data_4OI0
# 
_entry.id   4OI0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OI0         
NDB   NA2894       
RCSB  RCSB084517   
WWPDB D_1000084517 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OHV . unspecified 
PDB 4OHW . unspecified 
PDB 4OHX . unspecified 
PDB 4OHY . unspecified 
PDB 4OHZ . unspecified 
PDB 4OI1 . unspecified 
PDB 4OI2 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4OI0 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dikfidan, A.' 1 
'Loll, B.'     2 
'Zeymer, C.'   3 
'Clausen, T.'  4 
'Meinhart, A.' 5 
# 
_citation.id                        primary 
_citation.title                     'RNA specificity and regulation of catalysis in the eukaryotic polynucleotide kinase clp1.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            54 
_citation.page_first                975 
_citation.page_last                 986 
_citation.year                      2014 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24813946 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2014.04.005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dikfidan, A.' 1 
primary 'Loll, B.'     2 
primary 'Zeymer, C.'   3 
primary 'Magler, I.'   4 
primary 'Clausen, T.'  5 
primary 'Meinhart, A.' 6 
# 
_cell.entry_id           4OI0 
_cell.length_a           100.710 
_cell.length_b           100.710 
_cell.length_c           40.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              3 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4OI0 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein clpf-1'           47936.453 1   ? ? ? ?                     
2 polymer     syn 
;RNA (5'-R(*GP*C)-3')
;
605.430   1   ? ? ? 'diribonucleotide GC' 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201   1   ? ? ? ?                     
4 non-polymer syn 'MAGNESIUM ION'            24.305    1   ? ? ? ?                     
5 non-polymer syn 'TETRAFLUOROALUMINATE ION' 102.975   1   ? ? ? ?                     
6 non-polymer syn SARCOSINE                  89.093    2   ? ? ? ?                     
7 non-polymer syn 'NONAETHYLENE GLYCOL'      414.488   1   ? ? ? ?                     
8 water       nat water                      18.015    135 ? ? ? ?                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;GSHMSEENVQEFVLKEDCELRFAAGDDSDVCLELVKGYAEIFGTELLLNKKYTFPAKSRVAAFTWKGATIELVGTTESAY
VAESTPMVIYLNIHAAMEEVRKKREEQAAGNSNKAKGPRLLLVGPTDVGKTTVSRILCNYSVRQGRTPIFVELDVGQNSV
SVPGTVAAVLVQKTADVIDGFERNQPIVFNFGHTSPSANLSLYEALFKEMATTLNAQIQENDEAKIGGMIINTCGWVDGE
GYKCIVKAASAFEVDVVIVLDHERLYSDLSKELPEFVRLTHVPKSGGVEQRTGQIRSKMRGENVHRYFYGTRANNLYPFT
FDVSFDDVTLCKIGAEQLPDSCLPFGMEVENHETKLVIMEPSADIKHHLFAFSRSTKADENVLKSPVFGFCLVTEVDLEK
RTMSILCPQRTIPSKVLVFSDITHLDDQIKR
;
;GSHMSEENVQEFVLKEDCELRFAAGDDSDVCLELVKGYAEIFGTELLLNKKYTFPAKSRVAAFTWKGATIELVGTTESAY
VAESTPMVIYLNIHAAMEEVRKKREEQAAGNSNKAKGPRLLLVGPTDVGKTTVSRILCNYSVRQGRTPIFVELDVGQNSV
SVPGTVAAVLVQKTADVIDGFERNQPIVFNFGHTSPSANLSLYEALFKEMATTLNAQIQENDEAKIGGMIINTCGWVDGE
GYKCIVKAASAFEVDVVIVLDHERLYSDLSKELPEFVRLTHVPKSGGVEQRTGQIRSKMRGENVHRYFYGTRANNLYPFT
FDVSFDDVTLCKIGAEQLPDSCLPFGMEVENHETKLVIMEPSADIKHHLFAFSRSTKADENVLKSPVFGFCLVTEVDLEK
RTMSILCPQRTIPSKVLVFSDITHLDDQIKR
;
A ? 
2 polyribonucleotide no no GC GC B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   GLU n 
1 7   GLU n 
1 8   ASN n 
1 9   VAL n 
1 10  GLN n 
1 11  GLU n 
1 12  PHE n 
1 13  VAL n 
1 14  LEU n 
1 15  LYS n 
1 16  GLU n 
1 17  ASP n 
1 18  CYS n 
1 19  GLU n 
1 20  LEU n 
1 21  ARG n 
1 22  PHE n 
1 23  ALA n 
1 24  ALA n 
1 25  GLY n 
1 26  ASP n 
1 27  ASP n 
1 28  SER n 
1 29  ASP n 
1 30  VAL n 
1 31  CYS n 
1 32  LEU n 
1 33  GLU n 
1 34  LEU n 
1 35  VAL n 
1 36  LYS n 
1 37  GLY n 
1 38  TYR n 
1 39  ALA n 
1 40  GLU n 
1 41  ILE n 
1 42  PHE n 
1 43  GLY n 
1 44  THR n 
1 45  GLU n 
1 46  LEU n 
1 47  LEU n 
1 48  LEU n 
1 49  ASN n 
1 50  LYS n 
1 51  LYS n 
1 52  TYR n 
1 53  THR n 
1 54  PHE n 
1 55  PRO n 
1 56  ALA n 
1 57  LYS n 
1 58  SER n 
1 59  ARG n 
1 60  VAL n 
1 61  ALA n 
1 62  ALA n 
1 63  PHE n 
1 64  THR n 
1 65  TRP n 
1 66  LYS n 
1 67  GLY n 
1 68  ALA n 
1 69  THR n 
1 70  ILE n 
1 71  GLU n 
1 72  LEU n 
1 73  VAL n 
1 74  GLY n 
1 75  THR n 
1 76  THR n 
1 77  GLU n 
1 78  SER n 
1 79  ALA n 
1 80  TYR n 
1 81  VAL n 
1 82  ALA n 
1 83  GLU n 
1 84  SER n 
1 85  THR n 
1 86  PRO n 
1 87  MET n 
1 88  VAL n 
1 89  ILE n 
1 90  TYR n 
1 91  LEU n 
1 92  ASN n 
1 93  ILE n 
1 94  HIS n 
1 95  ALA n 
1 96  ALA n 
1 97  MET n 
1 98  GLU n 
1 99  GLU n 
1 100 VAL n 
1 101 ARG n 
1 102 LYS n 
1 103 LYS n 
1 104 ARG n 
1 105 GLU n 
1 106 GLU n 
1 107 GLN n 
1 108 ALA n 
1 109 ALA n 
1 110 GLY n 
1 111 ASN n 
1 112 SER n 
1 113 ASN n 
1 114 LYS n 
1 115 ALA n 
1 116 LYS n 
1 117 GLY n 
1 118 PRO n 
1 119 ARG n 
1 120 LEU n 
1 121 LEU n 
1 122 LEU n 
1 123 VAL n 
1 124 GLY n 
1 125 PRO n 
1 126 THR n 
1 127 ASP n 
1 128 VAL n 
1 129 GLY n 
1 130 LYS n 
1 131 THR n 
1 132 THR n 
1 133 VAL n 
1 134 SER n 
1 135 ARG n 
1 136 ILE n 
1 137 LEU n 
1 138 CYS n 
1 139 ASN n 
1 140 TYR n 
1 141 SER n 
1 142 VAL n 
1 143 ARG n 
1 144 GLN n 
1 145 GLY n 
1 146 ARG n 
1 147 THR n 
1 148 PRO n 
1 149 ILE n 
1 150 PHE n 
1 151 VAL n 
1 152 GLU n 
1 153 LEU n 
1 154 ASP n 
1 155 VAL n 
1 156 GLY n 
1 157 GLN n 
1 158 ASN n 
1 159 SER n 
1 160 VAL n 
1 161 SER n 
1 162 VAL n 
1 163 PRO n 
1 164 GLY n 
1 165 THR n 
1 166 VAL n 
1 167 ALA n 
1 168 ALA n 
1 169 VAL n 
1 170 LEU n 
1 171 VAL n 
1 172 GLN n 
1 173 LYS n 
1 174 THR n 
1 175 ALA n 
1 176 ASP n 
1 177 VAL n 
1 178 ILE n 
1 179 ASP n 
1 180 GLY n 
1 181 PHE n 
1 182 GLU n 
1 183 ARG n 
1 184 ASN n 
1 185 GLN n 
1 186 PRO n 
1 187 ILE n 
1 188 VAL n 
1 189 PHE n 
1 190 ASN n 
1 191 PHE n 
1 192 GLY n 
1 193 HIS n 
1 194 THR n 
1 195 SER n 
1 196 PRO n 
1 197 SER n 
1 198 ALA n 
1 199 ASN n 
1 200 LEU n 
1 201 SER n 
1 202 LEU n 
1 203 TYR n 
1 204 GLU n 
1 205 ALA n 
1 206 LEU n 
1 207 PHE n 
1 208 LYS n 
1 209 GLU n 
1 210 MET n 
1 211 ALA n 
1 212 THR n 
1 213 THR n 
1 214 LEU n 
1 215 ASN n 
1 216 ALA n 
1 217 GLN n 
1 218 ILE n 
1 219 GLN n 
1 220 GLU n 
1 221 ASN n 
1 222 ASP n 
1 223 GLU n 
1 224 ALA n 
1 225 LYS n 
1 226 ILE n 
1 227 GLY n 
1 228 GLY n 
1 229 MET n 
1 230 ILE n 
1 231 ILE n 
1 232 ASN n 
1 233 THR n 
1 234 CYS n 
1 235 GLY n 
1 236 TRP n 
1 237 VAL n 
1 238 ASP n 
1 239 GLY n 
1 240 GLU n 
1 241 GLY n 
1 242 TYR n 
1 243 LYS n 
1 244 CYS n 
1 245 ILE n 
1 246 VAL n 
1 247 LYS n 
1 248 ALA n 
1 249 ALA n 
1 250 SER n 
1 251 ALA n 
1 252 PHE n 
1 253 GLU n 
1 254 VAL n 
1 255 ASP n 
1 256 VAL n 
1 257 VAL n 
1 258 ILE n 
1 259 VAL n 
1 260 LEU n 
1 261 ASP n 
1 262 HIS n 
1 263 GLU n 
1 264 ARG n 
1 265 LEU n 
1 266 TYR n 
1 267 SER n 
1 268 ASP n 
1 269 LEU n 
1 270 SER n 
1 271 LYS n 
1 272 GLU n 
1 273 LEU n 
1 274 PRO n 
1 275 GLU n 
1 276 PHE n 
1 277 VAL n 
1 278 ARG n 
1 279 LEU n 
1 280 THR n 
1 281 HIS n 
1 282 VAL n 
1 283 PRO n 
1 284 LYS n 
1 285 SER n 
1 286 GLY n 
1 287 GLY n 
1 288 VAL n 
1 289 GLU n 
1 290 GLN n 
1 291 ARG n 
1 292 THR n 
1 293 GLY n 
1 294 GLN n 
1 295 ILE n 
1 296 ARG n 
1 297 SER n 
1 298 LYS n 
1 299 MET n 
1 300 ARG n 
1 301 GLY n 
1 302 GLU n 
1 303 ASN n 
1 304 VAL n 
1 305 HIS n 
1 306 ARG n 
1 307 TYR n 
1 308 PHE n 
1 309 TYR n 
1 310 GLY n 
1 311 THR n 
1 312 ARG n 
1 313 ALA n 
1 314 ASN n 
1 315 ASN n 
1 316 LEU n 
1 317 TYR n 
1 318 PRO n 
1 319 PHE n 
1 320 THR n 
1 321 PHE n 
1 322 ASP n 
1 323 VAL n 
1 324 SER n 
1 325 PHE n 
1 326 ASP n 
1 327 ASP n 
1 328 VAL n 
1 329 THR n 
1 330 LEU n 
1 331 CYS n 
1 332 LYS n 
1 333 ILE n 
1 334 GLY n 
1 335 ALA n 
1 336 GLU n 
1 337 GLN n 
1 338 LEU n 
1 339 PRO n 
1 340 ASP n 
1 341 SER n 
1 342 CYS n 
1 343 LEU n 
1 344 PRO n 
1 345 PHE n 
1 346 GLY n 
1 347 MET n 
1 348 GLU n 
1 349 VAL n 
1 350 GLU n 
1 351 ASN n 
1 352 HIS n 
1 353 GLU n 
1 354 THR n 
1 355 LYS n 
1 356 LEU n 
1 357 VAL n 
1 358 ILE n 
1 359 MET n 
1 360 GLU n 
1 361 PRO n 
1 362 SER n 
1 363 ALA n 
1 364 ASP n 
1 365 ILE n 
1 366 LYS n 
1 367 HIS n 
1 368 HIS n 
1 369 LEU n 
1 370 PHE n 
1 371 ALA n 
1 372 PHE n 
1 373 SER n 
1 374 ARG n 
1 375 SER n 
1 376 THR n 
1 377 LYS n 
1 378 ALA n 
1 379 ASP n 
1 380 GLU n 
1 381 ASN n 
1 382 VAL n 
1 383 LEU n 
1 384 LYS n 
1 385 SER n 
1 386 PRO n 
1 387 VAL n 
1 388 PHE n 
1 389 GLY n 
1 390 PHE n 
1 391 CYS n 
1 392 LEU n 
1 393 VAL n 
1 394 THR n 
1 395 GLU n 
1 396 VAL n 
1 397 ASP n 
1 398 LEU n 
1 399 GLU n 
1 400 LYS n 
1 401 ARG n 
1 402 THR n 
1 403 MET n 
1 404 SER n 
1 405 ILE n 
1 406 LEU n 
1 407 CYS n 
1 408 PRO n 
1 409 GLN n 
1 410 ARG n 
1 411 THR n 
1 412 ILE n 
1 413 PRO n 
1 414 SER n 
1 415 LYS n 
1 416 VAL n 
1 417 LEU n 
1 418 VAL n 
1 419 PHE n 
1 420 SER n 
1 421 ASP n 
1 422 ILE n 
1 423 THR n 
1 424 HIS n 
1 425 LEU n 
1 426 ASP n 
1 427 ASP n 
1 428 GLN n 
1 429 ILE n 
1 430 LYS n 
1 431 ARG n 
2 1   G   n 
2 2   C   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               nematode 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'clpf-1, F59A2.4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Caenorhabditis elegans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6239 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CLP1_CAEEL P52874 1 
;MSEENVQEFVLKEDCELRFAAGDDSDVCLELVKGYAEIFGTELLLNKKYTFPAKSRVAAFTWKGATIELVGTTESAYVAE
STPMVIYLNIHAAMEEVRKKREEQAAGNSNKAKGPRLLLVGPTDVGKTTVSRILCNYSVRQGRTPIFVELDVGQNSVSVP
GTVAAVLVQKTADVIDGFERNQPIVFNFGHTSPSANLSLYEALFKEMATTLNAQIQENDEAKIGGMIINTCGWVDGEGYK
CIVKAASAFEVDVVIVLDHERLYSDLSKELPEFVRLTHVPKSGGVEQRTGQIRSKMRGENVHRYFYGTRANNLYPFTFDV
SFDDVTLCKIGAEQLPDSCLPFGMEVENHETKLVIMEPSADIKHHLFAFSRSTKADENVLKSPVFGFCLVTEVDLEKRTM
SILCPQRTIPSKVLVFSDITHLDDQIKR
;
1 ? 
2 PDB 4OI0       4OI0   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4OI0 A 4 ? 431 ? P52874 1 ? 428 ? 1 428 
2 2 4OI0 B 1 ? 2   ? 4OI0   1 ? 2   ? 1 2   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4OI0 GLY A 1 ? UNP P52874 ? ? 'EXPRESSION TAG' -2 1 
1 4OI0 SER A 2 ? UNP P52874 ? ? 'EXPRESSION TAG' -1 2 
1 4OI0 HIS A 3 ? UNP P52874 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2PE non-polymer         . 'NONAETHYLENE GLYCOL'        ? 'C18 H38 O10'       414.488 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"   ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'        89.093  
ALF non-polymer         . 'TETRAFLUOROALUMINATE ION'   ? 'Al F4 -1'          102.975 
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                        ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'        115.130 
SAR 'peptide linking'   n SARCOSINE                    ? 'C3 H7 N O2'        89.093  
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4OI0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   49.52 
_exptl_crystal.description           
'Diffraction data include Deby-Scherrer rings at 3.62 Angstrom and 2.25 Angstrom resolution from salt in the cryo solution' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
;100 mM Na2HPO4/KH2PO4 
200 mM NaCl 
15 mM MgCl2 
90 mM sarcosine 
25% (w/v) PEG 1000, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.details                'Rigaku VariMax' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2010-08-07 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC KB MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_k_max                  ? 
_reflns.d_resolution_high            2.2 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.limit_l_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.entry_id                     4OI0 
_reflns.B_iso_Wilson_estimate        36.8 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.limit_l_min                  ? 
_reflns.limit_h_min                  ? 
_reflns.R_free_details               ? 
_reflns.number_all                   ? 
_reflns.d_resolution_low             50.0 
_reflns.pdbx_redundancy              3.0 
_reflns.number_obs                   22553 
_reflns.limit_h_max                  ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.3 
_reflns_shell.percent_possible_all   83.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.overall_SU_B                             12.481 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.entry_id                                 4OI0 
_refine.aniso_B[2][3]                            0.00 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_ML                            0.167 
_refine.aniso_B[1][3]                            0.00 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.aniso_B[3][3]                            0.22 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_number_restraints                     ? 
_refine.aniso_B[1][1]                            -0.14 
_refine.pdbx_overall_ESU_R                       0.340 
_refine.ls_R_factor_obs                          0.22938 
_refine.occupancy_min                            ? 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_starting_model                      ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.occupancy_max                            ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.correlation_coeff_Fo_to_Fc               0.921 
_refine.ls_number_reflns_R_free                  1108 
_refine.correlation_coeff_Fo_to_Fc_free          0.887 
_refine.pdbx_ls_sigma_F                          . 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_R_work                       0.22677 
_refine.overall_SU_R_free                        ? 
_refine.ls_d_res_high                            2.20 
_refine.pdbx_overall_ESU_R_Free                  0.251 
_refine.B_iso_min                                ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.B_iso_mean                               26.449 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.ls_R_factor_all                          ? 
_refine.aniso_B[2][2]                            -0.14 
_refine.B_iso_max                                ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_d_res_low                             36.66 
_refine.pdbx_overall_phase_error                 ? 
_refine.solvent_model_details                    MASK 
_refine.aniso_B[1][2]                            -0.07 
_refine.ls_R_factor_R_free                       0.27970 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_number_reflns_obs                     21145 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_number_parameters                     ? 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_number_reflns_all                     ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.solvent_model_param_bsol                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3096 
_refine_hist.pdbx_number_atoms_nucleic_acid   40 
_refine_hist.pdbx_number_atoms_ligand         58 
_refine_hist.number_atoms_solvent             135 
_refine_hist.number_atoms_total               3329 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        36.66 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.009  0.022  ? 3331 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               0.001  0.020  ? 2246 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.155  1.999  ? 4534 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            0.792  3.000  ? 5514 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.718  5.000  ? 421  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       35.607 24.406 ? 143  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       13.431 15.000 ? 579  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       16.614 15.000 ? 19   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.068  0.200  ? 525  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.020  ? 3639 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           0.001  0.020  ? 654  ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.412  1.500  ? 2022 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               0.083  1.500  ? 824  ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 0.779  2.000  ? 3290 ? 'X-RAY DIFFRACTION' 
r_mcangle_other              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.203  3.000  ? 1309 ? 'X-RAY DIFFRACTION' 
r_scbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scangle_it                 1.989  4.500  ? 1231 ? 'X-RAY DIFFRACTION' 
r_scangle_other              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_long_range_B_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_long_range_B_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.number_reflns_R_work             1223 
_refine_ls_shell.R_factor_R_work                  0.562 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.577 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OI0 
_struct.title                     'bound to ssRNA dinucleotide GC, ADP, AlF4-, and Mg2+(transition state, data set I)' 
_struct.pdbx_descriptor           'Protein clpf-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OI0 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN/RNA' 
_struct_keywords.text            'polynucleotide kinase, RNA BINDING PROTEIN-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 86  ? ALA A 108 ? PRO A 83  ALA A 105 1 ? 23 
HELX_P HELX_P2  2  GLY A 129 ? GLN A 144 ? GLY A 126 GLN A 141 1 ? 16 
HELX_P HELX_P3  3  SER A 195 ? ALA A 198 ? SER A 192 ALA A 195 5 ? 4  
HELX_P HELX_P4  4  ASN A 199 ? ILE A 218 ? ASN A 196 ILE A 215 1 ? 20 
HELX_P HELX_P5  5  ASN A 221 ? GLY A 228 ? ASN A 218 GLY A 225 1 ? 8  
HELX_P HELX_P6  6  GLY A 239 ? PHE A 252 ? GLY A 236 PHE A 249 1 ? 14 
HELX_P HELX_P7  7  HIS A 262 ? LEU A 273 ? HIS A 259 LEU A 270 1 ? 12 
HELX_P HELX_P8  8  THR A 292 ? GLY A 310 ? THR A 289 GLY A 307 1 ? 19 
HELX_P HELX_P9  9  ASP A 326 ? VAL A 328 ? ASP A 323 VAL A 325 5 ? 3  
HELX_P HELX_P10 10 SER A 362 ? LYS A 366 ? SER A 359 LYS A 363 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C ADP .   O2B ? ? ? 1_555 D MG  . MG ? ? A ADP 501 A MG  502 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc2 metalc ? ? D MG  .   MG  ? ? ? 1_555 I HOH . O  ? ? A MG  502 A HOH 602 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc3 metalc ? ? D MG  .   MG  ? ? ? 1_555 I HOH . O  ? ? A MG  502 A HOH 601 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc4 metalc ? ? D MG  .   MG  ? ? ? 1_555 I HOH . O  ? ? A MG  502 A HOH 603 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc5 metalc ? ? A THR 131 OG1 ? ? ? 1_555 D MG  . MG ? ? A THR 128 A MG  502 1_555 ? ? ? ? ? ? ? 2.212 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 7 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 9   ? LEU A 14  ? VAL A 6   LEU A 11  
A 2 ALA A 68  ? VAL A 73  ? ALA A 65  VAL A 70  
A 3 VAL A 30  ? GLY A 37  ? VAL A 27  GLY A 34  
A 4 LYS A 51  ? PHE A 54  ? LYS A 48  PHE A 51  
B 1 THR A 44  ? GLU A 45  ? THR A 41  GLU A 42  
B 2 GLU A 40  ? ILE A 41  ? GLU A 37  ILE A 38  
B 3 ARG A 59  ? THR A 64  ? ARG A 56  THR A 61  
B 4 CYS A 18  ? ALA A 24  ? CYS A 15  ALA A 21  
B 5 THR A 76  ? ALA A 82  ? THR A 73  ALA A 79  
C 1 ILE A 187 ? ASN A 190 ? ILE A 184 ASN A 187 
C 2 THR A 165 ? LEU A 170 ? THR A 162 LEU A 167 
C 3 ILE A 149 ? GLU A 152 ? ILE A 146 GLU A 149 
C 4 MET A 229 ? ASN A 232 ? MET A 226 ASN A 229 
C 5 ARG A 119 ? VAL A 123 ? ARG A 116 VAL A 120 
C 6 VAL A 256 ? LEU A 260 ? VAL A 253 LEU A 257 
C 7 ARG A 278 ? VAL A 282 ? ARG A 275 VAL A 279 
D 1 PHE A 319 ? SER A 324 ? PHE A 316 SER A 321 
D 2 THR A 402 ? CYS A 407 ? THR A 399 CYS A 404 
D 3 VAL A 387 ? ASP A 397 ? VAL A 384 ASP A 394 
D 4 HIS A 368 ? SER A 373 ? HIS A 365 SER A 370 
D 5 VAL A 416 ? THR A 423 ? VAL A 413 THR A 420 
D 6 THR A 329 ? ILE A 333 ? THR A 326 ILE A 330 
D 7 LEU A 356 ? ILE A 358 ? LEU A 353 ILE A 355 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 14  ? N LEU A 11  O ALA A 68  ? O ALA A 65  
A 2 3 O VAL A 73  ? O VAL A 70  N CYS A 31  ? N CYS A 28  
A 3 4 N VAL A 30  ? N VAL A 27  O PHE A 54  ? O PHE A 51  
B 1 2 O THR A 44  ? O THR A 41  N ILE A 41  ? N ILE A 38  
B 2 3 N GLU A 40  ? N GLU A 37  O PHE A 63  ? O PHE A 60  
B 3 4 O VAL A 60  ? O VAL A 57  N PHE A 22  ? N PHE A 19  
B 4 5 N GLU A 19  ? N GLU A 16  O ALA A 82  ? O ALA A 79  
C 1 2 O ILE A 187 ? O ILE A 184 N ALA A 168 ? N ALA A 165 
C 2 3 O VAL A 169 ? O VAL A 166 N PHE A 150 ? N PHE A 147 
C 3 4 N VAL A 151 ? N VAL A 148 O ASN A 232 ? O ASN A 229 
C 4 5 O ILE A 231 ? O ILE A 228 N LEU A 120 ? N LEU A 117 
C 5 6 N LEU A 121 ? N LEU A 118 O ILE A 258 ? O ILE A 255 
C 6 7 N VAL A 257 ? N VAL A 254 O THR A 280 ? O THR A 277 
D 1 2 N PHE A 319 ? N PHE A 316 O CYS A 407 ? O CYS A 404 
D 2 3 O THR A 402 ? O THR A 399 N ASP A 397 ? N ASP A 394 
D 3 4 O PHE A 388 ? O PHE A 385 N PHE A 372 ? N PHE A 369 
D 4 5 N ALA A 371 ? N ALA A 368 O VAL A 418 ? O VAL A 415 
D 5 6 O PHE A 419 ? O PHE A 416 N CYS A 331 ? N CYS A 328 
D 6 7 N LYS A 332 ? N LYS A 329 O VAL A 357 ? O VAL A 354 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADP A 501' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ALF A 503' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SAR A 504' 
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SAR A 505' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE 2PE A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 GLU A 19  ? GLU A 16  . ? 1_555 ? 
2  AC1 20 ARG A 59  ? ARG A 56  . ? 1_555 ? 
3  AC1 20 ALA A 61  ? ALA A 58  . ? 1_555 ? 
4  AC1 20 ASP A 127 ? ASP A 124 . ? 1_555 ? 
5  AC1 20 VAL A 128 ? VAL A 125 . ? 1_555 ? 
6  AC1 20 GLY A 129 ? GLY A 126 . ? 1_555 ? 
7  AC1 20 LYS A 130 ? LYS A 127 . ? 1_555 ? 
8  AC1 20 THR A 131 ? THR A 128 . ? 1_555 ? 
9  AC1 20 THR A 132 ? THR A 129 . ? 1_555 ? 
10 AC1 20 SER A 285 ? SER A 282 . ? 1_555 ? 
11 AC1 20 GLY A 287 ? GLY A 284 . ? 1_555 ? 
12 AC1 20 GLU A 289 ? GLU A 286 . ? 1_555 ? 
13 AC1 20 ARG A 291 ? ARG A 288 . ? 1_555 ? 
14 AC1 20 MG  D .   ? MG  A 502 . ? 1_555 ? 
15 AC1 20 ALF E .   ? ALF A 503 . ? 1_555 ? 
16 AC1 20 HOH I .   ? HOH A 602 . ? 1_555 ? 
17 AC1 20 HOH I .   ? HOH A 603 . ? 1_555 ? 
18 AC1 20 HOH I .   ? HOH A 613 . ? 1_555 ? 
19 AC1 20 HOH I .   ? HOH A 628 . ? 1_555 ? 
20 AC1 20 HOH I .   ? HOH A 698 . ? 1_555 ? 
21 AC2 6  THR A 131 ? THR A 128 . ? 1_555 ? 
22 AC2 6  ADP C .   ? ADP A 501 . ? 1_555 ? 
23 AC2 6  ALF E .   ? ALF A 503 . ? 1_555 ? 
24 AC2 6  HOH I .   ? HOH A 601 . ? 1_555 ? 
25 AC2 6  HOH I .   ? HOH A 602 . ? 1_555 ? 
26 AC2 6  HOH I .   ? HOH A 603 . ? 1_555 ? 
27 AC3 14 THR A 126 ? THR A 123 . ? 1_555 ? 
28 AC3 14 ASP A 127 ? ASP A 124 . ? 1_555 ? 
29 AC3 14 LYS A 130 ? LYS A 127 . ? 1_555 ? 
30 AC3 14 ASP A 154 ? ASP A 151 . ? 1_555 ? 
31 AC3 14 GLN A 157 ? GLN A 154 . ? 1_555 ? 
32 AC3 14 GLY A 235 ? GLY A 232 . ? 1_555 ? 
33 AC3 14 ARG A 291 ? ARG A 288 . ? 1_555 ? 
34 AC3 14 ARG A 296 ? ARG A 293 . ? 1_555 ? 
35 AC3 14 ADP C .   ? ADP A 501 . ? 1_555 ? 
36 AC3 14 MG  D .   ? MG  A 502 . ? 1_555 ? 
37 AC3 14 HOH I .   ? HOH A 601 . ? 1_555 ? 
38 AC3 14 HOH I .   ? HOH A 602 . ? 1_555 ? 
39 AC3 14 HOH I .   ? HOH A 603 . ? 1_555 ? 
40 AC3 14 G   B 1   ? G   B 1   . ? 1_555 ? 
41 AC4 2  TYR A 80  ? TYR A 77  . ? 1_555 ? 
42 AC4 2  HOH I .   ? HOH A 706 . ? 1_555 ? 
43 AC5 2  GLN A 185 ? GLN A 182 . ? 1_555 ? 
44 AC5 2  HOH I .   ? HOH A 692 . ? 1_555 ? 
45 AC6 3  TRP A 65  ? TRP A 62  . ? 1_555 ? 
46 AC6 3  LEU A 91  ? LEU A 88  . ? 1_555 ? 
47 AC6 3  TYR A 140 ? TYR A 137 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4OI0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4OI0 
_atom_sites.fract_transf_matrix[1][1]   0.009930 
_atom_sites.fract_transf_matrix[1][2]   0.005733 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011466 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024752 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AL 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 7   ? 17.622  23.670 -5.378  1.00 45.85 ? 4   GLU A N     1 
ATOM   2    C  CA    . GLU A 1 7   ? 18.963  23.077 -5.668  1.00 46.24 ? 4   GLU A CA    1 
ATOM   3    C  C     . GLU A 1 7   ? 19.072  21.582 -5.261  1.00 42.90 ? 4   GLU A C     1 
ATOM   4    O  O     . GLU A 1 7   ? 19.467  20.738 -6.071  1.00 42.30 ? 4   GLU A O     1 
ATOM   5    C  CB    . GLU A 1 7   ? 20.035  23.910 -4.967  1.00 50.56 ? 4   GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 7   ? 21.364  24.024 -5.732  1.00 53.76 ? 4   GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 7   ? 21.986  25.419 -5.645  1.00 60.02 ? 4   GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 7   ? 23.233  25.532 -5.635  1.00 63.97 ? 4   GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 7   ? 21.226  26.410 -5.596  1.00 63.28 ? 4   GLU A OE2   1 
ATOM   10   N  N     . ASN A 1 8   ? 18.749  21.269 -4.004  1.00 41.41 ? 5   ASN A N     1 
ATOM   11   C  CA    . ASN A 1 8   ? 18.626  19.877 -3.542  1.00 37.69 ? 5   ASN A CA    1 
ATOM   12   C  C     . ASN A 1 8   ? 17.388  19.241 -4.187  1.00 33.75 ? 5   ASN A C     1 
ATOM   13   O  O     . ASN A 1 8   ? 16.356  19.900 -4.343  1.00 32.98 ? 5   ASN A O     1 
ATOM   14   C  CB    . ASN A 1 8   ? 18.458  19.821 -2.022  1.00 38.64 ? 5   ASN A CB    1 
ATOM   15   C  CG    . ASN A 1 8   ? 19.732  20.179 -1.253  1.00 41.54 ? 5   ASN A CG    1 
ATOM   16   O  OD1   . ASN A 1 8   ? 20.843  20.246 -1.806  1.00 38.67 ? 5   ASN A OD1   1 
ATOM   17   N  ND2   . ASN A 1 8   ? 19.564  20.409 0.046   1.00 41.96 ? 5   ASN A ND2   1 
ATOM   18   N  N     . VAL A 1 9   ? 17.487  17.970 -4.558  1.00 30.80 ? 6   VAL A N     1 
ATOM   19   C  CA    . VAL A 1 9   ? 16.399  17.291 -5.270  1.00 27.56 ? 6   VAL A CA    1 
ATOM   20   C  C     . VAL A 1 9   ? 15.980  16.004 -4.557  1.00 25.50 ? 6   VAL A C     1 
ATOM   21   O  O     . VAL A 1 9   ? 16.811  15.229 -4.068  1.00 25.52 ? 6   VAL A O     1 
ATOM   22   C  CB    . VAL A 1 9   ? 16.788  16.994 -6.740  1.00 27.47 ? 6   VAL A CB    1 
ATOM   23   C  CG1   . VAL A 1 9   ? 15.609  16.400 -7.516  1.00 25.31 ? 6   VAL A CG1   1 
ATOM   24   C  CG2   . VAL A 1 9   ? 17.287  18.272 -7.432  1.00 29.36 ? 6   VAL A CG2   1 
ATOM   25   N  N     . GLN A 1 10  ? 14.676  15.791 -4.505  1.00 23.47 ? 7   GLN A N     1 
ATOM   26   C  CA    . GLN A 1 10  ? 14.100  14.588 -3.924  1.00 22.84 ? 7   GLN A CA    1 
ATOM   27   C  C     . GLN A 1 10  ? 13.134  13.956 -4.917  1.00 20.70 ? 7   GLN A C     1 
ATOM   28   O  O     . GLN A 1 10  ? 12.294  14.643 -5.491  1.00 19.98 ? 7   GLN A O     1 
ATOM   29   C  CB    . GLN A 1 10  ? 13.372  14.924 -2.625  1.00 23.20 ? 7   GLN A CB    1 
ATOM   30   C  CG    . GLN A 1 10  ? 14.289  15.118 -1.440  1.00 27.27 ? 7   GLN A CG    1 
ATOM   31   C  CD    . GLN A 1 10  ? 13.519  15.398 -0.158  1.00 30.51 ? 7   GLN A CD    1 
ATOM   32   O  OE1   . GLN A 1 10  ? 13.027  16.508 0.066   1.00 30.46 ? 7   GLN A OE1   1 
ATOM   33   N  NE2   . GLN A 1 10  ? 13.422  14.393 0.694   1.00 33.73 ? 7   GLN A NE2   1 
ATOM   34   N  N     . GLU A 1 11  ? 13.257  12.651 -5.120  1.00 20.47 ? 8   GLU A N     1 
ATOM   35   C  CA    . GLU A 1 11  ? 12.407  11.933 -6.070  1.00 19.43 ? 8   GLU A CA    1 
ATOM   36   C  C     . GLU A 1 11  ? 11.574  10.904 -5.314  1.00 19.63 ? 8   GLU A C     1 
ATOM   37   O  O     . GLU A 1 11  ? 12.082  10.252 -4.412  1.00 20.85 ? 8   GLU A O     1 
ATOM   38   C  CB    . GLU A 1 11  ? 13.265  11.232 -7.120  1.00 20.36 ? 8   GLU A CB    1 
ATOM   39   C  CG    . GLU A 1 11  ? 14.247  12.145 -7.865  1.00 20.12 ? 8   GLU A CG    1 
ATOM   40   C  CD    . GLU A 1 11  ? 13.590  13.067 -8.858  1.00 19.36 ? 8   GLU A CD    1 
ATOM   41   O  OE1   . GLU A 1 11  ? 12.410  12.857 -9.240  1.00 18.52 ? 8   GLU A OE1   1 
ATOM   42   O  OE2   . GLU A 1 11  ? 14.273  14.011 -9.287  1.00 20.88 ? 8   GLU A OE2   1 
ATOM   43   N  N     . PHE A 1 12  ? 10.306  10.759 -5.691  1.00 18.87 ? 9   PHE A N     1 
ATOM   44   C  CA    . PHE A 1 12  ? 9.374   9.892  -4.975  1.00 19.81 ? 9   PHE A CA    1 
ATOM   45   C  C     . PHE A 1 12  ? 8.553   9.050  -5.952  1.00 20.28 ? 9   PHE A C     1 
ATOM   46   O  O     . PHE A 1 12  ? 8.035   9.566  -6.951  1.00 18.80 ? 9   PHE A O     1 
ATOM   47   C  CB    . PHE A 1 12  ? 8.421   10.730 -4.106  1.00 18.89 ? 9   PHE A CB    1 
ATOM   48   C  CG    . PHE A 1 12  ? 9.103   11.434 -2.954  1.00 20.17 ? 9   PHE A CG    1 
ATOM   49   C  CD1   . PHE A 1 12  ? 9.480   12.767 -3.054  1.00 19.86 ? 9   PHE A CD1   1 
ATOM   50   C  CD2   . PHE A 1 12  ? 9.355   10.771 -1.775  1.00 22.65 ? 9   PHE A CD2   1 
ATOM   51   C  CE1   . PHE A 1 12  ? 10.102  13.409 -1.994  1.00 20.28 ? 9   PHE A CE1   1 
ATOM   52   C  CE2   . PHE A 1 12  ? 9.985   11.418 -0.716  1.00 24.14 ? 9   PHE A CE2   1 
ATOM   53   C  CZ    . PHE A 1 12  ? 10.347  12.746 -0.841  1.00 23.08 ? 9   PHE A CZ    1 
ATOM   54   N  N     . VAL A 1 13  ? 8.462   7.755  -5.665  1.00 22.31 ? 10  VAL A N     1 
ATOM   55   C  CA    . VAL A 1 13  ? 7.566   6.856  -6.394  1.00 23.77 ? 10  VAL A CA    1 
ATOM   56   C  C     . VAL A 1 13  ? 6.358   6.592  -5.499  1.00 23.86 ? 10  VAL A C     1 
ATOM   57   O  O     . VAL A 1 13  ? 6.499   6.078  -4.401  1.00 25.29 ? 10  VAL A O     1 
ATOM   58   C  CB    . VAL A 1 13  ? 8.252   5.521  -6.795  1.00 26.55 ? 10  VAL A CB    1 
ATOM   59   C  CG1   . VAL A 1 13  ? 7.292   4.634  -7.584  1.00 28.24 ? 10  VAL A CG1   1 
ATOM   60   C  CG2   . VAL A 1 13  ? 9.486   5.792  -7.639  1.00 27.02 ? 10  VAL A CG2   1 
ATOM   61   N  N     . LEU A 1 14  ? 5.184   6.986  -5.972  1.00 23.39 ? 11  LEU A N     1 
ATOM   62   C  CA    . LEU A 1 14  ? 3.922   6.773  -5.264  1.00 23.70 ? 11  LEU A CA    1 
ATOM   63   C  C     . LEU A 1 14  ? 3.156   5.606  -5.900  1.00 25.70 ? 11  LEU A C     1 
ATOM   64   O  O     . LEU A 1 14  ? 2.795   5.663  -7.085  1.00 25.14 ? 11  LEU A O     1 
ATOM   65   C  CB    . LEU A 1 14  ? 3.063   8.032  -5.341  1.00 22.17 ? 11  LEU A CB    1 
ATOM   66   C  CG    . LEU A 1 14  ? 3.473   9.264  -4.520  1.00 21.81 ? 11  LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1 14  ? 4.783   9.864  -5.018  1.00 21.47 ? 11  LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1 14  ? 2.362   10.290 -4.585  1.00 21.51 ? 11  LEU A CD2   1 
ATOM   69   N  N     . LYS A 1 15  ? 2.922   4.546  -5.128  1.00 27.79 ? 12  LYS A N     1 
ATOM   70   C  CA    . LYS A 1 15  ? 2.009   3.491  -5.562  1.00 30.09 ? 12  LYS A CA    1 
ATOM   71   C  C     . LYS A 1 15  ? 0.618   4.069  -5.656  1.00 28.25 ? 12  LYS A C     1 
ATOM   72   O  O     . LYS A 1 15  ? 0.368   5.147  -5.138  1.00 25.51 ? 12  LYS A O     1 
ATOM   73   C  CB    . LYS A 1 15  ? 2.003   2.317  -4.575  1.00 33.45 ? 12  LYS A CB    1 
ATOM   74   C  CG    . LYS A 1 15  ? 3.152   1.358  -4.763  1.00 36.78 ? 12  LYS A CG    1 
ATOM   75   C  CD    . LYS A 1 15  ? 3.083   0.184  -3.786  1.00 42.92 ? 12  LYS A CD    1 
ATOM   76   C  CE    . LYS A 1 15  ? 3.277   0.622  -2.346  1.00 43.61 ? 12  LYS A CE    1 
ATOM   77   N  NZ    . LYS A 1 15  ? 4.255   1.748  -2.236  1.00 41.59 ? 12  LYS A NZ    1 
ATOM   78   N  N     . GLU A 1 16  ? -0.281  3.359  -6.323  1.00 30.11 ? 13  GLU A N     1 
ATOM   79   C  CA    . GLU A 1 16  ? -1.692  3.727  -6.329  1.00 29.63 ? 13  GLU A CA    1 
ATOM   80   C  C     . GLU A 1 16  ? -2.197  3.978  -4.909  1.00 28.80 ? 13  GLU A C     1 
ATOM   81   O  O     . GLU A 1 16  ? -1.765  3.323  -3.954  1.00 30.39 ? 13  GLU A O     1 
ATOM   82   C  CB    . GLU A 1 16  ? -2.548  2.641  -6.998  1.00 33.27 ? 13  GLU A CB    1 
ATOM   83   C  CG    . GLU A 1 16  ? -2.504  1.258  -6.347  1.00 37.95 ? 13  GLU A CG    1 
ATOM   84   C  CD    . GLU A 1 16  ? -3.391  0.242  -7.071  1.00 43.98 ? 13  GLU A CD    1 
ATOM   85   O  OE1   . GLU A 1 16  ? -4.578  0.554  -7.336  1.00 47.10 ? 13  GLU A OE1   1 
ATOM   86   O  OE2   . GLU A 1 16  ? -2.917  -0.873 -7.363  1.00 46.99 ? 13  GLU A OE2   1 
ATOM   87   N  N     . ASP A 1 17  ? -3.106  4.938  -4.782  1.00 26.42 ? 14  ASP A N     1 
ATOM   88   C  CA    . ASP A 1 17  ? -3.750  5.253  -3.504  1.00 26.25 ? 14  ASP A CA    1 
ATOM   89   C  C     . ASP A 1 17  ? -2.765  5.711  -2.399  1.00 25.63 ? 14  ASP A C     1 
ATOM   90   O  O     . ASP A 1 17  ? -3.041  5.549  -1.228  1.00 26.18 ? 14  ASP A O     1 
ATOM   91   C  CB    . ASP A 1 17  ? -4.611  4.060  -3.037  1.00 29.27 ? 14  ASP A CB    1 
ATOM   92   C  CG    . ASP A 1 17  ? -5.624  3.609  -4.108  1.00 31.40 ? 14  ASP A CG    1 
ATOM   93   O  OD1   . ASP A 1 17  ? -6.418  4.453  -4.578  1.00 31.07 ? 14  ASP A OD1   1 
ATOM   94   O  OD2   . ASP A 1 17  ? -5.619  2.414  -4.490  1.00 36.19 ? 14  ASP A OD2   1 
ATOM   95   N  N     . CYS A 1 18  ? -1.623  6.288  -2.790  1.00 24.60 ? 15  CYS A N     1 
ATOM   96   C  CA    . CYS A 1 18  ? -0.657  6.846  -1.844  1.00 24.23 ? 15  CYS A CA    1 
ATOM   97   C  C     . CYS A 1 18  ? -0.570  8.344  -2.032  1.00 22.49 ? 15  CYS A C     1 
ATOM   98   O  O     . CYS A 1 18  ? -0.918  8.844  -3.100  1.00 21.91 ? 15  CYS A O     1 
ATOM   99   C  CB    . CYS A 1 18  ? 0.724   6.231  -2.054  1.00 24.96 ? 15  CYS A CB    1 
ATOM   100  S  SG    . CYS A 1 18  ? 0.768   4.441  -1.767  1.00 28.23 ? 15  CYS A SG    1 
ATOM   101  N  N     . GLU A 1 19  ? -0.132  9.066  -0.998  1.00 22.72 ? 16  GLU A N     1 
ATOM   102  C  CA    . GLU A 1 19  ? 0.125   10.501 -1.136  1.00 21.60 ? 16  GLU A CA    1 
ATOM   103  C  C     . GLU A 1 19  ? 1.455   10.935 -0.541  1.00 21.73 ? 16  GLU A C     1 
ATOM   104  O  O     . GLU A 1 19  ? 1.830   10.525 0.553   1.00 23.32 ? 16  GLU A O     1 
ATOM   105  C  CB    . GLU A 1 19  ? -1.008  11.380 -0.548  1.00 22.06 ? 16  GLU A CB    1 
ATOM   106  C  CG    . GLU A 1 19  ? -1.289  11.216 0.939   1.00 24.76 ? 16  GLU A CG    1 
ATOM   107  C  CD    . GLU A 1 19  ? -2.411  12.139 1.473   1.00 26.58 ? 16  GLU A CD    1 
ATOM   108  O  OE1   . GLU A 1 19  ? -3.238  12.638 0.684   1.00 27.01 ? 16  GLU A OE1   1 
ATOM   109  O  OE2   . GLU A 1 19  ? -2.459  12.368 2.706   1.00 28.60 ? 16  GLU A OE2   1 
ATOM   110  N  N     . LEU A 1 20  ? 2.142   11.788 -1.295  1.00 20.19 ? 17  LEU A N     1 
ATOM   111  C  CA    . LEU A 1 20  ? 3.329   12.488 -0.840  1.00 20.46 ? 17  LEU A CA    1 
ATOM   112  C  C     . LEU A 1 20  ? 2.891   13.669 0.004   1.00 20.99 ? 17  LEU A C     1 
ATOM   113  O  O     . LEU A 1 20  ? 2.143   14.514 -0.469  1.00 20.18 ? 17  LEU A O     1 
ATOM   114  C  CB    . LEU A 1 20  ? 4.130   13.000 -2.046  1.00 19.37 ? 17  LEU A CB    1 
ATOM   115  C  CG    . LEU A 1 20  ? 5.406   13.823 -1.831  1.00 18.69 ? 17  LEU A CG    1 
ATOM   116  C  CD1   . LEU A 1 20  ? 6.460   13.074 -1.022  1.00 19.34 ? 17  LEU A CD1   1 
ATOM   117  C  CD2   . LEU A 1 20  ? 5.951   14.232 -3.193  1.00 15.39 ? 17  LEU A CD2   1 
ATOM   118  N  N     . ARG A 1 21  ? 3.369   13.726 1.242   1.00 23.16 ? 18  ARG A N     1 
ATOM   119  C  CA    . ARG A 1 21  ? 3.116   14.850 2.129   1.00 24.61 ? 18  ARG A CA    1 
ATOM   120  C  C     . ARG A 1 21  ? 4.424   15.527 2.441   1.00 26.29 ? 18  ARG A C     1 
ATOM   121  O  O     . ARG A 1 21  ? 5.391   14.865 2.842   1.00 27.13 ? 18  ARG A O     1 
ATOM   122  C  CB    . ARG A 1 21  ? 2.488   14.375 3.431   1.00 26.76 ? 18  ARG A CB    1 
ATOM   123  C  CG    . ARG A 1 21  ? 1.168   13.661 3.256   1.00 26.40 ? 18  ARG A CG    1 
ATOM   124  C  CD    . ARG A 1 21  ? 0.782   12.940 4.519   1.00 29.61 ? 18  ARG A CD    1 
ATOM   125  N  NE    . ARG A 1 21  ? -0.483  12.228 4.371   1.00 28.73 ? 18  ARG A NE    1 
ATOM   126  C  CZ    . ARG A 1 21  ? -0.918  11.305 5.225   1.00 31.03 ? 18  ARG A CZ    1 
ATOM   127  N  NH1   . ARG A 1 21  ? -0.190  10.955 6.276   1.00 33.27 ? 18  ARG A NH1   1 
ATOM   128  N  NH2   . ARG A 1 21  ? -2.084  10.712 5.010   1.00 31.00 ? 18  ARG A NH2   1 
ATOM   129  N  N     . PHE A 1 22  ? 4.458   16.845 2.281   1.00 26.94 ? 19  PHE A N     1 
ATOM   130  C  CA    . PHE A 1 22  ? 5.665   17.593 2.589   1.00 29.56 ? 19  PHE A CA    1 
ATOM   131  C  C     . PHE A 1 22  ? 5.372   18.993 3.101   1.00 32.10 ? 19  PHE A C     1 
ATOM   132  O  O     . PHE A 1 22  ? 4.263   19.508 2.955   1.00 31.69 ? 19  PHE A O     1 
ATOM   133  C  CB    . PHE A 1 22  ? 6.607   17.639 1.368   1.00 28.02 ? 19  PHE A CB    1 
ATOM   134  C  CG    . PHE A 1 22  ? 6.093   18.462 0.233   1.00 27.14 ? 19  PHE A CG    1 
ATOM   135  C  CD1   . PHE A 1 22  ? 5.159   17.943 -0.647  1.00 25.33 ? 19  PHE A CD1   1 
ATOM   136  C  CD2   . PHE A 1 22  ? 6.547   19.757 0.037   1.00 29.57 ? 19  PHE A CD2   1 
ATOM   137  C  CE1   . PHE A 1 22  ? 4.672   18.712 -1.699  1.00 25.75 ? 19  PHE A CE1   1 
ATOM   138  C  CE2   . PHE A 1 22  ? 6.070   20.532 -1.024  1.00 29.49 ? 19  PHE A CE2   1 
ATOM   139  C  CZ    . PHE A 1 22  ? 5.135   20.008 -1.889  1.00 26.94 ? 19  PHE A CZ    1 
ATOM   140  N  N     . ALA A 1 23  ? 6.386   19.586 3.722   1.00 35.30 ? 20  ALA A N     1 
ATOM   141  C  CA    . ALA A 1 23  ? 6.335   20.971 4.117   1.00 38.78 ? 20  ALA A CA    1 
ATOM   142  C  C     . ALA A 1 23  ? 7.604   21.643 3.633   1.00 40.44 ? 20  ALA A C     1 
ATOM   143  O  O     . ALA A 1 23  ? 8.708   21.142 3.876   1.00 41.40 ? 20  ALA A O     1 
ATOM   144  C  CB    . ALA A 1 23  ? 6.195   21.099 5.648   1.00 42.68 ? 20  ALA A CB    1 
ATOM   145  N  N     . ALA A 1 24  ? 7.450   22.768 2.934   1.00 41.46 ? 21  ALA A N     1 
ATOM   146  C  CA    . ALA A 1 24  ? 8.599   23.562 2.508   1.00 43.50 ? 21  ALA A CA    1 
ATOM   147  C  C     . ALA A 1 24  ? 9.304   24.084 3.740   1.00 48.49 ? 21  ALA A C     1 
ATOM   148  O  O     . ALA A 1 24  ? 8.672   24.279 4.775   1.00 50.93 ? 21  ALA A O     1 
ATOM   149  C  CB    . ALA A 1 24  ? 8.162   24.708 1.639   1.00 44.25 ? 21  ALA A CB    1 
ATOM   150  N  N     . GLY A 1 25  ? 10.609  24.307 3.629   1.00 50.61 ? 22  GLY A N     1 
ATOM   151  C  CA    . GLY A 1 25  ? 11.392  24.813 4.750   1.00 56.07 ? 22  GLY A CA    1 
ATOM   152  C  C     . GLY A 1 25  ? 10.925  26.184 5.195   1.00 60.87 ? 22  GLY A C     1 
ATOM   153  O  O     . GLY A 1 25  ? 10.173  26.854 4.482   1.00 60.27 ? 22  GLY A O     1 
ATOM   154  N  N     . ASP A 1 26  ? 11.352  26.595 6.387   1.00 66.35 ? 23  ASP A N     1 
ATOM   155  C  CA    . ASP A 1 26  ? 11.036  27.924 6.896   1.00 71.91 ? 23  ASP A CA    1 
ATOM   156  C  C     . ASP A 1 26  ? 11.528  28.996 5.928   1.00 73.79 ? 23  ASP A C     1 
ATOM   157  O  O     . ASP A 1 26  ? 10.817  29.955 5.641   1.00 75.65 ? 23  ASP A O     1 
ATOM   158  C  CB    . ASP A 1 26  ? 11.678  28.147 8.270   1.00 78.03 ? 23  ASP A CB    1 
ATOM   159  C  CG    . ASP A 1 26  ? 10.899  27.495 9.397   1.00 78.46 ? 23  ASP A CG    1 
ATOM   160  O  OD1   . ASP A 1 26  ? 10.320  26.406 9.178   1.00 72.28 ? 23  ASP A OD1   1 
ATOM   161  O  OD2   . ASP A 1 26  ? 10.876  28.082 10.506  1.00 83.84 ? 23  ASP A OD2   1 
ATOM   162  N  N     . ASP A 1 27  ? 12.739  28.803 5.412   1.00 73.58 ? 24  ASP A N     1 
ATOM   163  C  CA    . ASP A 1 27  ? 13.443  29.827 4.643   1.00 76.67 ? 24  ASP A CA    1 
ATOM   164  C  C     . ASP A 1 27  ? 13.294  29.759 3.113   1.00 72.49 ? 24  ASP A C     1 
ATOM   165  O  O     . ASP A 1 27  ? 13.632  30.725 2.434   1.00 75.48 ? 24  ASP A O     1 
ATOM   166  C  CB    . ASP A 1 27  ? 14.946  29.783 4.982   1.00 79.76 ? 24  ASP A CB    1 
ATOM   167  C  CG    . ASP A 1 27  ? 15.245  30.170 6.425   1.00 86.18 ? 24  ASP A CG    1 
ATOM   168  O  OD1   . ASP A 1 27  ? 16.425  30.069 6.821   1.00 89.01 ? 24  ASP A OD1   1 
ATOM   169  O  OD2   . ASP A 1 27  ? 14.318  30.575 7.163   1.00 89.49 ? 24  ASP A OD2   1 
ATOM   170  N  N     . SER A 1 28  ? 12.815  28.650 2.553   1.00 66.61 ? 25  SER A N     1 
ATOM   171  C  CA    . SER A 1 28  ? 12.874  28.487 1.091   1.00 63.15 ? 25  SER A CA    1 
ATOM   172  C  C     . SER A 1 28  ? 11.582  27.987 0.454   1.00 58.27 ? 25  SER A C     1 
ATOM   173  O  O     . SER A 1 28  ? 10.694  27.468 1.132   1.00 56.73 ? 25  SER A O     1 
ATOM   174  C  CB    . SER A 1 28  ? 14.046  27.572 0.704   1.00 60.88 ? 25  SER A CB    1 
ATOM   175  O  OG    . SER A 1 28  ? 13.648  26.210 0.636   1.00 57.10 ? 25  SER A OG    1 
ATOM   176  N  N     . ASP A 1 29  ? 11.498  28.165 -0.863  1.00 56.47 ? 26  ASP A N     1 
ATOM   177  C  CA    . ASP A 1 29  ? 10.413  27.604 -1.673  1.00 52.10 ? 26  ASP A CA    1 
ATOM   178  C  C     . ASP A 1 29  ? 10.693  26.143 -1.969  1.00 47.08 ? 26  ASP A C     1 
ATOM   179  O  O     . ASP A 1 29  ? 11.844  25.722 -1.997  1.00 47.19 ? 26  ASP A O     1 
ATOM   180  C  CB    . ASP A 1 29  ? 10.312  28.327 -3.021  1.00 53.04 ? 26  ASP A CB    1 
ATOM   181  C  CG    . ASP A 1 29  ? 9.890   29.768 -2.891  1.00 58.58 ? 26  ASP A CG    1 
ATOM   182  O  OD1   . ASP A 1 29  ? 9.102   30.094 -1.980  1.00 60.98 ? 26  ASP A OD1   1 
ATOM   183  O  OD2   . ASP A 1 29  ? 10.333  30.581 -3.725  1.00 62.20 ? 26  ASP A OD2   1 
ATOM   184  N  N     . VAL A 1 30  ? 9.634   25.382 -2.219  1.00 43.28 ? 27  VAL A N     1 
ATOM   185  C  CA    . VAL A 1 30  ? 9.761   24.032 -2.759  1.00 38.92 ? 27  VAL A CA    1 
ATOM   186  C  C     . VAL A 1 30  ? 8.962   23.921 -4.041  1.00 36.90 ? 27  VAL A C     1 
ATOM   187  O  O     . VAL A 1 30  ? 7.767   24.198 -4.056  1.00 36.18 ? 27  VAL A O     1 
ATOM   188  C  CB    . VAL A 1 30  ? 9.267   22.967 -1.786  1.00 36.95 ? 27  VAL A CB    1 
ATOM   189  C  CG1   . VAL A 1 30  ? 9.158   21.606 -2.503  1.00 32.56 ? 27  VAL A CG1   1 
ATOM   190  C  CG2   . VAL A 1 30  ? 10.212  22.884 -0.593  1.00 38.56 ? 27  VAL A CG2   1 
ATOM   191  N  N     . CYS A 1 31  ? 9.640   23.517 -5.114  1.00 36.09 ? 28  CYS A N     1 
ATOM   192  C  CA    . CYS A 1 31  ? 8.999   23.297 -6.403  1.00 34.83 ? 28  CYS A CA    1 
ATOM   193  C  C     . CYS A 1 31  ? 8.680   21.806 -6.608  1.00 30.91 ? 28  CYS A C     1 
ATOM   194  O  O     . CYS A 1 31  ? 9.540   20.930 -6.418  1.00 30.07 ? 28  CYS A O     1 
ATOM   195  C  CB    . CYS A 1 31  ? 9.884   23.832 -7.528  1.00 37.15 ? 28  CYS A CB    1 
ATOM   196  S  SG    . CYS A 1 31  ? 9.151   23.688 -9.174  1.00 39.22 ? 28  CYS A SG    1 
ATOM   197  N  N     . LEU A 1 32  ? 7.426   21.540 -6.964  1.00 28.60 ? 29  LEU A N     1 
ATOM   198  C  CA    . LEU A 1 32  ? 6.908   20.200 -7.187  1.00 25.21 ? 29  LEU A CA    1 
ATOM   199  C  C     . LEU A 1 32  ? 6.644   19.966 -8.667  1.00 24.64 ? 29  LEU A C     1 
ATOM   200  O  O     . LEU A 1 32  ? 6.058   20.812 -9.331  1.00 26.02 ? 29  LEU A O     1 
ATOM   201  C  CB    . LEU A 1 32  ? 5.597   20.020 -6.429  1.00 24.03 ? 29  LEU A CB    1 
ATOM   202  C  CG    . LEU A 1 32  ? 4.903   18.668 -6.655  1.00 21.75 ? 29  LEU A CG    1 
ATOM   203  C  CD1   . LEU A 1 32  ? 4.279   18.171 -5.388  1.00 19.50 ? 29  LEU A CD1   1 
ATOM   204  C  CD2   . LEU A 1 32  ? 3.858   18.756 -7.795  1.00 22.23 ? 29  LEU A CD2   1 
ATOM   205  N  N     . GLU A 1 33  ? 7.052   18.808 -9.173  1.00 22.94 ? 30  GLU A N     1 
ATOM   206  C  CA    . GLU A 1 33  ? 6.783   18.445 -10.558 1.00 22.92 ? 30  GLU A CA    1 
ATOM   207  C  C     . GLU A 1 33  ? 6.375   16.984 -10.674 1.00 20.94 ? 30  GLU A C     1 
ATOM   208  O  O     . GLU A 1 33  ? 7.125   16.085 -10.275 1.00 20.08 ? 30  GLU A O     1 
ATOM   209  C  CB    . GLU A 1 33  ? 8.013   18.719 -11.434 1.00 24.86 ? 30  GLU A CB    1 
ATOM   210  C  CG    . GLU A 1 33  ? 7.758   18.529 -12.912 1.00 26.43 ? 30  GLU A CG    1 
ATOM   211  C  CD    . GLU A 1 33  ? 8.998   18.681 -13.757 1.00 29.76 ? 30  GLU A CD    1 
ATOM   212  O  OE1   . GLU A 1 33  ? 10.039  19.116 -13.228 1.00 31.67 ? 30  GLU A OE1   1 
ATOM   213  O  OE2   . GLU A 1 33  ? 8.928   18.357 -14.960 1.00 31.05 ? 30  GLU A OE2   1 
ATOM   214  N  N     . LEU A 1 34  ? 5.181   16.758 -11.221 1.00 20.65 ? 31  LEU A N     1 
ATOM   215  C  CA    . LEU A 1 34  ? 4.746   15.417 -11.641 1.00 19.98 ? 31  LEU A CA    1 
ATOM   216  C  C     . LEU A 1 34  ? 5.516   15.045 -12.913 1.00 21.26 ? 31  LEU A C     1 
ATOM   217  O  O     . LEU A 1 34  ? 5.429   15.750 -13.907 1.00 22.71 ? 31  LEU A O     1 
ATOM   218  C  CB    . LEU A 1 34  ? 3.235   15.405 -11.931 1.00 19.74 ? 31  LEU A CB    1 
ATOM   219  C  CG    . LEU A 1 34  ? 2.587   14.081 -12.355 1.00 20.01 ? 31  LEU A CG    1 
ATOM   220  C  CD1   . LEU A 1 34  ? 2.735   13.022 -11.260 1.00 16.71 ? 31  LEU A CD1   1 
ATOM   221  C  CD2   . LEU A 1 34  ? 1.098   14.297 -12.720 1.00 19.25 ? 31  LEU A CD2   1 
ATOM   222  N  N     . VAL A 1 35  ? 6.253   13.939 -12.879 1.00 20.97 ? 32  VAL A N     1 
ATOM   223  C  CA    . VAL A 1 35  ? 7.064   13.519 -14.030 1.00 23.20 ? 32  VAL A CA    1 
ATOM   224  C  C     . VAL A 1 35  ? 6.615   12.200 -14.673 1.00 24.17 ? 32  VAL A C     1 
ATOM   225  O  O     . VAL A 1 35  ? 7.044   11.876 -15.753 1.00 26.93 ? 32  VAL A O     1 
ATOM   226  C  CB    . VAL A 1 35  ? 8.569   13.490 -13.663 1.00 23.47 ? 32  VAL A CB    1 
ATOM   227  C  CG1   . VAL A 1 35  ? 9.012   14.889 -13.177 1.00 23.26 ? 32  VAL A CG1   1 
ATOM   228  C  CG2   . VAL A 1 35  ? 8.872   12.412 -12.601 1.00 20.83 ? 32  VAL A CG2   1 
ATOM   229  N  N     . LYS A 1 36  ? 5.740   11.458 -14.010 1.00 23.40 ? 33  LYS A N     1 
ATOM   230  C  CA    . LYS A 1 36  ? 5.089   10.291 -14.609 1.00 25.43 ? 33  LYS A CA    1 
ATOM   231  C  C     . LYS A 1 36  ? 3.741   10.054 -13.939 1.00 24.06 ? 33  LYS A C     1 
ATOM   232  O  O     . LYS A 1 36  ? 3.615   10.256 -12.734 1.00 22.55 ? 33  LYS A O     1 
ATOM   233  C  CB    . LYS A 1 36  ? 5.949   9.035  -14.440 1.00 26.48 ? 33  LYS A CB    1 
ATOM   234  C  CG    . LYS A 1 36  ? 5.481   7.838  -15.263 1.00 29.68 ? 33  LYS A CG    1 
ATOM   235  C  CD    . LYS A 1 36  ? 5.923   7.988  -16.705 1.00 34.59 ? 33  LYS A CD    1 
ATOM   236  C  CE    . LYS A 1 36  ? 5.479   6.821  -17.576 1.00 39.30 ? 33  LYS A CE    1 
ATOM   237  N  NZ    . LYS A 1 36  ? 6.413   6.640  -18.723 1.00 43.52 ? 33  LYS A NZ    1 
ATOM   238  N  N     . GLY A 1 37  ? 2.756   9.609  -14.712 1.00 25.93 ? 34  GLY A N     1 
ATOM   239  C  CA    . GLY A 1 37  ? 1.453   9.243  -14.170 1.00 25.74 ? 34  GLY A CA    1 
ATOM   240  C  C     . GLY A 1 37  ? 0.484   10.403 -13.969 1.00 24.76 ? 34  GLY A C     1 
ATOM   241  O  O     . GLY A 1 37  ? 0.517   11.407 -14.691 1.00 24.74 ? 34  GLY A O     1 
ATOM   242  N  N     . TYR A 1 38  ? -0.409  10.225 -13.000 1.00 24.19 ? 35  TYR A N     1 
ATOM   243  C  CA    . TYR A 1 38  ? -1.435  11.205 -12.664 1.00 23.50 ? 35  TYR A CA    1 
ATOM   244  C  C     . TYR A 1 38  ? -1.451  11.432 -11.158 1.00 21.26 ? 35  TYR A C     1 
ATOM   245  O  O     . TYR A 1 38  ? -1.146  10.538 -10.372 1.00 20.76 ? 35  TYR A O     1 
ATOM   246  C  CB    . TYR A 1 38  ? -2.814  10.742 -13.148 1.00 25.32 ? 35  TYR A CB    1 
ATOM   247  C  CG    . TYR A 1 38  ? -2.860  10.472 -14.633 1.00 29.53 ? 35  TYR A CG    1 
ATOM   248  C  CD1   . TYR A 1 38  ? -3.228  11.471 -15.532 1.00 32.84 ? 35  TYR A CD1   1 
ATOM   249  C  CD2   . TYR A 1 38  ? -2.517  9.222  -15.145 1.00 33.41 ? 35  TYR A CD2   1 
ATOM   250  C  CE1   . TYR A 1 38  ? -3.248  11.234 -16.907 1.00 35.92 ? 35  TYR A CE1   1 
ATOM   251  C  CE2   . TYR A 1 38  ? -2.540  8.972  -16.514 1.00 37.19 ? 35  TYR A CE2   1 
ATOM   252  C  CZ    . TYR A 1 38  ? -2.910  9.978  -17.391 1.00 38.67 ? 35  TYR A CZ    1 
ATOM   253  O  OH    . TYR A 1 38  ? -2.926  9.730  -18.754 1.00 43.89 ? 35  TYR A OH    1 
ATOM   254  N  N     . ALA A 1 39  ? -1.777  12.657 -10.776 1.00 20.32 ? 36  ALA A N     1 
ATOM   255  C  CA    . ALA A 1 39  ? -1.869  13.036 -9.378  1.00 18.70 ? 36  ALA A CA    1 
ATOM   256  C  C     . ALA A 1 39  ? -2.739  14.279 -9.251  1.00 18.31 ? 36  ALA A C     1 
ATOM   257  O  O     . ALA A 1 39  ? -3.057  14.954 -10.247 1.00 18.77 ? 36  ALA A O     1 
ATOM   258  C  CB    . ALA A 1 39  ? -0.487  13.307 -8.809  1.00 18.57 ? 36  ALA A CB    1 
ATOM   259  N  N     . GLU A 1 40  ? -3.124  14.562 -8.016  1.00 17.15 ? 37  GLU A N     1 
ATOM   260  C  CA    . GLU A 1 40  ? -3.971  15.705 -7.701  1.00 16.99 ? 37  GLU A CA    1 
ATOM   261  C  C     . GLU A 1 40  ? -3.596  16.212 -6.335  1.00 16.09 ? 37  GLU A C     1 
ATOM   262  O  O     . GLU A 1 40  ? -3.102  15.456 -5.510  1.00 15.26 ? 37  GLU A O     1 
ATOM   263  C  CB    . GLU A 1 40  ? -5.442  15.291 -7.708  1.00 17.51 ? 37  GLU A CB    1 
ATOM   264  C  CG    . GLU A 1 40  ? -5.726  14.055 -6.839  1.00 17.94 ? 37  GLU A CG    1 
ATOM   265  C  CD    . GLU A 1 40  ? -7.203  13.758 -6.711  1.00 17.52 ? 37  GLU A CD    1 
ATOM   266  O  OE1   . GLU A 1 40  ? -7.850  13.510 -7.750  1.00 19.20 ? 37  GLU A OE1   1 
ATOM   267  O  OE2   . GLU A 1 40  ? -7.698  13.757 -5.568  1.00 17.16 ? 37  GLU A OE2   1 
ATOM   268  N  N     . ILE A 1 41  ? -3.817  17.499 -6.102  1.00 16.42 ? 38  ILE A N     1 
ATOM   269  C  CA    . ILE A 1 41  ? -3.583  18.095 -4.789  1.00 16.19 ? 38  ILE A CA    1 
ATOM   270  C  C     . ILE A 1 41  ? -4.919  18.636 -4.307  1.00 16.74 ? 38  ILE A C     1 
ATOM   271  O  O     . ILE A 1 41  ? -5.511  19.523 -4.943  1.00 17.47 ? 38  ILE A O     1 
ATOM   272  C  CB    . ILE A 1 41  ? -2.533  19.230 -4.855  1.00 17.66 ? 38  ILE A CB    1 
ATOM   273  C  CG1   . ILE A 1 41  ? -1.147  18.651 -5.167  1.00 17.53 ? 38  ILE A CG1   1 
ATOM   274  C  CG2   . ILE A 1 41  ? -2.486  20.025 -3.544  1.00 16.72 ? 38  ILE A CG2   1 
ATOM   275  C  CD1   . ILE A 1 41  ? -0.054  19.739 -5.322  1.00 19.91 ? 38  ILE A CD1   1 
ATOM   276  N  N     . PHE A 1 42  ? -5.399  18.080 -3.196  1.00 16.24 ? 39  PHE A N     1 
ATOM   277  C  CA    . PHE A 1 42  ? -6.746  18.351 -2.671  1.00 16.61 ? 39  PHE A CA    1 
ATOM   278  C  C     . PHE A 1 42  ? -7.814  18.490 -3.750  1.00 15.90 ? 39  PHE A C     1 
ATOM   279  O  O     . PHE A 1 42  ? -8.610  19.421 -3.732  1.00 17.05 ? 39  PHE A O     1 
ATOM   280  C  CB    . PHE A 1 42  ? -6.733  19.587 -1.776  1.00 18.58 ? 39  PHE A CB    1 
ATOM   281  C  CG    . PHE A 1 42  ? -5.731  19.517 -0.644  1.00 20.34 ? 39  PHE A CG    1 
ATOM   282  C  CD1   . PHE A 1 42  ? -5.434  18.314 -0.018  1.00 20.16 ? 39  PHE A CD1   1 
ATOM   283  C  CD2   . PHE A 1 42  ? -5.107  20.675 -0.192  1.00 22.70 ? 39  PHE A CD2   1 
ATOM   284  C  CE1   . PHE A 1 42  ? -4.532  18.260 1.019   1.00 22.77 ? 39  PHE A CE1   1 
ATOM   285  C  CE2   . PHE A 1 42  ? -4.202  20.628 0.834   1.00 25.62 ? 39  PHE A CE2   1 
ATOM   286  C  CZ    . PHE A 1 42  ? -3.911  19.417 1.449   1.00 24.65 ? 39  PHE A CZ    1 
ATOM   287  N  N     . GLY A 1 43  ? -7.810  17.557 -4.692  1.00 14.60 ? 40  GLY A N     1 
ATOM   288  C  CA    . GLY A 1 43  ? -8.870  17.446 -5.687  1.00 15.03 ? 40  GLY A CA    1 
ATOM   289  C  C     . GLY A 1 43  ? -8.601  18.074 -7.037  1.00 16.13 ? 40  GLY A C     1 
ATOM   290  O  O     . GLY A 1 43  ? -9.333  17.798 -7.990  1.00 17.22 ? 40  GLY A O     1 
ATOM   291  N  N     . THR A 1 44  ? -7.581  18.930 -7.131  1.00 16.90 ? 41  THR A N     1 
ATOM   292  C  CA    . THR A 1 44  ? -7.203  19.532 -8.404  1.00 18.29 ? 41  THR A CA    1 
ATOM   293  C  C     . THR A 1 44  ? -6.131  18.710 -9.098  1.00 18.13 ? 41  THR A C     1 
ATOM   294  O  O     . THR A 1 44  ? -5.088  18.428 -8.514  1.00 16.90 ? 41  THR A O     1 
ATOM   295  C  CB    . THR A 1 44  ? -6.645  20.945 -8.232  1.00 20.10 ? 41  THR A CB    1 
ATOM   296  O  OG1   . THR A 1 44  ? -7.655  21.791 -7.655  1.00 21.87 ? 41  THR A OG1   1 
ATOM   297  C  CG2   . THR A 1 44  ? -6.179  21.524 -9.635  1.00 20.86 ? 41  THR A CG2   1 
ATOM   298  N  N     . GLU A 1 45  ? -6.362  18.373 -10.361 1.00 19.55 ? 42  GLU A N     1 
ATOM   299  C  CA    . GLU A 1 45  ? -5.416  17.544 -11.094 1.00 20.19 ? 42  GLU A CA    1 
ATOM   300  C  C     . GLU A 1 45  ? -4.128  18.325 -11.380 1.00 20.51 ? 42  GLU A C     1 
ATOM   301  O  O     . GLU A 1 45  ? -4.175  19.483 -11.759 1.00 22.33 ? 42  GLU A O     1 
ATOM   302  C  CB    . GLU A 1 45  ? -6.030  17.036 -12.407 1.00 22.58 ? 42  GLU A CB    1 
ATOM   303  C  CG    . GLU A 1 45  ? -7.344  16.218 -12.246 1.00 25.18 ? 42  GLU A CG    1 
ATOM   304  C  CD    . GLU A 1 45  ? -7.989  15.852 -13.601 1.00 30.07 ? 42  GLU A CD    1 
ATOM   305  O  OE1   . GLU A 1 45  ? -7.562  14.862 -14.233 1.00 32.88 ? 42  GLU A OE1   1 
ATOM   306  O  OE2   . GLU A 1 45  ? -8.926  16.555 -14.033 1.00 33.34 ? 42  GLU A OE2   1 
ATOM   307  N  N     . LEU A 1 46  ? -2.985  17.675 -11.198 1.00 19.41 ? 43  LEU A N     1 
ATOM   308  C  CA    . LEU A 1 46  ? -1.709  18.224 -11.627 1.00 20.39 ? 43  LEU A CA    1 
ATOM   309  C  C     . LEU A 1 46  ? -1.465  17.927 -13.096 1.00 22.78 ? 43  LEU A C     1 
ATOM   310  O  O     . LEU A 1 46  ? -1.849  16.866 -13.583 1.00 23.33 ? 43  LEU A O     1 
ATOM   311  C  CB    . LEU A 1 46  ? -0.573  17.629 -10.816 1.00 18.75 ? 43  LEU A CB    1 
ATOM   312  C  CG    . LEU A 1 46  ? -0.752  17.742 -9.315  1.00 17.16 ? 43  LEU A CG    1 
ATOM   313  C  CD1   . LEU A 1 46  ? 0.574   17.424 -8.635  1.00 15.93 ? 43  LEU A CD1   1 
ATOM   314  C  CD2   . LEU A 1 46  ? -1.260  19.143 -8.935  1.00 17.15 ? 43  LEU A CD2   1 
