 35.608  9.238   77.200  1.00 31.40 ? 333 VAL C CB  1 
ATOM   9860  C  CG1 . VAL C 1 319 ? 36.594  8.096   77.002  1.00 28.66 ? 333 VAL C CG1 1 
ATOM   9861  C  CG2 . VAL C 1 319 ? 36.192  10.531  76.704  1.00 31.10 ? 333 VAL C CG2 1 
ATOM   9862  N  N   . SER C 1 320 ? 33.346  7.174   77.786  1.00 37.17 ? 334 SER C N   1 
ATOM   9863  C  CA  . SER C 1 320 ? 32.900  5.807   78.032  1.00 36.32 ? 334 SER C CA  1 
ATOM   9864  C  C   . SER C 1 320 ? 31.708  5.417   77.147  1.00 31.06 ? 334 SER C C   1 
ATOM   9865  O  O   . SER C 1 320 ? 31.702  4.350   76.555  1.00 28.46 ? 334 SER C O   1 
ATOM   9866  C  CB  . SER C 1 320 ? 32.567  5.587   79.512  1.00 36.78 ? 334 SER C CB  1 
ATOM   9867  O  OG  . SER C 1 320 ? 31.490  6.410   79.919  1.00 52.46 ? 334 SER C OG  1 
ATOM   9868  N  N   . GLY C 1 321 ? 30.698  6.279   77.067  1.00 29.58 ? 335 GLY C N   1 
ATOM   9869  C  CA  . GLY C 1 321 ? 29.539  5.984   76.243  1.00 28.26 ? 335 GLY C CA  1 
ATOM   9870  C  C   . GLY C 1 321 ? 29.879  5.856   74.771  1.00 26.20 ? 335 GLY C C   1 
ATOM   9871  O  O   . GLY C 1 321 ? 29.368  4.967   74.083  1.00 23.80 ? 335 GLY C O   1 
ATOM   9872  N  N   . THR C 1 322 ? 30.745  6.736   74.278  1.00 24.48 ? 336 THR C N   1 
ATOM   9873  C  CA  . THR C 1 322 ? 31.106  6.709   72.865  1.00 28.08 ? 336 THR C CA  1 
ATOM   9874  C  C   . THR C 1 322 ? 31.940  5.473   72.514  1.00 26.50 ? 336 THR C C   1 
ATOM   9875  O  O   . THR C 1 322 ? 31.697  4.830   71.495  1.00 26.69 ? 336 THR C O   1 
ATOM   9876  C  CB  . THR C 1 322 ? 31.803  8.007   72.400  1.00 26.40 ? 336 THR C CB  1 
ATOM   9877  O  OG1 . THR C 1 322 ? 30.946  9.135   72.657  1.00 27.01 ? 336 THR C OG1 1 
ATOM   9878  C  CG2 . THR C 1 322 ? 32.094  7.952   70.909  1.00 24.58 ? 336 THR C CG2 1 
ATOM   9879  N  N   . LEU C 1 323 ? 32.892  5.112   73.368  1.00 23.78 ? 337 LEU C N   1 
ATOM   9880  C  CA  . LEU C 1 323 ? 33.700  3.919   73.093  1.00 19.68 ? 337 LEU C CA  1 
ATOM   9881  C  C   . LEU C 1 323 ? 32.842  2.671   73.116  1.00 20.51 ? 337 LEU C C   1 
ATOM   9882  O  O   . LEU C 1 323 ? 32.966  1.824   72.227  1.00 23.31 ? 337 LEU C O   1 
ATOM   9883  C  CB  . LEU C 1 323 ? 34.866  3.774   74.073  1.00 23.92 ? 337 LEU C CB  1 
ATOM   9884  C  CG  . LEU C 1 323 ? 35.877  4.904   73.933  1.00 28.14 ? 337 LEU C CG  1 
ATOM   9885  C  CD1 . LEU C 1 323 ? 36.901  4.830   75.039  1.00 31.86 ? 337 LEU C CD1 1 
ATOM   9886  C  CD2 . LEU C 1 323 ? 36.539  4.854   72.561  1.00 33.49 ? 337 LEU C CD2 1 
ATOM   9887  N  N   . ARG C 1 324 ? 31.961  2.563   74.113  1.00 20.43 ? 338 ARG C N   1 
ATOM   9888  C  CA  . ARG C 1 324 ? 31.059  1.414   74.187  1.00 20.37 ? 338 ARG C CA  1 
ATOM   9889  C  C   . ARG C 1 324 ? 30.114  1.340   72.982  1.00 25.09 ? 338 ARG C C   1 
ATOM   9890  O  O   . ARG C 1 324 ? 30.011  0.302   72.341  1.00 22.80 ? 338 ARG C O   1 
ATOM   9891  C  CB  . ARG C 1 324 ? 30.271  1.409   75.500  1.00 28.19 ? 338 ARG C CB  1 
ATOM   9892  C  CG  . ARG C 1 324 ? 31.152  1.202   76.750  1.00 42.10 ? 338 ARG C CG  1 
ATOM   9893  C  CD  . ARG C 1 324 ? 30.311  0.971   78.008  1.00 53.03 ? 338 ARG C CD  1 
ATOM   9894  N  NE  . ARG C 1 324 ? 29.569  -0.290  77.950  1.00 59.95 ? 338 ARG C NE  1 
ATOM   9895  C  CZ  . ARG C 1 324 ? 28.563  -0.610  78.760  1.00 64.75 ? 338 ARG C CZ  1 
ATOM   9896  N  NH1 . ARG C 1 324 ? 28.164  0.241   79.697  1.00 66.36 ? 338 ARG C NH1 1 
ATOM   9897  N  NH2 . ARG C 1 324 ? 27.948  -1.778  78.629  1.00 65.54 ? 338 ARG C NH2 1 
ATOM   9898  N  N   . SER C 1 325 ? 29.435  2.440   72.666  1.00 19.63 ? 339 SER C N   1 
ATOM   9899  C  CA  . SER C 1 325 ? 28.531  2.436   71.512  1.00 19.98 ? 339 SER C CA  1 
ATOM   9900  C  C   . SER C 1 325 ? 29.234  2.155   70.186  1.00 19.59 ? 339 SER C C   1 
ATOM   9901  O  O   . SER C 1 325 ? 28.699  1.449   69.330  1.00 23.25 ? 339 SER C O   1 
ATOM   9902  C  CB  . SER C 1 325 ? 27.767  3.759   71.405  1.00 22.68 ? 339 SER C CB  1 
ATOM   9903  O  OG  . SER C 1 325 ? 26.912  3.723   70.268  1.00 26.92 ? 339 SER C OG  1 
ATOM   9904  N  N   . ALA C 1 326 ? 30.434  2.694   70.014  1.00 18.61 ? 340 ALA C N   1 
ATOM   9905  C  CA  . ALA C 1 326 ? 31.148  2.538   68.749  1.00 23.53 ? 340 ALA C CA  1 
ATOM   9906  C  C   . ALA C 1 326 ? 31.785  1.162   68.579  1.00 24.43 ? 340 ALA C C   1 
ATOM   9907  O  O   . ALA C 1 326 ? 31.914  0.661   67.465  1.00 21.84 ? 340 ALA C O   1 
ATOM   9908  C  CB  . ALA C 1 326 ? 32.228  3.610   68.606  1.00 24.75 ? 340 ALA C CB  1 
ATOM   9909  N  N   . PHE C 1 327 ? 32.191  0.551   69.677  1.00 21.54 ? 341 PHE C N   1 
ATOM   9910  C  CA  . PHE C 1 327 ? 33.076  -0.597  69.550  1.00 21.90 ? 341 PHE C CA  1 
ATOM   9911  C  C   . PHE C 1 327 ? 32.550  -1.886  70.152  1.00 20.78 ? 341 PHE C C   1 
ATOM   9912  O  O   . PHE C 1 327 ? 33.115  -2.948  69.912  1.00 21.87 ? 341 PHE C O   1 
ATOM   9913  C  CB  . PHE C 1 327 ? 34.464  -0.243  70.099  1.00 28.20 ? 341 PHE C CB  1 
ATOM   9914  C  CG  . PHE C 1 327 ? 35.140  0.870   69.341  1.00 24.87 ? 341 PHE C CG  1 
ATOM   9915  C  CD1 . PHE C 1 327 ? 35.059  0.928   67.959  1.00 22.36 ? 341 PHE C CD1 1 
ATOM   9916  C  CD2 . PHE C 1 327 ? 35.852  1.856   70.010  1.00 30.04 ? 341 PHE C CD2 1 
ATOM   9917  C  CE1 . PHE C 1 327 ? 35.681  1.934   67.258  1.00 25.37 ? 341 PHE C CE1 1 
ATOM   9918  C  CE2 . PHE C 1 327 ? 36.475  2.875   69.314  1.00 27.40 ? 341 PHE C CE2 1 
ATOM   9919  C  CZ  . PHE C 1 327 ? 36.392  2.921   67.941  1.00 25.97 ? 341 PHE C CZ  1 
ATOM   9920  N  N   . GLU C 1 328 ? 31.474  -1.818  70.925  1.00 24.20 ? 342 GLU C N   1 
ATOM   9921  C  CA  . GLU C 1 328 ? 30.863  -3.064  71.385  1.00 21.70 ? 342 GLU C CA  1 
ATOM   9922  C  C   . GLU C 1 328 ? 30.393  -3.892  70.190  1.00 20.11 ? 342 GLU C C   1 
ATOM   9923  O  O   . GLU C 1 328 ? 29.784  -3.365  69.247  1.00 18.67 ? 342 GLU C O   1 
ATOM   9924  C  CB  . GLU C 1 328 ? 29.739  -2.801  72.398  1.00 24.88 ? 342 GLU C CB  1 
ATOM   9925  C  CG  . GLU C 1 328 ? 30.286  -2.576  73.813  1.00 28.14 ? 342 GLU C CG  1 
ATOM   9926  C  CD  . GLU C 1 328 ? 29.227  -2.178  74.831  1.00 36.97 ? 342 GLU C CD  1 
ATOM   9927  O  OE1 . GLU C 1 328 ? 28.137  -1.717  74.430  1.00 39.97 ? 342 GLU C OE1 1 
ATOM   9928  O  OE2 . GLU C 1 328 ? 29.500  -2.309  76.045  1.00 38.91 ? 342 GLU C OE2 1 
ATOM   9929  N  N   . TYR C 1 329 ? 30.748  -5.175  70.201  1.00 20.77 ? 343 TYR C N   1 
ATOM   9930  C  CA  . TYR C 1 329 ? 30.436  -6.094  69.104  1.00 19.81 ? 343 TYR C CA  1 
ATOM   9931  C  C   . TYR C 1 329 ? 31.025  -5.592  67.790  1.00 19.65 ? 343 TYR C C   1 
ATOM   9932  O  O   . TYR C 1 329 ? 30.466  -5.816  66.717  1.00 21.74 ? 343 TYR C O   1 
ATOM   9933  C  CB  . TYR C 1 329 ? 28.916  -6.312  68.970  1.00 20.07 ? 343 TYR C CB  1 
ATOM   9934  C  CG  . TYR C 1 329 ? 28.563  -7.513  68.118  1.00 22.75 ? 343 TYR C CG  1 
ATOM   9935  C  CD1 . TYR C 1 329 ? 29.450  -8.594  68.002  1.00 20.72 ? 343 TYR C CD1 1 
ATOM   9936  C  CD2 . TYR C 1 329 ? 27.369  -7.569  67.411  1.00 26.59 ? 343 TYR C CD2 1 
ATOM   9937  C  CE1 . TYR C 1 329 ? 29.146  -9.690  67.221  1.00 20.78 ? 343 TYR C CE1 1 
ATOM   9938  C  CE2 . TYR C 1 329 ? 27.057  -8.672  66.620  1.00 29.80 ? 343 TYR C CE2 1 
ATOM   9939  C  CZ  . TYR C 1 329 ? 27.952  -9.730  66.526  1.00 28.15 ? 343 TYR C CZ  1 
ATOM   9940  O  OH  . TYR C 1 329 ? 27.654  -10.834 65.746  1.00 26.05 ? 343 TYR C OH  1 
ATOM   9941  N  N   . GLY C 1 330 ? 32.143  -4.877  67.887  1.00 16.74 ? 344 GLY C N   1 
ATOM   9942  C  CA  . GLY C 1 330 ? 32.833  -4.371  66.712  1.00 18.49 ? 344 GLY C CA  1 
ATOM   9943  C  C   . GLY C 1 330 ? 32.041  -3.312  65.958  1.00 18.45 ? 344 GLY C C   1 
ATOM   9944  O  O   . GLY C 1 330 ? 32.222  -3.138  64.751  1.00 19.37 ? 344 GLY C O   1 
ATOM   9945  N  N   . GLY C 1 331 ? 31.163  -2.605  66.669  1.00 16.51 ? 345 GLY C N   1 
ATOM   9946  C  CA  . GLY C 1 331 ? 30.268  -1.645  66.042  1.00 14.59 ? 345 GLY C CA  1 
ATOM   9947  C  C   . GLY C 1 331 ? 29.249  -2.299  65.115  1.00 19.70 ? 345 GLY C C   1 
ATOM   9948  O  O   . GLY C 1 331 ? 28.615  -1.618  64.308  1.00 19.59 ? 345 GLY C O   1 
ATOM   9949  N  N   . GLN C 1 332 ? 29.087  -3.616  65.221  1.00 19.74 ? 346 GLN C N   1 
ATOM   9950  C  CA  . GLN C 1 332 ? 28.158  -4.333  64.354  1.00 18.82 ? 346 GLN C CA  1 
ATOM   9951  C  C   . GLN C 1 332 ? 26.735  -4.369  64.914  1.00 20.10 ? 346 GLN C C   1 
ATOM   9952  O  O   . GLN C 1 332 ? 26.095  -5.422  64.959  1.00 20.47 ? 346 GLN C O   1 
ATOM   9953  C  CB  . GLN C 1 332 ? 28.659  -5.762  64.109  1.00 20.59 ? 346 GLN C CB  1 
ATOM   9954  C  CG  . GLN C 1 332 ? 29.996  -5.786  63.440  1.00 20.55 ? 346 GLN C CG  1 
ATOM   9955  C  CD  . GLN C 1 332 ? 30.520  -7.189  63.276  1.00 20.85 ? 346 GLN C CD  1 
ATOM   9956  O  OE1 . GLN C 1 332 ? 30.777  -7.628  62.157  1.00 20.91 ? 346 GLN C OE1 1 
ATOM   9957  N  NE2 . GLN C 1 332 ? 30.672  -7.906  64.389  1.00 20.78 ? 346 GLN C NE2 1 
ATOM   9958  N  N   . LYS C 1 333 ? 26.247  -3.212  65.331  1.00 25.61 ? 347 LYS C N   1 
ATOM   9959  C  CA  . LYS C 1 333 ? 24.890  -3.077  65.827  1.00 29.80 ? 347 LYS C CA  1 
ATOM   9960  C  C   . LYS C 1 333 ? 24.194  -2.006  65.012  1.00 30.01 ? 347 LYS C C   1 
ATOM   9961  O  O   . LYS C 1 333 ? 24.832  -1.029  64.603  1.00 24.33 ? 347 LYS C O   1 
ATOM   9962  C  CB  . LYS C 1 333 ? 24.895  -2.660  67.292  1.00 26.70 ? 347 LYS C CB  1 
ATOM   9963  C  CG  . LYS C 1 333 ? 25.399  -3.735  68.252  1.00 22.78 ? 347 LYS C CG  1 
ATOM   9964  C  CD  . LYS C 1 333 ? 24.915  -3.442  69.660  1.00 28.41 ? 347 LYS C CD  1 
ATOM   9965  C  CE  . LYS C 1 333 ? 25.936  -3.875  70.689  1.00 33.15 ? 347 LYS C CE  1 
ATOM   9966  N  NZ  . LYS C 1 333 ? 25.462  -3.568  72.057  1.00 35.49 ? 347 LYS C NZ  1 
ATOM   9967  N  N   . CYS C 1 334 ? 22.894  -2.191  64.773  1.00 17.22 ? 348 CYS C N   1 
ATOM   9968  C  CA  . CYS C 1 334 ? 22.093  -1.202  64.055  1.00 24.67 ? 348 CYS C CA  1 
ATOM   9969  C  C   . CYS C 1 334 ? 22.109  0.154   64.773  1.00 24.58 ? 348 CYS C C   1 
ATOM   9970  O  O   . CYS C 1 334 ? 21.926  1.195   64.150  1.00 24.86 ? 348 CYS C O   1 
ATOM   9971  C  CB  . CYS C 1 334 ? 20.649  -1.693  63.891  1.00 26.44 ? 348 CYS C CB  1 
ATOM   9972  S  SG  . CYS C 1 334 ? 20.460  -2.976  62.606  1.00 42.93 ? 348 CYS C SG  1 
ATOM   9973  N  N   . SER C 1 335 ? 22.348  0.122   66.079  1.00 23.22 ? 349 SER C N   1 
ATOM   9974  C  CA  . SER C 1 335 ? 22.266  1.314   66.921  1.00 22.09 ? 349 SER C CA  1 
ATOM   9975  C  C   . SER C 1 335 ? 23.633  1.906   67.264  1.00 17.81 ? 349 SER C C   1 
ATOM   9976  O  O   . SER C 1 335 ? 23.711  2.889   68.006  1.00 20.51 ? 349 SER C O   1 
ATOM   9977  C  CB  . SER C 1 335 ? 21.556  0.940   68.221  1.00 23.30 ? 349 SER C CB  1 
ATOM   9978  O  OG  . SER C 1 335 ? 22.180  -0.202  68.795  1.00 25.67 ? 349 SER C OG  1 
ATOM   9979  N  N   . ALA C 1 336 ? 24.707  1.302   66.745  1.00 18.60 ? 350 ALA C N   1 
ATOM   9980  C  CA  . ALA C 1 336 ? 26.065  1.713   67.118  1.00 19.77 ? 350 ALA C CA  1 
ATOM   9981  C  C   . ALA C 1 336 ? 26.382  3.145   66.696  1.00 18.17 ? 350 ALA C C   1 
ATOM   9982  O  O   . ALA C 1 336 ? 26.055  3.556   65.582  1.00 25.14 ? 350 ALA C O   1 
ATOM   9983  C  CB  . ALA C 1 336 ? 27.101  0.763   66.524  1.00 15.82 ? 350 ALA C CB  1 
ATOM   9984  N  N   . CYS C 1 337 ? 27.062  3.879   67.573  1.00 17.06 ? 351 CYS C N   1 
ATOM   9985  C  CA  . CYS C 1 337 ? 27.554  5.203   67.220  1.00 20.80 ? 351 CYS C CA  1 
ATOM   9986  C  C   . CYS C 1 337 ? 28.708  5.100   66.237  1.00 24.81 ? 351 CYS C C   1 
ATOM   9987  O  O   . CYS C 1 337 ? 29.703  4.417   66.506  1.00 22.49 ? 351 CYS C O   1 
ATOM   9988  C  CB  . CYS C 1 337 ? 28.007  5.952   68.466  1.00 22.50 ? 351 CYS C CB  1 
ATOM   9989  S  SG  . CYS C 1 337 ? 28.799  7.515   68.103  1.00 25.96 ? 351 CYS C SG  1 
ATOM   9990  N  N   . SER C 1 338 ? 28.591  5.777   65.100  1.00 22.55 ? 352 SER C N   1 
ATOM   9991  C  CA  . SER C 1 338 ? 29.719  5.833   64.175  1.00 25.78 ? 352 SER C CA  1 
ATOM   9992  C  C   . SER C 1 338 ? 30.129  7.269   63.814  1.00 25.52 ? 352 SER C C   1 
ATOM   9993  O  O   . SER C 1 338 ? 31.033  7.477   63.007  1.00 23.52 ? 352 SER C O   1 
ATOM   9994  C  CB  . SER C 1 338 ? 29.471  5.006   62.916  1.00 25.86 ? 352 SER C CB  1 
ATOM   9995  O  OG  . SER C 1 338 ? 28.476  5.608   62.113  1.00 30.24 ? 352 SER C OG  1 
ATOM   9996  N  N   . ARG C 1 339 ? 29.464  8.262   64.390  1.00 18.91 ? 353 ARG C N   1 
ATOM   9997  C  CA  . ARG C 1 339 ? 29.943  9.625   64.194  1.00 23.81 ? 353 ARG C CA  1 
ATOM   9998  C  C   . ARG C 1 339 ? 29.811  10.430  65.474  1.00 25.10 ? 353 ARG C C   1 
ATOM   9999  O  O   . ARG C 1 339 ? 28.786  10.383  66.151  1.00 24.84 ? 353 ARG C O   1 
ATOM   10000 C  CB  . ARG C 1 339 ? 29.258  10.314  63.003  1.00 26.84 ? 353 ARG C CB  1 
ATOM   10001 C  CG  . ARG C 1 339 ? 27.782  10.055  62.904  1.00 26.38 ? 353 ARG C CG  1 
ATOM   10002 C  CD  . ARG C 1 339 ? 27.106  10.844  61.779  1.00 28.53 ? 353 ARG C CD  1 
ATOM   10003 N  NE  . ARG C 1 339 ? 25.674  10.542  61.752  1.00 27.01 ? 353 ARG C NE  1 
ATOM   10004 C  CZ  . ARG C 1 339 ? 24.716  11.420  61.483  1.00 30.28 ? 353 ARG C CZ  1 
ATOM   10005 N  NH1 . ARG C 1 339 ? 23.446  11.029  61.500  1.00 29.08 ? 353 ARG C NH1 1 
ATOM   10006 N  NH2 . ARG C 1 339 ? 25.023  12.690  61.198  1.00 28.45 ? 353 ARG C NH2 1 