ATOM   315  N  N     . LEU A 1 47  ? -0.843  18.878 -13.793 1.00 24.84 ? 44  LEU A N     1 
ATOM   316  C  CA    A LEU A 1 47  ? -0.473  18.706 -15.190 0.50 27.31 ? 44  LEU A CA    1 
ATOM   317  C  CA    B LEU A 1 47  ? -0.474  18.702 -15.194 0.50 27.40 ? 44  LEU A CA    1 
ATOM   318  C  C     . LEU A 1 47  ? 0.934   18.119 -15.270 1.00 27.00 ? 44  LEU A C     1 
ATOM   319  O  O     . LEU A 1 47  ? 1.834   18.550 -14.554 1.00 25.91 ? 44  LEU A O     1 
ATOM   320  C  CB    A LEU A 1 47  ? -0.526  20.049 -15.928 0.50 30.42 ? 44  LEU A CB    1 
ATOM   321  C  CB    B LEU A 1 47  ? -0.539  20.040 -15.947 0.50 30.60 ? 44  LEU A CB    1 
ATOM   322  C  CG    A LEU A 1 47  ? -1.913  20.657 -16.146 0.50 31.82 ? 44  LEU A CG    1 
ATOM   323  C  CG    B LEU A 1 47  ? -0.250  20.006 -17.459 0.50 34.40 ? 44  LEU A CG    1 
ATOM   324  C  CD1   A LEU A 1 47  ? -1.821  21.894 -17.035 0.50 34.51 ? 44  LEU A CD1   1 
ATOM   325  C  CD1   B LEU A 1 47  ? -1.251  19.119 -18.199 0.50 34.76 ? 44  LEU A CD1   1 
ATOM   326  C  CD2   A LEU A 1 47  ? -2.867  19.632 -16.752 0.50 31.84 ? 44  LEU A CD2   1 
ATOM   327  C  CD2   B LEU A 1 47  ? -0.247  21.415 -18.044 0.50 38.12 ? 44  LEU A CD2   1 
ATOM   328  N  N     . LEU A 1 48  ? 1.118   17.135 -16.145 1.00 28.28 ? 45  LEU A N     1 
ATOM   329  C  CA    . LEU A 1 48  ? 2.407   16.456 -16.289 1.00 28.22 ? 45  LEU A CA    1 
ATOM   330  C  C     . LEU A 1 48  ? 3.498   17.467 -16.605 1.00 29.76 ? 45  LEU A C     1 
ATOM   331  O  O     . LEU A 1 48  ? 3.329   18.301 -17.481 1.00 32.16 ? 45  LEU A O     1 
ATOM   332  C  CB    . LEU A 1 48  ? 2.334   15.393 -17.389 1.00 30.04 ? 45  LEU A CB    1 
ATOM   333  C  CG    . LEU A 1 48  ? 3.508   14.414 -17.510 1.00 30.17 ? 45  LEU A CG    1 
ATOM   334  C  CD1   . LEU A 1 48  ? 3.629   13.530 -16.275 1.00 25.26 ? 45  LEU A CD1   1 
ATOM   335  C  CD2   . LEU A 1 48  ? 3.350   13.568 -18.770 1.00 33.66 ? 45  LEU A CD2   1 
ATOM   336  N  N     . ASN A 1 49  ? 4.585   17.408 -15.842 1.00 28.78 ? 46  ASN A N     1 
ATOM   337  C  CA    . ASN A 1 49  ? 5.788   18.234 -16.057 1.00 31.08 ? 46  ASN A CA    1 
ATOM   338  C  C     . ASN A 1 49  ? 5.677   19.732 -15.781 1.00 32.90 ? 46  ASN A C     1 
ATOM   339  O  O     . ASN A 1 49  ? 6.646   20.457 -16.030 1.00 34.96 ? 46  ASN A O     1 
ATOM   340  C  CB    . ASN A 1 49  ? 6.362   18.035 -17.480 1.00 34.10 ? 46  ASN A CB    1 
ATOM   341  C  CG    . ASN A 1 49  ? 6.977   16.675 -17.666 1.00 33.39 ? 46  ASN A CG    1 
ATOM   342  O  OD1   . ASN A 1 49  ? 6.629   15.944 -18.587 1.00 36.15 ? 46  ASN A OD1   1 
ATOM   343  N  ND2   . ASN A 1 49  ? 7.884   16.318 -16.778 1.00 30.94 ? 46  ASN A ND2   1 
ATOM   344  N  N     . LYS A 1 50  ? 4.527   20.208 -15.296 1.00 32.77 ? 47  LYS A N     1 
ATOM   345  C  CA    . LYS A 1 50  ? 4.427   21.602 -14.882 1.00 34.46 ? 47  LYS A CA    1 
ATOM   346  C  C     . LYS A 1 50  ? 5.104   21.756 -13.530 1.00 32.84 ? 47  LYS A C     1 
ATOM   347  O  O     . LYS A 1 50  ? 4.951   20.912 -12.646 1.00 29.63 ? 47  LYS A O     1 
ATOM   348  C  CB    . LYS A 1 50  ? 2.981   22.070 -14.769 1.00 35.22 ? 47  LYS A CB    1 
ATOM   349  C  CG    . LYS A 1 50  ? 2.866   23.567 -14.450 1.00 38.13 ? 47  LYS A CG    1 
ATOM   350  C  CD    . LYS A 1 50  ? 1.424   24.013 -14.379 1.00 41.33 ? 47  LYS A CD    1 
ATOM   351  C  CE    . LYS A 1 50  ? 1.317   25.506 -14.092 1.00 45.88 ? 47  LYS A CE    1 
ATOM   352  N  NZ    . LYS A 1 50  ? -0.091  25.867 -13.744 1.00 48.59 ? 47  LYS A NZ    1 
ATOM   353  N  N     . LYS A 1 51  ? 5.844   22.844 -13.376 1.00 35.22 ? 48  LYS A N     1 
ATOM   354  C  CA    . LYS A 1 51  ? 6.540   23.130 -12.133 1.00 35.06 ? 48  LYS A CA    1 
ATOM   355  C  C     . LYS A 1 51  ? 5.657   24.012 -11.250 1.00 35.34 ? 48  LYS A C     1 
ATOM   356  O  O     . LYS A 1 51  ? 5.402   25.154 -11.583 1.00 38.25 ? 48  LYS A O     1 
ATOM   357  C  CB    . LYS A 1 51  ? 7.875   23.816 -12.431 1.00 37.99 ? 48  LYS A CB    1 
ATOM   358  C  CG    . LYS A 1 51  ? 8.921   22.885 -13.044 1.00 38.58 ? 48  LYS A CG    1 
ATOM   359  C  CD    . LYS A 1 51  ? 10.070  23.664 -13.692 1.00 42.78 ? 48  LYS A CD    1 
ATOM   360  C  CE    . LYS A 1 51  ? 11.297  22.775 -13.912 1.00 43.66 ? 48  LYS A CE    1 
ATOM   361  N  NZ    . LYS A 1 51  ? 10.949  21.412 -14.444 1.00 42.59 ? 48  LYS A NZ    1 
ATOM   362  N  N     . TYR A 1 52  ? 5.204   23.459 -10.125 1.00 33.00 ? 49  TYR A N     1 
ATOM   363  C  CA    . TYR A 1 52  ? 4.394   24.171 -9.139  1.00 33.46 ? 49  TYR A CA    1 
ATOM   364  C  C     . TYR A 1 52  ? 5.256   24.633 -7.966  1.00 34.74 ? 49  TYR A C     1 
ATOM   365  O  O     . TYR A 1 52  ? 5.674   23.810 -7.131  1.00 32.51 ? 49  TYR A O     1 
ATOM   366  C  CB    . TYR A 1 52  ? 3.313   23.252 -8.594  1.00 30.36 ? 49  TYR A CB    1 
ATOM   367  C  CG    . TYR A 1 52  ? 2.293   22.801 -9.612  1.00 30.15 ? 49  TYR A CG    1 
ATOM   368  C  CD1   . TYR A 1 52  ? 1.194   23.604 -9.932  1.00 31.87 ? 49  TYR A CD1   1 
ATOM   369  C  CD2   . TYR A 1 52  ? 2.406   21.572 -10.241 1.00 27.41 ? 49  TYR A CD2   1 
ATOM   370  C  CE1   . TYR A 1 52  ? 0.235   23.185 -10.853 1.00 30.29 ? 49  TYR A CE1   1 
ATOM   371  C  CE2   . TYR A 1 52  ? 1.448   21.148 -11.159 1.00 27.60 ? 49  TYR A CE2   1 
ATOM   372  C  CZ    . TYR A 1 52  ? 0.368   21.959 -11.458 1.00 27.33 ? 49  TYR A CZ    1 
ATOM   373  O  OH    . TYR A 1 52  ? -0.570  21.543 -12.371 1.00 25.89 ? 49  TYR A OH    1 
ATOM   374  N  N     . THR A 1 53  ? 5.503   25.942 -7.894  1.00 38.30 ? 50  THR A N     1 
ATOM   375  C  CA    . THR A 1 53  ? 6.358   26.523 -6.853  1.00 40.46 ? 50  THR A CA    1 
ATOM   376  C  C     . THR A 1 53  ? 5.532   26.877 -5.619  1.00 40.91 ? 50  THR A C     1 
ATOM   377  O  O     . THR A 1 53  ? 4.633   27.721 -5.680  1.00 42.53 ? 50  THR A O     1 
ATOM   378  C  CB    . THR A 1 53  ? 7.069   27.757 -7.375  1.00 44.82 ? 50  THR A CB    1 
ATOM   379  O  OG1   . THR A 1 53  ? 7.803   27.399 -8.550  1.00 45.79 ? 50  THR A OG1   1 
ATOM   380  C  CG2   . THR A 1 53  ? 8.032   28.316 -6.333  1.00 48.01 ? 50  THR A CG2   1 
ATOM   381  N  N     . PHE A 1 54  ? 5.823   26.200 -4.510  1.00 39.40 ? 51  PHE A N     1 
ATOM   382  C  CA    . PHE A 1 54  ? 5.127   26.437 -3.249  1.00 40.53 ? 51  PHE A CA    1 
ATOM   383  C  C     . PHE A 1 54  ? 6.027   27.269 -2.352  1.00 44.61 ? 51  PHE A C     1 
ATOM   384  O  O     . PHE A 1 54  ? 7.231   27.028 -2.306  1.00 45.09 ? 51  PHE A O     1 
ATOM   385  C  CB    . PHE A 1 54  ? 4.793   25.120 -2.545  1.00 37.10 ? 51  PHE A CB    1 
ATOM   386  C  CG    . PHE A 1 54  ? 3.688   24.331 -3.201  1.00 33.78 ? 51  PHE A CG    1 
ATOM   387  C  CD1   . PHE A 1 54  ? 2.369   24.503 -2.815  1.00 33.36 ? 51  PHE A CD1   1 
ATOM   388  C  CD2   . PHE A 1 54  ? 3.975   23.397 -4.191  1.00 31.14 ? 51  PHE A CD2   1 
ATOM   389  C  CE1   . PHE A 1 54  ? 1.362   23.771 -3.405  1.00 31.12 ? 51  PHE A CE1   1 
ATOM   390  C  CE2   . PHE A 1 54  ? 2.966   22.663 -4.787  1.00 28.34 ? 51  PHE A CE2   1 
ATOM   391  C  CZ    . PHE A 1 54  ? 1.664   22.851 -4.397  1.00 28.53 ? 51  PHE A CZ    1 
ATOM   392  N  N     . PRO A 1 55  ? 5.454   28.250 -1.636  1.00 48.35 ? 52  PRO A N     1 
ATOM   393  C  CA    . PRO A 1 55  ? 6.291   29.080 -0.773  1.00 53.25 ? 52  PRO A CA    1 
ATOM   394  C  C     . PRO A 1 55  ? 6.593   28.434 0.586   1.00 53.44 ? 52  PRO A C     1 
ATOM   395  O  O     . PRO A 1 55  ? 5.928   27.476 0.974   1.00 49.88 ? 52  PRO A O     1 
ATOM   396  C  CB    . PRO A 1 55  ? 5.453   30.357 -0.606  1.00 57.33 ? 52  PRO A CB    1 
ATOM   397  C  CG    . PRO A 1 55  ? 4.042   29.895 -0.758  1.00 54.32 ? 52  PRO A CG    1 
ATOM   398  C  CD    . PRO A 1 55  ? 4.077   28.769 -1.740  1.00 49.00 ? 52  PRO A CD    1 
ATOM   399  N  N     . ALA A 1 56  ? 7.585   28.979 1.293   1.00 58.03 ? 53  ALA A N     1 
ATOM   400  C  CA    . ALA A 1 56  ? 7.950   28.550 2.656   1.00 60.01 ? 53  ALA A CA    1 
ATOM   401  C  C     . ALA A 1 56  ? 6.742   28.314 3.573   1.00 60.41 ? 53  ALA A C     1 
ATOM   402  O  O     . ALA A 1 56  ? 5.723   28.998 3.454   1.00 61.82 ? 53  ALA A O     1 
ATOM   403  C  CB    . ALA A 1 56  ? 8.881   29.574 3.286   1.00 66.08 ? 53  ALA A CB    1 
ATOM   404  N  N     . LYS A 1 57  ? 6.869   27.335 4.473   1.00 59.79 ? 54  LYS A N     1 
ATOM   405  C  CA    . LYS A 1 57  ? 5.792   26.906 5.393   1.00 59.98 ? 54  LYS A CA    1 
ATOM   406  C  C     . LYS A 1 57  ? 4.659   26.114 4.731   1.00 55.00 ? 54  LYS A C     1 
ATOM   407  O  O     . LYS A 1 57  ? 3.890   25.455 5.437   1.00 54.51 ? 54  LYS A O     1 
ATOM   408  C  CB    . LYS A 1 57  ? 5.221   28.090 6.213   1.00 65.94 ? 54  LYS A CB    1 
ATOM   409  C  CG    . LYS A 1 57  ? 3.967   27.758 7.068   1.00 66.89 ? 54  LYS A CG    1 
ATOM   410  C  CD    . LYS A 1 57  ? 3.513   28.932 7.934   1.00 73.69 ? 54  LYS A CD    1 
ATOM   411  C  CE    . LYS A 1 57  ? 2.147   28.659 8.580   1.00 73.95 ? 54  LYS A CE    1 
ATOM   412  N  NZ    . LYS A 1 57  ? 1.684   29.802 9.428   1.00 80.38 ? 54  LYS A NZ    1 
ATOM   413  N  N     . SER A 1 58  ? 4.555   26.134 3.399   1.00 51.68 ? 55  SER A N     1 
ATOM   414  C  CA    . SER A 1 58  ? 3.474   25.424 2.722   1.00 47.30 ? 55  SER A CA    1 
ATOM   415  C  C     . SER A 1 58  ? 3.411   23.972 3.186   1.00 44.33 ? 55  SER A C     1 
ATOM   416  O  O     . SER A 1 58  ? 4.442   23.316 3.287   1.00 43.85 ? 55  SER A O     1 
ATOM   417  C  CB    . SER A 1 58  ? 3.659   25.452 1.200   1.00 44.85 ? 55  SER A CB    1 
ATOM   418  O  OG    . SER A 1 58  ? 3.760   26.776 0.709   1.00 48.24 ? 55  SER A OG    1 
ATOM   419  N  N     . ARG A 1 59  ? 2.202   23.495 3.479   1.00 42.92 ? 56  ARG A N     1 
ATOM   420  C  CA    . ARG A 1 59  ? 1.938   22.088 3.782   1.00 40.28 ? 56  ARG A CA    1 
ATOM   421  C  C     . ARG A 1 59  ? 1.071   21.556 2.664   1.00 36.00 ? 56  ARG A C     1 
ATOM   422  O  O     . ARG A 1 59  ? 0.052   22.162 2.341   1.00 35.82 ? 56  ARG A O     1 
ATOM   423  C  CB    . ARG A 1 59  ? 1.206   21.946 5.114   1.00 43.00 ? 56  ARG A CB    1 
ATOM   424  C  CG    . ARG A 1 59  ? 1.013   20.497 5.603   1.00 41.95 ? 56  ARG A CG    1 
ATOM   425  C  CD    . ARG A 1 59  ? 0.902   20.440 7.135   1.00 47.80 ? 56  ARG A CD    1 
ATOM   426  N  NE    . ARG A 1 59  ? 2.007   21.146 7.799   1.00 52.43 ? 56  ARG A NE    1 
ATOM   427  C  CZ    . ARG A 1 59  ? 3.137   20.587 8.244   1.00 54.12 ? 56  ARG A CZ    1 
ATOM   428  N  NH1   . ARG A 1 59  ? 3.351   19.281 8.135   1.00 52.59 ? 56  ARG A NH1   1 
ATOM   429  N  NH2   . ARG A 1 59  ? 4.067   21.347 8.816   1.00 57.39 ? 56  ARG A NH2   1 
ATOM   430  N  N     . VAL A 1 60  ? 1.481   20.425 2.082   1.00 32.65 ? 57  VAL A N     1 
ATOM   431  C  CA    . VAL A 1 60  ? 0.925   19.947 0.818   1.00 28.77 ? 57  VAL A CA    1 
ATOM   432  C  C     . VAL A 1 60  ? 0.824   18.422 0.770   1.00 26.33 ? 57  VAL A C     1 
ATOM   433  O  O     . VAL A 1 60  ? 1.701   17.699 1.248   1.00 26.24 ? 57  VAL A O     1 
ATOM   434  C  CB    . VAL A 1 60  ? 1.823   20.421 -0.362  1.00 28.48 ? 57  VAL A CB    1 
ATOM   435  C  CG1   . VAL A 1 60  ? 1.338   19.879 -1.696  1.00 25.64 ? 57  VAL A CG1   1 
ATOM   436  C  CG2   . VAL A 1 60  ? 1.887   21.933 -0.406  1.00 31.52 ? 57  VAL A CG2   1 
ATOM   437  N  N     . ALA A 1 61  ? -0.249  17.939 0.161   1.00 24.25 ? 58  ALA A N     1 
ATOM   438  C  CA    . ALA A 1 61  ? -0.441  16.527 -0.059  1.00 22.17 ? 58  ALA A CA    1 
ATOM   439  C  C     . ALA A 1 61  ? -0.820  16.357 -1.505  1.00 20.35 ? 58  ALA A C     1 
ATOM   440  O  O     . ALA A 1 61  ? -1.796  16.975 -1.967  1.00 19.80 ? 58  ALA A O     1 
ATOM   441  C  CB    . ALA A 1 61  ? -1.540  16.012 0.834   1.00 23.34 ? 58  ALA A CB    1 
ATOM   442  N  N     . ALA A 1 62  ? -0.031  15.546 -2.217  1.00 18.73 ? 59  ALA A N     1 
ATOM   443  C  CA    . ALA A 1 62  ? -0.325  15.142 -3.575  1.00 17.53 ? 59  ALA A CA    1 
ATOM   444  C  C     . ALA A 1 62  ? -0.655  13.650 -3.560  1.00 17.45 ? 59  ALA A C     1 
ATOM   445  O  O     . ALA A 1 62  ? 0.120   12.849 -3.035  1.00 18.45 ? 59  ALA A O     1 
ATOM   446  C  CB    . ALA A 1 62  ? 0.855   15.409 -4.488  1.00 16.97 ? 59  ALA A CB    1 
ATOM   447  N  N     . PHE A 1 63  ? -1.809  13.306 -4.140  1.00 16.30 ? 60  PHE A N     1 
ATOM   448  C  CA    . PHE A 1 63  ? -2.384  11.980 -4.068  1.00 15.87 ? 60  PHE A CA    1 
ATOM   449  C  C     . PHE A 1 63  ? -2.529  11.465 -5.473  1.00 15.96 ? 60  PHE A C     1 
ATOM   450  O  O     . PHE A 1 63  ? -2.645  12.251 -6.422  1.00 15.31 ? 60  PHE A O     1 
ATOM   451  C  CB    . PHE A 1 63  ? -3.760  12.046 -3.416  1.00 15.86 ? 60  PHE A CB    1 
ATOM   452  C  CG    . PHE A 1 63  ? -4.408  10.704 -3.233  1.00 16.10 ? 60  PHE A CG    1 
ATOM   453  C  CD1   . PHE A 1 63  ? -4.093  9.913  -2.141  1.00 16.51 ? 60  PHE A CD1   1 
ATOM   454  C  CD2   . PHE A 1 63  ? -5.346  10.243 -4.144  1.00 16.19 ? 60  PHE A CD2   1 
ATOM   455  C  CE1   . PHE A 1 63  ? -4.679  8.680  -1.974  1.00 19.35 ? 60  PHE A CE1   1 
ATOM   456  C  CE2   . PHE A 1 63  ? -5.930  8.999  -3.989  1.00 17.43 ? 60  PHE A CE2   1 
ATOM   457  C  CZ    . PHE A 1 63  ? -5.607  8.221  -2.895  1.00 19.96 ? 60  PHE A CZ    1 
ATOM   458  N  N     . THR A 1 64  ? -2.507  10.147 -5.608  1.00 16.64 ? 61  THR A N     1 
ATOM   459  C  CA    . THR A 1 64  ? -2.661  9.526  -6.894  1.00 18.06 ? 61  THR A CA    1 
ATOM   460  C  C     . THR A 1 64  ? -3.512  8.286  -6.760  1.00 20.28 ? 61  THR A C     1 
ATOM   461  O  O     . THR A 1 64  ? -3.293  7.474  -5.858  1.00 21.77 ? 61  THR A O     1 
ATOM   462  C  CB    . THR A 1 64  ? -1.303  9.140  -7.538  1.00 18.63 ? 61  THR A CB    1 
ATOM   463  O  OG1   . THR A 1 64  ? -1.560  8.488  -8.790  1.00 19.36 ? 61  THR A OG1   1 
ATOM   464  C  CG2   . THR A 1 64  ? -0.490  8.209  -6.639  1.00 18.68 ? 61  THR A CG2   1 
ATOM   465  N  N     . TRP A 1 65  ? -4.478  8.161  -7.666  1.00 21.38 ? 62  TRP A N     1 
ATOM   466  C  CA    . TRP A 1 65  ? -5.343  6.995  -7.747  1.00 23.87 ? 62  TRP A CA    1 
ATOM   467  C  C     . TRP A 1 65  ? -4.663  5.795  -8.414  1.00 26.67 ? 62  TRP A C     1 
ATOM   468  O  O     . TRP A 1 65  ? -4.823  4.677  -7.934  1.00 29.16 ? 62  TRP A O     1 
ATOM   469  C  CB    . TRP A 1 65  ? -6.640  7.359  -8.480  1.00 24.12 ? 62  TRP A CB    1 
ATOM   470  C  CG    . TRP A 1 65  ? -7.413  8.359  -7.727  1.00 22.58 ? 62  TRP A CG    1 
ATOM   471  C  CD1   . TRP A 1 65  ? -7.459  9.698  -7.955  1.00 21.70 ? 62  TRP A CD1   1 
ATOM   472  C  CD2   . TRP A 1 65  ? -8.202  8.119  -6.555  1.00 22.55 ? 62  TRP A CD2   1 
ATOM   473  N  NE1   . TRP A 1 65  ? -8.253  10.307 -7.007  1.00 21.22 ? 62  TRP A NE1   1 
ATOM   474  C  CE2   . TRP A 1 65  ? -8.724  9.362  -6.142  1.00 19.45 ? 62  TRP A CE2   1 
ATOM   475  C  CE3   . TRP A 1 65  ? -8.524  6.967  -5.818  1.00 23.84 ? 62  TRP A CE3   1 
ATOM   476  C  CZ2   . TRP A 1 65  ? -9.565  9.496  -5.031  1.00 20.83 ? 62  TRP A CZ2   1 
ATOM   477  C  CZ3   . TRP A 1 65  ? -9.359  7.098  -4.706  1.00 23.87 ? 62  TRP A CZ3   1 
ATOM   478  C  CH2   . TRP A 1 65  ? -9.870  8.355  -4.326  1.00 23.02 ? 62  TRP A CH2   1 
ATOM   479  N  N     . LYS A 1 66  ? -3.915  6.018  -9.499  1.00 27.06 ? 63  LYS A N     1 
ATOM   480  C  CA    . LYS A 1 66  ? -3.276  4.912  -10.244 1.00 30.46 ? 63  LYS A CA    1 
ATOM   481  C  C     . LYS A 1 66  ? -1.754  4.771  -10.055 1.00 29.74 ? 63  LYS A C     1 
ATOM   482  O  O     . LYS A 1 66  ? -1.190  3.737  -10.411 1.00 32.55 ? 63  LYS A O     1 
ATOM   483  C  CB    . LYS A 1 66  ? -3.563  5.036  -11.753 1.00 32.80 ? 63  LYS A CB    1 
ATOM   484  C  CG    . LYS A 1 66  ? -5.022  4.835  -12.152 1.00 36.34 ? 63  LYS A CG    1 
ATOM   485  C  CD    . LYS A 1 66  ? -5.163  4.645  -13.675 1.00 42.10 ? 63  LYS A CD    1 
ATOM   486  C  CE    . LYS A 1 66  ? -6.615  4.862  -14.130 1.00 44.28 ? 63  LYS A CE    1 
ATOM   487  N  NZ    . LYS A 1 66  ? -6.796  4.588  -15.584 1.00 49.17 ? 63  LYS A NZ    1 
ATOM   488  N  N     . GLY A 1 67  ? -1.090  5.800  -9.525  1.00 26.35 ? 64  GLY A N     1 
ATOM   489  C  CA    . GLY A 1 67  ? 0.362   5.768  -9.326  1.00 25.50 ? 64  GLY A CA    1 
ATOM   490  C  C     . GLY A 1 67  ? 1.087   6.912  -10.029 1.00 23.47 ? 64  GLY A C     1 
ATOM   491  O  O     . GLY A 1 67  ? 0.661   7.375  -11.088 1.00 23.55 ? 64  GLY A O     1 
ATOM   492  N  N     . ALA A 1 68  ? 2.197   7.346  -9.435  1.00 21.39 ? 65  ALA A N     1 
ATOM   493  C  CA    . ALA A 1 68  ? 2.908   8.525  -9.885  1.00 19.90 ? 65  ALA A CA    1 
ATOM   494  C  C     . ALA A 1 68  ? 4.371   8.558  -9.435  1.00 19.38 ? 65  ALA A C     1 
ATOM   495  O  O     . ALA A 1 68  ? 4.751   7.948  -8.421  1.00 19.64 ? 65  ALA A O     1 
ATOM   496  C  CB    . ALA A 1 68  ? 2.192   9.777  -9.388  1.00 17.63 ? 65  ALA A CB    1 
ATOM   497  N  N     . THR A 1 69  ? 5.170   9.290  -10.202 1.00 18.75 ? 66  THR A N     1 
ATOM   498  C  CA    . THR A 1 69  ? 6.527   9.683  -9.813  1.00 18.16 ? 66  THR A CA    1 
ATOM   499  C  C     . THR A 1 69  ? 6.574   11.199 -9.741  1.00 16.89 ? 66  THR A C     1 
ATOM   500  O  O     . THR A 1 69  ? 6.136   11.889 -10.663 1.00 17.02 ? 66  THR A O     1 
ATOM   501  C  CB    . THR A 1 69  ? 7.569   9.195  -10.830 1.00 19.81 ? 66  THR A CB    1 
ATOM   502  O  OG1   . THR A 1 69  ? 7.491   7.775  -10.925 1.00 21.21 ? 66  THR A OG1   1 
ATOM   503  C  CG2   . THR A 1 69  ? 8.984   9.593  -10.418 1.00 19.36 ? 66  THR A CG2   1 
ATOM   504  N  N     . ILE A 1 70  ? 7.092   11.716 -8.639  1.00 16.97 ? 67  ILE A N     1 
ATOM   505  C  CA    . ILE A 1 70  ? 7.069   13.153 -8.371  1.00 16.84 ? 67  ILE A CA    1 
ATOM   506  C  C     . ILE A 1 70  ? 8.436   13.652 -7.883  1.00 17.15 ? 67  ILE A C     1 
ATOM   507  O  O     . ILE A 1 70  ? 9.059   13.043 -7.018  1.00 16.98 ? 67  ILE A O     1 
ATOM   508  C  CB    . ILE A 1 70  ? 5.995   13.528 -7.306  1.00 16.25 ? 67  ILE A CB    1 
ATOM   509  C  CG1   . ILE A 1 70  ? 4.575   13.152 -7.767  1.00 16.35 ? 67  ILE A CG1   1 
ATOM   510  C  CG2   . ILE A 1 70  ? 6.035   15.041 -7.003  1.00 15.65 ? 67  ILE A CG2   1 
ATOM   511  C  CD1   . ILE A 1 70  ? 3.445   13.438 -6.643  1.00 14.56 ? 67  ILE A CD1   1 
ATOM   512  N  N     . GLU A 1 71  ? 8.864   14.782 -8.436  1.00 17.73 ? 68  GLU A N     1 
ATOM   513  C  CA    . GLU A 1 71  ? 10.111  15.430 -8.056  1.00 18.58 ? 68  GLU A CA    1 
ATOM   514  C  C     . GLU A 1 71  ? 9.834   16.666 -7.195  1.00 18.90 ? 68  GLU A C     1 
ATOM   515  O  O     . GLU A 1 71  ? 8.938   17.453 -7.519  1.00 19.63 ? 68  GLU A O     1 
ATOM   516  C  CB    . GLU A 1 71  ? 10.843  15.857 -9.319  1.00 19.81 ? 68  GLU A CB    1 
ATOM   517  C  CG    . GLU A 1 71  ? 12.165  16.535 -9.076  1.00 21.90 ? 68  GLU A CG    1 
ATOM   518  C  CD    . GLU A 1 71  ? 12.910  16.778 -10.350 1.00 23.64 ? 68  GLU A CD    1 
ATOM   519  O  OE1   . GLU A 1 71  ? 13.613  15.846 -10.769 1.00 25.06 ? 68  GLU A OE1   1 
ATOM   520  O  OE2   . GLU A 1 71  ? 12.792  17.888 -10.929 1.00 24.69 ? 68  GLU A OE2   1 
ATOM   521  N  N     . LEU A 1 72  ? 10.596  16.821 -6.112  1.00 19.02 ? 69  LEU A N     1 
ATOM   522  C  CA    . LEU A 1 72  ? 10.658  18.063 -5.349  1.00 20.51 ? 69  LEU A CA    1 
ATOM   523  C  C     . LEU A 1 72  ? 12.053  18.685 -5.446  1.00 22.61 ? 69  LEU A C     1 
ATOM   524  O  O     . LEU A 1 72  ? 13.065  18.013 -5.187  1.00 22.52 ? 69  LEU A O     1 
ATOM   525  C  CB    . LEU A 1 72  ? 10.324  17.831 -3.874  1.00 20.71 ? 69  LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 72  ? 8.964   17.205 -3.578  1.00 19.04 ? 69  LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 72  ? 8.759   17.104 -2.082  1.00 20.06 ? 69  LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 72  ? 7.845   17.990 -4.229  1.00 17.02 ? 69  LEU A CD2   1 
ATOM   529  N  N     . VAL A 1 73  ? 12.088  19.968 -5.812  1.00 24.17 ? 70  VAL A N     1 
ATOM   530  C  CA    . VAL A 1 73  ? 13.312  20.743 -5.895  1.00 26.86 ? 70  VAL A CA    1 
ATOM   531  C  C     . VAL A 1 73  ? 13.223  21.817 -4.813  1.00 29.75 ? 70  VAL A C     1 
ATOM   532  O  O     . VAL A 1 73  ? 12.351  22.700 -4.868  1.00 30.89 ? 70  VAL A O     1 
ATOM   533  C  CB    . VAL A 1 73  ? 13.487  21.413 -7.298  1.00 28.14 ? 70  VAL A CB    1 
ATOM   534  C  CG1   . VAL A 1 73  ? 14.817  22.160 -7.391  1.00 30.29 ? 70  VAL A CG1   1 
ATOM   535  C  CG2   . VAL A 1 73  ? 13.384  20.386 -8.422  1.00 25.86 ? 70  VAL A CG2   1 
ATOM   536  N  N     . GLY A 1 74  ? 14.114  21.727 -3.828  1.00 31.97 ? 71  GLY A N     1 
ATOM   537  C  CA    . GLY A 1 74  ? 14.183  22.687 -2.718  1.00 35.43 ? 71  GLY A CA    1 
ATOM   538  C  C     . GLY A 1 74  ? 14.227  22.018 -1.353  1.00 36.19 ? 71  GLY A C     1 
ATOM   539  O  O     . GLY A 1 74  ? 13.906  20.832 -1.217  1.00 33.56 ? 71  GLY A O     1 
ATOM   540  N  N     . THR A 1 75  ? 14.618  22.791 -0.340  1.00 39.99 ? 72  THR A N     1 
ATOM   541  C  CA    . THR A 1 75  ? 14.673  22.314 1.037   1.00 41.32 ? 72  THR A CA    1 
ATOM   542  C  C     . THR A 1 75  ? 13.287  22.081 1.611   1.00 39.97 ? 72  THR A C     1 
ATOM   543  O  O     . THR A 1 75  ? 12.451  22.978 1.597   1.00 41.61 ? 72  THR A O     1 
ATOM   544  C  CB    . THR A 1 75  ? 15.387  23.324 1.942   1.00 46.38 ? 72  THR A CB    1 
ATOM   545  O  OG1   . THR A 1 75  ? 16.754  23.435 1.533   1.00 48.48 ? 72  THR A OG1   1 
ATOM   546  C  CG2   . THR A 1 75  ? 15.324  22.889 3.407   1.00 48.67 ? 72  THR A CG2   1 
ATOM   547  N  N     . THR A 1 76  ? 13.061  20.885 2.139   1.00 38.17 ? 73  THR A N     1 
ATOM   548  C  CA    . THR A 1 76  ? 11.814  20.557 2.807   1.00 37.49 ? 73  THR A CA    1 
ATOM   549  C  C     . THR A 1 76  ? 12.089  20.301 4.281   1.00 41.20 ? 73  THR A C     1 
ATOM   550  O  O     . THR A 1 76  ? 13.149  19.802 4.647   1.00 42.23 ? 73  THR A O     1 
ATOM   551  C  CB    . THR A 1 76  ? 11.164  19.295 2.201   1.00 33.51 ? 73  THR A CB    1 
ATOM   552  O  OG1   . THR A 1 76  ? 12.108  18.219 2.227   1.00 32.18 ? 73  THR A OG1   1 
ATOM   553  C  CG2   . THR A 1 76  ? 10.703  19.552 0.761   1.00 29.78 ? 73  THR A CG2   1 
ATOM   554  N  N     . GLU A 1 77  ? 11.123  20.640 5.125   1.00 43.37 ? 74  GLU A N     1 
ATOM   555  C  CA    . GLU A 1 77  ? 11.223  20.343 6.548   1.00 47.48 ? 74  GLU A CA    1 
ATOM   556  C  C     . GLU A 1 77  ? 10.920  18.866 6.758   1.00 45.40 ? 74  GLU A C     1 
ATOM   557  O  O     . GLU A 1 77  ? 11.543  18.204 7.594   1.00 47.85 ? 74  GLU A O     1 
ATOM   558  C  CB    . GLU A 1 77  ? 10.233  21.191 7.342   1.00 50.40 ? 74  GLU A CB    1 
ATOM   559  C  CG    . GLU A 1 77  ? 10.379  21.031 8.833   1.00 57.01 ? 74  GLU A CG    1 
ATOM   560  C  CD    . GLU A 1 77  ? 9.566   22.042 9.604   1.00 62.77 ? 74  GLU A CD    1 
ATOM   561  O  OE1   . GLU A 1 77  ? 8.349   22.149 9.339   1.00 62.41 ? 74  GLU A OE1   1 
ATOM   562  O  OE2   . GLU A 1 77  ? 10.142  22.727 10.474  1.00 69.54 ? 74  GLU A OE2   1 
ATOM   563  N  N     . SER A 1 78  ? 9.954   18.379 5.980   1.00 41.27 ? 75  SER A N     1 
ATOM   564  C  CA    . SER A 1 78  ? 9.504   16.997 6.013   1.00 39.41 ? 75  SER A CA    1 
ATOM   565  C  C     . SER A 1 78  ? 9.055   16.594 4.600   1.00 35.10 ? 75  SER A C     1 
ATOM   566  O  O     . SER A 1 78  ? 8.660   17.444 3.814   1.00 33.85 ? 75  SER A O     1 
ATOM   567  C  CB    . SER A 1 78  ? 8.318   16.885 6.966   1.00 40.91 ? 75  SER A CB    1 
ATOM   568  O  OG    . SER A 1 78  ? 7.216   17.619 6.449   1.00 37.81 ? 75  SER A OG    1 
ATOM   569  N  N     . ALA A 1 79  ? 9.121   15.309 4.279   1.00 33.64 ? 76  ALA A N     1 
ATOM   570  C  CA    . ALA A 1 79  ? 8.589   14.795 3.014   1.00 30.56 ? 76  ALA A CA    1 
ATOM   571  C  C     . ALA A 1 79  ? 8.545   13.278 3.079   1.00 30.48 ? 76  ALA A C     1 
ATOM   572  O  O     . ALA A 1 79  ? 9.577   12.654 3.270   1.00 32.33 ? 76  ALA A O     1 
ATOM   573  C  CB    . ALA A 1 79  ? 9.438   15.242 1.836   1.00 28.89 ? 76  ALA A CB    1 
ATOM   574  N  N     . TYR A 1 80  ? 7.346   12.708 2.958   1.00 29.56 ? 77  TYR A N     1 
ATOM   575  C  CA    . TYR A 1 80  ? 7.143   11.258 2.968   1.00 29.62 ? 77  TYR A CA    1 
ATOM   576  C  C     . TYR A 1 80  ? 5.892   10.833 2.196   1.00 27.71 ? 77  TYR A C     1 
ATOM   577  O  O     . TYR A 1 80  ? 4.980   11.629 1.955   1.00 25.72 ? 77  TYR A O     1 
ATOM   578  C  CB    . TYR A 1 80  ? 7.077   10.726 4.405   1.00 33.03 ? 77  TYR A CB    1 
ATOM   579  C  CG    . TYR A 1 80  ? 5.845   11.130 5.191   1.00 33.93 ? 77  TYR A CG    1 
ATOM   580  C  CD1   . TYR A 1 80  ? 4.803   10.225 5.411   1.00 33.45 ? 77  TYR A CD1   1 
ATOM   581  C  CD2   . TYR A 1 80  ? 5.727   12.411 5.726   1.00 34.91 ? 77  TYR A CD2   1 
ATOM   582  C  CE1   . TYR A 1 80  ? 3.682   10.585 6.145   1.00 34.35 ? 77  TYR A CE1   1 
ATOM   583  C  CE2   . TYR A 1 80  ? 4.592   12.790 6.464   1.00 35.56 ? 77  TYR A CE2   1 
ATOM   584  C  CZ    . TYR A 1 80  ? 3.573   11.873 6.668   1.00 35.72 ? 77  TYR A CZ    1 
ATOM   585  O  OH    . TYR A 1 80  ? 2.458   12.240 7.412   1.00 36.90 ? 77  TYR A OH    1 
ATOM   586  N  N     . VAL A 1 81  ? 5.880   9.566  1.793   1.00 28.11 ? 78  VAL A N     1 
ATOM   587  C  CA    . VAL A 1 81  ? 4.751   8.971  1.104   1.00 26.96 ? 78  VAL A CA    1 
ATOM   588  C  C     . VAL A 1 81  ? 3.897   8.207  2.123   1.00 28.74 ? 78  VAL A C     1 
ATOM   589  O  O     . VAL A 1 81  ? 4.389   7.290  2.753   1.00 31.02 ? 78  VAL A O     1 
ATOM   590  C  CB    . VAL A 1 81  ? 5.231   7.996  0.006   1.00 26.79 ? 78  VAL A CB    1 
ATOM   591  C  CG1   . VAL A 1 81  ? 4.055   7.242  -0.607  1.00 26.50 ? 78  VAL A CG1   1 
ATOM   592  C  CG2   . VAL A 1 81  ? 6.019   8.752  -1.079  1.00 25.95 ? 78  VAL A CG2   1 
ATOM   593  N  N     . ALA A 1 82  ? 2.633   8.595  2.285   1.00 27.71 ? 79  ALA A N     1 
ATOM   594  C  CA    . ALA A 1 82  ? 1.683   7.833  3.120   1.00 29.92 ? 79  ALA A CA    1 
ATOM   595  C  C     . ALA A 1 82  ? 0.869   6.879  2.245   1.00 29.76 ? 79  ALA A C     1 
ATOM   596  O  O     . ALA A 1 82  ? 0.559   7.195  1.092   1.00 26.83 ? 79  ALA A O     1 
ATOM   597  C  CB    . ALA A 1 82  ? 0.769   8.768  3.875   1.00 29.50 ? 79  ALA A CB    1 
ATOM   598  N  N     . GLU A 1 83  ? 0.528   5.712  2.786   1.00 33.39 ? 80  GLU A N     1 
ATOM   599  C  CA    . GLU A 1 83  ? -0.073  4.626  1.981   1.00 34.84 ? 80  GLU A CA    1 
ATOM   600  C  C     . GLU A 1 83  ? -1.512  4.296  2.337   1.00 35.84 ? 80  GLU A C     1 
ATOM   601  O  O     . GLU A 1 83  ? -2.153  3.488  1.644   1.00 37.31 ? 80  GLU A O     1 
ATOM   602  C  CB    . GLU A 1 83  ? 0.753   3.349  2.103   1.00 38.40 ? 80  GLU A CB    1 
ATOM   603  C  CG    . GLU A 1 83  ? 2.170   3.539  1.642   1.00 39.22 ? 80  GLU A CG    1 
ATOM   604  C  CD    . GLU A 1 83  ? 2.915   2.250  1.460   1.00 44.20 ? 80  GLU A CD    1 
ATOM   605  O  OE1   . GLU A 1 83  ? 2.591   1.251  2.140   1.00 49.33 ? 80  GLU A OE1   1 
ATOM   606  O  OE2   . GLU A 1 83  ? 3.849   2.252  0.632   1.00 46.19 ? 80  GLU A OE2   1 
ATOM   607  N  N     . SER A 1 84  ? -2.031  4.921  3.386   1.00 35.37 ? 81  SER A N     1 
ATOM   608  C  CA    . SER A 1 84  ? -3.339  4.571  3.872   1.00 36.48 ? 81  SER A CA    1 
ATOM   609  C  C     . SER A 1 84  ? -4.154  5.796  4.268   1.00 34.05 ? 81  SER A C     1 
ATOM   610  O  O     . SER A 1 84  ? -4.353  6.074  5.450   1.00 37.39 ? 81  SER A O     1 
ATOM   611  C  CB    . SER A 1 84  ? -3.189  3.626  5.053   1.00 40.71 ? 81  SER A CB    1 
ATOM   612  O  OG    . SER A 1 84  ? -4.456  3.255  5.517   1.00 43.87 ? 81  SER A OG    1 
ATOM   613  N  N     . THR A 1 85  ? -4.686  6.478  3.274   1.00 29.56 ? 82  THR A N     1 
ATOM   614  C  CA    . THR A 1 85  ? -5.452  7.702  3.473   1.00 27.28 ? 82  THR A CA    1 
ATOM   615  C  C     . THR A 1 85  ? -6.954  7.381  3.454   1.00 27.78 ? 82  THR A C     1 
ATOM   616  O  O     . THR A 1 85  ? -7.328  6.252  3.153   1.00 28.60 ? 82  THR A O     1 
ATOM   617  C  CB    . THR A 1 85  ? -5.134  8.735  2.369   1.00 23.19 ? 82  THR A CB    1 
ATOM   618  O  OG1   . THR A 1 85  ? -5.858  8.403  1.188   1.00 22.19 ? 82  THR A OG1   1 
ATOM   619  C  CG2   . THR A 1 85  ? -3.669  8.740  2.030   1.00 22.49 ? 82  THR A CG2   1 
ATOM   620  N  N     . PRO A 1 86  ? -7.814  8.368  3.791   1.00 27.03 ? 83  PRO A N     1 
ATOM   621  C  CA    . PRO A 1 86  ? -9.255  8.234  3.609   1.00 26.98 ? 83  PRO A CA    1 
ATOM   622  C  C     . PRO A 1 86  ? -9.753  8.797  2.280   1.00 23.81 ? 83  PRO A C     1 
ATOM   623  O  O     . PRO A 1 86  ? -10.932 9.106  2.157   1.00 22.56 ? 83  PRO A O     1 
ATOM   624  C  CB    . PRO A 1 86  ? -9.838  9.039  4.788   1.00 28.25 ? 83  PRO A CB    1 
ATOM   625  C  CG    . PRO A 1 86  ? -8.749  9.937  5.267   1.00 28.45 ? 83  PRO A CG    1 
ATOM   626  C  CD    . PRO A 1 86  ? -7.489  9.613  4.507   1.00 27.40 ? 83  PRO A CD    1 
ATOM   627  N  N     . MET A 1 87  ? -8.875  8.910  1.285   1.00 21.93 ? 84  MET A N     1 
ATOM   628  C  CA    . MET A 1 87  ? -9.280  9.511  0.023   1.00 20.12 ? 84  MET A CA    1 
ATOM   629  C  C     . MET A 1 87  ? -10.430 8.774  -0.633  1.00 20.24 ? 84  MET A C     1 
ATOM   630  O  O     . MET A 1 87  ? -11.304 9.400  -1.241  1.00 19.01 ? 84  MET A O     1 
ATOM   631  C  CB    . MET A 1 87  ? -8.113  9.638  -0.955  1.00 19.24 ? 84  MET A CB    1 
ATOM   632  C  CG    . MET A 1 87  ? -7.178  10.807 -0.654  1.00 19.28 ? 84  MET A CG    1 
ATOM   633  S  SD    . MET A 1 87  ? -7.946  12.430 -0.592  1.00 17.29 ? 84  MET A SD    1 
ATOM   634  C  CE    . MET A 1 87  ? -8.142  12.767 -2.334  1.00 16.81 ? 84  MET A CE    1 
ATOM   635  N  N     . VAL A 1 88  ? -10.456 7.456  -0.491  1.00 22.07 ? 85  VAL A N     1 
ATOM   636  C  CA    . VAL A 1 88  ? -11.531 6.683  -1.077  1.00 23.30 ? 85  VAL A CA    1 
ATOM   637  C  C     . VAL A 1 88  ? -12.854 7.090  -0.420  1.00 23.38 ? 85  VAL A C     1 
ATOM   638  O  O     . VAL A 1 88  ? -13.835 7.362  -1.107  1.00 23.34 ? 85  VAL A O     1 
ATOM   639  C  CB    . VAL A 1 88  ? -11.275 5.190  -0.951  1.00 26.71 ? 85  VAL A CB    1 
ATOM   640  C  CG1   . VAL A 1 88  ? -12.410 4.414  -1.612  1.00 28.75 ? 85  VAL A CG1   1 
ATOM   641  C  CG2   . VAL A 1 88  ? -9.883  4.832  -1.568  1.00 26.59 ? 85  VAL A CG2   1 
ATOM   642  N  N     . ILE A 1 89  ? -12.859 7.175  0.905   1.00 23.95 ? 86  ILE A N     1 
ATOM   643  C  CA    . ILE A 1 89  ? -14.030 7.634  1.644   1.00 24.16 ? 86  ILE A CA    1 
ATOM   644  C  C     . ILE A 1 89  ? -14.517 8.964  1.090   1.00 22.42 ? 86  ILE A C     1 
ATOM   645  O  O     . ILE A 1 89  ? -15.699 9.116  0.773   1.00 22.51 ? 86  ILE A O     1 
ATOM   646  C  CB    . ILE A 1 89  ? -13.735 7.786  3.159   1.00 25.90 ? 86  ILE A CB    1 
ATOM   647  C  CG1   . ILE A 1 89  ? -13.437 6.422  3.786   1.00 27.93 ? 86  ILE A CG1   1 
ATOM   648  C  CG2   . ILE A 1 89  ? -14.928 8.444  3.876   1.00 26.38 ? 86  ILE A CG2   1 
ATOM   649  C  CD1   . ILE A 1 89  ? -12.790 6.494  5.142   1.00 30.53 ? 86  ILE A CD1   1 
ATOM   650  N  N     . TYR A 1 90  ? -13.599 9.918  0.939   1.00 20.81 ? 87  TYR A N     1 
ATOM   651  C  CA    . TYR A 1 90  ? -13.970 11.252 0.481   1.00 19.70 ? 87  TYR A CA    1 
ATOM   652  C  C     . TYR A 1 90  ? -14.479 11.196 -0.973  1.00 19.49 ? 87  TYR A C     1 
ATOM   653  O  O     . TYR A 1 90  ? -15.384 11.948 -1.349  1.00 20.06 ? 87  TYR A O     1 
ATOM   654  C  CB    . TYR A 1 90  ? -12.793 12.245 0.643   1.00 18.46 ? 87  TYR A CB    1 
ATOM   655  C  CG    . TYR A 1 90  ? -12.233 12.382 2.050   1.00 18.56 ? 87  TYR A CG    1 
ATOM   656  C  CD1   . TYR A 1 90  ? -13.027 12.190 3.160   1.00 20.73 ? 87  TYR A CD1   1 
ATOM   657  C  CD2   . TYR A 1 90  ? -10.898 12.721 2.266   1.00 18.38 ? 87  TYR A CD2   1 
ATOM   658  C  CE1   . TYR A 1 90  ? -12.520 12.315 4.453   1.00 24.02 ? 87  TYR A CE1   1 
ATOM   659  C  CE2   . TYR A 1 90  ? -10.370 12.845 3.581   1.00 18.53 ? 87  TYR A CE2   1 
ATOM   660  C  CZ    . TYR A 1 90  ? -11.183 12.653 4.661   1.00 23.36 ? 87  TYR A CZ    1 
ATOM   661  O  OH    . TYR A 1 90  ? -10.715 12.778 5.979   1.00 25.63 ? 87  TYR A OH    1 
ATOM   662  N  N     . LEU A 1 91  ? -13.937 10.286 -1.781  1.00 19.82 ? 88  LEU A N     1 
ATOM   663  C  CA    . LEU A 1 91  ? -14.452 10.093 -3.159  1.00 20.12 ? 88  LEU A CA    1 
ATOM   664  C  C     . LEU A 1 91  ? -15.872 9.521  -3.148  1.00 21.68 ? 88  LEU A C     1 
ATOM   665  O  O     . LEU A 1 91  ? -16.705 9.958  -3.930  1.00 22.33 ? 88  LEU A O     1 
ATOM   666  C  CB    . LEU A 1 91  ? -13.525 9.209  -4.013  1.00 20.36 ? 88  LEU A CB    1 
ATOM   667  C  CG    . LEU A 1 91  ? -14.010 8.795  -5.426  1.00 22.55 ? 88  LEU A CG    1 
ATOM   668  C  CD1   . LEU A 1 91  ? -14.331 10.004 -6.298  1.00 21.89 ? 88  LEU A CD1   1 
ATOM   669  C  CD2   . LEU A 1 91  ? -13.000 7.879  -6.131  1.00 22.04 ? 88  LEU A CD2   1 
ATOM   670  N  N     . ASN A 1 92  ? -16.138 8.540  -2.282  1.00 23.19 ? 89  ASN A N     1 
ATOM   671  C  CA    . ASN A 1 92  ? -17.469 7.911  -2.208  1.00 25.04 ? 89  ASN A CA    1 
ATOM   672  C  C     . ASN A 1 92  ? -18.556 8.882  -1.748  1.00 24.29 ? 89  ASN A C     1 
ATOM   673  O  O     . ASN A 1 92  ? -19.722 8.747  -2.151  1.00 25.52 ? 89  ASN A O     1 
ATOM   674  C  CB    . ASN A 1 92  ? -17.452 6.665  -1.306  1.00 27.36 ? 89  ASN A CB    1 
ATOM   675  C  CG    . ASN A 1 92  ? -16.671 5.506  -1.920  1.00 30.00 ? 89  ASN A CG    1 
ATOM   676  O  OD1   . ASN A 1 92  ? -16.252 5.575  -3.062  1.00 28.79 ? 89  ASN A OD1   1 
ATOM   677  N  ND2   . ASN A 1 92  ? -16.479 4.434  -1.153  1.00 34.37 ? 89  ASN A ND2   1 
ATOM   678  N  N     . ILE A 1 93  ? -18.180 9.855  -0.915  1.00 22.66 ? 90  ILE A N     1 
ATOM   679  C  CA    . ILE A 1 93  ? -19.102 10.938 -0.526  1.00 22.57 ? 90  ILE A CA    1 
ATOM   680  C  C     . ILE A 1 93  ? -19.506 11.763 -1.762  1.00 21.82 ? 90  ILE A C     1 
ATOM   681  O  O     . ILE A 1 93  ? -20.675 12.112 -1.944  1.00 21.77 ? 90  ILE A O     1 
ATOM   682  C  CB    . ILE A 1 93  ? -18.496 11.870 0.553   1.00 22.07 ? 90  ILE A CB    1 
ATOM   683  C  CG1   . ILE A 1 93  ? -18.262 11.106 1.858   1.00 23.48 ? 90  ILE A CG1   1 
ATOM   684  C  CG2   . ILE A 1 93  ? -19.434 13.038 0.844   1.00 22.60 ? 90  ILE A CG2   1 
ATOM   685  C  CD1   . ILE A 1 93  ? -17.370 11.823 2.813   1.00 21.98 ? 90  ILE A CD1   1 
ATOM   686  N  N     . HIS A 1 94  ? -18.534 12.052 -2.626  1.00 21.37 ? 91  HIS A N     1 
ATOM   687  C  CA    . HIS A 1 94  ? -18.827 12.786 -3.863  1.00 21.34 ? 91  HIS A CA    1 
ATOM   688  C  C     . HIS A 1 94  ? -19.724 11.951 -4.768  1.00 22.69 ? 91  HIS A C     1 
ATOM   689  O  O     . HIS A 1 94  ? -20.719 12.460 -5.286  1.00 22.80 ? 91  HIS A O     1 
ATOM   690  C  CB    . HIS A 1 94  ? -17.558 13.182 -4.602  1.00 20.43 ? 91  HIS A CB    1 
ATOM   691  C  CG    . HIS A 1 94  ? -17.762 13.362 -6.071  1.00 22.58 ? 91  HIS A CG    1 
ATOM   692  N  ND1   . HIS A 1 94  ? -18.455 14.432 -6.599  1.00 24.27 ? 91  HIS A ND1   1 
ATOM   693  C  CD2   . HIS A 1 94  ? -17.415 12.578 -7.120  1.00 23.48 ? 91  HIS A CD2   1 
ATOM   694  C  CE1   . HIS A 1 94  ? -18.505 14.312 -7.913  1.00 26.37 ? 91  HIS A CE1   1 
ATOM   695  N  NE2   . HIS A 1 94  ? -17.881 13.195 -8.255  1.00 26.75 ? 91  HIS A NE2   1 
ATOM   696  N  N     . ALA A 1 95  ? -19.370 10.670 -4.937  1.00 23.72 ? 92  ALA A N     1 
ATOM   697  C  CA    . ALA A 1 95  ? -20.146 9.733  -5.784  1.00 26.07 ? 92  ALA A CA    1 
ATOM   698  C  C     . ALA A 1 95  ? -21.599 9.676  -5.349  1.00 27.55 ? 92  ALA A C     1 
ATOM   699  O  O     . ALA A 1 95  ? -22.498 9.779  -6.172  1.00 29.22 ? 92  ALA A O     1 
ATOM   700  C  CB    . ALA A 1 95  ? -19.522 8.302  -5.779  1.00 26.79 ? 92  ALA A CB    1 
ATOM   701  N  N     . ALA A 1 96  ? -21.819 9.539  -4.045  1.00 28.08 ? 93  ALA A N     1 
ATOM   702  C  CA    . ALA A 1 96  ? -23.166 9.435  -3.493  1.00 29.94 ? 93  ALA A CA    1 
ATOM   703  C  C     . ALA A 1 96  ? -23.920 10.749 -3.649  1.00 29.69 ? 93  ALA A C     1 
ATOM   704  O  O     . ALA A 1 96  ? -25.116 10.760 -3.895  1.00 30.98 ? 93  ALA A O     1 
ATOM   705  C  CB    . ALA A 1 96  ? -23.113 9.005  -2.021  1.00 30.38 ? 93  ALA A CB    1 
ATOM   706  N  N     . MET A 1 97  ? -23.210 11.861 -3.521  1.00 28.58 ? 94  MET A N     1 
ATOM   707  C  CA    . MET A 1 97  ? -23.807 13.161 -3.774  1.00 29.12 ? 94  MET A CA    1 
ATOM   708  C  C     . MET A 1 97  ? -24.240 13.302 -5.248  1.00 29.22 ? 94  MET A C     1 
ATOM   709  O  O     . MET A 1 97  ? -25.340 13.784 -5.534  1.00 29.30 ? 94  MET A O     1 
ATOM   710  C  CB    . MET A 1 97  ? -22.837 14.276 -3.356  1.00 28.44 ? 94  MET A CB    1 
ATOM   711  C  CG    . MET A 1 97  ? -23.459 15.656 -3.348  1.00 33.10 ? 94  MET A CG    1 
ATOM   712  S  SD    . MET A 1 97  ? -22.384 16.993 -2.774  1.00 40.33 ? 94  MET A SD    1 
ATOM   713  C  CE    . MET A 1 97  ? -21.049 16.920 -3.960  1.00 37.75 ? 94  MET A CE    1 
ATOM   714  N  N     . GLU A 1 98  ? -23.392 12.876 -6.185  1.00 28.71 ? 95  GLU A N     1 
ATOM   715  C  CA    . GLU A 1 98  ? -23.758 12.965 -7.610  1.00 30.69 ? 95  GLU A CA    1 
ATOM   716  C  C     . GLU A 1 98  ? -24.913 12.019 -7.936  1.00 33.54 ? 95  GLU A C     1 
ATOM   717  O  O     . GLU A 1 98  ? -25.711 12.310 -8.819  1.00 35.47 ? 95  GLU A O     1 
ATOM   718  C  CB    . GLU A 1 98  ? -22.551 12.711 -8.519  1.00 30.41 ? 95  GLU A CB    1 
ATOM   719  C  CG    . GLU A 1 98  ? -22.851 12.481 -10.023 1.00 33.46 ? 95  GLU A CG    1 
ATOM   720  C  CD    . GLU A 1 98  ? -23.448 13.686 -10.766 1.00 35.03 ? 95  GLU A CD    1 
ATOM   721  O  OE1   . GLU A 1 98  ? -23.234 14.858 -10.371 1.00 32.72 ? 95  GLU A OE1   1 
ATOM   722  O  OE2   . GLU A 1 98  ? -24.130 13.445 -11.783 1.00 38.93 ? 95  GLU A OE2   1 
ATOM   723  N  N     . GLU A 1 99  ? -25.016 10.906 -7.209  1.00 34.32 ? 96  GLU A N     1 
ATOM   724  C  CA    . GLU A 1 99  ? -26.151 10.005 -7.366  1.00 37.84 ? 96  GLU A CA    1 
ATOM   725  C  C     . GLU A 1 99  ? -27.467 10.703 -7.037  1.00 38.39 ? 96  GLU A C     1 
ATOM   726  O  O     . GLU A 1 99  ? -28.431 10.597 -7.797  1.00 40.83 ? 96  GLU A O     1 
ATOM   727  C  CB    . GLU A 1 99  ? -26.007 8.760  -6.486  1.00 39.05 ? 96  GLU A CB    1 
ATOM   728  C  CG    . GLU A 1 99  ? -25.009 7.760  -6.996  1.00 41.57 ? 96  GLU A CG    1 
ATOM   729  C  CD    . GLU A 1 99  ? -24.946 6.512  -6.130  1.00 45.97 ? 96  GLU A CD    1 
ATOM   730  O  OE1   . GLU A 1 99  ? -26.019 5.943  -5.813  1.00 49.10 ? 96  GLU A OE1   1 
ATOM   731  O  OE2   . GLU A 1 99  ? -23.815 6.102  -5.781  1.00 47.35 ? 96  GLU A OE2   1 
ATOM   732  N  N     . VAL A 1 100 ? -27.505 11.409 -5.909  1.00 36.36 ? 97  VAL A N     1 
ATOM   733  C  CA    . VAL A 1 100 ? -28.705 12.139 -5.523  1.00 37.27 ? 97  VAL A CA    1 
ATOM   734  C  C     . VAL A 1 100 ? -29.096 13.159 -6.597  1.00 38.00 ? 97  VAL A C     1 
ATOM   735  O  O     . VAL A 1 100 ? -30.276 13.312 -6.896  1.00 40.06 ? 97  VAL A O     1 
ATOM   736  C  CB    . VAL A 1 100 ? -28.555 12.787 -4.120  1.00 35.89 ? 97  VAL A CB    1 
ATOM   737  C  CG1   . VAL A 1 100 ? -29.663 13.800 -3.847  1.00 36.81 ? 97  VAL A CG1   1 
ATOM   738  C  CG2   . VAL A 1 100 ? -28.577 11.695 -3.050  1.00 35.89 ? 97  VAL A CG2   1 
ATOM   739  N  N     . ARG A 1 101 ? -28.110 13.823 -7.200  1.00 36.85 ? 98  ARG A N     1 
ATOM   740  C  CA    . ARG A 1 101 ? -28.381 14.794 -8.269  1.00 38.40 ? 98  ARG A CA    1 
ATOM   741  C  C     . ARG A 1 101 ? -29.131 14.153 -9.439  1.00 41.96 ? 98  ARG A C     1 
ATOM   742  O  O     . ARG A 1 101 ? -30.175 14.654 -9.870  1.00 43.66 ? 98  ARG A O     1 
ATOM   743  C  CB    . ARG A 1 101 ? -27.090 15.396 -8.812  1.00 36.85 ? 98  ARG A CB    1 
ATOM   744  C  CG    . ARG A 1 101 ? -26.389 16.400 -7.907  1.00 34.49 ? 98  ARG A CG    1 
ATOM   745  C  CD    . ARG A 1 101 ? -25.344 17.156 -8.712  1.00 33.59 ? 98  ARG A CD    1 
ATOM   746  N  NE    . ARG A 1 101 ? -24.511 18.014 -7.879  1.00 32.61 ? 98  ARG A NE    1 
ATOM   747  C  CZ    . ARG A 1 101 ? -23.321 17.688 -7.380  1.00 30.40 ? 98  ARG A CZ    1 
ATOM   748  N  NH1   . ARG A 1 101 ? -22.665 18.575 -6.641  1.00 30.12 ? 98  ARG A NH1   1 
ATOM   749  N  NH2   . ARG A 1 101 ? -22.766 16.502 -7.620  1.00 28.45 ? 98  ARG A NH2   1 
ATOM   750  N  N     . LYS A 1 102 ? -28.567 13.061 -9.953  1.00 42.96 ? 99  LYS A N     1 
ATOM   751  C  CA    . LYS A 1 102 ? -29.160 12.324 -11.068 1.00 47.18 ? 99  LYS A CA    1 
ATOM   752  C  C     . LYS A 1 102 ? -30.570 11.878 -10.729 1.00 49.89 ? 99  LYS A C     1 
ATOM   753  O  O     . LYS A 1 102 ? -31.491 12.120 -11.507 1.00 53.30 ? 99  LYS A O     1 
ATOM   754  C  CB    . LYS A 1 102 ? -28.311 11.104 -11.425 1.00 47.48 ? 99  LYS A CB    1 
ATOM   755  C  CG    . LYS A 1 102 ? -27.034 11.441 -12.155 1.00 46.75 ? 99  LYS A CG    1 
ATOM   756  C  CD    . LYS A 1 102 ? -27.174 11.315 -13.675 1.00 50.74 ? 99  LYS A CD    1 
ATOM   757  C  CE    . LYS A 1 102 ? -25.810 11.414 -14.376 1.00 50.27 ? 99  LYS A CE    1 
ATOM   758  N  NZ    . LYS A 1 102 ? -24.689 10.864 -13.538 1.00 47.06 ? 99  LYS A NZ    1 
ATOM   759  N  N     . LYS A 1 103 ? -30.724 11.239 -9.568  1.00 49.28 ? 100 LYS A N     1 
ATOM   760  C  CA    . LYS A 1 103 ? -32.040 10.834 -9.050  1.00 51.95 ? 100 LYS A CA    1 
ATOM   761  C  C     . LYS A 1 103 ? -33.078 11.942 -9.148  1.00 53.04 ? 100 LYS A C     1 
ATOM   762  O  O     . LYS A 1 103 ? -34.205 11.717 -9.601  1.00 56.33 ? 100 LYS A O     1 
ATOM   763  C  CB    . LYS A 1 103 ? -31.943 10.424 -7.581  1.00 50.48 ? 100 LYS A CB    1 
ATOM   764  C  CG    . LYS A 1 103 ? -31.778 8.943  -7.323  1.00 53.18 ? 100 LYS A CG    1 
ATOM   765  C  CD    . LYS A 1 103 ? -32.264 8.621  -5.905  1.00 55.07 ? 100 LYS A CD    1 
ATOM   766  C  CE    . LYS A 1 103 ? -32.041 7.159  -5.508  1.00 57.78 ? 100 LYS A CE    1 
ATOM   767  N  NZ    . LYS A 1 103 ? -32.534 6.884  -4.116  1.00 58.68 ? 100 LYS A NZ    1 
ATOM   768  N  N     . ARG A 1 104 ? -32.695 13.132 -8.694  1.00 50.73 ? 101 ARG A N     1 
ATOM   769  C  CA    . ARG A 1 104 ? -33.602 14.277 -8.666  1.00 51.99 ? 101 ARG A CA    1 
ATOM   770  C  C     . ARG A 1 104 ? -33.744 14.948 -10.033 1.00 54.06 ? 101 ARG A C     1 
ATOM   771  O  O     . ARG A 1 104 ? -34.744 15.611 -10.295 1.00 56.49 ? 101 ARG A O     1 
ATOM   772  C  CB    . ARG A 1 104 ? -33.140 15.296 -7.625  1.00 49.57 ? 101 ARG A CB    1 
ATOM   773  C  CG    . ARG A 1 104 ? -33.314 14.819 -6.186  1.00 48.95 ? 101 ARG A CG    1 
ATOM   774  C  CD    . ARG A 1 104 ? -32.601 15.746 -5.209  1.00 47.04 ? 101 ARG A CD    1 
ATOM   775  N  NE    . ARG A 1 104 ? -32.787 15.344 -3.817  1.00 46.61 ? 101 ARG A NE    1 
ATOM   776  C  CZ    . ARG A 1 104 ? -32.411 16.063 -2.762  1.00 45.60 ? 101 ARG A CZ    1 
ATOM   777  N  NH1   . ARG A 1 104 ? -31.808 17.242 -2.913  1.00 45.14 ? 101 ARG A NH1   1 
ATOM   778  N  NH2   . ARG A 1 104 ? -32.637 15.593 -1.544  1.00 45.20 ? 101 ARG A NH2   1 
ATOM   779  N  N     . GLU A 1 105 ? -32.749 14.796 -10.899 1.00 53.51 ? 102 GLU A N     1 
ATOM   780  C  CA    . GLU A 1 105 ? -32.893 15.257 -12.277 1.00 56.50 ? 102 GLU A CA    1 
ATOM   781  C  C     . GLU A 1 105 ? -33.930 14.391 -12.991 1.00 60.79 ? 102 GLU A C     1 
ATOM   782  O  O     . GLU A 1 105 ? -34.824 14.908 -13.669 1.00 63.85 ? 102 GLU A O     1 
ATOM   783  C  CB    . GLU A 1 105 ? -31.555 15.223 -13.016 1.00 55.31 ? 102 GLU A CB    1 
ATOM   784  C  CG    . GLU A 1 105 ? -30.645 16.373 -12.638 1.00 52.20 ? 102 GLU A CG    1 
ATOM   785  C  CD    . GLU A 1 105 ? -29.286 16.289 -13.287 1.00 50.32 ? 102 GLU A CD    1 
ATOM   786  O  OE1   . GLU A 1 105 ? -28.874 17.294 -13.897 1.00 50.44 ? 102 GLU A OE1   1 
ATOM   787  O  OE2   . GLU A 1 105 ? -28.630 15.229 -13.193 1.00 48.54 ? 102 GLU A OE2   1 
ATOM   788  N  N     . GLU A 1 106 ? -33.819 13.079 -12.790 1.00 61.17 ? 103 GLU A N     1 
ATOM   789  C  CA    . GLU A 1 106 ? -34.688 12.102 -13.442 1.00 65.68 ? 103 GLU A CA    1 
ATOM   790  C  C     . GLU A 1 106 ? -36.110 12.120 -12.904 1.00 67.47 ? 103 GLU A C     1 
ATOM   791  O  O     . GLU A 1 106 ? -37.028 11.680 -13.588 1.00 71.80 ? 103 GLU A O     1 
ATOM   792  C  CB    . GLU A 1 106 ? -34.082 10.701 -13.323 1.00 65.85 ? 103 GLU A CB    1 
ATOM   793  C  CG    . GLU A 1 106 ? -32.782 10.543 -14.128 1.00 65.39 ? 103 GLU A CG    1 
ATOM   794  C  CD    . GLU A 1 106 ? -31.927 9.363  -13.679 1.00 65.26 ? 103 GLU A CD    1 
ATOM   795  O  OE1   . GLU A 1 106 ? -32.433 8.515  -12.911 1.00 65.48 ? 103 GLU A OE1   1 
ATOM   796  O  OE2   . GLU A 1 106 ? -30.740 9.289  -14.093 1.00 64.36 ? 103 GLU A OE2   1 
ATOM   797  N  N     . GLN A 1 107 ? -36.292 12.632 -11.688 1.00 64.66 ? 104 GLN A N     1 
ATOM   798  C  CA    . GLN A 1 107 ? -37.631 12.852 -11.136 1.00 66.26 ? 104 GLN A CA    1 
ATOM   799  C  C     . GLN A 1 107 ? -38.290 14.132 -11.664 1.00 67.87 ? 104 GLN A C     1 
ATOM   800  O  O     . GLN A 1 107 ? -39.506 14.289 -11.551 1.00 70.43 ? 104 GLN A O     1 
ATOM   801  C  CB    . GLN A 1 107 ? -37.590 12.897 -9.603  1.00 63.31 ? 104 GLN A CB    1 
ATOM   802  C  CG    . GLN A 1 107 ? -37.469 11.529 -8.941  1.00 63.79 ? 104 GLN A CG    1 
ATOM   803  C  CD    . GLN A 1 107 ? -37.364 11.612 -7.420  1.00 62.12 ? 104 GLN A CD    1 
ATOM   804  O  OE1   . GLN A 1 107 ? -36.266 12.183 -6.925  1.00 64.71 ? 104 GLN A OE1   1 
ATOM   805  N  NE2   . GLN A 1 107 ? -38.269 11.179 -6.701  1.00 58.07 ? 104 GLN A NE2   1 
ATOM   806  N  N     . ALA A 1 108 ? -37.497 15.037 -12.236 1.00 66.62 ? 105 ALA A N     1 
ATOM   807  C  CA    . ALA A 1 108 ? -37.988 16.360 -12.622 1.00 68.30 ? 105 ALA A CA    1 
ATOM   808  C  C     . ALA A 1 108 ? -38.472 16.387 -14.068 1.00 72.76 ? 105 ALA A C     1 
ATOM   809  O  O     . ALA A 1 108 ? -37.677 16.492 -14.996 1.00 73.17 ? 105 ALA A O     1 
ATOM   810  C  CB    . ALA A 1 108 ? -36.903 17.410 -12.397 1.00 65.30 ? 105 ALA A CB    1 
ATOM   811  N  N     . LYS A 1 114 ? -37.440 22.328 -11.484 1.00 54.90 ? 111 LYS A N     1 
ATOM   812  C  CA    . LYS A 1 114 ? -36.008 22.042 -11.625 1.00 52.22 ? 111 LYS A CA    1 
ATOM   813  C  C     . LYS A 1 114 ? -35.453 21.323 -10.396 1.00 49.58 ? 111 LYS A C     1 
ATOM   814  O  O     . LYS A 1 114 ? -35.861 21.594 -9.259  1.00 49.06 ? 111 LYS A O     1 
ATOM   815  C  CB    . LYS A 1 114 ? -35.217 23.334 -11.877 1.00 51.27 ? 111 LYS A CB    1 
ATOM   816  C  CG    . LYS A 1 114 ? -35.829 24.268 -12.941 1.00 54.61 ? 111 LYS A CG    1 
ATOM   817  C  CD    . LYS A 1 114 ? -36.077 23.561 -14.276 1.00 57.50 ? 111 LYS A CD    1 
ATOM   818  C  CE    . LYS A 1 114 ? -36.744 24.486 -15.297 1.00 61.46 ? 111 LYS A CE    1 
ATOM   819  N  NZ    . LYS A 1 114 ? -35.866 25.627 -15.682 1.00 61.12 ? 111 LYS A NZ    1 
ATOM   820  N  N     . ALA A 1 115 ? -34.500 20.424 -10.640 1.00 47.81 ? 112 ALA A N     1 
ATOM   821  C  CA    . ALA A 1 115 ? -33.928 19.568 -9.604  1.00 45.31 ? 112 ALA A CA    1 
ATOM   822  C  C     . ALA A 1 115 ? -33.072 20.353 -8.607  1.00 42.43 ? 112 ALA A C     1 
ATOM   823  O  O     . ALA A 1 115 ? -32.162 21.078 -9.005  1.00 41.44 ? 112 ALA A O     1 
ATOM   824  C  CB    . ALA A 1 115 ? -33.101 18.465 -10.254 1.00 44.71 ? 112 ALA A CB    1 
ATOM   825  N  N     . LYS A 1 116 ? -33.374 20.210 -7.318  1.00 41.18 ? 113 LYS A N     1 
ATOM   826  C  CA    . LYS A 1 116 ? -32.549 20.813 -6.269  1.00 38.71 ? 113 LYS A CA    1 
ATOM   827  C  C     . LYS A 1 116 ? -31.406 19.868 -5.921  1.00 36.08 ? 113 LYS A C     1 
ATOM   828  O  O     . LYS A 1 116 ? -31.628 18.692 -5.610  1.00 36.05 ? 113 LYS A O     1 
ATOM   829  C  CB    . LYS A 1 116 ? -33.362 21.149 -5.012  1.00 39.34 ? 113 LYS A CB    1 
ATOM   830  C  CG    . LYS A 1 116 ? -32.541 21.914 -3.954  1.00 38.56 ? 113 LYS A CG    1 
ATOM   831  C  CD    . LYS A 1 116 ? -33.397 22.780 -3.020  1.00 40.89 ? 113 LYS A CD    1 
ATOM   832  C  CE    . LYS A 1 116 ? -34.048 21.980 -1.883  1.00 42.31 ? 113 LYS A CE    1 
ATOM   833  N  NZ    . LYS A 1 116 ? -34.514 22.868 -0.762  1.00 42.41 ? 113 LYS A NZ    1 
ATOM   834  N  N     . GLY A 1 117 ? -30.182 20.393 -5.988  1.00 33.41 ? 114 GLY A N     1 
ATOM   835  C  CA    . GLY A 1 117 ? -28.988 19.621 -5.682  1.00 30.96 ? 114 GLY A CA    1 
ATOM   836  C  C     . GLY A 1 117 ? -28.869 19.338 -4.201  1.00 29.14 ? 114 GLY A C     1 
ATOM   837  O  O     . GLY A 1 117 ? -29.449 20.054 -3.379  1.00 29.21 ? 114 GLY A O     1 
ATOM   838  N  N     . PRO A 1 118 ? -28.115 18.290 -3.848  1.00 27.39 ? 115 PRO A N     1 
ATOM   839  C  CA    . PRO A 1 118 ? -27.961 17.892 -2.461  1.00 26.17 ? 115 PRO A CA    1 
ATOM   840  C  C     . PRO A 1 118 ? -27.069 18.865 -1.692  1.00 23.85 ? 115 PRO A C     1 
ATOM   841  O  O     . PRO A 1 118 ? -26.200 19.502 -2.274  1.00 22.32 ? 115 PRO A O     1 
ATOM   842  C  CB    . PRO A 1 118 ? -27.281 16.537 -2.572  1.00 25.94 ? 115 PRO A CB    1 
ATOM   843  C  CG    . PRO A 1 118 ? -26.431 16.699 -3.780  1.00 25.87 ? 115 PRO A CG    1 
ATOM   844  C  CD    . PRO A 1 118 ? -27.281 17.463 -4.737  1.00 27.40 ? 115 PRO A CD    1 
ATOM   845  N  N     . ARG A 1 119 ? -27.309 18.971 -0.395  1.00 22.99 ? 116 ARG A N     1 
ATOM   846  C  CA    . ARG A 1 119 ? -26.619 19.927 0.440   1.00 21.50 ? 116 ARG A CA    1 
ATOM   847  C  C     . ARG A 1 119 ? -25.948 19.214 1.580   1.00 20.54 ? 116 ARG A C     1 
ATOM   848  O  O     . ARG A 1 119 ? -26.565 18.413 2.275   1.00 20.91 ? 116 ARG A O     1 
ATOM   849  C  CB    . ARG A 1 119 ? -27.597 20.948 0.970   1.00 22.61 ? 116 ARG A CB    1 
ATOM   850  C  CG    . ARG A 1 119 ? -28.277 21.715 -0.136  1.00 23.89 ? 116 ARG A CG    1 
ATOM   851  C  CD    . ARG A 1 119 ? -29.056 22.822 0.420   1.00 25.58 ? 116 ARG A CD    1 
ATOM   852  N  NE    . ARG A 1 119 ? -29.765 23.546 -0.618  1.00 26.91 ? 116 ARG A NE    1 
ATOM   853  C  CZ    . ARG A 1 119 ? -30.591 24.552 -0.378  1.00 27.39 ? 116 ARG A CZ    1 
ATOM   854  N  NH1   . ARG A 1 119 ? -30.806 24.948 0.872   1.00 27.46 ? 116 ARG A NH1   1 
ATOM   855  N  NH2   . ARG A 1 119 ? -31.196 25.164 -1.388  1.00 27.85 ? 116 ARG A NH2   1 
ATOM   856  N  N     . LEU A 1 120 ? -24.678 19.542 1.773   1.00 19.05 ? 117 LEU A N     1 
ATOM   857  C  CA    . LEU A 1 120 ? -23.815 18.786 2.622   1.00 18.24 ? 117 LEU A CA    1 
ATOM   858  C  C     . LEU A 1 120 ? -23.125 19.704 3.629   1.00 17.20 ? 117 LEU A C     1 
ATOM   859  O  O     . LEU A 1 120 ? -22.537 20.733 3.255   1.00 16.53 ? 117 LEU A O     1 
ATOM   860  C  CB    . LEU A 1 120 ? -22.815 18.074 1.727   1.00 17.87 ? 117 LEU A CB    1 
ATOM   861  C  CG    . LEU A 1 120 ? -21.981 16.939 2.267   1.00 19.15 ? 117 LEU A CG    1 
ATOM   862  C  CD1   . LEU A 1 120 ? -21.418 16.085 1.092   1.00 18.73 ? 117 LEU A CD1   1 
ATOM   863  C  CD2   . LEU A 1 120 ? -20.875 17.533 3.136   1.00 19.28 ? 117 LEU A CD2   1 
ATOM   864  N  N     . LEU A 1 121 ? -23.202 19.306 4.899   1.00 16.68 ? 118 LEU A N     1 
ATOM   865  C  CA    . LEU A 1 121 ? -22.593 20.017 6.016   1.00 16.34 ? 118 LEU A CA    1 
ATOM   866  C  C     . LEU A 1 121 ? -21.410 19.223 6.562   1.00 16.09 ? 118 LEU A C     1 
ATOM   867  O  O     . LEU A 1 121 ? -21.576 18.065 6.962   1.00 16.27 ? 118 LEU A O     1 
ATOM   868  C  CB    . LEU A 1 121 ? -23.624 20.213 7.132   1.00 16.58 ? 118 LEU A CB    1 
ATOM   869  C  CG    . LEU A 1 121 ? -23.283 21.192 8.256   1.00 15.47 ? 118 LEU A CG    1 
ATOM   870  C  CD1   . LEU A 1 121 ? -23.254 22.633 7.747   1.00 13.94 ? 118 LEU A CD1   1 
ATOM   871  C  CD2   . LEU A 1 121 ? -24.292 21.056 9.388   1.00 13.50 ? 118 LEU A CD2   1 
ATOM   872  N  N     . LEU A 1 122 ? -20.233 19.850 6.582   1.00 15.41 ? 119 LEU A N     1 
ATOM   873  C  CA    . LEU A 1 122 ? -19.028 19.235 7.134   1.00 15.61 ? 119 LEU A CA    1 
ATOM   874  C  C     . LEU A 1 122 ? -18.824 19.790 8.547   1.00 15.57 ? 119 LEU A C     1 
ATOM   875  O  O     . LEU A 1 122 ? -18.733 21.013 8.725   1.00 15.60 ? 119 LEU A O     1 
ATOM   876  C  CB    . LEU A 1 122 ? -17.813 19.542 6.251   1.00 15.10 ? 119 LEU A CB    1 
ATOM   877  C  CG    . LEU A 1 122 ? -17.701 18.788 4.930   1.00 17.47 ? 119 LEU A CG    1 
ATOM   878  C  CD1   . LEU A 1 122 ? -16.989 19.589 3.869   1.00 20.29 ? 119 LEU A CD1   1 
ATOM   879  C  CD2   . LEU A 1 122 ? -16.958 17.494 5.133   1.00 22.34 ? 119 LEU A CD2   1 
ATOM   880  N  N     . VAL A 1 123 ? -18.777 18.894 9.539   1.00 15.86 ? 120 VAL A N     1 
ATOM   881  C  CA    . VAL A 1 123 ? -18.598 19.266 10.956  1.00 15.83 ? 120 VAL A CA    1 
ATOM   882  C  C     . VAL A 1 123 ? -17.523 18.407 11.660  1.00 16.20 ? 120 VAL A C     1 
ATOM   883  O  O     . VAL A 1 123 ? -17.103 17.343 11.178  1.00 15.48 ? 120 VAL A O     1 
ATOM   884  C  CB    . VAL A 1 123 ? -19.941 19.206 11.763  1.00 17.16 ? 120 VAL A CB    1 
ATOM   885  C  CG1   . VAL A 1 123 ? -21.041 19.992 11.061  1.00 16.66 ? 120 VAL A CG1   1 
ATOM   886  C  CG2   . VAL A 1 123 ? -20.394 17.762 11.995  1.00 16.27 ? 120 VAL A CG2   1 