ATOM   10007 N  N   . LEU C 1 340 ? 30.882  11.146  65.806  1.00 27.97 ? 354 LEU C N   1 
ATOM   10008 C  CA  . LEU C 1 340 ? 30.968  11.911  67.037  1.00 24.74 ? 354 LEU C CA  1 
ATOM   10009 C  C   . LEU C 1 340 ? 31.252  13.363  66.681  1.00 26.83 ? 354 LEU C C   1 
ATOM   10010 O  O   . LEU C 1 340 ? 32.210  13.655  65.962  1.00 29.75 ? 354 LEU C O   1 
ATOM   10011 C  CB  . LEU C 1 340 ? 32.105  11.362  67.909  1.00 27.60 ? 354 LEU C CB  1 
ATOM   10012 C  CG  . LEU C 1 340 ? 32.419  12.114  69.208  1.00 29.77 ? 354 LEU C CG  1 
ATOM   10013 C  CD1 . LEU C 1 340 ? 31.253  12.052  70.215  1.00 23.07 ? 354 LEU C CD1 1 
ATOM   10014 C  CD2 . LEU C 1 340 ? 33.716  11.603  69.827  1.00 26.86 ? 354 LEU C CD2 1 
ATOM   10015 N  N   . TYR C 1 341 ? 30.402  14.262  67.167  1.00 22.80 ? 355 TYR C N   1 
ATOM   10016 C  CA  . TYR C 1 341 ? 30.553  15.691  66.921  1.00 24.05 ? 355 TYR C CA  1 
ATOM   10017 C  C   . TYR C 1 341 ? 30.952  16.329  68.231  1.00 29.85 ? 355 TYR C C   1 
ATOM   10018 O  O   . TYR C 1 341 ? 30.196  16.261  69.204  1.00 29.33 ? 355 TYR C O   1 
ATOM   10019 C  CB  . TYR C 1 341 ? 29.223  16.289  66.436  1.00 23.85 ? 355 TYR C CB  1 
ATOM   10020 C  CG  . TYR C 1 341 ? 28.767  15.708  65.120  1.00 26.20 ? 355 TYR C CG  1 
ATOM   10021 C  CD1 . TYR C 1 341 ? 29.012  16.376  63.929  1.00 27.34 ? 355 TYR C CD1 1 
ATOM   10022 C  CD2 . TYR C 1 341 ? 28.106  14.484  65.066  1.00 28.09 ? 355 TYR C CD2 1 
ATOM   10023 C  CE1 . TYR C 1 341 ? 28.620  15.851  62.717  1.00 27.80 ? 355 TYR C CE1 1 
ATOM   10024 C  CE2 . TYR C 1 341 ? 27.700  13.939  63.849  1.00 25.01 ? 355 TYR C CE2 1 
ATOM   10025 C  CZ  . TYR C 1 341 ? 27.958  14.631  62.681  1.00 29.23 ? 355 TYR C CZ  1 
ATOM   10026 O  OH  . TYR C 1 341 ? 27.569  14.119  61.472  1.00 33.00 ? 355 TYR C OH  1 
ATOM   10027 N  N   . VAL C 1 342 ? 32.140  16.934  68.271  1.00 32.52 ? 356 VAL C N   1 
ATOM   10028 C  CA  . VAL C 1 342 ? 32.648  17.494  69.521  1.00 29.11 ? 356 VAL C CA  1 
ATOM   10029 C  C   . VAL C 1 342 ? 33.122  18.930  69.358  1.00 32.43 ? 356 VAL C C   1 
ATOM   10030 O  O   . VAL C 1 342 ? 33.706  19.283  68.330  1.00 29.26 ? 356 VAL C O   1 
ATOM   10031 C  CB  . VAL C 1 342 ? 33.806  16.651  70.135  1.00 45.30 ? 356 VAL C CB  1 
ATOM   10032 C  CG1 . VAL C 1 342 ? 33.322  15.274  70.530  1.00 40.13 ? 356 VAL C CG1 1 
ATOM   10033 C  CG2 . VAL C 1 342 ? 34.990  16.567  69.187  1.00 48.74 ? 356 VAL C CG2 1 
ATOM   10034 N  N   . PRO C 1 343 ? 32.877  19.760  70.388  1.00 32.09 ? 357 PRO C N   1 
ATOM   10035 C  CA  . PRO C 1 343 ? 33.183  21.188  70.323  1.00 36.90 ? 357 PRO C CA  1 
ATOM   10036 C  C   . PRO C 1 343 ? 34.681  21.421  70.461  1.00 41.35 ? 357 PRO C C   1 
ATOM   10037 O  O   . PRO C 1 343 ? 35.347  20.727  71.239  1.00 43.73 ? 357 PRO C O   1 
ATOM   10038 C  CB  . PRO C 1 343 ? 32.415  21.762  71.522  1.00 31.80 ? 357 PRO C CB  1 
ATOM   10039 C  CG  . PRO C 1 343 ? 32.371  20.670  72.495  1.00 37.58 ? 357 PRO C CG  1 
ATOM   10040 C  CD  . PRO C 1 343 ? 32.265  19.392  71.680  1.00 34.96 ? 357 PRO C CD  1 
ATOM   10041 N  N   . HIS C 1 344 ? 35.193  22.374  69.689  1.00 40.13 ? 358 HIS C N   1 
ATOM   10042 C  CA  . HIS C 1 344 ? 36.627  22.659  69.635  1.00 49.61 ? 358 HIS C CA  1 
ATOM   10043 C  C   . HIS C 1 344 ? 37.232  22.826  71.023  1.00 43.22 ? 358 HIS C C   1 
ATOM   10044 O  O   . HIS C 1 344 ? 38.342  22.366  71.281  1.00 40.28 ? 358 HIS C O   1 
ATOM   10045 C  CB  . HIS C 1 344 ? 36.890  23.904  68.786  1.00 55.31 ? 358 HIS C CB  1 
ATOM   10046 C  CG  . HIS C 1 344 ? 38.296  24.012  68.291  1.00 70.18 ? 358 HIS C CG  1 
ATOM   10047 N  ND1 . HIS C 1 344 ? 39.263  24.749  68.945  1.00 77.03 ? 358 HIS C ND1 1 
ATOM   10048 C  CD2 . HIS C 1 344 ? 38.904  23.478  67.204  1.00 75.30 ? 358 HIS C CD2 1 
ATOM   10049 C  CE1 . HIS C 1 344 ? 40.402  24.663  68.284  1.00 78.73 ? 358 HIS C CE1 1 
ATOM   10050 N  NE2 . HIS C 1 344 ? 40.212  23.898  67.223  1.00 78.69 ? 358 HIS C NE2 1 
ATOM   10051 N  N   . SER C 1 345 ? 36.480  23.447  71.923  1.00 45.74 ? 359 SER C N   1 
ATOM   10052 C  CA  . SER C 1 345 ? 36.972  23.729  73.267  1.00 48.93 ? 359 SER C CA  1 
ATOM   10053 C  C   . SER C 1 345 ? 37.207  22.477  74.112  1.00 46.91 ? 359 SER C C   1 
ATOM   10054 O  O   . SER C 1 345 ? 38.145  22.448  74.898  1.00 43.32 ? 359 SER C O   1 
ATOM   10055 C  CB  . SER C 1 345 ? 36.050  24.714  74.000  1.00 50.09 ? 359 SER C CB  1 
ATOM   10056 O  OG  . SER C 1 345 ? 34.917  24.068  74.544  1.00 51.77 ? 359 SER C OG  1 
ATOM   10057 N  N   . LEU C 1 346 ? 36.370  21.450  73.953  1.00 42.73 ? 360 LEU C N   1 
ATOM   10058 C  CA  . LEU C 1 346 ? 36.517  20.209  74.721  1.00 42.07 ? 360 LEU C CA  1 
ATOM   10059 C  C   . LEU C 1 346 ? 37.442  19.189  74.060  1.00 39.84 ? 360 LEU C C   1 
ATOM   10060 O  O   . LEU C 1 346 ? 37.839  18.216  74.688  1.00 45.36 ? 360 LEU C O   1 
ATOM   10061 C  CB  . LEU C 1 346 ? 35.156  19.531  74.953  1.00 37.28 ? 360 LEU C CB  1 
ATOM   10062 C  CG  . LEU C 1 346 ? 34.226  19.935  76.104  1.00 43.84 ? 360 LEU C CG  1 
ATOM   10063 C  CD1 . LEU C 1 346 ? 33.041  18.973  76.190  1.00 37.19 ? 360 LEU C CD1 1 
ATOM   10064 C  CD2 . LEU C 1 346 ? 34.965  19.984  77.429  1.00 51.33 ? 360 LEU C CD2 1 
ATOM   10065 N  N   . TRP C 1 347 ? 37.759  19.398  72.788  1.00 36.90 ? 361 TRP C N   1 
ATOM   10066 C  CA  . TRP C 1 347 ? 38.442  18.376  71.987  1.00 35.88 ? 361 TRP C CA  1 
ATOM   10067 C  C   . TRP C 1 347 ? 39.806  17.894  72.520  1.00 41.67 ? 361 TRP C C   1 
ATOM   10068 O  O   . TRP C 1 347 ? 40.038  16.685  72.572  1.00 36.45 ? 361 TRP C O   1 
ATOM   10069 C  CB  . TRP C 1 347 ? 38.496  18.803  70.509  1.00 36.28 ? 361 TRP C CB  1 
ATOM   10070 C  CG  . TRP C 1 347 ? 39.287  17.912  69.594  1.00 36.86 ? 361 TRP C CG  1 
ATOM   10071 C  CD1 . TRP C 1 347 ? 40.326  18.287  68.790  1.00 39.64 ? 361 TRP C CD1 1 
ATOM   10072 C  CD2 . TRP C 1 347 ? 39.097  16.506  69.374  1.00 37.68 ? 361 TRP C CD2 1 
ATOM   10073 N  NE1 . TRP C 1 347 ? 40.799  17.204  68.088  1.00 39.57 ? 361 TRP C NE1 1 
ATOM   10074 C  CE2 . TRP C 1 347 ? 40.056  16.100  68.422  1.00 37.82 ? 361 TRP C CE2 1 
ATOM   10075 C  CE3 . TRP C 1 347 ? 38.217  15.553  69.893  1.00 28.74 ? 361 TRP C CE3 1 
ATOM   10076 C  CZ2 . TRP C 1 347 ? 40.162  14.783  67.984  1.00 34.52 ? 361 TRP C CZ2 1 
ATOM   10077 C  CZ3 . TRP C 1 347 ? 38.311  14.252  69.448  1.00 33.29 ? 361 TRP C CZ3 1 
ATOM   10078 C  CH2 . TRP C 1 347 ? 39.281  13.875  68.504  1.00 38.01 ? 361 TRP C CH2 1 
ATOM   10079 N  N   . PRO C 1 348 ? 40.701  18.822  72.939  1.00 46.86 ? 362 PRO C N   1 
ATOM   10080 C  CA  . PRO C 1 348 ? 41.973  18.367  73.523  1.00 46.18 ? 362 PRO C CA  1 
ATOM   10081 C  C   . PRO C 1 348 ? 41.763  17.342  74.629  1.00 44.73 ? 362 PRO C C   1 
ATOM   10082 O  O   . PRO C 1 348 ? 42.391  16.279  74.646  1.00 39.95 ? 362 PRO C O   1 
ATOM   10083 C  CB  . PRO C 1 348 ? 42.554  19.651  74.125  1.00 47.26 ? 362 PRO C CB  1 
ATOM   10084 C  CG  . PRO C 1 348 ? 42.025  20.728  73.266  1.00 47.68 ? 362 PRO C CG  1 
ATOM   10085 C  CD  . PRO C 1 348 ? 40.628  20.295  72.884  1.00 46.90 ? 362 PRO C CD  1 
ATOM   10086 N  N   . GLN C 1 349 ? 40.850  17.660  75.535  1.00 45.84 ? 363 GLN C N   1 
ATOM   10087 C  CA  . GLN C 1 349 ? 40.548  16.788  76.653  1.00 43.58 ? 363 GLN C CA  1 
ATOM   10088 C  C   . GLN C 1 349 ? 39.945  15.456  76.198  1.00 42.94 ? 363 GLN C C   1 
ATOM   10089 O  O   . GLN C 1 349 ? 40.397  14.385  76.608  1.00 42.08 ? 363 GLN C O   1 
ATOM   10090 C  CB  . GLN C 1 349 ? 39.594  17.507  77.593  1.00 44.01 ? 363 GLN C CB  1 
ATOM   10091 C  CG  . GLN C 1 349 ? 39.378  16.828  78.920  1.00 53.09 ? 363 GLN C CG  1 
ATOM   10092 C  CD  . GLN C 1 349 ? 38.677  17.751  79.893  1.00 64.81 ? 363 GLN C CD  1 
ATOM   10093 O  OE1 . GLN C 1 349 ? 38.553  18.953  79.641  1.00 65.81 ? 363 GLN C OE1 1 
ATOM   10094 N  NE2 . GLN C 1 349 ? 38.206  17.198  81.006  1.00 70.30 ? 363 GLN C NE2 1 
ATOM   10095 N  N   . ILE C 1 350 ? 38.920  15.525  75.352  1.00 37.16 ? 364 ILE C N   1 
ATOM   10096 C  CA  . ILE C 1 350 ? 38.232  14.313  74.903  1.00 31.74 ? 364 ILE C CA  1 
ATOM   10097 C  C   . ILE C 1 350 ? 39.141  13.407  74.083  1.00 38.43 ? 364 ILE C C   1 
ATOM   10098 O  O   . ILE C 1 350 ? 39.201  12.196  74.314  1.00 42.63 ? 364 ILE C O   1 
ATOM   10099 C  CB  . ILE C 1 350 ? 36.956  14.652  74.123  1.00 29.97 ? 364 ILE C CB  1 
ATOM   10100 C  CG1 . ILE C 1 350 ? 35.920  15.232  75.086  1.00 38.51 ? 364 ILE C CG1 1 
ATOM   10101 C  CG2 . ILE C 1 350 ? 36.383  13.395  73.416  1.00 26.28 ? 364 ILE C CG2 1 
ATOM   10102 C  CD1 . ILE C 1 350 ? 34.581  15.548  74.440  1.00 40.68 ? 364 ILE C CD1 1 
ATOM   10103 N  N   . LYS C 1 351 ? 39.851  14.007  73.135  1.00 38.17 ? 365 LYS C N   1 
ATOM   10104 C  CA  . LYS C 1 351 ? 40.832  13.303  72.326  1.00 34.67 ? 365 LYS C CA  1 
ATOM   10105 C  C   . LYS C 1 351 ? 41.811  12.576  73.230  1.00 37.72 ? 365 LYS C C   1 
ATOM   10106 O  O   . LYS C 1 351 ? 42.066  11.386  73.043  1.00 40.99 ? 365 LYS C O   1 
ATOM   10107 C  CB  . LYS C 1 351 ? 41.570  14.292  71.424  1.00 38.41 ? 365 LYS C CB  1 
ATOM   10108 C  CG  . LYS C 1 351 ? 42.698  13.704  70.594  1.00 42.20 ? 365 LYS C CG  1 
ATOM   10109 C  CD  . LYS C 1 351 ? 43.313  14.789  69.728  1.00 51.02 ? 365 LYS C CD  1 
ATOM   10110 C  CE  . LYS C 1 351 ? 44.394  14.259  68.799  1.00 57.45 ? 365 LYS C CE  1 
ATOM   10111 N  NZ  . LYS C 1 351 ? 44.996  15.373  67.994  1.00 61.44 ? 365 LYS C NZ  1 
ATOM   10112 N  N   . GLY C 1 352 ? 42.329  13.290  74.227  1.00 37.33 ? 366 GLY C N   1 
ATOM   10113 C  CA  . GLY C 1 352 ? 43.251  12.711  75.186  1.00 40.83 ? 366 GLY C CA  1 
ATOM   10114 C  C   . GLY C 1 352 ? 42.697  11.476  75.866  1.00 41.81 ? 366 GLY C C   1 
ATOM   10115 O  O   . GLY C 1 352 ? 43.335  10.417  75.874  1.00 33.80 ? 366 GLY C O   1 
ATOM   10116 N  N   . ARG C 1 353 ? 41.498  11.606  76.422  1.00 40.35 ? 367 ARG C N   1 
ATOM   10117 C  CA  . ARG C 1 353 ? 40.866  10.495  77.115  1.00 41.28 ? 367 ARG C CA  1 
ATOM   10118 C  C   . ARG C 1 353 ? 40.452  9.366   76.162  1.00 42.55 ? 367 ARG C C   1 
ATOM   10119 O  O   . ARG C 1 353 ? 40.625  8.180   76.482  1.00 33.26 ? 367 ARG C O   1 
ATOM   10120 C  CB  . ARG C 1 353 ? 39.669  10.995  77.924  1.00 40.30 ? 367 ARG C CB  1 
ATOM   10121 C  CG  . ARG C 1 353 ? 40.082  11.862  79.107  1.00 40.43 ? 367 ARG C CG  1 
ATOM   10122 C  CD  . ARG C 1 353 ? 40.793  11.034  80.162  1.00 39.76 ? 367 ARG C CD  1 
ATOM   10123 N  NE  . ARG C 1 353 ? 39.886  10.069  80.775  1.00 44.35 ? 367 ARG C NE  1 
ATOM   10124 C  CZ  . ARG C 1 353 ? 40.111  8.765   80.886  1.00 42.80 ? 367 ARG C CZ  1 
ATOM   10125 N  NH1 . ARG C 1 353 ? 39.196  7.999   81.461  1.00 44.39 ? 367 ARG C NH1 1 
ATOM   10126 N  NH2 . ARG C 1 353 ? 41.237  8.220   80.432  1.00 43.21 ? 367 ARG C NH2 1 
ATOM   10127 N  N   . LEU C 1 354 ? 39.904  9.733   75.003  1.00 36.68 ? 368 LEU C N   1 
ATOM   10128 C  CA  . LEU C 1 354 ? 39.573  8.748   73.971  1.00 36.27 ? 368 LEU C CA  1 
ATOM   10129 C  C   . LEU C 1 354 ? 40.755  7.837   73.646  1.00 35.80 ? 368 LEU C C   1 
ATOM   10130 O  O   . LEU C 1 354 ? 40.621  6.617   73.624  1.00 30.30 ? 368 LEU C O   1 
ATOM   10131 C  CB  . LEU C 1 354 ? 39.091  9.426   72.684  1.00 39.32 ? 368 LEU C CB  1 
ATOM   10132 C  CG  . LEU C 1 354 ? 37.599  9.748   72.548  1.00 36.99 ? 368 LEU C CG  1 
ATOM   10133 C  CD1 . LEU C 1 354 ? 37.318  10.345  71.180  1.00 37.85 ? 368 LEU C CD1 1 
ATOM   10134 C  CD2 . LEU C 1 354 ? 36.758  8.497   72.759  1.00 34.10 ? 368 LEU C CD2 1 
ATOM   10135 N  N   . LEU C 1 355 ? 41.913  8.431   73.391  1.00 39.12 ? 369 LEU C N   1 
ATOM   10136 C  CA  . LEU C 1 355 ? 43.076  7.641   72.981  1.00 36.79 ? 369 LEU C CA  1 
ATOM   10137 C  C   . LEU C 1 355 ? 43.633  6.767   74.104  1.00 36.35 ? 369 LEU C C   1 
ATOM   10138 O  O   . LEU C 1 355 ? 44.061  5.637   73.858  1.00 30.53 ? 369 LEU C O   1 
ATOM   10139 C  CB  . LEU C 1 355 ? 44.169  8.535   72.396  1.00 36.71 ? 369 LEU C CB  1 
ATOM   10140 C  CG  . LEU C 1 355 ? 44.076  8.916   70.912  1.00 41.30 ? 369 LEU C CG  1 
ATOM   10141 C  CD1 . LEU C 1 355 ? 42.665  9.299   70.481  1.00 44.61 ? 369 LEU C CD1 1 
ATOM   10142 C  CD2 . LEU C 1 355 ? 45.037  10.071  70.642  1.00 45.06 ? 369 LEU C CD2 1 
ATOM   10143 N  N   . GLU C 1 356 ? 43.644  7.293   75.327  1.00 39.64 ? 370 GLU C N   1 
ATOM   10144 C  CA  . GLU C 1 356 ? 44.117  6.526   76.476  1.00 38.07 ? 370 GLU C CA  1 
ATOM   10145 C  C   . GLU C 1 356 ? 43.246  5.300   76.656  1.00 38.58 ? 370 GLU C C   1 
ATOM   10146 O  O   . GLU C 1 356 ? 43.745  4.174   76.732  1.00 41.35 ? 370 GLU C O   1 
ATOM   10147 C  CB  . GLU C 1 356 ? 44.068  7.362   77.751  1.00 29.75 ? 370 GLU C CB  1 
ATOM   10148 N  N   . GLU C 1 357 ? 41.939  5.526   76.723  1.00 34.43 ? 371 GLU C N   1 
ATOM   10149 C  CA  . GLU C 1 357 ? 40.992  4.439   76.940  1.00 37.24 ? 371 GLU C CA  1 
ATOM   10150 C  C   . GLU C 1 357 ? 41.002  3.457   75.773  1.00 38.93 ? 371 GLU C C   1 
ATOM   10151 O  O   . GLU C 1 357 ? 40.951  2.241   75.982  1.00 36.32 ? 371 GLU C O   1 
ATOM   10152 C  CB  . GLU C 1 357 ? 39.583  4.972   77.193  1.00 31.80 ? 371 GLU C CB  1 
ATOM   10153 C  CG  . GLU C 1 357 ? 39.408  5.712   78.504  1.00 33.65 ? 371 GLU C CG  1 