ATOM   887  N  N     . GLY A 1 124 ? -17.082 18.891 12.814  1.00 16.51 ? 121 GLY A N     1 
ATOM   888  C  CA    . GLY A 1 124 ? -16.013 18.253 13.556  1.00 16.96 ? 121 GLY A CA    1 
ATOM   889  C  C     . GLY A 1 124 ? -15.160 19.310 14.196  1.00 17.19 ? 121 GLY A C     1 
ATOM   890  O  O     . GLY A 1 124 ? -15.303 20.496 13.898  1.00 17.05 ? 121 GLY A O     1 
ATOM   891  N  N     . PRO A 1 125 ? -14.260 18.901 15.078  1.00 17.93 ? 122 PRO A N     1 
ATOM   892  C  CA    . PRO A 1 125 ? -13.487 19.902 15.813  1.00 18.54 ? 122 PRO A CA    1 
ATOM   893  C  C     . PRO A 1 125 ? -12.314 20.454 14.996  1.00 17.89 ? 122 PRO A C     1 
ATOM   894  O  O     . PRO A 1 125 ? -12.111 20.037 13.860  1.00 17.04 ? 122 PRO A O     1 
ATOM   895  C  CB    . PRO A 1 125 ? -13.003 19.123 17.044  1.00 19.42 ? 122 PRO A CB    1 
ATOM   896  C  CG    . PRO A 1 125 ? -12.882 17.712 16.569  1.00 19.44 ? 122 PRO A CG    1 
ATOM   897  C  CD    . PRO A 1 125 ? -13.982 17.531 15.537  1.00 18.96 ? 122 PRO A CD    1 
ATOM   898  N  N     . THR A 1 126 ? -11.564 21.388 15.590  1.00 18.63 ? 123 THR A N     1 
ATOM   899  C  CA    . THR A 1 126 ? -10.391 21.996 14.960  1.00 18.38 ? 123 THR A CA    1 
ATOM   900  C  C     . THR A 1 126 ? -9.408  20.956 14.383  1.00 18.75 ? 123 THR A C     1 
ATOM   901  O  O     . THR A 1 126 ? -9.156  19.906 14.984  1.00 19.11 ? 123 THR A O     1 
ATOM   902  C  CB    . THR A 1 126 ? -9.631  22.937 15.956  1.00 19.57 ? 123 THR A CB    1 
ATOM   903  O  OG1   . THR A 1 126 ? -9.372  22.244 17.183  1.00 19.91 ? 123 THR A OG1   1 
ATOM   904  C  CG2   . THR A 1 126 ? -10.437 24.210 16.263  1.00 19.16 ? 123 THR A CG2   1 
ATOM   905  N  N     . ASP A 1 127 ? -8.910  21.242 13.181  1.00 18.25 ? 124 ASP A N     1 
ATOM   906  C  CA    . ASP A 1 127 ? -7.847  20.468 12.540  1.00 18.19 ? 124 ASP A CA    1 
ATOM   907  C  C     . ASP A 1 127 ? -8.180  19.006 12.295  1.00 17.73 ? 124 ASP A C     1 
ATOM   908  O  O     . ASP A 1 127 ? -7.355  18.124 12.517  1.00 17.76 ? 124 ASP A O     1 
ATOM   909  C  CB    . ASP A 1 127 ? -6.546  20.611 13.346  1.00 19.83 ? 124 ASP A CB    1 
ATOM   910  C  CG    . ASP A 1 127 ? -5.985  22.012 13.260  1.00 20.41 ? 124 ASP A CG    1 
ATOM   911  O  OD1   . ASP A 1 127 ? -6.110  22.600 12.174  1.00 19.43 ? 124 ASP A OD1   1 
ATOM   912  O  OD2   . ASP A 1 127 ? -5.432  22.528 14.252  1.00 20.95 ? 124 ASP A OD2   1 
ATOM   913  N  N     . VAL A 1 128 ? -9.390  18.756 11.805  1.00 16.99 ? 125 VAL A N     1 
ATOM   914  C  CA    . VAL A 1 128 ? -9.770  17.411 11.362  1.00 16.02 ? 125 VAL A CA    1 
ATOM   915  C  C     . VAL A 1 128 ? -9.841  17.338 9.840   1.00 15.34 ? 125 VAL A C     1 
ATOM   916  O  O     . VAL A 1 128 ? -10.115 16.290 9.276   1.00 14.87 ? 125 VAL A O     1 
ATOM   917  C  CB    . VAL A 1 128 ? -11.112 16.964 11.981  1.00 16.13 ? 125 VAL A CB    1 
ATOM   918  C  CG1   . VAL A 1 128 ? -10.998 16.908 13.509  1.00 15.75 ? 125 VAL A CG1   1 
ATOM   919  C  CG2   . VAL A 1 128 ? -12.254 17.856 11.541  1.00 14.38 ? 125 VAL A CG2   1 
ATOM   920  N  N     . GLY A 1 129 ? -9.591  18.466 9.181   1.00 14.99 ? 126 GLY A N     1 
ATOM   921  C  CA    . GLY A 1 129 ? -9.608  18.529 7.730   1.00 14.54 ? 126 GLY A CA    1 
ATOM   922  C  C     . GLY A 1 129 ? -10.940 18.921 7.095   1.00 13.77 ? 126 GLY A C     1 
ATOM   923  O  O     . GLY A 1 129 ? -11.189 18.543 5.954   1.00 12.97 ? 126 GLY A O     1 
ATOM   924  N  N     . LYS A 1 130 ? -11.798 19.660 7.806   1.00 13.61 ? 127 LYS A N     1 
ATOM   925  C  CA    . LYS A 1 130 ? -13.099 20.038 7.229   1.00 13.55 ? 127 LYS A CA    1 
ATOM   926  C  C     . LYS A 1 130 ? -12.913 20.897 5.974   1.00 13.61 ? 127 LYS A C     1 
ATOM   927  O  O     . LYS A 1 130 ? -13.592 20.695 4.969   1.00 13.27 ? 127 LYS A O     1 
ATOM   928  C  CB    . LYS A 1 130 ? -13.972 20.806 8.218   1.00 13.65 ? 127 LYS A CB    1 
ATOM   929  C  CG    . LYS A 1 130 ? -14.355 20.079 9.487   1.00 14.60 ? 127 LYS A CG    1 
ATOM   930  C  CD    . LYS A 1 130 ? -15.159 20.992 10.456  1.00 15.30 ? 127 LYS A CD    1 
ATOM   931  C  CE    . LYS A 1 130 ? -14.289 22.072 11.098  1.00 16.07 ? 127 LYS A CE    1 
ATOM   932  N  NZ    . LYS A 1 130 ? -13.064 21.493 11.732  1.00 16.89 ? 127 LYS A NZ    1 
ATOM   933  N  N     . THR A 1 131 ? -11.996 21.863 6.047   1.00 14.32 ? 128 THR A N     1 
ATOM   934  C  CA    . THR A 1 131 ? -11.753 22.803 4.941   1.00 13.70 ? 128 THR A CA    1 
ATOM   935  C  C     . THR A 1 131 ? -11.171 22.077 3.750   1.00 13.98 ? 128 THR A C     1 
ATOM   936  O  O     . THR A 1 131 ? -11.594 22.310 2.605   1.00 14.39 ? 128 THR A O     1 
ATOM   937  C  CB    . THR A 1 131 ? -10.830 23.971 5.387   1.00 14.51 ? 128 THR A CB    1 
ATOM   938  O  OG1   . THR A 1 131 ? -11.559 24.837 6.276   1.00 13.89 ? 128 THR A OG1   1 
ATOM   939  C  CG2   . THR A 1 131 ? -10.302 24.805 4.176   1.00 13.16 ? 128 THR A CG2   1 
ATOM   940  N  N     . THR A 1 132 ? -10.222 21.183 4.027   1.00 13.92 ? 129 THR A N     1 
ATOM   941  C  CA    . THR A 1 132 ? -9.555  20.385 3.011   1.00 13.97 ? 129 THR A CA    1 
ATOM   942  C  C     . THR A 1 132 ? -10.547 19.447 2.320   1.00 13.80 ? 129 THR A C     1 
ATOM   943  O  O     . THR A 1 132 ? -10.603 19.383 1.087   1.00 13.95 ? 129 THR A O     1 
ATOM   944  C  CB    . THR A 1 132 ? -8.380  19.582 3.627   1.00 14.66 ? 129 THR A CB    1 
ATOM   945  O  OG1   . THR A 1 132 ? -7.470  20.492 4.240   1.00 15.11 ? 129 THR A OG1   1 
ATOM   946  C  CG2   . THR A 1 132 ? -7.631  18.789 2.569   1.00 14.21 ? 129 THR A CG2   1 
ATOM   947  N  N     . VAL A 1 133 ? -11.347 18.740 3.108   1.00 13.75 ? 130 VAL A N     1 
ATOM   948  C  CA    . VAL A 1 133 ? -12.393 17.877 2.539   1.00 13.77 ? 130 VAL A CA    1 
ATOM   949  C  C     . VAL A 1 133 ? -13.423 18.695 1.736   1.00 13.90 ? 130 VAL A C     1 
ATOM   950  O  O     . VAL A 1 133 ? -13.855 18.250 0.668   1.00 14.86 ? 130 VAL A O     1 
ATOM   951  C  CB    . VAL A 1 133 ? -13.087 17.026 3.617   1.00 13.65 ? 130 VAL A CB    1 
ATOM   952  C  CG1   . VAL A 1 133 ? -14.255 16.239 3.012   1.00 12.91 ? 130 VAL A CG1   1 
ATOM   953  C  CG2   . VAL A 1 133 ? -12.071 16.070 4.279   1.00 14.35 ? 130 VAL A CG2   1 
ATOM   954  N  N     . SER A 1 134 ? -13.794 19.880 2.222   1.00 13.11 ? 131 SER A N     1 
ATOM   955  C  CA    A SER A 1 134 ? -14.714 20.732 1.473   0.50 13.59 ? 131 SER A CA    1 
ATOM   956  C  CA    B SER A 1 134 ? -14.699 20.771 1.493   0.50 13.30 ? 131 SER A CA    1 
ATOM   957  C  C     . SER A 1 134 ? -14.113 21.099 0.125   1.00 13.83 ? 131 SER A C     1 
ATOM   958  O  O     . SER A 1 134 ? -14.822 21.127 -0.882  1.00 14.53 ? 131 SER A O     1 
ATOM   959  C  CB    A SER A 1 134 ? -15.080 22.003 2.253   0.50 13.79 ? 131 SER A CB    1 
ATOM   960  C  CB    B SER A 1 134 ? -14.937 22.084 2.270   0.50 13.40 ? 131 SER A CB    1 
ATOM   961  O  OG    A SER A 1 134 ? -14.039 22.956 2.225   0.50 14.07 ? 131 SER A OG    1 
ATOM   962  O  OG    B SER A 1 134 ? -15.662 21.886 3.485   0.50 11.82 ? 131 SER A OG    1 
ATOM   963  N  N     . ARG A 1 135 ? -12.802 21.351 0.107   1.00 14.02 ? 132 ARG A N     1 
ATOM   964  C  CA    . ARG A 1 135 ? -12.073 21.653 -1.120  1.00 13.80 ? 132 ARG A CA    1 
ATOM   965  C  C     . ARG A 1 135 ? -12.054 20.475 -2.088  1.00 13.75 ? 132 ARG A C     1 
ATOM   966  O  O     . ARG A 1 135 ? -12.334 20.621 -3.273  1.00 13.57 ? 132 ARG A O     1 
ATOM   967  C  CB    . ARG A 1 135 ? -10.648 22.077 -0.767  1.00 14.41 ? 132 ARG A CB    1 
ATOM   968  C  CG    . ARG A 1 135 ? -9.756  22.371 -1.961  1.00 15.01 ? 132 ARG A CG    1 
ATOM   969  C  CD    . ARG A 1 135 ? -8.514  23.109 -1.514  1.00 16.00 ? 132 ARG A CD    1 
ATOM   970  N  NE    . ARG A 1 135 ? -7.549  23.259 -2.607  1.00 17.73 ? 132 ARG A NE    1 
ATOM   971  C  CZ    . ARG A 1 135 ? -6.394  23.906 -2.494  1.00 18.79 ? 132 ARG A CZ    1 
ATOM   972  N  NH1   . ARG A 1 135 ? -6.052  24.452 -1.333  1.00 19.55 ? 132 ARG A NH1   1 
ATOM   973  N  NH2   . ARG A 1 135 ? -5.580  24.011 -3.539  1.00 20.26 ? 132 ARG A NH2   1 
ATOM   974  N  N     . ILE A 1 136 ? -11.729 19.298 -1.578  1.00 13.34 ? 133 ILE A N     1 
ATOM   975  C  CA    . ILE A 1 136 ? -11.745 18.094 -2.393  1.00 13.45 ? 133 ILE A CA    1 
ATOM   976  C  C     . ILE A 1 136 ? -13.123 17.856 -3.008  1.00 13.53 ? 133 ILE A C     1 
ATOM   977  O  O     . ILE A 1 136 ? -13.247 17.608 -4.203  1.00 14.71 ? 133 ILE A O     1 
ATOM   978  C  CB    . ILE A 1 136 ? -11.329 16.881 -1.563  1.00 13.69 ? 133 ILE A CB    1 
ATOM   979  C  CG1   . ILE A 1 136 ? -9.821  16.960 -1.265  1.00 14.51 ? 133 ILE A CG1   1 
ATOM   980  C  CG2   . ILE A 1 136 ? -11.680 15.584 -2.265  1.00 12.59 ? 133 ILE A CG2   1 
ATOM   981  C  CD1   . ILE A 1 136 ? -9.421  16.253 -0.002  1.00 13.32 ? 133 ILE A CD1   1 
ATOM   982  N  N     . LEU A 1 137 ? -14.162 17.960 -2.199  1.00 13.38 ? 134 LEU A N     1 
ATOM   983  C  CA    . LEU A 1 137 ? -15.522 17.729 -2.682  1.00 13.54 ? 134 LEU A CA    1 
ATOM   984  C  C     . LEU A 1 137 ? -15.936 18.762 -3.736  1.00 13.93 ? 134 LEU A C     1 
ATOM   985  O  O     . LEU A 1 137 ? -16.516 18.402 -4.747  1.00 14.17 ? 134 LEU A O     1 
ATOM   986  C  CB    . LEU A 1 137 ? -16.503 17.708 -1.518  1.00 12.98 ? 134 LEU A CB    1 
ATOM   987  C  CG    . LEU A 1 137 ? -16.415 16.493 -0.575  1.00 13.49 ? 134 LEU A CG    1 
ATOM   988  C  CD1   . LEU A 1 137 ? -17.264 16.736 0.672   1.00 12.19 ? 134 LEU A CD1   1 
ATOM   989  C  CD2   . LEU A 1 137 ? -16.837 15.186 -1.273  1.00 12.65 ? 134 LEU A CD2   1 
ATOM   990  N  N     . CYS A 1 138 ? -15.617 20.037 -3.508  1.00 13.91 ? 135 CYS A N     1 
ATOM   991  C  CA    . CYS A 1 138 ? -15.928 21.088 -4.497  1.00 14.31 ? 135 CYS A CA    1 
ATOM   992  C  C     . CYS A 1 138 ? -15.259 20.779 -5.822  1.00 14.60 ? 135 CYS A C     1 
ATOM   993  O  O     . CYS A 1 138 ? -15.905 20.788 -6.856  1.00 15.50 ? 135 CYS A O     1 
ATOM   994  C  CB    . CYS A 1 138 ? -15.524 22.484 -3.994  1.00 14.43 ? 135 CYS A CB    1 
ATOM   995  S  SG    . CYS A 1 138 ? -16.688 23.151 -2.744  1.00 14.57 ? 135 CYS A SG    1 
ATOM   996  N  N     . ASN A 1 139 ? -13.966 20.477 -5.774  1.00 14.33 ? 136 ASN A N     1 
ATOM   997  C  CA    . ASN A 1 139 ? -13.200 20.132 -6.963  1.00 14.71 ? 136 ASN A CA    1 
ATOM   998  C  C     . ASN A 1 139 ? -13.756 18.943 -7.721  1.00 15.42 ? 136 ASN A C     1 
ATOM   999  O  O     . ASN A 1 139 ? -13.809 18.954 -8.959  1.00 15.85 ? 136 ASN A O     1 
ATOM   1000 C  CB    . ASN A 1 139 ? -11.750 19.837 -6.588  1.00 14.27 ? 136 ASN A CB    1 
ATOM   1001 C  CG    . ASN A 1 139 ? -10.945 21.091 -6.349  1.00 14.44 ? 136 ASN A CG    1 
ATOM   1002 O  OD1   . ASN A 1 139 ? -11.230 22.143 -6.926  1.00 15.52 ? 136 ASN A OD1   1 
ATOM   1003 N  ND2   . ASN A 1 139 ? -9.901  20.979 -5.532  1.00 13.59 ? 136 ASN A ND2   1 
ATOM   1004 N  N     . TYR A 1 140 ? -14.130 17.906 -6.979  1.00 15.15 ? 137 TYR A N     1 
ATOM   1005 C  CA    . TYR A 1 140 ? -14.643 16.681 -7.582  1.00 16.21 ? 137 TYR A CA    1 
ATOM   1006 C  C     . TYR A 1 140 ? -15.969 16.959 -8.267  1.00 17.03 ? 137 TYR A C     1 
ATOM   1007 O  O     . TYR A 1 140 ? -16.203 16.455 -9.364  1.00 18.28 ? 137 TYR A O     1 
ATOM   1008 C  CB    . TYR A 1 140 ? -14.804 15.570 -6.531  1.00 15.96 ? 137 TYR A CB    1 
ATOM   1009 C  CG    . TYR A 1 140 ? -13.531 14.845 -6.129  1.00 16.68 ? 137 TYR A CG    1 
ATOM   1010 C  CD1   . TYR A 1 140 ? -12.281 15.231 -6.608  1.00 18.60 ? 137 TYR A CD1   1 
ATOM   1011 C  CD2   . TYR A 1 140 ? -13.577 13.796 -5.222  1.00 18.68 ? 137 TYR A CD2   1 
ATOM   1012 C  CE1   . TYR A 1 140 ? -11.126 14.560 -6.223  1.00 19.08 ? 137 TYR A CE1   1 
ATOM   1013 C  CE2   . TYR A 1 140 ? -12.426 13.137 -4.822  1.00 18.83 ? 137 TYR A CE2   1 
ATOM   1014 C  CZ    . TYR A 1 140 ? -11.209 13.517 -5.333  1.00 19.51 ? 137 TYR A CZ    1 
ATOM   1015 O  OH    . TYR A 1 140 ? -10.065 12.859 -4.931  1.00 21.32 ? 137 TYR A OH    1 
ATOM   1016 N  N     . SER A 1 141 ? -16.814 17.775 -7.633  1.00 16.49 ? 138 SER A N     1 
ATOM   1017 C  CA    . SER A 1 141 ? -18.056 18.255 -8.259  1.00 17.69 ? 138 SER A CA    1 
ATOM   1018 C  C     . SER A 1 141 ? -17.818 19.017 -9.560  1.00 17.98 ? 138 SER A C     1 
ATOM   1019 O  O     . SER A 1 141 ? -18.539 18.799 -10.541 1.00 19.06 ? 138 SER A O     1 
ATOM   1020 C  CB    . SER A 1 141 ? -18.865 19.143 -7.292  1.00 17.54 ? 138 SER A CB    1 
ATOM   1021 O  OG    . SER A 1 141 ? -19.814 18.371 -6.575  1.00 20.10 ? 138 SER A OG    1 
ATOM   1022 N  N     . VAL A 1 142 ? -16.831 19.914 -9.572  1.00 17.38 ? 139 VAL A N     1 
ATOM   1023 C  CA    . VAL A 1 142 ? -16.512 20.679 -10.793 1.00 18.70 ? 139 VAL A CA    1 
ATOM   1024 C  C     . VAL A 1 142 ? -16.023 19.748 -11.907 1.00 19.99 ? 139 VAL A C     1 
ATOM   1025 O  O     . VAL A 1 142 ? -16.452 19.866 -13.053 1.00 21.21 ? 139 VAL A O     1 
ATOM   1026 C  CB    . VAL A 1 142 ? -15.463 21.760 -10.548 1.00 18.39 ? 139 VAL A CB    1 
ATOM   1027 C  CG1   . VAL A 1 142 ? -14.934 22.302 -11.890 1.00 19.90 ? 139 VAL A CG1   1 
ATOM   1028 C  CG2   . VAL A 1 142 ? -16.038 22.869 -9.697  1.00 16.90 ? 139 VAL A CG2   1 
ATOM   1029 N  N     . ARG A 1 143 ? -15.171 18.793 -11.546 1.00 19.85 ? 140 ARG A N     1 
ATOM   1030 C  CA    . ARG A 1 143 ? -14.643 17.795 -12.502 1.00 21.55 ? 140 ARG A CA    1 
ATOM   1031 C  C     . ARG A 1 143 ? -15.727 16.852 -13.048 1.00 22.63 ? 140 ARG A C     1 
ATOM   1032 O  O     . ARG A 1 143 ? -15.551 16.257 -14.096 1.00 24.11 ? 140 ARG A O     1 
ATOM   1033 C  CB    . ARG A 1 143 ? -13.524 16.976 -11.845 1.00 20.38 ? 140 ARG A CB    1 
ATOM   1034 C  CG    . ARG A 1 143 ? -12.283 17.804 -11.524 1.00 20.56 ? 140 ARG A CG    1 
ATOM   1035 C  CD    . ARG A 1 143 ? -11.342 17.096 -10.553 1.00 19.47 ? 140 ARG A CD    1 
ATOM   1036 N  NE    . ARG A 1 143 ? -10.868 15.810 -11.080 1.00 20.21 ? 140 ARG A NE    1 
ATOM   1037 C  CZ    . ARG A 1 143 ? -9.936  15.064 -10.498 1.00 20.78 ? 140 ARG A CZ    1 
ATOM   1038 N  NH1   . ARG A 1 143 ? -9.347  15.468 -9.369  1.00 20.01 ? 140 ARG A NH1   1 
ATOM   1039 N  NH2   . ARG A 1 143 ? -9.586  13.905 -11.040 1.00 21.48 ? 140 ARG A NH2   1 
ATOM   1040 N  N     . GLN A 1 144 ? -16.831 16.722 -12.309 1.00 22.62 ? 141 GLN A N     1 
ATOM   1041 C  CA    . GLN A 1 144 ? -18.035 16.020 -12.757 1.00 23.54 ? 141 GLN A CA    1 
ATOM   1042 C  C     . GLN A 1 144 ? -18.862 16.876 -13.721 1.00 24.50 ? 141 GLN A C     1 
ATOM   1043 O  O     . GLN A 1 144 ? -19.788 16.382 -14.350 1.00 26.14 ? 141 GLN A O     1 
ATOM   1044 C  CB    . GLN A 1 144 ? -18.886 15.649 -11.529 1.00 23.14 ? 141 GLN A CB    1 
ATOM   1045 C  CG    . GLN A 1 144 ? -20.059 14.698 -11.787 1.00 25.21 ? 141 GLN A CG    1 
ATOM   1046 C  CD    . GLN A 1 144 ? -19.601 13.276 -12.061 1.00 27.75 ? 141 GLN A CD    1 
ATOM   1047 O  OE1   . GLN A 1 144 ? -19.744 12.775 -13.176 1.00 29.15 ? 141 GLN A OE1   1 
ATOM   1048 N  NE2   . GLN A 1 144 ? -19.033 12.628 -11.044 1.00 26.48 ? 141 GLN A NE2   1 
ATOM   1049 N  N     . GLY A 1 145 ? -18.535 18.156 -13.834 1.00 24.11 ? 142 GLY A N     1 
ATOM   1050 C  CA    . GLY A 1 145 ? -19.271 19.075 -14.692 1.00 25.62 ? 142 GLY A CA    1 
ATOM   1051 C  C     . GLY A 1 145 ? -20.315 19.905 -13.964 1.00 24.98 ? 142 GLY A C     1 
ATOM   1052 O  O     . GLY A 1 145 ? -21.101 20.602 -14.596 1.00 26.27 ? 142 GLY A O     1 
ATOM   1053 N  N     . ARG A 1 146 ? -20.301 19.856 -12.638 1.00 23.37 ? 143 ARG A N     1 
ATOM   1054 C  CA    . ARG A 1 146 ? -21.284 20.559 -11.818 1.00 22.92 ? 143 ARG A CA    1 
ATOM   1055 C  C     . ARG A 1 146 ? -20.712 21.871 -11.350 1.00 22.28 ? 143 ARG A C     1 
ATOM   1056 O  O     . ARG A 1 146 ? -19.497 22.051 -11.352 1.00 21.62 ? 143 ARG A O     1 
ATOM   1057 C  CB    . ARG A 1 146 ? -21.646 19.731 -10.581 1.00 21.82 ? 143 ARG A CB    1 
ATOM   1058 C  CG    . ARG A 1 146 ? -22.170 18.333 -10.878 1.00 22.35 ? 143 ARG A CG    1 
ATOM   1059 C  CD    . ARG A 1 146 ? -23.474 18.397 -11.674 1.00 24.47 ? 143 ARG A CD    1 
ATOM   1060 N  NE    . ARG A 1 146 ? -24.086 17.085 -11.820 1.00 24.93 ? 143 ARG A NE    1 
ATOM   1061 C  CZ    . ARG A 1 146 ? -25.273 16.867 -12.379 1.00 26.33 ? 143 ARG A CZ    1 
ATOM   1062 N  NH1   . ARG A 1 146 ? -25.990 17.870 -12.871 1.00 27.41 ? 143 ARG A NH1   1 
ATOM   1063 N  NH2   . ARG A 1 146 ? -25.745 15.628 -12.458 1.00 28.20 ? 143 ARG A NH2   1 
ATOM   1064 N  N     . THR A 1 147 ? -21.602 22.775 -10.939 1.00 22.55 ? 144 THR A N     1 
ATOM   1065 C  CA    . THR A 1 147 ? -21.227 24.038 -10.308 1.00 21.69 ? 144 THR A CA    1 
ATOM   1066 C  C     . THR A 1 147 ? -21.872 24.115 -8.927  1.00 20.56 ? 144 THR A C     1 
ATOM   1067 O  O     . THR A 1 147 ? -22.991 24.621 -8.780  1.00 21.16 ? 144 THR A O     1 
ATOM   1068 C  CB    . THR A 1 147 ? -21.691 25.250 -11.123 1.00 23.24 ? 144 THR A CB    1 
ATOM   1069 O  OG1   . THR A 1 147 ? -23.114 25.191 -11.309 1.00 25.42 ? 144 THR A OG1   1 
ATOM   1070 C  CG2   . THR A 1 147 ? -21.003 25.288 -12.466 1.00 24.15 ? 144 THR A CG2   1 
ATOM   1071 N  N     . PRO A 1 148 ? -21.185 23.594 -7.908  1.00 18.89 ? 145 PRO A N     1 
ATOM   1072 C  CA    . PRO A 1 148 ? -21.757 23.682 -6.571  1.00 18.71 ? 145 PRO A CA    1 
ATOM   1073 C  C     . PRO A 1 148 ? -21.499 25.051 -5.941  1.00 18.55 ? 145 PRO A C     1 
ATOM   1074 O  O     . PRO A 1 148 ? -20.594 25.788 -6.375  1.00 17.80 ? 145 PRO A O     1 
ATOM   1075 C  CB    . PRO A 1 148 ? -21.002 22.593 -5.809  1.00 17.55 ? 145 PRO A CB    1 
ATOM   1076 C  CG    . PRO A 1 148 ? -19.641 22.627 -6.441  1.00 17.40 ? 145 PRO A CG    1 
ATOM   1077 C  CD    . PRO A 1 148 ? -19.869 22.937 -7.897  1.00 17.93 ? 145 PRO A CD    1 
ATOM   1078 N  N     . ILE A 1 149 ? -22.304 25.381 -4.937  1.00 18.59 ? 146 ILE A N     1 
ATOM   1079 C  CA    . ILE A 1 149 ? -22.101 26.581 -4.148  1.00 18.55 ? 146 ILE A CA    1 
ATOM   1080 C  C     . ILE A 1 149 ? -21.299 26.163 -2.933  1.00 17.59 ? 146 ILE A C     1 
ATOM   1081 O  O     . ILE A 1 149 ? -21.670 25.209 -2.235  1.00 17.51 ? 146 ILE A O     1 
ATOM   1082 C  CB    . ILE A 1 149 ? -23.449 27.232 -3.745  1.00 19.71 ? 146 ILE A CB    1 
ATOM   1083 C  CG1   . ILE A 1 149 ? -24.180 27.698 -5.003  1.00 21.63 ? 146 ILE A CG1   1 
ATOM   1084 C  CG2   . ILE A 1 149 ? -23.234 28.408 -2.800  1.00 18.95 ? 146 ILE A CG2   1 
ATOM   1085 C  CD1   . ILE A 1 149 ? -25.473 28.413 -4.759  1.00 23.10 ? 146 ILE A CD1   1 
ATOM   1086 N  N     . PHE A 1 150 ? -20.175 26.839 -2.702  1.00 17.37 ? 147 PHE A N     1 
ATOM   1087 C  CA    . PHE A 1 150 ? -19.388 26.605 -1.503  1.00 16.65 ? 147 PHE A CA    1 
ATOM   1088 C  C     . PHE A 1 150 ? -19.748 27.659 -0.468  1.00 16.67 ? 147 PHE A C     1 
ATOM   1089 O  O     . PHE A 1 150 ? -19.666 28.844 -0.747  1.00 17.76 ? 147 PHE A O     1 
ATOM   1090 C  CB    . PHE A 1 150 ? -17.887 26.619 -1.785  1.00 16.05 ? 147 PHE A CB    1 
ATOM   1091 C  CG    . PHE A 1 150 ? -17.052 26.484 -0.543  1.00 17.42 ? 147 PHE A CG    1 
ATOM   1092 C  CD1   . PHE A 1 150 ? -17.224 25.410 0.307   1.00 19.24 ? 147 PHE A CD1   1 
ATOM   1093 C  CD2   . PHE A 1 150 ? -16.125 27.445 -0.198  1.00 18.87 ? 147 PHE A CD2   1 
ATOM   1094 C  CE1   . PHE A 1 150 ? -16.465 25.295 1.479   1.00 18.98 ? 147 PHE A CE1   1 
ATOM   1095 C  CE2   . PHE A 1 150 ? -15.379 27.334 0.961   1.00 19.12 ? 147 PHE A CE2   1 
ATOM   1096 C  CZ    . PHE A 1 150 ? -15.548 26.256 1.800   1.00 17.82 ? 147 PHE A CZ    1 
ATOM   1097 N  N     . VAL A 1 151 ? -20.138 27.206 0.718   1.00 16.47 ? 148 VAL A N     1 
ATOM   1098 C  CA    . VAL A 1 151 ? -20.606 28.063 1.796   1.00 16.53 ? 148 VAL A CA    1 
ATOM   1099 C  C     . VAL A 1 151 ? -19.628 27.973 2.956   1.00 16.48 ? 148 VAL A C     1 
ATOM   1100 O  O     . VAL A 1 151 ? -19.398 26.899 3.534   1.00 15.60 ? 148 VAL A O     1 
ATOM   1101 C  CB    . VAL A 1 151 ? -22.028 27.652 2.295   1.00 17.73 ? 148 VAL A CB    1 
ATOM   1102 C  CG1   . VAL A 1 151 ? -22.531 28.611 3.378   1.00 16.92 ? 148 VAL A CG1   1 
ATOM   1103 C  CG2   . VAL A 1 151 ? -23.027 27.603 1.149   1.00 16.67 ? 148 VAL A CG2   1 
ATOM   1104 N  N     . GLU A 1 152 ? -19.049 29.119 3.284   1.00 16.93 ? 149 GLU A N     1 
ATOM   1105 C  CA    . GLU A 1 152 ? -18.059 29.225 4.341   1.00 16.93 ? 149 GLU A CA    1 
ATOM   1106 C  C     . GLU A 1 152 ? -18.666 29.892 5.578   1.00 17.20 ? 149 GLU A C     1 
ATOM   1107 O  O     . GLU A 1 152 ? -18.960 31.100 5.568   1.00 18.04 ? 149 GLU A O     1 
ATOM   1108 C  CB    . GLU A 1 152 ? -16.877 30.049 3.824   1.00 17.22 ? 149 GLU A CB    1 
ATOM   1109 C  CG    . GLU A 1 152 ? -15.792 30.323 4.850   1.00 17.82 ? 149 GLU A CG    1 
ATOM   1110 C  CD    . GLU A 1 152 ? -15.110 29.063 5.317   1.00 17.97 ? 149 GLU A CD    1 
ATOM   1111 O  OE1   . GLU A 1 152 ? -15.634 28.447 6.274   1.00 19.91 ? 149 GLU A OE1   1 
ATOM   1112 O  OE2   . GLU A 1 152 ? -14.051 28.711 4.743   1.00 15.69 ? 149 GLU A OE2   1 
ATOM   1113 N  N     . LEU A 1 153 ? -18.835 29.124 6.651   1.00 16.71 ? 150 LEU A N     1 
ATOM   1114 C  CA    . LEU A 1 153 ? -19.358 29.680 7.901   1.00 16.76 ? 150 LEU A CA    1 
ATOM   1115 C  C     . LEU A 1 153 ? -18.264 29.940 8.941   1.00 16.91 ? 150 LEU A C     1 
ATOM   1116 O  O     . LEU A 1 153 ? -18.552 30.447 10.033  1.00 17.32 ? 150 LEU A O     1 
ATOM   1117 C  CB    . LEU A 1 153 ? -20.436 28.764 8.485   1.00 16.91 ? 150 LEU A CB    1 
ATOM   1118 C  CG    . LEU A 1 153 ? -21.603 28.433 7.540   1.00 17.10 ? 150 LEU A CG    1 
ATOM   1119 C  CD1   . LEU A 1 153 ? -22.555 27.386 8.171   1.00 15.28 ? 150 LEU A CD1   1 
ATOM   1120 C  CD2   . LEU A 1 153 ? -22.360 29.707 7.172   1.00 16.22 ? 150 LEU A CD2   1 
ATOM   1121 N  N     . ASP A 1 154 ? -17.012 29.606 8.621   1.00 16.22 ? 151 ASP A N     1 
ATOM   1122 C  CA    . ASP A 1 154 ? -15.937 29.769 9.582   1.00 16.35 ? 151 ASP A CA    1 
ATOM   1123 C  C     . ASP A 1 154 ? -15.461 31.215 9.534   1.00 17.36 ? 151 ASP A C     1 
ATOM   1124 O  O     . ASP A 1 154 ? -14.775 31.639 8.597   1.00 17.32 ? 151 ASP A O     1 
ATOM   1125 C  CB    . ASP A 1 154 ? -14.809 28.763 9.323   1.00 16.05 ? 151 ASP A CB    1 
ATOM   1126 C  CG    . ASP A 1 154 ? -13.819 28.663 10.485  1.00 16.42 ? 151 ASP A CG    1 
ATOM   1127 O  OD1   . ASP A 1 154 ? -13.690 29.639 11.262  1.00 15.77 ? 151 ASP A OD1   1 
ATOM   1128 O  OD2   . ASP A 1 154 ? -13.139 27.617 10.590  1.00 14.79 ? 151 ASP A OD2   1 
ATOM   1129 N  N     . VAL A 1 155 ? -15.870 31.982 10.543  1.00 18.33 ? 152 VAL A N     1 
ATOM   1130 C  CA    . VAL A 1 155 ? -15.493 33.385 10.639  1.00 18.88 ? 152 VAL A CA    1 
ATOM   1131 C  C     . VAL A 1 155 ? -14.035 33.564 11.093  1.00 20.18 ? 152 VAL A C     1 
ATOM   1132 O  O     . VAL A 1 155 ? -13.485 34.669 10.980  1.00 21.50 ? 152 VAL A O     1 
ATOM   1133 C  CB    . VAL A 1 155 ? -16.448 34.198 11.570  1.00 19.80 ? 152 VAL A CB    1 
ATOM   1134 C  CG1   . VAL A 1 155 ? -17.803 34.389 10.907  1.00 18.58 ? 152 VAL A CG1   1 
ATOM   1135 C  CG2   . VAL A 1 155 ? -16.593 33.539 12.962  1.00 19.08 ? 152 VAL A CG2   1 
ATOM   1136 N  N     . GLY A 1 156 ? -13.405 32.499 11.592  1.00 20.13 ? 153 GLY A N     1 
ATOM   1137 C  CA    . GLY A 1 156 ? -11.994 32.548 11.955  1.00 21.16 ? 153 GLY A CA    1 
ATOM   1138 C  C     . GLY A 1 156 ? -11.064 32.220 10.800  1.00 21.22 ? 153 GLY A C     1 
ATOM   1139 O  O     . GLY A 1 156 ? -10.265 33.057 10.368  1.00 22.66 ? 153 GLY A O     1 
ATOM   1140 N  N     . GLN A 1 157 ? -11.148 30.978 10.343  1.00 20.25 ? 154 GLN A N     1 
ATOM   1141 C  CA    . GLN A 1 157 ? -10.334 30.458 9.247   1.00 20.31 ? 154 GLN A CA    1 
ATOM   1142 C  C     . GLN A 1 157 ? -11.192 30.369 7.981   1.00 19.33 ? 154 GLN A C     1 
ATOM   1143 O  O     . GLN A 1 157 ? -11.874 29.369 7.745   1.00 18.76 ? 154 GLN A O     1 
ATOM   1144 C  CB    . GLN A 1 157 ? -9.763  29.077 9.634   1.00 19.91 ? 154 GLN A CB    1 
ATOM   1145 C  CG    . GLN A 1 157 ? -8.825  29.124 10.850  1.00 20.75 ? 154 GLN A CG    1 
ATOM   1146 C  CD    . GLN A 1 157 ? -7.559  29.931 10.585  1.00 21.55 ? 154 GLN A CD    1 
ATOM   1147 O  OE1   . GLN A 1 157 ? -6.906  29.727 9.579   1.00 21.57 ? 154 GLN A OE1   1 
ATOM   1148 N  NE2   . GLN A 1 157 ? -7.209  30.835 11.495  1.00 19.88 ? 154 GLN A NE2   1 
ATOM   1149 N  N     . ASN A 1 158 ? -11.155 31.433 7.182   1.00 19.88 ? 155 ASN A N     1 
ATOM   1150 C  CA    . ASN A 1 158 ? -12.132 31.667 6.132   1.00 19.58 ? 155 ASN A CA    1 
ATOM   1151 C  C     . ASN A 1 158 ? -11.444 31.605 4.771   1.00 20.05 ? 155 ASN A C     1 
ATOM   1152 O  O     . ASN A 1 158 ? -10.480 32.320 4.533   1.00 20.82 ? 155 ASN A O     1 
ATOM   1153 C  CB    . ASN A 1 158 ? -12.763 33.044 6.379   1.00 20.29 ? 155 ASN A CB    1 
ATOM   1154 C  CG    . ASN A 1 158 ? -14.019 33.285 5.559   1.00 19.87 ? 155 ASN A CG    1 
ATOM   1155 O  OD1   . ASN A 1 158 ? -13.977 33.296 4.335   1.00 19.52 ? 155 ASN A OD1   1 
ATOM   1156 N  ND2   . ASN A 1 158 ? -15.140 33.506 6.239   1.00 18.06 ? 155 ASN A ND2   1 
ATOM   1157 N  N     . SER A 1 159 ? -11.924 30.740 3.884   1.00 19.82 ? 156 SER A N     1 
ATOM   1158 C  CA    . SER A 1 159 ? -11.247 30.520 2.605   1.00 20.59 ? 156 SER A CA    1 
ATOM   1159 C  C     . SER A 1 159 ? -11.930 31.251 1.433   1.00 21.12 ? 156 SER A C     1 
ATOM   1160 O  O     . SER A 1 159 ? -11.515 31.117 0.290   1.00 21.78 ? 156 SER A O     1 
ATOM   1161 C  CB    . SER A 1 159 ? -11.100 29.017 2.324   1.00 20.27 ? 156 SER A CB    1 
ATOM   1162 O  OG    . SER A 1 159 ? -12.345 28.341 2.402   1.00 21.43 ? 156 SER A OG    1 
ATOM   1163 N  N     . VAL A 1 160 ? -12.937 32.069 1.733   1.00 20.92 ? 157 VAL A N     1 
ATOM   1164 C  CA    . VAL A 1 160 ? -13.687 32.786 0.711   1.00 20.79 ? 157 VAL A CA    1 
ATOM   1165 C  C     . VAL A 1 160 ? -13.433 34.300 0.796   1.00 21.00 ? 157 VAL A C     1 
ATOM   1166 O  O     . VAL A 1 160 ? -13.207 34.929 -0.207  1.00 21.70 ? 157 VAL A O     1 
ATOM   1167 C  CB    . VAL A 1 160 ? -15.204 32.452 0.827   1.00 20.80 ? 157 VAL A CB    1 
ATOM   1168 C  CG1   . VAL A 1 160 ? -16.054 33.427 0.009   1.00 21.06 ? 157 VAL A CG1   1 
ATOM   1169 C  CG2   . VAL A 1 160 ? -15.465 30.989 0.396   1.00 18.81 ? 157 VAL A CG2   1 
ATOM   1170 N  N     . SER A 1 161 ? -13.462 34.871 1.996   1.00 20.58 ? 158 SER A N     1 
ATOM   1171 C  CA    . SER A 1 161 ? -13.259 36.321 2.184   1.00 20.89 ? 158 SER A CA    1 
ATOM   1172 C  C     . SER A 1 161 ? -12.343 36.562 3.390   1.00 20.53 ? 158 SER A C     1 
ATOM   1173 O  O     . SER A 1 161 ? -11.610 35.667 3.792   1.00 19.91 ? 158 SER A O     1 
ATOM   1174 C  CB    . SER A 1 161 ? -14.612 37.038 2.345   1.00 21.07 ? 158 SER A CB    1 
ATOM   1175 O  OG    . SER A 1 161 ? -14.475 38.453 2.317   1.00 21.33 ? 158 SER A OG    1 
ATOM   1176 N  N     . VAL A 1 162 ? -12.360 37.773 3.945   1.00 20.96 ? 159 VAL A N     1 
ATOM   1177 C  CA    . VAL A 1 162 ? -11.568 38.093 5.123   1.00 20.94 ? 159 VAL A CA    1 
ATOM   1178 C  C     . VAL A 1 162 ? -12.146 37.384 6.361   1.00 20.14 ? 159 VAL A C     1 
ATOM   1179 O  O     . VAL A 1 162 ? -13.281 36.902 6.328   1.00 19.28 ? 159 VAL A O     1 
ATOM   1180 C  CB    . VAL A 1 162 ? -11.530 39.624 5.384   1.00 22.89 ? 159 VAL A CB    1 
ATOM   1181 C  CG1   . VAL A 1 162 ? -10.785 40.348 4.262   1.00 23.23 ? 159 VAL A CG1   1 
ATOM   1182 C  CG2   . VAL A 1 162 ? -12.936 40.185 5.560   1.00 22.51 ? 159 VAL A CG2   1 
ATOM   1183 N  N     . PRO A 1 163 ? -11.376 37.327 7.461   1.00 20.18 ? 160 PRO A N     1 
ATOM   1184 C  CA    . PRO A 1 163 ? -11.964 36.844 8.714   1.00 19.65 ? 160 PRO A CA    1 
ATOM   1185 C  C     . PRO A 1 163 ? -13.071 37.755 9.219   1.00 20.10 ? 160 PRO A C     1 
ATOM   1186 O  O     . PRO A 1 163 ? -13.111 38.938 8.892   1.00 21.11 ? 160 PRO A O     1 
ATOM   1187 C  CB    . PRO A 1 163 ? -10.791 36.841 9.706   1.00 20.81 ? 160 PRO A CB    1 
ATOM   1188 C  CG    . PRO A 1 163 ? -9.543  37.106 8.889   1.00 21.52 ? 160 PRO A CG    1 
ATOM   1189 C  CD    . PRO A 1 163 ? -9.967  37.740 7.610   1.00 21.22 ? 160 PRO A CD    1 
ATOM   1190 N  N     . GLY A 1 164 ? -13.971 37.192 10.011  1.00 19.95 ? 161 GLY A N     1 
ATOM   1191 C  CA    . GLY A 1 164 ? -15.146 37.908 10.458  1.00 20.30 ? 161 GLY A CA    1 
ATOM   1192 C  C     . GLY A 1 164 ? -16.216 37.983 9.389   1.00 19.89 ? 161 GLY A C     1 
ATOM   1193 O  O     . GLY A 1 164 ? -17.090 38.837 9.454   1.00 20.38 ? 161 GLY A O     1 
ATOM   1194 N  N     . THR A 1 165 ? -16.158 37.099 8.398   1.00 19.10 ? 162 THR A N     1 
ATOM   1195 C  CA    . THR A 1 165 ? -17.253 37.000 7.449   1.00 19.20 ? 162 THR A CA    1 
ATOM   1196 C  C     . THR A 1 165 ? -17.857 35.606 7.397   1.00 19.04 ? 162 THR A C     1 
ATOM   1197 O  O     . THR A 1 165 ? -17.224 34.607 7.757   1.00 18.14 ? 162 THR A O     1 
ATOM   1198 C  CB    . THR A 1 165 ? -16.850 37.402 6.019   1.00 19.13 ? 162 THR A CB    1 
ATOM   1199 O  OG1   . THR A 1 165 ? -15.920 36.446 5.498   1.00 17.13 ? 162 THR A OG1   1 
ATOM   1200 C  CG2   . THR A 1 165 ? -16.253 38.792 5.997   1.00 19.75 ? 162 THR A CG2   1 
ATOM   1201 N  N     . VAL A 1 166 ? -19.112 35.597 6.951   1.00 20.33 ? 163 VAL A N     1 
ATOM   1202 C  CA    . VAL A 1 166 ? -19.843 34.423 6.509   1.00 20.00 ? 163 VAL A CA    1 
ATOM   1203 C  C     . VAL A 1 166 ? -20.070 34.628 5.002   1.00 20.27 ? 163 VAL A C     1 
ATOM   1204 O  O     . VAL A 1 166 ? -20.600 35.642 4.593   1.00 21.67 ? 163 VAL A O     1 
ATOM   1205 C  CB    . VAL A 1 166 ? -21.183 34.350 7.275   1.00 20.97 ? 163 VAL A CB    1 
ATOM   1206 C  CG1   . VAL A 1 166 ? -22.158 33.374 6.614   1.00 21.09 ? 163 VAL A CG1   1 
ATOM   1207 C  CG2   . VAL A 1 166 ? -20.922 33.980 8.739   1.00 20.77 ? 163 VAL A CG2   1 
ATOM   1208 N  N     . ALA A 1 167 ? -19.649 33.681 4.176   1.00 19.95 ? 164 ALA A N     1 
ATOM   1209 C  CA    . ALA A 1 167 ? -19.594 33.907 2.727   1.00 20.56 ? 164 ALA A CA    1 
ATOM   1210 C  C     . ALA A 1 167 ? -19.990 32.666 1.933   1.00 20.10 ? 164 ALA A C     1 
ATOM   1211 O  O     . ALA A 1 167 ? -19.996 31.550 2.465   1.00 19.63 ? 164 ALA A O     1 
ATOM   1212 C  CB    . ALA A 1 167 ? -18.186 34.371 2.304   1.00 19.88 ? 164 ALA A CB    1 
ATOM   1213 N  N     . ALA A 1 168 ? -20.313 32.885 0.657   1.00 20.73 ? 165 ALA A N     1 
ATOM   1214 C  CA    . ALA A 1 168 ? -20.713 31.810 -0.262  1.00 20.32 ? 165 ALA A CA    1 
ATOM   1215 C  C     . ALA A 1 168 ? -20.288 32.162 -1.682  1.00 20.81 ? 165 ALA A C     1 
ATOM   1216 O  O     . ALA A 1 168 ? -20.453 33.301 -2.126  1.00 21.88 ? 165 ALA A O     1 
ATOM   1217 C  CB    . ALA A 1 168 ? -22.219 31.598 -0.206  1.00 20.40 ? 165 ALA A CB    1 
ATOM   1218 N  N     . VAL A 1 169 ? -19.746 31.186 -2.401  1.00 20.13 ? 166 VAL A N     1 
ATOM   1219 C  CA    . VAL A 1 169 ? -19.337 31.414 -3.775  1.00 20.60 ? 166 VAL A CA    1 
ATOM   1220 C  C     . VAL A 1 169 ? -19.754 30.249 -4.676  1.00 20.33 ? 166 VAL A C     1 
ATOM   1221 O  O     . VAL A 1 169 ? -19.743 29.092 -4.249  1.00 19.51 ? 166 VAL A O     1 
ATOM   1222 C  CB    . VAL A 1 169 ? -17.822 31.670 -3.828  1.00 20.71 ? 166 VAL A CB    1 
ATOM   1223 C  CG1   . VAL A 1 169 ? -17.031 30.393 -3.518  1.00 19.33 ? 166 VAL A CG1   1 
ATOM   1224 C  CG2   . VAL A 1 169 ? -17.433 32.268 -5.143  1.00 21.39 ? 166 VAL A CG2   1 
ATOM   1225 N  N     . LEU A 1 170 ? -20.171 30.563 -5.902  1.00 20.93 ? 167 LEU A N     1 
ATOM   1226 C  CA    . LEU A 1 170 ? -20.452 29.536 -6.915  1.00 21.18 ? 167 LEU A CA    1 
ATOM   1227 C  C     . LEU A 1 170 ? -19.117 29.065 -7.467  1.00 20.37 ? 167 LEU A C     1 
ATOM   1228 O  O     . LEU A 1 170 ? -18.352 29.862 -7.985  1.00 21.87 ? 167 LEU A O     1 
ATOM   1229 C  CB    . LEU A 1 170 ? -21.332 30.086 -8.046  1.00 22.44 ? 167 LEU A CB    1 
ATOM   1230 C  CG    . LEU A 1 170 ? -21.770 29.106 -9.139  1.00 22.80 ? 167 LEU A CG    1 
ATOM   1231 C  CD1   . LEU A 1 170 ? -22.719 28.069 -8.579  1.00 21.25 ? 167 LEU A CD1   1 
ATOM   1232 C  CD2   . LEU A 1 170 ? -22.426 29.855 -10.306 1.00 23.55 ? 167 LEU A CD2   1 
ATOM   1233 N  N     . VAL A 1 171 ? -18.839 27.776 -7.340  1.00 19.24 ? 168 VAL A N     1 
ATOM   1234 C  CA    . VAL A 1 171 ? -17.568 27.207 -7.770  1.00 18.72 ? 168 VAL A CA    1 
ATOM   1235 C  C     . VAL A 1 171 ? -17.720 26.666 -9.196  1.00 20.41 ? 168 VAL A C     1 
ATOM   1236 O  O     . VAL A 1 171 ? -18.477 25.720 -9.420  1.00 20.52 ? 168 VAL A O     1 
ATOM   1237 C  CB    . VAL A 1 171 ? -17.133 26.092 -6.791  1.00 17.83 ? 168 VAL A CB    1 
ATOM   1238 C  CG1   . VAL A 1 171 ? -15.761 25.543 -7.148  1.00 17.56 ? 168 VAL A CG1   1 
ATOM   1239 C  CG2   . VAL A 1 171 ? -17.152 26.620 -5.331  1.00 15.48 ? 168 VAL A CG2   1 
ATOM   1240 N  N     . GLN A 1 172 ? -17.026 27.291 -10.156 1.00 21.10 ? 169 GLN A N     1 
ATOM   1241 C  CA    . GLN A 1 172 ? -17.063 26.872 -11.567 1.00 22.98 ? 169 GLN A CA    1 
ATOM   1242 C  C     . GLN A 1 172 ? -15.741 26.359 -12.130 1.00 22.99 ? 169 GLN A C     1 
ATOM   1243 O  O     . GLN A 1 172 ? -15.701 25.928 -13.279 1.00 23.49 ? 169 GLN A O     1 
ATOM   1244 C  CB    . GLN A 1 172 ? -17.493 28.043 -12.459 1.00 24.75 ? 169 GLN A CB    1 
ATOM   1245 C  CG    . GLN A 1 172 ? -18.787 28.681 -12.041 1.00 26.17 ? 169 GLN A CG    1 
ATOM   1246 C  CD    . GLN A 1 172 ? -19.276 29.655 -13.064 1.00 29.49 ? 169 GLN A CD    1 
ATOM   1247 O  OE1   . GLN A 1 172 ? -19.262 30.862 -12.839 1.00 29.55 ? 169 GLN A OE1   1 
ATOM   1248 N  NE2   . GLN A 1 172 ? -19.689 29.140 -14.220 1.00 32.67 ? 169 GLN A NE2   1 
ATOM   1249 N  N     . LYS A 1 173 ? -14.673 26.484 -11.343 1.00 22.25 ? 170 LYS A N     1 
ATOM   1250 C  CA    A LYS A 1 173 ? -13.344 26.015 -11.726 0.50 22.74 ? 170 LYS A CA    1 
ATOM   1251 C  CA    B LYS A 1 173 ? -13.344 26.031 -11.725 0.50 22.83 ? 170 LYS A CA    1 
ATOM   1252 C  C     . LYS A 1 173 ? -12.706 25.312 -10.536 1.00 21.35 ? 170 LYS A C     1 
ATOM   1253 O  O     . LYS A 1 173 ? -12.978 25.661 -9.366  1.00 20.50 ? 170 LYS A O     1 
ATOM   1254 C  CB    A LYS A 1 173 ? -12.454 27.188 -12.157 0.50 24.11 ? 170 LYS A CB    1 
ATOM   1255 C  CB    B LYS A 1 173 ? -12.486 27.235 -12.137 0.50 24.23 ? 170 LYS A CB    1 
ATOM   1256 C  CG    A LYS A 1 173 ? -12.701 27.701 -13.575 0.50 26.34 ? 170 LYS A CG    1 
ATOM   1257 C  CG    B LYS A 1 173 ? -13.189 28.194 -13.104 0.50 26.50 ? 170 LYS A CG    1 
ATOM   1258 C  CD    A LYS A 1 173 ? -11.694 28.797 -13.949 0.50 27.94 ? 170 LYS A CD    1 
ATOM   1259 C  CD    B LYS A 1 173 ? -12.300 29.354 -13.543 0.50 28.53 ? 170 LYS A CD    1 
ATOM   1260 C  CE    A LYS A 1 173 ? -12.149 29.623 -15.152 0.50 29.58 ? 170 LYS A CE    1 
ATOM   1261 C  CE    B LYS A 1 173 ? -13.050 30.292 -14.476 0.50 30.61 ? 170 LYS A CE    1 
ATOM   1262 N  NZ    A LYS A 1 173 ? -12.177 28.834 -16.403 0.50 30.37 ? 170 LYS A NZ    1 
ATOM   1263 N  NZ    B LYS A 1 173 ? -12.153 31.310 -15.105 0.50 32.40 ? 170 LYS A NZ    1 
ATOM   1264 N  N     . THR A 1 174 ? -11.866 24.316 -10.809 1.00 21.19 ? 171 THR A N     1 
ATOM   1265 C  CA    . THR A 1 174 ? -11.167 23.635 -9.714  1.00 20.29 ? 171 THR A CA    1 
ATOM   1266 C  C     . THR A 1 174 ? -10.252 24.638 -8.996  1.00 20.05 ? 171 THR A C     1 
ATOM   1267 O  O     . THR A 1 174 ? -9.883  25.662 -9.561  1.00 21.27 ? 171 THR A O     1 
ATOM   1268 C  CB    . THR A 1 174 ? -10.360 22.419 -10.187 1.00 20.44 ? 171 THR A CB    1 
ATOM   1269 O  OG1   . THR A 1 174 ? -9.510  22.803 -11.261 1.00 23.13 ? 171 THR A OG1   1 
ATOM   1270 C  CG2   . THR A 1 174 ? -11.277 21.299 -10.648 1.00 19.77 ? 171 THR A CG2   1 
ATOM   1271 N  N     . ALA A 1 175 ? -9.920  24.382 -7.740  1.00 18.98 ? 172 ALA A N     1 
ATOM   1272 C  CA    . ALA A 1 175 ? -8.987  25.268 -7.048  1.00 19.51 ? 172 ALA A CA    1 
ATOM   1273 C  C     . ALA A 1 175 ? -7.650  25.306 -7.773  1.00 20.68 ? 172 ALA A C     1 
ATOM   1274 O  O     . ALA A 1 175 ? -7.221  24.324 -8.388  1.00 20.37 ? 172 ALA A O     1 
ATOM   1275 C  CB    . ALA A 1 175 ? -8.786  24.833 -5.575  1.00 18.51 ? 172 ALA A CB    1 
ATOM   1276 N  N     . ASP A 1 176 ? -7.005  26.457 -7.722  1.00 21.89 ? 173 ASP A N     1 
ATOM   1277 C  CA    . ASP A 1 176 ? -5.618  26.543 -8.126  1.00 23.92 ? 173 ASP A CA    1 
ATOM   1278 C  C     . ASP A 1 176 ? -4.782  25.749 -7.110  1.00 24.34 ? 173 ASP A C     1 
ATOM   1279 O  O     . ASP A 1 176 ? -5.044  25.818 -5.898  1.00 22.89 ? 173 ASP A O     1 
ATOM   1280 C  CB    . ASP A 1 176 ? -5.178  27.995 -8.161  1.00 24.99 ? 173 ASP A CB    1 
ATOM   1281 C  CG    . ASP A 1 176 ? -3.788  28.147 -8.663  1.00 26.29 ? 173 ASP A CG    1 
ATOM   1282 O  OD1   . ASP A 1 176 ? -3.602  28.132 -9.896  1.00 30.13 ? 173 ASP A OD1   1 
ATOM   1283 O  OD2   . ASP A 1 176 ? -2.876  28.254 -7.825  1.00 25.78 ? 173 ASP A OD2   1 
ATOM   1284 N  N     . VAL A 1 177 ? -3.795  24.993 -7.597  1.00 26.53 ? 174 VAL A N     1 
ATOM   1285 C  CA    . VAL A 1 177 ? -3.016  24.092 -6.731  1.00 27.64 ? 174 VAL A CA    1 
ATOM   1286 C  C     . VAL A 1 177 ? -2.317  24.887 -5.625  1.00 28.92 ? 174 VAL A C     1 
ATOM   1287 O  O     . VAL A 1 177 ? -2.339  24.492 -4.466  1.00 28.67 ? 174 VAL A O     1 
ATOM   1288 C  CB    . VAL A 1 177 ? -1.994  23.251 -7.538  1.00 29.10 ? 174 VAL A CB    1 
ATOM   1289 C  CG1   . VAL A 1 177 ? -1.011  22.602 -6.639  1.00 29.33 ? 174 VAL A CG1   1 
ATOM   1290 C  CG2   . VAL A 1 177 ? -2.707  22.193 -8.358  1.00 29.15 ? 174 VAL A CG2   1 
ATOM   1291 N  N     . ILE A 1 178 ? -1.744  26.030 -5.994  1.00 30.97 ? 175 ILE A N     1 
ATOM   1292 C  CA    . ILE A 1 178 ? -0.995  26.882 -5.075  1.00 32.25 ? 175 ILE A CA    1 
ATOM   1293 C  C     . ILE A 1 178 ? -1.916  27.861 -4.321  1.00 32.26 ? 175 ILE A C     1 
ATOM   1294 O  O     . ILE A 1 178 ? -1.829  27.985 -3.097  1.00 32.13 ? 175 ILE A O     1 
ATOM   1295 C  CB    . ILE A 1 178 ? 0.112   27.649 -5.861  1.00 34.67 ? 175 ILE A CB    1 
ATOM   1296 C  CG1   . ILE A 1 178 ? 1.112   26.657 -6.478  1.00 35.06 ? 175 ILE A CG1   1 
ATOM   1297 C  CG2   . ILE A 1 178 ? 0.828   28.677 -4.968  1.00 35.95 ? 175 ILE A CG2   1 
ATOM   1298 C  CD1   . ILE A 1 178 ? 1.682   27.104 -7.804  1.00 36.90 ? 175 ILE A CD1   1 
ATOM   1299 N  N     . ASP A 1 179 ? -2.823  28.521 -5.043  1.00 32.62 ? 176 ASP A N     1 
ATOM   1300 C  CA    . ASP A 1 179 ? -3.585  29.658 -4.492  1.00 32.48 ? 176 ASP A CA    1 
ATOM   1301 C  C     . ASP A 1 179 ? -4.975  29.353 -3.962  1.00 30.55 ? 176 ASP A C     1 
ATOM   1302 O  O     . ASP A 1 179 ? -5.615  30.252 -3.430  1.00 30.73 ? 176 ASP A O     1 
ATOM   1303 C  CB    . ASP A 1 179 ? -3.749  30.752 -5.569  1.00 34.01 ? 176 ASP A CB    1 
ATOM   1304 C  CG    . ASP A 1 179 ? -2.491  31.556 -5.795  1.00 36.71 ? 176 ASP A CG    1 
ATOM   1305 O  OD1   . ASP A 1 179 ? -1.504  31.383 -5.044  1.00 37.99 ? 176 ASP A OD1   1 
ATOM   1306 O  OD2   . ASP A 1 179 ? -2.499  32.386 -6.737  1.00 40.86 ? 176 ASP A OD2   1 
ATOM   1307 N  N     . GLY A 1 180 ? -5.477  28.132 -4.126  1.00 29.24 ? 177 GLY A N     1 
ATOM   1308 C  CA    . GLY A 1 180 ? -6.858  27.832 -3.713  1.00 27.46 ? 177 GLY A CA    1 
ATOM   1309 C  C     . GLY A 1 180 ? -7.884  28.322 -4.729  1.00 27.73 ? 177 GLY A C     1 
ATOM   1310 O  O     . GLY A 1 180 ? -7.542  28.597 -5.884  1.00 27.98 ? 177 GLY A O     1 
ATOM   1311 N  N     . PHE A 1 181 ? -9.137  28.444 -4.307  1.00 27.02 ? 178 PHE A N     1 
ATOM   1312 C  CA    . PHE A 1 181 ? -10.212 28.796 -5.238  1.00 28.44 ? 178 PHE A CA    1 
ATOM   1313 C  C     . PHE A 1 181 ? -10.197 30.267 -5.685  1.00 30.65 ? 178 PHE A C     1 
ATOM   1314 O  O     . PHE A 1 181 ? -9.820  31.151 -4.925  1.00 30.52 ? 178 PHE A O     1 
ATOM   1315 C  CB    . PHE A 1 181 ? -11.576 28.469 -4.633  1.00 26.73 ? 178 PHE A CB    1 
ATOM   1316 C  CG    . PHE A 1 181 ? -11.834 27.000 -4.485  1.00 26.07 ? 178 PHE A CG    1 
ATOM   1317 C  CD1   . PHE A 1 181 ? -12.104 26.209 -5.603  1.00 25.54 ? 178 PHE A CD1   1 
ATOM   1318 C  CD2   . PHE A 1 181 ? -11.820 26.394 -3.231  1.00 24.59 ? 178 PHE A CD2   1 
ATOM   1319 C  CE1   . PHE A 1 181 ? -12.352 24.849 -5.475  1.00 23.18 ? 178 PHE A CE1   1 
ATOM   1320 C  CE2   . PHE A 1 181 ? -12.067 25.032 -3.098  1.00 23.57 ? 178 PHE A CE2   1 
ATOM   1321 C  CZ    . PHE A 1 181 ? -12.332 24.260 -4.225  1.00 23.98 ? 178 PHE A CZ    1 
ATOM   1322 N  N     . GLU A 1 182 ? -10.588 30.513 -6.936  1.00 33.30 ? 179 GLU A N     1 
ATOM   1323 C  CA    . GLU A 1 182 ? -10.855 31.880 -7.396  1.00 35.87 ? 179 GLU A CA    1 
ATOM   1324 C  C     . GLU A 1 182 ? -12.117 32.341 -6.703  1.00 35.74 ? 179 GLU A C     1 
ATOM   1325 O  O     . GLU A 1 182 ? -13.107 31.622 -6.683  1.00 35.79 ? 179 GLU A O     1 
ATOM   1326 C  CB    . GLU A 1 182 ? -11.109 31.933 -8.905  1.00 37.76 ? 179 GLU A CB    1 
ATOM   1327 C  CG    . GLU A 1 182 ? -9.900  31.679 -9.813  1.00 40.68 ? 179 GLU A CG    1 
ATOM   1328 C  CD    . GLU A 1 182 ? -10.180 32.044 -11.285 1.00 45.32 ? 179 GLU A CD    1 
ATOM   1329 O  OE1   . GLU A 1 182 ? -11.215 32.699 -11.568 1.00 45.99 ? 179 GLU A OE1   1 
ATOM   1330 O  OE2   . GLU A 1 182 ? -9.353  31.689 -12.158 1.00 48.03 ? 179 GLU A OE2   1 
ATOM   1331 N  N     . ARG A 1 183 ? -12.098 33.524 -6.122  1.00 36.90 ? 180 ARG A N     1 
ATOM   1332 C  CA    . ARG A 1 183 ? -13.304 34.069 -5.503  1.00 37.08 ? 180 ARG A CA    1 
ATOM   1333 C  C     . ARG A 1 183 ? -14.099 34.847 -6.545  1.00 37.86 ? 180 ARG A C     1 
ATOM   1334 O  O     . ARG A 1 183 ? -14.006 36.069 -6.595  1.00 38.94 ? 180 ARG A O     1 
ATOM   1335 C  CB    . ARG A 1 183 ? -12.942 35.003 -4.349  1.00 37.88 ? 180 ARG A CB    1 
ATOM   1336 C  CG    . ARG A 1 183 ? -12.171 34.344 -3.209  1.00 39.01 ? 180 ARG A CG    1 
ATOM   1337 C  CD    . ARG A 1 183 ? -10.638 34.381 -3.413  1.00 41.88 ? 180 ARG A CD    1 
ATOM   1338 N  NE    . ARG A 1 183 ? -9.941  34.444 -2.122  1.00 43.54 ? 180 ARG A NE    1 
ATOM   1339 C  CZ    . ARG A 1 183 ? -9.542  33.399 -1.391  1.00 44.07 ? 180 ARG A CZ    1 
ATOM   1340 N  NH1   . ARG A 1 183 ? -9.735  32.136 -1.795  1.00 44.46 ? 180 ARG A NH1   1 
ATOM   1341 N  NH2   . ARG A 1 183 ? -8.929  33.624 -0.234  1.00 43.98 ? 180 ARG A NH2   1 
ATOM   1342 N  N     . ASN A 1 184 ? -14.870 34.142 -7.371  1.00 37.30 ? 181 ASN A N     1 
ATOM   1343 C  CA    . ASN A 1 184 ? -15.687 34.791 -8.395  1.00 38.74 ? 181 ASN A CA    1 
ATOM   1344 C  C     . ASN A 1 184 ? -16.980 35.327 -7.783  1.00 37.74 ? 181 ASN A C     1 
ATOM   1345 O  O     . ASN A 1 184 ? -17.927 34.569 -7.532  1.00 37.44 ? 181 ASN A O     1 
ATOM   1346 C  CB    . ASN A 1 184 ? -15.994 33.823 -9.552  1.00 39.48 ? 181 ASN A CB    1 
ATOM   1347 C  CG    . ASN A 1 184 ? -16.550 34.529 -10.789 1.00 43.11 ? 181 ASN A CG    1 
ATOM   1348 O  OD1   . ASN A 1 184 ? -16.559 35.763 -10.875 1.00 47.64 ? 181 ASN A OD1   1 
ATOM   1349 N  ND2   . ASN A 1 184 ? -17.010 33.742 -11.762 1.00 44.82 ? 181 ASN A ND2   1 
ATOM   1350 N  N     . GLN A 1 185 ? -16.983 36.629 -7.507  1.00 37.17 ? 182 GLN A N     1 
ATOM   1351 C  CA    . GLN A 1 185 ? -18.159 37.355 -7.010  1.00 36.67 ? 182 GLN A CA    1 
ATOM   1352 C  C     . GLN A 1 185 ? -18.888 36.650 -5.855  1.00 33.42 ? 182 GLN A C     1 
ATOM   1353 O  O     . GLN A 1 185 ? -20.024 36.196 -6.003  1.00 33.29 ? 182 GLN A O     1 
ATOM   1354 C  CB    . GLN A 1 185 ? -19.111 37.645 -8.178  1.00 38.77 ? 182 GLN A CB    1 
ATOM   1355 C  CG    . GLN A 1 185 ? -18.402 38.311 -9.352  1.00 42.22 ? 182 GLN A CG    1 
ATOM   1356 C  CD    . GLN A 1 185 ? -19.333 39.114 -10.232 1.00 47.95 ? 182 GLN A CD    1 
ATOM   1357 O  OE1   . GLN A 1 185 ? -19.650 38.704 -11.356 1.00 50.13 ? 182 GLN A OE1   1 
ATOM   1358 N  NE2   . GLN A 1 185 ? -19.779 40.274 -9.730  1.00 50.37 ? 182 GLN A NE2   1 
ATOM   1359 N  N     . PRO A 1 186 ? -18.230 36.556 -4.698  1.00 30.01 ? 183 PRO A N     1 
ATOM   1360 C  CA    . PRO A 1 186 ? -18.840 35.914 -3.560  1.00 27.71 ? 183 PRO A CA    1 
ATOM   1361 C  C     . PRO A 1 186 ? -19.950 36.772 -2.938  1.00 27.49 ? 183 PRO A C     1 
ATOM   1362 O  O     . PRO A 1 186 ? -19.930 37.990 -3.066  1.00 27.81 ? 183 PRO A O     1 
ATOM   1363 C  CB    . PRO A 1 186 ? -17.672 35.763 -2.595  1.00 26.84 ? 183 PRO A CB    1 
ATOM   1364 C  CG    . PRO A 1 186 ? -16.783 36.885 -2.902  1.00 27.91 ? 183 PRO A CG    1 
ATOM   1365 C  CD    . PRO A 1 186 ? -16.949 37.192 -4.353  1.00 30.31 ? 183 PRO A CD    1 
ATOM   1366 N  N     . ILE A 1 187 ? -20.930 36.121 -2.316  1.00 25.82 ? 184 ILE A N     1 
ATOM   1367 C  CA    . ILE A 1 187 ? -21.854 36.789 -1.417  1.00 25.55 ? 184 ILE A CA    1 
ATOM   1368 C  C     . ILE A 1 187 ? -21.160 36.781 -0.073  1.00 23.24 ? 184 ILE A C     1 
ATOM   1369 O  O     . ILE A 1 187 ? -20.743 35.731 0.396   1.00 21.62 ? 184 ILE A O     1 
ATOM   1370 C  CB    . ILE A 1 187 ? -23.190 36.045 -1.297  1.00 26.12 ? 184 ILE A CB    1 
ATOM   1371 C  CG1   . ILE A 1 187 ? -23.927 36.052 -2.641  1.00 28.95 ? 184 ILE A CG1   1 
ATOM   1372 C  CG2   . ILE A 1 187 ? -24.069 36.694 -0.236  1.00 27.22 ? 184 ILE A CG2   1 
ATOM   1373 C  CD1   . ILE A 1 187 ? -25.165 35.162 -2.648  1.00 30.70 ? 184 ILE A CD1   1 
ATOM   1374 N  N     . VAL A 1 188 ? -21.013 37.952 0.531   1.00 22.40 ? 185 VAL A N     1 
ATOM   1375 C  CA    . VAL A 1 188 ? -20.260 38.077 1.755   1.00 20.92 ? 185 VAL A CA    1 
ATOM   1376 C  C     . VAL A 1 188 ? -21.050 38.886 2.762   1.00 21.35 ? 185 VAL A C     1 
ATOM   1377 O  O     . VAL A 1 188 ? -21.527 39.963 2.437   1.00 21.28 ? 185 VAL A O     1 
ATOM   1378 C  CB    . VAL A 1 188 ? -18.928 38.806 1.506   1.00 21.45 ? 185 VAL A CB    1 
ATOM   1379 C  CG1   . VAL A 1 188 ? -18.153 38.980 2.828   1.00 19.75 ? 185 VAL A CG1   1 
ATOM   1380 C  CG2   . VAL A 1 188 ? -18.111 38.083 0.446   1.00 19.53 ? 185 VAL A CG2   1 
ATOM   1381 N  N     . PHE A 1 189 ? -21.169 38.358 3.979   1.00 20.79 ? 186 PHE A N     1 
ATOM   1382 C  CA    . PHE A 1 189 ? -21.763 39.090 5.099   1.00 22.03 ? 186 PHE A CA    1 
ATOM   1383 C  C     . PHE A 1 189 ? -20.710 39.382 6.157   1.00 22.23 ? 186 PHE A C     1 
ATOM   1384 O  O     . PHE A 1 189 ? -19.905 38.505 6.499   1.00 21.52 ? 186 PHE A O     1 
ATOM   1385 C  CB    . PHE A 1 189 ? -22.879 38.276 5.737   1.00 21.79 ? 186 PHE A CB    1 
ATOM   1386 C  CG    . PHE A 1 189 ? -24.094 38.143 4.873   1.00 22.27 ? 186 PHE A CG    1 
ATOM   1387 C  CD1   . PHE A 1 189 ? -25.139 39.042 4.988   1.00 22.39 ? 186 PHE A CD1   1 
ATOM   1388 C  CD2   . PHE A 1 189 ? -24.186 37.124 3.940   1.00 21.74 ? 186 PHE A CD2   1 
ATOM   1389 C  CE1   . PHE A 1 189 ? -26.259 38.926 4.191   1.00 24.16 ? 186 PHE A CE1   1 
ATOM   1390 C  CE2   . PHE A 1 189 ? -25.318 37.004 3.137   1.00 22.45 ? 186 PHE A CE2   1 
ATOM   1391 C  CZ    . PHE A 1 189 ? -26.351 37.910 3.271   1.00 23.69 ? 186 PHE A CZ    1 
ATOM   1392 N  N     . ASN A 1 190 ? -20.729 40.607 6.671   1.00 23.50 ? 187 ASN A N     1 
ATOM   1393 C  CA    . ASN A 1 190 ? -19.791 41.028 7.690   1.00 23.95 ? 187 ASN A CA    1 
ATOM   1394 C  C     . ASN A 1 190 ? -20.305 40.668 9.080   1.00 24.27 ? 187 ASN A C     1 
ATOM   1395 O  O     . ASN A 1 190 ? -21.223 41.310 9.604   1.00 25.82 ? 187 ASN A O     1 
ATOM   1396 C  CB    . ASN A 1 190 ? -19.520 42.533 7.613   1.00 25.30 ? 187 ASN A CB    1 
ATOM   1397 C  CG    . ASN A 1 190 ? -18.593 43.015 8.727   1.00 26.21 ? 187 ASN A CG    1 
ATOM   1398 O  OD1   . ASN A 1 190 ? -17.531 42.421 8.986   1.00 24.24 ? 187 ASN A OD1   1 
ATOM   1399 N  ND2   . ASN A 1 190 ? -18.994 44.091 9.397   1.00 27.91 ? 187 ASN A ND2   1 
ATOM   1400 N  N     . PHE A 1 191 ? -19.704 39.646 9.668   1.00 22.69 ? 188 PHE A N     1 
ATOM   1401 C  CA    . PHE A 1 191 ? -20.012 39.263 11.033  1.00 23.04 ? 188 PHE A CA    1 
ATOM   1402 C  C     . PHE A 1 191 ? -19.249 40.163 12.001  1.00 23.94 ? 188 PHE A C     1 
ATOM   1403 O  O     . PHE A 1 191 ? -19.833 40.680 12.946  1.00 24.76 ? 188 PHE A O     1 
ATOM   1404 C  CB    . PHE A 1 191 ? -19.675 37.786 11.270  1.00 21.42 ? 188 PHE A CB    1 
ATOM   1405 C  CG    . PHE A 1 191 ? -19.846 37.359 12.684  1.00 22.61 ? 188 PHE A CG    1 
ATOM   1406 C  CD1   . PHE A 1 191 ? -21.079 37.460 13.300  1.00 23.55 ? 188 PHE A CD1   1 
ATOM   1407 C  CD2   . PHE A 1 191 ? -18.770 36.875 13.416  1.00 23.54 ? 188 PHE A CD2   1 
ATOM   1408 C  CE1   . PHE A 1 191 ? -21.250 37.076 14.610  1.00 23.72 ? 188 PHE A CE1   1 
ATOM   1409 C  CE2   . PHE A 1 191 ? -18.930 36.493 14.736  1.00 24.43 ? 188 PHE A CE2   1 
ATOM   1410 C  CZ    . PHE A 1 191 ? -20.177 36.594 15.337  1.00 24.34 ? 188 PHE A CZ    1 
ATOM   1411 N  N     . GLY A 1 192 ? -17.940 40.308 11.776  1.00 23.53 ? 189 GLY A N     1 
ATOM   1412 C  CA    . GLY A 1 192 ? -17.121 41.301 12.479  1.00 24.84 ? 189 GLY A CA    1 
ATOM   1413 C  C     . GLY A 1 192 ? -16.255 40.783 13.618  1.00 25.00 ? 189 GLY A C     1 
ATOM   1414 O  O     . GLY A 1 192 ? -15.691 41.576 14.365  1.00 25.77 ? 189 GLY A O     1 
ATOM   1415 N  N     . HIS A 1 193 ? -16.143 39.461 13.751  1.00 23.95 ? 190 HIS A N     1 
ATOM   1416 C  CA    . HIS A 1 193 ? -15.434 38.850 14.877  1.00 24.36 ? 190 HIS A CA    1 
ATOM   1417 C  C     . HIS A 1 193 ? -14.838 37.538 14.431  1.00 23.34 ? 190 HIS A C     1 
ATOM   1418 O  O     . HIS A 1 193 ? -15.352 36.901 13.505  1.00 21.82 ? 190 HIS A O     1 
ATOM   1419 C  CB    . HIS A 1 193 ? -16.375 38.568 16.053  1.00 25.14 ? 190 HIS A CB    1 
ATOM   1420 C  CG    . HIS A 1 193 ? -17.180 39.751 16.494  1.00 26.43 ? 190 HIS A CG    1 
ATOM   1421 N  ND1   . HIS A 1 193 ? -16.706 40.674 17.400  1.00 28.77 ? 190 HIS A ND1   1 
ATOM   1422 C  CD2   . HIS A 1 193 ? -18.436 40.148 16.175  1.00 26.93 ? 190 HIS A CD2   1 
ATOM   1423 C  CE1   . HIS A 1 193 ? -17.626 41.603 17.602  1.00 29.88 ? 190 HIS A CE1   1 
ATOM   1424 N  NE2   . HIS A 1 193 ? -18.688 41.305 16.874  1.00 28.80 ? 190 HIS A NE2   1 
ATOM   1425 N  N     . THR A 1 194 ? -13.767 37.120 15.097  1.00 23.83 ? 191 THR A N     1 
ATOM   1426 C  CA    . THR A 1 194 ? -13.074 35.902 14.697  1.00 23.15 ? 191 THR A CA    1 
ATOM   1427 C  C     . THR A 1 194 ? -13.683 34.621 15.254  1.00 22.71 ? 191 THR A C     1 
ATOM   1428 O  O     . THR A 1 194 ? -13.298 33.527 14.812  1.00 22.24 ? 191 THR A O     1 
ATOM   1429 C  CB    . THR A 1 194 ? -11.608 35.969 15.064  1.00 23.93 ? 191 THR A CB    1 
ATOM   1430 O  OG1   . THR A 1 194 ? -11.500 36.160 16.470  1.00 24.96 ? 191 THR A OG1   1 
ATOM   1431 C  CG2   . THR A 1 194 ? -10.952 37.123 14.338  1.00 24.41 ? 191 THR A CG2   1 
ATOM   1432 N  N     . SER A 1 195 ? -14.607 34.732 16.211  1.00 23.44 ? 192 SER A N     1 
ATOM   1433 C  CA    A SER A 1 195 ? -15.352 33.568 16.674  0.50 23.11 ? 192 SER A CA    1 
ATOM   1434 C  CA    B SER A 1 195 ? -15.342 33.567 16.722  0.50 23.25 ? 192 SER A CA    1 
ATOM   1435 C  C     . SER A 1 195 ? -16.840 33.850 16.803  1.00 23.46 ? 192 SER A C     1 
ATOM   1436 O  O     . SER A 1 195 ? -17.238 34.972 17.088  1.00 23.96 ? 192 SER A O     1 
ATOM   1437 C  CB    A SER A 1 195 ? -14.823 33.086 18.011  0.50 24.25 ? 192 SER A CB    1 
ATOM   1438 C  CB    B SER A 1 195 ? -14.821 33.154 18.104  0.50 24.53 ? 192 SER A CB    1 
ATOM   1439 O  OG    A SER A 1 195 ? -15.400 31.838 18.320  0.50 23.24 ? 192 SER A OG    1 
ATOM   1440 O  OG    B SER A 1 195 ? -15.457 33.866 19.159  0.50 25.99 ? 192 SER A OG    1 
ATOM   1441 N  N     . PRO A 1 196 ? -17.679 32.817 16.584  1.00 22.94 ? 193 PRO A N     1 
ATOM   1442 C  CA    . PRO A 1 196 ? -19.109 33.053 16.726  1.00 23.93 ? 193 PRO A CA    1 
ATOM   1443 C  C     . PRO A 1 196 ? -19.536 33.482 18.138  1.00 25.49 ? 193 PRO A C     1 
ATOM   1444 O  O     . PRO A 1 196 ? -20.509 34.202 18.279  1.00 26.75 ? 193 PRO A O     1 
ATOM   1445 C  CB    . PRO A 1 196 ? -19.717 31.688 16.375  1.00 23.19 ? 193 PRO A CB    1 
ATOM   1446 C  CG    . PRO A 1 196 ? -18.733 31.053 15.519  1.00 21.41 ? 193 PRO A CG    1 
ATOM   1447 C  CD    . PRO A 1 196 ? -17.424 31.453 16.088  1.00 22.12 ? 193 PRO A CD    1 
ATOM   1448 N  N     . SER A 1 197 ? -18.795 33.065 19.159  1.00 26.45 ? 194 SER A N     1 
ATOM   1449 C  CA    . SER A 1 197 ? -19.150 33.358 20.551  1.00 28.53 ? 194 SER A CA    1 
ATOM   1450 C  C     . SER A 1 197 ? -19.090 34.830 20.903  1.00 29.74 ? 194 SER A C     1 
ATOM   1451 O  O     . SER A 1 197 ? -19.659 35.226 21.905  1.00 31.68 ? 194 SER A O     1 
ATOM   1452 C  CB    . SER A 1 197 ? -18.246 32.590 21.515  1.00 29.00 ? 194 SER A CB    1 
ATOM   1453 O  OG    . SER A 1 197 ? -16.927 33.075 21.426  1.00 29.93 ? 194 SER A OG    1 
ATOM   1454 N  N     . ALA A 1 198 ? -18.402 35.642 20.108  1.00 29.49 ? 195 ALA A N     1 
ATOM   1455 C  CA    . ALA A 1 198 ? -18.422 37.093 20.332  1.00 30.88 ? 195 ALA A CA    1 
ATOM   1456 C  C     . ALA A 1 198 ? -19.851 37.626 20.299  1.00 31.44 ? 195 ALA A C     1 
ATOM   1457 O  O     . ALA A 1 198 ? -20.179 38.532 21.042  1.00 33.01 ? 195 ALA A O     1 
ATOM   1458 C  CB    . ALA A 1 198 ? -17.567 37.821 19.300  1.00 30.35 ? 195 ALA A CB    1 