ATOM   10154 C  CD  . GLU C 1 357 ? 39.836  4.900   79.710  1.00 40.22 ? 371 GLU C CD  1 
ATOM   10155 O  OE1 . GLU C 1 357 ? 39.636  3.665   79.718  1.00 43.72 ? 371 GLU C OE1 1 
ATOM   10156 O  OE2 . GLU C 1 357 ? 40.387  5.499   80.657  1.00 42.84 ? 371 GLU C OE2 1 
ATOM   10157 N  N   . HIS C 1 358 ? 41.096  3.990   74.554  1.00 36.89 ? 372 HIS C N   1 
ATOM   10158 C  CA  . HIS C 1 358 ? 41.197  3.166   73.350  1.00 31.21 ? 372 HIS C CA  1 
ATOM   10159 C  C   . HIS C 1 358 ? 42.299  2.126   73.522  1.00 34.49 ? 372 HIS C C   1 
ATOM   10160 O  O   . HIS C 1 358 ? 42.123  0.977   73.146  1.00 28.57 ? 372 HIS C O   1 
ATOM   10161 C  CB  . HIS C 1 358 ? 41.499  4.036   72.122  1.00 33.18 ? 372 HIS C CB  1 
ATOM   10162 C  CG  . HIS C 1 358 ? 41.783  3.259   70.872  1.00 34.86 ? 372 HIS C CG  1 
ATOM   10163 N  ND1 . HIS C 1 358 ? 43.027  2.732   70.582  1.00 34.57 ? 372 HIS C ND1 1 
ATOM   10164 C  CD2 . HIS C 1 358 ? 40.985  2.932   69.824  1.00 34.17 ? 372 HIS C CD2 1 
ATOM   10165 C  CE1 . HIS C 1 358 ? 42.980  2.112   69.417  1.00 38.21 ? 372 HIS C CE1 1 
ATOM   10166 N  NE2 . HIS C 1 358 ? 41.751  2.215   68.937  1.00 38.07 ? 372 HIS C NE2 1 
ATOM   10167 N  N   . SER C 1 359 ? 43.424  2.533   74.111  1.00 34.72 ? 373 SER C N   1 
ATOM   10168 C  CA  . SER C 1 359 ? 44.590  1.654   74.235  1.00 36.30 ? 373 SER C CA  1 
ATOM   10169 C  C   . SER C 1 359 ? 44.363  0.477   75.187  1.00 34.57 ? 373 SER C C   1 
ATOM   10170 O  O   . SER C 1 359 ? 45.123  -0.491  75.174  1.00 37.24 ? 373 SER C O   1 
ATOM   10171 C  CB  . SER C 1 359 ? 45.832  2.444   74.675  1.00 39.87 ? 373 SER C CB  1 
ATOM   10172 O  OG  . SER C 1 359 ? 45.790  2.713   76.067  1.00 39.31 ? 373 SER C OG  1 
ATOM   10173 N  N   . ARG C 1 360 ? 43.326  0.572   76.012  1.00 35.00 ? 374 ARG C N   1 
ATOM   10174 C  CA  . ARG C 1 360 ? 42.942  -0.509  76.910  1.00 35.10 ? 374 ARG C CA  1 
ATOM   10175 C  C   . ARG C 1 360 ? 41.919  -1.475  76.297  1.00 38.99 ? 374 ARG C C   1 
ATOM   10176 O  O   . ARG C 1 360 ? 41.531  -2.452  76.936  1.00 42.78 ? 374 ARG C O   1 
ATOM   10177 C  CB  . ARG C 1 360 ? 42.374  0.067   78.210  1.00 40.22 ? 374 ARG C CB  1 
ATOM   10178 N  N   . ILE C 1 361 ? 41.472  -1.203  75.074  1.00 31.47 ? 375 ILE C N   1 
ATOM   10179 C  CA  . ILE C 1 361 ? 40.452  -2.046  74.439  1.00 28.33 ? 375 ILE C CA  1 
ATOM   10180 C  C   . ILE C 1 361 ? 41.021  -3.369  73.924  1.00 30.50 ? 375 ILE C C   1 
ATOM   10181 O  O   . ILE C 1 361 ? 41.791  -3.399  72.959  1.00 32.26 ? 375 ILE C O   1 
ATOM   10182 C  CB  . ILE C 1 361 ? 39.722  -1.309  73.294  1.00 28.71 ? 375 ILE C CB  1 
ATOM   10183 C  CG1 . ILE C 1 361 ? 38.959  -0.099  73.846  1.00 23.72 ? 375 ILE C CG1 1 
ATOM   10184 C  CG2 . ILE C 1 361 ? 38.752  -2.261  72.571  1.00 30.62 ? 375 ILE C CG2 1 
ATOM   10185 C  CD1 . ILE C 1 361 ? 38.243  0.750   72.771  1.00 23.43 ? 375 ILE C CD1 1 
ATOM   10186 N  N   . LYS C 1 362 ? 40.625  -4.466  74.563  1.00 27.11 ? 376 LYS C N   1 
ATOM   10187 C  CA  . LYS C 1 362 ? 41.178  -5.777  74.231  1.00 26.60 ? 376 LYS C CA  1 
ATOM   10188 C  C   . LYS C 1 362 ? 40.402  -6.458  73.105  1.00 29.29 ? 376 LYS C C   1 
ATOM   10189 O  O   . LYS C 1 362 ? 39.212  -6.722  73.229  1.00 27.53 ? 376 LYS C O   1 
ATOM   10190 C  CB  . LYS C 1 362 ? 41.212  -6.669  75.471  1.00 30.29 ? 376 LYS C CB  1 
ATOM   10191 N  N   . VAL C 1 363 ? 41.082  -6.727  72.001  1.00 24.79 ? 377 VAL C N   1 
ATOM   10192 C  CA  . VAL C 1 363 ? 40.482  -7.482  70.908  1.00 25.66 ? 377 VAL C CA  1 
ATOM   10193 C  C   . VAL C 1 363 ? 41.047  -8.923  70.947  1.00 31.75 ? 377 VAL C C   1 
ATOM   10194 O  O   . VAL C 1 363 ? 42.265  -9.105  70.931  1.00 30.62 ? 377 VAL C O   1 
ATOM   10195 C  CB  . VAL C 1 363 ? 40.799  -6.805  69.569  1.00 28.50 ? 377 VAL C CB  1 
ATOM   10196 C  CG1 . VAL C 1 363 ? 40.324  -7.646  68.419  1.00 26.24 ? 377 VAL C CG1 1 
ATOM   10197 C  CG2 . VAL C 1 363 ? 40.143  -5.406  69.509  1.00 31.74 ? 377 VAL C CG2 1 
ATOM   10198 N  N   . GLY C 1 364 ? 40.177  -9.929  71.031  1.00 23.25 ? 378 GLY C N   1 
ATOM   10199 C  CA  . GLY C 1 364 ? 40.619  -11.319 71.019  1.00 25.24 ? 378 GLY C CA  1 
ATOM   10200 C  C   . GLY C 1 364 ? 39.538  -12.384 70.865  1.00 28.45 ? 378 GLY C C   1 
ATOM   10201 O  O   . GLY C 1 364 ? 38.413  -12.112 70.426  1.00 24.12 ? 378 GLY C O   1 
ATOM   10202 N  N   . ASP C 1 365 ? 39.900  -13.607 71.244  1.00 21.06 ? 379 ASP C N   1 
ATOM   10203 C  CA  . ASP C 1 365 ? 39.022  -14.772 71.222  1.00 25.87 ? 379 ASP C CA  1 
ATOM   10204 C  C   . ASP C 1 365 ? 38.079  -14.711 72.429  1.00 26.63 ? 379 ASP C C   1 
ATOM   10205 O  O   . ASP C 1 365 ? 38.517  -14.820 73.571  1.00 26.65 ? 379 ASP C O   1 
ATOM   10206 C  CB  . ASP C 1 365 ? 39.906  -16.035 71.241  1.00 31.07 ? 379 ASP C CB  1 
ATOM   10207 C  CG  . ASP C 1 365 ? 39.117  -17.333 71.172  1.00 26.85 ? 379 ASP C CG  1 
ATOM   10208 O  OD1 . ASP C 1 365 ? 37.951  -17.362 71.607  1.00 25.95 ? 379 ASP C OD1 1 
ATOM   10209 O  OD2 . ASP C 1 365 ? 39.691  -18.350 70.719  1.00 30.02 ? 379 ASP C OD2 1 
ATOM   10210 N  N   . PRO C 1 366 ? 36.766  -14.540 72.177  1.00 25.23 ? 380 PRO C N   1 
ATOM   10211 C  CA  . PRO C 1 366 ? 35.790  -14.335 73.252  1.00 24.01 ? 380 PRO C CA  1 
ATOM   10212 C  C   . PRO C 1 366 ? 35.463  -15.609 74.018  1.00 21.97 ? 380 PRO C C   1 
ATOM   10213 O  O   . PRO C 1 366 ? 35.007  -15.545 75.162  1.00 24.83 ? 380 PRO C O   1 
ATOM   10214 C  CB  . PRO C 1 366 ? 34.543  -13.851 72.498  1.00 24.60 ? 380 PRO C CB  1 
ATOM   10215 C  CG  . PRO C 1 366 ? 34.654  -14.516 71.154  1.00 20.28 ? 380 PRO C CG  1 
ATOM   10216 C  CD  . PRO C 1 366 ? 36.133  -14.545 70.846  1.00 25.02 ? 380 PRO C CD  1 
ATOM   10217 N  N   . ALA C 1 367 ? 35.667  -16.758 73.386  1.00 19.76 ? 381 ALA C N   1 
ATOM   10218 C  CA  . ALA C 1 367 ? 35.479  -18.025 74.075  1.00 20.16 ? 381 ALA C CA  1 
ATOM   10219 C  C   . ALA C 1 367 ? 36.682  -18.302 74.999  1.00 23.46 ? 381 ALA C C   1 
ATOM   10220 O  O   . ALA C 1 367 ? 36.522  -18.797 76.112  1.00 27.71 ? 381 ALA C O   1 
ATOM   10221 C  CB  . ALA C 1 367 ? 35.295  -19.144 73.067  1.00 22.91 ? 381 ALA C CB  1 
ATOM   10222 N  N   . GLU C 1 368 ? 37.877  -17.942 74.545  1.00 30.78 ? 382 GLU C N   1 
ATOM   10223 C  CA  . GLU C 1 368 ? 39.102  -18.156 75.329  1.00 34.21 ? 382 GLU C CA  1 
ATOM   10224 C  C   . GLU C 1 368 ? 39.324  -17.137 76.454  1.00 31.07 ? 382 GLU C C   1 
ATOM   10225 O  O   . GLU C 1 368 ? 39.871  -17.469 77.507  1.00 28.64 ? 382 GLU C O   1 
ATOM   10226 C  CB  . GLU C 1 368 ? 40.338  -18.179 74.417  1.00 32.78 ? 382 GLU C CB  1 
ATOM   10227 N  N   . ASP C 1 369 ? 38.905  -15.897 76.235  1.00 26.36 ? 383 ASP C N   1 
ATOM   10228 C  CA  . ASP C 1 369 ? 39.278  -14.813 77.136  1.00 31.93 ? 383 ASP C CA  1 
ATOM   10229 C  C   . ASP C 1 369 ? 38.072  -13.919 77.413  1.00 36.24 ? 383 ASP C C   1 
ATOM   10230 O  O   . ASP C 1 369 ? 37.761  -13.005 76.644  1.00 32.53 ? 383 ASP C O   1 
ATOM   10231 C  CB  . ASP C 1 369 ? 40.468  -14.028 76.543  1.00 29.07 ? 383 ASP C CB  1 
ATOM   10232 C  CG  . ASP C 1 369 ? 40.919  -12.852 77.418  1.00 32.81 ? 383 ASP C CG  1 
ATOM   10233 O  OD1 . ASP C 1 369 ? 40.397  -12.671 78.536  1.00 31.54 ? 383 ASP C OD1 1 
ATOM   10234 O  OD2 . ASP C 1 369 ? 41.823  -12.107 76.981  1.00 33.92 ? 383 ASP C OD2 1 
ATOM   10235 N  N   . PHE C 1 370 ? 37.408  -14.177 78.536  1.00 32.53 ? 384 PHE C N   1 
ATOM   10236 C  CA  . PHE C 1 370 ? 36.223  -13.412 78.907  1.00 35.74 ? 384 PHE C CA  1 
ATOM   10237 C  C   . PHE C 1 370 ? 36.546  -11.945 79.221  1.00 33.64 ? 384 PHE C C   1 
ATOM   10238 O  O   . PHE C 1 370 ? 35.650  -11.149 79.477  1.00 36.07 ? 384 PHE C O   1 
ATOM   10239 C  CB  . PHE C 1 370 ? 35.475  -14.072 80.074  1.00 34.47 ? 384 PHE C CB  1 
ATOM   10240 C  CG  . PHE C 1 370 ? 34.699  -15.307 79.691  1.00 35.42 ? 384 PHE C CG  1 
ATOM   10241 C  CD1 . PHE C 1 370 ? 34.899  -15.932 78.468  1.00 34.59 ? 384 PHE C CD1 1 
ATOM   10242 C  CD2 . PHE C 1 370 ? 33.755  -15.835 80.554  1.00 35.28 ? 384 PHE C CD2 1 
ATOM   10243 C  CE1 . PHE C 1 370 ? 34.184  -17.070 78.124  1.00 34.85 ? 384 PHE C CE1 1 
ATOM   10244 C  CE2 . PHE C 1 370 ? 33.038  -16.966 80.215  1.00 37.92 ? 384 PHE C CE2 1 
ATOM   10245 C  CZ  . PHE C 1 370 ? 33.253  -17.586 78.995  1.00 38.75 ? 384 PHE C CZ  1 
ATOM   10246 N  N   . GLY C 1 371 ? 37.827  -11.590 79.196  1.00 34.53 ? 385 GLY C N   1 
ATOM   10247 C  CA  . GLY C 1 371 ? 38.221  -10.197 79.331  1.00 36.25 ? 385 GLY C CA  1 
ATOM   10248 C  C   . GLY C 1 371 ? 38.152  -9.420  78.020  1.00 37.08 ? 385 GLY C C   1 
ATOM   10249 O  O   . GLY C 1 371 ? 38.447  -8.228  77.982  1.00 32.35 ? 385 GLY C O   1 
ATOM   10250 N  N   . THR C 1 372 ? 37.776  -10.106 76.945  1.00 32.12 ? 386 THR C N   1 
ATOM   10251 C  CA  . THR C 1 372 ? 37.737  -9.517  75.614  1.00 28.00 ? 386 THR C CA  1 
ATOM   10252 C  C   . THR C 1 372 ? 36.654  -8.450  75.571  1.00 26.45 ? 386 THR C C   1 
ATOM   10253 O  O   . THR C 1 372 ? 35.544  -8.673  76.041  1.00 28.69 ? 386 THR C O   1 
ATOM   10254 C  CB  . THR C 1 372 ? 37.389  -10.589 74.554  1.00 27.73 ? 386 THR C CB  1 
ATOM   10255 O  OG1 . THR C 1 372 ? 38.487  -11.493 74.400  1.00 29.56 ? 386 THR C OG1 1 
ATOM   10256 C  CG2 . THR C 1 372 ? 37.072  -9.955  73.208  1.00 26.23 ? 386 THR C CG2 1 
ATOM   10257 N  N   . PHE C 1 373 ? 36.981  -7.293  75.015  1.00 25.12 ? 387 PHE C N   1 
ATOM   10258 C  CA  . PHE C 1 373 ? 35.975  -6.254  74.858  1.00 19.60 ? 387 PHE C CA  1 
ATOM   10259 C  C   . PHE C 1 373 ? 35.132  -6.517  73.614  1.00 19.98 ? 387 PHE C C   1 
ATOM   10260 O  O   . PHE C 1 373 ? 33.911  -6.459  73.672  1.00 23.34 ? 387 PHE C O   1 
ATOM   10261 C  CB  . PHE C 1 373 ? 36.597  -4.875  74.791  1.00 24.51 ? 387 PHE C CB  1 
ATOM   10262 C  CG  . PHE C 1 373 ? 35.571  -3.769  74.766  1.00 32.99 ? 387 PHE C CG  1 
ATOM   10263 C  CD1 . PHE C 1 373 ? 34.884  -3.421  75.920  1.00 36.01 ? 387 PHE C CD1 1 
ATOM   10264 C  CD2 . PHE C 1 373 ? 35.271  -3.109  73.593  1.00 34.64 ? 387 PHE C CD2 1 
ATOM   10265 C  CE1 . PHE C 1 373 ? 33.931  -2.408  75.905  1.00 41.68 ? 387 PHE C CE1 1 
ATOM   10266 C  CE2 . PHE C 1 373 ? 34.312  -2.100  73.576  1.00 33.31 ? 387 PHE C CE2 1 
ATOM   10267 C  CZ  . PHE C 1 373 ? 33.652  -1.755  74.735  1.00 34.60 ? 387 PHE C CZ  1 
ATOM   10268 N  N   . PHE C 1 374 ? 35.796  -6.797  72.495  1.00 19.86 ? 388 PHE C N   1 
ATOM   10269 C  CA  . PHE C 1 374 ? 35.114  -7.274  71.292  1.00 21.66 ? 388 PHE C CA  1 
ATOM   10270 C  C   . PHE C 1 374 ? 36.029  -8.127  70.422  1.00 22.21 ? 388 PHE C C   1 
ATOM   10271 O  O   . PHE C 1 374 ? 37.248  -8.040  70.529  1.00 24.53 ? 388 PHE C O   1 
ATOM   10272 C  CB  . PHE C 1 374 ? 34.471  -6.138  70.492  1.00 21.13 ? 388 PHE C CB  1 
ATOM   10273 C  CG  . PHE C 1 374 ? 35.434  -5.300  69.660  1.00 20.76 ? 388 PHE C CG  1 
ATOM   10274 C  CD1 . PHE C 1 374 ? 36.098  -4.216  70.210  1.00 20.88 ? 388 PHE C CD1 1 
ATOM   10275 C  CD2 . PHE C 1 374 ? 35.594  -5.553  68.299  1.00 19.57 ? 388 PHE C CD2 1 
ATOM   10276 C  CE1 . PHE C 1 374 ? 36.932  -3.421  69.436  1.00 24.41 ? 388 PHE C CE1 1 
ATOM   10277 C  CE2 . PHE C 1 374 ? 36.414  -4.765  67.507  1.00 19.87 ? 388 PHE C CE2 1 
ATOM   10278 C  CZ  . PHE C 1 374 ? 37.089  -3.689  68.075  1.00 22.16 ? 388 PHE C CZ  1 
ATOM   10279 N  N   . SER C 1 375 ? 35.435  -8.941  69.557  1.00 16.93 ? 389 SER C N   1 
ATOM   10280 C  CA  . SER C 1 375 ? 36.211  -9.920  68.813  1.00 19.83 ? 389 SER C CA  1 
ATOM   10281 C  C   . SER C 1 375 ? 36.230  -9.534  67.346  1.00 22.82 ? 389 SER C C   1 
ATOM   10282 O  O   . SER C 1 375 ? 35.927  -8.384  66.991  1.00 21.26 ? 389 SER C O   1 
ATOM   10283 C  CB  . SER C 1 375 ? 35.634  -11.334 69.015  1.00 22.71 ? 389 SER C CB  1 
ATOM   10284 O  OG  . SER C 1 375 ? 36.562  -12.356 68.634  1.00 25.21 ? 389 SER C OG  1 
ATOM   10285 N  N   . ALA C 1 376 ? 36.585  -10.500 66.503  1.00 18.45 ? 390 ALA C N   1 
ATOM   10286 C  CA  . ALA C 1 376 ? 36.598  -10.327 65.053  1.00 21.22 ? 390 ALA C CA  1 
ATOM   10287 C  C   . ALA C 1 376 ? 35.247  -9.873  64.483  1.00 20.71 ? 390 ALA C C   1 
ATOM   10288 O  O   . ALA C 1 376 ? 34.202  -10.175 65.047  1.00 27.78 ? 390 ALA C O   1 
ATOM   10289 C  CB  . ALA C 1 376 ? 37.004  -11.633 64.394  1.00 17.13 ? 390 ALA C CB  1 
ATOM   10290 N  N   . VAL C 1 377 ? 35.287  -9.179  63.346  1.00 19.94 ? 391 VAL C N   1 
ATOM   10291 C  CA  . VAL C 1 377 ? 34.080  -8.844  62.608  1.00 21.66 ? 391 VAL C CA  1 
ATOM   10292 C  C   . VAL C 1 377 ? 33.519  -10.101 61.934  1.00 20.68 ? 391 VAL C C   1 
ATOM   10293 O  O   . VAL C 1 377 ? 34.205  -11.116 61.834  1.00 22.15 ? 391 VAL C O   1 
ATOM   10294 C  CB  . VAL C 1 377 ? 34.328  -7.713  61.597  1.00 23.19 ? 391 VAL C CB  1 
ATOM   10295 C  CG1 . VAL C 1 377 ? 34.714  -6.436  62.334  1.00 18.55 ? 391 VAL C CG1 1 
ATOM   10296 C  CG2 . VAL C 1 377 ? 35.427  -8.111  60.622  1.00 18.10 ? 391 VAL C CG2 1 
ATOM   10297 N  N   . ILE C 1 378 ? 32.271  -10.024 61.481  1.00 19.72 ? 392 ILE C N   1 
ATOM   10298 C  CA  . ILE C 1 378 ? 31.469  -11.226 61.237  1.00 19.63 ? 392 ILE C CA  1 
ATOM   10299 C  C   . ILE C 1 378 ? 31.948  -12.151 60.109  1.00 22.27 ? 392 ILE C C   1 
ATOM   10300 O  O   . ILE C 1 378 ? 31.880  -13.369 60.242  1.00 21.07 ? 392 ILE C O   1 
ATOM   10301 C  CB  . ILE C 1 378 ? 29.973  -10.876 61.044  1.00 20.05 ? 392 ILE C CB  1 
ATOM   10302 C  CG1 . ILE C 1 378 ? 29.125  -12.146 61.071  1.00 23.42 ? 392 ILE C CG1 1 
ATOM   10303 C  CG2 . ILE C 1 378 ? 29.746  -10.052 59.762  1.00 20.65 ? 392 ILE C CG2 1 
ATOM   10304 C  CD1 . ILE C 1 378 ? 29.009  -12.779 62.453  1.00 16.19 ? 392 ILE C CD1 1 
ATOM   10305 N  N   . ASP C 1 379 ? 32.437  -11.588 59.009  1.00 25.66 ? 393 ASP C N   1 
ATOM   10306 C  CA  . ASP C 1 379 ? 32.873  -12.422 57.892  1.00 27.60 ? 393 ASP C CA  1 
ATOM   10307 C  C   . ASP C 1 379 ? 33.884  -11.731 56.974  1.00 30.24 ? 393 ASP C C   1 
ATOM   10308 O  O   . ASP C 1 379 ? 34.238  -10.563 57.180  1.00 21.19 ? 393 ASP C O   1 
ATOM   10309 C  CB  . ASP C 1 379 ? 31.666  -12.932 57.099  1.00 30.94 ? 393 ASP C CB  1 
ATOM   10310 C  CG  . ASP C 1 379 ? 30.940  -11.827 56.368  1.00 33.56 ? 393 ASP C CG  1 
ATOM   10311 O  OD1 . ASP C 1 379 ? 31.204  -10.640 56.654  1.00 30.20 ? 393 ASP C OD1 1 
ATOM   10312 O  OD2 . ASP C 1 379 ? 30.103  -12.148 55.502  1.00 37.49 ? 393 ASP C OD2 1 
ATOM   10313 N  N   . ALA C 1 380 ? 34.356  -12.463 55.967  1.00 31.34 ? 394 ALA C N   1 
ATOM   10314 C  CA  . ALA C 1 380 ? 35.354  -11.930 55.049  1.00 35.23 ? 394 ALA C CA  1 
ATOM   10315 C  C   . ALA C 1 380 ? 34.817  -10.706 54.318  1.00 33.98 ? 394 ALA C C   1 
ATOM   10316 O  O   . ALA C 1 380 ? 35.559  -9.763  54.064  1.00 30.52 ? 394 ALA C O   1 
ATOM   10317 C  CB  . ALA C 1 380 ? 35.793  -12.989 54.055  1.00 37.81 ? 394 ALA C CB  1 
ATOM   10318 N  N   . LYS C 1 381 ? 33.529  -10.734 53.985  1.00 31.39 ? 395 LYS C N   1 
ATOM   10319 C  CA  . LYS C 1 381 ? 32.899  -9.610  53.296  1.00 36.96 ? 395 LYS C CA  1 
ATOM   10320 C  C   . LYS C 1 381 ? 32.997  -8.322  54.120  1.00 33.40 ? 395 LYS C C   1 
ATOM   10321 O  O   . LYS C 1 381 ? 33.317  -7.257  53.589  1.00 29.79 ? 395 LYS C O   1 
ATOM   10322 C  CB  . LYS C 1 381 ? 31.431  -9.917  52.973  1.00 35.22 ? 395 LYS C CB  1 
ATOM   10323 N  N   . SER C 1 382 ? 32.723  -8.422  55.416  1.00 26.81 ? 396 SER C N   1 
ATOM   10324 C  CA  . SER C 1 382 ? 32.738  -7.236  56.263  1.00 31.33 ? 396 SER C CA  1 
ATOM   10325 C  C   . SER C 1 382 ? 34.166  -6.804  56.532  1.00 29.70 ? 396 SER C C   1 
ATOM   10326 O  O   . SER C 1 382 ? 34.457  -5.612  56.591  1.00 31.83 ? 396 SER C O   1 
ATOM   10327 C  CB  . SER C 1 382 ? 31.969  -7.470  57.564  1.00 30.10 ? 396 SER C CB  1 
ATOM   10328 O  OG  . SER C 1 382 ? 30.610  -7.786  57.276  1.00 39.29 ? 396 SER C OG  1 
ATOM   10329 N  N   . PHE C 1 383 ? 35.060  -7.775  56.669  1.00 24.63 ? 397 PHE C N   1 
ATOM   10330 C  CA  . PHE C 1 383 ? 36.475  -7.463  56.822  1.00 30.92 ? 397 PHE C CA  1 
ATOM   10331 C  C   . PHE C 1 383 ? 36.975  -6.695  55.608  1.00 38.24 ? 397 PHE C C   1 
ATOM   10332 O  O   . PHE C 1 383 ? 37.730  -5.731  55.737  1.00 35.56 ? 397 PHE C O   1 
ATOM   10333 C  CB  . PHE C 1 383 ? 37.304  -8.733  56.981  1.00 24.54 ? 397 PHE C CB  1 
ATOM   10334 C  CG  . PHE C 1 383 ? 38.765  -8.472  57.244  1.00 28.48 ? 397 PHE C CG  1 
ATOM   10335 C  CD1 . PHE C 1 383 ? 39.650  -8.279  56.193  1.00 30.42 ? 397 PHE C CD1 1 
ATOM   10336 C  CD2 . PHE C 1 383 ? 39.251  -8.415  58.543  1.00 20.12 ? 397 PHE C CD2 1 
ATOM   10337 C  CE1 . PHE C 1 383 ? 40.993  -8.037  56.433  1.00 33.95 ? 397 PHE C CE1 1 
ATOM   10338 C  CE2 . PHE C 1 383 ? 40.594  -8.177  58.791  1.00 31.48 ? 397 PHE C CE2 1 
ATOM   10339 C  CZ  . PHE C 1 383 ? 41.468  -7.987  57.733  1.00 33.06 ? 397 PHE C CZ  1 
ATOM   10340 N  N   . ALA C 1 384 ? 36.570  -7.137  54.424  1.00 37.38 ? 398 ALA C N   1 
ATOM   10341 C  CA  . ALA C 1 384 ? 37.014  -6.466  53.209  1.00 37.39 ? 398 ALA C CA  1 
ATOM   10342 C  C   . ALA C 1 384 ? 36.464  -5.025  53.133  1.00 33.50 ? 398 ALA C C   1 
ATOM   10343 O  O   . ALA C 1 384 ? 37.198  -4.082  52.836  1.00 32.37 ? 398 ALA C O   1 
ATOM   10344 C  CB  . ALA C 1 384 ? 36.624  -7.278  51.973  1.00 30.07 ? 398 ALA C CB  1 
ATOM   10345 N  N   . ARG C 1 385 ? 35.179  -4.869  53.421  1.00 30.08 ? 399 ARG C N   1 
ATOM   10346 C  CA  . ARG C 1 385 ? 34.535  -3.557  53.380  1.00 31.64 ? 399 ARG C CA  1 
ATOM   10347 C  C   . ARG C 1 385 ? 35.205  -2.593  54.371  1.00 35.84 ? 399 ARG C C   1 
ATOM   10348 O  O   . ARG C 1 385 ? 35.549  -1.456  54.034  1.00 29.61 ? 399 ARG C O   1 
ATOM   10349 C  CB  . ARG C 1 385 ? 33.049  -3.710  53.689  1.00 29.30 ? 399 ARG C CB  1 
ATOM   10350 C  CG  . ARG C 1 385 ? 32.225  -2.433  53.563  1.00 35.21 ? 399 ARG C CG  1 
ATOM   10351 C  CD  . ARG C 1 385 ? 30.773  -2.655  53.988  1.00 37.37 ? 399 ARG C CD  1 
ATOM   10352 N  NE  . ARG C 1 385 ? 30.666  -2.951  55.414  1.00 39.02 ? 399 ARG C NE  1 
ATOM   10353 C  CZ  . ARG C 1 385 ? 30.374  -4.151  55.911  1.00 41.71 ? 399 ARG C CZ  1 
ATOM   10354 N  NH1 . ARG C 1 385 ? 30.309  -4.332  57.228  1.00 40.33 ? 399 ARG C NH1 1 
ATOM   10355 N  NH2 . ARG C 1 385 ? 30.145  -5.169  55.092  1.00 37.54 ? 399 ARG C NH2 1 
ATOM   10356 N  N   . ILE C 1 386 ? 35.408  -3.064  55.593  1.00 33.36 ? 400 ILE C N   1 
ATOM   10357 C  CA  . ILE C 1 386 ? 36.044  -2.254  56.617  1.00 32.16 ? 400 ILE C CA  1 
ATOM   10358 C  C   . ILE C 1 386 ? 37.472  -1.886  56.229  1.00 32.15 ? 400 ILE C C   1 
ATOM   10359 O  O   . ILE C 1 386 ? 37.899  -0.735  56.388  1.00 35.37 ? 400 ILE C O   1 
ATOM   10360 C  CB  . ILE C 1 386 ? 35.996  -2.974  57.983  1.00 34.23 ? 400 ILE C CB  1 
ATOM   10361 C  CG1 . ILE C 1 386 ? 34.540  -3.075  58.454  1.00 31.25 ? 400 ILE C CG1 1 
ATOM   10362 C  CG2 . ILE C 1 386 ? 36.846  -2.249  59.005  1.00 30.30 ? 400 ILE C CG2 1 
ATOM   10363 C  CD1 . ILE C 1 386 ? 34.311  -4.088  59.557  1.00 26.02 ? 400 ILE C CD1 1 
ATOM   10364 N  N   . LYS C 1 387 ? 38.203  -2.857  55.686  1.00 38.04 ? 401 LYS C N   1 
ATOM   10365 C  CA  . LYS C 1 387 ? 39.579  -2.616  55.259  1.00 41.51 ? 401 LYS C CA  1 
ATOM   10366 C  C   . LYS C 1 387 ? 39.639  -1.513  54.203  1.00 35.66 ? 401 LYS C C   1 
ATOM   10367 O  O   . LYS C 1 387 ? 40.532  -0.668  54.233  1.00 34.34 ? 401 LYS C O   1 
ATOM   10368 C  CB  . LYS C 1 387 ? 40.231  -3.907  54.746  1.00 36.89 ? 401 LYS C CB  1 
ATOM   10369 C  CG  . LYS C 1 387 ? 41.686  -3.760  54.374  1.00 37.20 ? 401 LYS C CG  1 
ATOM   10370 N  N   . LYS C 1 388 ? 38.672  -1.516  53.291  1.00 31.19 ? 402 LYS C N   1 
ATOM   10371 C  CA  . LYS C 1 388 ? 38.586  -0.486  52.254  1.00 36.42 ? 402 LYS C CA  1 
ATOM   10372 C  C   . LYS C 1 388 ? 38.365  0.906   52.854  1.00 40.50 ? 402 LYS C C   1 
ATOM   10373 O  O   . LYS C 1 388 ? 38.949  1.883   52.389  1.00 35.89 ? 402 LYS C O   1 
ATOM   10374 C  CB  . LYS C 1 388 ? 37.479  -0.814  51.247  1.00 34.94 ? 402 LYS C CB  1 
ATOM   10375 N  N   . TRP C 1 389 ? 37.529  0.993   53.888  1.00 38.39 ? 403 TRP C N   1 
ATOM   10376 C  CA  . TRP C 1 389 ? 37.324  2.264   54.584  1.00 31.99 ? 403 TRP C CA  1 
ATOM   10377 C  C   . TRP C 1 389 ? 38.556  2.738   55.327  1.00 33.98 ? 403 TRP C C   1 
ATOM   10378 O  O   . TRP C 1 389 ? 38.842  3.938   55.349  1.00 34.72 ? 403 TRP C O   1 
ATOM   10379 C  CB  . TRP C 1 389 ? 36.121  2.210   55.530  1.00 28.36 ? 403 TRP C CB  1 
ATOM   10380 C  CG  . TRP C 1 389 ? 34.849  2.391   54.801  1.00 27.24 ? 403 TRP C CG  1 
ATOM   10381 C  CD1 . TRP C 1 389 ? 33.963  1.418   54.451  1.00 26.28 ? 403 TRP C CD1 1 
ATOM   10382 C  CD2 . TRP C 1 389 ? 34.315  3.626   54.307  1.00 32.12 ? 403 TRP C CD2 1 
ATOM   10383 N  NE1 . TRP C 1 389 ? 32.908  1.971   53.769  1.00 33.63 ? 403 TRP C NE1 1 
ATOM   10384 C  CE2 . TRP C 1 389 ? 33.099  3.324   53.665  1.00 28.10 ? 403 TRP C CE2 1 
ATOM   10385 C  CE3 . TRP C 1 389 ? 34.749  4.958   54.346  1.00 32.14 ? 403 TRP C CE3 1 
ATOM   10386 C  CZ2 . TRP C 1 389 ? 32.303  4.306   53.073  1.00 34.05 ? 403 TRP C CZ2 1 
ATOM   10387 C  CZ3 . TRP C 1 389 ? 33.955  5.935   53.747  1.00 32.91 ? 403 TRP C CZ3 1 
ATOM   10388 C  CH2 . TRP C 1 389 ? 32.751  5.603   53.119  1.00 30.97 ? 403 TRP C CH2 1 
ATOM   10389 N  N   . LEU C 1 390 ? 39.291  1.804   55.928  1.00 35.93 ? 404 LEU C N   1 
ATOM   10390 C  CA  . LEU C 1 390 ? 40.532  2.159   56.601  1.00 40.12 ? 404 LEU C CA  1 
ATOM   10391 C  C   . LEU C 1 390 ? 41.550  2.729   55.604  1.00 44.87 ? 404 LEU C C   1 
ATOM   10392 O  O   . LEU C 1 390 ? 42.243  3.700   55.901  1.00 43.42 ? 404 LEU C O   1 
ATOM   10393 C  CB  . LEU C 1 390 ? 41.128  0.950   57.333  1.00 40.63 ? 404 LEU C CB  1 
ATOM   10394 C  CG  . LEU C 1 390 ? 40.362  0.303   58.490  1.00 40.64 ? 404 LEU C CG  1 
ATOM   10395 C  CD1 . LEU C 1 390 ? 41.133  -0.899  58.998  1.00 40.81 ? 404 LEU C CD1 1 
ATOM   10396 C  CD2 . LEU C 1 390 ? 40.121  1.277   59.618  1.00 38.22 ? 404 LEU C CD2 1 
ATOM   10397 N  N   . GLU C 1 391 ? 41.645  2.118   54.425  1.00 49.83 ? 405 GLU C N   1 
ATOM   10398 C  CA  . GLU C 1 391 ? 42.564  2.601   53.395  1.00 50.87 ? 405 GLU C CA  1 
ATOM   10399 C  C   . GLU C 1 391 ? 42.108  3.959   52.876  1.00 49.79 ? 405 GLU C C   1 
ATOM   10400 O  O   . GLU C 1 391 ? 42.929  4.832   52.584  1.00 52.17 ? 405 GLU C O   1 
ATOM   10401 C  CB  . GLU C 1 391 ? 42.679  1.600   52.242  1.00 52.88 ? 405 GLU C CB  1 
ATOM   10402 N  N   . HIS C 1 392 ? 40.795  4.135   52.768  1.00 45.64 ? 406 HIS C N   1 
ATOM   10403 C  CA  . HIS C 1 392 ? 40.236  5.411   52.331  1.00 44.47 ? 406 HIS C CA  1 
ATOM   10404 C  C   . HIS C 1 392 ? 40.521  6.540   53.323  1.00 43.26 ? 406 HIS C C   1 
ATOM   10405 O  O   . HIS C 1 392 ? 40.797  7.667   52.922  1.00 44.50 ? 406 HIS C O   1 
ATOM   10406 C  CB  . HIS C 1 392 ? 38.732  5.294   52.094  1.00 41.06 ? 406 HIS C CB  1 
ATOM   10407 C  CG  . HIS C 1 392 ? 38.034  6.613   52.004  1.00 45.99 ? 406 HIS C CG  1 
ATOM   10408 N  ND1 . HIS C 1 392 ? 38.093  7.413   50.881  1.00 50.73 ? 406 HIS C ND1 1 
ATOM   10409 C  CD2 . HIS C 1 392 ? 37.273  7.284   52.900  1.00 48.21 ? 406 HIS C CD2 1 
ATOM   10410 C  CE1 . HIS C 1 392 ? 37.388  8.509   51.086  1.00 52.66 ? 406 HIS C CE1 1 
ATOM   10411 N  NE2 . HIS C 1 392 ? 36.881  8.458   52.306  1.00 52.14 ? 406 HIS C NE2 1 
ATOM   10412 N  N   . ALA C 1 393 ? 40.443  6.238   54.614  1.00 43.41 ? 407 ALA C N   1 
ATOM   10413 C  CA  . ALA C 1 393 ? 40.768  7.217   55.648  1.00 39.79 ? 407 ALA C CA  1 
ATOM   10414 C  C   . ALA C 1 393 ? 42.259  7.545   55.616  1.00 47.52 ? 407 ALA C C   1 
ATOM   10415 O  O   . ALA C 1 393 ? 42.664  8.680   55.843  1.00 46.78 ? 407 ALA C O   1 
ATOM   10416 C  CB  . ALA C 1 393 ? 40.378  6.691   57.008  1.00 41.76 ? 407 ALA C CB  1 
ATOM   10417 N  N   . ARG C 1 394 ? 43.072  6.532   55.338  1.00 52.88 ? 408 ARG C N   1 
ATOM   10418 C  CA  . ARG C 1 394 ? 44.509  6.726   55.213  1.00 54.99 ? 408 ARG C CA  1 
ATOM   10419 C  C   . ARG C 1 394 ? 44.849  7.615   54.009  1.00 56.95 ? 408 ARG C C   1 
ATOM   10420 O  O   . ARG C 1 394 ? 45.705  8.492   54.100  1.00 63.30 ? 408 ARG C O   1 
ATOM   10421 C  CB  . ARG C 1 394 ? 45.223  5.371   55.111  1.00 49.78 ? 408 ARG C CB  1 
ATOM   10422 N  N   . SER C 1 395 ? 44.163  7.402   52.891  1.00 55.16 ? 409 SER C N   1 
ATOM   10423 C  CA  . SER C 1 395 ? 44.521  8.077   51.649  1.00 56.58 ? 409 SER C CA  1 
ATOM   10424 C  C   . SER C 1 395 ? 43.808  9.415   51.448  1.00 62.13 ? 409 SER C C   1 
ATOM   10425 O  O   . SER C 1 395 ? 44.260  10.248  50.666  1.00 68.41 ? 409 SER C O   1 
ATOM   10426 C  CB  . SER C 1 395 ? 44.294  7.158   50.442  1.00 59.18 ? 409 SER C CB  1 
ATOM   10427 O  OG  . SER C 1 395 ? 42.915  6.980   50.168  1.00 60.11 ? 409 SER C OG  1 
ATOM   10428 N  N   . SER C 1 396 ? 42.700  9.627   52.149  1.00 58.65 ? 410 SER C N   1 
ATOM   10429 C  CA  . SER C 1 396 ? 41.970  10.884  52.012  1.00 55.49 ? 410 SER C CA  1 
ATOM   10430 C  C   . SER C 1 396 ? 42.639  11.989  52.831  1.00 56.56 ? 410 SER C C   1 
ATOM   10431 O  O   . SER C 1 396 ? 43.133  11.735  53.934  1.00 50.31 ? 410 SER C O   1 
ATOM   10432 C  CB  . SER C 1 396 ? 40.508  10.718  52.420  1.00 53.52 ? 410 SER C CB  1 
ATOM   10433 O  OG  . SER C 1 396 ? 39.765  11.890  52.131  1.00 52.59 ? 410 SER C OG  1 
ATOM   10434 N  N   . PRO C 1 397 ? 42.671  13.217  52.276  1.00 65.62 ? 411 PRO C N   1 
ATOM   10435 C  CA  . PRO C 1 397 ? 43.338  14.380  52.876  1.00 66.09 ? 411 PRO C CA  1 
ATOM   10436 C  C   . PRO C 1 397 ? 42.530  14.976  54.019  1.00 58.87 ? 411 PRO C C   1 
ATOM   10437 O  O   . PRO C 1 397 ? 43.092  15.442  55.012  1.00 55.52 ? 411 PRO C O   1 
ATOM   10438 C  CB  . PRO C 1 397 ? 43.403  15.389  51.718  1.00 68.40 ? 411 PRO C CB  1 
ATOM   10439 C  CG  . PRO C 1 397 ? 43.032  14.618  50.479  1.00 68.81 ? 411 PRO C CG  1 
ATOM   10440 C  CD  . PRO C 1 397 ? 42.123  13.539  50.947  1.00 65.48 ? 411 PRO C CD  1 
ATOM   10441 N  N   . SER C 1 398 ? 41.213  14.961  53.873  1.00 52.41 ? 412 SER C N   1 
ATOM   10442 C  CA  . SER C 1 398 ? 40.334  15.478  54.906  1.00 51.41 ? 412 SER C CA  1 
ATOM   10443 C  C   . SER C 1 398 ? 40.252  14.513  56.089  1.00 48.54 ? 412 SER C C   1 
ATOM   10444 O  O   . SER C 1 398 ? 39.672  14.847  57.128  1.00 45.91 ? 412 SER C O   1 
ATOM   10445 C  CB  . SER C 1 398 ? 38.944  15.716  54.324  1.00 55.79 ? 412 SER C CB  1 
ATOM   10446 O  OG  . SER C 1 398 ? 38.486  14.549  53.668  1.00 59.29 ? 412 SER C OG  1 
ATOM   10447 N  N   . LEU C 1 399 ? 40.839  13.323  55.932  1.00 42.06 ? 413 LEU C N   1 