ATOM   1459 N  N     . ASN A 1 199 ? -20.691 37.053 19.438  1.00 30.47 ? 196 ASN A N     1 
ATOM   1460 C  CA    . ASN A 1 199 ? -22.102 37.452 19.319  1.00 31.20 ? 196 ASN A CA    1 
ATOM   1461 C  C     . ASN A 1 199 ? -22.883 36.359 18.601  1.00 30.37 ? 196 ASN A C     1 
ATOM   1462 O  O     . ASN A 1 199 ? -23.108 36.424 17.385  1.00 29.25 ? 196 ASN A O     1 
ATOM   1463 C  CB    . ASN A 1 199 ? -22.217 38.773 18.559  1.00 31.88 ? 196 ASN A CB    1 
ATOM   1464 C  CG    . ASN A 1 199 ? -23.643 39.314 18.510  1.00 32.66 ? 196 ASN A CG    1 
ATOM   1465 O  OD1   . ASN A 1 199 ? -24.630 38.583 18.667  1.00 31.73 ? 196 ASN A OD1   1 
ATOM   1466 N  ND2   . ASN A 1 199 ? -23.749 40.606 18.274  1.00 33.86 ? 196 ASN A ND2   1 
ATOM   1467 N  N     . LEU A 1 200 ? -23.288 35.351 19.365  1.00 30.81 ? 197 LEU A N     1 
ATOM   1468 C  CA    . LEU A 1 200 ? -23.806 34.123 18.785  1.00 29.92 ? 197 LEU A CA    1 
ATOM   1469 C  C     . LEU A 1 200 ? -25.137 34.326 18.061  1.00 30.05 ? 197 LEU A C     1 
ATOM   1470 O  O     . LEU A 1 200 ? -25.371 33.701 17.031  1.00 29.02 ? 197 LEU A O     1 
ATOM   1471 C  CB    . LEU A 1 200 ? -23.928 33.034 19.858  1.00 30.88 ? 197 LEU A CB    1 
ATOM   1472 C  CG    . LEU A 1 200 ? -23.900 31.624 19.265  1.00 30.07 ? 197 LEU A CG    1 
ATOM   1473 C  CD1   . LEU A 1 200 ? -22.507 31.297 18.761  1.00 30.31 ? 197 LEU A CD1   1 
ATOM   1474 C  CD2   . LEU A 1 200 ? -24.346 30.608 20.280  1.00 31.36 ? 197 LEU A CD2   1 
ATOM   1475 N  N     . SER A 1 201 ? -25.990 35.215 18.567  1.00 31.39 ? 198 SER A N     1 
ATOM   1476 C  CA    . SER A 1 201 ? -27.292 35.453 17.935  1.00 32.13 ? 198 SER A CA    1 
ATOM   1477 C  C     . SER A 1 201 ? -27.194 36.223 16.604  1.00 31.21 ? 198 SER A C     1 
ATOM   1478 O  O     . SER A 1 201 ? -27.997 35.987 15.703  1.00 31.09 ? 198 SER A O     1 
ATOM   1479 C  CB    . SER A 1 201 ? -28.256 36.145 18.900  1.00 34.39 ? 198 SER A CB    1 
ATOM   1480 O  OG    . SER A 1 201 ? -27.958 37.519 19.036  1.00 36.14 ? 198 SER A OG    1 
ATOM   1481 N  N     . LEU A 1 202 ? -26.224 37.127 16.478  1.00 30.66 ? 199 LEU A N     1 
ATOM   1482 C  CA    . LEU A 1 202 ? -25.919 37.747 15.180  1.00 30.15 ? 199 LEU A CA    1 
ATOM   1483 C  C     . LEU A 1 202 ? -25.419 36.716 14.157  1.00 28.49 ? 199 LEU A C     1 
ATOM   1484 O  O     . LEU A 1 202 ? -25.812 36.751 12.992  1.00 27.87 ? 199 LEU A O     1 
ATOM   1485 C  CB    . LEU A 1 202 ? -24.865 38.844 15.332  1.00 30.53 ? 199 LEU A CB    1 
ATOM   1486 C  CG    . LEU A 1 202 ? -24.358 39.471 14.022  1.00 30.41 ? 199 LEU A CG    1 
ATOM   1487 C  CD1   . LEU A 1 202 ? -25.518 40.152 13.276  1.00 30.97 ? 199 LEU A CD1   1 
ATOM   1488 C  CD2   . LEU A 1 202 ? -23.209 40.459 14.269  1.00 30.45 ? 199 LEU A CD2   1 
ATOM   1489 N  N     . TYR A 1 203 ? -24.539 35.819 14.606  1.00 27.68 ? 200 TYR A N     1 
ATOM   1490 C  CA    . TYR A 1 203 ? -23.967 34.767 13.766  1.00 26.41 ? 200 TYR A CA    1 
ATOM   1491 C  C     . TYR A 1 203 ? -25.063 33.915 13.155  1.00 26.80 ? 200 TYR A C     1 
ATOM   1492 O  O     . TYR A 1 203 ? -25.079 33.662 11.953  1.00 25.58 ? 200 TYR A O     1 
ATOM   1493 C  CB    . TYR A 1 203 ? -23.063 33.869 14.608  1.00 25.59 ? 200 TYR A CB    1 
ATOM   1494 C  CG    . TYR A 1 203 ? -22.351 32.776 13.841  1.00 23.46 ? 200 TYR A CG    1 
ATOM   1495 C  CD1   . TYR A 1 203 ? -21.410 33.090 12.878  1.00 21.09 ? 200 TYR A CD1   1 
ATOM   1496 C  CD2   . TYR A 1 203 ? -22.586 31.424 14.110  1.00 23.09 ? 200 TYR A CD2   1 
ATOM   1497 C  CE1   . TYR A 1 203 ? -20.729 32.115 12.193  1.00 19.62 ? 200 TYR A CE1   1 
ATOM   1498 C  CE2   . TYR A 1 203 ? -21.907 30.432 13.411  1.00 21.99 ? 200 TYR A CE2   1 
ATOM   1499 C  CZ    . TYR A 1 203 ? -20.973 30.791 12.458  1.00 19.98 ? 200 TYR A CZ    1 
ATOM   1500 O  OH    . TYR A 1 203 ? -20.282 29.842 11.756  1.00 18.96 ? 200 TYR A OH    1 
ATOM   1501 N  N     . GLU A 1 204 ? -25.985 33.493 14.011  1.00 28.50 ? 201 GLU A N     1 
ATOM   1502 C  CA    . GLU A 1 204 ? -27.112 32.673 13.605  1.00 29.61 ? 201 GLU A CA    1 
ATOM   1503 C  C     . GLU A 1 204 ? -28.025 33.443 12.661  1.00 30.33 ? 201 GLU A C     1 
ATOM   1504 O  O     . GLU A 1 204 ? -28.401 32.921 11.607  1.00 30.21 ? 201 GLU A O     1 
ATOM   1505 C  CB    . GLU A 1 204 ? -27.833 32.135 14.848  1.00 31.50 ? 201 GLU A CB    1 
ATOM   1506 C  CG    . GLU A 1 204 ? -26.905 31.143 15.597  1.00 33.10 ? 201 GLU A CG    1 
ATOM   1507 C  CD    . GLU A 1 204 ? -27.383 30.676 16.960  1.00 37.32 ? 201 GLU A CD    1 
ATOM   1508 O  OE1   . GLU A 1 204 ? -28.211 31.347 17.618  1.00 41.43 ? 201 GLU A OE1   1 
ATOM   1509 O  OE2   . GLU A 1 204 ? -26.892 29.610 17.383  1.00 40.41 ? 201 GLU A OE2   1 
ATOM   1510 N  N     . ALA A 1 205 ? -28.335 34.694 12.996  1.00 31.37 ? 202 ALA A N     1 
ATOM   1511 C  CA    . ALA A 1 205 ? -29.079 35.556 12.079  1.00 32.25 ? 202 ALA A CA    1 
ATOM   1512 C  C     . ALA A 1 205 ? -28.386 35.656 10.710  1.00 31.16 ? 202 ALA A C     1 
ATOM   1513 O  O     . ALA A 1 205 ? -29.038 35.548 9.677   1.00 31.55 ? 202 ALA A O     1 
ATOM   1514 C  CB    . ALA A 1 205 ? -29.280 36.940 12.677  1.00 33.67 ? 202 ALA A CB    1 
ATOM   1515 N  N     . LEU A 1 206 ? -27.065 35.828 10.696  1.00 29.90 ? 203 LEU A N     1 
ATOM   1516 C  CA    . LEU A 1 206 ? -26.344 35.918 9.421   1.00 28.83 ? 203 LEU A CA    1 
ATOM   1517 C  C     . LEU A 1 206 ? -26.428 34.656 8.563   1.00 28.03 ? 203 LEU A C     1 
ATOM   1518 O  O     . LEU A 1 206 ? -26.670 34.750 7.355   1.00 28.03 ? 203 LEU A O     1 
ATOM   1519 C  CB    . LEU A 1 206 ? -24.883 36.335 9.618   1.00 27.62 ? 203 LEU A CB    1 
ATOM   1520 C  CG    . LEU A 1 206 ? -24.698 37.818 9.946   1.00 28.72 ? 203 LEU A CG    1 
ATOM   1521 C  CD1   . LEU A 1 206 ? -23.227 38.131 10.128  1.00 28.18 ? 203 LEU A CD1   1 
ATOM   1522 C  CD2   . LEU A 1 206 ? -25.313 38.729 8.882   1.00 29.29 ? 203 LEU A CD2   1 
ATOM   1523 N  N     . PHE A 1 207 ? -26.242 33.472 9.137   1.00 27.60 ? 204 PHE A N     1 
ATOM   1524 C  CA    . PHE A 1 207 ? -26.293 32.313 8.258   1.00 27.51 ? 204 PHE A CA    1 
ATOM   1525 C  C     . PHE A 1 207 ? -27.718 31.975 7.826   1.00 28.85 ? 204 PHE A C     1 
ATOM   1526 O  O     . PHE A 1 207 ? -27.909 31.380 6.771   1.00 28.53 ? 204 PHE A O     1 
ATOM   1527 C  CB    . PHE A 1 207 ? -25.409 31.124 8.696   1.00 26.72 ? 204 PHE A CB    1 
ATOM   1528 C  CG    . PHE A 1 207 ? -25.816 30.419 9.962   1.00 27.96 ? 204 PHE A CG    1 
ATOM   1529 C  CD1   . PHE A 1 207 ? -27.053 29.817 10.095  1.00 30.38 ? 204 PHE A CD1   1 
ATOM   1530 C  CD2   . PHE A 1 207 ? -24.889 30.247 10.977  1.00 29.07 ? 204 PHE A CD2   1 
ATOM   1531 C  CE1   . PHE A 1 207 ? -27.381 29.116 11.252  1.00 30.91 ? 204 PHE A CE1   1 
ATOM   1532 C  CE2   . PHE A 1 207 ? -25.211 29.552 12.130  1.00 29.78 ? 204 PHE A CE2   1 
ATOM   1533 C  CZ    . PHE A 1 207 ? -26.454 28.987 12.265  1.00 30.93 ? 204 PHE A CZ    1 
ATOM   1534 N  N     . LYS A 1 208 ? -28.709 32.405 8.603   1.00 30.69 ? 205 LYS A N     1 
ATOM   1535 C  CA    . LYS A 1 208 ? -30.105 32.367 8.167   1.00 32.38 ? 205 LYS A CA    1 
ATOM   1536 C  C     . LYS A 1 208 ? -30.374 33.298 6.978   1.00 32.87 ? 205 LYS A C     1 
ATOM   1537 O  O     . LYS A 1 208 ? -31.122 32.931 6.075   1.00 33.37 ? 205 LYS A O     1 
ATOM   1538 C  CB    . LYS A 1 208 ? -31.072 32.723 9.314   1.00 34.21 ? 205 LYS A CB    1 
ATOM   1539 C  CG    . LYS A 1 208 ? -31.580 31.518 10.130  1.00 35.65 ? 205 LYS A CG    1 
ATOM   1540 C  CD    . LYS A 1 208 ? -32.595 31.933 11.233  1.00 39.56 ? 205 LYS A CD    1 
ATOM   1541 C  CE    . LYS A 1 208 ? -33.716 32.860 10.706  1.00 41.88 ? 205 LYS A CE    1 
ATOM   1542 N  NZ    . LYS A 1 208 ? -34.829 33.097 11.680  1.00 45.24 ? 205 LYS A NZ    1 
ATOM   1543 N  N     . GLU A 1 209 ? -29.817 34.510 6.997   1.00 32.68 ? 206 GLU A N     1 
ATOM   1544 C  CA    . GLU A 1 209 ? -29.957 35.420 5.851   1.00 33.71 ? 206 GLU A CA    1 
ATOM   1545 C  C     . GLU A 1 209 ? -29.167 34.924 4.619   1.00 32.01 ? 206 GLU A C     1 
ATOM   1546 O  O     . GLU A 1 209 ? -29.614 35.058 3.483   1.00 32.72 ? 206 GLU A O     1 
ATOM   1547 C  CB    . GLU A 1 209 ? -29.532 36.840 6.235   1.00 34.78 ? 206 GLU A CB    1 
ATOM   1548 C  CG    . GLU A 1 209 ? -29.711 37.903 5.128   1.00 37.64 ? 206 GLU A CG    1 
ATOM   1549 C  CD    . GLU A 1 209 ? -31.152 38.385 4.925   1.00 42.42 ? 206 GLU A CD    1 
ATOM   1550 O  OE1   . GLU A 1 209 ? -32.107 37.717 5.378   1.00 45.39 ? 206 GLU A OE1   1 
ATOM   1551 O  OE2   . GLU A 1 209 ? -31.331 39.458 4.302   1.00 45.05 ? 206 GLU A OE2   1 
ATOM   1552 N  N     . MET A 1 210 ? -27.999 34.346 4.852   1.00 30.07 ? 207 MET A N     1 
ATOM   1553 C  CA    . MET A 1 210 ? -27.226 33.704 3.789   1.00 29.22 ? 207 MET A CA    1 
ATOM   1554 C  C     . MET A 1 210 ? -28.063 32.611 3.127   1.00 29.09 ? 207 MET A C     1 
ATOM   1555 O  O     . MET A 1 210 ? -28.276 32.635 1.918   1.00 29.66 ? 207 MET A O     1 
ATOM   1556 C  CB    . MET A 1 210 ? -25.938 33.122 4.371   1.00 27.45 ? 207 MET A CB    1 
ATOM   1557 C  CG    . MET A 1 210 ? -25.145 32.226 3.444   1.00 28.08 ? 207 MET A CG    1 
ATOM   1558 S  SD    . MET A 1 210 ? -24.253 33.129 2.177   1.00 30.36 ? 207 MET A SD    1 
ATOM   1559 C  CE    . MET A 1 210 ? -22.838 33.623 3.149   1.00 26.85 ? 207 MET A CE    1 
ATOM   1560 N  N     . ALA A 1 211 ? -28.565 31.683 3.937   1.00 28.97 ? 208 ALA A N     1 
ATOM   1561 C  CA    . ALA A 1 211 ? -29.423 30.592 3.453   1.00 29.51 ? 208 ALA A CA    1 
ATOM   1562 C  C     . ALA A 1 211 ? -30.615 31.098 2.649   1.00 31.22 ? 208 ALA A C     1 
ATOM   1563 O  O     . ALA A 1 211 ? -30.967 30.526 1.618   1.00 31.88 ? 208 ALA A O     1 
ATOM   1564 C  CB    . ALA A 1 211 ? -29.917 29.746 4.617   1.00 29.45 ? 208 ALA A CB    1 
ATOM   1565 N  N     . THR A 1 212 ? -31.240 32.167 3.128   1.00 32.37 ? 209 THR A N     1 
ATOM   1566 C  CA    . THR A 1 212 ? -32.414 32.725 2.464   1.00 34.46 ? 209 THR A CA    1 
ATOM   1567 C  C     . THR A 1 212 ? -32.040 33.352 1.125   1.00 34.02 ? 209 THR A C     1 
ATOM   1568 O  O     . THR A 1 212 ? -32.752 33.181 0.145   1.00 34.67 ? 209 THR A O     1 
ATOM   1569 C  CB    . THR A 1 212 ? -33.125 33.753 3.365   1.00 35.94 ? 209 THR A CB    1 
ATOM   1570 O  OG1   . THR A 1 212 ? -33.748 33.060 4.451   1.00 37.89 ? 209 THR A OG1   1 
ATOM   1571 C  CG2   . THR A 1 212 ? -34.188 34.529 2.600   1.00 37.99 ? 209 THR A CG2   1 
ATOM   1572 N  N     . THR A 1 213 ? -30.916 34.066 1.098   1.00 32.76 ? 210 THR A N     1 
ATOM   1573 C  CA    . THR A 1 213 ? -30.439 34.708 -0.124  1.00 32.86 ? 210 THR A CA    1 
ATOM   1574 C  C     . THR A 1 213 ? -30.090 33.657 -1.158  1.00 31.72 ? 210 THR A C     1 
ATOM   1575 O  O     . THR A 1 213 ? -30.501 33.767 -2.310  1.00 33.07 ? 210 THR A O     1 
ATOM   1576 C  CB    . THR A 1 213 ? -29.205 35.605 0.117   1.00 32.02 ? 210 THR A CB    1 
ATOM   1577 O  OG1   . THR A 1 213 ? -29.489 36.557 1.150   1.00 33.27 ? 210 THR A OG1   1 
ATOM   1578 C  CG2   . THR A 1 213 ? -28.826 36.353 -1.159  1.00 32.68 ? 210 THR A CG2   1 
ATOM   1579 N  N     . LEU A 1 214 ? -29.363 32.625 -0.739  1.00 29.64 ? 211 LEU A N     1 
ATOM   1580 C  CA    . LEU A 1 214 ? -28.978 31.553 -1.661  1.00 28.79 ? 211 LEU A CA    1 
ATOM   1581 C  C     . LEU A 1 214 ? -30.191 30.825 -2.264  1.00 30.46 ? 211 LEU A C     1 
ATOM   1582 O  O     . LEU A 1 214 ? -30.204 30.546 -3.465  1.00 30.78 ? 211 LEU A O     1 
ATOM   1583 C  CB    . LEU A 1 214 ? -28.026 30.556 -0.992  1.00 26.53 ? 211 LEU A CB    1 
ATOM   1584 C  CG    . LEU A 1 214 ? -26.672 31.086 -0.516  1.00 24.31 ? 211 LEU A CG    1 
ATOM   1585 C  CD1   . LEU A 1 214 ? -25.850 29.951 0.099   1.00 21.58 ? 211 LEU A CD1   1 
ATOM   1586 C  CD2   . LEU A 1 214 ? -25.892 31.740 -1.638  1.00 24.90 ? 211 LEU A CD2   1 
ATOM   1587 N  N     . ASN A 1 215 ? -31.206 30.534 -1.449  1.00 31.23 ? 212 ASN A N     1 
ATOM   1588 C  CA    . ASN A 1 215 ? -32.422 29.868 -1.954  1.00 33.06 ? 212 ASN A CA    1 
ATOM   1589 C  C     . ASN A 1 215 ? -33.159 30.666 -3.025  1.00 35.32 ? 212 ASN A C     1 
ATOM   1590 O  O     . ASN A 1 215 ? -33.772 30.084 -3.919  1.00 36.45 ? 212 ASN A O     1 
ATOM   1591 C  CB    . ASN A 1 215 ? -33.400 29.555 -0.814  1.00 33.73 ? 212 ASN A CB    1 
ATOM   1592 C  CG    . ASN A 1 215 ? -32.906 28.437 0.087   1.00 31.47 ? 212 ASN A CG    1 
ATOM   1593 O  OD1   . ASN A 1 215 ? -31.990 27.713 -0.265  1.00 28.99 ? 212 ASN A OD1   1 
ATOM   1594 N  ND2   . ASN A 1 215 ? -33.528 28.288 1.245   1.00 30.11 ? 212 ASN A ND2   1 
ATOM   1595 N  N     . ALA A 1 216 ? -33.126 31.992 -2.914  1.00 36.02 ? 213 ALA A N     1 
ATOM   1596 C  CA    . ALA A 1 216 ? -33.798 32.856 -3.887  1.00 38.21 ? 213 ALA A CA    1 
ATOM   1597 C  C     . ALA A 1 216 ? -32.948 33.023 -5.148  1.00 37.92 ? 213 ALA A C     1 
ATOM   1598 O  O     . ALA A 1 216 ? -33.475 33.144 -6.247  1.00 39.90 ? 213 ALA A O     1 
ATOM   1599 C  CB    . ALA A 1 216 ? -34.115 34.216 -3.273  1.00 39.10 ? 213 ALA A CB    1 
ATOM   1600 N  N     . GLN A 1 217 ? -31.632 33.036 -4.981  1.00 36.06 ? 214 GLN A N     1 
ATOM   1601 C  CA    . GLN A 1 217 ? -30.718 33.155 -6.113  1.00 36.05 ? 214 GLN A CA    1 
ATOM   1602 C  C     . GLN A 1 217 ? -30.632 31.889 -6.963  1.00 35.40 ? 214 GLN A C     1 
ATOM   1603 O  O     . GLN A 1 217 ? -30.558 31.979 -8.182  1.00 36.44 ? 214 GLN A O     1 
ATOM   1604 C  CB    . GLN A 1 217 ? -29.322 33.537 -5.636  1.00 34.52 ? 214 GLN A CB    1 
ATOM   1605 C  CG    . GLN A 1 217 ? -29.188 35.017 -5.294  1.00 36.99 ? 214 GLN A CG    1 
ATOM   1606 C  CD    . GLN A 1 217 ? -27.783 35.516 -5.525  1.00 38.88 ? 214 GLN A CD    1 
ATOM   1607 O  OE1   . GLN A 1 217 ? -26.816 34.770 -5.353  1.00 40.00 ? 214 GLN A OE1   1 
ATOM   1608 N  NE2   . GLN A 1 217 ? -27.656 36.774 -5.936  1.00 42.10 ? 214 GLN A NE2   1 
ATOM   1609 N  N     . ILE A 1 218 ? -30.637 30.719 -6.328  1.00 33.68 ? 215 ILE A N     1 
ATOM   1610 C  CA    . ILE A 1 218 ? -30.602 29.467 -7.073  1.00 33.50 ? 215 ILE A CA    1 
ATOM   1611 C  C     . ILE A 1 218 ? -31.875 29.249 -7.893  1.00 35.96 ? 215 ILE A C     1 
ATOM   1612 O  O     . ILE A 1 218 ? -31.858 28.463 -8.832  1.00 35.94 ? 215 ILE A O     1 
ATOM   1613 C  CB    . ILE A 1 218 ? -30.320 28.234 -6.183  1.00 31.77 ? 215 ILE A CB    1 
ATOM   1614 C  CG1   . ILE A 1 218 ? -31.453 27.985 -5.175  1.00 32.55 ? 215 ILE A CG1   1 
ATOM   1615 C  CG2   . ILE A 1 218 ? -28.985 28.400 -5.503  1.00 30.13 ? 215 ILE A CG2   1 
ATOM   1616 C  CD1   . ILE A 1 218 ? -31.178 26.825 -4.247  1.00 31.17 ? 215 ILE A CD1   1 
ATOM   1617 N  N     . GLN A 1 219 ? -32.961 29.946 -7.545  1.00 37.55 ? 216 GLN A N     1 
ATOM   1618 C  CA    . GLN A 1 219 ? -34.182 29.921 -8.345  1.00 40.55 ? 216 GLN A CA    1 
ATOM   1619 C  C     . GLN A 1 219 ? -33.990 30.540 -9.732  1.00 41.93 ? 216 GLN A C     1 
ATOM   1620 O  O     . GLN A 1 219 ? -34.721 30.207 -10.656 1.00 43.75 ? 216 GLN A O     1 
ATOM   1621 C  CB    . GLN A 1 219 ? -35.310 30.664 -7.620  1.00 42.40 ? 216 GLN A CB    1 
ATOM   1622 C  CG    . GLN A 1 219 ? -35.758 29.980 -6.346  1.00 41.97 ? 216 GLN A CG    1 
ATOM   1623 C  CD    . GLN A 1 219 ? -36.355 28.625 -6.622  1.00 42.86 ? 216 GLN A CD    1 
ATOM   1624 O  OE1   . GLN A 1 219 ? -35.799 27.599 -6.237  1.00 40.82 ? 216 GLN A OE1   1 
ATOM   1625 N  NE2   . GLN A 1 219 ? -37.478 28.613 -7.330  1.00 44.53 ? 216 GLN A NE2   1 
ATOM   1626 N  N     . GLU A 1 220 ? -33.000 31.430 -9.851  1.00 41.16 ? 217 GLU A N     1 
ATOM   1627 C  CA    A GLU A 1 220 ? -32.701 32.161 -11.081 0.50 42.51 ? 217 GLU A CA    1 
ATOM   1628 C  CA    B GLU A 1 220 ? -32.724 32.134 -11.108 0.50 42.60 ? 217 GLU A CA    1 
ATOM   1629 C  C     . GLU A 1 220 ? -31.486 31.582 -11.823 1.00 41.41 ? 217 GLU A C     1 
ATOM   1630 O  O     . GLU A 1 220 ? -31.025 32.149 -12.812 1.00 42.36 ? 217 GLU A O     1 
ATOM   1631 C  CB    A GLU A 1 220 ? -32.436 33.632 -10.737 0.50 42.61 ? 217 GLU A CB    1 
ATOM   1632 C  CB    B GLU A 1 220 ? -32.570 33.635 -10.845 0.50 43.01 ? 217 GLU A CB    1 
ATOM   1633 C  CG    A GLU A 1 220 ? -33.517 34.276 -9.864  0.50 43.56 ? 217 GLU A CG    1 
ATOM   1634 C  CG    B GLU A 1 220 ? -33.854 34.304 -10.366 0.50 44.91 ? 217 GLU A CG    1 
ATOM   1635 C  CD    A GLU A 1 220 ? -33.197 35.710 -9.486  0.50 43.23 ? 217 GLU A CD    1 
ATOM   1636 C  CD    B GLU A 1 220 ? -35.045 33.967 -11.241 0.50 47.14 ? 217 GLU A CD    1 
ATOM   1637 O  OE1   A GLU A 1 220 ? -32.257 35.923 -8.690  0.50 39.66 ? 217 GLU A OE1   1 
ATOM   1638 O  OE1   B GLU A 1 220 ? -35.041 34.346 -12.426 0.50 48.68 ? 217 GLU A OE1   1 
ATOM   1639 O  OE2   A GLU A 1 220 ? -33.895 36.623 -9.980  0.50 45.36 ? 217 GLU A OE2   1 
ATOM   1640 O  OE2   B GLU A 1 220 ? -35.988 33.320 -10.744 0.50 48.45 ? 217 GLU A OE2   1 
ATOM   1641 N  N     . ASN A 1 221 ? -30.965 30.457 -11.341 1.00 39.47 ? 218 ASN A N     1 
ATOM   1642 C  CA    . ASN A 1 221 ? -29.806 29.807 -11.955 1.00 38.49 ? 218 ASN A CA    1 
ATOM   1643 C  C     . ASN A 1 221 ? -29.864 28.294 -11.687 1.00 37.31 ? 218 ASN A C     1 
ATOM   1644 O  O     . ASN A 1 221 ? -29.504 27.822 -10.595 1.00 35.17 ? 218 ASN A O     1 
ATOM   1645 C  CB    . ASN A 1 221 ? -28.514 30.471 -11.435 1.00 36.68 ? 218 ASN A CB    1 
ATOM   1646 C  CG    . ASN A 1 221 ? -27.245 29.734 -11.831 1.00 37.11 ? 218 ASN A CG    1 
ATOM   1647 O  OD1   . ASN A 1 221 ? -27.264 28.788 -12.615 1.00 42.00 ? 218 ASN A OD1   1 
ATOM   1648 N  ND2   . ASN A 1 221 ? -26.125 30.169 -11.274 1.00 37.47 ? 218 ASN A ND2   1 
ATOM   1649 N  N     . ASP A 1 222 ? -30.326 27.548 -12.692 1.00 38.82 ? 219 ASP A N     1 
ATOM   1650 C  CA    . ASP A 1 222 ? -30.555 26.095 -12.572 1.00 38.74 ? 219 ASP A CA    1 
ATOM   1651 C  C     . ASP A 1 222 ? -29.303 25.268 -12.290 1.00 36.34 ? 219 ASP A C     1 
ATOM   1652 O  O     . ASP A 1 222 ? -29.396 24.193 -11.684 1.00 35.90 ? 219 ASP A O     1 
ATOM   1653 C  CB    . ASP A 1 222 ? -31.196 25.536 -13.849 1.00 41.20 ? 219 ASP A CB    1 
ATOM   1654 C  CG    . ASP A 1 222 ? -32.555 26.131 -14.138 1.00 44.37 ? 219 ASP A CG    1 
ATOM   1655 O  OD1   . ASP A 1 222 ? -32.928 27.112 -13.470 1.00 45.44 ? 219 ASP A OD1   1 
ATOM   1656 O  OD2   . ASP A 1 222 ? -33.242 25.629 -15.056 1.00 48.26 ? 219 ASP A OD2   1 
ATOM   1657 N  N     . GLU A 1 223 ? -28.148 25.748 -12.754 1.00 35.33 ? 220 GLU A N     1 
ATOM   1658 C  CA    A GLU A 1 223 ? -26.897 25.005 -12.612 0.50 33.24 ? 220 GLU A CA    1 
ATOM   1659 C  CA    B GLU A 1 223 ? -26.886 25.017 -12.610 0.50 33.44 ? 220 GLU A CA    1 
ATOM   1660 C  C     . GLU A 1 223 ? -26.414 25.106 -11.168 1.00 31.01 ? 220 GLU A C     1 
ATOM   1661 O  O     . GLU A 1 223 ? -25.932 24.129 -10.595 1.00 29.81 ? 220 GLU A O     1 
ATOM   1662 C  CB    A GLU A 1 223 ? -25.839 25.527 -13.591 0.50 33.34 ? 220 GLU A CB    1 
ATOM   1663 C  CB    B GLU A 1 223 ? -25.819 25.581 -13.554 0.50 33.66 ? 220 GLU A CB    1 
ATOM   1664 C  CG    A GLU A 1 223 ? -26.131 25.201 -15.059 0.50 35.21 ? 220 GLU A CG    1 
ATOM   1665 C  CG    B GLU A 1 223 ? -26.012 25.182 -15.004 0.50 36.27 ? 220 GLU A CG    1 
ATOM   1666 C  CD    A GLU A 1 223 ? -27.312 25.980 -15.636 0.50 36.80 ? 220 GLU A CD    1 
ATOM   1667 C  CD    B GLU A 1 223 ? -25.563 23.765 -15.262 0.50 36.24 ? 220 GLU A CD    1 
ATOM   1668 O  OE1   A GLU A 1 223 ? -27.915 25.501 -16.615 0.50 38.85 ? 220 GLU A OE1   1 
ATOM   1669 O  OE1   B GLU A 1 223 ? -24.996 23.160 -14.331 0.50 36.00 ? 220 GLU A OE1   1 
ATOM   1670 O  OE2   A GLU A 1 223 ? -27.644 27.063 -15.115 0.50 35.59 ? 220 GLU A OE2   1 
ATOM   1671 O  OE2   B GLU A 1 223 ? -25.768 23.254 -16.383 0.50 39.33 ? 220 GLU A OE2   1 
ATOM   1672 N  N     . ALA A 1 224 ? -26.554 26.292 -10.592 1.00 30.56 ? 221 ALA A N     1 
ATOM   1673 C  CA    . ALA A 1 224 ? -26.278 26.496 -9.182  1.00 28.70 ? 221 ALA A CA    1 
ATOM   1674 C  C     . ALA A 1 224 ? -27.210 25.613 -8.353  1.00 28.59 ? 221 ALA A C     1 
ATOM   1675 O  O     . ALA A 1 224 ? -26.772 24.947 -7.415  1.00 26.76 ? 221 ALA A O     1 
ATOM   1676 C  CB    . ALA A 1 224 ? -26.449 27.967 -8.818  1.00 28.95 ? 221 ALA A CB    1 
ATOM   1677 N  N     . LYS A 1 225 ? -28.486 25.575 -8.735  1.00 30.87 ? 222 LYS A N     1 
ATOM   1678 C  CA    . LYS A 1 225 ? -29.505 24.824 -7.997  1.00 31.41 ? 222 LYS A CA    1 
ATOM   1679 C  C     . LYS A 1 225 ? -29.196 23.336 -7.903  1.00 30.81 ? 222 LYS A C     1 
ATOM   1680 O  O     . LYS A 1 225 ? -29.254 22.767 -6.813  1.00 30.05 ? 222 LYS A O     1 
ATOM   1681 C  CB    . LYS A 1 225 ? -30.888 25.027 -8.619  1.00 34.12 ? 222 LYS A CB    1 
ATOM   1682 C  CG    . LYS A 1 225 ? -32.025 24.433 -7.784  1.00 35.44 ? 222 LYS A CG    1 
ATOM   1683 C  CD    . LYS A 1 225 ? -33.385 24.974 -8.196  1.00 38.90 ? 222 LYS A CD    1 
ATOM   1684 C  CE    . LYS A 1 225 ? -34.458 24.539 -7.210  1.00 40.67 ? 222 LYS A CE    1 
ATOM   1685 N  NZ    . LYS A 1 225 ? -35.810 25.055 -7.567  1.00 42.46 ? 222 LYS A NZ    1 
ATOM   1686 N  N     . ILE A 1 226 ? -28.875 22.712 -9.038  1.00 31.31 ? 223 ILE A N     1 
ATOM   1687 C  CA    . ILE A 1 226 ? -28.538 21.274 -9.083  1.00 30.63 ? 223 ILE A CA    1 
ATOM   1688 C  C     . ILE A 1 226 ? -27.105 20.990 -8.598  1.00 28.57 ? 223 ILE A C     1 
ATOM   1689 O  O     . ILE A 1 226 ? -26.808 19.881 -8.144  1.00 27.87 ? 223 ILE A O     1 
ATOM   1690 C  CB    . ILE A 1 226 ? -28.751 20.682 -10.514 1.00 32.52 ? 223 ILE A CB    1 
ATOM   1691 C  CG1   . ILE A 1 226 ? -28.674 19.143 -10.512 1.00 32.44 ? 223 ILE A CG1   1 
ATOM   1692 C  CG2   . ILE A 1 226 ? -27.747 21.272 -11.490 1.00 31.99 ? 223 ILE A CG2   1 
ATOM   1693 C  CD1   . ILE A 1 226 ? -29.561 18.465 -9.464  1.00 32.83 ? 223 ILE A CD1   1 
ATOM   1694 N  N     . GLY A 1 227 ? -26.220 21.983 -8.689  1.00 27.22 ? 224 GLY A N     1 
ATOM   1695 C  CA    . GLY A 1 227 ? -24.883 21.867 -8.097  1.00 25.07 ? 224 GLY A CA    1 
ATOM   1696 C  C     . GLY A 1 227 ? -24.909 21.561 -6.603  1.00 23.24 ? 224 GLY A C     1 
ATOM   1697 O  O     . GLY A 1 227 ? -24.062 20.847 -6.091  1.00 21.44 ? 224 GLY A O     1 
ATOM   1698 N  N     . GLY A 1 228 ? -25.910 22.081 -5.906  1.00 23.70 ? 225 GLY A N     1 
ATOM   1699 C  CA    . GLY A 1 228 ? -26.043 21.847 -4.480  1.00 22.47 ? 225 GLY A CA    1 
ATOM   1700 C  C     . GLY A 1 228 ? -25.101 22.719 -3.686  1.00 21.03 ? 225 GLY A C     1 
ATOM   1701 O  O     . GLY A 1 228 ? -24.657 23.757 -4.169  1.00 20.81 ? 225 GLY A O     1 
ATOM   1702 N  N     . MET A 1 229 ? -24.813 22.299 -2.456  1.00 20.05 ? 226 MET A N     1 
ATOM   1703 C  CA    . MET A 1 229 ? -24.043 23.101 -1.525  1.00 19.11 ? 226 MET A CA    1 
ATOM   1704 C  C     . MET A 1 229 ? -23.107 22.240 -0.709  1.00 17.65 ? 226 MET A C     1 
ATOM   1705 O  O     . MET A 1 229 ? -23.488 21.176 -0.220  1.00 17.05 ? 226 MET A O     1 
ATOM   1706 C  CB    . MET A 1 229 ? -24.960 23.830 -0.548  1.00 19.45 ? 226 MET A CB    1 
ATOM   1707 C  CG    . MET A 1 229 ? -25.948 24.778 -1.169  1.00 21.39 ? 226 MET A CG    1 
ATOM   1708 S  SD    . MET A 1 229 ? -26.712 25.801 0.121   1.00 21.90 ? 226 MET A SD    1 
ATOM   1709 C  CE    . MET A 1 229 ? -27.868 26.749 -0.869  1.00 22.49 ? 226 MET A CE    1 
ATOM   1710 N  N     . ILE A 1 230 ? -21.879 22.721 -0.565  1.00 16.74 ? 227 ILE A N     1 
ATOM   1711 C  CA    . ILE A 1 230 ? -20.936 22.149 0.364   1.00 15.73 ? 227 ILE A CA    1 
ATOM   1712 C  C     . ILE A 1 230 ? -20.661 23.235 1.379   1.00 15.59 ? 227 ILE A C     1 
ATOM   1713 O  O     . ILE A 1 230 ? -20.195 24.327 1.024   1.00 15.97 ? 227 ILE A O     1 
ATOM   1714 C  CB    . ILE A 1 230 ? -19.673 21.649 -0.342  1.00 15.45 ? 227 ILE A CB    1 
ATOM   1715 C  CG1   . ILE A 1 230 ? -20.050 20.440 -1.209  1.00 16.70 ? 227 ILE A CG1   1 
ATOM   1716 C  CG2   . ILE A 1 230 ? -18.602 21.271 0.699   1.00 13.69 ? 227 ILE A CG2   1 
ATOM   1717 C  CD1   . ILE A 1 230 ? -19.363 20.385 -2.518  1.00 18.04 ? 227 ILE A CD1   1 
ATOM   1718 N  N     . ILE A 1 231 ? -20.998 22.930 2.634   1.00 15.44 ? 228 ILE A N     1 
ATOM   1719 C  CA    . ILE A 1 231 ? -21.009 23.898 3.715   1.00 15.38 ? 228 ILE A CA    1 
ATOM   1720 C  C     . ILE A 1 231 ? -19.940 23.559 4.748   1.00 15.28 ? 228 ILE A C     1 
ATOM   1721 O  O     . ILE A 1 231 ? -19.985 22.507 5.407   1.00 16.18 ? 228 ILE A O     1 
ATOM   1722 C  CB    . ILE A 1 231 ? -22.399 23.961 4.394   1.00 15.96 ? 228 ILE A CB    1 
ATOM   1723 C  CG1   . ILE A 1 231 ? -23.507 24.119 3.346   1.00 16.72 ? 228 ILE A CG1   1 
ATOM   1724 C  CG2   . ILE A 1 231 ? -22.471 25.130 5.331   1.00 14.48 ? 228 ILE A CG2   1 
ATOM   1725 C  CD1   . ILE A 1 231 ? -24.919 23.888 3.896   1.00 16.20 ? 228 ILE A CD1   1 
ATOM   1726 N  N     . ASN A 1 232 ? -18.977 24.459 4.884   1.00 15.13 ? 229 ASN A N     1 
ATOM   1727 C  CA    . ASN A 1 232 ? -17.876 24.290 5.817   1.00 14.66 ? 229 ASN A CA    1 
ATOM   1728 C  C     . ASN A 1 232 ? -18.205 25.037 7.113   1.00 15.65 ? 229 ASN A C     1 
ATOM   1729 O  O     . ASN A 1 232 ? -18.508 26.234 7.064   1.00 16.08 ? 229 ASN A O     1 
ATOM   1730 C  CB    . ASN A 1 232 ? -16.614 24.863 5.190   1.00 14.28 ? 229 ASN A CB    1 
ATOM   1731 C  CG    . ASN A 1 232 ? -15.418 24.700 6.062   1.00 14.30 ? 229 ASN A CG    1 
ATOM   1732 O  OD1   . ASN A 1 232 ? -15.068 23.586 6.404   1.00 14.42 ? 229 ASN A OD1   1 
ATOM   1733 N  ND2   . ASN A 1 232 ? -14.782 25.814 6.453   1.00 13.97 ? 229 ASN A ND2   1 
ATOM   1734 N  N     . THR A 1 233 ? -18.186 24.337 8.255   1.00 15.71 ? 230 THR A N     1 
ATOM   1735 C  CA    . THR A 1 233 ? -18.329 24.989 9.563   1.00 16.51 ? 230 THR A CA    1 
ATOM   1736 C  C     . THR A 1 233 ? -16.991 25.164 10.271  1.00 16.51 ? 230 THR A C     1 
ATOM   1737 O  O     . THR A 1 233 ? -15.989 24.602 9.871   1.00 15.78 ? 230 THR A O     1 
ATOM   1738 C  CB    . THR A 1 233 ? -19.228 24.199 10.535  1.00 16.89 ? 230 THR A CB    1 
ATOM   1739 O  OG1   . THR A 1 233 ? -18.655 22.901 10.760  1.00 16.27 ? 230 THR A OG1   1 
ATOM   1740 C  CG2   . THR A 1 233 ? -20.641 24.088 9.992   1.00 16.68 ? 230 THR A CG2   1 
ATOM   1741 N  N     . CYS A 1 234 ? -17.007 25.938 11.353  1.00 17.49 ? 231 CYS A N     1 
ATOM   1742 C  CA    . CYS A 1 234 ? -15.833 26.070 12.197  1.00 18.00 ? 231 CYS A CA    1 
ATOM   1743 C  C     . CYS A 1 234 ? -15.733 24.877 13.157  1.00 17.54 ? 231 CYS A C     1 
ATOM   1744 O  O     . CYS A 1 234 ? -16.655 24.069 13.274  1.00 16.39 ? 231 CYS A O     1 
ATOM   1745 C  CB    . CYS A 1 234 ? -15.857 27.402 12.932  1.00 18.92 ? 231 CYS A CB    1 
ATOM   1746 S  SG    . CYS A 1 234 ? -16.985 27.495 14.312  1.00 23.28 ? 231 CYS A SG    1 
ATOM   1747 N  N     . GLY A 1 235 ? -14.583 24.748 13.802  1.00 17.89 ? 232 GLY A N     1 
ATOM   1748 C  CA    . GLY A 1 235 ? -14.335 23.647 14.722  1.00 18.42 ? 232 GLY A CA    1 
ATOM   1749 C  C     . GLY A 1 235 ? -14.992 23.766 16.089  1.00 19.62 ? 232 GLY A C     1 
ATOM   1750 O  O     . GLY A 1 235 ? -14.704 22.972 16.976  1.00 20.74 ? 232 GLY A O     1 
ATOM   1751 N  N     . TRP A 1 236 ? -15.871 24.739 16.290  1.00 19.93 ? 233 TRP A N     1 
ATOM   1752 C  CA    . TRP A 1 236 ? -16.505 24.874 17.599  1.00 21.37 ? 233 TRP A CA    1 
ATOM   1753 C  C     . TRP A 1 236 ? -17.665 23.896 17.711  1.00 21.49 ? 233 TRP A C     1 
ATOM   1754 O  O     . TRP A 1 236 ? -18.745 24.151 17.203  1.00 22.35 ? 233 TRP A O     1 
ATOM   1755 C  CB    . TRP A 1 236 ? -16.965 26.309 17.837  1.00 21.74 ? 233 TRP A CB    1 
ATOM   1756 C  CG    . TRP A 1 236 ? -17.383 26.582 19.254  1.00 23.20 ? 233 TRP A CG    1 
ATOM   1757 C  CD1   . TRP A 1 236 ? -17.011 25.893 20.370  1.00 23.18 ? 233 TRP A CD1   1 
ATOM   1758 C  CD2   . TRP A 1 236 ? -18.246 27.630 19.702  1.00 23.42 ? 233 TRP A CD2   1 
ATOM   1759 N  NE1   . TRP A 1 236 ? -17.600 26.432 21.481  1.00 23.98 ? 233 TRP A NE1   1 
ATOM   1760 C  CE2   . TRP A 1 236 ? -18.355 27.509 21.107  1.00 24.55 ? 233 TRP A CE2   1 
ATOM   1761 C  CE3   . TRP A 1 236 ? -18.939 28.658 19.053  1.00 23.89 ? 233 TRP A CE3   1 
ATOM   1762 C  CZ2   . TRP A 1 236 ? -19.121 28.383 21.880  1.00 25.41 ? 233 TRP A CZ2   1 
ATOM   1763 C  CZ3   . TRP A 1 236 ? -19.706 29.531 19.818  1.00 24.97 ? 233 TRP A CZ3   1 
ATOM   1764 C  CH2   . TRP A 1 236 ? -19.791 29.386 21.221  1.00 27.49 ? 233 TRP A CH2   1 
ATOM   1765 N  N     . VAL A 1 237 ? -17.429 22.764 18.357  1.00 22.09 ? 234 VAL A N     1 
ATOM   1766 C  CA    . VAL A 1 237 ? -18.429 21.699 18.427  1.00 22.27 ? 234 VAL A CA    1 
ATOM   1767 C  C     . VAL A 1 237 ? -19.039 21.536 19.823  1.00 24.76 ? 234 VAL A C     1 
ATOM   1768 O  O     . VAL A 1 237 ? -20.100 20.934 19.961  1.00 25.37 ? 234 VAL A O     1 
ATOM   1769 C  CB    . VAL A 1 237 ? -17.841 20.352 17.939  1.00 21.68 ? 234 VAL A CB    1 
ATOM   1770 C  CG1   . VAL A 1 237 ? -17.343 20.496 16.494  1.00 18.70 ? 234 VAL A CG1   1 
ATOM   1771 C  CG2   . VAL A 1 237 ? -16.724 19.862 18.869  1.00 21.75 ? 234 VAL A CG2   1 
ATOM   1772 N  N     . ASP A 1 238 ? -18.383 22.083 20.845  1.00 26.15 ? 235 ASP A N     1 
ATOM   1773 C  CA    . ASP A 1 238 ? -18.866 21.983 22.218  1.00 28.63 ? 235 ASP A CA    1 
ATOM   1774 C  C     . ASP A 1 238 ? -19.807 23.110 22.616  1.00 29.23 ? 235 ASP A C     1 
ATOM   1775 O  O     . ASP A 1 238 ? -19.815 24.181 22.012  1.00 27.55 ? 235 ASP A O     1 
ATOM   1776 C  CB    . ASP A 1 238 ? -17.686 21.979 23.186  1.00 29.94 ? 235 ASP A CB    1 
ATOM   1777 C  CG    . ASP A 1 238 ? -16.855 20.734 23.070  1.00 31.68 ? 235 ASP A CG    1 
ATOM   1778 O  OD1   . ASP A 1 238 ? -17.390 19.698 22.624  1.00 33.54 ? 235 ASP A OD1   1 
ATOM   1779 O  OD2   . ASP A 1 238 ? -15.659 20.795 23.410  1.00 35.89 ? 235 ASP A OD2   1 
ATOM   1780 N  N     . GLY A 1 239 ? -20.585 22.850 23.660  1.00 31.48 ? 236 GLY A N     1 
ATOM   1781 C  CA    . GLY A 1 239 ? -21.482 23.851 24.234  1.00 33.00 ? 236 GLY A CA    1 
ATOM   1782 C  C     . GLY A 1 239 ? -22.338 24.509 23.179  1.00 32.40 ? 236 GLY A C     1 
ATOM   1783 O  O     . GLY A 1 239 ? -23.054 23.826 22.447  1.00 32.11 ? 236 GLY A O     1 
ATOM   1784 N  N     . GLU A 1 240 ? -22.210 25.833 23.068  1.00 32.79 ? 237 GLU A N     1 
ATOM   1785 C  CA    A GLU A 1 240 ? -23.038 26.628 22.165  0.50 32.47 ? 237 GLU A CA    1 
ATOM   1786 C  CA    B GLU A 1 240 ? -23.041 26.624 22.159  0.50 32.31 ? 237 GLU A CA    1 
ATOM   1787 C  C     . GLU A 1 240 ? -22.644 26.441 20.696  1.00 30.63 ? 237 GLU A C     1 
ATOM   1788 O  O     . GLU A 1 240 ? -23.377 26.843 19.796  1.00 30.67 ? 237 GLU A O     1 
ATOM   1789 C  CB    A GLU A 1 240 ? -22.965 28.106 22.557  0.50 33.49 ? 237 GLU A CB    1 
ATOM   1790 C  CB    B GLU A 1 240 ? -22.985 28.106 22.532  0.50 33.20 ? 237 GLU A CB    1 
ATOM   1791 C  CG    A GLU A 1 240 ? -23.516 28.408 23.960  0.50 35.90 ? 237 GLU A CG    1 
ATOM   1792 C  CG    B GLU A 1 240 ? -23.666 28.443 23.856  0.50 34.94 ? 237 GLU A CG    1 
ATOM   1793 C  CD    A GLU A 1 240 ? -23.002 29.723 24.527  0.50 37.72 ? 237 GLU A CD    1 
ATOM   1794 C  CD    B GLU A 1 240 ? -25.179 28.332 23.786  0.50 35.92 ? 237 GLU A CD    1 
ATOM   1795 O  OE1   A GLU A 1 240 ? -22.326 30.464 23.786  0.50 37.23 ? 237 GLU A OE1   1 
ATOM   1796 O  OE1   B GLU A 1 240 ? -25.736 28.438 22.669  0.50 33.90 ? 237 GLU A OE1   1 
ATOM   1797 O  OE2   A GLU A 1 240 ? -23.272 30.018 25.719  0.50 40.33 ? 237 GLU A OE2   1 
ATOM   1798 O  OE2   B GLU A 1 240 ? -25.811 28.144 24.854  0.50 37.98 ? 237 GLU A OE2   1 
ATOM   1799 N  N     . GLY A 1 241 ? -21.479 25.845 20.460  1.00 29.47 ? 238 GLY A N     1 
ATOM   1800 C  CA    . GLY A 1 241 ? -21.036 25.510 19.120  1.00 27.58 ? 238 GLY A CA    1 
ATOM   1801 C  C     . GLY A 1 241 ? -21.871 24.367 18.568  1.00 27.38 ? 238 GLY A C     1 
ATOM   1802 O  O     . GLY A 1 241 ? -22.155 24.319 17.386  1.00 26.53 ? 238 GLY A O     1 
ATOM   1803 N  N     . TYR A 1 242 ? -22.275 23.449 19.437  1.00 28.68 ? 239 TYR A N     1 
ATOM   1804 C  CA    . TYR A 1 242 ? -23.139 22.342 19.041  1.00 28.54 ? 239 TYR A CA    1 
ATOM   1805 C  C     . TYR A 1 242 ? -24.473 22.846 18.482  1.00 29.42 ? 239 TYR A C     1 
ATOM   1806 O  O     . TYR A 1 242 ? -24.949 22.361 17.464  1.00 28.42 ? 239 TYR A O     1 
ATOM   1807 C  CB    . TYR A 1 242 ? -23.397 21.399 20.228  1.00 29.39 ? 239 TYR A CB    1 
ATOM   1808 C  CG    . TYR A 1 242 ? -24.362 20.297 19.884  1.00 28.43 ? 239 TYR A CG    1 
ATOM   1809 C  CD1   . TYR A 1 242 ? -23.980 19.258 19.040  1.00 25.39 ? 239 TYR A CD1   1 
ATOM   1810 C  CD2   . TYR A 1 242 ? -25.668 20.307 20.365  1.00 28.39 ? 239 TYR A CD2   1 
ATOM   1811 C  CE1   . TYR A 1 242 ? -24.861 18.254 18.692  1.00 25.13 ? 239 TYR A CE1   1 
ATOM   1812 C  CE2   . TYR A 1 242 ? -26.566 19.291 20.023  1.00 29.10 ? 239 TYR A CE2   1 
ATOM   1813 C  CZ    . TYR A 1 242 ? -26.153 18.267 19.179  1.00 26.60 ? 239 TYR A CZ    1 
ATOM   1814 O  OH    . TYR A 1 242 ? -27.021 17.243 18.830  1.00 25.99 ? 239 TYR A OH    1 
ATOM   1815 N  N     . LYS A 1 243 ? -25.089 23.805 19.159  1.00 31.68 ? 240 LYS A N     1 
ATOM   1816 C  CA    . LYS A 1 243 ? -26.362 24.335 18.679  1.00 33.23 ? 240 LYS A CA    1 
ATOM   1817 C  C     . LYS A 1 243 ? -26.225 25.115 17.384  1.00 32.18 ? 240 LYS A C     1 
ATOM   1818 O  O     . LYS A 1 243 ? -27.182 25.156 16.615  1.00 32.78 ? 240 LYS A O     1 
ATOM   1819 C  CB    . LYS A 1 243 ? -27.075 25.174 19.742  1.00 35.65 ? 240 LYS A CB    1 
ATOM   1820 C  CG    . LYS A 1 243 ? -27.754 24.317 20.804  1.00 38.70 ? 240 LYS A CG    1 
ATOM   1821 C  CD    . LYS A 1 243 ? -29.173 24.772 21.113  1.00 43.33 ? 240 LYS A CD    1 
ATOM   1822 C  CE    . LYS A 1 243 ? -29.863 23.747 22.010  1.00 46.43 ? 240 LYS A CE    1 
ATOM   1823 N  NZ    . LYS A 1 243 ? -31.065 24.296 22.726  1.00 50.65 ? 240 LYS A NZ    1 
ATOM   1824 N  N     . CYS A 1 244 ? -25.061 25.728 17.140  1.00 31.19 ? 241 CYS A N     1 
ATOM   1825 C  CA    . CYS A 1 244 ? -24.799 26.365 15.846  1.00 30.47 ? 241 CYS A CA    1 
ATOM   1826 C  C     . CYS A 1 244 ? -24.935 25.327 14.740  1.00 28.41 ? 241 CYS A C     1 
ATOM   1827 O  O     . CYS A 1 244 ? -25.543 25.594 13.715  1.00 28.09 ? 241 CYS A O     1 
ATOM   1828 C  CB    . CYS A 1 244 ? -23.395 26.981 15.752  1.00 29.61 ? 241 CYS A CB    1 
ATOM   1829 S  SG    . CYS A 1 244 ? -23.168 28.598 16.513  1.00 35.33 ? 241 CYS A SG    1 
ATOM   1830 N  N     . ILE A 1 245 ? -24.335 24.158 14.964  1.00 27.28 ? 242 ILE A N     1 
ATOM   1831 C  CA    . ILE A 1 245 ? -24.357 23.044 14.006  1.00 25.61 ? 242 ILE A CA    1 
ATOM   1832 C  C     . ILE A 1 245 ? -25.793 22.615 13.668  1.00 25.92 ? 242 ILE A C     1 
ATOM   1833 O  O     . ILE A 1 245 ? -26.142 22.489 12.493  1.00 25.46 ? 242 ILE A O     1 
ATOM   1834 C  CB    . ILE A 1 245 ? -23.531 21.834 14.544  1.00 25.32 ? 242 ILE A CB    1 
ATOM   1835 C  CG1   . ILE A 1 245 ? -22.041 22.195 14.595  1.00 24.68 ? 242 ILE A CG1   1 
ATOM   1836 C  CG2   . ILE A 1 245 ? -23.738 20.596 13.690  1.00 23.75 ? 242 ILE A CG2   1 
ATOM   1837 C  CD1   . ILE A 1 245 ? -21.149 21.069 15.159  1.00 24.90 ? 242 ILE A CD1   1 
ATOM   1838 N  N     . VAL A 1 246 ? -26.617 22.427 14.698  1.00 26.44 ? 243 VAL A N     1 
ATOM   1839 C  CA    . VAL A 1 246 ? -28.009 22.000 14.528  1.00 27.38 ? 243 VAL A CA    1 
ATOM   1840 C  C     . VAL A 1 246 ? -28.821 23.047 13.773  1.00 27.44 ? 243 VAL A C     1 
ATOM   1841 O  O     . VAL A 1 246 ? -29.605 22.709 12.893  1.00 27.31 ? 243 VAL A O     1 
ATOM   1842 C  CB    . VAL A 1 246 ? -28.692 21.719 15.895  1.00 29.28 ? 243 VAL A CB    1 
ATOM   1843 C  CG1   . VAL A 1 246 ? -30.214 21.650 15.748  1.00 29.62 ? 243 VAL A CG1   1 
ATOM   1844 C  CG2   . VAL A 1 246 ? -28.144 20.429 16.505  1.00 28.85 ? 243 VAL A CG2   1 
ATOM   1845 N  N     . LYS A 1 247 ? -28.619 24.312 14.128  1.00 27.38 ? 244 LYS A N     1 
ATOM   1846 C  CA    . LYS A 1 247 ? -29.289 25.429 13.459  1.00 27.81 ? 244 LYS A CA    1 
ATOM   1847 C  C     . LYS A 1 247 ? -28.774 25.683 12.042  1.00 25.89 ? 244 LYS A C     1 
ATOM   1848 O  O     . LYS A 1 247 ? -29.543 26.108 11.189  1.00 26.53 ? 244 LYS A O     1 
ATOM   1849 C  CB    . LYS A 1 247 ? -29.154 26.701 14.280  1.00 29.04 ? 244 LYS A CB    1 
ATOM   1850 C  CG    . LYS A 1 247 ? -29.963 26.687 15.570  1.00 31.88 ? 244 LYS A CG    1 
ATOM   1851 C  CD    . LYS A 1 247 ? -29.704 27.938 16.401  1.00 33.97 ? 244 LYS A CD    1 
ATOM   1852 C  CE    . LYS A 1 247 ? -30.609 27.997 17.648  1.00 37.64 ? 244 LYS A CE    1 
ATOM   1853 N  NZ    . LYS A 1 247 ? -31.764 28.929 17.454  1.00 40.77 ? 244 LYS A NZ    1 
ATOM   1854 N  N     . ALA A 1 248 ? -27.488 25.433 11.788  1.00 23.78 ? 245 ALA A N     1 
ATOM   1855 C  CA    . ALA A 1 248 ? -26.962 25.474 10.420  1.00 22.50 ? 245 ALA A CA    1 
ATOM   1856 C  C     . ALA A 1 248 ? -27.592 24.368 9.563   1.00 22.33 ? 245 ALA A C     1 
ATOM   1857 O  O     . ALA A 1 248 ? -28.031 24.629 8.444   1.00 22.21 ? 245 ALA A O     1 
ATOM   1858 C  CB    . ALA A 1 248 ? -25.439 25.361 10.396  1.00 20.54 ? 245 ALA A CB    1 
ATOM   1859 N  N     . ALA A 1 249 ? -27.641 23.146 10.099  1.00 22.51 ? 246 ALA A N     1 
ATOM   1860 C  CA    . ALA A 1 249 ? -28.290 22.012 9.414   1.00 23.09 ? 246 ALA A CA    1 
ATOM   1861 C  C     . ALA A 1 249 ? -29.725 22.349 9.034   1.00 24.38 ? 246 ALA A C     1 
ATOM   1862 O  O     . ALA A 1 249 ? -30.145 22.131 7.902   1.00 24.97 ? 246 ALA A O     1 
ATOM   1863 C  CB    . ALA A 1 249 ? -28.259 20.755 10.289  1.00 23.36 ? 246 ALA A CB    1 
ATOM   1864 N  N     . SER A 1 250 ? -30.466 22.888 9.990   1.00 25.61 ? 247 SER A N     1 
ATOM   1865 C  CA    . SER A 1 250 ? -31.847 23.342 9.771   1.00 27.88 ? 247 SER A CA    1 
ATOM   1866 C  C     . SER A 1 250 ? -31.973 24.494 8.747   1.00 27.74 ? 247 SER A C     1 
ATOM   1867 O  O     . SER A 1 250 ? -32.732 24.381 7.787   1.00 29.35 ? 247 SER A O     1 
ATOM   1868 C  CB    . SER A 1 250 ? -32.468 23.763 11.105  1.00 29.27 ? 247 SER A CB    1 
ATOM   1869 O  OG    . SER A 1 250 ? -33.625 24.554 10.900  1.00 32.99 ? 247 SER A OG    1 
ATOM   1870 N  N     . ALA A 1 251 ? -31.232 25.582 8.952   1.00 26.50 ? 248 ALA A N     1 
ATOM   1871 C  CA    . ALA A 1 251 ? -31.327 26.782 8.094   1.00 26.86 ? 248 ALA A CA    1 
ATOM   1872 C  C     . ALA A 1 251 ? -31.024 26.530 6.601   1.00 26.08 ? 248 ALA A C     1 
ATOM   1873 O  O     . ALA A 1 251 ? -31.675 27.105 5.726   1.00 26.89 ? 248 ALA A O     1 
ATOM   1874 C  CB    . ALA A 1 251 ? -30.401 27.881 8.627   1.00 25.93 ? 248 ALA A CB    1 
ATOM   1875 N  N     . PHE A 1 252 ? -30.026 25.688 6.327   1.00 24.71 ? 249 PHE A N     1 
ATOM   1876 C  CA    . PHE A 1 252 ? -29.631 25.334 4.955   1.00 23.97 ? 249 PHE A CA    1 
ATOM   1877 C  C     . PHE A 1 252 ? -30.330 24.069 4.435   1.00 24.69 ? 249 PHE A C     1 
ATOM   1878 O  O     . PHE A 1 252 ? -30.094 23.655 3.299   1.00 24.21 ? 249 PHE A O     1 
ATOM   1879 C  CB    . PHE A 1 252 ? -28.111 25.180 4.875   1.00 22.24 ? 249 PHE A CB    1 
ATOM   1880 C  CG    . PHE A 1 252 ? -27.368 26.493 4.962   1.00 22.22 ? 249 PHE A CG    1 
ATOM   1881 C  CD1   . PHE A 1 252 ? -27.111 27.240 3.816   1.00 23.11 ? 249 PHE A CD1   1 
ATOM   1882 C  CD2   . PHE A 1 252 ? -26.946 26.987 6.179   1.00 21.68 ? 249 PHE A CD2   1 
ATOM   1883 C  CE1   . PHE A 1 252 ? -26.439 28.476 3.890   1.00 22.85 ? 249 PHE A CE1   1 
ATOM   1884 C  CE2   . PHE A 1 252 ? -26.277 28.207 6.267   1.00 22.35 ? 249 PHE A CE2   1 
ATOM   1885 C  CZ    . PHE A 1 252 ? -26.019 28.953 5.109   1.00 22.84 ? 249 PHE A CZ    1 
ATOM   1886 N  N     . GLU A 1 253 ? -31.190 23.475 5.268   1.00 25.96 ? 250 GLU A N     1 
ATOM   1887 C  CA    . GLU A 1 253 ? -31.967 22.290 4.912   1.00 27.39 ? 250 GLU A CA    1 
ATOM   1888 C  C     . GLU A 1 253 ? -31.062 21.226 4.309   1.00 25.88 ? 250 GLU A C     1 
ATOM   1889 O  O     . GLU A 1 253 ? -31.303 20.740 3.207   1.00 25.97 ? 250 GLU A O     1 
ATOM   1890 C  CB    . GLU A 1 253 ? -33.085 22.647 3.931   1.00 29.38 ? 250 GLU A CB    1 
ATOM   1891 C  CG    . GLU A 1 253 ? -34.072 23.677 4.435   1.00 32.53 ? 250 GLU A CG    1 
ATOM   1892 C  CD    . GLU A 1 253 ? -34.975 24.175 3.322   1.00 36.32 ? 250 GLU A CD    1 
ATOM   1893 O  OE1   . GLU A 1 253 ? -36.094 23.648 3.192   1.00 40.52 ? 250 GLU A OE1   1 
ATOM   1894 O  OE2   . GLU A 1 253 ? -34.549 25.057 2.544   1.00 37.46 ? 250 GLU A OE2   1 
ATOM   1895 N  N     . VAL A 1 254 ? -30.007 20.882 5.038   1.00 24.43 ? 251 VAL A N     1 
ATOM   1896 C  CA    . VAL A 1 254 ? -29.028 19.929 4.547   1.00 23.58 ? 251 VAL A CA    1 
ATOM   1897 C  C     . VAL A 1 254 ? -29.605 18.518 4.478   1.00 25.01 ? 251 VAL A C     1 
ATOM   1898 O  O     . VAL A 1 254 ? -30.459 18.144 5.287   1.00 25.97 ? 251 VAL A O     1 
ATOM   1899 C  CB    . VAL A 1 254 ? -27.730 19.942 5.390   1.00 22.57 ? 251 VAL A CB    1 
ATOM   1900 C  CG1   . VAL A 1 254 ? -27.140 21.341 5.410   1.00 20.66 ? 251 VAL A CG1   1 
ATOM   1901 C  CG2   . VAL A 1 254 ? -27.982 19.427 6.815   1.00 22.38 ? 251 VAL A CG2   1 
ATOM   1902 N  N     . ASP A 1 255 ? -29.142 17.771 3.476   1.00 25.41 ? 252 ASP A N     1 
ATOM   1903 C  CA    . ASP A 1 255 ? -29.510 16.379 3.247   1.00 27.00 ? 252 ASP A CA    1 
ATOM   1904 C  C     . ASP A 1 255 ? -28.523 15.468 3.923   1.00 25.74 ? 252 ASP A C     1 
ATOM   1905 O  O     . ASP A 1 255 ? -28.858 14.342 4.263   1.00 27.40 ? 252 ASP A O     1 
ATOM   1906 C  CB    . ASP A 1 255 ? -29.407 16.024 1.758   1.00 27.89 ? 252 ASP A CB    1 
ATOM   1907 C  CG    . ASP A 1 255 ? -30.323 16.825 0.911   1.00 30.29 ? 252 ASP A CG    1 
ATOM   1908 O  OD1   . ASP A 1 255 ? -31.531 16.564 0.976   1.00 34.95 ? 252 ASP A OD1   1 
ATOM   1909 O  OD2   . ASP A 1 255 ? -29.834 17.701 0.173   1.00 31.31 ? 252 ASP A OD2   1 
ATOM   1910 N  N     . VAL A 1 256 ? -27.283 15.930 4.035   1.00 23.70 ? 253 VAL A N     1 
ATOM   1911 C  CA    . VAL A 1 256 ? -26.180 15.096 4.493   1.00 22.22 ? 253 VAL A CA    1 
ATOM   1912 C  C     . VAL A 1 256 ? -25.295 15.870 5.475   1.00 20.80 ? 253 VAL A C     1 
ATOM   1913 O  O     . VAL A 1 256 ? -24.953 17.033 5.226   1.00 18.87 ? 253 VAL A O     1 
ATOM   1914 C  CB    . VAL A 1 256 ? -25.312 14.611 3.313   1.00 21.54 ? 253 VAL A CB    1 
ATOM   1915 C  CG1   . VAL A 1 256 ? -24.152 13.756 3.815   1.00 21.15 ? 253 VAL A CG1   1 
ATOM   1916 C  CG2   . VAL A 1 256 ? -26.132 13.806 2.329   1.00 22.09 ? 253 VAL A CG2   1 
ATOM   1917 N  N     . VAL A 1 257 ? -24.968 15.221 6.597   1.00 20.23 ? 254 VAL A N     1 
ATOM   1918 C  CA    . VAL A 1 257 ? -23.961 15.714 7.534   1.00 19.01 ? 254 VAL A CA    1 
ATOM   1919 C  C     . VAL A 1 257 ? -22.804 14.729 7.593   1.00 17.78 ? 254 VAL A C     1 
ATOM   1920 O  O     . VAL A 1 257 ? -22.995 13.526 7.839   1.00 17.88 ? 254 VAL A O     1 
ATOM   1921 C  CB    . VAL A 1 257 ? -24.535 15.935 8.968   1.00 20.48 ? 254 VAL A CB    1 
ATOM   1922 C  CG1   . VAL A 1 257 ? -23.416 16.362 9.939   1.00 18.83 ? 254 VAL A CG1   1 
ATOM   1923 C  CG2   . VAL A 1 257 ? -25.687 16.975 8.948   1.00 19.80 ? 254 VAL A CG2   1 
ATOM   1924 N  N     . ILE A 1 258 ? -21.606 15.249 7.332   1.00 16.24 ? 255 ILE A N     1 
ATOM   1925 C  CA    . ILE A 1 258 ? -20.371 14.489 7.454   1.00 15.20 ? 255 ILE A CA    1 
ATOM   1926 C  C     . ILE A 1 258 ? -19.670 14.958 8.716   1.00 14.85 ? 255 ILE A C     1 
ATOM   1927 O  O     . ILE A 1 258 ? -19.287 16.130 8.837   1.00 14.05 ? 255 ILE A O     1 
ATOM   1928 C  CB    . ILE A 1 258 ? -19.427 14.702 6.239   1.00 14.54 ? 255 ILE A CB    1 
ATOM   1929 C  CG1   . ILE A 1 258 ? -20.115 14.340 4.922   1.00 15.49 ? 255 ILE A CG1   1 
ATOM   1930 C  CG2   . ILE A 1 258 ? -18.128 13.909 6.417   1.00 12.65 ? 255 ILE A CG2   1 
ATOM   1931 C  CD1   . ILE A 1 258 ? -20.862 13.028 4.925   1.00 16.77 ? 255 ILE A CD1   1 
ATOM   1932 N  N     . VAL A 1 259 ? -19.513 14.042 9.658   1.00 15.56 ? 256 VAL A N     1 
ATOM   1933 C  CA    . VAL A 1 259 ? -18.787 14.313 10.888  1.00 15.69 ? 256 VAL A CA    1 
ATOM   1934 C  C     . VAL A 1 259 ? -17.400 13.698 10.757  1.00 15.99 ? 256 VAL A C     1 
ATOM   1935 O  O     . VAL A 1 259 ? -17.271 12.499 10.506  1.00 16.66 ? 256 VAL A O     1 
ATOM   1936 C  CB    . VAL A 1 259 ? -19.483 13.707 12.123  1.00 16.98 ? 256 VAL A CB    1 
ATOM   1937 C  CG1   . VAL A 1 259 ? -18.757 14.119 13.393  1.00 16.22 ? 256 VAL A CG1   1 
ATOM   1938 C  CG2   . VAL A 1 259 ? -20.942 14.118 12.186  1.00 16.96 ? 256 VAL A CG2   1 
ATOM   1939 N  N     . LEU A 1 260 ? -16.388 14.538 10.938  1.00 15.82 ? 257 LEU A N     1 
ATOM   1940 C  CA    A LEU A 1 260 ? -14.989 14.122 10.883  0.50 16.14 ? 257 LEU A CA    1 
ATOM   1941 C  CA    B LEU A 1 260 ? -14.991 14.140 10.882  0.50 15.98 ? 257 LEU A CA    1 
ATOM   1942 C  C     . LEU A 1 260 ? -14.390 14.005 12.279  1.00 17.10 ? 257 LEU A C     1 
ATOM   1943 O  O     . LEU A 1 260 ? -14.181 15.000 12.953  1.00 17.57 ? 257 LEU A O     1 
ATOM   1944 C  CB    A LEU A 1 260 ? -14.141 15.121 10.091  0.50 15.44 ? 257 LEU A CB    1 
ATOM   1945 C  CB    B LEU A 1 260 ? -14.189 15.194 10.118  0.50 15.12 ? 257 LEU A CB    1 
ATOM   1946 C  CG    A LEU A 1 260 ? -14.353 15.243 8.585   0.50 15.18 ? 257 LEU A CG    1 
ATOM   1947 C  CG    B LEU A 1 260 ? -14.225 15.131 8.596   0.50 14.39 ? 257 LEU A CG    1 
ATOM   1948 C  CD1   A LEU A 1 260 ? -15.486 16.191 8.323   0.50 15.35 ? 257 LEU A CD1   1 
ATOM   1949 C  CD1   B LEU A 1 260 ? -14.128 16.537 8.011   0.50 13.07 ? 257 LEU A CD1   1 
ATOM   1950 C  CD2   A LEU A 1 260 ? -13.081 15.750 7.906   0.50 14.82 ? 257 LEU A CD2   1 
ATOM   1951 C  CD2   B LEU A 1 260 ? -13.087 14.253 8.117   0.50 13.23 ? 257 LEU A CD2   1 
ATOM   1952 N  N     . ASP A 1 261 ? -14.106 12.778 12.691  1.00 18.29 ? 258 ASP A N     1 
ATOM   1953 C  CA    . ASP A 1 261 ? -13.332 12.504 13.888  1.00 19.88 ? 258 ASP A CA    1 
ATOM   1954 C  C     . ASP A 1 261 ? -13.929 13.087 15.154  1.00 20.79 ? 258 ASP A C     1 
ATOM   1955 O  O     . ASP A 1 261 ? -13.257 13.794 15.900  1.00 21.33 ? 258 ASP A O     1 
ATOM   1956 C  CB    . ASP A 1 261 ? -11.874 12.979 13.693  1.00 20.12 ? 258 ASP A CB    1 
ATOM   1957 C  CG    . ASP A 1 261 ? -10.944 12.505 14.800  1.00 21.55 ? 258 ASP A CG    1 
ATOM   1958 O  OD1   . ASP A 1 261 ? -11.207 11.449 15.418  1.00 24.23 ? 258 ASP A OD1   1 
ATOM   1959 O  OD2   . ASP A 1 261 ? -9.962  13.209 15.078  1.00 23.37 ? 258 ASP A OD2   1 
ATOM   1960 N  N     . HIS A 1 262 ? -15.205 12.800 15.386  1.00 21.28 ? 259 HIS A N     1 
ATOM   1961 C  CA    . HIS A 1 262 ? -15.830 13.100 16.665  1.00 22.61 ? 259 HIS A CA    1 
ATOM   1962 C  C     . HIS A 1 262 ? -17.050 12.180 16.842  1.00 23.36 ? 259 HIS A C     1 
ATOM   1963 O  O     . HIS A 1 262 ? -18.160 12.490 16.381  1.00 22.42 ? 259 HIS A O     1 
ATOM   1964 C  CB    . HIS A 1 262 ? -16.214 14.585 16.738  1.00 22.25 ? 259 HIS A CB    1 
ATOM   1965 C  CG    . HIS A 1 262 ? -16.272 15.130 18.137  1.00 24.22 ? 259 HIS A CG    1 
ATOM   1966 N  ND1   . HIS A 1 262 ? -17.099 14.607 19.108  1.00 25.40 ? 259 HIS A ND1   1 
ATOM   1967 C  CD2   . HIS A 1 262 ? -15.609 16.157 18.723  1.00 24.72 ? 259 HIS A CD2   1 
ATOM   1968 C  CE1   . HIS A 1 262 ? -16.942 15.290 20.229  1.00 26.72 ? 259 HIS A CE1   1 
ATOM   1969 N  NE2   . HIS A 1 262 ? -16.043 16.235 20.023  1.00 25.03 ? 259 HIS A NE2   1 
ATOM   1970 N  N     . GLU A 1 263 ? -16.835 11.045 17.497  1.00 24.37 ? 260 GLU A N     1 
ATOM   1971 C  CA    A GLU A 1 263 ? -17.883 10.037 17.591  0.50 25.75 ? 260 GLU A CA    1 
ATOM   1972 C  CA    B GLU A 1 263 ? -17.875 10.018 17.619  0.50 25.66 ? 260 GLU A CA    1 
ATOM   1973 C  C     . GLU A 1 263 ? -19.029 10.464 18.516  1.00 26.71 ? 260 GLU A C     1 
ATOM   1974 O  O     . GLU A 1 263 ? -20.164 10.107 18.274  1.00 27.12 ? 260 GLU A O     1 
ATOM   1975 C  CB    A GLU A 1 263 ? -17.294 8.665  17.950  0.50 27.15 ? 260 GLU A CB    1 
ATOM   1976 C  CB    B GLU A 1 263 ? -17.289 8.689  18.117  0.50 27.09 ? 260 GLU A CB    1 
ATOM   1977 C  CG    A GLU A 1 263 ? -16.843 7.900  16.699  0.50 26.69 ? 260 GLU A CG    1 
ATOM   1978 C  CG    B GLU A 1 263 ? -16.456 7.931  17.074  0.50 26.18 ? 260 GLU A CG    1 
ATOM   1979 C  CD    A GLU A 1 263 ? -15.648 6.987  16.927  0.50 28.45 ? 260 GLU A CD    1 
ATOM   1980 C  CD    B GLU A 1 263 ? -17.297 7.082  16.114  0.50 26.80 ? 260 GLU A CD    1 
ATOM   1981 O  OE1   A GLU A 1 263 ? -15.214 6.859  18.089  0.50 30.47 ? 260 GLU A OE1   1 
ATOM   1982 O  OE1   B GLU A 1 263 ? -18.542 7.175  16.154  0.50 26.29 ? 260 GLU A OE1   1 
ATOM   1983 O  OE2   A GLU A 1 263 ? -15.137 6.400  15.935  0.50 28.25 ? 260 GLU A OE2   1 
ATOM   1984 O  OE2   B GLU A 1 263 ? -16.702 6.316  15.311  0.50 27.27 ? 260 GLU A OE2   1 
ATOM   1985 N  N     . ARG A 1 264 ? -18.738 11.262 19.545  1.00 27.43 ? 261 ARG A N     1 
ATOM   1986 C  CA    . ARG A 1 264 ? -19.783 11.798 20.416  1.00 28.66 ? 261 ARG A CA    1 
ATOM   1987 C  C     . ARG A 1 264 ? -20.681 12.795 19.663  1.00 27.78 ? 261 ARG A C     1 
ATOM   1988 O  O     . ARG A 1 264 ? -21.901 12.732 19.775  1.00 29.65 ? 261 ARG A O     1 
ATOM   1989 C  CB    . ARG A 1 264 ? -19.177 12.473 21.646  1.00 29.92 ? 261 ARG A CB    1 
ATOM   1990 C  CG    . ARG A 1 264 ? -20.209 12.911 22.722  1.00 32.58 ? 261 ARG A CG    1 
ATOM   1991 C  CD    . ARG A 1 264 ? -19.674 14.048 23.601  1.00 33.99 ? 261 ARG A CD    1 
ATOM   1992 N  NE    . ARG A 1 264 ? -19.672 15.346 22.907  1.00 34.07 ? 261 ARG A NE    1 
ATOM   1993 C  CZ    . ARG A 1 264 ? -18.742 16.297 23.042  1.00 33.62 ? 261 ARG A CZ    1 
ATOM   1994 N  NH1   . ARG A 1 264 ? -17.679 16.127 23.832  1.00 36.19 ? 261 ARG A NH1   1 
ATOM   1995 N  NH2   . ARG A 1 264 ? -18.860 17.426 22.366  1.00 31.85 ? 261 ARG A NH2   1 
ATOM   1996 N  N     . LEU A 1 265 ? -20.080 13.711 18.918  1.00 25.57 ? 262 LEU A N     1 
ATOM   1997 C  CA    . LEU A 1 265 ? -20.827 14.650 18.068  1.00 25.11 ? 262 LEU A CA    1 
ATOM   1998 C  C     . LEU A 1 265 ? -21.746 13.896 17.095  1.00 25.21 ? 262 LEU A C     1 
ATOM   1999 O  O     . LEU A 1 265 ? -22.919 14.216 16.950  1.00 25.84 ? 262 LEU A O     1 
ATOM   2000 C  CB    . LEU A 1 265 ? -19.854 15.527 17.266  1.00 23.21 ? 262 LEU A CB    1 
ATOM   2001 C  CG    . LEU A 1 265 ? -20.445 16.676 16.457  1.00 22.83 ? 262 LEU A CG    1 
ATOM   2002 C  CD1   . LEU A 1 265 ? -21.206 17.602 17.402  1.00 23.62 ? 262 LEU A CD1   1 
ATOM   2003 C  CD2   . LEU A 1 265 ? -19.368 17.442 15.731  1.00 20.25 ? 262 LEU A CD2   1 
ATOM   2004 N  N     . TYR A 1 266 ? -21.174 12.899 16.431  1.00 24.61 ? 263 TYR A N     1 
ATOM   2005 C  CA    . TYR A 1 266 ? -21.915 11.974 15.611  1.00 24.87 ? 263 TYR A CA    1 
ATOM   2006 C  C     . TYR A 1 266 ? -23.111 11.372 16.335  1.00 26.29 ? 263 TYR A C     1 
ATOM   2007 O  O     . TYR A 1 266 ? -24.210 11.387 15.790  1.00 26.36 ? 263 TYR A O     1 
ATOM   2008 C  CB    . TYR A 1 266 ? -20.993 10.837 15.178  1.00 24.78 ? 263 TYR A CB    1 
ATOM   2009 C  CG    . TYR A 1 266 ? -21.645 9.767  14.349  1.00 25.03 ? 263 TYR A CG    1 
ATOM   2010 C  CD1   . TYR A 1 266 ? -22.019 10.015 13.031  1.00 25.01 ? 263 TYR A CD1   1 
ATOM   2011 C  CD2   . TYR A 1 266 ? -21.860 8.500  14.867  1.00 27.31 ? 263 TYR A CD2   1 
ATOM   2012 C  CE1   . TYR A 1 266 ? -22.597 9.025  12.256  1.00 26.18 ? 263 TYR A CE1   1 
ATOM   2013 C  CE2   . TYR A 1 266 ? -22.440 7.502  14.103  1.00 28.74 ? 263 TYR A CE2   1 
ATOM   2014 C  CZ    . TYR A 1 266 ? -22.800 7.772  12.793  1.00 26.95 ? 263 TYR A CZ    1 
ATOM   2015 O  OH    . TYR A 1 266 ? -23.365 6.794  12.029  1.00 28.26 ? 263 TYR A OH    1 
ATOM   2016 N  N     . SER A 1 267 ? -22.880 10.825 17.529  1.00 27.26 ? 264 SER A N     1 
ATOM   2017 C  CA    A SER A 1 267 ? -23.945 10.167 18.284  0.50 29.25 ? 264 SER A CA    1 
ATOM   2018 C  CA    B SER A 1 267 ? -23.934 10.169 18.320  0.50 29.50 ? 264 SER A CA    1 
ATOM   2019 C  C     . SER A 1 267 ? -25.062 11.136 18.663  1.00 30.13 ? 264 SER A C     1 
ATOM   2020 O  O     . SER A 1 267 ? -26.236 10.809 18.509  1.00 31.19 ? 264 SER A O     1 
ATOM   2021 C  CB    A SER A 1 267 ? -23.399 9.508  19.548  0.50 30.68 ? 264 SER A CB    1 
ATOM   2022 C  CB    B SER A 1 267 ? -23.375 9.599  19.634  0.50 30.95 ? 264 SER A CB    1 
ATOM   2023 O  OG    A SER A 1 267 ? -24.407 8.739  20.172  0.50 31.65 ? 264 SER A OG    1 
ATOM   2024 O  OG    B SER A 1 267 ? -22.443 8.552  19.419  0.50 30.95 ? 264 SER A OG    1 
ATOM   2025 N  N     . ASP A 1 268 ? -24.691 12.318 19.152  1.00 29.50 ? 265 ASP A N     1 
ATOM   2026 C  CA    . ASP A 1 268 ? -25.669 13.345 19.507  1.00 30.55 ? 265 ASP A CA    1 
ATOM   2027 C  C     . ASP A 1 268 ? -26.445 13.817 18.271  1.00 30.25 ? 265 ASP A C     1 
ATOM   2028 O  O     . ASP A 1 268 ? -27.669 13.911 18.300  1.00 31.34 ? 265 ASP A O     1 
ATOM   2029 C  CB    . ASP A 1 268 ? -24.994 14.552 20.169  1.00 30.10 ? 265 ASP A CB    1 
ATOM   2030 C  CG    . ASP A 1 268 ? -24.417 14.238 21.543  1.00 31.24 ? 265 ASP A CG    1 
ATOM   2031 O  OD1   . ASP A 1 268 ? -24.699 13.154 22.087  1.00 34.99 ? 265 ASP A OD1   1 