ATOM   10448 C  CA  . LEU C 1 399 ? 40.738  12.268  56.942  1.00 40.71 ? 413 LEU C CA  1 
ATOM   10449 C  C   . LEU C 1 399 ? 42.070  11.902  57.574  1.00 43.29 ? 413 LEU C C   1 
ATOM   10450 O  O   . LEU C 1 399 ? 43.077  11.743  56.880  1.00 51.05 ? 413 LEU C O   1 
ATOM   10451 C  CB  . LEU C 1 399 ? 40.128  11.004  56.337  1.00 36.98 ? 413 LEU C CB  1 
ATOM   10452 C  CG  . LEU C 1 399 ? 38.737  11.129  55.728  1.00 33.49 ? 413 LEU C CG  1 
ATOM   10453 C  CD1 . LEU C 1 399 ? 38.200  9.749   55.349  1.00 34.53 ? 413 LEU C CD1 1 
ATOM   10454 C  CD2 . LEU C 1 399 ? 37.828  11.824  56.715  1.00 31.90 ? 413 LEU C CD2 1 
ATOM   10455 N  N   . THR C 1 400 ? 42.063  11.755  58.895  1.00 38.87 ? 414 THR C N   1 
ATOM   10456 C  CA  . THR C 1 400 ? 43.247  11.308  59.619  1.00 43.16 ? 414 THR C CA  1 
ATOM   10457 C  C   . THR C 1 400 ? 42.928  10.255  60.683  1.00 42.21 ? 414 THR C C   1 
ATOM   10458 O  O   . THR C 1 400 ? 42.046  10.457  61.518  1.00 38.59 ? 414 THR C O   1 
ATOM   10459 C  CB  . THR C 1 400 ? 43.937  12.471  60.323  1.00 42.26 ? 414 THR C CB  1 
ATOM   10460 O  OG1 . THR C 1 400 ? 44.226  13.507  59.374  1.00 45.34 ? 414 THR C OG1 1 
ATOM   10461 C  CG2 . THR C 1 400 ? 45.217  11.977  60.978  1.00 40.10 ? 414 THR C CG2 1 
ATOM   10462 N  N   . ILE C 1 401 ? 43.665  9.143   60.669  1.00 37.31 ? 415 ILE C N   1 
ATOM   10463 C  CA  . ILE C 1 401 ? 43.467  8.099   61.672  1.00 40.54 ? 415 ILE C CA  1 
ATOM   10464 C  C   . ILE C 1 401 ? 44.141  8.470   62.996  1.00 41.46 ? 415 ILE C C   1 
ATOM   10465 O  O   . ILE C 1 401 ? 45.336  8.755   63.034  1.00 44.05 ? 415 ILE C O   1 
ATOM   10466 C  CB  . ILE C 1 401 ? 44.000  6.734   61.184  1.00 36.12 ? 415 ILE C CB  1 
ATOM   10467 C  CG1 . ILE C 1 401 ? 43.308  6.332   59.881  1.00 35.88 ? 415 ILE C CG1 1 
ATOM   10468 C  CG2 . ILE C 1 401 ? 43.824  5.680   62.262  1.00 35.72 ? 415 ILE C CG2 1 
ATOM   10469 C  CD1 . ILE C 1 401 ? 43.700  4.933   59.388  1.00 40.05 ? 415 ILE C CD1 1 
ATOM   10470 N  N   . LEU C 1 402 ? 43.375  8.456   64.081  1.00 36.96 ? 416 LEU C N   1 
ATOM   10471 C  CA  . LEU C 1 402 ? 43.879  8.921   65.367  1.00 39.30 ? 416 LEU C CA  1 
ATOM   10472 C  C   . LEU C 1 402 ? 44.339  7.761   66.229  1.00 39.63 ? 416 LEU C C   1 
ATOM   10473 O  O   . LEU C 1 402 ? 45.272  7.887   67.027  1.00 35.05 ? 416 LEU C O   1 
ATOM   10474 C  CB  . LEU C 1 402 ? 42.798  9.695   66.115  1.00 41.19 ? 416 LEU C CB  1 
ATOM   10475 C  CG  . LEU C 1 402 ? 42.286  10.998  65.497  1.00 37.22 ? 416 LEU C CG  1 
ATOM   10476 C  CD1 . LEU C 1 402 ? 41.252  11.606  66.426  1.00 35.49 ? 416 LEU C CD1 1 
ATOM   10477 C  CD2 . LEU C 1 402 ? 43.438  11.974  65.261  1.00 38.63 ? 416 LEU C CD2 1 
ATOM   10478 N  N   . ALA C 1 403 ? 43.653  6.637   66.067  1.00 33.92 ? 417 ALA C N   1 
ATOM   10479 C  CA  . ALA C 1 403 ? 43.922  5.426   66.825  1.00 36.75 ? 417 ALA C CA  1 
ATOM   10480 C  C   . ALA C 1 403 ? 43.467  4.237   66.002  1.00 37.97 ? 417 ALA C C   1 
ATOM   10481 O  O   . ALA C 1 403 ? 42.526  4.339   65.217  1.00 33.58 ? 417 ALA C O   1 
ATOM   10482 C  CB  . ALA C 1 403 ? 43.194  5.457   68.155  1.00 35.10 ? 417 ALA C CB  1 
ATOM   10483 N  N   . GLY C 1 404 ? 44.135  3.106   66.181  1.00 36.16 ? 418 GLY C N   1 
ATOM   10484 C  CA  . GLY C 1 404 ? 43.808  1.913   65.431  1.00 35.57 ? 418 GLY C CA  1 
ATOM   10485 C  C   . GLY C 1 404 ? 44.224  2.026   63.977  1.00 38.37 ? 418 GLY C C   1 
ATOM   10486 O  O   . GLY C 1 404 ? 45.148  2.761   63.637  1.00 36.00 ? 418 GLY C O   1 
ATOM   10487 N  N   . GLY C 1 405 ? 43.538  1.288   63.114  1.00 35.49 ? 419 GLY C N   1 
ATOM   10488 C  CA  . GLY C 1 405 ? 43.832  1.331   61.695  1.00 36.78 ? 419 GLY C CA  1 
ATOM   10489 C  C   . GLY C 1 405 ? 44.393  0.023   61.166  1.00 41.09 ? 419 GLY C C   1 
ATOM   10490 O  O   . GLY C 1 405 ? 44.401  -0.207  59.953  1.00 43.87 ? 419 GLY C O   1 
ATOM   10491 N  N   . LYS C 1 406 ? 44.863  -0.837  62.068  1.00 38.13 ? 420 LYS C N   1 
ATOM   10492 C  CA  . LYS C 1 406 ? 45.373  -2.147  61.667  1.00 36.30 ? 420 LYS C CA  1 
ATOM   10493 C  C   . LYS C 1 406 ? 44.267  -3.208  61.636  1.00 37.36 ? 420 LYS C C   1 
ATOM   10494 O  O   . LYS C 1 406 ? 43.295  -3.146  62.394  1.00 30.13 ? 420 LYS C O   1 
ATOM   10495 C  CB  . LYS C 1 406 ? 46.517  -2.595  62.577  1.00 36.06 ? 420 LYS C CB  1 
ATOM   10496 N  N   . CYS C 1 407 ? 44.424  -4.167  60.730  1.00 36.79 ? 421 CYS C N   1 
ATOM   10497 C  CA  . CYS C 1 407 ? 43.560  -5.333  60.663  1.00 33.14 ? 421 CYS C CA  1 
ATOM   10498 C  C   . CYS C 1 407 ? 44.369  -6.501  60.101  1.00 39.66 ? 421 CYS C C   1 
ATOM   10499 O  O   . CYS C 1 407 ? 45.289  -6.298  59.306  1.00 38.98 ? 421 CYS C O   1 
ATOM   10500 C  CB  . CYS C 1 407 ? 42.360  -5.040  59.773  1.00 39.15 ? 421 CYS C CB  1 
ATOM   10501 S  SG  . CYS C 1 407 ? 42.825  -4.517  58.117  1.00 46.19 ? 421 CYS C SG  1 
ATOM   10502 N  N   . ASP C 1 408 ? 44.027  -7.718  60.518  1.00 41.25 ? 422 ASP C N   1 
ATOM   10503 C  CA  . ASP C 1 408 ? 44.746  -8.921  60.097  1.00 37.82 ? 422 ASP C CA  1 
ATOM   10504 C  C   . ASP C 1 408 ? 43.811  -10.132 60.010  1.00 35.38 ? 422 ASP C C   1 
ATOM   10505 O  O   . ASP C 1 408 ? 43.221  -10.533 61.015  1.00 29.97 ? 422 ASP C O   1 
ATOM   10506 C  CB  . ASP C 1 408 ? 45.870  -9.219  61.081  1.00 38.73 ? 422 ASP C CB  1 
ATOM   10507 C  CG  . ASP C 1 408 ? 46.728  -10.377 60.640  1.00 49.10 ? 422 ASP C CG  1 
ATOM   10508 O  OD1 . ASP C 1 408 ? 46.709  -10.702 59.434  1.00 52.65 ? 422 ASP C OD1 1 
ATOM   10509 O  OD2 . ASP C 1 408 ? 47.418  -10.958 61.496  1.00 53.23 ? 422 ASP C OD2 1 
ATOM   10510 N  N   . ASP C 1 409 ? 43.680  -10.708 58.815  1.00 33.35 ? 423 ASP C N   1 
ATOM   10511 C  CA  . ASP C 1 409 ? 42.747  -11.812 58.588  1.00 29.38 ? 423 ASP C CA  1 
ATOM   10512 C  C   . ASP C 1 409 ? 43.421  -13.199 58.528  1.00 35.42 ? 423 ASP C C   1 
ATOM   10513 O  O   . ASP C 1 409 ? 42.864  -14.154 57.980  1.00 35.94 ? 423 ASP C O   1 
ATOM   10514 C  CB  . ASP C 1 409 ? 41.886  -11.553 57.332  1.00 29.36 ? 423 ASP C CB  1 
ATOM   10515 C  CG  . ASP C 1 409 ? 42.691  -11.619 56.037  1.00 38.61 ? 423 ASP C CG  1 
ATOM   10516 O  OD1 . ASP C 1 409 ? 43.940  -11.550 56.089  1.00 43.59 ? 423 ASP C OD1 1 
ATOM   10517 O  OD2 . ASP C 1 409 ? 42.069  -11.736 54.963  1.00 40.17 ? 423 ASP C OD2 1 
ATOM   10518 N  N   . SER C 1 410 ? 44.602  -13.320 59.118  1.00 33.52 ? 424 SER C N   1 
ATOM   10519 C  CA  . SER C 1 410 ? 45.338  -14.577 59.028  1.00 38.81 ? 424 SER C CA  1 
ATOM   10520 C  C   . SER C 1 410 ? 44.675  -15.714 59.822  1.00 36.84 ? 424 SER C C   1 
ATOM   10521 O  O   . SER C 1 410 ? 44.683  -16.857 59.383  1.00 36.51 ? 424 SER C O   1 
ATOM   10522 C  CB  . SER C 1 410 ? 46.810  -14.391 59.421  1.00 44.90 ? 424 SER C CB  1 
ATOM   10523 O  OG  . SER C 1 410 ? 46.957  -14.127 60.805  1.00 48.39 ? 424 SER C OG  1 
ATOM   10524 N  N   . VAL C 1 411 ? 44.081  -15.390 60.969  1.00 27.51 ? 425 VAL C N   1 
ATOM   10525 C  CA  . VAL C 1 411 ? 43.426  -16.386 61.816  1.00 27.31 ? 425 VAL C CA  1 
ATOM   10526 C  C   . VAL C 1 411 ? 41.921  -16.126 61.915  1.00 30.90 ? 425 VAL C C   1 
ATOM   10527 O  O   . VAL C 1 411 ? 41.089  -17.011 61.646  1.00 24.34 ? 425 VAL C O   1 
ATOM   10528 C  CB  . VAL C 1 411 ? 44.042  -16.377 63.229  1.00 31.56 ? 425 VAL C CB  1 
ATOM   10529 C  CG1 . VAL C 1 411 ? 43.186  -17.181 64.201  1.00 32.32 ? 425 VAL C CG1 1 
ATOM   10530 C  CG2 . VAL C 1 411 ? 45.466  -16.910 63.173  1.00 39.63 ? 425 VAL C CG2 1 
ATOM   10531 N  N   . GLY C 1 412 ? 41.578  -14.898 62.291  1.00 25.38 ? 426 GLY C N   1 
ATOM   10532 C  CA  . GLY C 1 412 ? 40.193  -14.462 62.299  1.00 27.38 ? 426 GLY C CA  1 
ATOM   10533 C  C   . GLY C 1 412 ? 40.082  -13.148 61.548  1.00 25.83 ? 426 GLY C C   1 
ATOM   10534 O  O   . GLY C 1 412 ? 41.083  -12.609 61.079  1.00 30.58 ? 426 GLY C O   1 
ATOM   10535 N  N   . TYR C 1 413 ? 38.868  -12.628 61.431  1.00 24.37 ? 427 TYR C N   1 
ATOM   10536 C  CA  . TYR C 1 413 ? 38.648  -11.352 60.761  1.00 30.58 ? 427 TYR C CA  1 
ATOM   10537 C  C   . TYR C 1 413 ? 38.866  -10.204 61.749  1.00 26.25 ? 427 TYR C C   1 
ATOM   10538 O  O   . TYR C 1 413 ? 37.932  -9.500  62.147  1.00 23.30 ? 427 TYR C O   1 
ATOM   10539 C  CB  . TYR C 1 413 ? 37.251  -11.326 60.146  1.00 27.16 ? 427 TYR C CB  1 
ATOM   10540 C  CG  . TYR C 1 413 ? 37.045  -12.492 59.204  1.00 25.10 ? 427 TYR C CG  1 
ATOM   10541 C  CD1 . TYR C 1 413 ? 37.802  -12.608 58.049  1.00 31.54 ? 427 TYR C CD1 1 
ATOM   10542 C  CD2 . TYR C 1 413 ? 36.112  -13.473 59.472  1.00 21.27 ? 427 TYR C CD2 1 
ATOM   10543 C  CE1 . TYR C 1 413 ? 37.636  -13.664 57.191  1.00 30.02 ? 427 TYR C CE1 1 
ATOM   10544 C  CE2 . TYR C 1 413 ? 35.930  -14.536 58.615  1.00 25.16 ? 427 TYR C CE2 1 
ATOM   10545 C  CZ  . TYR C 1 413 ? 36.699  -14.625 57.477  1.00 26.49 ? 427 TYR C CZ  1 
ATOM   10546 O  OH  . TYR C 1 413 ? 36.540  -15.674 56.615  1.00 26.58 ? 427 TYR C OH  1 
ATOM   10547 N  N   . PHE C 1 414 ? 40.118  -10.044 62.153  1.00 25.63 ? 428 PHE C N   1 
ATOM   10548 C  CA  . PHE C 1 414 ? 40.467  -9.158  63.244  1.00 22.49 ? 428 PHE C CA  1 
ATOM   10549 C  C   . PHE C 1 414 ? 40.778  -7.749  62.793  1.00 24.34 ? 428 PHE C C   1 
ATOM   10550 O  O   . PHE C 1 414 ? 41.648  -7.536  61.950  1.00 25.52 ? 428 PHE C O   1 
ATOM   10551 C  CB  . PHE C 1 414 ? 41.615  -9.748  64.058  1.00 24.92 ? 428 PHE C CB  1 
ATOM   10552 C  CG  . PHE C 1 414 ? 41.166  -10.779 65.047  1.00 29.08 ? 428 PHE C CG  1 
ATOM   10553 C  CD1 . PHE C 1 414 ? 40.432  -10.406 66.165  1.00 24.31 ? 428 PHE C CD1 1 
ATOM   10554 C  CD2 . PHE C 1 414 ? 41.446  -12.125 64.848  1.00 29.41 ? 428 PHE C CD2 1 
ATOM   10555 C  CE1 . PHE C 1 414 ? 40.008  -11.355 67.085  1.00 23.58 ? 428 PHE C CE1 1 
ATOM   10556 C  CE2 . PHE C 1 414 ? 41.025  -13.072 65.756  1.00 24.89 ? 428 PHE C CE2 1 
ATOM   10557 C  CZ  . PHE C 1 414 ? 40.310  -12.694 66.875  1.00 26.11 ? 428 PHE C CZ  1 
ATOM   10558 N  N   . VAL C 1 415 ? 40.030  -6.798  63.344  1.00 21.21 ? 429 VAL C N   1 
ATOM   10559 C  CA  . VAL C 1 415 ? 40.209  -5.383  63.039  1.00 23.06 ? 429 VAL C CA  1 
ATOM   10560 C  C   . VAL C 1 415 ? 40.346  -4.592  64.333  1.00 23.00 ? 429 VAL C C   1 
ATOM   10561 O  O   . VAL C 1 415 ? 39.502  -4.717  65.222  1.00 26.58 ? 429 VAL C O   1 
ATOM   10562 C  CB  . VAL C 1 415 ? 39.002  -4.810  62.283  1.00 24.82 ? 429 VAL C CB  1 
ATOM   10563 C  CG1 . VAL C 1 415 ? 39.228  -3.343  61.985  1.00 28.91 ? 429 VAL C CG1 1 
ATOM   10564 C  CG2 . VAL C 1 415 ? 38.729  -5.601  61.000  1.00 28.18 ? 429 VAL C CG2 1 
ATOM   10565 N  N   . GLU C 1 416 ? 41.403  -3.788  64.446  1.00 21.50 ? 430 GLU C N   1 
ATOM   10566 C  CA  . GLU C 1 416 ? 41.561  -2.905  65.592  1.00 25.97 ? 430 GLU C CA  1 
ATOM   10567 C  C   . GLU C 1 416 ? 40.402  -1.915  65.605  1.00 25.79 ? 430 GLU C C   1 
ATOM   10568 O  O   . GLU C 1 416 ? 39.927  -1.515  64.549  1.00 30.98 ? 430 GLU C O   1 
ATOM   10569 C  CB  . GLU C 1 416 ? 42.833  -2.085  65.459  1.00 32.10 ? 430 GLU C CB  1 
ATOM   10570 C  CG  . GLU C 1 416 ? 44.107  -2.769  65.883  1.00 43.72 ? 430 GLU C CG  1 
ATOM   10571 C  CD  . GLU C 1 416 ? 45.218  -1.755  66.065  1.00 48.76 ? 430 GLU C CD  1 
ATOM   10572 O  OE1 . GLU C 1 416 ? 45.378  -0.889  65.173  1.00 46.83 ? 430 GLU C OE1 1 
ATOM   10573 O  OE2 . GLU C 1 416 ? 45.895  -1.796  67.112  1.00 52.05 ? 430 GLU C OE2 1 
ATOM   10574 N  N   . PRO C 1 417 ? 39.948  -1.517  66.798  1.00 21.58 ? 431 PRO C N   1 
ATOM   10575 C  CA  . PRO C 1 417 ? 39.001  -0.403  66.807  1.00 25.31 ? 431 PRO C CA  1 
ATOM   10576 C  C   . PRO C 1 417 ? 39.712  0.821   66.259  1.00 30.90 ? 431 PRO C C   1 
ATOM   10577 O  O   . PRO C 1 417 ? 40.865  1.085   66.601  1.00 26.56 ? 431 PRO C O   1 
ATOM   10578 C  CB  . PRO C 1 417 ? 38.670  -0.226  68.288  1.00 26.63 ? 431 PRO C CB  1 
ATOM   10579 C  CG  . PRO C 1 417 ? 39.855  -0.811  69.025  1.00 26.86 ? 431 PRO C CG  1 
ATOM   10580 C  CD  . PRO C 1 417 ? 40.329  -1.952  68.156  1.00 22.29 ? 431 PRO C CD  1 
ATOM   10581 N  N   . CYS C 1 418 ? 39.030  1.553   65.392  1.00 28.79 ? 432 CYS C N   1 
ATOM   10582 C  CA  . CYS C 1 418 ? 39.655  2.667   64.714  1.00 29.87 ? 432 CYS C CA  1 
ATOM   10583 C  C   . CYS C 1 418 ? 38.902  3.963   64.966  1.00 32.77 ? 432 CYS C C   1 
ATOM   10584 O  O   . CYS C 1 418 ? 37.675  4.006   64.916  1.00 27.29 ? 432 CYS C O   1 
ATOM   10585 C  CB  . CYS C 1 418 ? 39.741  2.396   63.213  1.00 30.55 ? 432 CYS C CB  1 
ATOM   10586 S  SG  . CYS C 1 418 ? 40.648  3.668   62.303  1.00 35.13 ? 432 CYS C SG  1 
ATOM   10587 N  N   . ILE C 1 419 ? 39.650  5.019   65.246  1.00 30.87 ? 433 ILE C N   1 
ATOM   10588 C  CA  . ILE C 1 419 ? 39.061  6.335   65.407  1.00 29.30 ? 433 ILE C CA  1 
ATOM   10589 C  C   . ILE C 1 419 ? 39.628  7.224   64.316  1.00 31.76 ? 433 ILE C C   1 
ATOM   10590 O  O   . ILE C 1 419 ? 40.851  7.383   64.213  1.00 31.56 ? 433 ILE C O   1 
ATOM   10591 C  CB  . ILE C 1 419 ? 39.402  6.943   66.772  1.00 28.52 ? 433 ILE C CB  1 
ATOM   10592 C  CG1 . ILE C 1 419 ? 38.892  6.040   67.904  1.00 31.62 ? 433 ILE C CG1 1 
ATOM   10593 C  CG2 . ILE C 1 419 ? 38.803  8.344   66.873  1.00 30.04 ? 433 ILE C CG2 1 
ATOM   10594 C  CD1 . ILE C 1 419 ? 39.080  6.637   69.303  1.00 32.55 ? 433 ILE C CD1 1 