ATOM   2032 O  OD2   . ASP A 1 268 ? -23.686 15.095 22.094  1.00 31.22 ? 265 ASP A OD2   1 
ATOM   2033 N  N     . LEU A 1 269 ? -25.744 14.114 17.184  1.00 28.85 ? 266 LEU A N     1 
ATOM   2034 C  CA    . LEU A 1 269 ? -26.432 14.536 15.968  1.00 28.94 ? 266 LEU A CA    1 
ATOM   2035 C  C     . LEU A 1 269 ? -27.383 13.446 15.445  1.00 30.74 ? 266 LEU A C     1 
ATOM   2036 O  O     . LEU A 1 269 ? -28.481 13.754 14.982  1.00 31.62 ? 266 LEU A O     1 
ATOM   2037 C  CB    . LEU A 1 269 ? -25.448 14.952 14.872  1.00 26.98 ? 266 LEU A CB    1 
ATOM   2038 C  CG    . LEU A 1 269 ? -24.727 16.295 14.987  1.00 25.68 ? 266 LEU A CG    1 
ATOM   2039 C  CD1   . LEU A 1 269 ? -23.840 16.484 13.763  1.00 24.07 ? 266 LEU A CD1   1 
ATOM   2040 C  CD2   . LEU A 1 269 ? -25.682 17.475 15.136  1.00 25.06 ? 266 LEU A CD2   1 
ATOM   2041 N  N     . SER A 1 270 ? -26.977 12.183 15.545  1.00 31.91 ? 267 SER A N     1 
ATOM   2042 C  CA    . SER A 1 270 ? -27.818 11.074 15.095  1.00 34.03 ? 267 SER A CA    1 
ATOM   2043 C  C     . SER A 1 270 ? -29.171 11.078 15.809  1.00 37.03 ? 267 SER A C     1 
ATOM   2044 O  O     . SER A 1 270 ? -30.191 10.793 15.194  1.00 38.14 ? 267 SER A O     1 
ATOM   2045 C  CB    . SER A 1 270 ? -27.123 9.716  15.288  1.00 34.36 ? 267 SER A CB    1 
ATOM   2046 O  OG    . SER A 1 270 ? -27.421 9.129  16.561  1.00 37.20 ? 267 SER A OG    1 
ATOM   2047 N  N     . LYS A 1 271 ? -29.173 11.413 17.098  1.00 38.73 ? 268 LYS A N     1 
ATOM   2048 C  CA    . LYS A 1 271 ? -30.401 11.422 17.888  1.00 41.91 ? 268 LYS A CA    1 
ATOM   2049 C  C     . LYS A 1 271 ? -31.263 12.670 17.670  1.00 42.69 ? 268 LYS A C     1 
ATOM   2050 O  O     . LYS A 1 271 ? -32.453 12.636 17.948  1.00 44.97 ? 268 LYS A O     1 
ATOM   2051 C  CB    . LYS A 1 271 ? -30.079 11.276 19.380  1.00 43.14 ? 268 LYS A CB    1 
ATOM   2052 C  CG    . LYS A 1 271 ? -29.382 9.970  19.715  1.00 44.64 ? 268 LYS A CG    1 
ATOM   2053 C  CD    . LYS A 1 271 ? -29.177 9.771  21.209  1.00 47.54 ? 268 LYS A CD    1 
ATOM   2054 C  CE    . LYS A 1 271 ? -28.235 8.591  21.461  1.00 48.91 ? 268 LYS A CE    1 
ATOM   2055 N  NZ    . LYS A 1 271 ? -28.123 8.266  22.909  1.00 52.45 ? 268 LYS A NZ    1 
ATOM   2056 N  N     . GLU A 1 272 ? -30.680 13.765 17.187  1.00 41.43 ? 269 GLU A N     1 
ATOM   2057 C  CA    . GLU A 1 272 ? -31.409 15.035 17.122  1.00 42.36 ? 269 GLU A CA    1 
ATOM   2058 C  C     . GLU A 1 272 ? -31.838 15.463 15.723  1.00 41.38 ? 269 GLU A C     1 
ATOM   2059 O  O     . GLU A 1 272 ? -32.896 16.061 15.568  1.00 42.42 ? 269 GLU A O     1 
ATOM   2060 C  CB    . GLU A 1 272 ? -30.595 16.161 17.753  1.00 41.59 ? 269 GLU A CB    1 
ATOM   2061 C  CG    . GLU A 1 272 ? -31.463 17.368 18.101  1.00 44.41 ? 269 GLU A CG    1 
ATOM   2062 C  CD    . GLU A 1 272 ? -30.688 18.481 18.751  1.00 45.85 ? 269 GLU A CD    1 
ATOM   2063 O  OE1   . GLU A 1 272 ? -31.131 19.651 18.656  1.00 47.29 ? 269 GLU A OE1   1 
ATOM   2064 O  OE2   . GLU A 1 272 ? -29.639 18.185 19.360  1.00 46.97 ? 269 GLU A OE2   1 
ATOM   2065 N  N     . LEU A 1 273 ? -31.025 15.173 14.714  1.00 39.57 ? 270 LEU A N     1 
ATOM   2066 C  CA    . LEU A 1 273 ? -31.315 15.656 13.369  1.00 38.93 ? 270 LEU A CA    1 
ATOM   2067 C  C     . LEU A 1 273 ? -32.577 15.001 12.827  1.00 40.64 ? 270 LEU A C     1 
ATOM   2068 O  O     . LEU A 1 273 ? -32.879 13.871 13.202  1.00 41.69 ? 270 LEU A O     1 
ATOM   2069 C  CB    . LEU A 1 273 ? -30.159 15.354 12.431  1.00 37.02 ? 270 LEU A CB    1 
ATOM   2070 C  CG    . LEU A 1 273 ? -28.865 16.130 12.639  1.00 36.36 ? 270 LEU A CG    1 
ATOM   2071 C  CD1   . LEU A 1 273 ? -27.799 15.594 11.686  1.00 35.53 ? 270 LEU A CD1   1 
ATOM   2072 C  CD2   . LEU A 1 273 ? -29.061 17.624 12.433  1.00 37.24 ? 270 LEU A CD2   1 
ATOM   2073 N  N     . PRO A 1 274 ? -33.307 15.693 11.923  1.00 40.89 ? 271 PRO A N     1 
ATOM   2074 C  CA    . PRO A 1 274 ? -34.473 15.039 11.339  1.00 42.88 ? 271 PRO A CA    1 
ATOM   2075 C  C     . PRO A 1 274 ? -34.099 13.715 10.676  1.00 42.58 ? 271 PRO A C     1 
ATOM   2076 O  O     . PRO A 1 274 ? -32.955 13.516 10.262  1.00 40.41 ? 271 PRO A O     1 
ATOM   2077 C  CB    . PRO A 1 274 ? -34.977 16.054 10.303  1.00 42.73 ? 271 PRO A CB    1 
ATOM   2078 C  CG    . PRO A 1 274 ? -34.437 17.359 10.753  1.00 41.59 ? 271 PRO A CG    1 
ATOM   2079 C  CD    . PRO A 1 274 ? -33.096 17.030 11.342  1.00 39.73 ? 271 PRO A CD    1 
ATOM   2080 N  N     . GLU A 1 275 ? -35.075 12.820 10.595  1.00 44.90 ? 272 GLU A N     1 
ATOM   2081 C  CA    . GLU A 1 275 ? -34.848 11.450 10.158  1.00 45.15 ? 272 GLU A CA    1 
ATOM   2082 C  C     . GLU A 1 275 ? -34.362 11.363 8.713   1.00 43.29 ? 272 GLU A C     1 
ATOM   2083 O  O     . GLU A 1 275 ? -33.618 10.444 8.369   1.00 42.45 ? 272 GLU A O     1 
ATOM   2084 C  CB    . GLU A 1 275 ? -36.133 10.646 10.347  1.00 48.45 ? 272 GLU A CB    1 
ATOM   2085 C  CG    . GLU A 1 275 ? -36.029 9.173  10.015  1.00 50.58 ? 272 GLU A CG    1 
ATOM   2086 C  CD    . GLU A 1 275 ? -37.279 8.407  10.412  1.00 56.58 ? 272 GLU A CD    1 
ATOM   2087 O  OE1   . GLU A 1 275 ? -38.167 8.994  11.085  1.00 59.32 ? 272 GLU A OE1   1 
ATOM   2088 O  OE2   . GLU A 1 275 ? -37.375 7.211  10.053  1.00 59.59 ? 272 GLU A OE2   1 
ATOM   2089 N  N     . PHE A 1 276 ? -34.766 12.318 7.879   1.00 42.64 ? 273 PHE A N     1 
ATOM   2090 C  CA    . PHE A 1 276 ? -34.362 12.327 6.473   1.00 41.41 ? 273 PHE A CA    1 
ATOM   2091 C  C     . PHE A 1 276 ? -32.880 12.712 6.258   1.00 38.00 ? 273 PHE A C     1 
ATOM   2092 O  O     . PHE A 1 276 ? -32.336 12.517 5.168   1.00 36.82 ? 273 PHE A O     1 
ATOM   2093 C  CB    . PHE A 1 276 ? -35.290 13.232 5.640   1.00 42.91 ? 273 PHE A CB    1 
ATOM   2094 C  CG    . PHE A 1 276 ? -35.002 14.716 5.764   1.00 42.85 ? 273 PHE A CG    1 
ATOM   2095 C  CD1   . PHE A 1 276 ? -35.599 15.474 6.760   1.00 45.56 ? 273 PHE A CD1   1 
ATOM   2096 C  CD2   . PHE A 1 276 ? -34.159 15.359 4.852   1.00 43.95 ? 273 PHE A CD2   1 
ATOM   2097 C  CE1   . PHE A 1 276 ? -35.347 16.849 6.864   1.00 45.12 ? 273 PHE A CE1   1 
ATOM   2098 C  CE2   . PHE A 1 276 ? -33.895 16.738 4.955   1.00 42.46 ? 273 PHE A CE2   1 
ATOM   2099 C  CZ    . PHE A 1 276 ? -34.496 17.475 5.962   1.00 43.14 ? 273 PHE A CZ    1 
ATOM   2100 N  N     . VAL A 1 277 ? -32.226 13.259 7.279   1.00 35.90 ? 274 VAL A N     1 
ATOM   2101 C  CA    . VAL A 1 277 ? -30.842 13.671 7.120   1.00 33.08 ? 274 VAL A CA    1 
ATOM   2102 C  C     . VAL A 1 277 ? -29.920 12.460 7.247   1.00 32.24 ? 274 VAL A C     1 
ATOM   2103 O  O     . VAL A 1 277 ? -29.967 11.735 8.235   1.00 32.48 ? 274 VAL A O     1 
ATOM   2104 C  CB    . VAL A 1 277 ? -30.443 14.760 8.123   1.00 32.21 ? 274 VAL A CB    1 
ATOM   2105 C  CG1   . VAL A 1 277 ? -28.973 15.140 7.920   1.00 30.00 ? 274 VAL A CG1   1 
ATOM   2106 C  CG2   . VAL A 1 277 ? -31.348 15.977 7.973   1.00 31.28 ? 274 VAL A CG2   1 
ATOM   2107 N  N     . ARG A 1 278 ? -29.102 12.242 6.223   1.00 30.65 ? 275 ARG A N     1 
ATOM   2108 C  CA    . ARG A 1 278 ? -28.117 11.168 6.242   1.00 30.18 ? 275 ARG A CA    1 
ATOM   2109 C  C     . ARG A 1 278 ? -26.815 11.629 6.908   1.00 27.30 ? 275 ARG A C     1 
ATOM   2110 O  O     . ARG A 1 278 ? -26.228 12.611 6.504   1.00 26.25 ? 275 ARG A O     1 
ATOM   2111 C  CB    . ARG A 1 278 ? -27.834 10.692 4.824   1.00 30.46 ? 275 ARG A CB    1 
ATOM   2112 C  CG    . ARG A 1 278 ? -26.734 9.668  4.749   1.00 32.68 ? 275 ARG A CG    1 
ATOM   2113 C  CD    . ARG A 1 278 ? -26.796 8.870  3.467   1.00 37.11 ? 275 ARG A CD    1 
ATOM   2114 N  NE    . ARG A 1 278 ? -25.447 8.649  2.940   1.00 38.03 ? 275 ARG A NE    1 
ATOM   2115 C  CZ    . ARG A 1 278 ? -25.015 7.514  2.397   1.00 40.79 ? 275 ARG A CZ    1 
ATOM   2116 N  NH1   . ARG A 1 278 ? -25.809 6.441  2.310   1.00 42.95 ? 275 ARG A NH1   1 
ATOM   2117 N  NH2   . ARG A 1 278 ? -23.762 7.448  1.949   1.00 41.50 ? 275 ARG A NH2   1 
ATOM   2118 N  N     . LEU A 1 279 ? -26.380 10.890 7.920   1.00 26.66 ? 276 LEU A N     1 
ATOM   2119 C  CA    A LEU A 1 279 ? -25.214 11.234 8.715   0.50 24.89 ? 276 LEU A CA    1 
ATOM   2120 C  CA    B LEU A 1 279 ? -25.196 11.242 8.692   0.50 24.96 ? 276 LEU A CA    1 
ATOM   2121 C  C     . LEU A 1 279 ? -24.121 10.192 8.512   1.00 24.22 ? 276 LEU A C     1 
ATOM   2122 O  O     . LEU A 1 279 ? -24.377 8.996  8.651   1.00 25.20 ? 276 LEU A O     1 
ATOM   2123 C  CB    A LEU A 1 279 ? -25.618 11.275 10.185  0.50 25.74 ? 276 LEU A CB    1 
ATOM   2124 C  CB    B LEU A 1 279 ? -25.518 11.368 10.179  0.50 25.78 ? 276 LEU A CB    1 
ATOM   2125 C  CG    A LEU A 1 279 ? -24.598 11.702 11.236  0.50 24.46 ? 276 LEU A CG    1 
ATOM   2126 C  CG    B LEU A 1 279 ? -26.244 12.633 10.629  0.50 25.88 ? 276 LEU A CG    1 
ATOM   2127 C  CD1   A LEU A 1 279 ? -24.418 13.207 11.243  0.50 21.88 ? 276 LEU A CD1   1 
ATOM   2128 C  CD1   B LEU A 1 279 ? -27.699 12.322 10.917  0.50 27.79 ? 276 LEU A CD1   1 
ATOM   2129 C  CD2   A LEU A 1 279 ? -25.068 11.205 12.593  0.50 25.43 ? 276 LEU A CD2   1 
ATOM   2130 C  CD2   B LEU A 1 279 ? -25.569 13.190 11.863  0.50 24.89 ? 276 LEU A CD2   1 
ATOM   2131 N  N     . THR A 1 280 ? -22.910 10.650 8.212   1.00 22.14 ? 277 THR A N     1 
ATOM   2132 C  CA    . THR A 1 280 ? -21.790 9.759  7.982   1.00 21.12 ? 277 THR A CA    1 
ATOM   2133 C  C     . THR A 1 280 ? -20.599 10.183 8.819   1.00 19.92 ? 277 THR A C     1 
ATOM   2134 O  O     . THR A 1 280 ? -20.200 11.334 8.788   1.00 18.80 ? 277 THR A O     1 
ATOM   2135 C  CB    . THR A 1 280 ? -21.397 9.741  6.510   1.00 20.57 ? 277 THR A CB    1 
ATOM   2136 O  OG1   . THR A 1 280 ? -22.520 9.300  5.729   1.00 21.40 ? 277 THR A OG1   1 
ATOM   2137 C  CG2   . THR A 1 280 ? -20.200 8.816  6.289   1.00 19.42 ? 277 THR A CG2   1 
ATOM   2138 N  N     . HIS A 1 281 ? -20.069 9.247  9.595   1.00 20.45 ? 278 HIS A N     1 
ATOM   2139 C  CA    . HIS A 1 281 ? -18.868 9.475  10.351  1.00 19.78 ? 278 HIS A CA    1 
ATOM   2140 C  C     . HIS A 1 281 ? -17.689 8.959  9.555   1.00 18.98 ? 278 HIS A C     1 
ATOM   2141 O  O     . HIS A 1 281 ? -17.672 7.796  9.143   1.00 18.95 ? 278 HIS A O     1 
ATOM   2142 C  CB    . HIS A 1 281 ? -18.898 8.786  11.713  1.00 21.50 ? 278 HIS A CB    1 
ATOM   2143 C  CG    . HIS A 1 281 ? -17.793 9.239  12.606  1.00 22.63 ? 278 HIS A CG    1 
ATOM   2144 N  ND1   . HIS A 1 281 ? -16.538 8.676  12.571  1.00 24.46 ? 278 HIS A ND1   1 
ATOM   2145 C  CD2   . HIS A 1 281 ? -17.719 10.274 13.476  1.00 24.31 ? 278 HIS A CD2   1 
ATOM   2146 C  CE1   . HIS A 1 281 ? -15.752 9.315  13.419  1.00 26.11 ? 278 HIS A CE1   1 
ATOM   2147 N  NE2   . HIS A 1 281 ? -16.444 10.287 13.983  1.00 24.03 ? 278 HIS A NE2   1 
ATOM   2148 N  N     . VAL A 1 282 ? -16.705 9.839  9.355   1.00 18.14 ? 279 VAL A N     1 
ATOM   2149 C  CA    . VAL A 1 282 ? -15.470 9.509  8.662   1.00 17.69 ? 279 VAL A CA    1 
ATOM   2150 C  C     . VAL A 1 282 ? -14.280 9.957  9.500   1.00 17.86 ? 279 VAL A C     1 
ATOM   2151 O  O     . VAL A 1 282 ? -14.365 10.933 10.258  1.00 18.04 ? 279 VAL A O     1 
ATOM   2152 C  CB    . VAL A 1 282 ? -15.399 10.216 7.294   1.00 17.20 ? 279 VAL A CB    1 
ATOM   2153 C  CG1   . VAL A 1 282 ? -16.719 10.040 6.529   1.00 16.48 ? 279 VAL A CG1   1 
ATOM   2154 C  CG2   . VAL A 1 282 ? -15.092 11.663 7.490   1.00 16.09 ? 279 VAL A CG2   1 
ATOM   2155 N  N     . PRO A 1 283 ? -13.159 9.248  9.380   1.00 18.16 ? 280 PRO A N     1 
ATOM   2156 C  CA    . PRO A 1 283 ? -11.965 9.640  10.117  1.00 18.12 ? 280 PRO A CA    1 
ATOM   2157 C  C     . PRO A 1 283 ? -11.250 10.830 9.464   1.00 17.18 ? 280 PRO A C     1 
ATOM   2158 O  O     . PRO A 1 283 ? -11.409 11.064 8.265   1.00 16.97 ? 280 PRO A O     1 
ATOM   2159 C  CB    . PRO A 1 283 ? -11.094 8.392  10.053  1.00 19.26 ? 280 PRO A CB    1 
ATOM   2160 C  CG    . PRO A 1 283 ? -11.561 7.647  8.798   1.00 19.45 ? 280 PRO A CG    1 
ATOM   2161 C  CD    . PRO A 1 283 ? -12.943 8.082  8.501   1.00 18.88 ? 280 PRO A CD    1 
ATOM   2162 N  N     . LYS A 1 284 ? -10.471 11.572 10.248  1.00 16.81 ? 281 LYS A N     1 
ATOM   2163 C  CA    . LYS A 1 284 ? -9.568  12.558 9.686   1.00 16.44 ? 281 LYS A CA    1 
ATOM   2164 C  C     . LYS A 1 284 ? -8.361  11.833 9.093   1.00 16.72 ? 281 LYS A C     1 
ATOM   2165 O  O     . LYS A 1 284 ? -8.032  10.716 9.495   1.00 17.13 ? 281 LYS A O     1 
ATOM   2166 C  CB    . LYS A 1 284 ? -9.120  13.588 10.737  1.00 16.97 ? 281 LYS A CB    1 
ATOM   2167 C  CG    . LYS A 1 284 ? -7.991  13.155 11.627  1.00 18.01 ? 281 LYS A CG    1 
ATOM   2168 C  CD    . LYS A 1 284 ? -7.704  14.209 12.699  1.00 20.83 ? 281 LYS A CD    1 
ATOM   2169 C  CE    . LYS A 1 284 ? -6.598  13.721 13.644  1.00 23.53 ? 281 LYS A CE    1 
ATOM   2170 N  NZ    . LYS A 1 284 ? -6.777  14.249 14.999  1.00 26.80 ? 281 LYS A NZ    1 
ATOM   2171 N  N     . SER A 1 285 ? -7.725  12.480 8.127   1.00 16.58 ? 282 SER A N     1 
ATOM   2172 C  CA    . SER A 1 285 ? -6.503  11.977 7.522   1.00 17.88 ? 282 SER A CA    1 
ATOM   2173 C  C     . SER A 1 285 ? -5.351  12.135 8.501   1.00 19.06 ? 282 SER A C     1 
ATOM   2174 O  O     . SER A 1 285 ? -5.270  13.128 9.233   1.00 18.52 ? 282 SER A O     1 
ATOM   2175 C  CB    . SER A 1 285 ? -6.174  12.765 6.233   1.00 17.36 ? 282 SER A CB    1 
ATOM   2176 O  OG    . SER A 1 285 ? -4.936  12.329 5.653   1.00 18.39 ? 282 SER A OG    1 
ATOM   2177 N  N     . GLY A 1 286 ? -4.446  11.166 8.482   1.00 20.66 ? 283 GLY A N     1 
ATOM   2178 C  CA    . GLY A 1 286 ? -3.210  11.256 9.247   1.00 22.52 ? 283 GLY A CA    1 
ATOM   2179 C  C     . GLY A 1 286 ? -2.306  12.412 8.842   1.00 23.16 ? 283 GLY A C     1 
ATOM   2180 O  O     . GLY A 1 286 ? -1.404  12.768 9.588   1.00 25.18 ? 283 GLY A O     1 
ATOM   2181 N  N     . GLY A 1 287 ? -2.531  12.996 7.668   1.00 22.74 ? 284 GLY A N     1 
ATOM   2182 C  CA    . GLY A 1 287 ? -1.772  14.168 7.233   1.00 23.32 ? 284 GLY A CA    1 
ATOM   2183 C  C     . GLY A 1 287 ? -2.233  15.500 7.804   1.00 23.29 ? 284 GLY A C     1 
ATOM   2184 O  O     . GLY A 1 287 ? -1.523  16.512 7.670   1.00 23.80 ? 284 GLY A O     1 
ATOM   2185 N  N     . VAL A 1 288 ? -3.414  15.530 8.429   1.00 22.80 ? 285 VAL A N     1 
ATOM   2186 C  CA    . VAL A 1 288 ? -3.916  16.776 8.978   1.00 23.10 ? 285 VAL A CA    1 
ATOM   2187 C  C     . VAL A 1 288 ? -2.965  17.185 10.080  1.00 25.41 ? 285 VAL A C     1 
ATOM   2188 O  O     . VAL A 1 288 ? -2.493  16.342 10.826  1.00 26.79 ? 285 VAL A O     1 
ATOM   2189 C  CB    . VAL A 1 288 ? -5.343  16.680 9.564   1.00 22.10 ? 285 VAL A CB    1 
ATOM   2190 C  CG1   . VAL A 1 288 ? -5.739  18.016 10.110  1.00 20.93 ? 285 VAL A CG1   1 
ATOM   2191 C  CG2   . VAL A 1 288 ? -6.350  16.234 8.522   1.00 19.69 ? 285 VAL A CG2   1 
ATOM   2192 N  N     . GLU A 1 289 ? -2.667  18.473 10.166  1.00 27.15 ? 286 GLU A N     1 
ATOM   2193 C  CA    . GLU A 1 289 ? -1.733  18.959 11.170  1.00 30.18 ? 286 GLU A CA    1 
ATOM   2194 C  C     . GLU A 1 289 ? -2.379  19.950 12.132  1.00 29.94 ? 286 GLU A C     1 
ATOM   2195 O  O     . GLU A 1 289 ? -3.143  20.811 11.711  1.00 29.20 ? 286 GLU A O     1 
ATOM   2196 C  CB    . GLU A 1 289 ? -0.494  19.553 10.490  1.00 32.22 ? 286 GLU A CB    1 
ATOM   2197 C  CG    . GLU A 1 289 ? 0.651   18.507 10.284  1.00 36.19 ? 286 GLU A CG    1 
ATOM   2198 C  CD    . GLU A 1 289 ? 1.153   17.890 11.606  1.00 41.83 ? 286 GLU A CD    1 
ATOM   2199 O  OE1   . GLU A 1 289 ? 0.893   18.489 12.680  1.00 43.53 ? 286 GLU A OE1   1 
ATOM   2200 O  OE2   . GLU A 1 289 ? 1.808   16.805 11.574  1.00 45.93 ? 286 GLU A OE2   1 
ATOM   2201 N  N     . GLN A 1 290 ? -2.086  19.786 13.422  1.00 31.12 ? 287 GLN A N     1 
ATOM   2202 C  CA    . GLN A 1 290 ? -2.604  20.669 14.456  1.00 31.68 ? 287 GLN A CA    1 
ATOM   2203 C  C     . GLN A 1 290 ? -1.925  22.037 14.321  1.00 31.90 ? 287 GLN A C     1 
ATOM   2204 O  O     . GLN A 1 290 ? -0.733  22.126 14.036  1.00 32.99 ? 287 GLN A O     1 
ATOM   2205 C  CB    . GLN A 1 290 ? -2.376  20.070 15.868  1.00 33.58 ? 287 GLN A CB    1 
ATOM   2206 C  CG    . GLN A 1 290 ? -0.974  20.343 16.474  1.00 38.01 ? 287 GLN A CG    1 
ATOM   2207 C  CD    . GLN A 1 290 ? -0.625  19.469 17.692  1.00 41.93 ? 287 GLN A CD    1 
ATOM   2208 O  OE1   . GLN A 1 290 ? 0.206   18.560 17.588  1.00 44.42 ? 287 GLN A OE1   1 
ATOM   2209 N  NE2   . GLN A 1 290 ? -1.246  19.754 18.849  1.00 43.69 ? 287 GLN A NE2   1 
ATOM   2210 N  N     . ARG A 1 291 ? -2.691  23.101 14.516  1.00 30.84 ? 288 ARG A N     1 
ATOM   2211 C  CA    . ARG A 1 291 ? -2.168  24.454 14.405  1.00 30.92 ? 288 ARG A CA    1 
ATOM   2212 C  C     . ARG A 1 291 ? -2.453  25.187 15.701  1.00 31.14 ? 288 ARG A C     1 
ATOM   2213 O  O     . ARG A 1 291 ? -3.584  25.192 16.168  1.00 30.05 ? 288 ARG A O     1 
ATOM   2214 C  CB    . ARG A 1 291 ? -2.807  25.180 13.214  1.00 29.55 ? 288 ARG A CB    1 
ATOM   2215 C  CG    . ARG A 1 291 ? -2.486  24.532 11.861  1.00 29.63 ? 288 ARG A CG    1 
ATOM   2216 C  CD    . ARG A 1 291 ? -3.403  25.035 10.769  1.00 29.56 ? 288 ARG A CD    1 
ATOM   2217 N  NE    . ARG A 1 291 ? -4.791  24.663 11.031  1.00 29.48 ? 288 ARG A NE    1 
ATOM   2218 C  CZ    . ARG A 1 291 ? -5.856  25.293 10.537  1.00 30.99 ? 288 ARG A CZ    1 
ATOM   2219 N  NH1   . ARG A 1 291 ? -5.704  26.345 9.733   1.00 33.57 ? 288 ARG A NH1   1 
ATOM   2220 N  NH2   . ARG A 1 291 ? -7.085  24.873 10.848  1.00 28.82 ? 288 ARG A NH2   1 
ATOM   2221 N  N     . THR A 1 292 ? -1.418  25.795 16.271  1.00 32.32 ? 289 THR A N     1 
ATOM   2222 C  CA    . THR A 1 292 ? -1.548  26.589 17.482  1.00 33.31 ? 289 THR A CA    1 
ATOM   2223 C  C     . THR A 1 292 ? -2.283  27.903 17.212  1.00 32.73 ? 289 THR A C     1 
ATOM   2224 O  O     . THR A 1 292 ? -2.467  28.307 16.060  1.00 30.91 ? 289 THR A O     1 
ATOM   2225 C  CB    . THR A 1 292 ? -0.166  26.929 18.067  1.00 35.85 ? 289 THR A CB    1 
ATOM   2226 O  OG1   . THR A 1 292 ? 0.604   27.617 17.076  1.00 35.12 ? 289 THR A OG1   1 
ATOM   2227 C  CG2   . THR A 1 292 ? 0.578   25.657 18.496  1.00 36.07 ? 289 THR A CG2   1 
ATOM   2228 N  N     . GLY A 1 293 ? -2.690  28.575 18.285  1.00 33.69 ? 290 GLY A N     1 
ATOM   2229 C  CA    . GLY A 1 293 ? -3.378  29.859 18.162  1.00 33.71 ? 290 GLY A CA    1 
ATOM   2230 C  C     . GLY A 1 293 ? -2.507  30.930 17.526  1.00 34.74 ? 290 GLY A C     1 
ATOM   2231 O  O     . GLY A 1 293 ? -3.012  31.853 16.897  1.00 34.29 ? 290 GLY A O     1 
ATOM   2232 N  N     . GLN A 1 294 ? -1.194  30.797 17.692  1.00 36.52 ? 291 GLN A N     1 
ATOM   2233 C  CA    . GLN A 1 294 ? -0.232  31.739 17.128  1.00 38.05 ? 291 GLN A CA    1 
ATOM   2234 C  C     . GLN A 1 294 ? -0.204  31.596 15.610  1.00 36.31 ? 291 GLN A C     1 
ATOM   2235 O  O     . GLN A 1 294 ? -0.259  32.590 14.880  1.00 36.37 ? 291 GLN A O     1 
ATOM   2236 C  CB    . GLN A 1 294 ? 1.167   31.474 17.708  1.00 40.69 ? 291 GLN A CB    1 
ATOM   2237 C  CG    . GLN A 1 294 ? 2.015   32.703 17.930  1.00 44.03 ? 291 GLN A CG    1 
ATOM   2238 C  CD    . GLN A 1 294 ? 3.419   32.362 18.431  1.00 48.18 ? 291 GLN A CD    1 
ATOM   2239 O  OE1   . GLN A 1 294 ? 3.930   31.260 18.192  1.00 49.28 ? 291 GLN A OE1   1 
ATOM   2240 N  NE2   . GLN A 1 294 ? 4.049   33.308 19.124  1.00 49.05 ? 291 GLN A NE2   1 
ATOM   2241 N  N     . ILE A 1 295 ? -0.130  30.352 15.147  1.00 34.81 ? 292 ILE A N     1 
ATOM   2242 C  CA    . ILE A 1 295 ? -0.150  30.047 13.716  1.00 33.48 ? 292 ILE A CA    1 
ATOM   2243 C  C     . ILE A 1 295 ? -1.474  30.458 13.054  1.00 31.30 ? 292 ILE A C     1 
ATOM   2244 O  O     . ILE A 1 295 ? -1.484  30.989 11.942  1.00 30.47 ? 292 ILE A O     1 
ATOM   2245 C  CB    . ILE A 1 295 ? 0.110   28.544 13.450  1.00 32.70 ? 292 ILE A CB    1 
ATOM   2246 C  CG1   . ILE A 1 295 ? 1.535   28.161 13.881  1.00 35.98 ? 292 ILE A CG1   1 
ATOM   2247 C  CG2   . ILE A 1 295 ? -0.073  28.228 11.979  1.00 30.28 ? 292 ILE A CG2   1 
ATOM   2248 C  CD1   . ILE A 1 295 ? 1.849   26.647 13.750  1.00 36.87 ? 292 ILE A CD1   1 
ATOM   2249 N  N     . ARG A 1 296 ? -2.579  30.201 13.746  1.00 30.29 ? 293 ARG A N     1 
ATOM   2250 C  CA    . ARG A 1 296 ? -3.910  30.592 13.281  1.00 28.87 ? 293 ARG A CA    1 
ATOM   2251 C  C     . ARG A 1 296 ? -4.071  32.110 13.139  1.00 29.42 ? 293 ARG A C     1 
ATOM   2252 O  O     . ARG A 1 296 ? -4.706  32.579 12.187  1.00 29.03 ? 293 ARG A O     1 
ATOM   2253 C  CB    . ARG A 1 296 ? -4.981  30.038 14.222  1.00 28.25 ? 293 ARG A CB    1 
ATOM   2254 C  CG    . ARG A 1 296 ? -5.136  28.541 14.117  1.00 27.41 ? 293 ARG A CG    1 
ATOM   2255 C  CD    . ARG A 1 296 ? -5.724  27.914 15.373  1.00 27.81 ? 293 ARG A CD    1 
ATOM   2256 N  NE    . ARG A 1 296 ? -6.011  26.507 15.114  1.00 27.14 ? 293 ARG A NE    1 
ATOM   2257 C  CZ    . ARG A 1 296 ? -7.061  26.065 14.425  1.00 25.49 ? 293 ARG A CZ    1 
ATOM   2258 N  NH1   . ARG A 1 296 ? -7.957  26.914 13.942  1.00 24.38 ? 293 ARG A NH1   1 
ATOM   2259 N  NH2   . ARG A 1 296 ? -7.221  24.761 14.218  1.00 25.52 ? 293 ARG A NH2   1 
ATOM   2260 N  N     . SER A 1 297 ? -3.519  32.864 14.087  1.00 30.74 ? 294 SER A N     1 
ATOM   2261 C  CA    A SER A 1 297 ? -3.537  34.323 14.016  0.50 31.72 ? 294 SER A CA    1 
ATOM   2262 C  CA    B SER A 1 297 ? -3.532  34.329 14.018  0.50 31.71 ? 294 SER A CA    1 
ATOM   2263 C  C     . SER A 1 297 ? -2.692  34.811 12.840  1.00 32.27 ? 294 SER A C     1 
ATOM   2264 O  O     . SER A 1 297 ? -3.053  35.765 12.151  1.00 32.46 ? 294 SER A O     1 
ATOM   2265 C  CB    A SER A 1 297 ? -3.029  34.932 15.328  0.50 33.61 ? 294 SER A CB    1 
ATOM   2266 C  CB    B SER A 1 297 ? -2.995  34.951 15.315  0.50 33.62 ? 294 SER A CB    1 
ATOM   2267 O  OG    A SER A 1 297 ? -2.715  36.299 15.161  0.50 34.68 ? 294 SER A OG    1 
ATOM   2268 O  OG    B SER A 1 297 ? -3.713  34.499 16.447  0.50 32.87 ? 294 SER A OG    1 
ATOM   2269 N  N     . LYS A 1 298 ? -1.562  34.156 12.615  1.00 32.92 ? 295 LYS A N     1 
ATOM   2270 C  CA    . LYS A 1 298 ? -0.699  34.524 11.507  1.00 33.94 ? 295 LYS A CA    1 
ATOM   2271 C  C     . LYS A 1 298 ? -1.441  34.277 10.206  1.00 31.46 ? 295 LYS A C     1 
ATOM   2272 O  O     . LYS A 1 298 ? -1.425  35.120 9.309   1.00 31.65 ? 295 LYS A O     1 
ATOM   2273 C  CB    . LYS A 1 298 ? 0.608   33.737 11.545  1.00 35.48 ? 295 LYS A CB    1 
ATOM   2274 C  CG    . LYS A 1 298 ? 1.668   34.217 10.558  1.00 38.77 ? 295 LYS A CG    1 
ATOM   2275 C  CD    . LYS A 1 298 ? 2.750   33.144 10.370  1.00 41.81 ? 295 LYS A CD    1 
ATOM   2276 C  CE    . LYS A 1 298 ? 3.982   33.678 9.654   1.00 45.22 ? 295 LYS A CE    1 
ATOM   2277 N  NZ    . LYS A 1 298 ? 4.940   32.564 9.363   1.00 47.64 ? 295 LYS A NZ    1 
ATOM   2278 N  N     . MET A 1 299 ? -2.123  33.141 10.115  1.00 29.47 ? 296 MET A N     1 
ATOM   2279 C  CA    . MET A 1 299 ? -2.910  32.839 8.918   1.00 27.91 ? 296 MET A CA    1 
ATOM   2280 C  C     . MET A 1 299 ? -4.083  33.817 8.720   1.00 26.76 ? 296 MET A C     1 
ATOM   2281 O  O     . MET A 1 299 ? -4.410  34.138 7.579   1.00 26.05 ? 296 MET A O     1 
ATOM   2282 C  CB    . MET A 1 299 ? -3.400  31.385 8.910   1.00 26.91 ? 296 MET A CB    1 
ATOM   2283 C  CG    . MET A 1 299 ? -2.287  30.351 8.738   1.00 28.45 ? 296 MET A CG    1 
ATOM   2284 S  SD    . MET A 1 299 ? -2.927  28.670 8.902   1.00 31.69 ? 296 MET A SD    1 
ATOM   2285 C  CE    . MET A 1 299 ? -1.418  27.698 8.643   1.00 32.85 ? 296 MET A CE    1 
ATOM   2286 N  N     . ARG A 1 300 ? -4.700  34.298 9.802   1.00 26.20 ? 297 ARG A N     1 
ATOM   2287 C  CA    . ARG A 1 300 ? -5.743  35.339 9.668   1.00 25.82 ? 297 ARG A CA    1 
ATOM   2288 C  C     . ARG A 1 300 ? -5.156  36.626 9.066   1.00 26.79 ? 297 ARG A C     1 
ATOM   2289 O  O     . ARG A 1 300 ? -5.761  37.240 8.174   1.00 26.63 ? 297 ARG A O     1 
ATOM   2290 C  CB    . ARG A 1 300 ? -6.453  35.624 11.007  1.00 25.87 ? 297 ARG A CB    1 
ATOM   2291 C  CG    . ARG A 1 300 ? -7.393  34.498 11.478  1.00 24.11 ? 297 ARG A CG    1 
ATOM   2292 C  CD    . ARG A 1 300 ? -8.331  34.962 12.600  1.00 24.21 ? 297 ARG A CD    1 
ATOM   2293 N  NE    . ARG A 1 300 ? -7.615  35.540 13.742  1.00 25.28 ? 297 ARG A NE    1 
ATOM   2294 C  CZ    . ARG A 1 300 ? -7.112  34.852 14.771  1.00 25.87 ? 297 ARG A CZ    1 
ATOM   2295 N  NH1   . ARG A 1 300 ? -7.237  33.536 14.850  1.00 25.79 ? 297 ARG A NH1   1 
ATOM   2296 N  NH2   . ARG A 1 300 ? -6.471  35.489 15.741  1.00 27.48 ? 297 ARG A NH2   1 
ATOM   2297 N  N     . GLY A 1 301 ? -3.969  37.010 9.527   1.00 28.20 ? 298 GLY A N     1 
ATOM   2298 C  CA    . GLY A 1 301 ? -3.253  38.163 8.966   1.00 29.88 ? 298 GLY A CA    1 
ATOM   2299 C  C     . GLY A 1 301 ? -2.918  38.023 7.483   1.00 29.57 ? 298 GLY A C     1 
ATOM   2300 O  O     . GLY A 1 301 ? -3.038  38.985 6.709   1.00 29.52 ? 298 GLY A O     1 
ATOM   2301 N  N     . GLU A 1 302 ? -2.512  36.818 7.085   1.00 28.87 ? 299 GLU A N     1 
ATOM   2302 C  CA    . GLU A 1 302 ? -2.136  36.548 5.698   1.00 29.22 ? 299 GLU A CA    1 
ATOM   2303 C  C     . GLU A 1 302 ? -3.386  36.483 4.833   1.00 27.48 ? 299 GLU A C     1 
ATOM   2304 O  O     . GLU A 1 302 ? -3.354  36.873 3.669   1.00 28.03 ? 299 GLU A O     1 
ATOM   2305 C  CB    . GLU A 1 302 ? -1.303  35.255 5.573   1.00 29.02 ? 299 GLU A CB    1 
ATOM   2306 C  CG    . GLU A 1 302 ? 0.110   35.361 6.194   1.00 32.32 ? 299 GLU A CG    1 
ATOM   2307 C  CD    . GLU A 1 302 ? 0.835   34.001 6.351   1.00 34.53 ? 299 GLU A CD    1 
ATOM   2308 O  OE1   . GLU A 1 302 ? 2.086   33.994 6.385   1.00 38.49 ? 299 GLU A OE1   1 
ATOM   2309 O  OE2   . GLU A 1 302 ? 0.171   32.945 6.462   1.00 33.81 ? 299 GLU A OE2   1 
ATOM   2310 N  N     . ASN A 1 303 ? -4.490  36.007 5.395   1.00 25.83 ? 300 ASN A N     1 
ATOM   2311 C  CA    . ASN A 1 303 ? -5.767  36.081 4.691   1.00 24.92 ? 300 ASN A CA    1 
ATOM   2312 C  C     . ASN A 1 303 ? -6.138  37.543 4.372   1.00 25.24 ? 300 ASN A C     1 
ATOM   2313 O  O     . ASN A 1 303 ? -6.436  37.865 3.229   1.00 25.70 ? 300 ASN A O     1 
ATOM   2314 C  CB    . ASN A 1 303 ? -6.887  35.397 5.493   1.00 24.12 ? 300 ASN A CB    1 
ATOM   2315 C  CG    . ASN A 1 303 ? -8.147  35.158 4.663   1.00 25.27 ? 300 ASN A CG    1 
ATOM   2316 O  OD1   . ASN A 1 303 ? -8.076  35.048 3.436   1.00 28.96 ? 300 ASN A OD1   1 
ATOM   2317 N  ND2   . ASN A 1 303 ? -9.305  35.072 5.331   1.00 25.70 ? 300 ASN A ND2   1 
ATOM   2318 N  N     . VAL A 1 304 ? -6.097  38.420 5.376   1.00 25.19 ? 301 VAL A N     1 
ATOM   2319 C  CA    . VAL A 1 304 ? -6.360  39.856 5.174   1.00 25.88 ? 301 VAL A CA    1 
ATOM   2320 C  C     . VAL A 1 304 ? -5.392  40.486 4.167   1.00 27.71 ? 301 VAL A C     1 
ATOM   2321 O  O     . VAL A 1 304 ? -5.793  41.275 3.309   1.00 27.83 ? 301 VAL A O     1 
ATOM   2322 C  CB    . VAL A 1 304 ? -6.262  40.663 6.505   1.00 26.81 ? 301 VAL A CB    1 
ATOM   2323 C  CG1   . VAL A 1 304 ? -6.488  42.133 6.249   1.00 27.41 ? 301 VAL A CG1   1 
ATOM   2324 C  CG2   . VAL A 1 304 ? -7.255  40.131 7.567   1.00 23.64 ? 301 VAL A CG2   1 
ATOM   2325 N  N     . HIS A 1 305 ? -4.114  40.134 4.279   1.00 28.97 ? 302 HIS A N     1 
ATOM   2326 C  CA    . HIS A 1 305 ? -3.107  40.627 3.349   1.00 31.21 ? 302 HIS A CA    1 
ATOM   2327 C  C     . HIS A 1 305 ? -3.457  40.242 1.923   1.00 31.15 ? 302 HIS A C     1 
ATOM   2328 O  O     . HIS A 1 305 ? -3.399  41.070 1.017   1.00 32.10 ? 302 HIS A O     1 
ATOM   2329 C  CB    . HIS A 1 305 ? -1.710  40.087 3.692   1.00 32.21 ? 302 HIS A CB    1 
ATOM   2330 C  CG    . HIS A 1 305 ? -0.641  40.617 2.797   1.00 33.41 ? 302 HIS A CG    1 
ATOM   2331 N  ND1   . HIS A 1 305 ? -0.147  41.898 2.909   1.00 35.84 ? 302 HIS A ND1   1 
ATOM   2332 C  CD2   . HIS A 1 305 ? -0.007  40.059 1.740   1.00 33.50 ? 302 HIS A CD2   1 
ATOM   2333 C  CE1   . HIS A 1 305 ? 0.759   42.101 1.970   1.00 36.09 ? 302 HIS A CE1   1 
ATOM   2334 N  NE2   . HIS A 1 305 ? 0.861   41.003 1.246   1.00 34.07 ? 302 HIS A NE2   1 
ATOM   2335 N  N     . ARG A 1 306 ? -3.824  38.980 1.743   1.00 30.05 ? 303 ARG A N     1 
ATOM   2336 C  CA    . ARG A 1 306 ? -4.161  38.451 0.430   1.00 30.63 ? 303 ARG A CA    1 
ATOM   2337 C  C     . ARG A 1 306 ? -5.374  39.155 -0.181  1.00 30.12 ? 303 ARG A C     1 
ATOM   2338 O  O     . ARG A 1 306 ? -5.399  39.415 -1.386  1.00 30.90 ? 303 ARG A O     1 
ATOM   2339 C  CB    . ARG A 1 306 ? -4.424  36.943 0.517   1.00 29.60 ? 303 ARG A CB    1 
ATOM   2340 C  CG    . ARG A 1 306 ? -4.580  36.278 -0.844  1.00 32.78 ? 303 ARG A CG    1 
ATOM   2341 C  CD    . ARG A 1 306 ? -5.161  34.877 -0.755  1.00 35.43 ? 303 ARG A CD    1 
ATOM   2342 N  NE    . ARG A 1 306 ? -5.787  34.483 -2.022  1.00 39.29 ? 303 ARG A NE    1 
ATOM   2343 C  CZ    . ARG A 1 306 ? -6.151  33.237 -2.335  1.00 40.64 ? 303 ARG A CZ    1 
ATOM   2344 N  NH1   . ARG A 1 306 ? -5.943  32.236 -1.485  1.00 41.11 ? 303 ARG A NH1   1 
ATOM   2345 N  NH2   . ARG A 1 306 ? -6.720  32.988 -3.512  1.00 41.44 ? 303 ARG A NH2   1 
ATOM   2346 N  N     . TYR A 1 307 ? -6.376  39.445 0.646   1.00 28.87 ? 304 TYR A N     1 
ATOM   2347 C  CA    . TYR A 1 307 ? -7.572  40.157 0.195   1.00 28.32 ? 304 TYR A CA    1 
ATOM   2348 C  C     . TYR A 1 307 ? -7.238  41.459 -0.541  1.00 29.90 ? 304 TYR A C     1 
ATOM   2349 O  O     . TYR A 1 307 ? -7.879  41.803 -1.528  1.00 29.90 ? 304 TYR A O     1 
ATOM   2350 C  CB    . TYR A 1 307 ? -8.498  40.473 1.383   1.00 27.90 ? 304 TYR A CB    1 
ATOM   2351 C  CG    . TYR A 1 307 ? -9.730  41.230 0.960   1.00 27.53 ? 304 TYR A CG    1 
ATOM   2352 C  CD1   . TYR A 1 307 ? -10.805 40.564 0.382   1.00 26.94 ? 304 TYR A CD1   1 
ATOM   2353 C  CD2   . TYR A 1 307 ? -9.809  42.604 1.096   1.00 28.57 ? 304 TYR A CD2   1 
ATOM   2354 C  CE1   . TYR A 1 307 ? -11.942 41.251 -0.034  1.00 27.25 ? 304 TYR A CE1   1 
ATOM   2355 C  CE2   . TYR A 1 307 ? -10.940 43.298 0.677   1.00 30.45 ? 304 TYR A CE2   1 
ATOM   2356 C  CZ    . TYR A 1 307 ? -12.007 42.604 0.121   1.00 28.71 ? 304 TYR A CZ    1 
ATOM   2357 O  OH    . TYR A 1 307 ? -13.133 43.270 -0.308  1.00 31.46 ? 304 TYR A OH    1 
ATOM   2358 N  N     . PHE A 1 308 ? -6.247  42.189 -0.047  1.00 30.96 ? 305 PHE A N     1 
ATOM   2359 C  CA    . PHE A 1 308 ? -5.887  43.470 -0.641  1.00 32.95 ? 305 PHE A CA    1 
ATOM   2360 C  C     . PHE A 1 308 ? -4.830  43.343 -1.729  1.00 34.31 ? 305 PHE A C     1 
ATOM   2361 O  O     . PHE A 1 308 ? -4.894  44.052 -2.739  1.00 35.44 ? 305 PHE A O     1 
ATOM   2362 C  CB    . PHE A 1 308 ? -5.414  44.450 0.443   1.00 34.20 ? 305 PHE A CB    1 
ATOM   2363 C  CG    . PHE A 1 308 ? -6.493  44.845 1.394   1.00 33.09 ? 305 PHE A CG    1 
ATOM   2364 C  CD1   . PHE A 1 308 ? -7.484  45.727 0.998   1.00 33.99 ? 305 PHE A CD1   1 
ATOM   2365 C  CD2   . PHE A 1 308 ? -6.539  44.322 2.672   1.00 31.56 ? 305 PHE A CD2   1 
ATOM   2366 C  CE1   . PHE A 1 308 ? -8.507  46.093 1.861   1.00 33.39 ? 305 PHE A CE1   1 
ATOM   2367 C  CE2   . PHE A 1 308 ? -7.552  44.678 3.547   1.00 31.70 ? 305 PHE A CE2   1 
ATOM   2368 C  CZ    . PHE A 1 308 ? -8.545  45.572 3.138   1.00 32.36 ? 305 PHE A CZ    1 
ATOM   2369 N  N     . TYR A 1 309 ? -3.863  42.452 -1.520  1.00 34.31 ? 306 TYR A N     1 
ATOM   2370 C  CA    . TYR A 1 309 ? -2.671  42.384 -2.376  1.00 36.62 ? 306 TYR A CA    1 
ATOM   2371 C  C     . TYR A 1 309 ? -2.619  41.149 -3.286  1.00 36.37 ? 306 TYR A C     1 
ATOM   2372 O  O     . TYR A 1 309 ? -1.778  41.069 -4.188  1.00 37.62 ? 306 TYR A O     1 
ATOM   2373 C  CB    . TYR A 1 309 ? -1.398  42.479 -1.517  1.00 37.53 ? 306 TYR A CB    1 
ATOM   2374 C  CG    . TYR A 1 309 ? -1.194  43.839 -0.866  1.00 37.86 ? 306 TYR A CG    1 
ATOM   2375 C  CD1   . TYR A 1 309 ? -0.621  44.896 -1.572  1.00 40.39 ? 306 TYR A CD1   1 
ATOM   2376 C  CD2   . TYR A 1 309 ? -1.554  44.057 0.456   1.00 35.73 ? 306 TYR A CD2   1 
ATOM   2377 C  CE1   . TYR A 1 309 ? -0.424  46.144 -0.972  1.00 41.72 ? 306 TYR A CE1   1 
ATOM   2378 C  CE2   . TYR A 1 309 ? -1.374  45.281 1.063   1.00 37.08 ? 306 TYR A CE2   1 
ATOM   2379 C  CZ    . TYR A 1 309 ? -0.807  46.325 0.351   1.00 40.74 ? 306 TYR A CZ    1 
ATOM   2380 O  OH    . TYR A 1 309 ? -0.630  47.540 0.967   1.00 40.90 ? 306 TYR A OH    1 
ATOM   2381 N  N     . GLY A 1 310 ? -3.523  40.201 -3.061  1.00 35.41 ? 307 GLY A N     1 
ATOM   2382 C  CA    . GLY A 1 310 ? -3.603  38.994 -3.878  1.00 35.18 ? 307 GLY A CA    1 
ATOM   2383 C  C     . GLY A 1 310 ? -2.521  37.994 -3.526  1.00 35.97 ? 307 GLY A C     1 
ATOM   2384 O  O     . GLY A 1 310 ? -2.177  37.830 -2.361  1.00 35.97 ? 307 GLY A O     1 
ATOM   2385 N  N     . THR A 1 311 ? -1.974  37.336 -4.544  1.00 37.61 ? 308 THR A N     1 
ATOM   2386 C  CA    . THR A 1 311 ? -0.964  36.300 -4.354  1.00 38.25 ? 308 THR A CA    1 
ATOM   2387 C  C     . THR A 1 311 ? 0.272   36.577 -5.188  1.00 41.12 ? 308 THR A C     1 
ATOM   2388 O  O     . THR A 1 311 ? 0.279   37.468 -6.028  1.00 42.69 ? 308 THR A O     1 
ATOM   2389 C  CB    . THR A 1 311 ? -1.510  34.932 -4.780  1.00 36.46 ? 308 THR A CB    1 
ATOM   2390 O  OG1   . THR A 1 311 ? -1.825  34.952 -6.181  1.00 37.53 ? 308 THR A OG1   1 
ATOM   2391 C  CG2   . THR A 1 311 ? -2.770  34.589 -4.003  1.00 34.75 ? 308 THR A CG2   1 
ATOM   2392 N  N     . ARG A 1 312 ? 1.317   35.790 -4.937  1.00 42.28 ? 309 ARG A N     1 
ATOM   2393 C  CA    . ARG A 1 312 ? 2.491   35.721 -5.800  1.00 44.93 ? 309 ARG A CA    1 
ATOM   2394 C  C     . ARG A 1 312 ? 2.125   35.476 -7.263  1.00 44.70 ? 309 ARG A C     1 
ATOM   2395 O  O     . ARG A 1 312 ? 2.625   36.161 -8.155  1.00 46.83 ? 309 ARG A O     1 
ATOM   2396 C  CB    . ARG A 1 312 ? 3.409   34.597 -5.327  1.00 45.61 ? 309 ARG A CB    1 
ATOM   2397 C  CG    . ARG A 1 312 ? 4.318   34.978 -4.168  1.00 48.97 ? 309 ARG A CG    1 
ATOM   2398 C  CD    . ARG A 1 312 ? 5.056   33.749 -3.636  1.00 51.03 ? 309 ARG A CD    1 
ATOM   2399 N  NE    . ARG A 1 312 ? 6.498   33.980 -3.582  1.00 55.79 ? 309 ARG A NE    1 
ATOM   2400 C  CZ    . ARG A 1 312 ? 7.428   33.026 -3.634  1.00 57.79 ? 309 ARG A CZ    1 
ATOM   2401 N  NH1   . ARG A 1 312 ? 7.088   31.741 -3.725  1.00 56.03 ? 309 ARG A NH1   1 
ATOM   2402 N  NH2   . ARG A 1 312 ? 8.716   33.364 -3.594  1.00 61.07 ? 309 ARG A NH2   1 
ATOM   2403 N  N     . ALA A 1 313 ? 1.257   34.496 -7.500  1.00 42.17 ? 310 ALA A N     1 
ATOM   2404 C  CA    . ALA A 1 313 ? 0.785   34.188 -8.853  1.00 42.02 ? 310 ALA A CA    1 
ATOM   2405 C  C     . ALA A 1 313 ? -0.072  35.318 -9.431  1.00 42.02 ? 310 ALA A C     1 
ATOM   2406 O  O     . ALA A 1 313 ? 0.225   35.809 -10.525 1.00 44.31 ? 310 ALA A O     1 
ATOM   2407 C  CB    . ALA A 1 313 ? 0.010   32.873 -8.868  1.00 39.93 ? 310 ALA A CB    1 
ATOM   2408 N  N     . ASN A 1 314 ? -1.109  35.730 -8.698  1.00 62.05 ? 311 ASN A N     1 
ATOM   2409 C  CA    . ASN A 1 314 ? -2.028  36.799 -9.136  1.00 59.34 ? 311 ASN A CA    1 
ATOM   2410 C  C     . ASN A 1 314 ? -2.028  38.013 -8.206  1.00 55.16 ? 311 ASN A C     1 
ATOM   2411 O  O     . ASN A 1 314 ? -2.826  38.098 -7.258  1.00 51.00 ? 311 ASN A O     1 
ATOM   2412 C  CB    . ASN A 1 314 ? -3.458  36.263 -9.271  1.00 57.60 ? 311 ASN A CB    1 
ATOM   2413 C  CG    . ASN A 1 314 ? -3.728  35.668 -10.636 1.00 62.17 ? 311 ASN A CG    1 
ATOM   2414 O  OD1   . ASN A 1 314 ? -2.966  34.835 -11.131 1.00 64.97 ? 311 ASN A OD1   1 
ATOM   2415 N  ND2   . ASN A 1 314 ? -4.822  36.094 -11.254 1.00 62.98 ? 311 ASN A ND2   1 
ATOM   2416 N  N     . ASN A 1 315 ? -1.137  38.958 -8.486  1.00 56.07 ? 312 ASN A N     1 
ATOM   2417 C  CA    . ASN A 1 315 ? -1.053  40.172 -7.687  1.00 53.08 ? 312 ASN A CA    1 
ATOM   2418 C  C     . ASN A 1 315 ? -2.297  41.029 -7.871  1.00 49.65 ? 312 ASN A C     1 
ATOM   2419 O  O     . ASN A 1 315 ? -2.816  41.149 -8.979  1.00 51.32 ? 312 ASN A O     1 
ATOM   2420 C  CB    . ASN A 1 315 ? 0.194   40.985 -8.048  1.00 56.36 ? 312 ASN A CB    1 
ATOM   2421 C  CG    . ASN A 1 315 ? 1.484   40.278 -7.666  1.00 59.96 ? 312 ASN A CG    1 
ATOM   2422 O  OD1   . ASN A 1 315 ? 1.767   39.181 -8.145  1.00 64.01 ? 312 ASN A OD1   1 
ATOM   2423 N  ND2   . ASN A 1 315 ? 2.277   40.911 -6.808  1.00 60.38 ? 312 ASN A ND2   1 
ATOM   2424 N  N     . LEU A 1 316 ? -2.784  41.592 -6.773  1.00 45.15 ? 313 LEU A N     1 
ATOM   2425 C  CA    . LEU A 1 316 ? -3.807  42.629 -6.819  1.00 42.69 ? 313 LEU A CA    1 
ATOM   2426 C  C     . LEU A 1 316 ? -3.114  43.925 -6.421  1.00 42.14 ? 313 LEU A C     1 
ATOM   2427 O  O     . LEU A 1 316 ? -2.099  43.898 -5.720  1.00 42.62 ? 313 LEU A O     1 
ATOM   2428 C  CB    . LEU A 1 316 ? -4.982  42.313 -5.883  1.00 38.83 ? 313 LEU A CB    1 
ATOM   2429 C  CG    . LEU A 1 316 ? -5.844  41.076 -6.200  1.00 39.47 ? 313 LEU A CG    1 
ATOM   2430 C  CD1   . LEU A 1 316 ? -6.996  40.939 -5.176  1.00 36.00 ? 313 LEU A CD1   1 
ATOM   2431 C  CD2   . LEU A 1 316 ? -6.397  41.116 -7.625  1.00 41.29 ? 313 LEU A CD2   1 
ATOM   2432 N  N     . TYR A 1 317 ? -3.648  45.049 -6.883  1.00 41.53 ? 314 TYR A N     1 
ATOM   2433 C  CA    . TYR A 1 317 ? -2.983  46.348 -6.728  1.00 42.10 ? 314 TYR A CA    1 
ATOM   2434 C  C     . TYR A 1 317 ? -3.937  47.335 -6.075  1.00 39.30 ? 314 TYR A C     1 
ATOM   2435 O  O     . TYR A 1 317 ? -4.658  48.049 -6.767  1.00 39.42 ? 314 TYR A O     1 
ATOM   2436 C  CB    . TYR A 1 317 ? -2.521  46.868 -8.087  1.00 45.69 ? 314 TYR A CB    1 
ATOM   2437 C  CG    . TYR A 1 317 ? -1.556  45.941 -8.788  1.00 48.80 ? 314 TYR A CG    1 
ATOM   2438 C  CD1   . TYR A 1 317 ? -1.947  45.206 -9.912  1.00 50.33 ? 314 TYR A CD1   1 
ATOM   2439 C  CD2   . TYR A 1 317 ? -0.248  45.798 -8.333  1.00 49.64 ? 314 TYR A CD2   1 
ATOM   2440 C  CE1   . TYR A 1 317 ? -1.058  44.366 -10.557 1.00 53.45 ? 314 TYR A CE1   1 
ATOM   2441 C  CE2   . TYR A 1 317 ? 0.641   44.953 -8.970  1.00 52.45 ? 314 TYR A CE2   1 
ATOM   2442 C  CZ    . TYR A 1 317 ? 0.234   44.243 -10.076 1.00 54.94 ? 314 TYR A CZ    1 
ATOM   2443 O  OH    . TYR A 1 317 ? 1.132   43.413 -10.706 1.00 59.74 ? 314 TYR A OH    1 
ATOM   2444 N  N     . PRO A 1 318 ? -3.955  47.356 -4.732  1.00 37.00 ? 315 PRO A N     1 
ATOM   2445 C  CA    . PRO A 1 318 ? -4.927  48.141 -3.987  1.00 34.80 ? 315 PRO A CA    1 
ATOM   2446 C  C     . PRO A 1 318 ? -4.523  49.606 -3.927  1.00 36.07 ? 315 PRO A C     1 
ATOM   2447 O  O     . PRO A 1 318 ? -3.341  49.921 -4.043  1.00 37.96 ? 315 PRO A O     1 
ATOM   2448 C  CB    . PRO A 1 318 ? -4.873  47.520 -2.593  1.00 32.28 ? 315 PRO A CB    1 
ATOM   2449 C  CG    . PRO A 1 318 ? -3.452  47.066 -2.462  1.00 34.28 ? 315 PRO A CG    1 
ATOM   2450 C  CD    . PRO A 1 318 ? -2.967  46.722 -3.839  1.00 36.82 ? 315 PRO A CD    1 
ATOM   2451 N  N     . PHE A 1 319 ? -5.510  50.474 -3.720  1.00 35.32 ? 316 PHE A N     1 
ATOM   2452 C  CA    . PHE A 1 319 ? -5.294  51.915 -3.684  1.00 36.83 ? 316 PHE A CA    1 
ATOM   2453 C  C     . PHE A 1 319 ? -5.303  52.367 -2.242  1.00 35.35 ? 316 PHE A C     1 
ATOM   2454 O  O     . PHE A 1 319 ? -6.050  51.834 -1.416  1.00 32.78 ? 316 PHE A O     1 
ATOM   2455 C  CB    . PHE A 1 319 ? -6.395  52.643 -4.450  1.00 37.44 ? 316 PHE A CB    1 
ATOM   2456 C  CG    . PHE A 1 319 ? -6.518  52.212 -5.877  1.00 39.69 ? 316 PHE A CG    1 
ATOM   2457 C  CD1   . PHE A 1 319 ? -7.180  51.039 -6.203  1.00 38.69 ? 316 PHE A CD1   1 
ATOM   2458 C  CD2   . PHE A 1 319 ? -5.970  52.978 -6.897  1.00 43.91 ? 316 PHE A CD2   1 
ATOM   2459 C  CE1   . PHE A 1 319 ? -7.296  50.630 -7.526  1.00 42.13 ? 316 PHE A CE1   1 
ATOM   2460 C  CE2   . PHE A 1 319 ? -6.077  52.575 -8.218  1.00 47.05 ? 316 PHE A CE2   1 
ATOM   2461 C  CZ    . PHE A 1 319 ? -6.745  51.395 -8.535  1.00 45.30 ? 316 PHE A CZ    1 
ATOM   2462 N  N     . THR A 1 320 ? -4.438  53.323 -1.939  1.00 37.35 ? 317 THR A N     1 
ATOM   2463 C  CA    . THR A 1 320 ? -4.463  54.023 -0.671  1.00 37.03 ? 317 THR A CA    1 
ATOM   2464 C  C     . THR A 1 320 ? -4.855  55.459 -0.987  1.00 38.87 ? 317 THR A C     1 
ATOM   2465 O  O     . THR A 1 320 ? -4.250  56.089 -1.859  1.00 41.76 ? 317 THR A O     1 
ATOM   2466 C  CB    . THR A 1 320 ? -3.087  54.007 0.028   1.00 38.68 ? 317 THR A CB    1 
ATOM   2467 O  OG1   . THR A 1 320 ? -2.775  52.672 0.453   1.00 37.81 ? 317 THR A OG1   1 
ATOM   2468 C  CG2   . THR A 1 320 ? -3.078  54.955 1.251   1.00 38.40 ? 317 THR A CG2   1 
ATOM   2469 N  N     . PHE A 1 321 ? -5.886  55.956 -0.314  1.00 37.56 ? 318 PHE A N     1 
ATOM   2470 C  CA    . PHE A 1 321 ? -6.289  57.364 -0.454  1.00 39.75 ? 318 PHE A CA    1 
ATOM   2471 C  C     . PHE A 1 321 ? -7.015  57.839 0.797   1.00 38.62 ? 318 PHE A C     1 
ATOM   2472 O  O     . PHE A 1 321 ? -7.310  57.050 1.709   1.00 36.28 ? 318 PHE A O     1 
ATOM   2473 C  CB    . PHE A 1 321 ? -7.180  57.575 -1.696  1.00 40.58 ? 318 PHE A CB    1 
ATOM   2474 C  CG    . PHE A 1 321 ? -8.402  56.689 -1.725  1.00 38.20 ? 318 PHE A CG    1 
ATOM   2475 C  CD1   . PHE A 1 321 ? -8.373  55.461 -2.389  1.00 35.74 ? 318 PHE A CD1   1 
ATOM   2476 C  CD2   . PHE A 1 321 ? -9.575  57.080 -1.087  1.00 36.54 ? 318 PHE A CD2   1 
ATOM   2477 C  CE1   . PHE A 1 321 ? -9.499  54.642 -2.420  1.00 34.49 ? 318 PHE A CE1   1 
ATOM   2478 C  CE2   . PHE A 1 321 ? -10.698 56.269 -1.108  1.00 34.77 ? 318 PHE A CE2   1 
ATOM   2479 C  CZ    . PHE A 1 321 ? -10.660 55.041 -1.775  1.00 33.56 ? 318 PHE A CZ    1 
ATOM   2480 N  N     . ASP A 1 322 ? -7.305  59.130 0.820   1.00 40.78 ? 319 ASP A N     1 
ATOM   2481 C  CA    . ASP A 1 322 ? -7.939  59.760 1.959   1.00 40.90 ? 319 ASP A CA    1 
ATOM   2482 C  C     . ASP A 1 322 ? -9.442  59.894 1.729   1.00 40.65 ? 319 ASP A C     1 
ATOM   2483 O  O     . ASP A 1 322 ? -9.895  60.139 0.606   1.00 41.74 ? 319 ASP A O     1 
ATOM   2484 C  CB    . ASP A 1 322 ? -7.300  61.129 2.217   1.00 43.90 ? 319 ASP A CB    1 
ATOM   2485 C  CG    . ASP A 1 322 ? -5.877  61.019 2.732   1.00 44.44 ? 319 ASP A CG    1 
ATOM   2486 O  OD1   . ASP A 1 322 ? -5.617  60.121 3.549   1.00 42.62 ? 319 ASP A OD1   1 
ATOM   2487 O  OD2   . ASP A 1 322 ? -5.016  61.832 2.334   1.00 48.25 ? 319 ASP A OD2   1 
ATOM   2488 N  N     . VAL A 1 323 ? -10.208 59.728 2.802   1.00 39.69 ? 320 VAL A N     1 
ATOM   2489 C  CA    . VAL A 1 323 ? -11.663 59.906 2.764   1.00 40.12 ? 320 VAL A CA    1 
ATOM   2490 C  C     . VAL A 1 323 ? -12.071 60.893 3.840   1.00 41.88 ? 320 VAL A C     1 
ATOM   2491 O  O     . VAL A 1 323 ? -11.631 60.762 4.978   1.00 41.20 ? 320 VAL A O     1 
ATOM   2492 C  CB    . VAL A 1 323 ? -12.386 58.561 3.014   1.00 37.00 ? 320 VAL A CB    1 
ATOM   2493 C  CG1   . VAL A 1 323 ? -13.899 58.755 3.094   1.00 37.50 ? 320 VAL A CG1   1 
ATOM   2494 C  CG2   . VAL A 1 323 ? -12.022 57.576 1.928   1.00 35.69 ? 320 VAL A CG2   1 
ATOM   2495 N  N     . SER A 1 324 ? -12.887 61.884 3.486   1.00 44.87 ? 321 SER A N     1 
ATOM   2496 C  CA    A SER A 1 324 ? -13.407 62.829 4.471   0.50 47.19 ? 321 SER A CA    1 
ATOM   2497 C  CA    B SER A 1 324 ? -13.398 62.827 4.479   0.50 47.20 ? 321 SER A CA    1 
ATOM   2498 C  C     . SER A 1 324 ? -14.520 62.151 5.262   1.00 46.04 ? 321 SER A C     1 
ATOM   2499 O  O     . SER A 1 324 ? -15.329 61.414 4.693   1.00 44.85 ? 321 SER A O     1 
ATOM   2500 C  CB    A SER A 1 324 ? -13.942 64.089 3.789   0.50 50.95 ? 321 SER A CB    1 
ATOM   2501 C  CB    B SER A 1 324 ? -13.906 64.118 3.828   0.50 51.03 ? 321 SER A CB    1 
ATOM   2502 O  OG    A SER A 1 324 ? -14.317 65.067 4.745   0.50 53.24 ? 321 SER A OG    1 
ATOM   2503 O  OG    B SER A 1 324 ? -15.290 64.046 3.530   0.50 51.40 ? 321 SER A OG    1 
ATOM   2504 N  N     . PHE A 1 325 ? -14.565 62.400 6.568   1.00 47.14 ? 322 PHE A N     1 
ATOM   2505 C  CA    . PHE A 1 325 ? -15.631 61.849 7.415   1.00 47.12 ? 322 PHE A CA    1 
ATOM   2506 C  C     . PHE A 1 325 ? -17.009 62.417 7.090   1.00 49.66 ? 322 PHE A C     1 
ATOM   2507 O  O     . PHE A 1 325 ? -18.022 61.853 7.498   1.00 49.17 ? 322 PHE A O     1 
ATOM   2508 C  CB    . PHE A 1 325 ? -15.317 62.068 8.896   1.00 48.08 ? 322 PHE A CB    1 
ATOM   2509 C  CG    . PHE A 1 325 ? -14.129 61.295 9.366   1.00 46.77 ? 322 PHE A CG    1 
ATOM   2510 C  CD1   . PHE A 1 325 ? -13.044 61.943 9.931   1.00 48.54 ? 322 PHE A CD1   1 
ATOM   2511 C  CD2   . PHE A 1 325 ? -14.086 59.913 9.217   1.00 44.66 ? 322 PHE A CD2   1 
ATOM   2512 C  CE1   . PHE A 1 325 ? -11.935 61.242 10.355  1.00 47.47 ? 322 PHE A CE1   1 
ATOM   2513 C  CE2   . PHE A 1 325 ? -12.976 59.189 9.639   1.00 44.10 ? 322 PHE A CE2   1 
ATOM   2514 C  CZ    . PHE A 1 325 ? -11.894 59.860 10.215  1.00 45.65 ? 322 PHE A CZ    1 
ATOM   2515 N  N     . ASP A 1 326 ? -17.037 63.524 6.352   1.00 52.89 ? 323 ASP A N     1 
ATOM   2516 C  CA    . ASP A 1 326 ? -18.285 64.123 5.887   1.00 56.25 ? 323 ASP A CA    1 
ATOM   2517 C  C     . ASP A 1 326 ? -18.836 63.420 4.643   1.00 55.31 ? 323 ASP A C     1 
ATOM   2518 O  O     . ASP A 1 326 ? -19.921 63.768 4.165   1.00 58.28 ? 323 ASP A O     1 
ATOM   2519 C  CB    . ASP A 1 326 ? -18.073 65.608 5.575   1.00 60.31 ? 323 ASP A CB    1 
ATOM   2520 C  CG    . ASP A 1 326 ? -17.537 66.382 6.761   1.00 62.53 ? 323 ASP A CG    1 
ATOM   2521 O  OD1   . ASP A 1 326 ? -16.789 67.359 6.551   1.00 65.63 ? 323 ASP A OD1   1 
ATOM   2522 O  OD2   . ASP A 1 326 ? -17.859 66.009 7.908   1.00 62.46 ? 323 ASP A OD2   1 
ATOM   2523 N  N     . ASP A 1 327 ? -18.088 62.459 4.109   1.00 51.95 ? 324 ASP A N     1 
ATOM   2524 C  CA    . ASP A 1 327 ? -18.509 61.722 2.926   1.00 51.17 ? 324 ASP A CA    1 
ATOM   2525 C  C     . ASP A 1 327 ? -18.911 60.275 3.243   1.00 48.02 ? 324 ASP A C     1 
ATOM   2526 O  O     . ASP A 1 327 ? -19.343 59.566 2.343   1.00 47.40 ? 324 ASP A O     1 
ATOM   2527 C  CB    . ASP A 1 327 ? -17.387 61.717 1.877   1.00 50.76 ? 324 ASP A CB    1 
ATOM   2528 C  CG    . ASP A 1 327 ? -17.026 63.117 1.376   1.00 54.69 ? 324 ASP A CG    1 
ATOM   2529 O  OD1   . ASP A 1 327 ? -17.639 64.115 1.813   1.00 57.73 ? 324 ASP A OD1   1 
ATOM   2530 O  OD2   . ASP A 1 327 ? -16.103 63.212 0.538   1.00 55.68 ? 324 ASP A OD2   1 
ATOM   2531 N  N     . VAL A 1 328 ? -18.759 59.845 4.502   1.00 46.38 ? 325 VAL A N     1 
ATOM   2532 C  CA    . VAL A 1 328 ? -19.126 58.489 4.928   1.00 43.89 ? 325 VAL A CA    1 
ATOM   2533 C  C     . VAL A 1 328 ? -19.790 58.462 6.302   1.00 44.61 ? 325 VAL A C     1 
ATOM   2534 O  O     . VAL A 1 328 ? -19.561 59.336 7.127   1.00 45.86 ? 325 VAL A O     1 
ATOM   2535 C  CB    . VAL A 1 328 ? -17.894 57.554 5.010   1.00 40.79 ? 325 VAL A CB    1 
ATOM   2536 C  CG1   . VAL A 1 328 ? -17.310 57.301 3.627   1.00 40.45 ? 325 VAL A CG1   1 
ATOM   2537 C  CG2   . VAL A 1 328 ? -16.839 58.123 5.950   1.00 40.70 ? 325 VAL A CG2   1 
ATOM   2538 N  N     . THR A 1 329 ? -20.591 57.428 6.545   1.00 43.91 ? 326 THR A N     1 
ATOM   2539 C  CA    . THR A 1 329 ? -21.123 57.141 7.882   1.00 44.64 ? 326 THR A CA    1 
ATOM   2540 C  C     . THR A 1 329 ? -20.526 55.838 8.412   1.00 41.74 ? 326 THR A C     1 
ATOM   2541 O  O     . THR A 1 329 ? -20.773 54.778 7.853   1.00 39.98 ? 326 THR A O     1 
ATOM   2542 C  CB    . THR A 1 329 ? -22.651 56.986 7.859   1.00 46.88 ? 326 THR A CB    1 
ATOM   2543 O  OG1   . THR A 1 329 ? -23.234 58.107 7.191   1.00 49.98 ? 326 THR A OG1   1 
ATOM   2544 C  CG2   . THR A 1 329 ? -23.204 56.883 9.274   1.00 48.42 ? 326 THR A CG2   1 
ATOM   2545 N  N     . LEU A 1 330 ? -19.738 55.931 9.484   1.00 41.83 ? 327 LEU A N     1 
ATOM   2546 C  CA    . LEU A 1 330 ? -19.201 54.747 10.170  1.00 40.07 ? 327 LEU A CA    1 
ATOM   2547 C  C     . LEU A 1 330 ? -20.222 54.225 11.163  1.00 41.73 ? 327 LEU A C     1 
ATOM   2548 O  O     . LEU A 1 330 ? -20.777 55.002 11.942  1.00 44.45 ? 327 LEU A O     1 
ATOM   2549 C  CB    . LEU A 1 330 ? -17.910 55.079 10.924  1.00 39.89 ? 327 LEU A CB    1 
ATOM   2550 C  CG    . LEU A 1 330 ? -16.775 55.759 10.150  1.00 39.57 ? 327 LEU A CG    1 
ATOM   2551 C  CD1   . LEU A 1 330 ? -15.606 56.014 11.079  1.00 40.61 ? 327 LEU A CD1   1 
ATOM   2552 C  CD2   . LEU A 1 330 ? -16.338 54.931 8.943   1.00 36.41 ? 327 LEU A CD2   1 
ATOM   2553 N  N     . CYS A 1 331 ? -20.465 52.916 11.139  1.00 40.72 ? 328 CYS A N     1 
ATOM   2554 C  CA    . CYS A 1 331 ? -21.396 52.293 12.072  1.00 42.92 ? 328 CYS A CA    1 
ATOM   2555 C  C     . CYS A 1 331 ? -20.922 50.918 12.544  1.00 41.61 ? 328 CYS A C     1 
ATOM   2556 O  O     . CYS A 1 331 ? -20.014 50.332 11.976  1.00 39.36 ? 328 CYS A O     1 
ATOM   2557 C  CB    . CYS A 1 331 ? -22.805 52.220 11.464  1.00 44.57 ? 328 CYS A CB    1 
ATOM   2558 S  SG    . CYS A 1 331 ? -22.980 51.206 9.985   1.00 43.73 ? 328 CYS A SG    1 
ATOM   2559 N  N     . LYS A 1 332 ? -21.564 50.411 13.589  1.00 44.07 ? 329 LYS A N     1 
ATOM   2560 C  CA    . LYS A 1 332 ? -21.080 49.249 14.319  1.00 43.72 ? 329 LYS A CA    1 
ATOM   2561 C  C     . LYS A 1 332 ? -22.260 48.429 14.820  1.00 46.12 ? 329 LYS A C     1 
ATOM   2562 O  O     . LYS A 1 332 ? -23.145 48.962 15.490  1.00 49.36 ? 329 LYS A O     1 
ATOM   2563 C  CB    . LYS A 1 332 ? -20.219 49.736 15.497  1.00 44.90 ? 329 LYS A CB    1 
ATOM   2564 C  CG    . LYS A 1 332 ? -19.970 48.732 16.620  1.00 46.39 ? 329 LYS A CG    1 
ATOM   2565 C  CD    . LYS A 1 332 ? -19.131 49.347 17.756  1.00 48.19 ? 329 LYS A CD    1 
ATOM   2566 C  CE    . LYS A 1 332 ? -17.657 49.485 17.375  1.00 45.93 ? 329 LYS A CE    1 
ATOM   2567 N  NZ    . LYS A 1 332 ? -16.745 49.728 18.530  1.00 47.32 ? 329 LYS A NZ    1 
ATOM   2568 N  N     . ILE A 1 333 ? -22.267 47.141 14.492  1.00 45.33 ? 330 ILE A N     1 
ATOM   2569 C  CA    . ILE A 1 333 ? -23.299 46.215 14.968  1.00 47.98 ? 330 ILE A CA    1 
ATOM   2570 C  C     . ILE A 1 333 ? -22.953 45.753 16.378  1.00 49.90 ? 330 ILE A C     1 
ATOM   2571 O  O     . ILE A 1 333 ? -21.826 45.322 16.630  1.00 48.73 ? 330 ILE A O     1 
ATOM   2572 C  CB    . ILE A 1 333 ? -23.396 44.954 14.089  1.00 46.53 ? 330 ILE A CB    1 
ATOM   2573 C  CG1   . ILE A 1 333 ? -23.611 45.317 12.614  1.00 44.91 ? 330 ILE A CG1   1 
ATOM   2574 C  CG2   . ILE A 1 333 ? -24.523 44.051 14.604  1.00 49.16 ? 330 ILE A CG2   1 
ATOM   2575 C  CD1   . ILE A 1 333 ? -23.028 44.275 11.640  1.00 43.89 ? 330 ILE A CD1   1 
ATOM   2576 N  N     . GLY A 1 334 ? -23.923 45.819 17.283  1.00 53.60 ? 331 GLY A N     1 
ATOM   2577 C  CA    . GLY A 1 334 ? -23.694 45.497 18.687  1.00 56.10 ? 331 GLY A CA    1 
ATOM   2578 C  C     . GLY A 1 334 ? -23.019 46.643 19.412  1.00 56.71 ? 331 GLY A C     1 
ATOM   2579 O  O     . GLY A 1 334 ? -22.922 46.637 20.637  1.00 59.49 ? 331 GLY A O     1 
ATOM   2580 N  N     . THR A 1 354 ? -29.252 42.639 19.324  1.00 71.37 ? 351 THR A N     1 
ATOM   2581 C  CA    . THR A 1 354 ? -28.148 43.576 19.105  1.00 67.53 ? 351 THR A CA    1 
ATOM   2582 C  C     . THR A 1 354 ? -28.320 44.337 17.769  1.00 64.97 ? 351 THR A C     1 
ATOM   2583 O  O     . THR A 1 354 ? -28.618 43.733 16.731  1.00 63.67 ? 351 THR A O     1 
ATOM   2584 C  CB    . THR A 1 354 ? -26.767 42.852 19.195  1.00 64.42 ? 351 THR A CB    1 
ATOM   2585 O  OG1   . THR A 1 354 ? -26.495 42.119 17.989  1.00 60.75 ? 351 THR A OG1   1 
ATOM   2586 C  CG2   . THR A 1 354 ? -26.739 41.898 20.401  1.00 67.36 ? 351 THR A CG2   1 
ATOM   2587 N  N     . LYS A 1 355 ? -28.112 45.657 17.812  1.00 64.53 ? 352 LYS A N     1 
ATOM   2588 C  CA    . LYS A 1 355 ? -28.579 46.587 16.768  1.00 63.79 ? 352 LYS A CA    1 
ATOM   2589 C  C     . LYS A 1 355 ? -27.466 47.490 16.200  1.00 59.89 ? 352 LYS A C     1 
ATOM   2590 O  O     . LYS A 1 355 ? -26.290 47.325 16.534  1.00 57.29 ? 352 LYS A O     1 
ATOM   2591 C  CB    . LYS A 1 355 ? -29.695 47.472 17.347  1.00 68.65 ? 352 LYS A CB    1 
ATOM   2592 C  CG    . LYS A 1 355 ? -30.781 46.713 18.086  1.00 73.26 ? 352 LYS A CG    1 
ATOM   2593 C  CD    . LYS A 1 355 ? -31.874 47.643 18.551  1.00 78.20 ? 352 LYS A CD    1 
ATOM   2594 C  CE    . LYS A 1 355 ? -32.780 46.950 19.533  1.00 83.48 ? 352 LYS A CE    1 
ATOM   2595 N  NZ    . LYS A 1 355 ? -33.770 47.888 20.108  1.00 89.50 ? 352 LYS A NZ    1 
ATOM   2596 N  N     . LEU A 1 356 ? -27.853 48.449 15.351  1.00 59.80 ? 353 LEU A N     1 
ATOM   2597 C  CA    . LEU A 1 356 ? -26.906 49.378 14.709  1.00 56.81 ? 353 LEU A CA    1 
ATOM   2598 C  C     . LEU A 1 356 ? -26.638 50.647 15.538  1.00 58.44 ? 353 LEU A C     1 
ATOM   2599 O  O     . LEU A 1 356 ? -27.555 51.238 16.103  1.00 62.18 ? 353 LEU A O     1 
ATOM   2600 C  CB    . LEU A 1 356 ? -27.412 49.778 13.320  1.00 56.24 ? 353 LEU A CB    1 
ATOM   2601 C  CG    . LEU A 1 356 ? -26.387 50.525 12.460  1.00 53.42 ? 353 LEU A CG    1 
ATOM   2602 C  CD1   . LEU A 1 356 ? -25.245 49.609 12.067  1.00 49.24 ? 353 LEU A CD1   1 
ATOM   2603 C  CD2   . LEU A 1 356 ? -27.050 51.094 11.232  1.00 54.76 ? 353 LEU A CD2   1 
ATOM   2604 N  N     . VAL A 1 357 ? -25.366 51.046 15.581  1.00 55.77 ? 354 VAL A N     1 
ATOM   2605 C  CA    . VAL A 1 357 ? -24.908 52.220 16.322  1.00 57.29 ? 354 VAL A CA    1 
ATOM   2606 C  C     . VAL A 1 357 ? -23.988 53.043 15.427  1.00 54.66 ? 354 VAL A C     1 
ATOM   2607 O  O     . VAL A 1 357 ? -23.069 52.491 14.815  1.00 50.96 ? 354 VAL A O     1 
ATOM   2608 C  CB    . VAL A 1 357 ? -24.098 51.826 17.582  1.00 57.68 ? 354 VAL A CB    1 
ATOM   2609 C  CG1   . VAL A 1 357 ? -24.120 52.959 18.596  1.00 61.37 ? 354 VAL A CG1   1 
ATOM   2610 C  CG2   . VAL A 1 357 ? -24.640 50.538 18.210  1.00 59.35 ? 354 VAL A CG2   1 
ATOM   2611 N  N     . ILE A 1 358 ? -24.228 54.350 15.350  1.00 56.80 ? 355 ILE A N     1 
ATOM   2612 C  CA    . ILE A 1 358 ? -23.408 55.232 14.514  1.00 55.21 ? 355 ILE A CA    1 
ATOM   2613 C  C     . ILE A 1 358 ? -22.135 55.663 15.252  1.00 54.71 ? 355 ILE A C     1 
ATOM   2614 O  O     . ILE A 1 358 ? -22.202 56.282 16.312  1.00 58.05 ? 355 ILE A O     1 
ATOM   2615 C  CB    . ILE A 1 358 ? -24.180 56.490 14.065  1.00 58.16 ? 355 ILE A CB    1 
ATOM   2616 C  CG1   . ILE A 1 358 ? -25.397 56.109 13.218  1.00 59.16 ? 355 ILE A CG1   1 
ATOM   2617 C  CG2   . ILE A 1 358 ? -23.273 57.403 13.258  1.00 57.22 ? 355 ILE A CG2   1 
ATOM   2618 C  CD1   . ILE A 1 358 ? -25.041 55.415 11.922  1.00 55.73 ? 355 ILE A CD1   1 
ATOM   2619 N  N     . MET A 1 359 ? -20.981 55.341 14.676  1.00 51.30 ? 356 MET A N     1 
ATOM   2620 C  CA    . MET A 1 359 ? -19.690 55.647 15.293  1.00 50.86 ? 356 MET A CA    1 
ATOM   2621 C  C     . MET A 1 359 ? -19.201 57.031 14.935  1.00 51.71 ? 356 MET A C     1 
ATOM   2622 O  O     . MET A 1 359 ? -19.375 57.493 13.810  1.00 50.92 ? 356 MET A O     1 
ATOM   2623 C  CB    . MET A 1 359 ? -18.619 54.678 14.818  1.00 47.24 ? 356 MET A CB    1 
ATOM   2624 C  CG    . MET A 1 359 ? -18.832 53.256 15.199  1.00 46.75 ? 356 MET A CG    1 
ATOM   2625 S  SD    . MET A 1 359 ? -17.426 52.328 14.586  1.00 44.28 ? 356 MET A SD    1 
ATOM   2626 C  CE    . MET A 1 359 ? -16.216 52.646 15.873  1.00 46.25 ? 356 MET A CE    1 
ATOM   2627 N  N     . GLU A 1 360 ? -18.547 57.667 15.896  1.00 53.72 ? 357 GLU A N     1 
ATOM   2628 C  CA    . GLU A 1 360 ? -17.873 58.927 15.656  1.00 55.11 ? 357 GLU A CA    1 
ATOM   2629 C  C     . GLU A 1 360 ? -16.433 58.579 15.308  1.00 52.01 ? 357 GLU A C     1 
ATOM   2630 O  O     . GLU A 1 360 ? -15.815 57.772 16.002  1.00 51.16 ? 357 GLU A O     1 
ATOM   2631 C  CB    . GLU A 1 360 ? -17.928 59.824 16.896  1.00 59.39 ? 357 GLU A CB    1 
ATOM   2632 C  CG    . GLU A 1 360 ? -19.344 60.101 17.429  1.00 64.12 ? 357 GLU A CG    1 
ATOM   2633 C  CD    . GLU A 1 360 ? -20.223 60.898 16.462  1.00 66.82 ? 357 GLU A CD    1 
ATOM   2634 O  OE1   . GLU A 1 360 ? -21.465 60.854 16.614  1.00 69.45 ? 357 GLU A OE1   1 
ATOM   2635 O  OE2   . GLU A 1 360 ? -19.681 61.567 15.553  1.00 67.26 ? 357 GLU A OE2   1 
ATOM   2636 N  N     . PRO A 1 361 ? -15.893 59.178 14.234  1.00 50.73 ? 358 PRO A N     1 
ATOM   2637 C  CA    . PRO A 1 361 ? -14.514 58.856 13.872  1.00 48.60 ? 358 PRO A CA    1 
ATOM   2638 C  C     . PRO A 1 361 ? -13.573 59.039 15.064  1.00 50.13 ? 358 PRO A C     1 
ATOM   2639 O  O     . PRO A 1 361 ? -13.544 60.101 15.676  1.00 53.07 ? 358 PRO A O     1 
ATOM   2640 C  CB    . PRO A 1 361 ? -14.195 59.851 12.745  1.00 49.12 ? 358 PRO A CB    1 
ATOM   2641 C  CG    . PRO A 1 361 ? -15.221 60.929 12.852  1.00 52.07 ? 358 PRO A CG    1 
ATOM   2642 C  CD    . PRO A 1 361 ? -16.442 60.263 13.403  1.00 52.25 ? 358 PRO A CD    1 
ATOM   2643 N  N     . SER A 1 362 ? -12.834 57.987 15.388  1.00 48.33 ? 359 SER A N     1 
ATOM   2644 C  CA    . SER A 1 362 ? -12.038 57.928 16.607  1.00 50.04 ? 359 SER A CA    1 
ATOM   2645 C  C     . SER A 1 362 ? -10.659 57.380 16.285  1.00 48.03 ? 359 SER A C     1 
ATOM   2646 O  O     . SER A 1 362 ? -10.440 56.835 15.209  1.00 45.30 ? 359 SER A O     1 
ATOM   2647 C  CB    . SER A 1 362 ? -12.728 57.015 17.620  1.00 50.58 ? 359 SER A CB    1 
ATOM   2648 O  OG    . SER A 1 362 ? -12.095 57.092 18.882  1.00 53.68 ? 359 SER A OG    1 
ATOM   2649 N  N     . ALA A 1 363 ? -9.734  57.516 17.226  1.00 49.78 ? 360 ALA A N     1 
ATOM   2650 C  CA    . ALA A 1 363 ? -8.381  57.008 17.040  1.00 48.75 ? 360 ALA A CA    1 
ATOM   2651 C  C     . ALA A 1 363 ? -8.388  55.475 16.991  1.00 45.81 ? 360 ALA A C     1 
ATOM   2652 O  O     . ALA A 1 363 ? -7.511  54.865 16.384  1.00 44.28 ? 360 ALA A O     1 
ATOM   2653 C  CB    . ALA A 1 363 ? -7.463  57.514 18.162  1.00 52.38 ? 360 ALA A CB    1 
ATOM   2654 N  N     . ASP A 1 364 ? -9.402  54.877 17.614  1.00 45.19 ? 361 ASP A N     1 
ATOM   2655 C  CA    . ASP A 1 364 ? -9.485  53.432 17.797  1.00 43.48 ? 361 ASP A CA    1 
ATOM   2656 C  C     . ASP A 1 364 ? -10.033 52.663 16.609  1.00 39.15 ? 361 ASP A C     1 
ATOM   2657 O  O     . ASP A 1 364 ? -10.091 51.439 16.669  1.00 37.96 ? 361 ASP A O     1 
ATOM   2658 C  CB    . ASP A 1 364 ? -10.324 53.106 19.040  1.00 45.71 ? 361 ASP A CB    1 
ATOM   2659 C  CG    . ASP A 1 364 ? -9.673  53.594 20.318  1.00 50.82 ? 361 ASP A CG    1 
ATOM   2660 O  OD1   . ASP A 1 364 ? -8.471  53.931 20.277  1.00 54.06 ? 361 ASP A OD1   1 
ATOM   2661 O  OD2   . ASP A 1 364 ? -10.351 53.639 21.367  1.00 54.61 ? 361 ASP A OD2   1 
ATOM   2662 N  N     . ILE A 1 365 ? -10.437 53.358 15.542  1.00 36.93 ? 362 ILE A N     1 
ATOM   2663 C  CA    . ILE A 1 365 ? -10.788 52.679 14.286  1.00 33.30 ? 362 ILE A CA    1 
ATOM   2664 C  C     . ILE A 1 365 ? -9.538  52.312 13.470  1.00 31.91 ? 362 ILE A C     1 
ATOM   2665 O  O     . ILE A 1 365 ? -9.610  51.517 12.521  1.00 30.09 ? 362 ILE A O     1 
ATOM   2666 C  CB    . ILE A 1 365 ? -11.787 53.499 13.417  1.00 32.78 ? 362 ILE A CB    1 
ATOM   2667 C  CG1   . ILE A 1 365 ? -11.081 54.664 12.701  1.00 33.12 ? 362 ILE A CG1   1 
ATOM   2668 C  CG2   . ILE A 1 365 ? -12.993 53.947 14.277  1.00 33.92 ? 362 ILE A CG2   1 
ATOM   2669 C  CD1   . ILE A 1 365 ? -12.004 55.544 11.864  1.00 32.85 ? 362 ILE A CD1   1 
ATOM   2670 N  N     . LYS A 1 366 ? -8.400  52.889 13.844  1.00 33.10 ? 363 LYS A N     1 
ATOM   2671 C  CA    . LYS A 1 366 ? -7.138  52.667 13.145  1.00 32.85 ? 363 LYS A CA    1 
ATOM   2672 C  C     . LYS A 1 366 ? -6.745  51.173 13.106  1.00 31.15 ? 363 LYS A C     1 
ATOM   2673 O  O     . LYS A 1 366 ? -6.791  50.491 14.123  1.00 31.58 ? 363 LYS A O     1 
ATOM   2674 C  CB    . LYS A 1 366 ? -6.044  53.485 13.832  1.00 35.98 ? 363 LYS A CB    1 
ATOM   2675 C  CG    . LYS A 1 366 ? -4.736  53.594 13.078  1.00 37.42 ? 363 LYS A CG    1 
ATOM   2676 C  CD    . LYS A 1 366 ? -3.742  54.425 13.886  1.00 41.79 ? 363 LYS A CD    1 
ATOM   2677 C  CE    . LYS A 1 366 ? -2.600  54.927 13.026  1.00 43.72 ? 363 LYS A CE    1 
ATOM   2678 N  NZ    . LYS A 1 366 ? -1.839  56.001 13.720  1.00 48.06 ? 363 LYS A NZ    1 
ATOM   2679 N  N     . HIS A 1 367 ? -6.375  50.692 11.918  1.00 29.11 ? 364 HIS A N     1 
ATOM   2680 C  CA    . HIS A 1 367 ? -6.007  49.289 11.665  1.00 28.21 ? 364 HIS A CA    1 
ATOM   2681 C  C     . HIS A 1 367 ? -7.191  48.331 11.541  1.00 26.27 ? 364 HIS A C     1 
ATOM   2682 O  O     . HIS A 1 367 ? -6.985  47.139 11.289  1.00 25.37 ? 364 HIS A O     1 
ATOM   2683 C  CB    . HIS A 1 367 ? -5.037  48.746 12.715  1.00 30.31 ? 364 HIS A CB    1 
ATOM   2684 C  CG    . HIS A 1 367 ? -3.799  49.565 12.860  1.00 32.82 ? 364 HIS A CG    1 
ATOM   2685 N  ND1   . HIS A 1 367 ? -3.042  49.954 11.778  1.00 33.26 ? 364 HIS A ND1   1 
ATOM   2686 C  CD2   . HIS A 1 367 ? -3.186  50.072 13.953  1.00 35.28 ? 364 HIS A CD2   1 
ATOM   2687 C  CE1   . HIS A 1 367 ? -2.016  50.669 12.196  1.00 35.49 ? 364 HIS A CE1   1 
ATOM   2688 N  NE2   . HIS A 1 367 ? -2.077  50.753 13.513  1.00 37.63 ? 364 HIS A NE2   1 
ATOM   2689 N  N     . HIS A 1 368 ? -8.414  48.836 11.716  1.00 25.30 ? 365 HIS A N     1 
ATOM   2690 C  CA    . HIS A 1 368 ? -9.603  47.994 11.599  1.00 24.05 ? 365 HIS A CA    1 
ATOM   2691 C  C     . HIS A 1 368 ? -10.053 47.875 10.165  1.00 22.74 ? 365 HIS A C     1 
ATOM   2692 O  O     . HIS A 1 368 ? -9.907  48.812 9.367   1.00 23.62 ? 365 HIS A O     1 
ATOM   2693 C  CB    . HIS A 1 368 ? -10.763 48.537 12.440  1.00 24.29 ? 365 HIS A CB    1 
ATOM   2694 C  CG    . HIS A 1 368 ? -10.629 48.233 13.893  1.00 24.71 ? 365 HIS A CG    1 
ATOM   2695 N  ND1   . HIS A 1 368 ? -11.243 47.150 14.481  1.00 22.85 ? 365 HIS A ND1   1 
ATOM   2696 C  CD2   . HIS A 1 368 ? -9.928  48.853 14.872  1.00 25.56 ? 365 HIS A CD2   1 
ATOM   2697 C  CE1   . HIS A 1 368 ? -10.928 47.117 15.764  1.00 26.29 ? 365 HIS A CE1   1 
ATOM   2698 N  NE2   . HIS A 1 368 ? -10.137 48.144 16.029  1.00 26.76 ? 365 HIS A NE2   1 
ATOM   2699 N  N     . LEU A 1 369 ? -10.598 46.709 9.841   1.00 22.08 ? 366 LEU A N     1 
ATOM   2700 C  CA    . LEU A 1 369 ? -11.372 46.544 8.620   1.00 20.80 ? 366 LEU A CA    1 
ATOM   2701 C  C     . LEU A 1 369 ? -12.747 47.195 8.771   1.00 21.00 ? 366 LEU A C     1 
ATOM   2702 O  O     . LEU A 1 369 ? -13.342 47.163 9.847   1.00 21.31 ? 366 LEU A O     1 
ATOM   2703 C  CB    . LEU A 1 369 ? -11.564 45.063 8.299   1.00 20.29 ? 366 LEU A CB    1 
ATOM   2704 C  CG    . LEU A 1 369 ? -10.335 44.217 7.961   1.00 21.12 ? 366 LEU A CG    1 
ATOM   2705 C  CD1   . LEU A 1 369 ? -10.793 42.808 7.610   1.00 21.14 ? 366 LEU A CD1   1 
ATOM   2706 C  CD2   . LEU A 1 369 ? -9.476  44.804 6.823   1.00 20.53 ? 366 LEU A CD2   1 
ATOM   2707 N  N     . PHE A 1 370 ? -13.239 47.788 7.682   1.00 20.87 ? 367 PHE A N     1 
ATOM   2708 C  CA    . PHE A 1 370 ? -14.623 48.214 7.580   1.00 21.30 ? 367 PHE A CA    1 
ATOM   2709 C  C     . PHE A 1 370 ? -15.208 47.628 6.307   1.00 21.05 ? 367 PHE A C     1 
ATOM   2710 O  O     . PHE A 1 370 ? -14.572 47.661 5.264   1.00 21.52 ? 367 PHE A O     1 
ATOM   2711 C  CB    . PHE A 1 370 ? -14.718 49.735 7.512   1.00 22.04 ? 367 PHE A CB    1 
ATOM   2712 C  CG    . PHE A 1 370 ? -14.688 50.402 8.845   1.00 22.66 ? 367 PHE A CG    1 
ATOM   2713 C  CD1   . PHE A 1 370 ? -13.496 50.566 9.525   1.00 22.59 ? 367 PHE A CD1   1 
ATOM   2714 C  CD2   . PHE A 1 370 ? -15.849 50.875 9.425   1.00 23.58 ? 367 PHE A CD2   1 
ATOM   2715 C  CE1   . PHE A 1 370 ? -13.464 51.180 10.759  1.00 23.21 ? 367 PHE A CE1   1 
ATOM   2716 C  CE2   . PHE A 1 370 ? -15.815 51.498 10.662  1.00 24.80 ? 367 PHE A CE2   1 
ATOM   2717 C  CZ    . PHE A 1 370 ? -14.617 51.648 11.325  1.00 24.50 ? 367 PHE A CZ    1 
ATOM   2718 N  N     . ALA A 1 371 ? -16.420 47.099 6.391   1.00 21.48 ? 368 ALA A N     1 
ATOM   2719 C  CA    . ALA A 1 371 ? -17.116 46.584 5.218   1.00 21.61 ? 368 ALA A CA    1 
ATOM   2720 C  C     . ALA A 1 371 ? -17.900 47.710 4.570   1.00 22.95 ? 368 ALA A C     1 
ATOM   2721 O  O     . ALA A 1 371 ? -18.506 48.519 5.259   1.00 23.68 ? 368 ALA A O     1 
ATOM   2722 C  CB    . ALA A 1 371 ? -18.044 45.467 5.605   1.00 21.46 ? 368 ALA A CB    1 
ATOM   2723 N  N     . PHE A 1 372 ? -17.885 47.765 3.246   1.00 23.94 ? 369 PHE A N     1 
ATOM   2724 C  CA    . PHE A 1 372 ? -18.786 48.647 2.516   1.00 26.38 ? 369 PHE A CA    1 
ATOM   2725 C  C     . PHE A 1 372 ? -20.136 47.981 2.386   1.00 27.78 ? 369 PHE A C     1 
ATOM   2726 O  O     . PHE A 1 372 ? -20.274 47.036 1.621   1.00 28.14 ? 369 PHE A O     1 
ATOM   2727 C  CB    . PHE A 1 372 ? -18.244 48.945 1.128   1.00 27.00 ? 369 PHE A CB    1 
ATOM   2728 C  CG    . PHE A 1 372 ? -16.953 49.692 1.139   1.00 27.24 ? 369 PHE A CG    1 
ATOM   2729 C  CD1   . PHE A 1 372 ? -15.771 49.063 0.778   1.00 25.90 ? 369 PHE A CD1   1 
ATOM   2730 C  CD2   . PHE A 1 372 ? -16.922 51.031 1.496   1.00 28.68 ? 369 PHE A CD2   1 
ATOM   2731 C  CE1   . PHE A 1 372 ? -14.577 49.748 0.789   1.00 26.41 ? 369 PHE A CE1   1 
ATOM   2732 C  CE2   . PHE A 1 372 ? -15.731 51.723 1.507   1.00 28.79 ? 369 PHE A CE2   1 
ATOM   2733 C  CZ    . PHE A 1 372 ? -14.549 51.076 1.151   1.00 27.29 ? 369 PHE A CZ    1 
ATOM   2734 N  N     . SER A 1 373 ? -21.137 48.481 3.107   1.00 29.57 ? 370 SER A N     1 
ATOM   2735 C  CA    . SER A 1 373 ? -22.461 47.854 3.105   1.00 31.53 ? 370 SER A CA    1 
ATOM   2736 C  C     . SER A 1 373 ? -23.176 48.093 1.790   1.00 34.15 ? 370 SER A C     1 
ATOM   2737 O  O     . SER A 1 373 ? -23.035 49.159 1.190   1.00 35.07 ? 370 SER A O     1 
ATOM   2738 C  CB    . SER A 1 373 ? -23.318 48.392 4.252   1.00 33.08 ? 370 SER A CB    1 
ATOM   2739 O  OG    . SER A 1 373 ? -24.533 47.667 4.356   1.00 34.96 ? 370 SER A OG    1 
ATOM   2740 N  N     . ARG A 1 374 ? -23.956 47.108 1.351   1.00 36.00 ? 371 ARG A N     1 
ATOM   2741 C  CA    . ARG A 1 374 ? -24.810 47.278 0.171   1.00 39.40 ? 371 ARG A CA    1 
ATOM   2742 C  C     . ARG A 1 374 ? -26.064 48.090 0.490   1.00 42.59 ? 371 ARG A C     1 
ATOM   2743 O  O     . ARG A 1 374 ? -26.746 48.565 -0.421  1.00 45.28 ? 371 ARG A O     1 
ATOM   2744 C  CB    . ARG A 1 374 ? -25.179 45.927 -0.450  1.00 40.39 ? 371 ARG A CB    1 
ATOM   2745 C  CG    . ARG A 1 374 ? -23.991 45.272 -1.135  1.00 39.74 ? 371 ARG A CG    1 
ATOM   2746 C  CD    . ARG A 1 374 ? -24.360 43.984 -1.844  1.00 43.04 ? 371 ARG A CD    1 
ATOM   2747 N  NE    . ARG A 1 374 ? -23.373 43.621 -2.868  1.00 43.94 ? 371 ARG A NE    1 
ATOM   2748 C  CZ    . ARG A 1 374 ? -23.402 44.020 -4.144  1.00 46.86 ? 371 ARG A CZ    1 
ATOM   2749 N  NH1   . ARG A 1 374 ? -24.374 44.804 -4.599  1.00 50.18 ? 371 ARG A NH1   1 
ATOM   2750 N  NH2   . ARG A 1 374 ? -22.448 43.622 -4.980  1.00 47.17 ? 371 ARG A NH2   1 
ATOM   2751 N  N     . SER A 1 375 ? -26.357 48.243 1.782   1.00 42.78 ? 372 SER A N     1 
ATOM   2752 C  CA    . SER A 1 375 ? -27.434 49.118 2.246   1.00 46.19 ? 372 SER A CA    1 
ATOM   2753 C  C     . SER A 1 375 ? -27.055 50.571 1.992   1.00 46.60 ? 372 SER A C     1 
ATOM   2754 O  O     . SER A 1 375 ? -25.948 50.984 2.330   1.00 44.78 ? 372 SER A O     1 
ATOM   2755 C  CB    . SER A 1 375 ? -27.676 48.902 3.738   1.00 45.96 ? 372 SER A CB    1 
ATOM   2756 O  OG    . SER A 1 375 ? -28.541 49.884 4.263   1.00 50.07 ? 372 SER A OG    1 
ATOM   2757 N  N     . THR A 1 376 ? -27.966 51.341 1.400   1.00 50.25 ? 373 THR A N     1 
ATOM   2758 C  CA    . THR A 1 376 ? -27.670 52.731 1.018   1.00 51.35 ? 373 THR A CA    1 
ATOM   2759 C  C     . THR A 1 376 ? -27.748 53.665 2.231   1.00 51.82 ? 373 THR A C     1 
ATOM   2760 O  O     . THR A 1 376 ? -27.014 54.649 2.303   1.00 51.32 ? 373 THR A O     1 
ATOM   2761 C  CB    . THR A 1 376 ? -28.597 53.264 -0.118  1.00 55.48 ? 373 THR A CB    1 
ATOM   2762 O  OG1   . THR A 1 376 ? -29.833 53.722 0.434   1.00 59.68 ? 373 THR A OG1   1 
ATOM   2763 C  CG2   . THR A 1 376 ? -28.871 52.188 -1.179  1.00 55.81 ? 373 THR A CG2   1 
ATOM   2764 N  N     . LYS A 1 377 ? -28.634 53.345 3.174   1.00 53.15 ? 374 LYS A N     1 
ATOM   2765 C  CA    . LYS A 1 377 ? -28.733 54.069 4.441   1.00 54.04 ? 374 LYS A CA    1 
ATOM   2766 C  C     . LYS A 1 377 ? -28.141 53.240 5.592   1.00 51.04 ? 374 LYS A C     1 
ATOM   2767 O  O     . LYS A 1 377 ? -28.069 52.013 5.519   1.00 49.48 ? 374 LYS A O     1 
ATOM   2768 C  CB    . LYS A 1 377 ? -30.195 54.418 4.743   1.00 59.05 ? 374 LYS A CB    1 
ATOM   2769 C  CG    . LYS A 1 377 ? -30.841 55.346 3.723   1.00 62.56 ? 374 LYS A CG    1 
ATOM   2770 C  CD    . LYS A 1 377 ? -32.338 55.471 3.954   1.00 67.87 ? 374 LYS A CD    1 
ATOM   2771 C  CE    . LYS A 1 377 ? -33.025 56.167 2.793   1.00 71.83 ? 374 LYS A CE    1 
ATOM   2772 N  NZ    . LYS A 1 377 ? -34.508 56.167 2.944   1.00 77.36 ? 374 LYS A NZ    1 
ATOM   2773 N  N     . ALA A 1 378 ? -27.715 53.926 6.648   1.00 50.72 ? 375 ALA A N     1 
ATOM   2774 C  CA    . ALA A 1 378 ? -27.198 53.283 7.856   1.00 48.59 ? 375 ALA A CA    1 
ATOM   2775 C  C     . ALA A 1 378 ? -28.335 52.990 8.832   1.00 51.78 ? 375 ALA A C     1 
ATOM   2776 O  O     . ALA A 1 378 ? -28.406 53.597 9.897   1.00 53.42 ? 375 ALA A O     1 
ATOM   2777 C  CB    . ALA A 1 378 ? -26.160 54.181 8.522   1.00 47.27 ? 375 ALA A CB    1 
ATOM   2778 N  N     . ASP A 1 379 ? -29.208 52.050 8.472   1.00 53.17 ? 376 ASP A N     1 
ATOM   2779 C  CA    . ASP A 1 379 ? -30.397 51.723 9.277   1.00 57.12 ? 376 ASP A CA    1 
ATOM   2780 C  C     . ASP A 1 379 ? -30.502 50.208 9.555   1.00 56.24 ? 376 ASP A C     1 
ATOM   2781 O  O     . ASP A 1 379 ? -29.488 49.499 9.540   1.00 52.57 ? 376 ASP A O     1 
ATOM   2782 C  CB    . ASP A 1 379 ? -31.649 52.276 8.579   1.00 61.57 ? 376 ASP A CB    1 
ATOM   2783 C  CG    . ASP A 1 379 ? -31.851 51.707 7.181   1.00 60.98 ? 376 ASP A CG    1 
ATOM   2784 O  OD1   . ASP A 1 379 ? -30.988 50.941 6.710   1.00 57.47 ? 376 ASP A OD1   1 
ATOM   2785 O  OD2   . ASP A 1 379 ? -32.873 52.035 6.547   1.00 64.62 ? 376 ASP A OD2   1 
ATOM   2786 N  N     . GLU A 1 380 ? -31.715 49.717 9.809   1.00 60.25 ? 377 GLU A N     1 
ATOM   2787 C  CA    . GLU A 1 380 ? -31.943 48.292 10.073  1.00 60.39 ? 377 GLU A CA    1 
ATOM   2788 C  C     . GLU A 1 380 ? -31.507 47.403 8.908   1.00 57.44 ? 377 GLU A C     1 
ATOM   2789 O  O     . GLU A 1 380 ? -31.241 46.221 9.107   1.00 56.20 ? 377 GLU A O     1 
ATOM   2790 C  CB    . GLU A 1 380 ? -33.423 47.984 10.362  1.00 65.78 ? 377 GLU A CB    1 
ATOM   2791 C  CG    . GLU A 1 380 ? -34.157 48.939 11.292  1.00 70.77 ? 377 GLU A CG    1 
ATOM   2792 C  CD    . GLU A 1 380 ? -35.167 49.815 10.558  1.00 75.25 ? 377 GLU A CD    1 
ATOM   2793 O  OE1   . GLU A 1 380 ? -34.827 50.378 9.495   1.00 74.42 ? 377 GLU A OE1   1 
ATOM   2794 O  OE2   . GLU A 1 380 ? -36.305 49.936 11.049  1.00 80.33 ? 377 GLU A OE2   1 
ATOM   2795 N  N     . ASN A 1 381 ? -31.471 47.959 7.697   1.00 56.96 ? 378 ASN A N     1 
ATOM   2796 C  CA    . ASN A 1 381 ? -31.077 47.201 6.516   1.00 54.90 ? 378 ASN A CA    1 
ATOM   2797 C  C     . ASN A 1 381 ? -29.639 46.702 6.609   1.00 50.06 ? 378 ASN A C     1 
ATOM   2798 O  O     . ASN A 1 381 ? -29.330 45.644 6.078   1.00 48.49 ? 378 ASN A O     1 
ATOM   2799 C  CB    . ASN A 1 381 ? -31.251 48.029 5.236   1.00 55.75 ? 378 ASN A CB    1 
ATOM   2800 C  CG    . ASN A 1 381 ? -32.708 48.338 4.924   1.00 62.36 ? 378 ASN A CG    1 
ATOM   2801 O  OD1   . ASN A 1 381 ? -33.561 48.394 5.819   1.00 66.10 ? 378 ASN A OD1   1 
ATOM   2802 N  ND2   . ASN A 1 381 ? -33.000 48.550 3.645   1.00 65.29 ? 378 ASN A ND2   1 
ATOM   2803 N  N     . VAL A 1 382 ? -28.777 47.454 7.295   1.00 48.11 ? 379 VAL A N     1 
ATOM   2804 C  CA    . VAL A 1 382 ? -27.340 47.148 7.362   1.00 44.25 ? 379 VAL A CA    1 
ATOM   2805 C  C     . VAL A 1 382 ? -27.052 45.768 7.967   1.00 43.50 ? 379 VAL A C     1 
ATOM   2806 O  O     . VAL A 1 382 ? -26.207 45.023 7.463   1.00 41.16 ? 379 VAL A O     1 
ATOM   2807 C  CB    . VAL A 1 382 ? -26.566 48.248 8.143   1.00 43.21 ? 379 VAL A CB    1 
ATOM   2808 C  CG1   . VAL A 1 382 ? -25.151 47.803 8.485   1.00 39.79 ? 379 VAL A CG1   1 
ATOM   2809 C  CG2   . VAL A 1 382 ? -26.522 49.539 7.333   1.00 43.44 ? 379 VAL A CG2   1 
ATOM   2810 N  N     . LEU A 1 383 ? -27.783 45.433 9.024   1.00 46.29 ? 380 LEU A N     1 
ATOM   2811 C  CA    . LEU A 1 383 ? -27.600 44.183 9.766   1.00 46.22 ? 380 LEU A CA    1 
ATOM   2812 C  C     . LEU A 1 383 ? -27.576 42.945 8.852   1.00 45.08 ? 380 LEU A C     1 
ATOM   2813 O  O     . LEU A 1 383 ? -26.615 42.172 8.884   1.00 43.11 ? 380 LEU A O     1 
ATOM   2814 C  CB    . LEU A 1 383 ? -28.710 44.033 10.827  1.00 50.55 ? 380 LEU A CB    1 
ATOM   2815 C  CG    . LEU A 1 383 ? -28.249 43.475 12.178  1.00 51.77 ? 380 LEU A CG    1 
ATOM   2816 C  CD1   . LEU A 1 383 ? -27.708 44.626 13.041  1.00 52.53 ? 380 LEU A CD1   1 
ATOM   2817 C  CD2   . LEU A 1 383 ? -29.373 42.723 12.899  1.00 56.45 ? 380 LEU A CD2   1 
ATOM   2818 N  N     . LYS A 1 384 ? -28.621 42.784 8.036   1.00 46.72 ? 381 LYS A N     1 
ATOM   2819 C  CA    . LYS A 1 384 ? -28.761 41.625 7.144   1.00 46.59 ? 381 LYS A CA    1 
ATOM   2820 C  C     . LYS A 1 384 ? -28.560 41.954 5.648   1.00 44.87 ? 381 LYS A C     1 
ATOM   2821 O  O     . LYS A 1 384 ? -29.065 41.243 4.775   1.00 46.42 ? 381 LYS A O     1 
ATOM   2822 C  CB    . LYS A 1 384 ? -30.114 40.923 7.389   1.00 51.03 ? 381 LYS A CB    1 
ATOM   2823 C  CG    . LYS A 1 384 ? -30.125 40.032 8.647   1.00 52.65 ? 381 LYS A CG    1 
ATOM   2824 C  CD    . LYS A 1 384 ? -31.341 39.084 8.706   1.00 57.92 ? 381 LYS A CD    1 
ATOM   2825 C  CE    . LYS A 1 384 ? -31.195 38.019 9.824   1.00 59.06 ? 381 LYS A CE    1 
ATOM   2826 N  NZ    . LYS A 1 384 ? -32.055 36.782 9.667   1.00 60.79 ? 381 LYS A NZ    1 
ATOM   2827 N  N     . SER A 1 385 ? -27.802 43.012 5.354   1.00 41.65 ? 382 SER A N     1 
ATOM   2828 C  CA    . SER A 1 385 ? -27.378 43.294 3.981   1.00 40.11 ? 382 SER A CA    1 
ATOM   2829 C  C     . SER A 1 385 ? -25.992 42.694 3.737   1.00 36.28 ? 382 SER A C     1 
ATOM   2830 O  O     . SER A 1 385 ? -25.109 42.827 4.576   1.00 33.64 ? 382 SER A O     1 
ATOM   2831 C  CB    . SER A 1 385 ? -27.307 44.803 3.715   1.00 40.00 ? 382 SER A CB    1 
ATOM   2832 O  OG    . SER A 1 385 ? -28.592 45.352 3.493   1.00 44.66 ? 382 SER A OG    1 
ATOM   2833 N  N     . PRO A 1 386 ? -25.789 42.050 2.577   1.00 35.97 ? 383 PRO A N     1 
ATOM   2834 C  CA    . PRO A 1 386 ? -24.413 41.678 2.230   1.00 33.07 ? 383 PRO A CA    1 
ATOM   2835 C  C     . PRO A 1 386 ? -23.563 42.925 2.023   1.00 31.23 ? 383 PRO A C     1 
ATOM   2836 O  O     . PRO A 1 386 ? -24.081 44.046 2.074   1.00 31.72 ? 383 PRO A O     1 
ATOM   2837 C  CB    . PRO A 1 386 ? -24.550 40.883 0.918   1.00 34.38 ? 383 PRO A CB    1 
ATOM   2838 C  CG    . PRO A 1 386 ? -26.015 40.816 0.595   1.00 38.27 ? 383 PRO A CG    1 
ATOM   2839 C  CD    . PRO A 1 386 ? -26.764 41.728 1.518   1.00 38.97 ? 383 PRO A CD    1 
ATOM   2840 N  N     . VAL A 1 387 ? -22.276 42.727 1.784   1.00 29.19 ? 384 VAL A N     1 
ATOM   2841 C  CA    . VAL A 1 387 ? -21.349 43.835 1.635   1.00 28.11 ? 384 VAL A CA    1 
ATOM   2842 C  C     . VAL A 1 387 ? -20.657 43.790 0.271   1.00 28.50 ? 384 VAL A C     1 
ATOM   2843 O  O     . VAL A 1 387 ? -20.536 42.737 -0.339  1.00 28.85 ? 384 VAL A O     1 
ATOM   2844 C  CB    . VAL A 1 387 ? -20.303 43.831 2.773   1.00 26.26 ? 384 VAL A CB    1 
ATOM   2845 C  CG1   . VAL A 1 387 ? -21.002 43.804 4.130   1.00 27.08 ? 384 VAL A CG1   1 
ATOM   2846 C  CG2   . VAL A 1 387 ? -19.363 42.647 2.645   1.00 24.30 ? 384 VAL A CG2   1 
ATOM   2847 N  N     . PHE A 1 388 ? -20.213 44.951 -0.196  1.00 28.75 ? 385 PHE A N     1 
ATOM   2848 C  CA    . PHE A 1 388 ? -19.496 45.069 -1.458  1.00 29.24 ? 385 PHE A CA    1 
ATOM   2849 C  C     . PHE A 1 388 ? -18.081 44.520 -1.335  1.00 27.60 ? 385 PHE A C     1 
ATOM   2850 O  O     . PHE A 1 388 ? -17.542 43.959 -2.272  1.00 28.06 ? 385 PHE A O     1 
ATOM   2851 C  CB    . PHE A 1 388 ? -19.387 46.533 -1.866  1.00 30.30 ? 385 PHE A CB    1 
ATOM   2852 C  CG    . PHE A 1 388 ? -20.641 47.116 -2.447  1.00 33.06 ? 385 PHE A CG    1 
ATOM   2853 C  CD1   . PHE A 1 388 ? -21.384 48.047 -1.734  1.00 35.54 ? 385 PHE A CD1   1 
ATOM   2854 C  CD2   . PHE A 1 388 ? -21.040 46.790 -3.737  1.00 36.31 ? 385 PHE A CD2   1 
ATOM   2855 C  CE1   . PHE A 1 388 ? -22.545 48.631 -2.293  1.00 38.75 ? 385 PHE A CE1   1 
ATOM   2856 C  CE2   . PHE A 1 388 ? -22.189 47.354 -4.302  1.00 39.78 ? 385 PHE A CE2   1 
ATOM   2857 C  CZ    . PHE A 1 388 ? -22.944 48.278 -3.574  1.00 40.88 ? 385 PHE A CZ    1 
ATOM   2858 N  N     . GLY A 1 389 ? -17.488 44.695 -0.161  1.00 26.13 ? 386 GLY A N     1 
ATOM   2859 C  CA    . GLY A 1 389 ? -16.088 44.391 0.065   1.00 24.41 ? 386 GLY A CA    1 
ATOM   2860 C  C     . GLY A 1 389 ? -15.626 45.130 1.301   1.00 23.42 ? 386 GLY A C     1 
ATOM   2861 O  O     . GLY A 1 389 ? -16.463 45.598 2.084   1.00 22.83 ? 386 GLY A O     1 
ATOM   2862 N  N     . PHE A 1 390 ? -14.304 45.232 1.472   1.00 22.68 ? 387 PHE A N     1 
ATOM   2863 C  CA    . PHE A 1 390 ? -13.704 45.812 2.667   1.00 22.20 ? 387 PHE A CA    1 
ATOM   2864 C  C     . PHE A 1 390 ? -12.636 46.826 2.323   1.00 23.16 ? 387 PHE A C     1 
ATOM   2865 O  O     . PHE A 1 390 ? -12.144 46.885 1.186   1.00 24.18 ? 387 PHE A O     1 
ATOM   2866 C  CB    . PHE A 1 390 ? -13.075 44.714 3.545   1.00 21.85 ? 387 PHE A CB    1 
ATOM   2867 C  CG    . PHE A 1 390 ? -14.078 43.783 4.154   1.00 21.90 ? 387 PHE A CG    1 
ATOM   2868 C  CD1   . PHE A 1 390 ? -14.634 42.761 3.406   1.00 22.29 ? 387 PHE A CD1   1 
ATOM   2869 C  CD2   . PHE A 1 390 ? -14.510 43.966 5.459   1.00 21.79 ? 387 PHE A CD2   1 
ATOM   2870 C  CE1   . PHE A 1 390 ? -15.582 41.908 3.955   1.00 23.19 ? 387 PHE A CE1   1 
ATOM   2871 C  CE2   . PHE A 1 390 ? -15.452 43.120 6.017   1.00 22.90 ? 387 PHE A CE2   1 
ATOM   2872 C  CZ    . PHE A 1 390 ? -15.988 42.082 5.259   1.00 23.02 ? 387 PHE A CZ    1 
ATOM   2873 N  N     . CYS A 1 391 ? -12.295 47.625 3.332   1.00 23.19 ? 388 CYS A N     1 
ATOM   2874 C  CA    . CYS A 1 391 ? -11.130 48.486 3.316   1.00 23.79 ? 388 CYS A CA    1 
ATOM   2875 C  C     . CYS A 1 391 ? -10.467 48.378 4.692   1.00 23.78 ? 388 CYS A C     1 
ATOM   2876 O  O     . CYS A 1 391 ? -11.074 47.850 5.646   1.00 23.51 ? 388 CYS A O     1 
ATOM   2877 C  CB    . CYS A 1 391 ? -11.528 49.935 3.003   1.00 25.03 ? 388 CYS A CB    1 
ATOM   2878 S  SG    . CYS A 1 391 ? -12.460 50.756 4.306   1.00 25.14 ? 388 CYS A SG    1 
ATOM   2879 N  N     . LEU A 1 392 ? -9.218  48.832 4.768   1.00 24.45 ? 389 LEU A N     1 
ATOM   2880 C  CA    . LEU A 1 392 ? -8.428  48.845 6.004   1.00 24.98 ? 389 LEU A CA    1 
ATOM   2881 C  C     . LEU A 1 392 ? -8.095  50.297 6.312   1.00 26.25 ? 389 LEU A C     1 
ATOM   2882 O  O     . LEU A 1 392 ? -7.558  50.993 5.458   1.00 27.37 ? 389 LEU A O     1 
ATOM   2883 C  CB    . LEU A 1 392 ? -7.131  48.047 5.822   1.00 25.64 ? 389 LEU A CB    1 
ATOM   2884 C  CG    . LEU A 1 392 ? -6.154  47.933 7.004   1.00 27.04 ? 389 LEU A CG    1 
ATOM   2885 C  CD1   . LEU A 1 392 ? -6.817  47.335 8.251   1.00 24.71 ? 389 LEU A CD1   1 
ATOM   2886 C  CD2   . LEU A 1 392 ? -4.925  47.105 6.597   1.00 27.22 ? 389 LEU A CD2   1 
ATOM   2887 N  N     . VAL A 1 393 ? -8.437  50.752 7.514   1.00 26.65 ? 390 VAL A N     1 
ATOM   2888 C  CA    . VAL A 1 393 ? -8.093  52.091 7.945   1.00 28.29 ? 390 VAL A CA    1 
ATOM   2889 C  C     . VAL A 1 393 ? -6.641  52.104 8.405   1.00 30.17 ? 390 VAL A C     1 
ATOM   2890 O  O     . VAL A 1 393 ? -6.297  51.482 9.416   1.00 30.42 ? 390 VAL A O     1 
ATOM   2891 C  CB    . VAL A 1 393 ? -9.013  52.568 9.086   1.00 28.88 ? 390 VAL A CB    1 
ATOM   2892 C  CG1   . VAL A 1 393 ? -8.655  53.982 9.500   1.00 30.37 ? 390 VAL A CG1   1 
ATOM   2893 C  CG2   . VAL A 1 393 ? -10.477 52.485 8.656   1.00 27.25 ? 390 VAL A CG2   1 
ATOM   2894 N  N     . THR A 1 394 ? -5.789  52.803 7.656   1.00 31.89 ? 391 THR A N     1 
ATOM   2895 C  CA    . THR A 1 394 ? -4.347  52.834 7.936   1.00 34.33 ? 391 THR A CA    1 
ATOM   2896 C  C     . THR A 1 394 ? -3.918  54.047 8.795   1.00 36.98 ? 391 THR A C     1 
ATOM   2897 O  O     . THR A 1 394 ? -3.035  53.928 9.643   1.00 38.63 ? 391 THR A O     1 
ATOM   2898 C  CB    . THR A 1 394 ? -3.531  52.770 6.612   1.00 35.24 ? 391 THR A CB    1 
ATOM   2899 O  OG1   . THR A 1 394 ? -3.908  53.850 5.743   1.00 35.76 ? 391 THR A OG1   1 
ATOM   2900 C  CG2   . THR A 1 394 ? -3.780  51.439 5.903   1.00 33.30 ? 391 THR A CG2   1 
ATOM   2901 N  N     . GLU A 1 395 ? -4.541  55.205 8.578   1.00 37.83 ? 392 GLU A N     1 
ATOM   2902 C  CA    . GLU A 1 395 ? -4.283  56.395 9.400   1.00 40.58 ? 392 GLU A CA    1 
ATOM   2903 C  C     . GLU A 1 395 ? -5.597  57.074 9.736   1.00 40.10 ? 392 GLU A C     1 
ATOM   2904 O  O     . GLU A 1 395 ? -6.589  56.895 9.030   1.00 38.53 ? 392 GLU A O     1 
ATOM   2905 C  CB    . GLU A 1 395 ? -3.382  57.404 8.675   1.00 43.33 ? 392 GLU A CB    1 
ATOM   2906 C  CG    . GLU A 1 395 ? -2.108  56.832 8.044   1.00 45.10 ? 392 GLU A CG    1 
ATOM   2907 C  CD    . GLU A 1 395 ? -1.052  56.408 9.056   1.00 47.50 ? 392 GLU A CD    1 
ATOM   2908 O  OE1   . GLU A 1 395 ? -1.053  56.936 10.190  1.00 49.06 ? 392 GLU A OE1   1 
ATOM   2909 O  OE2   . GLU A 1 395 ? -0.212  55.549 8.700   1.00 47.34 ? 392 GLU A OE2   1 
ATOM   2910 N  N     . VAL A 1 396 ? -5.598  57.856 10.809  1.00 42.40 ? 393 VAL A N     1 
ATOM   2911 C  CA    . VAL A 1 396 ? -6.745  58.696 11.165  1.00 43.20 ? 393 VAL A CA    1 
ATOM   2912 C  C     . VAL A 1 396 ? -6.269  60.109 11.503  1.00 46.83 ? 393 VAL A C     1 
ATOM   2913 O  O     . VAL A 1 396 ? -5.549  60.303 12.489  1.00 49.10 ? 393 VAL A O     1 
ATOM   2914 C  CB    . VAL A 1 396 ? -7.535  58.119 12.367  1.00 42.76 ? 393 VAL A CB    1 
ATOM   2915 C  CG1   . VAL A 1 396 ? -8.834  58.888 12.573  1.00 43.74 ? 393 VAL A CG1   1 
ATOM   2916 C  CG2   . VAL A 1 396 ? -7.831  56.645 12.160  1.00 39.69 ? 393 VAL A CG2   1 
ATOM   2917 N  N     . ASP A 1 397 ? -6.649  61.084 10.673  1.00 47.82 ? 394 ASP A N     1 
ATOM   2918 C  CA    . ASP A 1 397 ? -6.342  62.484 10.935  1.00 51.68 ? 394 ASP A CA    1 
ATOM   2919 C  C     . ASP A 1 397 ? -7.580  63.198 11.457  1.00 53.07 ? 394 ASP A C     1 
ATOM   2920 O  O     . ASP A 1 397 ? -8.497  63.515 10.702  1.00 52.60 ? 394 ASP A O     1 
ATOM   2921 C  CB    . ASP A 1 397 ? -5.817  63.193 9.690   1.00 52.98 ? 394 ASP A CB    1 
ATOM   2922 C  CG    . ASP A 1 397 ? -5.216  64.553 10.011  1.00 57.26 ? 394 ASP A CG    1 
ATOM   2923 O  OD1   . ASP A 1 397 ? -4.221  64.922 9.368   1.00 59.92 ? 394 ASP A OD1   1 
ATOM   2924 O  OD2   . ASP A 1 397 ? -5.725  65.251 10.914  1.00 59.08 ? 394 ASP A OD2   1 
ATOM   2925 N  N     . LEU A 1 398 ? -7.578  63.470 12.754  1.00 55.34 ? 395 LEU A N     1 
ATOM   2926 C  CA    . LEU A 1 398 ? -8.755  63.970 13.436  1.00 57.04 ? 395 LEU A CA    1 
ATOM   2927 C  C     . LEU A 1 398 ? -9.010  65.446 13.129  1.00 60.93 ? 395 LEU A C     1 
ATOM   2928 O  O     . LEU A 1 398 ? -10.149 65.823 12.845  1.00 61.39 ? 395 LEU A O     1 
ATOM   2929 C  CB    . LEU A 1 398 ? -8.632  63.717 14.945  1.00 58.60 ? 395 LEU A CB    1 
ATOM   2930 C  CG    . LEU A 1 398 ? -8.530  62.224 15.310  1.00 55.42 ? 395 LEU A CG    1 
ATOM   2931 C  CD1   . LEU A 1 398 ? -8.066  62.021 16.742  1.00 56.83 ? 395 LEU A CD1   1 
ATOM   2932 C  CD2   . LEU A 1 398 ? -9.865  61.520 15.073  1.00 52.88 ? 395 LEU A CD2   1 
ATOM   2933 N  N     . GLU A 1 399 ? -7.968  66.274 13.163  1.00 64.19 ? 396 GLU A N     1 
ATOM   2934 C  CA    . GLU A 1 399 ? -8.133  67.693 12.826  1.00 68.44 ? 396 GLU A CA    1 
ATOM   2935 C  C     . GLU A 1 399 ? -8.654  67.887 11.384  1.00 67.20 ? 396 GLU A C     1 
ATOM   2936 O  O     . GLU A 1 399 ? -9.650  68.591 11.178  1.00 69.22 ? 396 GLU A O     1 
ATOM   2937 C  CB    . GLU A 1 399 ? -6.839  68.495 13.063  1.00 72.29 ? 396 GLU A CB    1 
ATOM   2938 C  CG    . GLU A 1 399 ? -5.663  68.062 12.194  1.00 71.75 ? 396 GLU A CG    1 
ATOM   2939 C  CD    . GLU A 1 399 ? -4.418  68.880 12.398  1.00 76.60 ? 396 GLU A CD    1 
ATOM   2940 O  OE1   . GLU A 1 399 ? -4.502  70.014 12.912  1.00 80.74 ? 396 GLU A OE1   1 
ATOM   2941 O  OE2   . GLU A 1 399 ? -3.343  68.375 12.018  1.00 77.15 ? 396 GLU A OE2   1 
ATOM   2942 N  N     . LYS A 1 400 ? -8.016  67.238 10.404  1.00 64.45 ? 397 LYS A N     1 
ATOM   2943 C  CA    . LYS A 1 400 ? -8.429  67.348 8.996   1.00 63.39 ? 397 LYS A CA    1 
ATOM   2944 C  C     . LYS A 1 400 ? -9.730  66.593 8.730   1.00 59.83 ? 397 LYS A C     1 
ATOM   2945 O  O     . LYS A 1 400 ? -10.309 66.714 7.650   1.00 59.34 ? 397 LYS A O     1 
ATOM   2946 C  CB    . LYS A 1 400 ? -7.346  66.801 8.060   1.00 62.09 ? 397 LYS A CB    1 
ATOM   2947 C  CG    . LYS A 1 400 ? -6.040  67.577 8.087   1.00 66.81 ? 397 LYS A CG    1 
ATOM   2948 C  CD    . LYS A 1 400 ? -5.069  67.052 7.028   1.00 66.97 ? 397 LYS A CD    1 
ATOM   2949 C  CE    . LYS A 1 400 ? -3.699  67.714 7.151   1.00 71.70 ? 397 LYS A CE    1 
ATOM   2950 N  NZ    . LYS A 1 400 ? -2.954  67.208 8.339   1.00 71.65 ? 397 LYS A NZ    1 
ATOM   2951 N  N     . ARG A 1 401 ? -10.176 65.807 9.711   1.00 57.33 ? 398 ARG A N     1 
ATOM   2952 C  CA    . ARG A 1 401 ? -11.384 64.995 9.584   1.00 54.47 ? 398 ARG A CA    1 
ATOM   2953 C  C     . ARG A 1 401 ? -11.284 64.069 8.361   1.00 50.64 ? 398 ARG A C     1 
ATOM   2954 O  O     . ARG A 1 401 ? -12.217 63.958 7.568   1.00 49.62 ? 398 ARG A O     1 
ATOM   2955 C  CB    . ARG A 1 401 ? -12.647 65.883 9.552   1.00 57.11 ? 398 ARG A CB    1 
ATOM   2956 C  CG    . ARG A 1 401 ? -12.946 66.558 10.901  1.00 60.99 ? 398 ARG A CG    1 
ATOM   2957 C  CD    . ARG A 1 401 ? -14.161 67.500 10.870  1.00 65.08 ? 398 ARG A CD    1 
ATOM   2958 N  NE    . ARG A 1 401 ? -15.341 66.879 10.265  1.00 64.39 ? 398 ARG A NE    1 
ATOM   2959 C  CZ    . ARG A 1 401 ? -16.084 65.920 10.825  1.00 63.13 ? 398 ARG A CZ    1 
ATOM   2960 N  NH1   . ARG A 1 401 ? -15.792 65.431 12.028  1.00 63.57 ? 398 ARG A NH1   1 
ATOM   2961 N  NH2   . ARG A 1 401 ? -17.131 65.431 10.171  1.00 61.61 ? 398 ARG A NH2   1 
ATOM   2962 N  N     . THR A 1 402 ? -10.132 63.416 8.221   1.00 48.68 ? 399 THR A N     1 
ATOM   2963 C  CA    . THR A 1 402 ? -9.913  62.439 7.151   1.00 45.96 ? 399 THR A CA    1 
ATOM   2964 C  C     . THR A 1 402 ? -9.332  61.141 7.708   1.00 43.26 ? 399 THR A C     1 
ATOM   2965 O  O     . THR A 1 402 ? -8.679  61.132 8.750   1.00 43.87 ? 399 THR A O     1 
ATOM   2966 C  CB    . THR A 1 402 ? -8.965  62.984 6.046   1.00 47.51 ? 399 THR A CB    1 
ATOM   2967 O  OG1   . THR A 1 402 ? -7.651  63.171 6.582   1.00 48.11 ? 399 THR A OG1   1 
ATOM   2968 C  CG2   . THR A 1 402 ? -9.479  64.319 5.478   1.00 50.82 ? 399 THR A CG2   1 
ATOM   2969 N  N     . MET A 1 403 ? -9.596  60.043 7.016   1.00 40.70 ? 400 MET A N     1 
ATOM   2970 C  CA    . MET A 1 403 ? -8.895  58.798 7.281   1.00 39.21 ? 400 MET A CA    1 
ATOM   2971 C  C     . MET A 1 403 ? -8.241  58.309 5.994   1.00 38.33 ? 400 MET A C     1 
ATOM   2972 O  O     . MET A 1 403 ? -8.739  58.582 4.902   1.00 39.26 ? 400 MET A O     1 
ATOM   2973 C  CB    . MET A 1 403 ? -9.832  57.733 7.867   1.00 37.26 ? 400 MET A CB    1 
ATOM   2974 C  CG    . MET A 1 403 ? -11.124 57.486 7.103   1.00 37.19 ? 400 MET A CG    1 
ATOM   2975 S  SD    . MET A 1 403 ? -11.920 55.956 7.659   1.00 38.30 ? 400 MET A SD    1 
ATOM   2976 C  CE    . MET A 1 403 ? -13.017 55.617 6.280   1.00 36.53 ? 400 MET A CE    1 
ATOM   2977 N  N     . SER A 1 404 ? -7.099  57.639 6.129   1.00 37.42 ? 401 SER A N     1 
ATOM   2978 C  CA    . SER A 1 404 ? -6.463  56.977 5.005   1.00 36.53 ? 401 SER A CA    1 
ATOM   2979 C  C     . SER A 1 404 ? -6.967  55.553 5.004   1.00 33.24 ? 401 SER A C     1 
ATOM   2980 O  O     . SER A 1 404 ? -6.943  54.896 6.040   1.00 31.68 ? 401 SER A O     1 
ATOM   2981 C  CB    . SER A 1 404 ? -4.943  56.968 5.157   1.00 38.28 ? 401 SER A CB    1 
ATOM   2982 O  OG    . SER A 1 404 ? -4.443  58.281 5.329   1.00 41.57 ? 401 SER A OG    1 
ATOM   2983 N  N     . ILE A 1 405 ? -7.424  55.078 3.849   1.00 32.27 ? 402 ILE A N     1 
ATOM   2984 C  CA    . ILE A 1 405 ? -7.850  53.688 3.721   1.00 30.08 ? 402 ILE A CA    1 
ATOM   2985 C  C     . ILE A 1 405 ? -7.112  52.939 2.609   1.00 30.13 ? 402 ILE A C     1 
ATOM   2986 O  O     . ILE A 1 405 ? -6.778  53.513 1.573   1.00 31.52 ? 402 ILE A O     1 
ATOM   2987 C  CB    . ILE A 1 405 ? -9.388  53.564 3.504   1.00 29.09 ? 402 ILE A CB    1 
ATOM   2988 C  CG1   . ILE A 1 405 ? -9.837  54.258 2.208   1.00 30.63 ? 402 ILE A CG1   1 
ATOM   2989 C  CG2   . ILE A 1 405 ? -10.145 54.122 4.713   1.00 28.62 ? 402 ILE A CG2   1 
ATOM   2990 C  CD1   . ILE A 1 405 ? -11.219 53.809 1.731   1.00 29.93 ? 402 ILE A CD1   1 
ATOM   2991 N  N     . LEU A 1 406 ? -6.864  51.653 2.836   1.00 29.02 ? 403 LEU A N     1 
ATOM   2992 C  CA    . LEU A 1 406 ? -6.432  50.756 1.770   1.00 29.38 ? 403 LEU A CA    1 
ATOM   2993 C  C     . LEU A 1 406 ? -7.701  50.175 1.182   1.00 28.86 ? 403 LEU A C     1 
ATOM   2994 O  O     . LEU A 1 406 ? -8.552  49.701 1.923   1.00 27.37 ? 403 LEU A O     1 
ATOM   2995 C  CB    . LEU A 1 406 ? -5.545  49.647 2.326   1.00 29.08 ? 403 LEU A CB    1 
ATOM   2996 C  CG    . LEU A 1 406 ? -4.822  48.741 1.332   1.00 29.31 ? 403 LEU A CG    1 
ATOM   2997 C  CD1   . LEU A 1 406 ? -3.783  49.533 0.531   1.00 31.41 ? 403 LEU A CD1   1 
ATOM   2998 C  CD2   . LEU A 1 406 ? -4.161  47.606 2.080   1.00 27.69 ? 403 LEU A CD2   1 
ATOM   2999 N  N     . CYS A 1 407 ? -7.833  50.207 -0.140  1.00 30.96 ? 404 CYS A N     1 
ATOM   3000 C  CA    . CYS A 1 407 ? -9.089  49.833 -0.799  1.00 31.39 ? 404 CYS A CA    1 
ATOM   3001 C  C     . CYS A 1 407 ? -8.831  49.102 -2.118  1.00 32.92 ? 404 CYS A C     1 
ATOM   3002 O  O     . CYS A 1 407 ? -7.986  49.537 -2.905  1.00 35.25 ? 404 CYS A O     1 
ATOM   3003 C  CB    . CYS A 1 407 ? -9.936  51.088 -1.053  1.00 32.12 ? 404 CYS A CB    1 
ATOM   3004 S  SG    . CYS A 1 407 ? -11.664 50.768 -1.523  1.00 33.78 ? 404 CYS A SG    1 
ATOM   3005 N  N     . PRO A 1 408 ? -9.560  47.995 -2.372  1.00 33.06 ? 405 PRO A N     1 
ATOM   3006 C  CA    . PRO A 1 408 ? -9.353  47.248 -3.625  1.00 35.13 ? 405 PRO A CA    1 
ATOM   3007 C  C     . PRO A 1 408 ? -9.695  48.056 -4.869  1.00 37.75 ? 405 PRO A C     1 
ATOM   3008 O  O     . PRO A 1 408 ? -9.167  47.769 -5.936  1.00 39.99 ? 405 PRO A O     1 
ATOM   3009 C  CB    . PRO A 1 408 ? -10.307 46.051 -3.499  1.00 33.70 ? 405 PRO A CB    1 
ATOM   3010 C  CG    . PRO A 1 408 ? -10.597 45.939 -2.073  1.00 31.44 ? 405 PRO A CG    1 
ATOM   3011 C  CD    . PRO A 1 408 ? -10.533 47.315 -1.499  1.00 31.04 ? 405 PRO A CD    1 
ATOM   3012 N  N     . GLN A 1 409 ? -10.561 49.057 -4.728  1.00 38.46 ? 406 GLN A N     1 
ATOM   3013 C  CA    . GLN A 1 409 ? -10.896 49.935 -5.845  1.00 41.73 ? 406 GLN A CA    1 
ATOM   3014 C  C     . GLN A 1 409 ? -10.628 51.418 -5.562  1.00 42.70 ? 406 GLN A C     1 
ATOM   3015 O  O     . GLN A 1 409 ? -10.378 51.826 -4.424  1.00 41.12 ? 406 GLN A O     1 
ATOM   3016 C  CB    . GLN A 1 409 ? -12.343 49.711 -6.295  1.00 42.53 ? 406 GLN A CB    1 
ATOM   3017 C  CG    . GLN A 1 409 ? -13.400 50.003 -5.250  1.00 42.45 ? 406 GLN A CG    1 
ATOM   3018 C  CD    . GLN A 1 409 ? -14.803 49.839 -5.817  1.00 45.77 ? 406 GLN A CD    1 
ATOM   3019 O  OE1   . GLN A 1 409 ? -15.173 48.755 -6.268  1.00 46.46 ? 406 GLN A OE1   1 
ATOM   3020 N  NE2   . GLN A 1 409 ? -15.586 50.917 -5.807  1.00 47.78 ? 406 GLN A NE2   1 
ATOM   3021 N  N     . ARG A 1 410 ? -10.698 52.199 -6.637  1.00 45.62 ? 407 ARG A N     1 
ATOM   3022 C  CA    . ARG A 1 410 ? -10.285 53.594 -6.674  1.00 47.61 ? 407 ARG A CA    1 
ATOM   3023 C  C     . ARG A 1 410 ? -11.166 54.517 -5.827  1.00 46.67 ? 407 ARG A C     1 
ATOM   3024 O  O     . ARG A 1 410 ? -10.669 55.454 -5.201  1.00 47.27 ? 407 ARG A O     1 
ATOM   3025 C  CB    . ARG A 1 410 ? -10.314 54.049 -8.142  1.00 51.85 ? 407 ARG A CB    1 
ATOM   3026 C  CG    . ARG A 1 410 ? -9.605  55.348 -8.459  1.00 55.71 ? 407 ARG A CG    1 
ATOM   3027 C  CD    . ARG A 1 410 ? -9.666  55.610 -9.958  1.00 61.60 ? 407 ARG A CD    1 
ATOM   3028 N  NE    . ARG A 1 410 ? -9.008  54.545 -10.723 1.00 63.80 ? 407 ARG A NE    1 
ATOM   3029 C  CZ    . ARG A 1 410 ? -7.714  54.521 -11.055 1.00 66.59 ? 407 ARG A CZ    1 
ATOM   3030 N  NH1   . ARG A 1 410 ? -6.890  55.505 -10.702 1.00 67.97 ? 407 ARG A NH1   1 
ATOM   3031 N  NH2   . ARG A 1 410 ? -7.236  53.495 -11.750 1.00 68.24 ? 407 ARG A NH2   1 
ATOM   3032 N  N     . THR A 1 411 ? -12.473 54.271 -5.837  1.00 45.78 ? 408 THR A N     1 
ATOM   3033 C  CA    . THR A 1 411 ? -13.422 55.024 -5.015  1.00 44.94 ? 408 THR A CA    1 
ATOM   3034 C  C     . THR A 1 411 ? -14.243 54.044 -4.196  1.00 41.86 ? 408 THR A C     1 
ATOM   3035 O  O     . THR A 1 411 ? -14.406 52.884 -4.577  1.00 41.43 ? 408 THR A O     1 
ATOM   3036 C  CB    . THR A 1 411 ? -14.381 55.883 -5.864  1.00 48.22 ? 408 THR A CB    1 
ATOM   3037 O  OG1   . THR A 1 411 ? -14.884 55.100 -6.952  1.00 49.54 ? 408 THR A OG1   1 
ATOM   3038 C  CG2   . THR A 1 411 ? -13.681 57.114 -6.401  1.00 50.60 ? 408 THR A CG2   1 
ATOM   3039 N  N     . ILE A 1 412 ? -14.755 54.512 -3.065  1.00 40.19 ? 409 ILE A N     1 
ATOM   3040 C  CA    . ILE A 1 412 ? -15.539 53.665 -2.178  1.00 37.41 ? 409 ILE A CA    1 
ATOM   3041 C  C     . ILE A 1 412 ? -16.795 53.195 -2.905  1.00 37.91 ? 409 ILE A C     1 
ATOM   3042 O  O     . ILE A 1 412 ? -17.431 53.975 -3.605  1.00 40.58 ? 409 ILE A O     1 
ATOM   3043 C  CB    . ILE A 1 412 ? -15.902 54.386 -0.849  1.00 37.11 ? 409 ILE A CB    1 
ATOM   3044 C  CG1   . ILE A 1 412 ? -16.726 55.658 -1.089  1.00 40.19 ? 409 ILE A CG1   1 
ATOM   3045 C  CG2   . ILE A 1 412 ? -14.634 54.736 -0.067  1.00 36.28 ? 409 ILE A CG2   1 
ATOM   3046 C  CD1   . ILE A 1 412 ? -17.025 56.421 0.176   1.00 40.70 ? 409 ILE A CD1   1 
ATOM   3047 N  N     . PRO A 1 413 ? -17.135 51.906 -2.778  1.00 35.80 ? 410 PRO A N     1 
ATOM   3048 C  CA    . PRO A 1 413 ? -18.372 51.408 -3.396  1.00 36.71 ? 410 PRO A CA    1 
ATOM   3049 C  C     . PRO A 1 413 ? -19.648 51.739 -2.619  1.00 36.81 ? 410 PRO A C     1 
ATOM   3050 O  O     . PRO A 1 413 ? -20.747 51.522 -3.132  1.00 38.87 ? 410 PRO A O     1 
ATOM   3051 C  CB    . PRO A 1 413 ? -18.157 49.894 -3.441  1.00 35.25 ? 410 PRO A CB    1 
ATOM   3052 C  CG    . PRO A 1 413 ? -17.240 49.613 -2.305  1.00 33.08 ? 410 PRO A CG    1 
ATOM   3053 C  CD    . PRO A 1 413 ? -16.325 50.816 -2.207  1.00 33.20 ? 410 PRO A CD    1 
ATOM   3054 N  N     A SER A 1 414 ? -19.501 52.260 -1.404  0.50 35.35 ? 411 SER A N     1 
ATOM   3055 N  N     B SER A 1 414 ? -19.507 52.239 -1.395  0.50 35.32 ? 411 SER A N     1 
ATOM   3056 C  CA    A SER A 1 414 ? -20.641 52.644 -0.586  0.50 36.33 ? 411 SER A CA    1 
ATOM   3057 C  CA    B SER A 1 414 ? -20.655 52.677 -0.616  0.50 36.42 ? 411 SER A CA    1 
ATOM   3058 C  C     A SER A 1 414 ? -20.203 53.640 0.476   0.50 35.94 ? 411 SER A C     1 
ATOM   3059 C  C     B SER A 1 414 ? -20.200 53.657 0.450   0.50 35.98 ? 411 SER A C     1 
ATOM   3060 O  O     A SER A 1 414 ? -19.074 53.578 0.953   0.50 34.28 ? 411 SER A O     1 
ATOM   3061 O  O     B SER A 1 414 ? -19.059 53.603 0.900   0.50 34.33 ? 411 SER A O     1 
ATOM   3062 C  CB    A SER A 1 414 ? -21.254 51.412 0.076   0.50 35.18 ? 411 SER A CB    1 
ATOM   3063 C  CB    B SER A 1 414 ? -21.354 51.489 0.042   0.50 35.44 ? 411 SER A CB    1 
ATOM   3064 O  OG    A SER A 1 414 ? -22.117 51.778 1.137   0.50 35.93 ? 411 SER A OG    1 
ATOM   3065 O  OG    B SER A 1 414 ? -20.827 51.247 1.333   0.50 33.14 ? 411 SER A OG    1 
ATOM   3066 N  N     . LYS A 1 415 ? -21.103 54.550 0.845   1.00 38.10 ? 412 LYS A N     1 
ATOM   3067 C  CA    . LYS A 1 415 ? -20.825 55.547 1.872   1.00 38.35 ? 412 LYS A CA    1 
ATOM   3068 C  C     . LYS A 1 415 ? -21.163 55.051 3.285   1.00 36.90 ? 412 LYS A C     1 
ATOM   3069 O  O     . LYS A 1 415 ? -21.007 55.800 4.247   1.00 37.52 ? 412 LYS A O     1 
ATOM   3070 C  CB    . LYS A 1 415 ? -21.604 56.832 1.573   1.00 42.23 ? 412 LYS A CB    1 
ATOM   3071 C  CG    . LYS A 1 415 ? -21.317 57.441 0.199   1.00 44.62 ? 412 LYS A CG    1 
ATOM   3072 C  CD    . LYS A 1 415 ? -21.923 58.851 0.068   1.00 49.28 ? 412 LYS A CD    1 
ATOM   3073 C  CE    . LYS A 1 415 ? -21.828 59.365 -1.367  1.00 52.33 ? 412 LYS A CE    1 
ATOM   3074 N  NZ    . LYS A 1 415 ? -22.267 60.783 -1.514  1.00 56.07 ? 412 LYS A NZ    1 
ATOM   3075 N  N     . VAL A 1 416 ? -21.624 53.803 3.406   1.00 35.58 ? 413 VAL A N     1 
ATOM   3076 C  CA    . VAL A 1 416 ? -21.961 53.198 4.702   1.00 34.80 ? 413 VAL A CA    1 
ATOM   3077 C  C     . VAL A 1 416 ? -20.913 52.144 5.031   1.00 31.97 ? 413 VAL A C     1 
ATOM   3078 O  O     . VAL A 1 416 ? -20.911 51.074 4.437   1.00 31.40 ? 413 VAL A O     1 
ATOM   3079 C  CB    . VAL A 1 416 ? -23.378 52.561 4.680   1.00 36.47 ? 413 VAL A CB    1 
ATOM   3080 C  CG1   . VAL A 1 416 ? -23.789 52.079 6.070   1.00 35.32 ? 413 VAL A CG1   1 
ATOM   3081 C  CG2   . VAL A 1 416 ? -24.396 53.564 4.149   1.00 39.72 ? 413 VAL A CG2   1 
ATOM   3082 N  N     . LEU A 1 417 ? -20.005 52.474 5.950   1.00 30.90 ? 414 LEU A N     1 
ATOM   3083 C  CA    . LEU A 1 417 ? -18.866 51.618 6.286   1.00 28.57 ? 414 LEU A CA    1 
ATOM   3084 C  C     . LEU A 1 417 ? -19.116 50.933 7.620   1.00 28.32 ? 414 LEU A C     1 
ATOM   3085 O  O     . LEU A 1 417 ? -19.274 51.606 8.638   1.00 30.04 ? 414 LEU A O     1 
ATOM   3086 C  CB    . LEU A 1 417 ? -17.566 52.439 6.355   1.00 28.00 ? 414 LEU A CB    1 
ATOM   3087 C  CG    . LEU A 1 417 ? -16.896 52.771 5.017   1.00 27.91 ? 414 LEU A CG    1 
ATOM   3088 C  CD1   . LEU A 1 417 ? -17.841 53.532 4.095   1.00 28.64 ? 414 LEU A CD1   1 
ATOM   3089 C  CD2   . LEU A 1 417 ? -15.589 53.550 5.215   1.00 28.50 ? 414 LEU A CD2   1 
ATOM   3090 N  N     . VAL A 1 418 ? -19.151 49.604 7.622   1.00 26.84 ? 415 VAL A N     1 
ATOM   3091 C  CA    . VAL A 1 418 ? -19.510 48.854 8.824   1.00 27.36 ? 415 VAL A CA    1 
ATOM   3092 C  C     . VAL A 1 418 ? -18.281 48.268 9.526   1.00 26.14 ? 415 VAL A C     1 
ATOM   3093 O  O     . VAL A 1 418 ? -17.487 47.556 8.921   1.00 24.66 ? 415 VAL A O     1 
ATOM   3094 C  CB    . VAL A 1 418 ? -20.503 47.704 8.528   1.00 27.86 ? 415 VAL A CB    1 
ATOM   3095 C  CG1   . VAL A 1 418 ? -21.092 47.178 9.844   1.00 29.46 ? 415 VAL A CG1   1 
ATOM   3096 C  CG2   . VAL A 1 418 ? -21.606 48.158 7.581   1.00 28.23 ? 415 VAL A CG2   1 
ATOM   3097 N  N     . PHE A 1 419 ? -18.166 48.559 10.816  1.00 27.17 ? 416 PHE A N     1 
ATOM   3098 C  CA    . PHE A 1 419 ? -17.014 48.188 11.626  1.00 26.85 ? 416 PHE A CA    1 
ATOM   3099 C  C     . PHE A 1 419 ? -16.836 46.689 11.725  1.00 25.74 ? 416 PHE A C     1 
ATOM   3100 O  O     . PHE A 1 419 ? -17.804 45.957 11.900  1.00 26.19 ? 416 PHE A O     1 
ATOM   3101 C  CB    . PHE A 1 419 ? -17.200 48.758 13.036  1.00 29.38 ? 416 PHE A CB    1 
ATOM   3102 C  CG    . PHE A 1 419 ? -16.142 48.339 14.038  1.00 30.92 ? 416 PHE A CG    1 
ATOM   3103 C  CD1   . PHE A 1 419 ? -14.996 49.115 14.229  1.00 31.38 ? 416 PHE A CD1   1 
ATOM   3104 C  CD2   . PHE A 1 419 ? -16.332 47.210 14.839  1.00 32.24 ? 416 PHE A CD2   1 
ATOM   3105 C  CE1   . PHE A 1 419 ? -14.038 48.756 15.181  1.00 32.74 ? 416 PHE A CE1   1 
ATOM   3106 C  CE2   . PHE A 1 419 ? -15.382 46.838 15.793  1.00 33.63 ? 416 PHE A CE2   1 
ATOM   3107 C  CZ    . PHE A 1 419 ? -14.232 47.611 15.965  1.00 34.68 ? 416 PHE A CZ    1 
ATOM   3108 N  N     . SER A 1 420 ? -15.588 46.249 11.604  1.00 24.19 ? 417 SER A N     1 
ATOM   3109 C  CA    . SER A 1 420 ? -15.206 44.898 11.978  1.00 24.22 ? 417 SER A CA    1 
ATOM   3110 C  C     . SER A 1 420 ? -14.162 44.995 13.086  1.00 25.08 ? 417 SER A C     1 
ATOM   3111 O  O     . SER A 1 420 ? -13.339 45.917 13.095  1.00 24.64 ? 417 SER A O     1 
ATOM   3112 C  CB    . SER A 1 420 ? -14.657 44.129 10.773  1.00 22.61 ? 417 SER A CB    1 
ATOM   3113 O  OG    . SER A 1 420 ? -14.205 42.854 11.172  1.00 22.70 ? 417 SER A OG    1 
ATOM   3114 N  N     . ASP A 1 421 ? -14.198 44.049 14.019  1.00 26.44 ? 418 ASP A N     1 
ATOM   3115 C  CA    . ASP A 1 421 ? -13.199 44.016 15.092  1.00 28.15 ? 418 ASP A CA    1 
ATOM   3116 C  C     . ASP A 1 421 ? -11.875 43.403 14.635  1.00 27.44 ? 418 ASP A C     1 
ATOM   3117 O  O     . ASP A 1 421 ? -10.914 43.362 15.410  1.00 28.94 ? 418 ASP A O     1 
ATOM   3118 C  CB    . ASP A 1 421 ? -13.719 43.267 16.321  1.00 30.44 ? 418 ASP A CB    1 
ATOM   3119 C  CG    . ASP A 1 421 ? -13.027 43.704 17.611  1.00 33.68 ? 418 ASP A CG    1 
ATOM   3120 O  OD1   . ASP A 1 421 ? -12.669 44.894 17.727  1.00 33.94 ? 418 ASP A OD1   1 
ATOM   3121 O  OD2   . ASP A 1 421 ? -12.841 42.861 18.516  1.00 37.45 ? 418 ASP A OD2   1 
ATOM   3122 N  N     . ILE A 1 422 ? -11.825 42.919 13.394  1.00 25.67 ? 419 ILE A N     1 
ATOM   3123 C  CA    . ILE A 1 422 ? -10.592 42.370 12.836  1.00 25.72 ? 419 ILE A CA    1 
ATOM   3124 C  C     . ILE A 1 422 ? -9.635  43.524 12.529  1.00 25.79 ? 419 ILE A C     1 
ATOM   3125 O  O     . ILE A 1 422 ? -10.000 44.473 11.827  1.00 24.76 ? 419 ILE A O     1 
ATOM   3126 C  CB    . ILE A 1 422 ? -10.825 41.529 11.541  1.00 24.24 ? 419 ILE A CB    1 
ATOM   3127 C  CG1   . ILE A 1 422 ? -11.348 40.129 11.859  1.00 25.68 ? 419 ILE A CG1   1 
ATOM   3128 C  CG2   . ILE A 1 422 ? -9.516  41.345 10.789  1.00 23.46 ? 419 ILE A CG2   1 
ATOM   3129 C  CD1   . ILE A 1 422 ? -12.723 40.074 12.451  1.00 27.86 ? 419 ILE A CD1   1 
ATOM   3130 N  N     . THR A 1 423 ? -8.426  43.445 13.075  1.00 27.74 ? 420 THR A N     1 
ATOM   3131 C  CA    . THR A 1 423 ? -7.408  44.442 12.820  1.00 28.94 ? 420 THR A CA    1 
ATOM   3132 C  C     . THR A 1 423 ? -6.255  43.840 12.028  1.00 30.28 ? 420 THR A C     1 
ATOM   3133 O  O     . THR A 1 423 ? -6.088  42.626 11.974  1.00 31.11 ? 420 THR A O     1 
ATOM   3134 C  CB    . THR A 1 423 ? -6.862  45.023 14.118  1.00 30.87 ? 420 THR A CB    1 
ATOM   3135 O  OG1   . THR A 1 423 ? -6.336  43.965 14.919  1.00 33.09 ? 420 THR A OG1   1 
ATOM   3136 C  CG2   . THR A 1 423 ? -7.954  45.765 14.896  1.00 30.91 ? 420 THR A CG2   1 
ATOM   3137 N  N     . HIS A 1 424 ? -5.459  44.705 11.416  1.00 31.70 ? 421 HIS A N     1 
ATOM   3138 C  CA    . HIS A 1 424 ? -4.321  44.280 10.629  1.00 33.57 ? 421 HIS A CA    1 
ATOM   3139 C  C     . HIS A 1 424 ? -3.296  45.401 10.531  1.00 36.41 ? 421 HIS A C     1 
ATOM   3140 O  O     . HIS A 1 424 ? -3.584  46.474 10.012  1.00 35.65 ? 421 HIS A O     1 
ATOM   3141 C  CB    . HIS A 1 424 ? -4.773  43.861 9.230   1.00 31.78 ? 421 HIS A CB    1 
ATOM   3142 C  CG    . HIS A 1 424 ? -3.677  43.285 8.386   1.00 32.61 ? 421 HIS A CG    1 
ATOM   3143 N  ND1   . HIS A 1 424 ? -3.086  42.068 8.662   1.00 32.91 ? 421 HIS A ND1   1 
ATOM   3144 C  CD2   . HIS A 1 424 ? -3.076  43.748 7.264   1.00 32.02 ? 421 HIS A CD2   1 
ATOM   3145 C  CE1   . HIS A 1 424 ? -2.160  41.816 7.756   1.00 32.64 ? 421 HIS A CE1   1 
ATOM   3146 N  NE2   . HIS A 1 424 ? -2.140  42.812 6.890   1.00 32.88 ? 421 HIS A NE2   1 
ATOM   3147 N  N     . LEU A 1 425 ? -2.104  45.139 11.050  1.00 40.73 ? 422 LEU A N     1 
ATOM   3148 C  CA    . LEU A 1 425 ? -0.966  46.026 10.883  1.00 44.16 ? 422 LEU A CA    1 
ATOM   3149 C  C     . LEU A 1 425 ? -0.291  45.639 9.567   1.00 45.94 ? 422 LEU A C     1 
ATOM   3150 O  O     . LEU A 1 425 ? -0.102  44.448 9.282   1.00 46.23 ? 422 LEU A O     1 
ATOM   3151 C  CB    . LEU A 1 425 ? 0.008   45.888 12.065  1.00 47.50 ? 422 LEU A CB    1 
ATOM   3152 C  CG    . LEU A 1 425 ? -0.602  45.923 13.478  1.00 47.98 ? 422 LEU A CG    1 
ATOM   3153 C  CD1   . LEU A 1 425 ? 0.479   45.850 14.556  1.00 51.86 ? 422 LEU A CD1   1 
ATOM   3154 C  CD2   . LEU A 1 425 ? -1.480  47.160 13.682  1.00 46.23 ? 422 LEU A CD2   1 
ATOM   3155 N  N     . ASP A 1 426 ? 0.056   46.645 8.764   1.00 47.87 ? 423 ASP A N     1 
ATOM   3156 C  CA    . ASP A 1 426 ? 0.561   46.421 7.407   1.00 49.36 ? 423 ASP A CA    1 
ATOM   3157 C  C     . ASP A 1 426 ? 2.004   46.896 7.283   1.00 53.10 ? 423 ASP A C     1 
ATOM   3158 O  O     . ASP A 1 426 ? 2.934   46.097 7.399   1.00 55.99 ? 423 ASP A O     1 
ATOM   3159 C  CB    . ASP A 1 426 ? -0.330  47.158 6.394   1.00 47.67 ? 423 ASP A CB    1 
ATOM   3160 C  CG    . ASP A 1 426 ? -0.064  46.737 4.949   1.00 49.31 ? 423 ASP A CG    1 
ATOM   3161 O  OD1   . ASP A 1 426 ? 0.648   45.730 4.727   1.00 51.84 ? 423 ASP A OD1   1 
ATOM   3162 O  OD2   . ASP A 1 426 ? -0.569  47.425 4.032   1.00 50.57 ? 423 ASP A OD2   1 
ATOM   3163 O  "O5'" . G   B 2 1   ? -11.943 26.343 12.544  1.00 24.06 ? 1   G   B "O5'" 1 
ATOM   3164 C  "C5'" . G   B 2 1   ? -11.284 27.246 13.437  1.00 24.63 ? 1   G   B "C5'" 1 
ATOM   3165 C  "C4'" . G   B 2 1   ? -12.214 28.322 13.968  1.00 25.22 ? 1   G   B "C4'" 1 
ATOM   3166 O  "O4'" . G   B 2 1   ? -13.264 27.698 14.746  1.00 26.78 ? 1   G   B "O4'" 1 
ATOM   3167 C  "C3'" . G   B 2 1   ? -11.564 29.293 14.944  1.00 26.54 ? 1   G   B "C3'" 1 
ATOM   3168 O  "O3'" . G   B 2 1   ? -10.832 30.321 14.263  1.00 25.86 ? 1   G   B "O3'" 1 
ATOM   3169 C  "C2'" . G   B 2 1   ? -12.765 29.810 15.737  1.00 26.40 ? 1   G   B "C2'" 1 
ATOM   3170 O  "O2'" . G   B 2 1   ? -13.520 30.833 15.103  1.00 25.42 ? 1   G   B "O2'" 1 
ATOM   3171 C  "C1'" . G   B 2 1   ? -13.589 28.531 15.852  1.00 27.94 ? 1   G   B "C1'" 1 
ATOM   3172 N  N9    . G   B 2 1   ? -13.400 27.771 17.097  1.00 28.24 ? 1   G   B N9    1 
ATOM   3173 C  C8    . G   B 2 1   ? -12.767 26.570 17.268  1.00 28.66 ? 1   G   B C8    1 
ATOM   3174 N  N7    . G   B 2 1   ? -12.783 26.130 18.497  1.00 28.62 ? 1   G   B N7    1 
ATOM   3175 C  C5    . G   B 2 1   ? -13.479 27.111 19.184  1.00 28.93 ? 1   G   B C5    1 