ATOM   10595 N  N   . VAL C 1 420 ? 38.742  7.791   63.500  1.00 30.63 ? 434 VAL C N   1 
ATOM   10596 C  CA  . VAL C 1 420 ? 39.149  8.643   62.383  1.00 32.72 ? 434 VAL C CA  1 
ATOM   10597 C  C   . VAL C 1 420 ? 38.638  10.061  62.574  1.00 33.83 ? 434 VAL C C   1 
ATOM   10598 O  O   . VAL C 1 420 ? 37.450  10.249  62.829  1.00 33.12 ? 434 VAL C O   1 
ATOM   10599 C  CB  . VAL C 1 420 ? 38.563  8.112   61.054  1.00 33.27 ? 434 VAL C CB  1 
ATOM   10600 C  CG1 . VAL C 1 420 ? 39.024  8.953   59.890  1.00 27.97 ? 434 VAL C CG1 1 
ATOM   10601 C  CG2 . VAL C 1 420 ? 38.954  6.650   60.838  1.00 34.26 ? 434 VAL C CG2 1 
ATOM   10602 N  N   . GLU C 1 421 ? 39.516  11.059  62.454  1.00 31.00 ? 435 GLU C N   1 
ATOM   10603 C  CA  . GLU C 1 421 ? 39.054  12.449  62.434  1.00 30.55 ? 435 GLU C CA  1 
ATOM   10604 C  C   . GLU C 1 421 ? 38.796  12.930  61.007  1.00 34.95 ? 435 GLU C C   1 
ATOM   10605 O  O   . GLU C 1 421 ? 39.633  12.748  60.123  1.00 39.34 ? 435 GLU C O   1 
ATOM   10606 C  CB  . GLU C 1 421 ? 40.030  13.405  63.129  1.00 30.06 ? 435 GLU C CB  1 
ATOM   10607 C  CG  . GLU C 1 421 ? 39.476  14.825  63.184  1.00 37.00 ? 435 GLU C CG  1 
ATOM   10608 C  CD  . GLU C 1 421 ? 40.354  15.782  63.964  1.00 38.92 ? 435 GLU C CD  1 
ATOM   10609 O  OE1 . GLU C 1 421 ? 41.451  15.378  64.398  1.00 43.39 ? 435 GLU C OE1 1 
ATOM   10610 O  OE2 . GLU C 1 421 ? 39.935  16.949  64.147  1.00 35.40 ? 435 GLU C OE2 1 
ATOM   10611 N  N   . SER C 1 422 ? 37.631  13.535  60.790  1.00 31.85 ? 436 SER C N   1 
ATOM   10612 C  CA  . SER C 1 422 ? 37.323  14.180  59.522  1.00 32.68 ? 436 SER C CA  1 
ATOM   10613 C  C   . SER C 1 422 ? 37.268  15.702  59.664  1.00 40.52 ? 436 SER C C   1 
ATOM   10614 O  O   . SER C 1 422 ? 36.625  16.221  60.576  1.00 33.44 ? 436 SER C O   1 
ATOM   10615 C  CB  . SER C 1 422 ? 35.976  13.708  58.992  1.00 38.46 ? 436 SER C CB  1 
ATOM   10616 O  OG  . SER C 1 422 ? 35.619  14.450  57.837  1.00 36.53 ? 436 SER C OG  1 
ATOM   10617 N  N   . LYS C 1 423 ? 37.924  16.410  58.747  1.00 44.65 ? 437 LYS C N   1 
ATOM   10618 C  CA  . LYS C 1 423 ? 37.847  17.871  58.708  1.00 47.40 ? 437 LYS C CA  1 
ATOM   10619 C  C   . LYS C 1 423 ? 36.654  18.311  57.872  1.00 46.37 ? 437 LYS C C   1 
ATOM   10620 O  O   . LYS C 1 423 ? 36.322  19.490  57.815  1.00 52.64 ? 437 LYS C O   1 
ATOM   10621 C  CB  . LYS C 1 423 ? 39.133  18.475  58.145  1.00 50.21 ? 437 LYS C CB  1 
ATOM   10622 C  CG  . LYS C 1 423 ? 40.058  19.052  59.202  1.00 52.38 ? 437 LYS C CG  1 
ATOM   10623 C  CD  . LYS C 1 423 ? 40.632  17.972  60.102  1.00 48.28 ? 437 LYS C CD  1 
ATOM   10624 C  CE  . LYS C 1 423 ? 41.430  18.581  61.246  1.00 51.15 ? 437 LYS C CE  1 
ATOM   10625 N  NZ  . LYS C 1 423 ? 42.390  17.599  61.825  1.00 52.48 ? 437 LYS C NZ  1 
ATOM   10626 N  N   . ASP C 1 424 ? 36.016  17.349  57.217  1.00 42.35 ? 438 ASP C N   1 
ATOM   10627 C  CA  . ASP C 1 424 ? 34.850  17.632  56.402  1.00 43.93 ? 438 ASP C CA  1 
ATOM   10628 C  C   . ASP C 1 424 ? 33.636  16.869  56.938  1.00 37.73 ? 438 ASP C C   1 
ATOM   10629 O  O   . ASP C 1 424 ? 33.610  15.633  56.944  1.00 34.03 ? 438 ASP C O   1 
ATOM   10630 C  CB  . ASP C 1 424 ? 35.123  17.286  54.934  1.00 47.04 ? 438 ASP C CB  1 
ATOM   10631 C  CG  . ASP C 1 424 ? 33.925  17.537  54.036  1.00 50.86 ? 438 ASP C CG  1 
ATOM   10632 O  OD1 . ASP C 1 424 ? 32.959  18.195  54.482  1.00 53.08 ? 438 ASP C OD1 1 
ATOM   10633 O  OD2 . ASP C 1 424 ? 33.953  17.081  52.872  1.00 50.29 ? 438 ASP C OD2 1 
ATOM   10634 N  N   . PRO C 1 425 ? 32.625  17.616  57.399  1.00 39.63 ? 439 PRO C N   1 
ATOM   10635 C  CA  . PRO C 1 425 ? 31.410  16.995  57.937  1.00 34.05 ? 439 PRO C CA  1 
ATOM   10636 C  C   . PRO C 1 425 ? 30.540  16.356  56.850  1.00 40.74 ? 439 PRO C C   1 
ATOM   10637 O  O   . PRO C 1 425 ? 29.589  15.648  57.171  1.00 37.52 ? 439 PRO C O   1 
ATOM   10638 C  CB  . PRO C 1 425 ? 30.697  18.157  58.630  1.00 30.44 ? 439 PRO C CB  1 
ATOM   10639 C  CG  . PRO C 1 425 ? 31.200  19.402  57.919  1.00 40.81 ? 439 PRO C CG  1 
ATOM   10640 C  CD  . PRO C 1 425 ? 32.627  19.086  57.538  1.00 37.38 ? 439 PRO C CD  1 
ATOM   10641 N  N   . GLN C 1 426 ? 30.879  16.588  55.585  1.00 44.11 ? 440 GLN C N   1 
ATOM   10642 C  CA  . GLN C 1 426 ? 30.162  15.977  54.467  1.00 42.46 ? 440 GLN C CA  1 
ATOM   10643 C  C   . GLN C 1 426 ? 30.955  14.821  53.851  1.00 34.85 ? 440 GLN C C   1 
ATOM   10644 O  O   . GLN C 1 426 ? 30.527  14.233  52.859  1.00 38.10 ? 440 GLN C O   1 
ATOM   10645 C  CB  . GLN C 1 426 ? 29.852  17.017  53.381  1.00 47.45 ? 440 GLN C CB  1 
ATOM   10646 C  CG  . GLN C 1 426 ? 29.128  18.267  53.867  1.00 54.58 ? 440 GLN C CG  1 
ATOM   10647 C  CD  . GLN C 1 426 ? 27.639  18.054  54.072  1.00 57.52 ? 440 GLN C CD  1 
ATOM   10648 O  OE1 . GLN C 1 426 ? 27.094  17.005  53.719  1.00 62.35 ? 440 GLN C OE1 1 
ATOM   10649 N  NE2 . GLN C 1 426 ? 26.971  19.052  54.643  1.00 51.46 ? 440 GLN C NE2 1 
ATOM   10650 N  N   . GLU C 1 427 ? 32.111  14.506  54.427  1.00 30.50 ? 441 GLU C N   1 
ATOM   10651 C  CA  . GLU C 1 427 ? 32.935  13.412  53.918  1.00 35.61 ? 441 GLU C CA  1 
ATOM   10652 C  C   . GLU C 1 427 ? 32.112  12.131  53.933  1.00 37.27 ? 441 GLU C C   1 
ATOM   10653 O  O   . GLU C 1 427 ? 31.384  11.880  54.884  1.00 42.79 ? 441 GLU C O   1 
ATOM   10654 C  CB  . GLU C 1 427 ? 34.193  13.232  54.770  1.00 39.08 ? 441 GLU C CB  1 
ATOM   10655 C  CG  . GLU C 1 427 ? 35.484  13.066  53.973  1.00 40.80 ? 441 GLU C CG  1 
ATOM   10656 C  CD  . GLU C 1 427 ? 35.711  11.657  53.452  1.00 44.73 ? 441 GLU C CD  1 
ATOM   10657 O  OE1 . GLU C 1 427 ? 35.198  10.679  54.053  1.00 42.98 ? 441 GLU C OE1 1 
ATOM   10658 O  OE2 . GLU C 1 427 ? 36.426  11.528  52.436  1.00 41.78 ? 441 GLU C OE2 1 
ATOM   10659 N  N   . PRO C 1 428 ? 32.187  11.349  52.851  1.00 36.97 ? 442 PRO C N   1 
ATOM   10660 C  CA  . PRO C 1 428 ? 31.521  10.043  52.748  1.00 39.35 ? 442 PRO C CA  1 
ATOM   10661 C  C   . PRO C 1 428 ? 31.606  9.180   54.023  1.00 34.75 ? 442 PRO C C   1 
ATOM   10662 O  O   . PRO C 1 428 ? 30.641  8.471   54.334  1.00 31.70 ? 442 PRO C O   1 
ATOM   10663 C  CB  . PRO C 1 428 ? 32.253  9.368   51.577  1.00 41.70 ? 442 PRO C CB  1 
ATOM   10664 C  CG  . PRO C 1 428 ? 33.033  10.503  50.860  1.00 38.85 ? 442 PRO C CG  1 
ATOM   10665 C  CD  . PRO C 1 428 ? 32.712  11.796  51.549  1.00 34.94 ? 442 PRO C CD  1 
ATOM   10666 N  N   . ILE C 1 429 ? 32.719  9.251   54.751  1.00 30.55 ? 443 ILE C N   1 
ATOM   10667 C  CA  . ILE C 1 429 ? 32.870  8.471   55.981  1.00 29.04 ? 443 ILE C CA  1 
ATOM   10668 C  C   . ILE C 1 429 ? 31.939  8.956   57.119  1.00 31.50 ? 443 ILE C C   1 
ATOM   10669 O  O   . ILE C 1 429 ? 31.713  8.245   58.095  1.00 30.91 ? 443 ILE C O   1 
ATOM   10670 C  CB  . ILE C 1 429 ? 34.352  8.373   56.445  1.00 26.60 ? 443 ILE C CB  1 
ATOM   10671 C  CG1 . ILE C 1 429 ? 34.561  7.129   57.314  1.00 26.90 ? 443 ILE C CG1 1 
ATOM   10672 C  CG2 . ILE C 1 429 ? 34.809  9.653   57.175  1.00 23.47 ? 443 ILE C CG2 1 
ATOM   10673 C  CD1 . ILE C 1 429 ? 36.022  6.814   57.610  1.00 23.03 ? 443 ILE C CD1 1 
ATOM   10674 N  N   . MET C 1 430 ? 31.366  10.146  56.972  1.00 29.62 ? 444 MET C N   1 
ATOM   10675 C  CA  . MET C 1 430 ? 30.425  10.655  57.971  1.00 28.77 ? 444 MET C CA  1 
ATOM   10676 C  C   . MET C 1 430 ? 28.992  10.319  57.574  1.00 30.96 ? 444 MET C C   1 
ATOM   10677 O  O   . MET C 1 430 ? 28.040  10.589  58.316  1.00 32.25 ? 444 MET C O   1 
ATOM   10678 C  CB  . MET C 1 430 ? 30.563  12.177  58.115  1.00 31.87 ? 444 MET C CB  1 
ATOM   10679 C  CG  . MET C 1 430 ? 31.935  12.644  58.569  1.00 29.72 ? 444 MET C CG  1 
ATOM   10680 S  SD  . MET C 1 430 ? 32.187  12.541  60.349  1.00 36.19 ? 444 MET C SD  1 
ATOM   10681 C  CE  . MET C 1 430 ? 30.884  13.636  60.927  1.00 25.47 ? 444 MET C CE  1 
ATOM   10682 N  N   . LYS C 1 431 ? 28.839  9.735   56.396  1.00 31.33 ? 445 LYS C N   1 
ATOM   10683 C  CA  . LYS C 1 431 ? 27.513  9.495   55.845  1.00 34.41 ? 445 LYS C CA  1 
ATOM   10684 C  C   . LYS C 1 431 ? 27.195  8.022   55.602  1.00 37.24 ? 445 LYS C C   1 
ATOM   10685 O  O   . LYS C 1 431 ? 26.032  7.610   55.678  1.00 38.70 ? 445 LYS C O   1 
ATOM   10686 C  CB  . LYS C 1 431 ? 27.350  10.276  54.535  1.00 37.59 ? 445 LYS C CB  1 
ATOM   10687 C  CG  . LYS C 1 431 ? 27.313  11.783  54.721  1.00 38.41 ? 445 LYS C CG  1 
ATOM   10688 C  CD  . LYS C 1 431 ? 27.334  12.505  53.384  1.00 39.59 ? 445 LYS C CD  1 
ATOM   10689 C  CE  . LYS C 1 431 ? 26.573  13.809  53.472  1.00 45.92 ? 445 LYS C CE  1 
ATOM   10690 N  NZ  . LYS C 1 431 ? 26.361  14.383  52.118  1.00 55.55 ? 445 LYS C NZ  1 
ATOM   10691 N  N   . GLU C 1 432 ? 28.213  7.228   55.290  1.00 33.98 ? 446 GLU C N   1 
ATOM   10692 C  CA  . GLU C 1 432 ? 27.958  5.856   54.874  1.00 29.62 ? 446 GLU C CA  1 
ATOM   10693 C  C   . GLU C 1 432 ? 28.148  4.868   56.012  1.00 35.09 ? 446 GLU C C   1 
ATOM   10694 O  O   . GLU C 1 432 ? 29.085  4.991   56.800  1.00 37.08 ? 446 GLU C O   1 
ATOM   10695 C  CB  . GLU C 1 432 ? 28.832  5.491   53.677  1.00 28.89 ? 446 GLU C CB  1 
ATOM   10696 C  CG  . GLU C 1 432 ? 28.765  6.531   52.565  1.00 45.37 ? 446 GLU C CG  1 
ATOM   10697 C  CD  . GLU C 1 432 ? 29.355  6.036   51.264  1.00 55.75 ? 446 GLU C CD  1 
ATOM   10698 O  OE1 . GLU C 1 432 ? 29.563  4.812   51.133  1.00 58.21 ? 446 GLU C OE1 1 
ATOM   10699 O  OE2 . GLU C 1 432 ? 29.610  6.873   50.372  1.00 60.70 ? 446 GLU C OE2 1 
ATOM   10700 N  N   . GLU C 1 433 ? 27.242  3.899   56.100  1.00 32.35 ? 447 GLU C N   1 
ATOM   10701 C  CA  . GLU C 1 433 ? 27.328  2.864   57.121  1.00 33.01 ? 447 GLU C CA  1 
ATOM   10702 C  C   . GLU C 1 433 ? 28.467  1.916   56.814  1.00 32.57 ? 447 GLU C C   1 
ATOM   10703 O  O   . GLU C 1 433 ? 28.543  1.348   55.725  1.00 32.66 ? 447 GLU C O   1 
ATOM   10704 C  CB  . GLU C 1 433 ? 26.018  2.082   57.228  1.00 34.21 ? 447 GLU C CB  1 
ATOM   10705 N  N   . ILE C 1 434 ? 29.360  1.747   57.783  1.00 26.80 ? 448 ILE C N   1 
ATOM   10706 C  CA  . ILE C 1 434 ? 30.474  0.823   57.637  1.00 24.10 ? 448 ILE C CA  1 
ATOM   10707 C  C   . ILE C 1 434 ? 30.146  -0.517  58.303  1.00 28.01 ? 448 ILE C C   1 
ATOM   10708 O  O   . ILE C 1 434 ? 30.613  -1.572  57.865  1.00 28.52 ? 448 ILE C O   1 
ATOM   10709 C  CB  . ILE C 1 434 ? 31.766  1.421   58.230  1.00 26.34 ? 448 ILE C CB  1 
ATOM   10710 C  CG1 . ILE C 1 434 ? 32.127  2.719   57.496  1.00 29.71 ? 448 ILE C CG1 1 
ATOM   10711 C  CG2 . ILE C 1 434 ? 32.929  0.433   58.136  1.00 30.60 ? 448 ILE C CG2 1 
ATOM   10712 C  CD1 . ILE C 1 434 ? 33.152  3.563   58.192  1.00 33.95 ? 448 ILE C CD1 1 
ATOM   10713 N  N   . PHE C 1 435 ? 29.329  -0.446  59.351  1.00 23.66 ? 449 PHE C N   1 
ATOM   10714 C  CA  . PHE C 1 435 ? 28.929  -1.593  60.163  1.00 29.11 ? 449 PHE C CA  1 
ATOM   10715 C  C   . PHE C 1 435 ? 30.149  -2.342  60.681  1.00 30.04 ? 449 PHE C C   1 
ATOM   10716 O  O   . PHE C 1 435 ? 30.250  -3.569  60.570  1.00 27.33 ? 449 PHE C O   1 
ATOM   10717 C  CB  . PHE C 1 435 ? 27.957  -2.516  59.407  1.00 30.33 ? 449 PHE C CB  1 
ATOM   10718 C  CG  . PHE C 1 435 ? 26.951  -3.205  60.301  1.00 36.62 ? 449 PHE C CG  1 
ATOM   10719 C  CD1 . PHE C 1 435 ? 26.920  -4.599  60.399  1.00 37.40 ? 449 PHE C CD1 1 
ATOM   10720 C  CD2 . PHE C 1 435 ? 26.041  -2.463  61.055  1.00 36.28 ? 449 PHE C CD2 1 
ATOM   10721 C  CE1 . PHE C 1 435 ? 25.996  -5.237  61.220  1.00 36.14 ? 449 PHE C CE1 1 
ATOM   10722 C  CE2 . PHE C 1 435 ? 25.116  -3.095  61.885  1.00 32.80 ? 449 PHE C CE2 1 
ATOM   10723 C  CZ  . PHE C 1 435 ? 25.094  -4.481  61.969  1.00 36.72 ? 449 PHE C CZ  1 
ATOM   10724 N  N   . GLY C 1 436 ? 31.065  -1.572  61.260  1.00 26.29 ? 450 GLY C N   1 
ATOM   10725 C  CA  . GLY C 1 436 ? 32.326  -2.077  61.771  1.00 24.20 ? 450 GLY C CA  1 
ATOM   10726 C  C   . GLY C 1 436 ? 32.843  -1.148  62.849  1.00 26.29 ? 450 GLY C C   1 
ATOM   10727 O  O   . GLY C 1 436 ? 32.163  -0.181  63.213  1.00 22.18 ? 450 GLY C O   1 
ATOM   10728 N  N   . PRO C 1 437 ? 34.025  -1.454  63.398  1.00 19.45 ? 451 PRO C N   1 
ATOM   10729 C  CA  . PRO C 1 437 ? 34.522  -0.659  64.523  1.00 21.49 ? 451 PRO C CA  1 
ATOM   10730 C  C   . PRO C 1 437 ? 35.314  0.570   64.049  1.00 25.19 ? 451 PRO C C   1 
ATOM   10731 O  O   . PRO C 1 437 ? 36.517  0.695   64.288  1.00 26.49 ? 451 PRO C O   1 
ATOM   10732 C  CB  . PRO C 1 437 ? 35.417  -1.656  65.281  1.00 19.70 ? 451 PRO C CB  1 
ATOM   10733 C  CG  . PRO C 1 437 ? 35.943  -2.557  64.214  1.00 21.15 ? 451 PRO C CG  1 
ATOM   10734 C  CD  . PRO C 1 437 ? 34.851  -2.659  63.153  1.00 19.49 ? 451 PRO C CD  1 
ATOM   10735 N  N   . VAL C 1 438 ? 34.623  1.484   63.378  1.00 24.43 ? 452 VAL C N   1 
ATOM   10736 C  CA  . VAL C 1 438 ? 35.276  2.663   62.833  1.00 23.90 ? 452 VAL C CA  1 
ATOM   10737 C  C   . VAL C 1 438 ? 34.499  3.920   63.219  1.00 29.23 ? 452 VAL C C   1 
ATOM   10738 O  O   . VAL C 1 438 ? 33.409  4.162   62.717  1.00 31.01 ? 452 VAL C O   1 
ATOM   10739 C  CB  . VAL C 1 438 ? 35.386  2.579   61.297  1.00 23.18 ? 452 VAL C CB  1 
ATOM   10740 C  CG1 . VAL C 1 438 ? 36.148  3.789   60.752  1.00 22.71 ? 452 VAL C CG1 1 
ATOM   10741 C  CG2 . VAL C 1 438 ? 36.077  1.272   60.876  1.00 28.19 ? 452 VAL C CG2 1 