ATOM   3176 C  C6    . G   B 2 1   ? -13.820 27.181 20.562  1.00 29.02 ? 1   G   B C6    1 
ATOM   3177 O  O6    . G   B 2 1   ? -13.554 26.350 21.447  1.00 29.28 ? 1   G   B O6    1 
ATOM   3178 N  N1    . G   B 2 1   ? -14.535 28.340 20.861  1.00 28.04 ? 1   G   B N1    1 
ATOM   3179 C  C2    . G   B 2 1   ? -14.869 29.312 19.931  1.00 28.47 ? 1   G   B C2    1 
ATOM   3180 N  N2    . G   B 2 1   ? -15.561 30.367 20.399  1.00 28.26 ? 1   G   B N2    1 
ATOM   3181 N  N3    . G   B 2 1   ? -14.559 29.253 18.633  1.00 26.25 ? 1   G   B N3    1 
ATOM   3182 C  C4    . G   B 2 1   ? -13.873 28.126 18.336  1.00 27.52 ? 1   G   B C4    1 
ATOM   3183 P  P     . C   B 2 2   ? -9.343  30.656 14.751  1.00 24.92 ? 2   C   B P     1 
ATOM   3184 O  OP1   . C   B 2 2   ? -8.793  31.587 13.750  1.00 23.90 ? 2   C   B OP1   1 
ATOM   3185 O  OP2   . C   B 2 2   ? -8.621  29.400 15.051  1.00 23.14 ? 2   C   B OP2   1 
ATOM   3186 O  "O5'" . C   B 2 2   ? -9.590  31.389 16.162  1.00 27.09 ? 2   C   B "O5'" 1 
ATOM   3187 C  "C5'" . C   B 2 2   ? -10.280 32.657 16.244  1.00 28.15 ? 2   C   B "C5'" 1 
ATOM   3188 C  "C4'" . C   B 2 2   ? -10.752 32.964 17.662  1.00 28.07 ? 2   C   B "C4'" 1 
ATOM   3189 O  "O4'" . C   B 2 2   ? -11.734 31.985 18.087  1.00 28.80 ? 2   C   B "O4'" 1 
ATOM   3190 C  "C3'" . C   B 2 2   ? -9.683  32.914 18.760  1.00 28.44 ? 2   C   B "C3'" 1 
ATOM   3191 O  "O3'" . C   B 2 2   ? -8.857  34.084 18.723  1.00 27.60 ? 2   C   B "O3'" 1 
ATOM   3192 C  "C2'" . C   B 2 2   ? -10.578 32.796 19.991  1.00 29.26 ? 2   C   B "C2'" 1 
ATOM   3193 O  "O2'" . C   B 2 2   ? -11.215 34.004 20.373  1.00 30.37 ? 2   C   B "O2'" 1 
ATOM   3194 C  "C1'" . C   B 2 2   ? -11.615 31.778 19.487  1.00 30.36 ? 2   C   B "C1'" 1 
ATOM   3195 N  N1    . C   B 2 2   ? -11.178 30.369 19.801  1.00 31.33 ? 2   C   B N1    1 
ATOM   3196 C  C2    . C   B 2 2   ? -11.411 29.856 21.089  1.00 32.52 ? 2   C   B C2    1 
ATOM   3197 O  O2    . C   B 2 2   ? -12.003 30.559 21.915  1.00 32.74 ? 2   C   B O2    1 
ATOM   3198 N  N3    . C   B 2 2   ? -11.003 28.593 21.393  1.00 33.04 ? 2   C   B N3    1 
ATOM   3199 C  C4    . C   B 2 2   ? -10.368 27.862 20.470  1.00 33.62 ? 2   C   B C4    1 
ATOM   3200 N  N4    . C   B 2 2   ? -9.977  26.627 20.796  1.00 33.63 ? 2   C   B N4    1 
ATOM   3201 C  C5    . C   B 2 2   ? -10.110 28.371 19.156  1.00 32.81 ? 2   C   B C5    1 
ATOM   3202 C  C6    . C   B 2 2   ? -10.521 29.613 18.873  1.00 31.30 ? 2   C   B C6    1 
HETATM 3203 P  PB    . ADP C 3 .   ? -10.165 22.243 9.711   1.00 18.08 ? 501 ADP A PB    1 
HETATM 3204 O  O1B   . ADP C 3 .   ? -10.941 21.047 10.205  1.00 17.50 ? 501 ADP A O1B   1 
HETATM 3205 O  O2B   . ADP C 3 .   ? -10.787 22.891 8.491   1.00 18.17 ? 501 ADP A O2B   1 
HETATM 3206 O  O3B   . ADP C 3 .   ? -9.867  23.203 10.830  1.00 18.64 ? 501 ADP A O3B   1 
HETATM 3207 P  PA    . ADP C 3 .   ? -8.101  22.003 7.740   1.00 19.72 ? 501 ADP A PA    1 
HETATM 3208 O  O1A   . ADP C 3 .   ? -7.803  23.478 7.601   1.00 20.20 ? 501 ADP A O1A   1 
HETATM 3209 O  O2A   . ADP C 3 .   ? -8.886  21.328 6.658   1.00 19.15 ? 501 ADP A O2A   1 
HETATM 3210 O  O3A   . ADP C 3 .   ? -8.730  21.709 9.197   1.00 17.48 ? 501 ADP A O3A   1 
HETATM 3211 O  "O5'" . ADP C 3 .   ? -6.698  21.264 7.797   1.00 22.52 ? 501 ADP A "O5'" 1 
HETATM 3212 C  "C5'" . ADP C 3 .   ? -5.789  21.588 8.842   1.00 24.74 ? 501 ADP A "C5'" 1 
HETATM 3213 C  "C4'" . ADP C 3 .   ? -4.380  21.659 8.264   1.00 25.72 ? 501 ADP A "C4'" 1 
HETATM 3214 O  "O4'" . ADP C 3 .   ? -3.928  20.371 7.824   1.00 25.81 ? 501 ADP A "O4'" 1 
HETATM 3215 C  "C3'" . ADP C 3 .   ? -4.309  22.562 7.053   1.00 26.37 ? 501 ADP A "C3'" 1 
HETATM 3216 O  "O3'" . ADP C 3 .   ? -3.167  23.399 7.241   1.00 28.77 ? 501 ADP A "O3'" 1 
HETATM 3217 C  "C2'" . ADP C 3 .   ? -4.141  21.654 5.846   1.00 26.56 ? 501 ADP A "C2'" 1 
HETATM 3218 O  "O2'" . ADP C 3 .   ? -3.286  22.195 4.834   1.00 28.33 ? 501 ADP A "O2'" 1 
HETATM 3219 C  "C1'" . ADP C 3 .   ? -3.490  20.432 6.459   1.00 25.36 ? 501 ADP A "C1'" 1 
HETATM 3220 N  N9    . ADP C 3 .   ? -3.889  19.167 5.837   1.00 23.89 ? 501 ADP A N9    1 
HETATM 3221 C  C8    . ADP C 3 .   ? -5.149  18.686 5.765   1.00 23.63 ? 501 ADP A C8    1 
HETATM 3222 N  N7    . ADP C 3 .   ? -5.163  17.473 5.164   1.00 22.42 ? 501 ADP A N7    1 
HETATM 3223 C  C5    . ADP C 3 .   ? -3.890  17.182 4.853   1.00 21.70 ? 501 ADP A C5    1 
HETATM 3224 C  C6    . ADP C 3 .   ? -3.198  16.060 4.224   1.00 21.06 ? 501 ADP A C6    1 
HETATM 3225 N  N6    . ADP C 3 .   ? -3.894  14.997 3.772   1.00 22.61 ? 501 ADP A N6    1 
HETATM 3226 N  N1    . ADP C 3 .   ? -1.859  16.136 4.101   1.00 23.89 ? 501 ADP A N1    1 
HETATM 3227 C  C2    . ADP C 3 .   ? -1.144  17.187 4.539   1.00 22.21 ? 501 ADP A C2    1 
HETATM 3228 N  N3    . ADP C 3 .   ? -1.723  18.245 5.133   1.00 22.57 ? 501 ADP A N3    1 
HETATM 3229 C  C4    . ADP C 3 .   ? -3.056  18.291 5.315   1.00 22.02 ? 501 ADP A C4    1 
HETATM 3230 MG MG    . MG  D 4 .   ? -11.616 24.697 8.483   1.00 17.87 ? 502 MG  A MG    1 
HETATM 3231 AL AL    . ALF E 5 .   ? -10.701 24.770 11.747  1.00 21.06 ? 503 ALF A AL    1 
HETATM 3232 F  F1    . ALF E 5 .   ? -9.537  25.866 10.976  1.00 19.86 ? 503 ALF A F1    1 
HETATM 3233 F  F2    . ALF E 5 .   ? -11.868 23.659 12.517  1.00 20.95 ? 503 ALF A F2    1 
HETATM 3234 F  F3    . ALF E 5 .   ? -9.650  24.619 13.193  1.00 22.41 ? 503 ALF A F3    1 
HETATM 3235 F  F4    . ALF E 5 .   ? -11.728 24.891 10.290  1.00 22.81 ? 503 ALF A F4    1 
HETATM 3236 N  N     . SAR F 6 .   ? 5.193   10.854 9.824   1.00 50.56 ? 504 SAR A N     1 
HETATM 3237 C  CA    . SAR F 6 .   ? 6.038   9.657  9.865   1.00 50.52 ? 504 SAR A CA    1 
HETATM 3238 C  C     . SAR F 6 .   ? 7.199   9.667  8.887   1.00 50.43 ? 504 SAR A C     1 
HETATM 3239 O  O     . SAR F 6 .   ? 7.327   8.766  8.057   1.00 50.28 ? 504 SAR A O     1 
HETATM 3240 C  CN    . SAR F 6 .   ? 5.710   12.175 10.148  1.00 50.91 ? 504 SAR A CN    1 
HETATM 3241 O  OXT   . SAR F 6 .   ? 8.058   10.555 8.894   1.00 50.39 ? 504 SAR A OXT   1 
HETATM 3242 N  N     . SAR G 6 .   ? -25.093 40.392 -5.350  1.00 50.61 ? 505 SAR A N     1 
HETATM 3243 C  CA    . SAR G 6 .   ? -24.848 39.562 -6.533  1.00 50.50 ? 505 SAR A CA    1 
HETATM 3244 C  C     . SAR G 6 .   ? -23.405 39.556 -7.020  1.00 50.55 ? 505 SAR A C     1 
HETATM 3245 O  O     . SAR G 6 .   ? -23.055 40.249 -7.983  1.00 50.25 ? 505 SAR A O     1 
HETATM 3246 C  CN    . SAR G 6 .   ? -25.874 39.890 -4.223  1.00 50.53 ? 505 SAR A CN    1 
HETATM 3247 O  OXT   . SAR G 6 .   ? -22.543 38.848 -6.479  1.00 50.28 ? 505 SAR A OXT   1 
HETATM 3248 O  O1    . 2PE H 7 .   ? -17.015 7.951  -12.588 1.00 43.81 ? 506 2PE A O1    1 
HETATM 3249 C  C2    . 2PE H 7 .   ? -17.136 9.305  -13.041 1.00 41.61 ? 506 2PE A C2    1 
HETATM 3250 C  C3    . 2PE H 7 .   ? -15.769 9.984  -13.009 1.00 40.74 ? 506 2PE A C3    1 
HETATM 3251 O  O4    . 2PE H 7 .   ? -15.888 11.303 -13.559 1.00 38.69 ? 506 2PE A O4    1 
HETATM 3252 C  C5    . 2PE H 7 .   ? -14.878 12.222 -13.126 1.00 34.92 ? 506 2PE A C5    1 
HETATM 3253 C  C6    . 2PE H 7 .   ? -15.279 12.858 -11.798 1.00 31.86 ? 506 2PE A C6    1 
HETATM 3254 O  O7    . 2PE H 7 .   ? -14.089 13.128 -11.062 1.00 29.09 ? 506 2PE A O7    1 
HETATM 3255 C  C8    . 2PE H 7 .   ? -14.176 12.915 -9.657  1.00 26.90 ? 506 2PE A C8    1 
HETATM 3256 C  C9    . 2PE H 7 .   ? -12.770 12.661 -9.132  1.00 26.08 ? 506 2PE A C9    1 
HETATM 3257 O  O10   . 2PE H 7 .   ? -12.523 11.273 -9.213  1.00 26.23 ? 506 2PE A O10   1 
HETATM 3258 C  C11   . 2PE H 7 .   ? -11.203 10.880 -8.858  1.00 26.90 ? 506 2PE A C11   1 
HETATM 3259 C  C12   . 2PE H 7 .   ? -10.530 10.305 -10.095 1.00 28.17 ? 506 2PE A C12   1 
HETATM 3260 O  O13   . 2PE H 7 .   ? -10.997 8.979  -10.292 1.00 28.99 ? 506 2PE A O13   1 
HETATM 3261 O  O     . HOH I 8 .   ? -12.365 26.671 8.259   1.00 12.52 ? 601 HOH A O     1 
HETATM 3262 O  O     . HOH I 8 .   ? -13.571 24.253 8.500   1.00 19.13 ? 602 HOH A O     1 
HETATM 3263 O  O     . HOH I 8 .   ? -9.607  25.461 8.417   1.00 12.55 ? 603 HOH A O     1 
HETATM 3264 O  O     . HOH I 8 .   ? -18.094 21.623 13.220  1.00 9.49  ? 604 HOH A O     1 
HETATM 3265 O  O     . HOH I 8 .   ? -7.642  38.209 13.098  1.00 20.36 ? 605 HOH A O     1 
HETATM 3266 O  O     . HOH I 8 .   ? -8.223  40.313 14.810  1.00 26.03 ? 606 HOH A O     1 
HETATM 3267 O  O     . HOH I 8 .   ? -10.516 40.729 16.464  1.00 25.76 ? 607 HOH A O     1 
HETATM 3268 O  O     . HOH I 8 .   ? -12.751 39.256 16.735  1.00 24.81 ? 608 HOH A O     1 
HETATM 3269 O  O     . HOH I 8 .   ? -9.153  36.605 17.731  1.00 27.33 ? 609 HOH A O     1 
HETATM 3270 O  O     . HOH I 8 .   ? -5.862  32.261 17.085  1.00 27.37 ? 610 HOH A O     1 
HETATM 3271 O  O     . HOH I 8 .   ? -24.253 22.003 -11.474 1.00 17.71 ? 611 HOH A O     1 
HETATM 3272 O  O     . HOH I 8 .   ? -9.183  14.962 7.193   1.00 16.58 ? 612 HOH A O     1 
HETATM 3273 O  O     . HOH I 8 .   ? -7.693  16.138 5.042   1.00 14.92 ? 613 HOH A O     1 
HETATM 3274 O  O     . HOH I 8 .   ? -8.595  19.418 -11.954 1.00 24.46 ? 614 HOH A O     1 
HETATM 3275 O  O     . HOH I 8 .   ? -6.848  21.948 -4.912  1.00 17.25 ? 615 HOH A O     1 
HETATM 3276 O  O     . HOH I 8 .   ? -15.043 29.455 -9.955  1.00 22.64 ? 616 HOH A O     1 
HETATM 3277 O  O     . HOH I 8 .   ? -14.714 29.496 -6.496  1.00 24.23 ? 617 HOH A O     1 
HETATM 3278 O  O     . HOH I 8 .   ? -10.172 34.317 2.113   1.00 31.32 ? 618 HOH A O     1 
HETATM 3279 O  O     . HOH I 8 .   ? -19.957 8.193  1.414   1.00 19.24 ? 619 HOH A O     1 
HETATM 3280 O  O     . HOH I 8 .   ? -17.848 7.394  2.018   1.00 21.35 ? 620 HOH A O     1 
HETATM 3281 O  O     . HOH I 8 .   ? 12.603  12.619 -11.967 1.00 21.04 ? 621 HOH A O     1 
HETATM 3282 O  O     . HOH I 8 .   ? 13.043  14.700 -13.515 1.00 32.10 ? 622 HOH A O     1 
HETATM 3283 O  O     . HOH I 8 .   ? -20.518 27.126 -15.496 1.00 26.31 ? 623 HOH A O     1 
HETATM 3284 O  O     . HOH I 8 .   ? -6.537  15.216 -3.720  1.00 24.13 ? 624 HOH A O     1 
HETATM 3285 O  O     . HOH I 8 .   ? -4.287  15.597 -2.103  1.00 17.54 ? 625 HOH A O     1 
HETATM 3286 O  O     . HOH I 8 .   ? -5.328  14.175 -0.009  1.00 18.86 ? 626 HOH A O     1 
HETATM 3287 O  O     . HOH I 8 .   ? 8.360   7.937  2.393   1.00 31.22 ? 627 HOH A O     1 
HETATM 3288 O  O     . HOH I 8 .   ? -7.050  24.332 5.518   1.00 24.31 ? 628 HOH A O     1 
HETATM 3289 O  O     . HOH I 8 .   ? 3.487   18.512 -12.439 1.00 23.18 ? 629 HOH A O     1 
HETATM 3290 O  O     . HOH I 8 .   ? -9.270  36.953 1.858   1.00 34.89 ? 630 HOH A O     1 
HETATM 3291 O  O     . HOH I 8 .   ? -12.001 27.226 5.355   1.00 18.25 ? 631 HOH A O     1 
HETATM 3292 O  O     . HOH I 8 .   ? -12.417 21.745 18.473  1.00 24.65 ? 632 HOH A O     1 
HETATM 3293 O  O     . HOH I 8 .   ? 3.920   4.289  -9.176  1.00 20.40 ? 633 HOH A O     1 
HETATM 3294 O  O     . HOH I 8 .   ? -4.510  10.788 -9.965  1.00 18.52 ? 634 HOH A O     1 
HETATM 3295 O  O     A HOH I 8 .   ? -17.239 5.643  13.449  0.50 8.55  ? 635 HOH A O     1 
HETATM 3296 O  O     . HOH I 8 .   ? -5.181  8.191  7.046   1.00 26.22 ? 636 HOH A O     1 
HETATM 3297 O  O     . HOH I 8 .   ? 9.363   6.824  -3.320  1.00 21.39 ? 637 HOH A O     1 
HETATM 3298 O  O     . HOH I 8 .   ? -3.958  8.243  -10.996 1.00 40.30 ? 638 HOH A O     1 
HETATM 3299 O  O     . HOH I 8 .   ? -11.163 15.271 -13.870 1.00 24.20 ? 639 HOH A O     1 
HETATM 3300 O  O     . HOH I 8 .   ? -3.598  24.671 -10.193 1.00 27.10 ? 640 HOH A O     1 
HETATM 3301 O  O     . HOH I 8 .   ? -6.781  12.797 -10.147 1.00 18.24 ? 641 HOH A O     1 
HETATM 3302 O  O     . HOH I 8 .   ? -2.540  14.406 -13.186 1.00 18.12 ? 642 HOH A O     1 
HETATM 3303 O  O     . HOH I 8 .   ? -20.305 33.143 -6.903  1.00 23.83 ? 643 HOH A O     1 
HETATM 3304 O  O     . HOH I 8 .   ? 9.494   6.071  -11.104 1.00 19.21 ? 644 HOH A O     1 
HETATM 3305 O  O     . HOH I 8 .   ? -5.428  12.112 3.204   1.00 11.90 ? 645 HOH A O     1 
HETATM 3306 O  O     . HOH I 8 .   ? -14.589 41.192 9.160   1.00 23.63 ? 646 HOH A O     1 
HETATM 3307 O  O     . HOH I 8 .   ? -0.933  43.506 4.890   1.00 28.71 ? 647 HOH A O     1 
HETATM 3308 O  O     . HOH I 8 .   ? -9.166  28.383 -1.325  1.00 24.53 ? 648 HOH A O     1 
HETATM 3309 O  O     . HOH I 8 .   ? -9.678  27.440 6.360   1.00 31.19 ? 649 HOH A O     1 
HETATM 3310 O  O     . HOH I 8 .   ? -5.020  13.976 -11.849 1.00 35.67 ? 650 HOH A O     1 
HETATM 3311 O  O     . HOH I 8 .   ? -7.729  26.397 18.127  1.00 39.96 ? 651 HOH A O     1 
HETATM 3312 O  O     . HOH I 8 .   ? -4.393  5.391  7.625   1.00 20.05 ? 652 HOH A O     1 
HETATM 3313 O  O     . HOH I 8 .   ? -25.667 11.695 -0.842  1.00 30.10 ? 653 HOH A O     1 
HETATM 3314 O  O     . HOH I 8 .   ? -23.096 42.023 6.098   1.00 18.27 ? 654 HOH A O     1 
HETATM 3315 O  O     . HOH I 8 .   ? -6.487  22.872 3.273   1.00 30.06 ? 655 HOH A O     1 
HETATM 3316 O  O     . HOH I 8 .   ? 12.682  25.561 -5.592  1.00 34.08 ? 656 HOH A O     1 
HETATM 3317 O  O     . HOH I 8 .   ? -32.410 20.757 0.796   1.00 34.14 ? 657 HOH A O     1 
HETATM 3318 O  O     . HOH I 8 .   ? -36.677 24.339 -5.104  1.00 43.52 ? 658 HOH A O     1 
HETATM 3319 O  O     . HOH I 8 .   ? -14.574 39.192 -0.105  1.00 28.40 ? 659 HOH A O     1 
HETATM 3320 O  O     . HOH I 8 .   ? -31.475 27.921 11.808  1.00 29.77 ? 660 HOH A O     1 
HETATM 3321 O  O     . HOH I 8 .   ? -25.123 20.734 -13.807 1.00 24.81 ? 661 HOH A O     1 
HETATM 3322 O  O     . HOH I 8 .   ? -13.850 31.095 -11.341 1.00 41.30 ? 662 HOH A O     1 
HETATM 3323 O  O     . HOH I 8 .   ? -22.550 13.919 -14.032 1.00 34.70 ? 663 HOH A O     1 
HETATM 3324 O  O     . HOH I 8 .   ? -23.858 15.263 25.096  1.00 39.18 ? 664 HOH A O     1 
HETATM 3325 O  O     . HOH I 8 .   ? -9.114  33.625 7.999   1.00 14.51 ? 665 HOH A O     1 
HETATM 3326 O  O     . HOH I 8 .   ? -6.972  32.060 7.550   1.00 23.30 ? 666 HOH A O     1 
HETATM 3327 O  O     . HOH I 8 .   ? -13.274 28.360 -8.608  1.00 32.32 ? 667 HOH A O     1 
HETATM 3328 O  O     . HOH I 8 .   ? 4.971   16.980 -20.679 1.00 44.71 ? 668 HOH A O     1 
HETATM 3329 O  O     . HOH I 8 .   ? -0.535  8.791  8.232   1.00 28.05 ? 669 HOH A O     1 
HETATM 3330 O  O     . HOH I 8 .   ? -14.430 40.699 18.544  1.00 28.68 ? 670 HOH A O     1 
HETATM 3331 O  O     . HOH I 8 .   ? -15.557 6.211  11.617  1.00 21.30 ? 671 HOH A O     1 
HETATM 3332 O  O     . HOH I 8 .   ? -13.146 6.224  12.536  1.00 28.80 ? 672 HOH A O     1 
HETATM 3333 O  O     . HOH I 8 .   ? -12.340 8.908  13.722  1.00 30.56 ? 673 HOH A O     1 
HETATM 3334 O  O     . HOH I 8 .   ? -9.938  10.023 12.874  1.00 20.17 ? 674 HOH A O     1 
HETATM 3335 O  O     . HOH I 8 .   ? 11.172  19.995 -10.809 1.00 29.27 ? 675 HOH A O     1 
HETATM 3336 O  O     . HOH I 8 .   ? 9.609   12.461 -16.708 1.00 33.98 ? 676 HOH A O     1 
HETATM 3337 O  O     . HOH I 8 .   ? -10.089 26.031 0.393   1.00 26.29 ? 677 HOH A O     1 
HETATM 3338 O  O     . HOH I 8 .   ? -4.944  25.488 18.307  1.00 32.71 ? 678 HOH A O     1 
HETATM 3339 O  O     . HOH I 8 .   ? -9.250  18.272 17.169  1.00 36.75 ? 679 HOH A O     1 
HETATM 3340 O  O     . HOH I 8 .   ? 4.380   4.469  -2.666  1.00 35.08 ? 680 HOH A O     1 
HETATM 3341 O  O     . HOH I 8 .   ? 2.611   28.488 17.923  1.00 40.22 ? 681 HOH A O     1 
HETATM 3342 O  O     . HOH I 8 .   ? -10.612 28.332 -9.204  1.00 41.95 ? 682 HOH A O     1 
HETATM 3343 O  O     . HOH I 8 .   ? -13.812 20.562 20.665  1.00 39.47 ? 683 HOH A O     1 
HETATM 3344 O  O     . HOH I 8 .   ? 9.548   4.187  -3.483  1.00 21.45 ? 684 HOH A O     1 
HETATM 3345 O  O     . HOH I 8 .   ? -7.830  8.103  8.298   1.00 25.09 ? 685 HOH A O     1 
HETATM 3346 O  O     . HOH I 8 .   ? 6.614   24.499 -15.473 1.00 42.41 ? 686 HOH A O     1 
HETATM 3347 O  O     . HOH I 8 .   ? -0.048  49.504 -0.564  1.00 30.73 ? 687 HOH A O     1 
HETATM 3348 O  O     . HOH I 8 .   ? -35.322 33.036 -0.442  1.00 42.41 ? 688 HOH A O     1 
HETATM 3349 O  O     . HOH I 8 .   ? -11.778 60.625 -1.377  1.00 40.09 ? 689 HOH A O     1 
HETATM 3350 O  O     . HOH I 8 .   ? -0.139  29.729 20.037  1.00 37.56 ? 690 HOH A O     1 
HETATM 3351 O  O     . HOH I 8 .   ? -24.220 45.397 5.586   1.00 31.68 ? 691 HOH A O     1 
HETATM 3352 O  O     . HOH I 8 .   ? -26.561 37.877 -8.294  1.00 32.84 ? 692 HOH A O     1 
HETATM 3353 O  O     . HOH I 8 .   ? 5.255   6.112  -11.602 1.00 23.51 ? 693 HOH A O     1 
HETATM 3354 O  O     . HOH I 8 .   ? -27.202 15.516 -15.518 1.00 38.87 ? 694 HOH A O     1 
HETATM 3355 O  O     . HOH I 8 .   ? 0.719   28.599 -14.474 1.00 36.72 ? 695 HOH A O     1 
HETATM 3356 O  O     . HOH I 8 .   ? 3.232   9.668  -17.828 1.00 34.55 ? 696 HOH A O     1 
HETATM 3357 O  O     . HOH I 8 .   ? -2.132  42.483 12.705  1.00 38.70 ? 697 HOH A O     1 
HETATM 3358 O  O     . HOH I 8 .   ? -6.746  14.425 2.912   1.00 31.16 ? 698 HOH A O     1 
HETATM 3359 O  O     . HOH I 8 .   ? -29.453 23.280 -3.603  1.00 34.52 ? 699 HOH A O     1 
HETATM 3360 O  O     . HOH I 8 .   ? -22.250 17.476 -14.809 1.00 25.54 ? 700 HOH A O     1 
HETATM 3361 O  O     . HOH I 8 .   ? -7.766  31.409 5.151   1.00 27.37 ? 701 HOH A O     1 
HETATM 3362 O  O     . HOH I 8 .   ? 13.855  18.373 -2.389  1.00 27.12 ? 702 HOH A O     1 
HETATM 3363 O  O     . HOH I 8 .   ? 12.418  13.836 3.190   1.00 38.56 ? 703 HOH A O     1 
HETATM 3364 O  O     . HOH I 8 .   ? 0.776   1.002  -8.007  1.00 32.29 ? 704 HOH A O     1 
HETATM 3365 O  O     . HOH I 8 .   ? -0.199  10.331 11.224  1.00 52.37 ? 705 HOH A O     1 
HETATM 3366 O  O     . HOH I 8 .   ? 2.724   10.376 10.875  1.00 37.25 ? 706 HOH A O     1 
HETATM 3367 O  O     . HOH I 8 .   ? 9.048   20.982 -16.352 1.00 39.04 ? 707 HOH A O     1 
HETATM 3368 O  O     . HOH I 8 .   ? 6.918   12.585 -18.735 1.00 36.49 ? 708 HOH A O     1 
HETATM 3369 O  O     . HOH I 8 .   ? -9.470  15.513 16.807  1.00 43.20 ? 709 HOH A O     1 
HETATM 3370 O  O     . HOH I 8 .   ? -22.138 8.877  -8.661  1.00 36.65 ? 710 HOH A O     1 
HETATM 3371 O  O     . HOH I 8 .   ? -24.389 9.077  -10.097 1.00 30.15 ? 711 HOH A O     1 
HETATM 3372 O  O     . HOH I 8 .   ? -7.259  24.699 -11.292 1.00 34.90 ? 712 HOH A O     1 
HETATM 3373 O  O     . HOH I 8 .   ? -19.950 58.224 11.226  1.00 36.33 ? 713 HOH A O     1 
HETATM 3374 O  O     . HOH I 8 .   ? -21.727 60.187 11.163  1.00 33.84 ? 714 HOH A O     1 
HETATM 3375 O  O     . HOH I 8 .   ? -31.241 19.593 -0.983  1.00 26.35 ? 715 HOH A O     1 
HETATM 3376 O  O     . HOH I 8 .   ? -11.766 20.508 -14.209 1.00 34.73 ? 716 HOH A O     1 
HETATM 3377 O  O     . HOH I 8 .   ? -11.566 23.438 -13.530 1.00 28.52 ? 717 HOH A O     1 
HETATM 3378 O  O     . HOH I 8 .   ? -9.973  25.073 -14.446 1.00 38.59 ? 718 HOH A O     1 
HETATM 3379 O  O     . HOH I 8 .   ? -15.022 18.244 21.702  1.00 30.92 ? 719 HOH A O     1 
HETATM 3380 O  O     . HOH I 8 .   ? -15.985 11.603 20.590  1.00 31.94 ? 720 HOH A O     1 
HETATM 3381 O  O     . HOH I 8 .   ? -32.529 26.524 3.292   1.00 27.80 ? 721 HOH A O     1 
HETATM 3382 O  O     . HOH I 8 .   ? -14.148 10.380 18.428  1.00 28.23 ? 722 HOH A O     1 
HETATM 3383 O  O     . HOH I 8 .   ? -27.424 25.197 -4.698  1.00 37.14 ? 723 HOH A O     1 
HETATM 3384 O  O     . HOH I 8 .   ? -15.265 22.719 20.514  1.00 34.45 ? 724 HOH A O     1 
HETATM 3385 O  O     . HOH I 8 .   ? -10.652 17.648 19.455  1.00 37.41 ? 725 HOH A O     1 
HETATM 3386 O  O     . HOH I 8 .   ? -12.301 16.360 20.176  1.00 37.46 ? 726 HOH A O     1 
HETATM 3387 O  O     . HOH I 8 .   ? -17.693 24.739 -14.530 1.00 28.09 ? 727 HOH A O     1 
HETATM 3388 O  O     . HOH I 8 .   ? -18.127 22.115 -13.787 1.00 18.72 ? 728 HOH A O     1 
HETATM 3389 O  O     . HOH I 8 .   ? 11.669  15.408 -15.703 1.00 39.12 ? 729 HOH A O     1 
HETATM 3390 O  O     . HOH I 8 .   ? -7.004  24.481 1.234   1.00 28.35 ? 730 HOH A O     1 
HETATM 3391 O  O     . HOH I 8 .   ? -34.386 13.249 -3.397  1.00 40.84 ? 731 HOH A O     1 
HETATM 3392 O  O     . HOH I 8 .   ? -31.608 22.706 -11.371 1.00 29.90 ? 732 HOH A O     1 
HETATM 3393 O  O     . HOH I 8 .   ? -3.160  40.684 11.263  1.00 42.36 ? 733 HOH A O     1 
HETATM 3394 O  O     . HOH J 8 .   ? -7.174  30.113 17.692  1.00 25.57 ? 101 HOH B O     1 
HETATM 3395 O  O     . HOH J 8 .   ? -14.893 27.833 23.925  1.00 35.31 ? 102 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 7   ? 0.4004 0.5189 0.8228 -0.0597 -0.0734 0.0067  4   GLU A N   
2    C CA  . GLU A 7   ? 0.3929 0.5572 0.8065 -0.0576 -0.0729 0.0233  4   GLU A CA  
3    C C   . GLU A 7   ? 0.3767 0.5597 0.6933 -0.0335 -0.0730 0.0182  4   GLU A C   
4    O O   . GLU A 7   ? 0.3763 0.5730 0.6576 -0.0229 -0.0612 0.0502  4   GLU A O   
5    C CB  . GLU A 7   ? 0.4099 0.6063 0.9048 -0.0759 -0.0871 -0.0099 4   GLU A CB  
6    C CG  . GLU A 7   ? 0.4218 0.6563 0.9646 -0.0857 -0.0819 0.0238  4   GLU A CG  
7    C CD  . GLU A 7   ? 0.4563 0.6971 1.1270 -0.1141 -0.0874 0.0113  4   GLU A CD  
8    O OE1 . GLU A 7   ? 0.4764 0.7620 1.1920 -0.1243 -0.0919 0.0115  4   GLU A OE1 
9    O OE2 . GLU A 7   ? 0.4893 0.6900 1.2251 -0.1266 -0.0861 0.0013  4   GLU A OE2 
10   N N   . ASN A 8   ? 0.3670 0.5570 0.6492 -0.0241 -0.0849 -0.0213 5   ASN A N   
11   C CA  . ASN A 8   ? 0.3427 0.5454 0.5436 0.0006  -0.0822 -0.0182 5   ASN A CA  
12   C C   . ASN A 8   ? 0.3258 0.4815 0.4748 0.0113  -0.0673 0.0035  5   ASN A C   
13   O O   . ASN A 8   ? 0.3242 0.4438 0.4849 0.0033  -0.0661 -0.0010 5   ASN A O   
14   C CB  . ASN A 8   ? 0.3507 0.5843 0.5328 0.0083  -0.0977 -0.0594 5   ASN A CB  
15   C CG  . ASN A 8   ? 0.3521 0.6527 0.5736 0.0017  -0.1143 -0.0862 5   ASN A CG  
16   O OD1 . ASN A 8   ? 0.2966 0.6196 0.5527 -0.0053 -0.1134 -0.0694 5   ASN A OD1 
17   N ND2 . ASN A 8   ? 0.3450 0.6878 0.5614 0.0045  -0.1298 -0.1303 5   ASN A ND2 
18   N N   . VAL A 9   ? 0.3041 0.4622 0.4039 0.0291  -0.0556 0.0245  6   VAL A N   
19   C CA  . VAL A 9   ? 0.2894 0.4099 0.3479 0.0372  -0.0409 0.0399  6   VAL A CA  
20   C C   . VAL A 9   ? 0.2817 0.3973 0.2899 0.0588  -0.0359 0.0369  6   VAL A C   
21   O O   . VAL A 9   ? 0.2743 0.4198 0.2755 0.0731  -0.0356 0.0416  6   VAL A O   
22   C CB  . VAL A 9   ? 0.2843 0.4125 0.3466 0.0355  -0.0260 0.0676  6   VAL A CB  
23   C CG1 . VAL A 9   ? 0.2783 0.3791 0.3039 0.0407  -0.0127 0.0746  6   VAL A CG1 
24   C CG2 . VAL A 9   ? 0.2835 0.4268 0.4050 0.0154  -0.0288 0.0829  6   VAL A CG2 
25   N N   . GLN A 10  ? 0.2768 0.3571 0.2577 0.0616  -0.0308 0.0338  7   GLN A N   
26   C CA  . GLN A 10  ? 0.2845 0.3548 0.2283 0.0804  -0.0227 0.0372  7   GLN A CA  
27   C C   . GLN A 10  ? 0.2756 0.3094 0.2015 0.0808  -0.0069 0.0447  7   GLN A C   
28   O O   . GLN A 10  ? 0.2726 0.2862 0.2000 0.0682  -0.0075 0.0419  7   GLN A O   
29   C CB  . GLN A 10  ? 0.2919 0.3669 0.2225 0.0838  -0.0330 0.0207  7   GLN A CB  
30   C CG  . GLN A 10  ? 0.3221 0.4530 0.2609 0.0901  -0.0472 0.0095  7   GLN A CG  
31   C CD  . GLN A 10  ? 0.3618 0.5139 0.2832 0.0956  -0.0562 -0.0105 7   GLN A CD  
32   O OE1 . GLN A 10  ? 0.3577 0.5037 0.2958 0.0818  -0.0660 -0.0403 7   GLN A OE1 
33   N NE2 . GLN A 10  ? 0.4017 0.5841 0.2958 0.1171  -0.0514 0.0071  7   GLN A NE2 
34   N N   . GLU A 11  ? 0.2772 0.3068 0.1936 0.0955  0.0076  0.0530  8   GLU A N   
35   C CA  . GLU A 11  ? 0.2761 0.2791 0.1831 0.0950  0.0231  0.0503  8   GLU A CA  
36   C C   . GLU A 11  ? 0.2899 0.2687 0.1871 0.1083  0.0322  0.0527  8   GLU A C   
37   O O   . GLU A 11  ? 0.2991 0.2901 0.2027 0.1246  0.0345  0.0659  8   GLU A O   
38   C CB  . GLU A 11  ? 0.2774 0.2978 0.1981 0.0993  0.0362  0.0504  8   GLU A CB  
39   C CG  . GLU A 11  ? 0.2578 0.3132 0.1934 0.0883  0.0300  0.0562  8   GLU A CG  
40   C CD  . GLU A 11  ? 0.2471 0.3073 0.1809 0.0712  0.0279  0.0584  8   GLU A CD  
41   O OE1 . GLU A 11  ? 0.2481 0.2904 0.1652 0.0682  0.0328  0.0509  8   GLU A OE1 
42   O OE2 . GLU A 11  ? 0.2501 0.3377 0.2052 0.0610  0.0219  0.0717  8   GLU A OE2 
43   N N   . PHE A 12  ? 0.2930 0.2440 0.1797 0.1019  0.0381  0.0445  9   PHE A N   
44   C CA  . PHE A 12  ? 0.3136 0.2411 0.1979 0.1116  0.0474  0.0495  9   PHE A CA  
45   C C   . PHE A 12  ? 0.3243 0.2278 0.2184 0.1069  0.0634  0.0352  9   PHE A C   
46   O O   . PHE A 12  ? 0.3078 0.2142 0.1923 0.0923  0.0608  0.0202  9   PHE A O   
47   C CB  . PHE A 12  ? 0.3100 0.2332 0.1742 0.1071  0.0356  0.0492  9   PHE A CB  
48   C CG  . PHE A 12  ? 0.3170 0.2731 0.1762 0.1127  0.0205  0.0530  9   PHE A CG  
49   C CD1 . PHE A 12  ? 0.3073 0.2769 0.1702 0.0996  0.0046  0.0388  9   PHE A CD1 
50   C CD2 . PHE A 12  ? 0.3406 0.3216 0.1983 0.1311  0.0229  0.0706  9   PHE A CD2 
51   C CE1 . PHE A 12  ? 0.2995 0.3058 0.1652 0.1026  -0.0097 0.0312  9   PHE A CE1 
52   C CE2 . PHE A 12  ? 0.3456 0.3746 0.1970 0.1362  0.0075  0.0680  9   PHE A CE2 
53   C CZ  . PHE A 12  ? 0.3270 0.3674 0.1825 0.1206  -0.0094 0.0424  9   PHE A CZ  
54   N N   . VAL A 13  ? 0.3468 0.2335 0.2673 0.1195  0.0803  0.0405  10  VAL A N   
55   C CA  . VAL A 13  ? 0.3660 0.2286 0.3084 0.1142  0.0964  0.0202  10  VAL A CA  
56   C C   . VAL A 13  ? 0.3746 0.2136 0.3183 0.1159  0.0998  0.0340  10  VAL A C   
57   O O   . VAL A 13  ? 0.3884 0.2253 0.3471 0.1316  0.1055  0.0633  10  VAL A O   
58   C CB  . VAL A 13  ? 0.3869 0.2423 0.3794 0.1258  0.1172  0.0115  10  VAL A CB  
59   C CG1 . VAL A 13  ? 0.4044 0.2389 0.4297 0.1168  0.1335  -0.0217 10  VAL A CG1 
60   C CG2 . VAL A 13  ? 0.3831 0.2703 0.3730 0.1259  0.1148  -0.0012 10  VAL A CG2 
61   N N   . LEU A 14  ? 0.3765 0.2072 0.3048 0.1007  0.0961  0.0169  11  LEU A N   
62   C CA  . LEU A 14  ? 0.3860 0.1977 0.3167 0.1000  0.1001  0.0271  11  LEU A CA  
63   C C   . LEU A 14  ? 0.4041 0.1934 0.3788 0.0936  0.1189  0.0063  11  LEU A C   
64   O O   . LEU A 14  ? 0.3941 0.1926 0.3683 0.0788  0.1183  -0.0285 11  LEU A O   
65   C CB  . LEU A 14  ? 0.3768 0.1966 0.2687 0.0875  0.0837  0.0210  11  LEU A CB  
66   C CG  . LEU A 14  ? 0.3766 0.2140 0.2381 0.0915  0.0660  0.0343  11  LEU A CG  
67   C CD1 . LEU A 14  ? 0.3670 0.2242 0.2243 0.0900  0.0567  0.0305  11  LEU A CD1 
68   C CD2 . LEU A 14  ? 0.3795 0.2158 0.2218 0.0807  0.0558  0.0269  11  LEU A CD2 
69   N N   . LYS A 15  ? 0.4229 0.1904 0.4423 0.1047  0.1361  0.0277  12  LYS A N   
70   C CA  . LYS A 15  ? 0.4423 0.1844 0.5166 0.0961  0.1546  0.0079  12  LYS A CA  
71   C C   . LYS A 15  ? 0.4272 0.1713 0.4749 0.0804  0.1461  -0.0021 12  LYS A C   
72   O O   . LYS A 15  ? 0.4049 0.1637 0.4007 0.0812  0.1297  0.0145  12  LYS A O   
73   C CB  . LYS A 15  ? 0.4710 0.1896 0.6100 0.1124  0.1765  0.0464  12  LYS A CB  
74   C CG  . LYS A 15  ? 0.4972 0.2058 0.6945 0.1263  0.1930  0.0481  12  LYS A CG  
75   C CD  . LYS A 15  ? 0.5557 0.2431 0.8317 0.1443  0.2175  0.0970  12  LYS A CD  
76   C CE  . LYS A 15  ? 0.5661 0.2851 0.8055 0.1639  0.2100  0.1622  12  LYS A CE  
77   N NZ  . LYS A 15  ? 0.5534 0.3108 0.7158 0.1686  0.1853  0.1601  12  LYS A NZ  
78   N N   . GLU A 16  ? 0.4407 0.1732 0.5302 0.0662  0.1574  -0.0331 13  GLU A N   
79   C CA  . GLU A 16  ? 0.4379 0.1738 0.5139 0.0525  0.1521  -0.0388 13  GLU A CA  
80   C C   . GLU A 16  ? 0.4344 0.1630 0.4969 0.0642  0.1523  0.0102  13  GLU A C   
81   O O   . GLU A 16  ? 0.4478 0.1655 0.5411 0.0809  0.1653  0.0479  13  GLU A O   
82   C CB  . GLU A 16  ? 0.4655 0.1893 0.6090 0.0369  0.1686  -0.0761 13  GLU A CB  
83   C CG  . GLU A 16  ? 0.5081 0.1934 0.7402 0.0452  0.1952  -0.0576 13  GLU A CG  
84   C CD  . GLU A 16  ? 0.5619 0.2352 0.8739 0.0257  0.2113  -0.1046 13  GLU A CD  
85   O OE1 . GLU A 16  ? 0.6005 0.2890 0.8999 0.0089  0.2041  -0.1218 13  GLU A OE1 
86   O OE2 . GLU A 16  ? 0.5800 0.2306 0.9745 0.0271  0.2316  -0.1267 13  GLU A OE2 
87   N N   . ASP A 17  ? 0.4138 0.1571 0.4328 0.0573  0.1385  0.0111  14  ASP A N   
88   C CA  . ASP A 17  ? 0.4153 0.1632 0.4188 0.0675  0.1387  0.0487  14  ASP A CA  
89   C C   . ASP A 17  ? 0.4121 0.1777 0.3841 0.0883  0.1324  0.0822  14  ASP A C   
90   O O   . ASP A 17  ? 0.4135 0.1936 0.3874 0.1017  0.1388  0.1177  14  ASP A O   
91   C CB  . ASP A 17  ? 0.4380 0.1684 0.5057 0.0667  0.1612  0.0671  14  ASP A CB  
92   C CG  . ASP A 17  ? 0.4557 0.1763 0.5608 0.0435  0.1662  0.0258  14  ASP A CG  
93   O OD1 . ASP A 17  ? 0.4579 0.1972 0.5254 0.0318  0.1517  0.0061  14  ASP A OD1 
94   O OD2 . ASP A 17  ? 0.4993 0.1980 0.6777 0.0370  0.1848  0.0111  14  ASP A OD2 
95   N N   . CYS A 18  ? 0.4051 0.1792 0.3500 0.0905  0.1197  0.0700  15  CYS A N   
96   C CA  . CYS A 18  ? 0.4018 0.2015 0.3172 0.1069  0.1102  0.0918  15  CYS A CA  
97   C C   . CYS A 18  ? 0.3901 0.2053 0.2590 0.1002  0.0882  0.0715  15  CYS A C   
98   O O   . CYS A 18  ? 0.3879 0.1939 0.2506 0.0849  0.0816  0.0469  15  CYS A O   
99   C CB  . CYS A 18  ? 0.4043 0.2029 0.3411 0.1160  0.1153  0.0977  15  CYS A CB  
100  S SG  . CYS A 18  ? 0.4272 0.2041 0.4413 0.1278  0.1448  0.1273  15  CYS A SG  
101  N N   . GLU A 19  ? 0.3916 0.2367 0.2347 0.1117  0.0777  0.0815  16  GLU A N   
102  C CA  . GLU A 19  ? 0.3823 0.2389 0.1992 0.1052  0.0583  0.0593  16  GLU A CA  
103  C C   . GLU A 19  ? 0.3772 0.2637 0.1846 0.1144  0.0476  0.0602  16  GLU A C   
104  O O   . GLU A 19  ? 0.3873 0.3074 0.1911 0.1305  0.0503  0.0793  16  GLU A O   
105  C CB  . GLU A 19  ? 0.3899 0.2566 0.1915 0.1043  0.0524  0.0508  16  GLU A CB  
106  C CG  . GLU A 19  ? 0.4149 0.3204 0.2054 0.1211  0.0562  0.0665  16  GLU A CG  
107  C CD  . GLU A 19  ? 0.4373 0.3572 0.2152 0.1210  0.0514  0.0505  16  GLU A CD  
108  O OE1 . GLU A 19  ? 0.4500 0.3418 0.2344 0.1085  0.0494  0.0367  16  GLU A OE1 
109  O OE2 . GLU A 19  ? 0.4517 0.4201 0.2148 0.1350  0.0500  0.0515  16  GLU A OE2 
110  N N   . LEU A 20  ? 0.3594 0.2411 0.1666 0.1039  0.0356  0.0420  17  LEU A N   
111  C CA  . LEU A 20  ? 0.3541 0.2645 0.1588 0.1073  0.0224  0.0345  17  LEU A CA  
112  C C   . LEU A 20  ? 0.3559 0.2880 0.1535 0.1069  0.0101  0.0137  17  LEU A C   
113  O O   . LEU A 20  ? 0.3501 0.2614 0.1552 0.0962  0.0062  -0.0007 17  LEU A O   
114  C CB  . LEU A 20  ? 0.3402 0.2376 0.1579 0.0942  0.0165  0.0255  17  LEU A CB  
115  C CG  . LEU A 20  ? 0.3199 0.2429 0.1473 0.0924  0.0028  0.0160  17  LEU A CG  
116  C CD1 . LEU A 20  ? 0.3179 0.2747 0.1420 0.1077  0.0036  0.0283  17  LEU A CD1 
117  C CD2 . LEU A 20  ? 0.2766 0.1871 0.1210 0.0790  0.0017  0.0163  17  LEU A CD2 
118  N N   . ARG A 21  ? 0.3703 0.3513 0.1582 0.1198  0.0045  0.0109  18  ARG A N   
119  C CA  . ARG A 21  ? 0.3780 0.3928 0.1643 0.1203  -0.0076 -0.0209 18  ARG A CA  
120  C C   . ARG A 21  ? 0.3830 0.4334 0.1824 0.1180  -0.0226 -0.0431 18  ARG A C   
121  O O   . ARG A 21  ? 0.3838 0.4714 0.1755 0.1282  -0.0233 -0.0267 18  ARG A O   
122  C CB  . ARG A 21  ? 0.3958 0.4618 0.1590 0.1380  -0.0019 -0.0122 18  ARG A CB  
123  C CG  . ARG A 21  ? 0.4031 0.4399 0.1600 0.1402  0.0140  0.0117  18  ARG A CG  
124  C CD  . ARG A 21  ? 0.4297 0.5262 0.1690 0.1603  0.0232  0.0367  18  ARG A CD  
125  N NE  . ARG A 21  ? 0.4266 0.4957 0.1691 0.1609  0.0400  0.0620  18  ARG A NE  
126  C CZ  . ARG A 21  ? 0.4434 0.5523 0.1831 0.1772  0.0546  0.1008  18  ARG A CZ  
127  N NH1 . ARG A 21  ? 0.4503 0.6342 0.1796 0.1964  0.0544  0.1233  18  ARG A NH1 
128  N NH2 . ARG A 21  ? 0.4485 0.5283 0.2008 0.1744  0.0700  0.1213  18  ARG A NH2 
129  N N   . PHE A 22  ? 0.3846 0.4265 0.2123 0.1048  -0.0339 -0.0793 19  PHE A N   
130  C CA  . PHE A 22  ? 0.3979 0.4743 0.2509 0.0990  -0.0486 -0.1072 19  PHE A CA  
131  C C   . PHE A 22  ? 0.4136 0.5030 0.3031 0.0907  -0.0592 -0.1595 19  PHE A C   
132  O O   . PHE A 22  ? 0.4148 0.4732 0.3159 0.0878  -0.0546 -0.1697 19  PHE A O   
133  C CB  . PHE A 22  ? 0.3819 0.4229 0.2595 0.0861  -0.0490 -0.0898 19  PHE A CB  
134  C CG  . PHE A 22  ? 0.3777 0.3642 0.2892 0.0700  -0.0466 -0.0886 19  PHE A CG  
135  C CD1 . PHE A 22  ? 0.3737 0.3199 0.2687 0.0695  -0.0345 -0.0614 19  PHE A CD1 
136  C CD2 . PHE A 22  ? 0.3912 0.3732 0.3590 0.0555  -0.0559 -0.1127 19  PHE A CD2 
137  C CE1 . PHE A 22  ? 0.3800 0.2918 0.3063 0.0570  -0.0326 -0.0538 19  PHE A CE1 
138  C CE2 . PHE A 22  ? 0.3912 0.3299 0.3993 0.0431  -0.0517 -0.0998 19  PHE A CE2 
139  C CZ  . PHE A 22  ? 0.3772 0.2858 0.3605 0.0450  -0.0406 -0.0681 19  PHE A CZ  
140  N N   . ALA A 23  ? 0.4294 0.5687 0.3430 0.0871  -0.0732 -0.1952 20  ALA A N   
141  C CA  . ALA A 23  ? 0.4516 0.6014 0.4203 0.0758  -0.0833 -0.2540 20  ALA A CA  
142  C C   . ALA A 23  ? 0.4555 0.6006 0.4803 0.0584  -0.0932 -0.2671 20  ALA A C   
143  O O   . ALA A 23  ? 0.4578 0.6477 0.4673 0.0614  -0.1001 -0.2598 20  ALA A O   
144  C CB  . ALA A 23  ? 0.4772 0.7173 0.4271 0.0887  -0.0914 -0.3024 20  ALA A CB  
145  N N   . ALA A 24  ? 0.4620 0.5554 0.5579 0.0412  -0.0926 -0.2809 21  ALA A N   
146  C CA  . ALA A 24  ? 0.4653 0.5551 0.6322 0.0226  -0.1004 -0.2939 21  ALA A CA  
147  C C   . ALA A 24  ? 0.4942 0.6593 0.6886 0.0198  -0.1164 -0.3623 21  ALA A C   
148  O O   . ALA A 24  ? 0.5150 0.7228 0.6971 0.0288  -0.1199 -0.4094 21  ALA A O   
149  C CB  . ALA A 24  ? 0.4682 0.4942 0.7187 0.0070  -0.0941 -0.2909 21  ALA A CB  
150  N N   . GLY A 25  ? 0.4999 0.6905 0.7322 0.0075  -0.1260 -0.3704 22  GLY A N   
151  C CA  . GLY A 25  ? 0.5306 0.8045 0.7951 0.0023  -0.1432 -0.4402 22  GLY A CA  
152  C C   . GLY A 25  ? 0.5633 0.8316 0.9176 -0.0112 -0.1468 -0.5150 22  GLY A C   
153  O O   . GLY A 25  ? 0.5639 0.7540 0.9719 -0.0188 -0.1352 -0.5031 22  GLY A O   
154  N N   . ASP A 26  ? 0.5960 0.9542 0.9708 -0.0131 -0.1621 -0.5938 23  ASP A N   
155  C CA  . ASP A 26  ? 0.6315 0.9941 1.1064 -0.0273 -0.1659 -0.6814 23  ASP A CA  
156  C C   . ASP A 26  ? 0.6385 0.9234 1.2414 -0.0546 -0.1616 -0.6787 23  ASP A C   
157  O O   . ASP A 26  ? 0.6538 0.8769 1.3435 -0.0630 -0.1517 -0.6992 23  ASP A O   
158  C CB  . ASP A 26  ? 0.6643 1.1552 1.1451 -0.0277 -0.1857 -0.7723 23  ASP A CB  
159  C CG  . ASP A 26  ? 0.6725 1.2515 1.0570 -0.0008 -0.1874 -0.7933 23  ASP A CG  
160  O OD1 . ASP A 26  ? 0.6330 1.1932 0.9201 0.0201  -0.1769 -0.7173 23  ASP A OD1 
161  O OD2 . ASP A 26  ? 0.6999 1.3733 1.1122 -0.0012 -0.1986 -0.8879 23  ASP A OD2 
162  N N   . ASP A 27  ? 0.6290 0.9197 1.2470 -0.0667 -0.1671 -0.6466 24  ASP A N   
163  C CA  . ASP A 27  ? 0.6410 0.8819 1.3901 -0.0942 -0.1645 -0.6468 24  ASP A CA  
164  C C   . ASP A 27  ? 0.6145 0.7612 1.3785 -0.0976 -0.1466 -0.5482 24  ASP A C   
165  O O   . ASP A 27  ? 0.6275 0.7282 1.5121 -0.1184 -0.1399 -0.5393 24  ASP A O   
166  C CB  . ASP A 27  ? 0.6476 0.9623 1.4204 -0.1081 -0.1814 -0.6738 24  ASP A CB  
167  C CG  . ASP A 27  ? 0.6862 1.1076 1.4805 -0.1116 -0.2010 -0.7844 24  ASP A CG  
168  O OD1 . ASP A 27  ? 0.6926 1.1916 1.4974 -0.1209 -0.2171 -0.8111 24  ASP A OD1 
169  O OD2 . ASP A 27  ? 0.7205 1.1575 1.5219 -0.1046 -0.2005 -0.8467 24  ASP A OD2 
170  N N   . SER A 28  ? 0.5847 0.7098 1.2362 -0.0781 -0.1379 -0.4747 25  SER A N   
171  C CA  . SER A 28  ? 0.5596 0.6219 1.2176 -0.0814 -0.1232 -0.3857 25  SER A CA  
172  C C   . SER A 28  ? 0.5365 0.5476 1.1297 -0.0647 -0.1085 -0.3317 25  SER A C   
173  O O   . SER A 28  ? 0.5373 0.5606 1.0576 -0.0478 -0.1093 -0.3515 25  SER A O   
174  C CB  . SER A 28  ? 0.5379 0.6352 1.1401 -0.0798 -0.1272 -0.3434 25  SER A CB  
175  O OG  . SER A 28  ? 0.5295 0.6346 1.0053 -0.0566 -0.1232 -0.3026 25  SER A OG  
176  N N   . ASP A 29  ? 0.5193 0.4824 1.1437 -0.0700 -0.0951 -0.2622 26  ASP A N   
177  C CA  . ASP A 29  ? 0.4972 0.4236 1.0587 -0.0558 -0.0819 -0.2039 26  ASP A CA  
178  C C   . ASP A 29  ? 0.4651 0.4145 0.9089 -0.0421 -0.0814 -0.1661 26  ASP A C   
179  O O   . ASP A 29  ? 0.4599 0.4421 0.8908 -0.0454 -0.0869 -0.1609 26  ASP A O   
180  C CB  . ASP A 29  ? 0.4956 0.3833 1.1360 -0.0655 -0.0680 -0.1398 26  ASP A CB  
181  C CG  . ASP A 29  ? 0.5328 0.3864 1.3064 -0.0768 -0.0633 -0.1628 26  ASP A CG  
182  O OD1 . ASP A 29  ? 0.5628 0.4082 1.3457 -0.0712 -0.0665 -0.2200 26  ASP A OD1 
183  O OD2 . ASP A 29  ? 0.5499 0.3871 1.4260 -0.0902 -0.0545 -0.1209 26  ASP A OD2 
184  N N   . VAL A 30  ? 0.4482 0.3801 0.8160 -0.0269 -0.0737 -0.1403 27  VAL A N   
185  C CA  . VAL A 30  ? 0.4201 0.3623 0.6964 -0.0153 -0.0685 -0.0994 27  VAL A CA  
186  C C   . VAL A 30  ? 0.4073 0.3204 0.6744 -0.0137 -0.0551 -0.0455 27  VAL A C   
187  O O   . VAL A 30  ? 0.4057 0.2942 0.6748 -0.0095 -0.0506 -0.0448 27  VAL A O   
188  C CB  . VAL A 30  ? 0.4177 0.3792 0.6069 0.0023  -0.0713 -0.1210 27  VAL A CB  
189  C CG1 . VAL A 30  ? 0.3884 0.3460 0.5027 0.0136  -0.0614 -0.0770 27  VAL A CG1 
190  C CG2 . VAL A 30  ? 0.4216 0.4357 0.6077 0.0039  -0.0850 -0.1646 27  VAL A CG2 
191  N N   . CYS A 31  ? 0.3957 0.3217 0.6536 -0.0163 -0.0489 -0.0021 28  CYS A N   
192  C CA  . CYS A 31  ? 0.3867 0.3080 0.6284 -0.0140 -0.0370 0.0477  28  CYS A CA  
193  C C   . CYS A 31  ? 0.3655 0.2960 0.5127 -0.0008 -0.0321 0.0525  28  CYS A C   
194  O O   . CYS A 31  ? 0.3609 0.3103 0.4713 0.0041  -0.0331 0.0455  28  CYS A O   
195  C CB  . CYS A 31  ? 0.3902 0.3339 0.6873 -0.0245 -0.0312 0.0922  28  CYS A CB  
196  S SG  . CYS A 31  ? 0.4139 0.3800 0.6961 -0.0209 -0.0170 0.1561  28  CYS A SG  
197  N N   . LEU A 32  ? 0.3504 0.2677 0.4683 0.0047  -0.0261 0.0632  29  LEU A N   
198  C CA  . LEU A 32  ? 0.3305 0.2517 0.3755 0.0148  -0.0199 0.0636  29  LEU A CA  
199  C C   . LEU A 32  ? 0.3177 0.2643 0.3541 0.0128  -0.0105 0.0992  29  LEU A C   
200  O O   . LEU A 32  ? 0.3209 0.2743 0.3932 0.0083  -0.0085 0.1262  29  LEU A O   
201  C CB  . LEU A 32  ? 0.3323 0.2288 0.3518 0.0217  -0.0203 0.0436  29  LEU A CB  
202  C CG  . LEU A 32  ? 0.3236 0.2200 0.2828 0.0298  -0.0122 0.0442  29  LEU A CG  
203  C CD1 . LEU A 32  ? 0.3097 0.1905 0.2404 0.0392  -0.0135 0.0195  29  LEU A CD1 
204  C CD2 . LEU A 32  ? 0.3272 0.2316 0.2856 0.0264  -0.0060 0.0669  29  LEU A CD2 
205  N N   . GLU A 33  ? 0.3035 0.2713 0.2965 0.0176  -0.0042 0.0982  30  GLU A N   
206  C CA  . GLU A 33  ? 0.2948 0.3027 0.2731 0.0167  0.0045  0.1203  30  GLU A CA  
207  C C   . GLU A 33  ? 0.2867 0.2957 0.2133 0.0237  0.0117  0.0959  30  GLU A C   
208  O O   . GLU A 33  ? 0.2836 0.2857 0.1935 0.0298  0.0147  0.0778  30  GLU A O   
209  C CB  . GLU A 33  ? 0.2963 0.3495 0.2986 0.0126  0.0080  0.1455  30  GLU A CB  
210  C CG  . GLU A 33  ? 0.2989 0.4153 0.2898 0.0123  0.0169  0.1706  30  GLU A CG  
211  C CD  . GLU A 33  ? 0.3163 0.4883 0.3261 0.0104  0.0224  0.1954  30  GLU A CD  
212  O OE1 . GLU A 33  ? 0.3348 0.4911 0.3772 0.0070  0.0187  0.1987  30  GLU A OE1 
213  O OE2 . GLU A 33  ? 0.3154 0.5559 0.3082 0.0123  0.0307  0.2098  30  GLU A OE2 
214  N N   . LEU A 34  ? 0.2849 0.3044 0.1951 0.0228  0.0151  0.0961  31  LEU A N   
215  C CA  . LEU A 34  ? 0.2838 0.3152 0.1602 0.0258  0.0238  0.0711  31  LEU A CA  
216  C C   . LEU A 34  ? 0.2801 0.3744 0.1531 0.0248  0.0311  0.0740  31  LEU A C   
217  O O   . LEU A 34  ? 0.2767 0.4259 0.1602 0.0206  0.0307  0.1014  31  LEU A O   
218  C CB  . LEU A 34  ? 0.2822 0.3187 0.1489 0.0228  0.0239  0.0688  31  LEU A CB  
219  C CG  . LEU A 34  ? 0.2888 0.3380 0.1334 0.0223  0.0325  0.0366  31  LEU A CG  
220  C CD1 . LEU A 34  ? 0.2669 0.2612 0.1066 0.0287  0.0381  0.0116  31  LEU A CD1 
221  C CD2 . LEU A 34  ? 0.2745 0.3412 0.1155 0.0173  0.0302  0.0388  31  LEU A CD2 
222  N N   . VAL A 35  ? 0.2804 0.3731 0.1432 0.0304  0.0390  0.0479  32  VAL A N   
223  C CA  . VAL A 35  ? 0.2878 0.4445 0.1490 0.0314  0.0476  0.0426  32  VAL A CA  
224  C C   . VAL A 35  ? 0.2964 0.4775 0.1444 0.0329  0.0591  -0.0009 32  VAL A C   
225  O O   . VAL A 35  ? 0.3095 0.5587 0.1548 0.0332  0.0665  -0.0135 32  VAL A O   
226  C CB  . VAL A 35  ? 0.2889 0.4390 0.1639 0.0370  0.0488  0.0487  32  VAL A CB  
227  C CG1 . VAL A 35  ? 0.2819 0.4193 0.1823 0.0317  0.0374  0.0859  32  VAL A CG1 
228  C CG2 . VAL A 35  ? 0.2743 0.3691 0.1479 0.0468  0.0531  0.0226  32  VAL A CG2 
229  N N   . LYS A 36  ? 0.3040 0.4349 0.1501 0.0333  0.0614  -0.0256 33  LYS A N   
230  C CA  . LYS A 36  ? 0.3225 0.4733 0.1705 0.0310  0.0720  -0.0708 33  LYS A CA  
231  C C   . LYS A 36  ? 0.3205 0.4244 0.1692 0.0266  0.0700  -0.0786 33  LYS A C   
232  O O   . LYS A 36  ? 0.3215 0.3631 0.1720 0.0309  0.0659  -0.0597 33  LYS A O   
233  C CB  . LYS A 36  ? 0.3353 0.4656 0.2052 0.0399  0.0864  -0.1036 33  LYS A CB  
234  C CG  . LYS A 36  ? 0.3592 0.5209 0.2475 0.0363  0.1000  -0.1606 33  LYS A CG  
235  C CD  . LYS A 36  ? 0.3912 0.6548 0.2680 0.0338  0.1025  -0.1792 33  LYS A CD  
236  C CE  . LYS A 36  ? 0.4283 0.7376 0.3272 0.0291  0.1155  -0.2493 33  LYS A CE  
237  N NZ  . LYS A 36  ? 0.4515 0.8532 0.3487 0.0336  0.1237  -0.2762 33  LYS A NZ  
238  N N   . GLY A 37  ? 0.3310 0.4742 0.1799 0.0182  0.0729  -0.1083 34  GLY A N   
239  C CA  . GLY A 37  ? 0.3388 0.4440 0.1949 0.0127  0.0730  -0.1198 34  GLY A CA  
240  C C   . GLY A 37  ? 0.3314 0.4389 0.1704 0.0086  0.0597  -0.0846 34  GLY A C   
241  O O   . GLY A 37  ? 0.3169 0.4794 0.1435 0.0069  0.0514  -0.0577 34  GLY A O   
242  N N   . TYR A 38  ? 0.3406 0.3924 0.1858 0.0083  0.0598  -0.0826 35  TYR A N   
243  C CA  . TYR A 38  ? 0.3368 0.3830 0.1728 0.0062  0.0496  -0.0550 35  TYR A CA  
244  C C   . TYR A 38  ? 0.3318 0.3065 0.1693 0.0144  0.0484  -0.0364 35  TYR A C   
245  O O   . TYR A 38  ? 0.3358 0.2695 0.1832 0.0198  0.0572  -0.0468 35  TYR A O   
246  C CB  . TYR A 38  ? 0.3483 0.4233 0.1902 -0.0037 0.0509  -0.0783 35  TYR A CB  
247  C CG  . TYR A 38  ? 0.3724 0.5375 0.2117 -0.0118 0.0511  -0.1045 35  TYR A CG  
248  C CD1 . TYR A 38  ? 0.3937 0.6347 0.2190 -0.0133 0.0411  -0.0775 35  TYR A CD1 
249  C CD2 . TYR A 38  ? 0.4099 0.5930 0.2665 -0.0165 0.0624  -0.1563 35  TYR A CD2 
250  C CE1 . TYR A 38  ? 0.4001 0.7457 0.2189 -0.0190 0.0409  -0.0998 35  TYR A CE1 
251  C CE2 . TYR A 38  ? 0.4261 0.7075 0.2794 -0.0235 0.0625  -0.1895 35  TYR A CE2 
252  C CZ  . TYR A 38  ? 0.4236 0.7923 0.2532 -0.0245 0.0510  -0.1605 35  TYR A CZ  
253  O OH  . TYR A 38  ? 0.4528 0.9395 0.2753 -0.0298 0.0508  -0.1920 35  TYR A OH  
254  N N   . ALA A 39  ? 0.3236 0.2919 0.1565 0.0166  0.0383  -0.0079 36  ALA A N   
255  C CA  . ALA A 39  ? 0.3197 0.2377 0.1529 0.0245  0.0358  0.0033  36  ALA A CA  
256  C C   . ALA A 39  ? 0.3117 0.2330 0.1507 0.0243  0.0272  0.0225  36  ALA A C   
257  O O   . ALA A 39  ? 0.3017 0.2633 0.1480 0.0196  0.0228  0.0375  36  ALA A O   
258  C CB  . ALA A 39  ? 0.3235 0.2251 0.1569 0.0317  0.0331  0.0110  36  ALA A CB  
259  N N   . GLU A 40  ? 0.3085 0.1947 0.1483 0.0311  0.0261  0.0233  37  GLU A N   
260  C CA  . GLU A 40  ? 0.3030 0.1859 0.1565 0.0333  0.0202  0.0350  37  GLU A CA  
261  C C   . GLU A 40  ? 0.2999 0.1542 0.1569 0.0423  0.0172  0.0288  37  GLU A C   
262  O O   . GLU A 40  ? 0.2988 0.1410 0.1401 0.0479  0.0210  0.0190  37  GLU A O   
263  C CB  . GLU A 40  ? 0.3087 0.1968 0.1595 0.0310  0.0245  0.0306  37  GLU A CB  
264  C CG  . GLU A 40  ? 0.3257 0.1910 0.1649 0.0335  0.0343  0.0156  37  GLU A CG  
265  C CD  . GLU A 40  ? 0.3171 0.1870 0.1614 0.0306  0.0390  0.0133  37  GLU A CD  
266  O OE1 . GLU A 40  ? 0.3266 0.2259 0.1768 0.0206  0.0388  0.0089  37  GLU A OE1 
267  O OE2 . GLU A 40  ? 0.3189 0.1716 0.1615 0.0387  0.0430  0.0150  37  GLU A OE2 
268  N N   . ILE A 41  ? 0.2966 0.1469 0.1802 0.0446  0.0111  0.0339  38  ILE A N   
269  C CA  . ILE A 41  ? 0.2959 0.1303 0.1888 0.0526  0.0076  0.0165  38  ILE A CA  
270  C C   . ILE A 41  ? 0.2998 0.1305 0.2057 0.0579  0.0094  0.0115  38  ILE A C   
271  O O   . ILE A 41  ? 0.2969 0.1301 0.2366 0.0560  0.0080  0.0255  38  ILE A O   
272  C CB  . ILE A 41  ? 0.3027 0.1347 0.2336 0.0500  0.0000  0.0161  38  ILE A CB  
273  C CG1 . ILE A 41  ? 0.3033 0.1430 0.2196 0.0464  -0.0014 0.0193  38  ILE A CG1 
274  C CG2 . ILE A 41  ? 0.2861 0.1108 0.2383 0.0568  -0.0044 -0.0134 38  ILE A CG2 
275  C CD1 . ILE A 41  ? 0.3181 0.1591 0.2792 0.0413  -0.0084 0.0218  38  ILE A CD1 
276  N N   . PHE A 42  ? 0.3011 0.1322 0.1836 0.0660  0.0140  -0.0036 39  PHE A N   
277  C CA  . PHE A 42  ? 0.3028 0.1370 0.1912 0.0723  0.0183  -0.0091 39  PHE A CA  
278  C C   . PHE A 42  ? 0.2875 0.1256 0.1907 0.0663  0.0202  0.0107  39  PHE A C   
279  O O   . PHE A 42  ? 0.2915 0.1303 0.2259 0.0706  0.0197  0.0119  39  PHE A O   
280  C CB  . PHE A 42  ? 0.3172 0.1518 0.2367 0.0805  0.0141  -0.0342 39  PHE A CB  
281  C CG  . PHE A 42  ? 0.3395 0.1886 0.2447 0.0867  0.0103  -0.0601 39  PHE A CG  
282  C CD1 . PHE A 42  ? 0.3458 0.2131 0.2069 0.0919  0.0148  -0.0547 39  PHE A CD1 
283  C CD2 . PHE A 42  ? 0.3557 0.2066 0.3003 0.0876  0.0027  -0.0896 39  PHE A CD2 
284  C CE1 . PHE A 42  ? 0.3737 0.2697 0.2215 0.0996  0.0106  -0.0734 39  PHE A CE1 
285  C CE2 . PHE A 42  ? 0.3876 0.2660 0.3195 0.0926  -0.0025 -0.1179 39  PHE A CE2 
286  C CZ  . PHE A 42  ? 0.3839 0.2899 0.2628 0.0996  0.0007  -0.1078 39  PHE A CZ  
287  N N   . GLY A 43  ? 0.2742 0.1211 0.1594 0.0570  0.0225  0.0237  40  GLY A N   
288  C CA  . GLY A 43  ? 0.2702 0.1381 0.1627 0.0506  0.0238  0.0380  40  GLY A CA  
289  C C   . GLY A 43  ? 0.2691 0.1622 0.1814 0.0446  0.0178  0.0601  40  GLY A C   
290  O O   . GLY A 43  ? 0.2714 0.1996 0.1832 0.0385  0.0178  0.0712  40  GLY A O   
291  N N   . THR A 44  ? 0.2744 0.1593 0.2084 0.0463  0.0130  0.0683  41  THR A N   
292  C CA  . THR A 44  ? 0.2733 0.1903 0.2310 0.0420  0.0094  0.0989  41  THR A CA  
293  C C   . THR A 44  ? 0.2744 0.2101 0.2043 0.0342  0.0094  0.0963  41  THR A C   
294  O O   . THR A 44  ? 0.2712 0.1811 0.1898 0.0347  0.0093  0.0806  41  THR A O   
295  C CB  . THR A 44  ? 0.2834 0.1839 0.2963 0.0467  0.0066  0.1145  41  THR A CB  
296  O OG1 . THR A 44  ? 0.2982 0.1832 0.3493 0.0554  0.0084  0.1139  41  THR A OG1 
297  C CG2 . THR A 44  ? 0.2683 0.2127 0.3116 0.0429  0.0054  0.1596  41  THR A CG2 
298  N N   . GLU A 45  ? 0.2772 0.2666 0.1989 0.0282  0.0093  0.1107  42  GLU A N   
299  C CA  . GLU A 45  ? 0.2843 0.3009 0.1816 0.0217  0.0108  0.1014  42  GLU A CA  
300  C C   . GLU A 45  ? 0.2798 0.3008 0.1984 0.0230  0.0085  0.1242  42  GLU A C   
301  O O   . GLU A 45  ? 0.2840 0.3220 0.2423 0.0258  0.0063  0.1605  42  GLU A O   
302  C CB  . GLU A 45  ? 0.2938 0.3849 0.1791 0.0151  0.0110  0.1038  42  GLU A CB  
303  C CG  . GLU A 45  ? 0.3295 0.4243 0.2027 0.0104  0.0132  0.0784  42  GLU A CG  
304  C CD  . GLU A 45  ? 0.3633 0.5486 0.2306 0.0027  0.0109  0.0760  42  GLU A CD  
305  O OE1 . GLU A 45  ? 0.3931 0.6120 0.2441 -0.0053 0.0140  0.0441  42  GLU A OE1 
306  O OE2 . GLU A 45  ? 0.3847 0.6145 0.2674 0.0054  0.0063  0.1039  42  GLU A OE2 
307  N N   . LEU A 46  ? 0.2768 0.2836 0.1769 0.0213  0.0105  0.1057  43  LEU A N   
308  C CA  . LEU A 46  ? 0.2781 0.3003 0.1963 0.0206  0.0092  0.1257  43  LEU A CA  
309  C C   . LEU A 46  ? 0.2859 0.3858 0.1938 0.0168  0.0119  0.1412  43  LEU A C   
310  O O   . LEU A 46  ? 0.2931 0.4231 0.1703 0.0134  0.0153  0.1146  43  LEU A O   
311  C CB  . LEU A 46  ? 0.2751 0.2587 0.1783 0.0219  0.0102  0.1000  43  LEU A CB  
312  C CG  . LEU A 46  ? 0.2735 0.2002 0.1781 0.0272  0.0076  0.0800  43  LEU A CG  
313  C CD1 . LEU A 46  ? 0.2659 0.1743 0.1647 0.0296  0.0065  0.0659  43  LEU A CD1 
314  C CD2 . LEU A 46  ? 0.2640 0.1754 0.2121 0.0290  0.0028  0.0948  43  LEU A CD2 
315  N N   . LEU A 47  ? 0.2884 0.4268 0.2285 0.0171  0.0113  0.1830  44  LEU A N   
316  C CA  A LEU A 47  ? 0.2922 0.5219 0.2235 0.0156  0.0146  0.2037  44  LEU A CA  
317  C CA  B LEU A 47  ? 0.2932 0.5232 0.2244 0.0155  0.0146  0.2036  44  LEU A CA  
318  C C   . LEU A 47  ? 0.2927 0.5240 0.2092 0.0142  0.0185  0.1857  44  LEU A C   
319  O O   . LEU A 47  ? 0.2879 0.4698 0.2264 0.0145  0.0171  0.1899  44  LEU A O   
320  C CB  A LEU A 47  ? 0.2975 0.5786 0.2794 0.0187  0.0146  0.2705  44  LEU A CB  
321  C CB  B LEU A 47  ? 0.2995 0.5822 0.2809 0.0187  0.0146  0.2706  44  LEU A CB  
322  C CG  A LEU A 47  ? 0.3004 0.6046 0.3038 0.0228  0.0123  0.2995  44  LEU A CG  
323  C CG  B LEU A 47  ? 0.3100 0.7126 0.2843 0.0196  0.0186  0.3047  44  LEU A CG  
324  C CD1 A LEU A 47  ? 0.2928 0.6629 0.3553 0.0282  0.0153  0.3766  44  LEU A CD1 
325  C CD1 B LEU A 47  ? 0.3052 0.7807 0.2347 0.0184  0.0174  0.2777  44  LEU A CD1 
326  C CD2 A LEU A 47  ? 0.2977 0.6609 0.2512 0.0205  0.0109  0.2695  44  LEU A CD2 
327  C CD2 B LEU A 47  ? 0.3201 0.7688 0.3593 0.0249  0.0209  0.3848  44  LEU A CD2 
328  N N   . LEU A 48  ? 0.2991 0.5925 0.1827 0.0127  0.0234  0.1616  45  LEU A N   
329  C CA  . LEU A 48  ? 0.3002 0.6007 0.1713 0.0133  0.0291  0.1401  45  LEU A CA  
330  C C   . LEU A 48  ? 0.3003 0.6260 0.2043 0.0144  0.0295  0.1881  45  LEU A C   
331  O O   . LEU A 48  ? 0.3001 0.6953 0.2263 0.0149  0.0301  0.2372  45  LEU A O   
332  C CB  . LEU A 48  ? 0.3057 0.6884 0.1473 0.0120  0.0357  0.1055  45  LEU A CB  
333  C CG  . LEU A 48  ? 0.3098 0.6961 0.1404 0.0143  0.0443  0.0683  45  LEU A CG  
334  C CD1 . LEU A 48  ? 0.2814 0.5676 0.1106 0.0161  0.0466  0.0293  45  LEU A CD1 
335  C CD2 . LEU A 48  ? 0.3266 0.8144 0.1379 0.0129  0.0512  0.0316  45  LEU A CD2 
336  N N   . ASN A 49  ? 0.3027 0.5743 0.2163 0.0149  0.0295  0.1778  46  ASN A N   
337  C CA  . ASN A 49  ? 0.3130 0.6042 0.2637 0.0138  0.0307  0.2160  46  ASN A CA  
338  C C   . ASN A 49  ? 0.3227 0.5923 0.3348 0.0105  0.0263  0.2653  46  ASN A C   
339  O O   . ASN A 49  ? 0.3277 0.6172 0.3833 0.0077  0.0286  0.3006  46  ASN A O   
340  C CB  . ASN A 49  ? 0.3180 0.7180 0.2596 0.0155  0.0393  0.2357  46  ASN A CB  
341  C CG  . ASN A 49  ? 0.3169 0.7322 0.2193 0.0190  0.0461  0.1832  46  ASN A CG  
342  O OD1 . ASN A 49  ? 0.3374 0.8250 0.2111 0.0208  0.0519  0.1597  46  ASN A OD1 
343  N ND2 . ASN A 49  ? 0.3057 0.6574 0.2122 0.0206  0.0459  0.1615  46  ASN A ND2 
344  N N   . LYS A 50  ? 0.3297 0.5607 0.3547 0.0108  0.0214  0.2681  47  LYS A N   
345  C CA  . LYS A 50  ? 0.3384 0.5359 0.4351 0.0084  0.0187  0.3046  47  LYS A CA  
346  C C   . LYS A 50  ? 0.3384 0.4561 0.4531 0.0049  0.0126  0.2687  47  LYS A C   
347  O O   . LYS A 50  ? 0.3276 0.4019 0.3963 0.0075  0.0087  0.2197  47  LYS A O   
348  C CB  . LYS A 50  ? 0.3479 0.5322 0.4580 0.0118  0.0166  0.3157  47  LYS A CB  
349  C CG  . LYS A 50  ? 0.3646 0.5175 0.5664 0.0108  0.0169  0.3548  47  LYS A CG  
350  C CD  . LYS A 50  ? 0.4023 0.5464 0.6215 0.0168  0.0163  0.3675  47  LYS A CD  
351  C CE  . LYS A 50  ? 0.4354 0.5463 0.7614 0.0173  0.0194  0.4048  47  LYS A CE  
352  N NZ  . LYS A 50  ? 0.4722 0.5592 0.8146 0.0248  0.0187  0.4034  47  LYS A NZ  
353  N N   . LYS A 51  ? 0.3480 0.4544 0.5357 -0.0007 0.0124  0.2948  48  LYS A N   
354  C CA  . LYS A 51  ? 0.3570 0.4037 0.5715 -0.0056 0.0052  0.2579  48  LYS A CA  
355  C C   . LYS A 51  ? 0.3625 0.3554 0.6245 -0.0059 0.0009  0.2436  48  LYS A C   
356  O O   . LYS A 51  ? 0.3725 0.3660 0.7145 -0.0087 0.0049  0.2814  48  LYS A O   
357  C CB  . LYS A 51  ? 0.3660 0.4332 0.6440 -0.0142 0.0075  0.2855  48  LYS A CB  
358  C CG  . LYS A 51  ? 0.3731 0.4890 0.6035 -0.0128 0.0114  0.2866  48  LYS A CG  
359  C CD  . LYS A 51  ? 0.3898 0.5463 0.6894 -0.0208 0.0172  0.3327  48  LYS A CD  
360  C CE  . LYS A 51  ? 0.4028 0.5940 0.6618 -0.0194 0.0193  0.3187  48  LYS A CE  
361  N NZ  . LYS A 51  ? 0.4083 0.6325 0.5772 -0.0082 0.0238  0.2971  48  LYS A NZ  
362  N N   . TYR A 52  ? 0.3615 0.3130 0.5791 -0.0016 -0.0055 0.1909  49  TYR A N   
363  C CA  . TYR A 52  ? 0.3703 0.2769 0.6241 -0.0001 -0.0095 0.1643  49  TYR A CA  
364  C C   . TYR A 52  ? 0.3828 0.2626 0.6743 -0.0058 -0.0175 0.1204  49  TYR A C   
365  O O   . TYR A 52  ? 0.3739 0.2517 0.6094 -0.0025 -0.0237 0.0807  49  TYR A O   
366  C CB  . TYR A 52  ? 0.3603 0.2525 0.5406 0.0090  -0.0108 0.1340  49  TYR A CB  
367  C CG  . TYR A 52  ? 0.3592 0.2802 0.5060 0.0133  -0.0047 0.1649  49  TYR A CG  
368  C CD1 . TYR A 52  ? 0.3669 0.2883 0.5555 0.0163  -0.0017 0.1910  49  TYR A CD1 
369  C CD2 . TYR A 52  ? 0.3364 0.2891 0.4160 0.0147  -0.0018 0.1643  49  TYR A CD2 
370  C CE1 . TYR A 52  ? 0.3444 0.3048 0.5016 0.0202  0.0020  0.2175  49  TYR A CE1 
371  C CE2 . TYR A 52  ? 0.3357 0.3252 0.3876 0.0170  0.0024  0.1827  49  TYR A CE2 
372  C CZ  . TYR A 52  ? 0.3178 0.3148 0.4055 0.0194  0.0033  0.2102  49  TYR A CZ  
373  O OH  . TYR A 52  ? 0.2923 0.3383 0.3529 0.0215  0.0060  0.2275  49  TYR A OH  
374  N N   . THR A 53  ? 0.3990 0.2640 0.7922 -0.0140 -0.0168 0.1275  50  THR A N   
375  C CA  . THR A 53  ? 0.4139 0.2630 0.8602 -0.0227 -0.0250 0.0795  50  THR A CA  
376  C C   . THR A 53  ? 0.4256 0.2466 0.8822 -0.0177 -0.0300 0.0219  50  THR A C   
377  O O   . THR A 53  ? 0.4333 0.2310 0.9516 -0.0158 -0.0244 0.0283  50  THR A O   
378  C CB  . THR A 53  ? 0.4295 0.2772 0.9963 -0.0361 -0.0202 0.1100  50  THR A CB  
379  O OG1 . THR A 53  ? 0.4338 0.3203 0.9857 -0.0388 -0.0141 0.1674  50  THR A OG1 
380  C CG2 . THR A 53  ? 0.4527 0.2915 1.0798 -0.0481 -0.0297 0.0524  50  THR A CG2 
381  N N   . PHE A 54  ? 0.4230 0.2545 0.8194 -0.0136 -0.0395 -0.0310 51  PHE A N   