ATOM   10742 N  N   . LEU C 1 439 ? 35.063  4.700   64.128  1.00 29.67 ? 453 LEU C N   1 
ATOM   10743 C  CA  . LEU C 1 439 ? 34.401  5.892   64.632  1.00 27.55 ? 453 LEU C CA  1 
ATOM   10744 C  C   . LEU C 1 439 ? 34.952  7.146   63.945  1.00 31.62 ? 453 LEU C C   1 
ATOM   10745 O  O   . LEU C 1 439 ? 36.161  7.390   63.955  1.00 36.17 ? 453 LEU C O   1 
ATOM   10746 C  CB  . LEU C 1 439 ? 34.595  5.977   66.147  1.00 21.75 ? 453 LEU C CB  1 
ATOM   10747 C  CG  . LEU C 1 439 ? 34.052  7.219   66.849  1.00 25.63 ? 453 LEU C CG  1 
ATOM   10748 C  CD1 . LEU C 1 439 ? 32.531  7.236   66.765  1.00 21.95 ? 453 LEU C CD1 1 
ATOM   10749 C  CD2 . LEU C 1 439 ? 34.505  7.228   68.286  1.00 30.64 ? 453 LEU C CD2 1 
ATOM   10750 N  N   . SER C 1 440 ? 34.061  7.928   63.344  1.00 31.37 ? 454 SER C N   1 
ATOM   10751 C  CA  . SER C 1 440 ? 34.445  9.172   62.694  1.00 28.04 ? 454 SER C CA  1 
ATOM   10752 C  C   . SER C 1 440 ? 34.159  10.358  63.611  1.00 28.03 ? 454 SER C C   1 
ATOM   10753 O  O   . SER C 1 440 ? 33.086  10.442  64.202  1.00 28.25 ? 454 SER C O   1 
ATOM   10754 C  CB  . SER C 1 440 ? 33.676  9.341   61.385  1.00 28.53 ? 454 SER C CB  1 
ATOM   10755 O  OG  . SER C 1 440 ? 34.040  8.341   60.453  1.00 33.61 ? 454 SER C OG  1 
ATOM   10756 N  N   . VAL C 1 441 ? 35.125  11.268  63.724  1.00 25.55 ? 455 VAL C N   1 
ATOM   10757 C  CA  . VAL C 1 441 ? 35.015  12.393  64.637  1.00 26.47 ? 455 VAL C CA  1 
ATOM   10758 C  C   . VAL C 1 441 ? 35.115  13.682  63.848  1.00 28.52 ? 455 VAL C C   1 
ATOM   10759 O  O   . VAL C 1 441 ? 36.057  13.875  63.072  1.00 36.10 ? 455 VAL C O   1 
ATOM   10760 C  CB  . VAL C 1 441 ? 36.112  12.366  65.737  1.00 28.01 ? 455 VAL C CB  1 
ATOM   10761 C  CG1 . VAL C 1 441 ? 35.924  13.522  66.711  1.00 29.94 ? 455 VAL C CG1 1 
ATOM   10762 C  CG2 . VAL C 1 441 ? 36.074  11.046  66.480  1.00 30.78 ? 455 VAL C CG2 1 
ATOM   10763 N  N   . TYR C 1 442 ? 34.113  14.535  64.021  1.00 26.67 ? 456 TYR C N   1 
ATOM   10764 C  CA  . TYR C 1 442 ? 34.154  15.891  63.483  1.00 34.88 ? 456 TYR C CA  1 
ATOM   10765 C  C   . TYR C 1 442 ? 34.181  16.908  64.623  1.00 35.83 ? 456 TYR C C   1 
ATOM   10766 O  O   . TYR C 1 442 ? 33.286  16.930  65.473  1.00 34.74 ? 456 TYR C O   1 
ATOM   10767 C  CB  . TYR C 1 442 ? 32.981  16.168  62.537  1.00 32.49 ? 456 TYR C CB  1 
ATOM   10768 C  CG  . TYR C 1 442 ? 32.969  17.605  62.064  1.00 31.11 ? 456 TYR C CG  1 
ATOM   10769 C  CD1 . TYR C 1 442 ? 33.888  18.049  61.123  1.00 35.15 ? 456 TYR C CD1 1 
ATOM   10770 C  CD2 . TYR C 1 442 ? 32.068  18.523  62.585  1.00 31.36 ? 456 TYR C CD2 1 
ATOM   10771 C  CE1 . TYR C 1 442 ? 33.902  19.370  60.700  1.00 43.05 ? 456 TYR C CE1 1 
ATOM   10772 C  CE2 . TYR C 1 442 ? 32.071  19.855  62.164  1.00 37.94 ? 456 TYR C CE2 1 
ATOM   10773 C  CZ  . TYR C 1 442 ? 32.989  20.267  61.218  1.00 41.15 ? 456 TYR C CZ  1 
ATOM   10774 O  OH  . TYR C 1 442 ? 33.016  21.572  60.791  1.00 42.74 ? 456 TYR C OH  1 
ATOM   10775 N  N   . VAL C 1 443 ? 35.228  17.732  64.646  1.00 36.65 ? 457 VAL C N   1 
ATOM   10776 C  CA  . VAL C 1 443 ? 35.392  18.743  65.679  1.00 29.80 ? 457 VAL C CA  1 
ATOM   10777 C  C   . VAL C 1 443 ? 34.817  20.066  65.176  1.00 38.42 ? 457 VAL C C   1 
ATOM   10778 O  O   . VAL C 1 443 ? 35.318  20.626  64.201  1.00 36.22 ? 457 VAL C O   1 
ATOM   10779 C  CB  . VAL C 1 443 ? 36.881  18.968  66.034  1.00 35.87 ? 457 VAL C CB  1 
ATOM   10780 C  CG1 . VAL C 1 443 ? 36.995  20.026  67.118  1.00 44.56 ? 457 VAL C CG1 1 
ATOM   10781 C  CG2 . VAL C 1 443 ? 37.538  17.682  66.491  1.00 34.11 ? 457 VAL C CG2 1 
ATOM   10782 N  N   . TYR C 1 444 ? 33.765  20.552  65.831  1.00 31.68 ? 458 TYR C N   1 
ATOM   10783 C  CA  . TYR C 1 444 ? 33.070  21.757  65.378  1.00 39.57 ? 458 TYR C CA  1 
ATOM   10784 C  C   . TYR C 1 444 ? 33.405  22.960  66.261  1.00 38.74 ? 458 TYR C C   1 
ATOM   10785 O  O   . TYR C 1 444 ? 33.743  22.798  67.430  1.00 39.50 ? 458 TYR C O   1 
ATOM   10786 C  CB  . TYR C 1 444 ? 31.549  21.527  65.325  1.00 37.77 ? 458 TYR C CB  1 
ATOM   10787 C  CG  . TYR C 1 444 ? 30.852  21.424  66.673  1.00 40.15 ? 458 TYR C CG  1 
ATOM   10788 C  CD1 . TYR C 1 444 ? 30.311  22.548  67.280  1.00 42.51 ? 458 TYR C CD1 1 
ATOM   10789 C  CD2 . TYR C 1 444 ? 30.708  20.198  67.322  1.00 40.03 ? 458 TYR C CD2 1 
ATOM   10790 C  CE1 . TYR C 1 444 ? 29.668  22.465  68.502  1.00 40.24 ? 458 TYR C CE1 1 
ATOM   10791 C  CE2 . TYR C 1 444 ? 30.066  20.103  68.548  1.00 34.05 ? 458 TYR C CE2 1 
ATOM   10792 C  CZ  . TYR C 1 444 ? 29.540  21.247  69.129  1.00 37.67 ? 458 TYR C CZ  1 
ATOM   10793 O  OH  . TYR C 1 444 ? 28.896  21.187  70.348  1.00 32.24 ? 458 TYR C OH  1 
ATOM   10794 N  N   . PRO C 1 445 ? 33.310  24.176  65.705  1.00 43.18 ? 459 PRO C N   1 
ATOM   10795 C  CA  . PRO C 1 445 ? 33.600  25.339  66.550  1.00 44.46 ? 459 PRO C CA  1 
ATOM   10796 C  C   . PRO C 1 445 ? 32.467  25.573  67.543  1.00 43.65 ? 459 PRO C C   1 
ATOM   10797 O  O   . PRO C 1 445 ? 31.302  25.485  67.154  1.00 40.73 ? 459 PRO C O   1 
ATOM   10798 C  CB  . PRO C 1 445 ? 33.703  26.489  65.543  1.00 43.64 ? 459 PRO C CB  1 
ATOM   10799 C  CG  . PRO C 1 445 ? 32.900  26.060  64.384  1.00 39.42 ? 459 PRO C CG  1 
ATOM   10800 C  CD  . PRO C 1 445 ? 32.952  24.556  64.327  1.00 42.65 ? 459 PRO C CD  1 
ATOM   10801 N  N   . ASP C 1 446 ? 32.813  25.838  68.801  1.00 44.71 ? 460 ASP C N   1 
ATOM   10802 C  CA  . ASP C 1 446 ? 31.833  26.070  69.865  1.00 49.38 ? 460 ASP C CA  1 
ATOM   10803 C  C   . ASP C 1 446 ? 30.745  27.062  69.468  1.00 50.84 ? 460 ASP C C   1 
ATOM   10804 O  O   . ASP C 1 446 ? 29.565  26.854  69.767  1.00 47.08 ? 460 ASP C O   1 
ATOM   10805 C  CB  . ASP C 1 446 ? 32.529  26.575  71.131  1.00 49.87 ? 460 ASP C CB  1 
ATOM   10806 C  CG  . ASP C 1 446 ? 33.286  25.481  71.859  1.00 50.84 ? 460 ASP C CG  1 
ATOM   10807 O  OD1 . ASP C 1 446 ? 34.284  24.978  71.305  1.00 53.39 ? 460 ASP C OD1 1 
ATOM   10808 O  OD2 . ASP C 1 446 ? 32.893  25.136  72.993  1.00 51.49 ? 460 ASP C OD2 1 
ATOM   10809 N  N   . ASP C 1 447 ? 31.148  28.133  68.788  1.00 48.96 ? 461 ASP C N   1 
ATOM   10810 C  CA  . ASP C 1 447 ? 30.220  29.182  68.383  1.00 50.91 ? 461 ASP C CA  1 
ATOM   10811 C  C   . ASP C 1 447 ? 29.243  28.757  67.287  1.00 44.36 ? 461 ASP C C   1 
ATOM   10812 O  O   . ASP C 1 447 ? 28.408  29.547  66.863  1.00 45.41 ? 461 ASP C O   1 
ATOM   10813 C  CB  . ASP C 1 447 ? 30.984  30.415  67.908  1.00 48.44 ? 461 ASP C CB  1 
ATOM   10814 C  CG  . ASP C 1 447 ? 31.715  31.115  69.031  1.00 50.84 ? 461 ASP C CG  1 
ATOM   10815 O  OD1 . ASP C 1 447 ? 32.755  31.735  68.747  1.00 48.33 ? 461 ASP C OD1 1 
ATOM   10816 O  OD2 . ASP C 1 447 ? 31.253  31.046  70.190  1.00 56.62 ? 461 ASP C OD2 1 
ATOM   10817 N  N   . LYS C 1 448 ? 29.364  27.529  66.806  1.00 40.88 ? 462 LYS C N   1 
ATOM   10818 C  CA  . LYS C 1 448 ? 28.466  27.058  65.764  1.00 40.46 ? 462 LYS C CA  1 
ATOM   10819 C  C   . LYS C 1 448 ? 27.741  25.786  66.187  1.00 39.59 ? 462 LYS C C   1 
ATOM   10820 O  O   . LYS C 1 448 ? 27.365  24.970  65.341  1.00 37.94 ? 462 LYS C O   1 
ATOM   10821 C  CB  . LYS C 1 448 ? 29.221  26.840  64.448  1.00 39.16 ? 462 LYS C CB  1 
ATOM   10822 C  CG  . LYS C 1 448 ? 29.891  28.103  63.895  1.00 40.01 ? 462 LYS C CG  1 
ATOM   10823 C  CD  . LYS C 1 448 ? 29.442  28.395  62.478  1.00 38.42 ? 462 LYS C CD  1 
ATOM   10824 C  CE  . LYS C 1 448 ? 29.891  27.331  61.491  1.00 40.61 ? 462 LYS C CE  1 
ATOM   10825 N  NZ  . LYS C 1 448 ? 29.087  27.351  60.219  1.00 39.84 ? 462 LYS C NZ  1 
ATOM   10826 N  N   . TYR C 1 449 ? 27.530  25.631  67.493  1.00 37.59 ? 463 TYR C N   1 
ATOM   10827 C  CA  . TYR C 1 449 ? 26.842  24.448  68.001  1.00 35.93 ? 463 TYR C CA  1 
ATOM   10828 C  C   . TYR C 1 449 ? 25.430  24.348  67.443  1.00 36.70 ? 463 TYR C C   1 
ATOM   10829 O  O   . TYR C 1 449 ? 24.952  23.253  67.136  1.00 36.21 ? 463 TYR C O   1 
ATOM   10830 C  CB  . TYR C 1 449 ? 26.856  24.395  69.542  1.00 38.63 ? 463 TYR C CB  1 
ATOM   10831 C  CG  . TYR C 1 449 ? 25.644  24.981  70.248  1.00 40.52 ? 463 TYR C CG  1 
ATOM   10832 C  CD1 . TYR C 1 449 ? 24.455  24.258  70.348  1.00 37.83 ? 463 TYR C CD1 1 
ATOM   10833 C  CD2 . TYR C 1 449 ? 25.696  26.242  70.841  1.00 44.99 ? 463 TYR C CD2 1 
ATOM   10834 C  CE1 . TYR C 1 449 ? 23.353  24.775  70.986  1.00 33.90 ? 463 TYR C CE1 1 
ATOM   10835 C  CE2 . TYR C 1 449 ? 24.589  26.768  71.492  1.00 47.34 ? 463 TYR C CE2 1 
ATOM   10836 C  CZ  . TYR C 1 449 ? 23.419  26.024  71.557  1.00 44.31 ? 463 TYR C CZ  1 
ATOM   10837 O  OH  . TYR C 1 449 ? 22.308  26.519  72.195  1.00 48.38 ? 463 TYR C OH  1 
ATOM   10838 N  N   . LYS C 1 450 ? 24.761  25.490  67.306  1.00 36.20 ? 464 LYS C N   1 
ATOM   10839 C  CA  . LYS C 1 450 ? 23.399  25.500  66.775  1.00 34.28 ? 464 LYS C CA  1 
ATOM   10840 C  C   . LYS C 1 450 ? 23.380  25.009  65.335  1.00 36.44 ? 464 LYS C C   1 
ATOM   10841 O  O   . LYS C 1 450 ? 22.570  24.152  64.966  1.00 34.42 ? 464 LYS C O   1 
ATOM   10842 C  CB  . LYS C 1 450 ? 22.778  26.902  66.878  1.00 37.03 ? 464 LYS C CB  1 
ATOM   10843 C  CG  . LYS C 1 450 ? 22.496  27.346  68.301  1.00 42.84 ? 464 LYS C CG  1 
ATOM   10844 C  CD  . LYS C 1 450 ? 21.985  28.797  68.343  1.00 49.05 ? 464 LYS C CD  1 
ATOM   10845 C  CE  . LYS C 1 450 ? 21.842  29.310  69.772  1.00 50.75 ? 464 LYS C CE  1 
ATOM   10846 N  NZ  . LYS C 1 450 ? 20.760  28.628  70.534  1.00 50.30 ? 464 LYS C NZ  1 
ATOM   10847 N  N   . GLU C 1 451 ? 24.278  25.549  64.520  1.00 35.18 ? 465 GLU C N   1 
ATOM   10848 C  CA  . GLU C 1 451 ? 24.345  25.149  63.122  1.00 36.80 ? 465 GLU C CA  1 
ATOM   10849 C  C   . GLU C 1 451 ? 24.819  23.700  62.976  1.00 38.26 ? 465 GLU C C   1 
ATOM   10850 O  O   . GLU C 1 451 ? 24.406  23.009  62.044  1.00 35.88 ? 465 GLU C O   1 
ATOM   10851 C  CB  . GLU C 1 451 ? 25.248  26.090  62.322  1.00 42.64 ? 465 GLU C CB  1 
ATOM   10852 N  N   . THR C 1 452 ? 25.687  23.252  63.889  1.00 33.28 ? 466 THR C N   1 
ATOM   10853 C  CA  . THR C 1 452 ? 26.198  21.894  63.845  1.00 34.16 ? 466 THR C CA  1 
ATOM   10854 C  C   . THR C 1 452 ? 25.089  20.886  64.158  1.00 34.17 ? 466 THR C C   1 
ATOM   10855 O  O   . THR C 1 452 ? 25.058  19.798  63.577  1.00 34.91 ? 466 THR C O   1 
ATOM   10856 C  CB  . THR C 1 452 ? 27.400  21.687  64.800  1.00 31.93 ? 466 THR C CB  1 
ATOM   10857 O  OG1 . THR C 1 452 ? 28.437  22.625  64.473  1.00 40.49 ? 466 THR C OG1 1 
ATOM   10858 C  CG2 . THR C 1 452 ? 27.956  20.257  64.673  1.00 26.78 ? 466 THR C CG2 1 
ATOM   10859 N  N   . LEU C 1 453 ? 24.194  21.253  65.076  1.00 31.71 ? 467 LEU C N   1 
ATOM   10860 C  CA  . LEU C 1 453 ? 22.998  20.453  65.337  1.00 34.64 ? 467 LEU C CA  1 
ATOM   10861 C  C   . LEU C 1 453 ? 22.198  20.289  64.048  1.00 32.11 ? 467 LEU C C   1 
ATOM   10862 O  O   . LEU C 1 453 ? 21.759  19.185  63.708  1.00 29.28 ? 467 LEU C O   1 
ATOM   10863 C  CB  . LEU C 1 453 ? 22.127  21.101  66.421  1.00 27.64 ? 467 LEU C CB  1 
ATOM   10864 C  CG  . LEU C 1 453 ? 22.576  20.848  67.858  1.00 31.30 ? 467 LEU C CG  1 
ATOM   10865 C  CD1 . LEU C 1 453 ? 21.847  21.777  68.819  1.00 36.97 ? 467 LEU C CD1 1 
ATOM   10866 C  CD2 . LEU C 1 453 ? 22.356  19.371  68.248  1.00 28.84 ? 467 LEU C CD2 1 
ATOM   10867 N  N   . GLN C 1 454 ? 22.028  21.395  63.331  1.00 29.02 ? 468 GLN C N   1 
ATOM   10868 C  CA  . GLN C 1 454 ? 21.297  21.395  62.071  1.00 37.34 ? 468 GLN C CA  1 
ATOM   10869 C  C   . GLN C 1 454 ? 22.039  20.512  61.071  1.00 36.11 ? 468 GLN C C   1 
ATOM   10870 O  O   . GLN C 1 454 ? 21.435  19.788  60.279  1.00 30.39 ? 468 GLN C O   1 
ATOM   10871 C  CB  . GLN C 1 454 ? 21.182  22.825  61.533  1.00 40.16 ? 468 GLN C CB  1 
ATOM   10872 C  CG  . GLN C 1 454 ? 19.861  23.153  60.873  1.00 51.60 ? 468 GLN C CG  1 
ATOM   10873 C  CD  . GLN C 1 454 ? 18.688  23.062  61.840  1.00 53.94 ? 468 GLN C CD  1 
ATOM   10874 O  OE1 . GLN C 1 454 ? 17.994  22.046  61.895  1.00 49.47 ? 468 GLN C OE1 1 
ATOM   10875 N  NE2 . GLN C 1 454 ? 18.465  24.125  62.611  1.00 51.34 ? 468 GLN C NE2 1 
ATOM   10876 N  N   . LEU C 1 455 ? 23.362  20.579  61.124  1.00 32.08 ? 469 LEU C N   1 
ATOM   10877 C  CA  . LEU C 1 455 ? 24.201  19.781  60.248  1.00 33.20 ? 469 LEU C CA  1 
ATOM   10878 C  C   . LEU C 1 455 ? 24.035  18.283  60.525  1.00 30.47 ? 469 LEU C C   1 
ATOM   10879 O  O   . LEU C 1 455 ? 23.985  17.470  59.596  1.00 30.04 ? 469 LEU C O   1 
ATOM   10880 C  CB  . LEU C 1 455 ? 25.659  20.193  60.419  1.00 39.50 ? 469 LEU C CB  1 
ATOM   10881 C  CG  . LEU C 1 455 ? 26.644  19.597  59.421  1.00 44.20 ? 469 LEU C CG  1 
ATOM   10882 C  CD1 . LEU C 1 455 ? 26.219  19.938  57.996  1.00 49.55 ? 469 LEU C CD1 1 
ATOM   10883 C  CD2 . LEU C 1 455 ? 28.040  20.101  59.724  1.00 45.99 ? 469 LEU C CD2 1 
ATOM   10884 N  N   . VAL C 1 456 ? 23.952  17.923  61.800  1.00 30.65 ? 470 VAL C N   1 
ATOM   10885 C  CA  . VAL C 1 456 ? 23.785  16.514  62.174  1.00 26.33 ? 470 VAL C CA  1 
ATOM   10886 C  C   . VAL C 1 456 ? 22.507  15.969  61.542  1.00 26.87 ? 470 VAL C C   1 
ATOM   10887 O  O   . VAL C 1 456 ? 22.488  14.867  60.983  1.00 25.33 ? 470 VAL C O   1 
ATOM   10888 C  CB  . VAL C 1 456 ? 23.710  16.338  63.701  1.00 26.63 ? 470 VAL C CB  1 
ATOM   10889 C  CG1 . VAL C 1 456 ? 23.254  14.909  64.084  1.00 26.38 ? 470 VAL C CG1 1 
ATOM   10890 C  CG2 . VAL C 1 456 ? 25.055  16.659  64.334  1.00 27.41 ? 470 VAL C CG2 1 
ATOM   10891 N  N   . ASP C 1 457 ? 21.439  16.755  61.629  1.00 30.60 ? 471 ASP C N   1 
ATOM   10892 C  CA  . ASP C 1 457 ? 20.165  16.339  61.068  1.00 28.34 ? 471 ASP C CA  1 
ATOM   10893 C  C   . ASP C 1 457 ? 20.220  16.260  59.544  1.00 31.71 ? 471 ASP C C   1 
ATOM   10894 O  O   . ASP C 1 457 ? 19.790  15.264  58.947  1.00 30.78 ? 471 ASP C O   1 
ATOM   10895 C  CB  . ASP C 1 457 ? 19.047  17.286  61.495  1.00 30.14 ? 471 ASP C CB  1 
ATOM   10896 C  CG  . ASP C 1 457 ? 17.718  16.915  60.877  1.00 36.74 ? 471 ASP C CG  1 
ATOM   10897 O  OD1 . ASP C 1 457 ? 17.281  15.751  61.041  1.00 39.03 ? 471 ASP C OD1 1 
ATOM   10898 O  OD2 . ASP C 1 457 ? 17.127  17.777  60.203  1.00 36.51 ? 471 ASP C OD2 1 
ATOM   10899 N  N   . SER C 1 458 ? 20.765  17.302  58.919  1.00 31.47 ? 472 SER C N   1 
ATOM   10900 C  CA  . SER C 1 458 ? 20.745  17.417  57.466  1.00 35.03 ? 472 SER C CA  1 
ATOM   10901 C  C   . SER C 1 458 ? 21.633  16.398  56.771  1.00 36.46 ? 472 SER C C   1 
ATOM   10902 O  O   . SER C 1 458 ? 21.475  16.145  55.577  1.00 39.23 ? 472 SER C O   1 
ATOM   10903 C  CB  . SER C 1 458 ? 21.145  18.824  57.027  1.00 34.08 ? 472 SER C CB  1 
ATOM   10904 O  OG  . SER C 1 458 ? 22.534  19.013  57.204  1.00 45.65 ? 472 SER C OG  1 
ATOM   10905 N  N   . THR C 1 459 ? 22.578  15.817  57.504  1.00 32.53 ? 473 THR C N   1 
ATOM   10906 C  CA  . THR C 1 459 ? 23.420  14.799  56.906  1.00 29.80 ? 473 THR C CA  1 
ATOM   10907 C  C   . THR C 1 459 ? 23.024  13.403  57.397  1.00 33.05 ? 473 THR C C   1 
ATOM   10908 O  O   . THR C 1 459 ? 23.739  12.441  57.167  1.00 32.34 ? 473 THR C O   1 
ATOM   10909 C  CB  . THR C 1 459 ? 24.922  15.044  57.171  1.00 32.47 ? 473 THR C CB  1 
ATOM   10910 O  OG1 . THR C 1 459 ? 25.170  15.001  58.578  1.00 36.46 ? 473 THR C OG1 1 
ATOM   10911 C  CG2 . THR C 1 459 ? 25.347  16.410  56.624  1.00 37.20 ? 473 THR C CG2 1 
ATOM   10912 N  N   . THR C 1 460 ? 21.884  13.312  58.074  1.00 33.39 ? 474 THR C N   1 
ATOM   10913 C  CA  . THR C 1 460 ? 21.343  12.027  58.504  1.00 37.23 ? 474 THR C CA  1 
ATOM   10914 C  C   . THR C 1 460 ? 20.482  11.468  57.385  1.00 37.00 ? 474 THR C C   1 
ATOM   10915 O  O   . THR C 1 460 ? 19.531  12.114  56.948  1.00 35.81 ? 474 THR C O   1 
ATOM   10916 C  CB  . THR C 1 460 ? 20.510  12.167  59.800  1.00 41.51 ? 474 THR C CB  1 
ATOM   10917 O  OG1 . THR C 1 460 ? 21.361  12.597  60.873  1.00 40.68 ? 474 THR C OG1 1 
ATOM   10918 C  CG2 . THR C 1 460 ? 19.874  10.840  60.180  1.00 43.38 ? 474 THR C CG2 1 
ATOM   10919 N  N   . SER C 1 461 ? 20.828  10.278  56.910  1.00 39.18 ? 475 SER C N   1 
ATOM   10920 C  CA  . SER C 1 461 ? 20.126  9.669   55.782  1.00 47.14 ? 475 SER C CA  1 
ATOM   10921 C  C   . SER C 1 461 ? 18.932  8.833   56.237  1.00 45.16 ? 475 SER C C   1 
ATOM   10922 O  O   . SER C 1 461 ? 17.813  9.017   55.760  1.00 50.43 ? 475 SER C O   1 
ATOM   10923 C  CB  . SER C 1 461 ? 21.086  8.803   54.967  1.00 54.42 ? 475 SER C CB  1 
ATOM   10924 O  OG  . SER C 1 461 ? 22.344  9.442   54.816  1.00 64.92 ? 475 SER C OG  1 
ATOM   10925 N  N   . TYR C 1 462 ? 19.174  7.892   57.141  1.00 33.02 ? 476 TYR C N   1 
ATOM   10926 C  CA  . TYR C 1 462 ? 18.082  7.115   57.728  1.00 44.31 ? 476 TYR C CA  1 
ATOM   10927 C  C   . TYR C 1 462 ? 18.456  6.777   59.164  1.00 48.02 ? 476 TYR C C   1 
ATOM   10928 O  O   . TYR C 1 462 ? 18.815  5.638   59.478  1.00 49.70 ? 476 TYR C O   1 
ATOM   10929 C  CB  . TYR C 1 462 ? 17.800  5.844   56.912  1.00 40.52 ? 476 TYR C CB  1 
ATOM   10930 N  N   . GLY C 1 463 ? 18.379  7.784   60.028  1.00 47.64 ? 477 GLY C N   1 
ATOM   10931 C  CA  . GLY C 1 463 ? 18.942  7.696   61.363  1.00 45.14 ? 477 GLY C CA  1 
ATOM   10932 C  C   . GLY C 1 463 ? 18.075  6.942   62.341  1.00 42.18 ? 477 GLY C C   1 
ATOM   10933 O  O   . GLY C 1 463 ? 16.895  7.240   62.511  1.00 48.90 ? 477 GLY C O   1 
ATOM   10934 N  N   . LEU C 1 464 ? 18.678  5.961   62.995  1.00 37.20 ? 478 LEU C N   1 
ATOM   10935 C  CA  . LEU C 1 464 ? 17.947  5.083   63.883  1.00 28.45 ? 478 LEU C CA  1 
ATOM   10936 C  C   . LEU C 1 464 ? 18.113  5.515   65.324  1.00 26.62 ? 478 LEU C C   1 
ATOM   10937 O  O   . LEU C 1 464 ? 17.125  5.629   66.058  1.00 20.84 ? 478 LEU C O   1 
ATOM   10938 C  CB  . LEU C 1 464 ? 18.421  3.647   63.695  1.00 30.28 ? 478 LEU C CB  1 
ATOM   10939 C  CG  . LEU C 1 464 ? 17.615  2.566   64.408  1.00 39.98 ? 478 LEU C CG  1 
ATOM   10940 C  CD1 . LEU C 1 464 ? 16.305  2.287   63.680  1.00 37.47 ? 478 LEU C CD1 1 
ATOM   10941 C  CD2 . LEU C 1 464 ? 18.448  1.295   64.537  1.00 46.09 ? 478 LEU C CD2 1 
ATOM   10942 N  N   . THR C 1 465 ? 19.361  5.758   65.732  1.00 19.14 ? 479 THR C N   1 
ATOM   10943 C  CA  . THR C 1 465 ? 19.644  6.201   67.085  1.00 20.59 ? 479 THR C CA  1 
ATOM   10944 C  C   . THR C 1 465 ? 20.575  7.413   67.132  1.00 19.62 ? 479 THR C C   1 
ATOM   10945 O  O   . THR C 1 465 ? 21.241  7.747   66.159  1.00 19.35 ? 479 THR C O   1 
ATOM   10946 C  CB  . THR C 1 465 ? 20.233  5.064   67.949  1.00 17.02 ? 479 THR C CB  1 
ATOM   10947 O  OG1 . THR C 1 465 ? 21.565  4.753   67.520  1.00 20.60 ? 479 THR C OG1 1 
ATOM   10948 C  CG2 . THR C 1 465 ? 19.347  3.810   67.857  1.00 22.64 ? 479 THR C CG2 1 
ATOM   10949 N  N   . GLY C 1 466 ? 20.614  8.069   68.279  1.00 17.30 ? 480 GLY C N   1 
ATOM   10950 C  CA  . GLY C 1 466 ? 21.423  9.265   68.419  1.00 21.10 ? 480 GLY C CA  1 
ATOM   10951 C  C   . GLY C 1 466 ? 21.476  9.632   69.878  1.00 27.22 ? 480 GLY C C   1 
ATOM   10952 O  O   . GLY C 1 466 ? 20.636  9.190   70.668  1.00 25.69 ? 480 GLY C O   1 
ATOM   10953 N  N   . ALA C 1 467 ? 22.470  10.432  70.244  1.00 21.23 ? 481 ALA C N   1 
ATOM   10954 C  CA  . ALA C 1 467 ? 22.597  10.850  71.626  1.00 22.54 ? 481 ALA C CA  1 
ATOM   10955 C  C   . ALA C 1 467 ? 23.106  12.275  71.679  1.00 23.30 ? 481 ALA C C   1 
ATOM   10956 O  O   . ALA C 1 467 ? 23.839  12.707  70.791  1.00 24.38 ? 481 ALA C O   1 
ATOM   10957 C  CB  . ALA C 1 467 ? 23.537  9.913   72.377  1.00 23.59 ? 481 ALA C CB  1 
ATOM   10958 N  N   . VAL C 1 468 ? 22.689  13.009  72.705  1.00 21.44 ? 482 VAL C N   1 
ATOM   10959 C  CA  . VAL C 1 468 ? 23.252  14.315  72.990  1.00 24.83 ? 482 VAL C CA  1 
ATOM   10960 C  C   . VAL C 1 468 ? 23.853  14.255  74.380  1.00 29.67 ? 482 VAL C C   1 
ATOM   10961 O  O   . VAL C 1 468 ? 23.231  13.761  75.315  1.00 26.68 ? 482 VAL C O   1 
ATOM   10962 C  CB  . VAL C 1 468 ? 22.214  15.474  72.902  1.00 26.40 ? 482 VAL C CB  1 
ATOM   10963 C  CG1 . VAL C 1 468 ? 21.017  15.219  73.805  1.00 31.29 ? 482 VAL C CG1 1 
ATOM   10964 C  CG2 . VAL C 1 468 ? 22.867  16.785  73.290  1.00 25.32 ? 482 VAL C CG2 1 
ATOM   10965 N  N   . PHE C 1 469 ? 25.085  14.733  74.503  1.00 28.10 ? 483 PHE C N   1 
ATOM   10966 C  CA  . PHE C 1 469 ? 25.719  14.838  75.801  1.00 32.81 ? 483 PHE C CA  1 
ATOM   10967 C  C   . PHE C 1 469 ? 25.807  16.307  76.166  1.00 35.30 ? 483 PHE C C   1 
ATOM   10968 O  O   . PHE C 1 469 ? 26.459  17.097  75.466  1.00 37.72 ? 483 PHE C O   1 
ATOM   10969 C  CB  . PHE C 1 469 ? 27.108  14.201  75.791  1.00 26.79 ? 483 PHE C CB  1 
ATOM   10970 C  CG  . PHE C 1 469 ? 27.086  12.695  75.734  1.00 29.73 ? 483 PHE C CG  1 
ATOM   10971 C  CD1 . PHE C 1 469 ? 26.933  12.033  74.520  1.00 32.39 ? 483 PHE C CD1 1 
ATOM   10972 C  CD2 . PHE C 1 469 ? 27.228  11.941  76.891  1.00 28.58 ? 483 PHE C CD2 1 
ATOM   10973 C  CE1 . PHE C 1 469 ? 26.913  10.639  74.466  1.00 36.81 ? 483 PHE C CE1 1 
ATOM   10974 C  CE2 . PHE C 1 469 ? 27.225  10.551  76.847  1.00 29.36 ? 483 PHE C CE2 1 
ATOM   10975 C  CZ  . PHE C 1 469 ? 27.055  9.898   75.630  1.00 33.12 ? 483 PHE C CZ  1 
ATOM   10976 N  N   . SER C 1 470 ? 25.141  16.672  77.257  1.00 34.75 ? 484 SER C N   1 
ATOM   10977 C  CA  . SER C 1 470 ? 25.125  18.063  77.703  1.00 33.76 ? 484 SER C CA  1 
ATOM   10978 C  C   . SER C 1 470 ? 24.575  18.165  79.113  1.00 32.10 ? 484 SER C C   1 
ATOM   10979 O  O   . SER C 1 470 ? 23.546  17.566  79.429  1.00 37.78 ? 484 SER C O   1 
ATOM   10980 C  CB  . SER C 1 470 ? 24.288  18.934  76.760  1.00 34.04 ? 484 SER C CB  1 
ATOM   10981 O  OG  . SER C 1 470 ? 24.151  20.271  77.270  1.00 36.77 ? 484 SER C OG  1 
ATOM   10982 N  N   . GLN C 1 471 ? 25.265  18.932  79.951  1.00 33.36 ? 485 GLN C N   1 
ATOM   10983 C  CA  . GLN C 1 471 ? 24.771  19.259  81.287  1.00 41.95 ? 485 GLN C CA  1 
ATOM   10984 C  C   . GLN C 1 471 ? 23.801  20.452  81.245  1.00 44.44 ? 485 GLN C C   1 
ATOM   10985 O  O   . GLN C 1 471 ? 23.015  20.666  82.177  1.00 45.01 ? 485 GLN C O   1 
ATOM   10986 C  CB  . GLN C 1 471 ? 25.946  19.539  82.236  1.00 47.74 ? 485 GLN C CB  1 
ATOM   10987 N  N   . ASP C 1 472 ? 23.869  21.222  80.158  1.00 41.36 ? 486 ASP C N   1 
ATOM   10988 C  CA  . ASP C 1 472 ? 22.988  22.372  79.946  1.00 47.05 ? 486 ASP C CA  1 
ATOM   10989 C  C   . ASP C 1 472 ? 21.610  21.884  79.510  1.00 44.64 ? 486 ASP C C   1 
ATOM   10990 O  O   . ASP C 1 472 ? 21.449  21.399  78.389  1.00 46.16 ? 486 ASP C O   1 
ATOM   10991 C  CB  . ASP C 1 472 ? 23.584  23.299  78.873  1.00 45.61 ? 486 ASP C CB  1 
ATOM   10992 C  CG  . ASP C 1 472 ? 22.803  24.610  78.705  1.00 50.84 ? 486 ASP C CG  1 
ATOM   10993 O  OD1 . ASP C 1 472 ? 21.550  24.591  78.657  1.00 52.62 ? 486 ASP C OD1 1 
ATOM   10994 O  OD2 . ASP C 1 472 ? 23.461  25.668  78.601  1.00 55.45 ? 486 ASP C OD2 1 
ATOM   10995 N  N   . LYS C 1 473 ? 20.617  22.031  80.385  1.00 46.89 ? 487 LYS C N   1 
ATOM   10996 C  CA  . LYS C 1 473 ? 19.269  21.527  80.109  1.00 49.19 ? 487 LYS C CA  1 
ATOM   10997 C  C   . LYS C 1 473 ? 18.561  22.258  78.963  1.00 43.75 ? 487 LYS C C   1 
ATOM   10998 O  O   . LYS C 1 473 ? 17.757  21.662  78.250  1.00 42.72 ? 487 LYS C O   1 
ATOM   10999 C  CB  . LYS C 1 473 ? 18.405  21.550  81.374  1.00 49.06 ? 487 LYS C CB  1 
ATOM   11000 N  N   . ASP C 1 474 ? 18.849  23.544  78.783  1.00 47.33 ? 488 ASP C N   1 
ATOM   11001 C  CA  . ASP C 1 474 ? 18.257  24.282  77.668  1.00 45.33 ? 488 ASP C CA  1 
ATOM   11002 C  C   . ASP C 1 474 ? 18.720  23.679  76.340  1.00 40.18 ? 488 ASP C C   1 
ATOM   11003 O  O   . ASP C 1 474 ? 17.920  23.464  75.428  1.00 41.75 ? 488 ASP C O   1 
ATOM   11004 C  CB  . ASP C 1 474 ? 18.609  25.773  77.740  1.00 45.53 ? 488 ASP C CB  1 
ATOM   11005 N  N   . VAL C 1 475 ? 20.017  23.389  76.255  1.00 41.77 ? 489 VAL C N   1 
ATOM   11006 C  CA  . VAL C 1 475 ? 20.603  22.780  75.067  1.00 38.95 ? 489 VAL C CA  1 
ATOM   11007 C  C   . VAL C 1 475 ? 19.987  21.409  74.808  1.00 35.59 ? 489 VAL C C   1 
ATOM   11008 O  O   . VAL C 1 475 ? 19.694  21.058  73.667  1.00 36.90 ? 489 VAL C O   1 
ATOM   11009 C  CB  . VAL C 1 475 ? 22.130  22.640  75.210  1.00 40.47 ? 489 VAL C CB  1 
ATOM   11010 C  CG1 . VAL C 1 475 ? 22.707  21.786  74.077  1.00 36.63 ? 489 VAL C CG1 1 
ATOM   11011 C  CG2 . VAL C 1 475 ? 22.776  24.011  75.231  1.00 38.81 ? 489 VAL C CG2 1 
ATOM   11012 N  N   . VAL C 1 476 ? 19.788  20.642  75.876  1.00 34.80 ? 490 VAL C N   1 
ATOM   11013 C  CA  . VAL C 1 476 ? 19.132  19.345  75.764  1.00 38.71 ? 490 VAL C CA  1 
ATOM   11014 C  C   . VAL C 1 476 ? 17.744  19.501  75.130  1.00 35.50 ? 490 VAL C C   1 
ATOM   11015 O  O   . VAL C 1 476 ? 17.390  18.785  74.192  1.00 32.89 ? 490 VAL C O   1 
ATOM   11016 C  CB  . VAL C 1 476 ? 19.019  18.654  77.132  1.00 36.25 ? 490 VAL C CB  1 
ATOM   11017 C  CG1 . VAL C 1 476 ? 18.145  17.419  77.016  1.00 38.83 ? 490 VAL C CG1 1 
ATOM   11018 C  CG2 . VAL C 1 476 ? 20.408  18.291  77.672  1.00 32.81 ? 490 VAL C CG2 1 
ATOM   11019 N  N   . GLN C 1 477 ? 16.970  20.462  75.633  1.00 38.67 ? 491 GLN C N   1 
ATOM   11020 C  CA  . GLN C 1 477 ? 15.666  20.761  75.055  1.00 40.68 ? 491 GLN C CA  1 
ATOM   11021 C  C   . GLN C 1 477 ? 15.814  21.143  73.581  1.00 35.42 ? 491 GLN C C   1 
ATOM   11022 O  O   . GLN C 1 477 ? 15.100  20.637  72.731  1.00 39.45 ? 491 GLN C O   1 
ATOM   11023 C  CB  . GLN C 1 477 ? 14.973  21.889  75.837  1.00 42.42 ? 491 GLN C CB  1 
ATOM   11024 N  N   . GLU C 1 478 ? 16.763  22.024  73.285  1.00 42.89 ? 492 GLU C N   1 
ATOM   11025 C  CA  . GLU C 1 478 ? 16.977  22.490  71.919  1.00 40.10 ? 492 GLU C CA  1 
ATOM   11026 C  C   . GLU C 1 478 ? 17.372  21.354  70.976  1.00 38.50 ? 492 GLU C C   1 
ATOM   11027 O  O   . GLU C 1 478 ? 16.805  21.209  69.889  1.00 37.47 ? 492 GLU C O   1 
ATOM   11028 C  CB  . GLU C 1 478 ? 18.040  23.590  71.887  1.00 39.95 ? 492 GLU C CB  1 
ATOM   11029 C  CG  . GLU C 1 478 ? 18.149  24.287  70.549  1.00 48.24 ? 492 GLU C CG  1 
ATOM   11030 C  CD  . GLU C 1 478 ? 19.294  25.283  70.496  1.00 52.01 ? 492 GLU C CD  1 
ATOM   11031 O  OE1 . GLU C 1 478 ? 20.038  25.404  71.499  1.00 53.72 ? 492 GLU C OE1 1 
ATOM   11032 O  OE2 . GLU C 1 478 ? 19.449  25.939  69.443  1.00 50.08 ? 492 GLU C OE2 1 
ATOM   11033 N  N   . ALA C 1 479 ? 18.339  20.543  71.388  1.00 33.01 ? 493 ALA C N   1 
ATOM   11034 C  CA  . ALA C 1 479 ? 18.795  19.434  70.545  1.00 33.44 ? 493 ALA C CA  1 
ATOM   11035 C  C   . ALA C 1 479 ? 17.678  18.428  70.296  1.00 32.21 ? 493 ALA C C   1 
ATOM   11036 O  O   . ALA C 1 479 ? 17.558  17.857