382  C CA  . PHE A 54  ? 0.4401 0.2641 0.8357 -0.0072 -0.0445 -0.0902 51  PHE A CA  
383  C C   . PHE A 54  ? 0.4639 0.2985 0.9325 -0.0180 -0.0538 -0.1469 51  PHE A C   
384  O O   . PHE A 54  ? 0.4629 0.3223 0.9278 -0.0255 -0.0606 -0.1509 51  PHE A O   
385  C CB  . PHE A 54  ? 0.4271 0.2721 0.7105 0.0064  -0.0478 -0.1081 51  PHE A CB  
386  C CG  . PHE A 54  ? 0.4093 0.2432 0.6308 0.0160  -0.0389 -0.0696 51  PHE A CG  
387  C CD1 . PHE A 54  ? 0.4100 0.2304 0.6269 0.0244  -0.0350 -0.0820 51  PHE A CD1 
388  C CD2 . PHE A 54  ? 0.3896 0.2323 0.5609 0.0162  -0.0342 -0.0264 51  PHE A CD2 
389  C CE1 . PHE A 54  ? 0.4005 0.2160 0.5657 0.0312  -0.0276 -0.0499 51  PHE A CE1 
390  C CE2 . PHE A 54  ? 0.3719 0.2113 0.4934 0.0228  -0.0268 -0.0005 51  PHE A CE2 
391  C CZ  . PHE A 54  ? 0.3798 0.2054 0.4988 0.0294  -0.0241 -0.0110 51  PHE A CZ  
392  N N   . PRO A 55  ? 0.4921 0.3126 1.0322 -0.0190 -0.0540 -0.1955 52  PRO A N   
393  C CA  . PRO A 55  ? 0.5218 0.3593 1.1421 -0.0313 -0.0632 -0.2618 52  PRO A CA  
394  C C   . PRO A 55  ? 0.5298 0.4241 1.0765 -0.0239 -0.0767 -0.3271 52  PRO A C   
395  O O   . PRO A 55  ? 0.5123 0.4244 0.9583 -0.0074 -0.0763 -0.3217 52  PRO A O   
396  C CB  . PRO A 55  ? 0.5478 0.3493 1.2811 -0.0334 -0.0554 -0.2904 52  PRO A CB  
397  C CG  . PRO A 55  ? 0.5367 0.3224 1.2046 -0.0156 -0.0473 -0.2644 52  PRO A CG  
398  C CD  . PRO A 55  ? 0.5006 0.2898 1.0714 -0.0106 -0.0444 -0.1901 52  PRO A CD  
399  N N   . ALA A 56  ? 0.5571 0.4863 1.1613 -0.0363 -0.0881 -0.3858 53  ALA A N   
400  C CA  . ALA A 56  ? 0.5755 0.5795 1.1252 -0.0295 -0.1024 -0.4533 53  ALA A CA  
401  C C   . ALA A 56  ? 0.5911 0.6184 1.0858 -0.0109 -0.1005 -0.4898 53  ALA A C   
402  O O   . ALA A 56  ? 0.6058 0.5920 1.1508 -0.0087 -0.0908 -0.4998 53  ALA A O   
403  C CB  . ALA A 56  ? 0.6062 0.6432 1.2611 -0.0482 -0.1137 -0.5287 53  ALA A CB  
404  N N   . LYS A 57  ? 0.5927 0.6906 0.9882 0.0039  -0.1085 -0.5036 54  LYS A N   
405  C CA  . LYS A 57  ? 0.6042 0.7415 0.9330 0.0241  -0.1057 -0.5274 54  LYS A CA  
406  C C   . LYS A 57  ? 0.5803 0.6668 0.8426 0.0374  -0.0911 -0.4581 54  LYS A C   
407  O O   . LYS A 57  ? 0.5848 0.7092 0.7770 0.0551  -0.0878 -0.4602 54  LYS A O   
408  C CB  . LYS A 57  ? 0.6470 0.8037 1.0546 0.0219  -0.1067 -0.6156 54  LYS A CB  
409  C CG  . LYS A 57  ? 0.6663 0.8624 1.0129 0.0437  -0.1006 -0.6376 54  LYS A CG  
410  C CD  . LYS A 57  ? 0.7145 0.9424 1.1430 0.0425  -0.1015 -0.7365 54  LYS A CD  
411  C CE  . LYS A 57  ? 0.7261 0.9828 1.1006 0.0645  -0.0916 -0.7479 54  LYS A CE  
412  N NZ  . LYS A 57  ? 0.7679 1.0607 1.2255 0.0653  -0.0908 -0.8516 54  LYS A NZ  
413  N N   . SER A 58  ? 0.5560 0.5681 0.8396 0.0292  -0.0823 -0.3960 55  SER A N   
414  C CA  . SER A 58  ? 0.5324 0.5044 0.7603 0.0394  -0.0697 -0.3375 55  SER A CA  
415  C C   . SER A 58  ? 0.5170 0.5294 0.6378 0.0551  -0.0691 -0.3121 55  SER A C   
416  O O   . SER A 58  ? 0.5113 0.5548 0.6000 0.0553  -0.0752 -0.2998 55  SER A O   
417  C CB  . SER A 58  ? 0.5125 0.4260 0.7653 0.0288  -0.0628 -0.2723 55  SER A CB  
418  O OG  . SER A 58  ? 0.5305 0.4088 0.8934 0.0154  -0.0608 -0.2809 55  SER A OG  
419  N N   . ARG A 59  ? 0.5140 0.5271 0.5895 0.0686  -0.0603 -0.3022 56  ARG A N   
420  C CA  . ARG A 59  ? 0.5004 0.5403 0.4894 0.0833  -0.0548 -0.2658 56  ARG A CA  
421  C C   . ARG A 59  ? 0.4721 0.4522 0.4436 0.0819  -0.0427 -0.2120 56  ARG A C   
422  O O   . ARG A 59  ? 0.4707 0.4192 0.4711 0.0805  -0.0371 -0.2145 56  ARG A O   
423  C CB  . ARG A 59  ? 0.5247 0.6281 0.4809 0.0999  -0.0535 -0.2988 56  ARG A CB  
424  C CG  . ARG A 59  ? 0.5236 0.6671 0.4030 0.1166  -0.0462 -0.2562 56  ARG A CG  
425  C CD  . ARG A 59  ? 0.5734 0.8181 0.4243 0.1337  -0.0494 -0.2920 56  ARG A CD  
426  N NE  . ARG A 59  ? 0.6025 0.9095 0.4799 0.1297  -0.0656 -0.3475 56  ARG A NE  
427  C CZ  . ARG A 59  ? 0.6113 0.9808 0.4640 0.1349  -0.0741 -0.3381 56  ARG A CZ  
428  N NH1 . ARG A 59  ? 0.6060 0.9816 0.4105 0.1463  -0.0664 -0.2719 56  ARG A NH1 
429  N NH2 . ARG A 59  ? 0.6221 1.0515 0.5068 0.1286  -0.0901 -0.3969 56  ARG A NH2 
430  N N   . VAL A 60  ? 0.4468 0.4173 0.3764 0.0828  -0.0384 -0.1667 57  VAL A N   
431  C CA  . VAL A 60  ? 0.4167 0.3382 0.3383 0.0773  -0.0290 -0.1227 57  VAL A CA  
432  C C   . VAL A 60  ? 0.4021 0.3291 0.2691 0.0857  -0.0198 -0.0886 57  VAL A C   
433  O O   . VAL A 60  ? 0.3986 0.3548 0.2433 0.0926  -0.0211 -0.0822 57  VAL A O   
434  C CB  . VAL A 60  ? 0.4091 0.3041 0.3690 0.0628  -0.0325 -0.1059 57  VAL A CB  
435  C CG1 . VAL A 60  ? 0.3871 0.2528 0.3342 0.0581  -0.0236 -0.0641 57  VAL A CG1 
436  C CG2 . VAL A 60  ? 0.4271 0.3097 0.4607 0.0535  -0.0382 -0.1316 57  VAL A CG2 
437  N N   . ALA A 61  ? 0.3887 0.2888 0.2435 0.0850  -0.0098 -0.0661 58  ALA A N   
438  C CA  . ALA A 61  ? 0.3746 0.2705 0.1972 0.0895  0.0010  -0.0370 58  ALA A CA  
439  C C   . ALA A 61  ? 0.3597 0.2221 0.1913 0.0777  0.0057  -0.0190 58  ALA A C   
440  O O   . ALA A 61  ? 0.3522 0.2014 0.1986 0.0726  0.0060  -0.0196 58  ALA A O   
441  C CB  . ALA A 61  ? 0.3906 0.3033 0.1926 0.1006  0.0097  -0.0336 58  ALA A CB  
442  N N   . ALA A 62  ? 0.3428 0.2004 0.1682 0.0745  0.0093  -0.0045 59  ALA A N   
443  C CA  . ALA A 62  ? 0.3311 0.1749 0.1598 0.0647  0.0149  0.0073  59  ALA A CA  
444  C C   . ALA A 62  ? 0.3363 0.1746 0.1522 0.0686  0.0283  0.0149  59  ALA A C   
445  O O   . ALA A 62  ? 0.3486 0.1916 0.1607 0.0772  0.0331  0.0210  59  ALA A O   
446  C CB  . ALA A 62  ? 0.3180 0.1680 0.1588 0.0579  0.0106  0.0120  59  ALA A CB  
447  N N   . PHE A 63  ? 0.3235 0.1543 0.1414 0.0622  0.0347  0.0154  60  PHE A N   
448  C CA  . PHE A 63  ? 0.3196 0.1420 0.1413 0.0632  0.0487  0.0187  60  PHE A CA  
449  C C   . PHE A 63  ? 0.3163 0.1413 0.1486 0.0507  0.0529  0.0082  60  PHE A C   
450  O O   . PHE A 63  ? 0.3032 0.1448 0.1334 0.0422  0.0447  0.0049  60  PHE A O   
451  C CB  . PHE A 63  ? 0.3201 0.1415 0.1408 0.0651  0.0525  0.0219  60  PHE A CB  
452  C CG  . PHE A 63  ? 0.3207 0.1332 0.1576 0.0651  0.0687  0.0293  60  PHE A CG  
453  C CD1 . PHE A 63  ? 0.3232 0.1377 0.1662 0.0785  0.0791  0.0490  60  PHE A CD1 
454  C CD2 . PHE A 63  ? 0.3175 0.1264 0.1712 0.0518  0.0741  0.0185  60  PHE A CD2 
455  C CE1 . PHE A 63  ? 0.3524 0.1563 0.2263 0.0784  0.0967  0.0624  60  PHE A CE1 
456  C CE2 . PHE A 63  ? 0.3267 0.1247 0.2105 0.0492  0.0902  0.0219  60  PHE A CE2 
457  C CZ  . PHE A 63  ? 0.3563 0.1473 0.2545 0.0625  0.1026  0.0462  60  PHE A CZ  
458  N N   . THR A 64  ? 0.3221 0.1377 0.1723 0.0502  0.0666  0.0031  61  THR A N   
459  C CA  . THR A 64  ? 0.3311 0.1580 0.1968 0.0381  0.0719  -0.0188 61  THR A CA  
460  C C   . THR A 64  ? 0.3534 0.1649 0.2522 0.0340  0.0875  -0.0283 61  THR A C   
461  O O   . THR A 64  ? 0.3727 0.1610 0.2932 0.0439  0.0996  -0.0131 61  THR A O   
462  C CB  . THR A 64  ? 0.3335 0.1691 0.2049 0.0399  0.0743  -0.0286 61  THR A CB  
463  O OG1 . THR A 64  ? 0.3296 0.1881 0.2179 0.0282  0.0805  -0.0593 61  THR A OG1 
464  C CG2 . THR A 64  ? 0.3358 0.1468 0.2269 0.0534  0.0857  -0.0170 61  THR A CG2 
465  N N   . TRP A 65  ? 0.3576 0.1885 0.2660 0.0196  0.0874  -0.0507 62  TRP A N   
466  C CA  . TRP A 65  ? 0.3779 0.1990 0.3298 0.0106  0.1020  -0.0688 62  TRP A CA  
467  C C   . TRP A 65  ? 0.4003 0.2178 0.3952 0.0065  0.1155  -0.1003 62  TRP A C   
468  O O   . TRP A 65  ? 0.4244 0.2111 0.4721 0.0075  0.1332  -0.1007 62  TRP A O   
469  C CB  . TRP A 65  ? 0.3711 0.2254 0.3199 -0.0041 0.0950  -0.0859 62  TRP A CB  
470  C CG  . TRP A 65  ? 0.3612 0.2128 0.2836 0.0016  0.0863  -0.0569 62  TRP A CG  
471  C CD1 . TRP A 65  ? 0.3541 0.2274 0.2429 0.0046  0.0710  -0.0435 62  TRP A CD1 
472  C CD2 . TRP A 65  ? 0.3648 0.1926 0.2995 0.0072  0.0947  -0.0360 62  TRP A CD2 
473  N NE1 . TRP A 65  ? 0.3546 0.2160 0.2356 0.0116  0.0690  -0.0229 62  TRP A NE1 
474  C CE2 . TRP A 65  ? 0.3324 0.1708 0.2358 0.0135  0.0830  -0.0184 62  TRP A CE2 
475  C CE3 . TRP A 65  ? 0.3755 0.1781 0.3519 0.0084  0.1128  -0.0277 62  TRP A CE3 
476  C CZ2 . TRP A 65  ? 0.3522 0.1828 0.2564 0.0211  0.0879  0.0010  62  TRP A CZ2 
477  C CZ3 . TRP A 65  ? 0.3775 0.1753 0.3541 0.0158  0.1179  0.0003  62  TRP A CZ3 
478  C CH2 . TRP A 65  ? 0.3746 0.1890 0.3110 0.0223  0.1051  0.0114  62  TRP A CH2 
479  N N   . LYS A 66  ? 0.3987 0.2504 0.3788 0.0028  0.1093  -0.1249 63  LYS A N   
480  C CA  . LYS A 66  ? 0.4254 0.2829 0.4489 -0.0008 0.1228  -0.1655 63  LYS A CA  
481  C C   . LYS A 66  ? 0.4213 0.2650 0.4436 0.0141  0.1268  -0.1540 63  LYS A C   
482  O O   . LYS A 66  ? 0.4433 0.2800 0.5135 0.0154  0.1420  -0.1830 63  LYS A O   
483  C CB  . LYS A 66  ? 0.4349 0.3612 0.4502 -0.0160 0.1160  -0.2125 63  LYS A CB  
484  C CG  . LYS A 66  ? 0.4648 0.4175 0.4982 -0.0331 0.1147  -0.2387 63  LYS A CG  
485  C CD  . LYS A 66  ? 0.5087 0.5455 0.5454 -0.0473 0.1110  -0.2960 63  LYS A CD  
486  C CE  . LYS A 66  ? 0.5202 0.6057 0.5563 -0.0631 0.1023  -0.3118 63  LYS A CE  
487  N NZ  . LYS A 66  ? 0.5471 0.7321 0.5889 -0.0769 0.0985  -0.3725 63  LYS A NZ  
488  N N   . GLY A 67  ? 0.3944 0.2370 0.3698 0.0250  0.1139  -0.1161 64  GLY A N   
489  C CA  . GLY A 67  ? 0.3863 0.2234 0.3590 0.0385  0.1155  -0.1034 64  GLY A CA  
490  C C   . GLY A 67  ? 0.3614 0.2401 0.2901 0.0370  0.0998  -0.0990 64  GLY A C   
491  O O   . GLY A 67  ? 0.3526 0.2768 0.2651 0.0257  0.0930  -0.1166 64  GLY A O   
492  N N   . ALA A 68  ? 0.3424 0.2125 0.2578 0.0489  0.0949  -0.0725 65  ALA A N   
493  C CA  . ALA A 68  ? 0.3229 0.2257 0.2074 0.0474  0.0808  -0.0594 65  ALA A CA  
494  C C   . ALA A 68  ? 0.3166 0.2158 0.2038 0.0594  0.0804  -0.0437 65  ALA A C   
495  O O   . ALA A 68  ? 0.3243 0.1945 0.2272 0.0718  0.0867  -0.0308 65  ALA A O   
496  C CB  . ALA A 68  ? 0.3040 0.2024 0.1635 0.0437  0.0659  -0.0355 65  ALA A CB  
497  N N   . THR A 69  ? 0.3000 0.2370 0.1751 0.0562  0.0734  -0.0403 66  THR A N   
498  C CA  . THR A 69  ? 0.2907 0.2329 0.1663 0.0642  0.0686  -0.0220 66  THR A CA  
499  C C   . THR A 69  ? 0.2750 0.2302 0.1362 0.0569  0.0521  0.0007  66  THR A C   
500  O O   . THR A 69  ? 0.2684 0.2540 0.1241 0.0470  0.0481  0.0045  66  THR A O   
501  C CB  . THR A 69  ? 0.2950 0.2747 0.1829 0.0667  0.0777  -0.0374 66  THR A CB  
502  O OG1 . THR A 69  ? 0.3084 0.2725 0.2246 0.0734  0.0953  -0.0650 66  THR A OG1 
503  C CG2 . THR A 69  ? 0.2850 0.2733 0.1773 0.0745  0.0727  -0.0169 66  THR A CG2 
504  N N   . ILE A 70  ? 0.2815 0.2195 0.1437 0.0623  0.0431  0.0158  67  ILE A N   
505  C CA  . ILE A 70  ? 0.2778 0.2195 0.1423 0.0549  0.0285  0.0301  67  ILE A CA  
506  C C   . ILE A 70  ? 0.2728 0.2269 0.1518 0.0575  0.0209  0.0383  67  ILE A C   
507  O O   . ILE A 70  ? 0.2724 0.2224 0.1504 0.0686  0.0217  0.0362  67  ILE A O   
508  C CB  . ILE A 70  ? 0.2826 0.1952 0.1396 0.0559  0.0224  0.0285  67  ILE A CB  
509  C CG1 . ILE A 70  ? 0.2903 0.1934 0.1373 0.0516  0.0288  0.0221  67  ILE A CG1 
510  C CG2 . ILE A 70  ? 0.2686 0.1830 0.1428 0.0487  0.0089  0.0351  67  ILE A CG2 
511  C CD1 . ILE A 70  ? 0.2785 0.1562 0.1184 0.0546  0.0249  0.0210  67  ILE A CD1 
512  N N   . GLU A 71  ? 0.2668 0.2411 0.1656 0.0472  0.0138  0.0509  68  GLU A N   
513  C CA  . GLU A 71  ? 0.2643 0.2536 0.1879 0.0453  0.0055  0.0569  68  GLU A CA  
514  C C   . GLU A 71  ? 0.2652 0.2397 0.2130 0.0382  -0.0078 0.0526  68  GLU A C   
515  O O   . GLU A 71  ? 0.2736 0.2369 0.2352 0.0305  -0.0092 0.0590  68  GLU A O   
516  C CB  . GLU A 71  ? 0.2604 0.2875 0.2046 0.0376  0.0095  0.0760  68  GLU A CB  
517  C CG  . GLU A 71  ? 0.2687 0.3152 0.2479 0.0331  0.0024  0.0846  68  GLU A CG  
518  C CD  . GLU A 71  ? 0.2692 0.3612 0.2677 0.0277  0.0097  0.1085  68  GLU A CD  
519  O OE1 . GLU A 71  ? 0.2842 0.4008 0.2672 0.0363  0.0188  0.1036  68  GLU A OE1 
520  O OE2 . GLU A 71  ? 0.2654 0.3726 0.2998 0.0162  0.0080  0.1344  68  GLU A OE2 
521  N N   . LEU A 72  ? 0.2614 0.2423 0.2188 0.0414  -0.0170 0.0393  69  LEU A N   
522  C CA  . LEU A 72  ? 0.2683 0.2481 0.2628 0.0326  -0.0301 0.0242  69  LEU A CA  
523  C C   . LEU A 72  ? 0.2711 0.2783 0.3096 0.0237  -0.0368 0.0263  69  LEU A C   
524  O O   . LEU A 72  ? 0.2652 0.2982 0.2921 0.0311  -0.0375 0.0257  69  LEU A O   
525  C CB  . LEU A 72  ? 0.2772 0.2594 0.2503 0.0426  -0.0375 -0.0021 69  LEU A CB  
526  C CG  . LEU A 72  ? 0.2765 0.2359 0.2111 0.0518  -0.0305 -0.0031 69  LEU A CG  
527  C CD1 . LEU A 72  ? 0.2880 0.2676 0.2062 0.0624  -0.0375 -0.0249 69  LEU A CD1 
528  C CD2 . LEU A 72  ? 0.2545 0.1865 0.2056 0.0421  -0.0283 0.0007  69  LEU A CD2 
529  N N   . VAL A 73  ? 0.2728 0.2754 0.3700 0.0083  -0.0405 0.0313  70  VAL A N   
530  C CA  . VAL A 73  ? 0.2792 0.3053 0.4361 -0.0040 -0.0464 0.0333  70  VAL A CA  
531  C C   . VAL A 73  ? 0.3007 0.3201 0.5092 -0.0134 -0.0595 -0.0054 70  VAL A C   
532  O O   . VAL A 73  ? 0.3117 0.3028 0.5592 -0.0203 -0.0586 -0.0090 70  VAL A O   
533  C CB  . VAL A 73  ? 0.2775 0.3102 0.4811 -0.0154 -0.0369 0.0765  70  VAL A CB  
534  C CG1 . VAL A 73  ? 0.2727 0.3320 0.5459 -0.0291 -0.0410 0.0831  70  VAL A CG1 
535  C CG2 . VAL A 73  ? 0.2605 0.3114 0.4107 -0.0057 -0.0235 0.1053  70  VAL A CG2 
536  N N   . GLY A 74  ? 0.3167 0.3687 0.5291 -0.0128 -0.0713 -0.0370 71  GLY A N   
537  C CA  . GLY A 74  ? 0.3396 0.4034 0.6030 -0.0222 -0.0854 -0.0876 71  GLY A CA  
538  C C   . GLY A 74  ? 0.3535 0.4579 0.5636 -0.0076 -0.0960 -0.1247 71  GLY A C   
539  O O   . GLY A 74  ? 0.3432 0.4521 0.4795 0.0111  -0.0902 -0.1059 71  GLY A O   
540  N N   . THR A 75  ? 0.3746 0.5154 0.6294 -0.0162 -0.1109 -0.1776 72  THR A N   
541  C CA  . THR A 75  ? 0.3859 0.5880 0.5960 -0.0022 -0.1226 -0.2154 72  THR A CA  
542  C C   . THR A 75  ? 0.3890 0.5773 0.5522 0.0113  -0.1183 -0.2271 72  THR A C   
543  O O   . THR A 75  ? 0.4077 0.5619 0.6111 0.0025  -0.1167 -0.2517 72  THR A O   
544  C CB  . THR A 75  ? 0.4091 0.6661 0.6867 -0.0173 -0.1405 -0.2803 72  THR A CB  
545  O OG1 . THR A 75  ? 0.4137 0.6952 0.7331 -0.0292 -0.1455 -0.2693 72  THR A OG1 
546  C CG2 . THR A 75  ? 0.4271 0.7674 0.6546 -0.0009 -0.1531 -0.3217 72  THR A CG2 
547  N N   . THR A 76  ? 0.3819 0.5997 0.4683 0.0335  -0.1151 -0.2071 73  THR A N   
548  C CA  . THR A 76  ? 0.3884 0.6070 0.4290 0.0480  -0.1105 -0.2145 73  THR A CA  
549  C C   . THR A 76  ? 0.4130 0.7275 0.4249 0.0623  -0.1225 -0.2468 73  THR A C   
550  O O   . THR A 76  ? 0.4096 0.7843 0.4104 0.0692  -0.1298 -0.2382 73  THR A O   
551  C CB  . THR A 76  ? 0.3712 0.5491 0.3527 0.0631  -0.0934 -0.1575 73  THR A CB  
552  O OG1 . THR A 76  ? 0.3527 0.5636 0.3063 0.0759  -0.0914 -0.1249 73  THR A OG1 
553  C CG2 . THR A 76  ? 0.3427 0.4429 0.3456 0.0505  -0.0820 -0.1298 73  THR A CG2 
554  N N   . GLU A 77  ? 0.4364 0.7745 0.4368 0.0683  -0.1240 -0.2823 74  GLU A N   
555  C CA  . GLU A 77  ? 0.4643 0.9105 0.4292 0.0854  -0.1336 -0.3092 74  GLU A CA  
556  C C   . GLU A 77  ? 0.4555 0.9193 0.3501 0.1112  -0.1210 -0.2443 74  GLU A C   
557  O O   . GLU A 77  ? 0.4658 1.0207 0.3313 0.1287  -0.1264 -0.2304 74  GLU A O   
558  C CB  . GLU A 77  ? 0.4888 0.9597 0.4665 0.0846  -0.1369 -0.3700 74  GLU A CB  
559  C CG  . GLU A 77  ? 0.5390 1.1434 0.4834 0.1014  -0.1481 -0.4069 74  GLU A CG  
560  C CD  . GLU A 77  ? 0.5917 1.2310 0.5620 0.0981  -0.1527 -0.4845 74  GLU A CD  
561  O OE1 . GLU A 77  ? 0.6098 1.1869 0.5743 0.1006  -0.1395 -0.4765 74  GLU A OE1 
562  O OE2 . GLU A 77  ? 0.6359 1.3699 0.6362 0.0930  -0.1694 -0.5573 74  GLU A OE2 
563  N N   . SER A 78  ? 0.4374 0.8169 0.3138 0.1132  -0.1038 -0.2040 75  SER A N   
564  C CA  . SER A 78  ? 0.4313 0.8065 0.2595 0.1340  -0.0879 -0.1430 75  SER A CA  
565  C C   . SER A 78  ? 0.4105 0.6787 0.2443 0.1251  -0.0725 -0.1060 75  SER A C   
566  O O   . SER A 78  ? 0.4050 0.6130 0.2678 0.1070  -0.0730 -0.1257 75  SER A O   
567  C CB  . SER A 78  ? 0.4477 0.8623 0.2444 0.1483  -0.0827 -0.1500 75  SER A CB  
568  O OG  . SER A 78  ? 0.4263 0.7705 0.2396 0.1350  -0.0780 -0.1737 75  SER A OG  
569  N N   . ALA A 79  ? 0.4045 0.6563 0.2172 0.1384  -0.0582 -0.0535 76  ALA A N   
570  C CA  . ALA A 79  ? 0.3932 0.5589 0.2089 0.1315  -0.0428 -0.0257 76  ALA A CA  
571  C C   . ALA A 79  ? 0.3973 0.5631 0.1977 0.1504  -0.0257 0.0238  76  ALA A C   
572  O O   . ALA A 79  ? 0.4075 0.6076 0.2132 0.1619  -0.0251 0.0459  76  ALA A O   
573  C CB  . ALA A 79  ? 0.3748 0.5025 0.2202 0.1146  -0.0462 -0.0302 76  ALA A CB  
574  N N   . TYR A 80  ? 0.4010 0.5309 0.1911 0.1538  -0.0112 0.0413  77  TYR A N   
575  C CA  . TYR A 80  ? 0.4042 0.5236 0.1975 0.1695  0.0085  0.0875  77  TYR A CA  
576  C C   . TYR A 80  ? 0.4007 0.4532 0.1988 0.1610  0.0234  0.0928  77  TYR A C   
577  O O   . TYR A 80  ? 0.3863 0.4154 0.1755 0.1481  0.0185  0.0675  77  TYR A O   
578  C CB  . TYR A 80  ? 0.4258 0.6229 0.2063 0.1932  0.0115  0.1167  77  TYR A CB  
579  C CG  . TYR A 80  ? 0.4362 0.6579 0.1950 0.1955  0.0114  0.1062  77  TYR A CG  
580  C CD1 . TYR A 80  ? 0.4333 0.6421 0.1954 0.2051  0.0309  0.1435  77  TYR A CD1 
581  C CD2 . TYR A 80  ? 0.4409 0.7014 0.1841 0.1882  -0.0065 0.0570  77  TYR A CD2 
582  C CE1 . TYR A 80  ? 0.4414 0.6798 0.1839 0.2084  0.0320  0.1359  77  TYR A CE1 
583  C CE2 . TYR A 80  ? 0.4456 0.7345 0.1710 0.1921  -0.0051 0.0429  77  TYR A CE2 
584  C CZ  . TYR A 80  ? 0.4520 0.7319 0.1732 0.2028  0.0139  0.0844  77  TYR A CZ  
585  O OH  . TYR A 80  ? 0.4610 0.7761 0.1648 0.2078  0.0163  0.0723  77  TYR A OH  
586  N N   . VAL A 81  ? 0.4077 0.4324 0.2278 0.1684  0.0421  0.1239  78  VAL A N   
587  C CA  . VAL A 81  ? 0.4068 0.3769 0.2406 0.1604  0.0576  0.1269  78  VAL A CA  
588  C C   . VAL A 81  ? 0.4201 0.4115 0.2601 0.1756  0.0717  0.1620  78  VAL A C   
589  O O   . VAL A 81  ? 0.4322 0.4523 0.2939 0.1946  0.0830  0.2023  78  VAL A O   
590  C CB  . VAL A 81  ? 0.4069 0.3356 0.2754 0.1577  0.0719  0.1312  78  VAL A CB  
591  C CG1 . VAL A 81  ? 0.4106 0.2933 0.3027 0.1494  0.0887  0.1293  78  VAL A CG1 
592  C CG2 . VAL A 81  ? 0.4024 0.3199 0.2637 0.1430  0.0598  0.1007  78  VAL A CG2 
593  N N   . ALA A 82  ? 0.4146 0.3973 0.2407 0.1685  0.0720  0.1517  79  ALA A N   
594  C CA  . ALA A 82  ? 0.4326 0.4335 0.2705 0.1807  0.0884  0.1880  79  ALA A CA  
595  C C   . ALA A 82  ? 0.4378 0.3761 0.3168 0.1701  0.1075  0.1943  79  ALA A C   
596  O O   . ALA A 82  ? 0.4160 0.3084 0.2950 0.1506  0.1032  0.1587  79  ALA A O   
597  C CB  . ALA A 82  ? 0.4270 0.4633 0.2305 0.1804  0.0792  0.1716  79  ALA A CB  
598  N N   . GLU A 83  ? 0.4680 0.4119 0.3885 0.1830  0.1292  0.2400  80  GLU A N   
599  C CA  . GLU A 83  ? 0.4860 0.3714 0.4661 0.1729  0.1501  0.2433  80  GLU A CA  
600  C C   . GLU A 83  ? 0.4937 0.3748 0.4931 0.1688  0.1633  0.2598  80  GLU A C   
601  O O   . GLU A 83  ? 0.5099 0.3444 0.5630 0.1561  0.1791  0.2534  80  GLU A O   
602  C CB  . GLU A 83  ? 0.5118 0.3911 0.5560 0.1888  0.1702  0.2832  80  GLU A CB  
603  C CG  . GLU A 83  ? 0.5249 0.4061 0.5591 0.1925  0.1598  0.2668  80  GLU A CG  
604  C CD  . GLU A 83  ? 0.5696 0.4307 0.6790 0.2056  0.1818  0.2953  80  GLU A CD  
605  O OE1 . GLU A 83  ? 0.6128 0.4794 0.7821 0.2205  0.2044  0.3483  80  GLU A OE1 
606  O OE2 . GLU A 83  ? 0.5992 0.4418 0.7137 0.2018  0.1776  0.2665  80  GLU A OE2 
607  N N   . SER A 84  ? 0.4833 0.4174 0.4431 0.1785  0.1571  0.2757  81  SER A N   
608  C CA  . SER A 84  ? 0.4880 0.4303 0.4677 0.1782  0.1717  0.2999  81  SER A CA  
609  C C   . SER A 84  ? 0.4663 0.4404 0.3871 0.1745  0.1559  0.2727  81  SER A C   
610  O O   . SER A 84  ? 0.4941 0.5369 0.3896 0.1916  0.1561  0.2971  81  SER A O   
611  C CB  . SER A 84  ? 0.5117 0.5057 0.5292 0.2032  0.1922  0.3730  81  SER A CB  
612  O OG  . SER A 84  ? 0.5394 0.5447 0.5825 0.2026  0.2085  0.4017  81  SER A OG  
613  N N   . THR A 85  ? 0.4290 0.3596 0.3345 0.1533  0.1443  0.2238  82  THR A N   
614  C CA  . THR A 85  ? 0.4082 0.3584 0.2699 0.1490  0.1300  0.1938  82  THR A CA  
615  C C   . THR A 85  ? 0.4100 0.3510 0.2945 0.1412  0.1431  0.2026  82  THR A C   
616  O O   . THR A 85  ? 0.4119 0.3257 0.3489 0.1352  0.1614  0.2255  82  THR A O   
617  C CB  . THR A 85  ? 0.3759 0.2905 0.2147 0.1324  0.1099  0.1432  82  THR A CB  
618  O OG1 . THR A 85  ? 0.3702 0.2380 0.2347 0.1129  0.1144  0.1276  82  THR A OG1 
619  C CG2 . THR A 85  ? 0.3704 0.2789 0.2051 0.1345  0.1015  0.1369  82  THR A CG2 
620  N N   . PRO A 86  ? 0.4028 0.3678 0.2562 0.1411  0.1348  0.1827  83  PRO A N   
621  C CA  . PRO A 86  ? 0.3989 0.3543 0.2718 0.1314  0.1441  0.1841  83  PRO A CA  
622  C C   . PRO A 86  ? 0.3735 0.2832 0.2477 0.1097  0.1324  0.1430  83  PRO A C   
623  O O   . PRO A 86  ? 0.3553 0.2679 0.2338 0.1031  0.1337  0.1354  83  PRO A O   
624  C CB  . PRO A 86  ? 0.4052 0.4239 0.2443 0.1475  0.1421  0.1852  83  PRO A CB  
625  C CG  . PRO A 86  ? 0.4104 0.4612 0.2093 0.1591  0.1250  0.1619  83  PRO A CG  
626  C CD  . PRO A 86  ? 0.4079 0.4186 0.2145 0.1523  0.1183  0.1581  83  PRO A CD  
627  N N   . MET A 87  ? 0.3615 0.2380 0.2337 0.0997  0.1219  0.1204  84  MET A N   
628  C CA  . MET A 87  ? 0.3473 0.1991 0.2180 0.0819  0.1103  0.0877  84  MET A CA  
629  C C   . MET A 87  ? 0.3407 0.1797 0.2485 0.0660  0.1208  0.0858  84  MET A C   
630  O O   . MET A 87  ? 0.3252 0.1682 0.2290 0.0563  0.1131  0.0684  84  MET A O   
631  C CB  . MET A 87  ? 0.3448 0.1759 0.2101 0.0748  0.1000  0.0690  84  MET A CB  
632  C CG  . MET A 87  ? 0.3523 0.1954 0.1847 0.0836  0.0838  0.0586  84  MET A CG  
633  S SD  . MET A 87  ? 0.3281 0.1834 0.1452 0.0838  0.0701  0.0391  84  MET A SD  
634  C CE  . MET A 87  ? 0.3239 0.1612 0.1533 0.0650  0.0620  0.0263  84  MET A CE  
635  N N   . VAL A 88  ? 0.3531 0.1802 0.3050 0.0637  0.1390  0.1047  85  VAL A N   
636  C CA  . VAL A 88  ? 0.3561 0.1728 0.3562 0.0462  0.1500  0.0976  85  VAL A CA  
637  C C   . VAL A 88  ? 0.3499 0.1926 0.3457 0.0488  0.1533  0.1115  85  VAL A C   
638  O O   . VAL A 88  ? 0.3452 0.1928 0.3486 0.0346  0.1483  0.0911  85  VAL A O   
639  C CB  . VAL A 88  ? 0.3844 0.1796 0.4507 0.0438  0.1720  0.1163  85  VAL A CB  
640  C CG1 . VAL A 88  ? 0.3930 0.1784 0.5209 0.0218  0.1830  0.0989  85  VAL A CG1 
641  C CG2 . VAL A 88  ? 0.3889 0.1612 0.4601 0.0444  0.1694  0.1004  85  VAL A CG2 
642  N N   . ILE A 89  ? 0.3528 0.2225 0.3345 0.0684  0.1612  0.1456  86  ILE A N   
643  C CA  . ILE A 89  ? 0.3468 0.2513 0.3199 0.0749  0.1653  0.1581  86  ILE A CA  
644  C C   . ILE A 89  ? 0.3348 0.2437 0.2730 0.0709  0.1462  0.1233  86  ILE A C   
645  O O   . ILE A 89  ? 0.3281 0.2453 0.2817 0.0618  0.1474  0.1170  86  ILE A O   
646  C CB  . ILE A 89  ? 0.3612 0.3137 0.3089 0.1007  0.1725  0.1920  86  ILE A CB  
647  C CG1 . ILE A 89  ? 0.3691 0.3286 0.3635 0.1076  0.1954  0.2428  86  ILE A CG1 
648  C CG2 . ILE A 89  ? 0.3575 0.3545 0.2901 0.1090  0.1754  0.1950  86  ILE A CG2 
649  C CD1 . ILE A 89  ? 0.3915 0.4108 0.3575 0.1348  0.2001  0.2792  86  ILE A CD1 
650  N N   . TYR A 90  ? 0.3288 0.2332 0.2286 0.0776  0.1295  0.1032  87  TYR A N   
651  C CA  . TYR A 90  ? 0.3202 0.2281 0.2000 0.0767  0.1136  0.0774  87  TYR A CA  
652  C C   . TYR A 90  ? 0.3162 0.2085 0.2158 0.0563  0.1070  0.0616  87  TYR A C   
653  O O   . TYR A 90  ? 0.3180 0.2237 0.2204 0.0539  0.1008  0.0539  87  TYR A O   
654  C CB  . TYR A 90  ? 0.3154 0.2207 0.1652 0.0867  0.0990  0.0611  87  TYR A CB  
655  C CG  . TYR A 90  ? 0.3130 0.2509 0.1410 0.1066  0.1023  0.0679  87  TYR A CG  
656  C CD1 . TYR A 90  ? 0.3272 0.3069 0.1534 0.1194  0.1147  0.0836  87  TYR A CD1 
657  C CD2 . TYR A 90  ? 0.3167 0.2553 0.1262 0.1130  0.0926  0.0580  87  TYR A CD2 
658  C CE1 . TYR A 90  ? 0.3597 0.3900 0.1628 0.1392  0.1173  0.0889  87  TYR A CE1 
659  C CE2 . TYR A 90  ? 0.3098 0.2958 0.0983 0.1316  0.0940  0.0606  87  TYR A CE2 
660  C CZ  . TYR A 90  ? 0.3560 0.3919 0.1395 0.1451  0.1060  0.0752  87  TYR A CZ  
661  O OH  . TYR A 90  ? 0.3700 0.4740 0.1298 0.1652  0.1073  0.0771  87  TYR A OH  
662  N N   . LEU A 91  ? 0.3209 0.1939 0.2381 0.0427  0.1091  0.0560  88  LEU A N   
663  C CA  . LEU A 91  ? 0.3167 0.1940 0.2538 0.0227  0.1036  0.0355  88  LEU A CA  
664  C C   . LEU A 91  ? 0.3192 0.2128 0.2916 0.0121  0.1136  0.0380  88  LEU A C   
665  O O   . LEU A 91  ? 0.3177 0.2356 0.2951 0.0027  0.1052  0.0257  88  LEU A O   
666  C CB  . LEU A 91  ? 0.3199 0.1813 0.2721 0.0110  0.1050  0.0189  88  LEU A CB  
667  C CG  . LEU A 91  ? 0.3326 0.2150 0.3092 -0.0105 0.1009  -0.0111 88  LEU A CG  
668  C CD1 . LEU A 91  ? 0.3210 0.2390 0.2715 -0.0117 0.0830  -0.0167 88  LEU A CD1 
669  C CD2 . LEU A 91  ? 0.3239 0.1942 0.3191 -0.0192 0.1051  -0.0343 88  LEU A CD2 
670  N N   . ASN A 92  ? 0.3309 0.2170 0.3330 0.0138  0.1321  0.0579  89  ASN A N   
671  C CA  . ASN A 92  ? 0.3344 0.2358 0.3811 0.0021  0.1442  0.0634  89  ASN A CA  
672  C C   . ASN A 92  ? 0.3208 0.2530 0.3489 0.0113  0.1403  0.0726  89  ASN A C   
673  O O   . ASN A 92  ? 0.3195 0.2735 0.3764 -0.0013 0.1418  0.0667  89  ASN A O   
674  C CB  . ASN A 92  ? 0.3525 0.2410 0.4459 0.0041  0.1680  0.0938  89  ASN A CB  
675  C CG  . ASN A 92  ? 0.3810 0.2376 0.5209 -0.0088 0.1761  0.0801  89  ASN A CG  
676  O OD1 . ASN A 92  ? 0.3693 0.2204 0.5041 -0.0214 0.1640  0.0418  89  ASN A OD1 
677  N ND2 . ASN A 92  ? 0.4245 0.2656 0.6156 -0.0044 0.1984  0.1135  89  ASN A ND2 
678  N N   . ILE A 93  ? 0.3123 0.2504 0.2980 0.0331  0.1356  0.0827  90  ILE A N   
679  C CA  . ILE A 93  ? 0.3066 0.2727 0.2782 0.0446  0.1314  0.0833  90  ILE A CA  
680  C C   . ILE A 93  ? 0.2944 0.2681 0.2663 0.0355  0.1145  0.0636  90  ILE A C   
681  O O   . ILE A 93  ? 0.2795 0.2800 0.2677 0.0336  0.1141  0.0648  90  ILE A O   
682  C CB  . ILE A 93  ? 0.3101 0.2843 0.2439 0.0691  0.1289  0.0849  90  ILE A CB  
683  C CG1 . ILE A 93  ? 0.3226 0.3150 0.2542 0.0816  0.1460  0.1115  90  ILE A CG1 
684  C CG2 . ILE A 93  ? 0.3091 0.3095 0.2398 0.0810  0.1254  0.0765  90  ILE A CG2 
685  C CD1 . ILE A 93  ? 0.3105 0.3205 0.2038 0.1029  0.1414  0.1057  90  ILE A CD1 
686  N N   . HIS A 94  ? 0.2991 0.2569 0.2559 0.0308  0.1015  0.0501  91  HIS A N   
687  C CA  . HIS A 94  ? 0.2909 0.2691 0.2506 0.0236  0.0865  0.0409  91  HIS A CA  
688  C C   . HIS A 94  ? 0.2881 0.2957 0.2783 0.0022  0.0875  0.0308  91  HIS A C   
689  O O   . HIS A 94  ? 0.2727 0.3180 0.2755 0.0000  0.0812  0.0328  91  HIS A O   
690  C CB  . HIS A 94  ? 0.2902 0.2551 0.2306 0.0230  0.0745  0.0337  91  HIS A CB  
691  C CG  . HIS A 94  ? 0.3029 0.3038 0.2513 0.0102  0.0628  0.0276  91  HIS A CG  
692  N ND1 . HIS A 94  ? 0.3098 0.3449 0.2672 0.0159  0.0537  0.0409  91  HIS A ND1 
693  C CD2 . HIS A 94  ? 0.3064 0.3261 0.2593 -0.0068 0.0597  0.0095  91  HIS A CD2 
694  C CE1 . HIS A 94  ? 0.3197 0.4005 0.2815 0.0035  0.0445  0.0367  91  HIS A CE1 
695  N NE2 . HIS A 94  ? 0.3282 0.4026 0.2852 -0.0110 0.0476  0.0130  91  HIS A NE2 
696  N N   . ALA A 95  ? 0.2995 0.2929 0.3088 -0.0129 0.0959  0.0181  92  ALA A N   
697  C CA  . ALA A 95  ? 0.3059 0.3281 0.3565 -0.0369 0.0981  -0.0037 92  ALA A CA  
698  C C   . ALA A 95  ? 0.3065 0.3544 0.3859 -0.0397 0.1053  0.0070  92  ALA A C   
699  O O   . ALA A 95  ? 0.3058 0.4010 0.4033 -0.0521 0.0972  -0.0058 92  ALA A O   
700  C CB  . ALA A 95  ? 0.3136 0.3053 0.3987 -0.0507 0.1115  -0.0201 92  ALA A CB  
701  N N   . ALA A 96  ? 0.3192 0.3458 0.4019 -0.0269 0.1204  0.0325  93  ALA A N   
702  C CA  . ALA A 96  ? 0.3242 0.3772 0.4361 -0.0278 0.1305  0.0471  93  ALA A CA  
703  C C   . ALA A 96  ? 0.3163 0.4037 0.4080 -0.0150 0.1186  0.0525  93  ALA A C   
704  O O   . ALA A 96  ? 0.3105 0.4367 0.4299 -0.0225 0.1188  0.0530  93  ALA A O   
705  C CB  . ALA A 96  ? 0.3341 0.3690 0.4509 -0.0136 0.1509  0.0783  93  ALA A CB  
706  N N   . MET A 97  ? 0.3201 0.3938 0.3719 0.0043  0.1089  0.0567  94  MET A N   
707  C CA  . MET A 97  ? 0.3196 0.4204 0.3663 0.0177  0.0986  0.0629  94  MET A CA  
708  C C   . MET A 97  ? 0.3011 0.4463 0.3627 0.0028  0.0835  0.0551  94  MET A C   
709  O O   . MET A 97  ? 0.2808 0.4697 0.3628 0.0050  0.0801  0.0638  94  MET A O   
710  C CB  . MET A 97  ? 0.3306 0.4027 0.3473 0.0392  0.0929  0.0654  94  MET A CB  
711  C CG  . MET A 97  ? 0.3795 0.4705 0.4077 0.0572  0.0877  0.0736  94  MET A CG  
712  S SD  . MET A 97  ? 0.4871 0.5427 0.5023 0.0804  0.0834  0.0680  94  MET A SD  
713  C CE  . MET A 97  ? 0.4653 0.5032 0.4655 0.0673  0.0692  0.0680  94  MET A CE  
714  N N   . GLU A 98  ? 0.2978 0.4426 0.3502 -0.0109 0.0749  0.0390  95  GLU A N   
715  C CA  . GLU A 98  ? 0.2986 0.5060 0.3614 -0.0243 0.0602  0.0298  95  GLU A CA  
716  C C   . GLU A 98  ? 0.3068 0.5592 0.4083 -0.0462 0.0636  0.0114  95  GLU A C   
717  O O   . GLU A 98  ? 0.3031 0.6257 0.4188 -0.0523 0.0524  0.0104  95  GLU A O   
718  C CB  . GLU A 98  ? 0.3015 0.5094 0.3445 -0.0330 0.0516  0.0128  95  GLU A CB  
719  C CG  . GLU A 98  ? 0.3092 0.6003 0.3618 -0.0503 0.0381  -0.0060 95  GLU A CG  
720  C CD  . GLU A 98  ? 0.3058 0.6664 0.3586 -0.0381 0.0244  0.0247  95  GLU A CD  
721  O OE1 . GLU A 98  ? 0.2874 0.6225 0.3331 -0.0155 0.0237  0.0603  95  GLU A OE1 
722  O OE2 . GLU A 98  ? 0.3214 0.7691 0.3886 -0.0514 0.0148  0.0126  95  GLU A OE2 
723  N N   . GLU A 99  ? 0.3203 0.5378 0.4456 -0.0576 0.0796  0.0002  96  GLU A N   
724  C CA  . GLU A 99  ? 0.3359 0.5895 0.5123 -0.0795 0.0858  -0.0161 96  GLU A CA  
725  C C   . GLU A 99  ? 0.3255 0.6187 0.5143 -0.0696 0.0857  0.0074  96  GLU A C   
726  O O   . GLU A 99  ? 0.3244 0.6846 0.5422 -0.0841 0.0776  -0.0047 96  GLU A O   
727  C CB  . GLU A 99  ? 0.3560 0.5588 0.5686 -0.0899 0.1072  -0.0192 96  GLU A CB  
728  C CG  . GLU A 99  ? 0.3916 0.5675 0.6202 -0.1064 0.1098  -0.0513 96  GLU A CG  
729  C CD  . GLU A 99  ? 0.4453 0.5731 0.7281 -0.1152 0.1339  -0.0455 96  GLU A CD  
730  O OE1 . GLU A 99  ? 0.4607 0.6052 0.7996 -0.1282 0.1457  -0.0413 96  GLU A OE1 
731  O OE2 . GLU A 99  ? 0.4824 0.5593 0.7573 -0.1087 0.1418  -0.0411 96  GLU A OE2 
732  N N   . VAL A 100 ? 0.3174 0.5771 0.4869 -0.0447 0.0947  0.0376  97  VAL A N   
733  C CA  . VAL A 100 ? 0.3125 0.6077 0.4957 -0.0313 0.0968  0.0586  97  VAL A CA  
734  C C   . VAL A 100 ? 0.3033 0.6564 0.4840 -0.0250 0.0778  0.0650  97  VAL A C   
735  O O   . VAL A 100 ? 0.3000 0.7118 0.5101 -0.0280 0.0749  0.0713  97  VAL A O   
736  C CB  . VAL A 100 ? 0.3153 0.5712 0.4772 -0.0032 0.1101  0.0810  97  VAL A CB  
737  C CG1 . VAL A 100 ? 0.3097 0.6035 0.4852 0.0158  0.1107  0.0982  97  VAL A CG1 
738  C CG2 . VAL A 100 ? 0.3188 0.5491 0.4957 -0.0091 0.1313  0.0869  97  VAL A CG2 
739  N N   . ARG A 101 ? 0.3019 0.6452 0.4528 -0.0163 0.0656  0.0678  98  ARG A N   
740  C CA  . ARG A 101 ? 0.2996 0.7051 0.4540 -0.0083 0.0491  0.0852  98  ARG A CA  
741  C C   . ARG A 101 ? 0.3074 0.8021 0.4847 -0.0323 0.0376  0.0676  98  ARG A C   
742  O O   . ARG A 101 ? 0.2974 0.8626 0.4986 -0.0276 0.0308  0.0853  98  ARG A O   
743  C CB  . ARG A 101 ? 0.2964 0.6821 0.4215 0.0001  0.0396  0.0924  98  ARG A CB  
744  C CG  . ARG A 101 ? 0.2932 0.6113 0.4057 0.0260  0.0459  0.1106  98  ARG A CG  
745  C CD  . ARG A 101 ? 0.2851 0.6053 0.3857 0.0332  0.0348  0.1260  98  ARG A CD  
746  N NE  . ARG A 101 ? 0.2969 0.5493 0.3925 0.0531  0.0404  0.1336  98  ARG A NE  
747  C CZ  . ARG A 101 ? 0.2980 0.4925 0.3646 0.0507  0.0436  0.1160  98  ARG A CZ  
748  N NH1 . ARG A 101 ? 0.3097 0.4555 0.3791 0.0686  0.0471  0.1193  98  ARG A NH1 
749  N NH2 . ARG A 101 ? 0.2836 0.4717 0.3254 0.0309  0.0434  0.0929  98  ARG A NH2 
750  N N   . LYS A 102 ? 0.3206 0.8171 0.4945 -0.0573 0.0356  0.0298  99  LYS A N   
751  C CA  . LYS A 102 ? 0.3357 0.9219 0.5348 -0.0838 0.0247  -0.0031 99  LYS A CA  
752  C C   . LYS A 102 ? 0.3432 0.9638 0.5885 -0.0957 0.0307  -0.0085 99  LYS A C   
753  O O   . LYS A 102 ? 0.3477 1.0646 0.6127 -0.1006 0.0181  -0.0072 99  LYS A O   
754  C CB  . LYS A 102 ? 0.3458 0.9111 0.5470 -0.1086 0.0273  -0.0529 99  LYS A CB  
755  C CG  . LYS A 102 ? 0.3493 0.9171 0.5095 -0.1022 0.0175  -0.0554 99  LYS A CG  
756  C CD  . LYS A 102 ? 0.3592 1.0479 0.5208 -0.1170 -0.0005 -0.0828 99  LYS A CD  
757  C CE  . LYS A 102 ? 0.3643 1.0570 0.4884 -0.1136 -0.0066 -0.0914 99  LYS A CE  
758  N NZ  . LYS A 102 ? 0.3663 0.9420 0.4796 -0.1130 0.0082  -0.1037 99  LYS A NZ  
759  N N   . LYS A 103 ? 0.3526 0.9027 0.6169 -0.0992 0.0503  -0.0103 100 LYS A N   
760  C CA  . LYS A 103 ? 0.3624 0.9366 0.6747 -0.1085 0.0602  -0.0077 100 LYS A CA  
761  C C   . LYS A 103 ? 0.3546 0.9902 0.6705 -0.0887 0.0527  0.0266  100 LYS A C   
762  O O   . LYS A 103 ? 0.3571 1.0709 0.7123 -0.1028 0.0471  0.0186  100 LYS A O   
763  C CB  . LYS A 103 ? 0.3690 0.8600 0.6889 -0.1011 0.0844  0.0092  100 LYS A CB  
764  C CG  . LYS A 103 ? 0.3993 0.8563 0.7648 -0.1288 0.0995  -0.0182 100 LYS A CG  
765  C CD  . LYS A 103 ? 0.4284 0.8454 0.8186 -0.1206 0.1243  0.0138  100 LYS A CD  
766  C CE  . LYS A 103 ? 0.4569 0.8330 0.9054 -0.1444 0.1441  0.0013  100 LYS A CE  
767  N NZ  . LYS A 103 ? 0.4678 0.8205 0.9410 -0.1336 0.1697  0.0443  100 LYS A NZ  
768  N N   . ARG A 104 ? 0.3481 0.9484 0.6310 -0.0560 0.0534  0.0632  101 ARG A N   
769  C CA  . ARG A 104 ? 0.3447 0.9900 0.6406 -0.0318 0.0500  0.0995  101 ARG A CA  
770  C C   . ARG A 104 ? 0.3401 1.0768 0.6372 -0.0284 0.0285  0.1136  101 ARG A C   
771  O O   . ARG A 104 ? 0.3392 1.1434 0.6638 -0.0159 0.0235  0.1409  101 ARG A O   
772  C CB  . ARG A 104 ? 0.3451 0.9180 0.6203 0.0017  0.0613  0.1266  101 ARG A CB  
773  C CG  . ARG A 104 ? 0.3556 0.8712 0.6330 0.0052  0.0834  0.1225  101 ARG A CG  
774  C CD  . ARG A 104 ? 0.3619 0.8128 0.6125 0.0357  0.0923  0.1346  101 ARG A CD  
775  N NE  . ARG A 104 ? 0.3681 0.7860 0.6166 0.0424  0.1133  0.1330  101 ARG A NE  
776  C CZ  . ARG A 104 ? 0.3737 0.7545 0.6043 0.0690  0.1239  0.1359  101 ARG A CZ  
777  N NH1 . ARG A 104 ? 0.3781 0.7369 0.5998 0.0901  0.1161  0.1378  101 ARG A NH1 
778  N NH2 . ARG A 104 ? 0.3724 0.7451 0.5999 0.0742  0.1431  0.1366  101 ARG A NH2 
779  N N   . GLU A 105 ? 0.3387 1.0860 0.6082 -0.0373 0.0166  0.0995  102 GLU A N   
780  C CA  . GLU A 105 ? 0.3396 1.1969 0.6103 -0.0369 -0.0035 0.1131  102 GLU A CA  
781  C C   . GLU A 105 ? 0.3482 1.3109 0.6506 -0.0653 -0.0131 0.0797  102 GLU A C   
782  O O   . GLU A 105 ? 0.3442 1.4132 0.6683 -0.0586 -0.0252 0.1039  102 GLU A O   
783  C CB  . GLU A 105 ? 0.3386 1.1913 0.5716 -0.0404 -0.0122 0.1033  102 GLU A CB  
784  C CG  . GLU A 105 ? 0.3288 1.1122 0.5422 -0.0103 -0.0078 0.1460  102 GLU A CG  
785  C CD  . GLU A 105 ? 0.3196 1.0944 0.4978 -0.0147 -0.0143 0.1373  102 GLU A CD  
786  O OE1 . GLU A 105 ? 0.3101 1.1193 0.4869 0.0043  -0.0215 0.1813  102 GLU A OE1 
787  O OE2 . GLU A 105 ? 0.3165 1.0523 0.4752 -0.0362 -0.0109 0.0901  102 GLU A OE2 
788  N N   . GLU A 106 ? 0.3591 1.2923 0.6728 -0.0963 -0.0065 0.0250  103 GLU A N   
789  C CA  . GLU A 106 ? 0.3717 1.3967 0.7269 -0.1295 -0.0143 -0.0218 103 GLU A CA  
790  C C   . GLU A 106 ? 0.3693 1.4234 0.7709 -0.1303 -0.0081 -0.0070 103 GLU A C   
791  O O   . GLU A 106 ? 0.3764 1.5358 0.8159 -0.1517 -0.0192 -0.0332 103 GLU A O   
792  C CB  . GLU A 106 ? 0.3866 1.3577 0.7574 -0.1616 -0.0052 -0.0845 103 GLU A CB  
793  C CG  . GLU A 106 ? 0.3927 1.3668 0.7249 -0.1656 -0.0142 -0.1113 103 GLU A CG  
794  C CD  . GLU A 106 ? 0.4179 1.2980 0.7637 -0.1858 0.0011  -0.1577 103 GLU A CD  
795  O OE1 . GLU A 106 ? 0.4205 1.2508 0.8166 -0.2025 0.0174  -0.1740 103 GLU A OE1 
796  O OE2 . GLU A 106 ? 0.4250 1.2836 0.7366 -0.1839 -0.0018 -0.1732 103 GLU A OE2 
797  N N   . GLN A 107 ? 0.3623 1.3319 0.7623 -0.1070 0.0094  0.0316  104 GLN A N   
798  C CA  . GLN A 107 ? 0.3586 1.3594 0.7994 -0.1007 0.0167  0.0542  104 GLN A CA  
799  C C   . GLN A 107 ? 0.3502 1.4346 0.7937 -0.0721 0.0040  0.1026  104 GLN A C   
800  O O   . GLN A 107 ? 0.3494 1.4940 0.8325 -0.0695 0.0048  0.1176  104 GLN A O   
801  C CB  . GLN A 107 ? 0.3580 1.2502 0.7972 -0.0848 0.0421  0.0742  104 GLN A CB  
802  C CG  . GLN A 107 ? 0.3744 1.2095 0.8396 -0.1133 0.0593  0.0408  104 GLN A CG  
803  C CD  . GLN A 107 ? 0.3855 1.1318 0.8429 -0.0939 0.0845  0.0681  104 GLN A CD  
804  O OE1 . GLN A 107 ? 0.4018 1.1561 0.9006 -0.0998 0.1003  0.0763  104 GLN A OE1 
805  N NE2 . GLN A 107 ? 0.3761 1.0479 0.7823 -0.0702 0.0884  0.0822  104 GLN A NE2 
806  N N   . ALA A 108 ? 0.3438 1.4341 0.7533 -0.0501 -0.0063 0.1311  105 ALA A N   
807  C CA  . ALA A 108 ? 0.3396 1.4927 0.7624 -0.0170 -0.0138 0.1898  105 ALA A CA  
808  C C   . ALA A 108 ? 0.3397 1.6501 0.7748 -0.0262 -0.0375 0.1948  105 ALA A C   
809  O O   . ALA A 108 ? 0.3394 1.6944 0.7463 -0.0278 -0.0509 0.1955  105 ALA A O   
810  C CB  . ALA A 108 ? 0.3367 1.4124 0.7321 0.0138  -0.0092 0.2265  105 ALA A CB  
811  N N   . LYS A 114 ? 0.5276 0.8717 0.6864 0.1064  -0.2750 -0.1073 111 LYS A N   
812  C CA  . LYS A 114 ? 0.5301 0.8230 0.6311 0.1000  -0.2572 -0.0985 111 LYS A CA  
813  C C   . LYS A 114 ? 0.4909 0.7828 0.6099 0.0773  -0.2269 -0.0973 111 LYS A C   
814  O O   . LYS A 114 ? 0.4616 0.7795 0.6229 0.0738  -0.2108 -0.0961 111 LYS A O   
815  C CB  . LYS A 114 ? 0.5452 0.8025 0.6003 0.1221  -0.2494 -0.0829 111 LYS A CB  
816  C CG  . LYS A 114 ? 0.5938 0.8503 0.6308 0.1487  -0.2772 -0.0814 111 LYS A CG  
817  C CD  . LYS A 114 ? 0.6429 0.8907 0.6510 0.1493  -0.3068 -0.0908 111 LYS A CD  
818  C CE  . LYS A 114 ? 0.6997 0.9468 0.6886 0.1775  -0.3367 -0.0892 111 LYS A CE  
819  N NZ  . LYS A 114 ? 0.7304 0.9302 0.6613 0.1977  -0.3260 -0.0719 111 LYS A NZ  
820  N N   . ALA A 115 ? 0.4912 0.7505 0.5746 0.0637  -0.2188 -0.0971 112 ALA A N   
821  C CA  . ALA A 115 ? 0.4579 0.7115 0.5520 0.0425  -0.1935 -0.0966 112 ALA A CA  
822  C C   . ALA A 115 ? 0.4296 0.6675 0.5151 0.0475  -0.1666 -0.0833 112 ALA A C   
823  O O   . ALA A 115 ? 0.4413 0.6477 0.4854 0.0603  -0.1622 -0.0732 112 ALA A O   
824  C CB  . ALA A 115 ? 0.4748 0.6947 0.5292 0.0307  -0.1941 -0.0998 112 ALA A CB  
825  N N   . LYS A 116 ? 0.3938 0.6529 0.5176 0.0369  -0.1486 -0.0835 113 LYS A N   
826  C CA  . LYS A 116 ? 0.3709 0.6139 0.4858 0.0391  -0.1238 -0.0728 113 LYS A CA  
827  C C   . LYS A 116 ? 0.3558 0.5694 0.4455 0.0238  -0.1079 -0.0702 113 LYS A C   
828  O O   . LYS A 116 ? 0.3482 0.5682 0.4531 0.0058  -0.1046 -0.0770 113 LYS A O   
829  C CB  . LYS A 116 ? 0.3527 0.6277 0.5140 0.0370  -0.1107 -0.0740 113 LYS A CB  
830  C CG  . LYS A 116 ? 0.3538 0.6098 0.5015 0.0417  -0.0879 -0.0638 113 LYS A CG  
831  C CD  . LYS A 116 ? 0.3623 0.6454 0.5457 0.0503  -0.0793 -0.0637 113 LYS A CD  
832  C CE  . LYS A 116 ? 0.3594 0.6671 0.5811 0.0334  -0.0635 -0.0692 113 LYS A CE  
833  N NZ  . LYS A 116 ? 0.3485 0.6706 0.5923 0.0420  -0.0473 -0.0670 113 LYS A NZ  
834  N N   . GLY A 117 ? 0.3454 0.5262 0.3976 0.0313  -0.0982 -0.0603 114 GLY A N   
835  C CA  . GLY A 117 ? 0.3315 0.4847 0.3599 0.0203  -0.0837 -0.0570 114 GLY A CA  
836  C C   . GLY A 117 ? 0.2996 0.4588 0.3487 0.0095  -0.0642 -0.0553 114 GLY A C   
837  O O   . GLY A 117 ? 0.2861 0.4641 0.3595 0.0137  -0.0580 -0.0540 114 GLY A O   
838  N N   . PRO A 118 ? 0.2876 0.4287 0.3244 -0.0033 -0.0542 -0.0552 115 PRO A N   
839  C CA  . PRO A 118 ? 0.2675 0.4093 0.3173 -0.0135 -0.0365 -0.0532 115 PRO A CA  
840  C C   . PRO A 118 ? 0.2470 0.3752 0.2840 -0.0045 -0.0242 -0.0442 115 PRO A C   
841  O O   . PRO A 118 ? 0.2416 0.3518 0.2546 0.0051  -0.0263 -0.0389 115 PRO A O   
842  C CB  . PRO A 118 ? 0.2777 0.3979 0.3100 -0.0261 -0.0330 -0.0551 115 PRO A CB  
843  C CG  . PRO A 118 ? 0.2948 0.3935 0.2946 -0.0171 -0.0414 -0.0531 115 PRO A CG  
844  C CD  . PRO A 118 ? 0.3069 0.4218 0.3122 -0.0068 -0.0581 -0.0562 115 PRO A CD  
845  N N   . ARG A 119 ? 0.2283 0.3642 0.2809 -0.0084 -0.0111 -0.0429 116 ARG A N   
846  C CA  . ARG A 119 ? 0.2164 0.3411 0.2592 -0.0006 -0.0010 -0.0364 116 ARG A CA  
847  C C   . ARG A 119 ? 0.2122 0.3217 0.2463 -0.0100 0.0123  -0.0340 116 ARG A C   
848  O O   . ARG A 119 ? 0.2098 0.3273 0.2574 -0.0206 0.0196  -0.0369 116 ARG A O   
849  C CB  . ARG A 119 ? 0.2158 0.3618 0.2812 0.0075  0.0011  -0.0373 116 ARG A CB  
850  C CG  . ARG A 119 ? 0.2248 0.3849 0.2979 0.0196  -0.0138 -0.0391 116 ARG A CG  
851  C CD  . ARG A 119 ? 0.2343 0.4110 0.3266 0.0307  -0.0105 -0.0391 116 ARG A CD  
852  N NE  . ARG A 119 ? 0.2439 0.4343 0.3440 0.0441  -0.0263 -0.0405 116 ARG A NE  
853  C CZ  . ARG A 119 ? 0.2379 0.4453 0.3572 0.0572  -0.0270 -0.0411 116 ARG A CZ  
854  N NH1 . ARG A 119 ? 0.2332 0.4454 0.3647 0.0578  -0.0113 -0.0410 116 ARG A NH1 
855  N NH2 . ARG A 119 ? 0.2389 0.4566 0.3625 0.0710  -0.0435 -0.0419 116 ARG A NH2 
856  N N   . LEU A 120 ? 0.2081 0.2956 0.2201 -0.0058 0.0156  -0.0286 117 LEU A N   
857  C CA  . LEU A 120 ? 0.2082 0.2778 0.2069 -0.0126 0.0240  -0.0261 117 LEU A CA  
858  C C   . LEU A 120 ? 0.2013 0.2607 0.1915 -0.0063 0.0304  -0.0220 117 LEU A C   
859  O O   . LEU A 120 ? 0.1966 0.2506 0.1806 0.0023  0.0268  -0.0194 117 LEU A O   
860  C CB  . LEU A 120 ? 0.2150 0.2676 0.1961 -0.0140 0.0192  -0.0250 117 LEU A CB  
861  C CG  . LEU A 120 ? 0.2418 0.2759 0.2099 -0.0209 0.0248  -0.0235 117 LEU A CG  
862  C CD1 . LEU A 120 ? 0.2446 0.2669 0.2002 -0.0224 0.0193  -0.0249 117 LEU A CD1 
863  C CD2 . LEU A 120 ? 0.2508 0.2726 0.2088 -0.0154 0.0293  -0.0185 117 LEU A CD2 
864  N N   . LEU A 121 ? 0.1970 0.2517 0.1850 -0.0113 0.0398  -0.0217 118 LEU A N   
865  C CA  . LEU A 121 ? 0.2005 0.2432 0.1770 -0.0065 0.0449  -0.0193 118 LEU A CA  
866  C C   . LEU A 121 ? 0.2107 0.2323 0.1682 -0.0101 0.0458  -0.0165 118 LEU A C   
867  O O   . LEU A 121 ? 0.2167 0.2321 0.1693 -0.0177 0.0505  -0.0163 118 LEU A O   
868  C CB  . LEU A 121 ? 0.1983 0.2493 0.1822 -0.0075 0.0555  -0.0213 118 LEU A CB  
869  C CG  . LEU A 121 ? 0.1922 0.2319 0.1635 -0.0005 0.0603  -0.0206 118 LEU A CG  
870  C CD1 . LEU A 121 ? 0.1694 0.2136 0.1464 0.0100  0.0546  -0.0213 118 LEU A CD1 
871  C CD2 . LEU A 121 ? 0.1647 0.2093 0.1387 -0.0027 0.0741  -0.0224 118 LEU A CD2 
872  N N   . LEU A 122 ? 0.2089 0.2193 0.1571 -0.0045 0.0412  -0.0143 119 LEU A N   
873  C CA  . LEU A 122 ? 0.2221 0.2152 0.1557 -0.0054 0.0398  -0.0120 119 LEU A CA  
874  C C   . LEU A 122 ? 0.2288 0.2120 0.1508 -0.0026 0.0422  -0.0123 119 LEU A C   
875  O O   . LEU A 122 ? 0.2280 0.2124 0.1521 0.0026  0.0405  -0.0136 119 LEU A O   
876  C CB  . LEU A 122 ? 0.2164 0.2060 0.1512 -0.0017 0.0332  -0.0103 119 LEU A CB  
877  C CG  . LEU A 122 ? 0.2449 0.2366 0.1823 -0.0036 0.0313  -0.0100 119 LEU A CG  
878  C CD1 . LEU A 122 ? 0.2789 0.2717 0.2200 0.0013  0.0283  -0.0084 119 LEU A CD1 
879  C CD2 . LEU A 122 ? 0.3137 0.2930 0.2420 -0.0063 0.0315  -0.0089 119 LEU A CD2 
880  N N   . VAL A 123 ? 0.2417 0.2121 0.1485 -0.0057 0.0462  -0.0111 120 VAL A N   
881  C CA  . VAL A 123 ? 0.2522 0.2087 0.1405 -0.0024 0.0482  -0.0114 120 VAL A CA  
882  C C   . VAL A 123 ? 0.2704 0.2068 0.1384 -0.0015 0.0430  -0.0088 120 VAL A C   
883  O O   . VAL A 123 ? 0.2625 0.1949 0.1305 -0.0040 0.0411  -0.0063 120 VAL A O   
884  C CB  . VAL A 123 ? 0.2698 0.2281 0.1540 -0.0050 0.0615  -0.0123 120 VAL A CB  
885  C CG1 . VAL A 123 ? 0.2479 0.2290 0.1559 -0.0042 0.0653  -0.0152 120 VAL A CG1 
886  C CG2 . VAL A 123 ? 0.2633 0.2145 0.1404 -0.0130 0.0697  -0.0095 120 VAL A CG2 
887  N N   . GLY A 124 ? 0.2851 0.2075 0.1345 0.0031  0.0399  -0.0098 121 GLY A N   
888  C CA  . GLY A 124 ? 0.3038 0.2074 0.1332 0.0065  0.0315  -0.0079 121 GLY A CA  
889  C C   . GLY A 124 ? 0.3104 0.2087 0.1339 0.0123  0.0203  -0.0118 121 GLY A C   
890  O O   . GLY A 124 ? 0.3009 0.2090 0.1376 0.0129  0.0196  -0.0156 121 GLY A O   
891  N N   . PRO A 125 ? 0.3322 0.2135 0.1355 0.0169  0.0104  -0.0114 122 PRO A N   
892  C CA  . PRO A 125 ? 0.3445 0.2193 0.1406 0.0216  -0.0022 -0.0167 122 PRO A CA  
893  C C   . PRO A 125 ? 0.3211 0.2113 0.1471 0.0216  -0.0145 -0.0192 122 PRO A C   
894  O O   . PRO A 125 ? 0.2980 0.2025 0.1468 0.0190  -0.0118 -0.0163 122 PRO A O   
895  C CB  . PRO A 125 ? 0.3752 0.2255 0.1368 0.0273  -0.0097 -0.0150 122 PRO A CB  
896  C CG  . PRO A 125 ? 0.3756 0.2242 0.1386 0.0265  -0.0065 -0.0084 122 PRO A CG  
897  C CD  . PRO A 125 ? 0.3578 0.2219 0.1405 0.0185  0.0097  -0.0063 122 PRO A CD  
898  N N   . THR A 126 ? 0.3323 0.2183 0.1571 0.0238  -0.0271 -0.0251 123 THR A N   
899  C CA  . THR A 126 ? 0.3144 0.2145 0.1694 0.0223  -0.0382 -0.0281 123 THR A CA  
900  C C   . THR A 126 ? 0.3103 0.2199 0.1823 0.0241  -0.0439 -0.0243 123 THR A C   
901  O O   . THR A 126 ? 0.3245 0.2230 0.1784 0.0293  -0.0490 -0.0217 123 THR A O   
902  C CB  . THR A 126 ? 0.3350 0.2256 0.1827 0.0240  -0.0542 -0.0362 123 THR A CB  
903  O OG1 . THR A 126 ? 0.3562 0.2282 0.1719 0.0305  -0.0646 -0.0368 123 THR A OG1 
904  C CG2 . THR A 126 ? 0.3358 0.2184 0.1738 0.0222  -0.0482 -0.0413 123 THR A CG2 
905  N N   . ASP A 127 ? 0.2869 0.2149 0.1917 0.0206  -0.0411 -0.0236 124 ASP A N   
906  C CA  . ASP A 127 ? 0.2751 0.2145 0.2015 0.0229  -0.0452 -0.0212 124 ASP A CA  
907  C C   . ASP A 127 ? 0.2755 0.2089 0.1891 0.0263  -0.0389 -0.0153 124 ASP A C   
908  O O   . ASP A 127 ? 0.2763 0.2077 0.1906 0.0324  -0.0468 -0.0139 124 ASP A O   
909  C CB  . ASP A 127 ? 0.2926 0.2334 0.2274 0.0269  -0.0642 -0.0260 124 ASP A CB  
910  C CG  . ASP A 127 ? 0.2889 0.2393 0.2473 0.0210  -0.0699 -0.0323 124 ASP A CG  
911  O OD1 . ASP A 127 ? 0.2657 0.2270 0.2453 0.0153  -0.0583 -0.0307 124 ASP A OD1 
912  O OD2 . ASP A 127 ? 0.2988 0.2438 0.2531 0.0220  -0.0858 -0.0389 124 ASP A OD2 
913  N N   . VAL A 128 ? 0.2704 0.2011 0.1740 0.0225  -0.0250 -0.0122 125 VAL A N   
914  C CA  . VAL A 128 ? 0.2629 0.1879 0.1579 0.0231  -0.0175 -0.0075 125 VAL A CA  
915  C C   . VAL A 128 ? 0.2428 0.1815 0.1586 0.0199  -0.0085 -0.0061 125 VAL A C   
916  O O   . VAL A 128 ? 0.2399 0.1742 0.1507 0.0197  -0.0025 -0.0034 125 VAL A O   
917  C CB  . VAL A 128 ? 0.2782 0.1887 0.1459 0.0202  -0.0086 -0.0055 125 VAL A CB  
918  C CG1 . VAL A 128 ? 0.2891 0.1806 0.1286 0.0248  -0.0160 -0.0060 125 VAL A CG1 
919  C CG2 . VAL A 128 ? 0.2506 0.1708 0.1247 0.0142  0.0010  -0.0072 125 VAL A CG2 
920  N N   . GLY A 129 ? 0.2271 0.1792 0.1631 0.0174  -0.0075 -0.0080 126 GLY A N   
921  C CA  . GLY A 129 ? 0.2130 0.1752 0.1642 0.0154  0.0009  -0.0064 126 GLY A CA  
922  C C   . GLY A 129 ? 0.2046 0.1685 0.1498 0.0111  0.0095  -0.0059 126 GLY A C   
923  O O   . GLY A 129 ? 0.1926 0.1596 0.1404 0.0103  0.0156  -0.0043 126 GLY A O   
924  N N   . LYS A 130 ? 0.2062 0.1678 0.1430 0.0094  0.0094  -0.0076 127 LYS A N   
925  C CA  . LYS A 130 ? 0.2045 0.1708 0.1394 0.0069  0.0165  -0.0075 127 LYS A CA  
926  C C   . LYS A 130 ? 0.1982 0.1722 0.1464 0.0073  0.0191  -0.0064 127 LYS A C   
927  O O   . LYS A 130 ? 0.1928 0.1708 0.1405 0.0068  0.0233  -0.0052 127 LYS A O   
928  C CB  . LYS A 130 ? 0.2096 0.1731 0.1358 0.0068  0.0172  -0.0098 127 LYS A CB  
929  C CG  . LYS A 130 ? 0.2314 0.1842 0.1391 0.0065  0.0177  -0.0102 127 LYS A CG  
930  C CD  . LYS A 130 ? 0.2448 0.1938 0.1427 0.0077  0.0205  -0.0131 127 LYS A CD  
931  C CE  . LYS A 130 ? 0.2572 0.1996 0.1536 0.0107  0.0121  -0.0166 127 LYS A CE  
932  N NZ  . LYS A 130 ? 0.2727 0.2064 0.1626 0.0123  0.0018  -0.0168 127 LYS A NZ  
933  N N   . THR A 131 ? 0.2035 0.1779 0.1624 0.0079  0.0163  -0.0069 128 THR A N   
934  C CA  . THR A 131 ? 0.1913 0.1686 0.1604 0.0079  0.0207  -0.0049 128 THR A CA  
935  C C   . THR A 131 ? 0.1924 0.1724 0.1661 0.0086  0.0257  -0.0019 128 THR A C   
936  O O   . THR A 131 ? 0.1990 0.1787 0.1689 0.0097  0.0311  0.0005  128 THR A O   
937  C CB  . THR A 131 ? 0.1982 0.1734 0.1795 0.0062  0.0175  -0.0066 128 THR A CB  
938  O OG1 . THR A 131 ? 0.1953 0.1644 0.1680 0.0066  0.0146  -0.0098 128 THR A OG1 
939  C CG2 . THR A 131 ? 0.1773 0.1526 0.1700 0.0051  0.0246  -0.0030 128 THR A CG2 
940  N N   . THR A 132 ? 0.1893 0.1705 0.1688 0.0093  0.0234  -0.0023 129 THR A N   
941  C CA  . THR A 132 ? 0.1882 0.1707 0.1717 0.0114  0.0291  -0.0002 129 THR A CA  
942  C C   . THR A 132 ? 0.1934 0.1712 0.1597 0.0119  0.0321  0.0000  129 THR A C   
943  O O   . THR A 132 ? 0.1973 0.1734 0.1592 0.0132  0.0383  0.0016  129 THR A O   
944  C CB  . THR A 132 ? 0.1924 0.1775 0.1869 0.0140  0.0246  -0.0013 129 THR A CB  
945  O OG1 . THR A 132 ? 0.1896 0.1812 0.2031 0.0125  0.0196  -0.0029 129 THR A OG1 
946  C CG2 . THR A 132 ? 0.1844 0.1708 0.1846 0.0177  0.0323  0.0003  129 THR A CG2 
947  N N   . VAL A 133 ? 0.1975 0.1719 0.1530 0.0104  0.0280  -0.0017 130 VAL A N   
948  C CA  . VAL A 133 ? 0.2032 0.1741 0.1456 0.0085  0.0299  -0.0026 130 VAL A CA  
949  C C   . VAL A 133 ? 0.2040 0.1799 0.1440 0.0078  0.0310  -0.0027 130 VAL A C   
950  O O   . VAL A 133 ? 0.2194 0.1934 0.1516 0.0080  0.0324  -0.0033 130 VAL A O   
951  C CB  . VAL A 133 ? 0.2065 0.1722 0.1397 0.0053  0.0274  -0.0041 130 VAL A CB  
952  C CG1 . VAL A 133 ? 0.2005 0.1646 0.1253 0.0009  0.0293  -0.0060 130 VAL A CG1 
953  C CG2 . VAL A 133 ? 0.2193 0.1760 0.1500 0.0082  0.0252  -0.0032 130 VAL A CG2 
954  N N   . SER A 134 ? 0.1909 0.1713 0.1358 0.0080  0.0296  -0.0024 131 SER A N   
955  C CA  A SER A 134 ? 0.1963 0.1806 0.1393 0.0098  0.0297  -0.0020 131 SER A CA  
956  C CA  B SER A 134 ? 0.1925 0.1768 0.1357 0.0099  0.0297  -0.0019 131 SER A CA  
957  C C   . SER A 134 ? 0.2020 0.1817 0.1416 0.0132  0.0336  0.0011  131 SER A C   
958  O O   . SER A 134 ? 0.2142 0.1933 0.1443 0.0156  0.0327  0.0013  131 SER A O   
959  C CB  A SER A 134 ? 0.1963 0.1830 0.1444 0.0112  0.0285  -0.0022 131 SER A CB  
960  C CB  B SER A 134 ? 0.1914 0.1774 0.1401 0.0112  0.0287  -0.0020 131 SER A CB  
961  O OG  A SER A 134 ? 0.1996 0.1813 0.1537 0.0123  0.0302  0.0000  131 SER A OG  
962  O OG  B SER A 134 ? 0.1706 0.1596 0.1187 0.0093  0.0270  -0.0049 131 SER A OG  
963  N N   . ARG A 135 ? 0.2030 0.1793 0.1501 0.0136  0.0379  0.0034  132 ARG A N   
964  C CA  . ARG A 135 ? 0.2032 0.1736 0.1474 0.0163  0.0453  0.0071  132 ARG A CA  
965  C C   . ARG A 135 ? 0.2085 0.1740 0.1396 0.0181  0.0480  0.0063  132 ARG A C   
966  O O   . ARG A 135 ? 0.2137 0.1721 0.1297 0.0215  0.0510  0.0080  132 ARG A O   
967  C CB  . ARG A 135 ? 0.2045 0.1763 0.1665 0.0147  0.0501  0.0088  132 ARG A CB  
968  C CG  . ARG A 135 ? 0.2139 0.1801 0.1763 0.0165  0.0617  0.0131  132 ARG A CG  
969  C CD  . ARG A 135 ? 0.2167 0.1876 0.2035 0.0129  0.0660  0.0143  132 ARG A CD  
970  N NE  . ARG A 135 ? 0.2383 0.2056 0.2296 0.0137  0.0804  0.0186  132 ARG A NE  
971  C CZ  . ARG A 135 ? 0.2418 0.2142 0.2578 0.0095  0.0875  0.0200  132 ARG A CZ  
972  N NH1 . ARG A 135 ? 0.2416 0.2221 0.2788 0.0044  0.0789  0.0166  132 ARG A NH1 
973  N NH2 . ARG A 135 ? 0.2604 0.2292 0.2800 0.0101  0.1036  0.0244  132 ARG A NH2 
974  N N   . ILE A 136 ? 0.2022 0.1685 0.1361 0.0167  0.0465  0.0035  133 ILE A N   
975  C CA  . ILE A 136 ? 0.2109 0.1693 0.1308 0.0183  0.0487  0.0015  133 ILE A CA  
976  C C   . ILE A 136 ? 0.2180 0.1742 0.1216 0.0171  0.0428  -0.0013 133 ILE A C   
977  O O   . ILE A 136 ? 0.2416 0.1890 0.1283 0.0201  0.0446  -0.0020 133 ILE A O   
978  C CB  . ILE A 136 ? 0.2130 0.1699 0.1372 0.0172  0.0467  -0.0009 133 ILE A CB  
979  C CG1 . ILE A 136 ? 0.2165 0.1768 0.1579 0.0206  0.0516  0.0012  133 ILE A CG1 
980  C CG2 . ILE A 136 ? 0.2085 0.1541 0.1155 0.0174  0.0472  -0.0043 133 ILE A CG2 
981  C CD1 . ILE A 136 ? 0.1984 0.1599 0.1478 0.0207  0.0457  0.0000  133 ILE A CD1 
982  N N   . LEU A 137 ? 0.2117 0.1760 0.1205 0.0130  0.0357  -0.0035 134 LEU A N   
983  C CA  . LEU A 137 ? 0.2153 0.1827 0.1162 0.0111  0.0288  -0.0073 134 LEU A CA  
984  C C   . LEU A 137 ? 0.2234 0.1904 0.1152 0.0168  0.0268  -0.0052 134 LEU A C   
985  O O   . LEU A 137 ? 0.2328 0.1955 0.1099 0.0184  0.0220  -0.0080 134 LEU A O   
986  C CB  . LEU A 137 ? 0.2005 0.1791 0.1135 0.0057  0.0245  -0.0097 134 LEU A CB  
987  C CG  . LEU A 137 ? 0.2078 0.1823 0.1225 -0.0003 0.0258  -0.0118 134 LEU A CG  
988  C CD1 . LEU A 137 ? 0.1847 0.1688 0.1097 -0.0046 0.0251  -0.0126 134 LEU A CD1 
989  C CD2 . LEU A 137 ? 0.2033 0.1698 0.1075 -0.0046 0.0238  -0.0165 134 LEU A CD2 
990  N N   . CYS A 138 ? 0.2205 0.1891 0.1188 0.0203  0.0298  -0.0004 135 CYS A N   
991  C CA  . CYS A 138 ? 0.2313 0.1947 0.1176 0.0271  0.0290  0.0031  135 CYS A CA  
992  C C   . CYS A 138 ? 0.2473 0.1951 0.1123 0.0312  0.0347  0.0052  135 CYS A C   
993  O O   . CYS A 138 ? 0.2674 0.2088 0.1126 0.0359  0.0293  0.0045  135 CYS A O   
994  C CB  . CYS A 138 ? 0.2298 0.1925 0.1257 0.0292  0.0334  0.0082  135 CYS A CB  
995  S SG  . CYS A 138 ? 0.2214 0.1986 0.1335 0.0285  0.0260  0.0053  135 CYS A SG  
996  N N   . ASN A 139 ? 0.2444 0.1864 0.1133 0.0300  0.0455  0.0074  136 ASN A N   
997  C CA  . ASN A 139 ? 0.2608 0.1876 0.1105 0.0343  0.0549  0.0095  136 ASN A CA  
998  C C   . ASN A 139 ? 0.2793 0.1985 0.1079 0.0352  0.0491  0.0034  136 ASN A C   
999  O O   . ASN A 139 ? 0.2990 0.2031 0.1002 0.0410  0.0509  0.0041  136 ASN A O   
1000 C CB  . ASN A 139 ? 0.2496 0.1772 0.1153 0.0326  0.0670  0.0113  136 ASN A CB  
1001 C CG  . ASN A 139 ? 0.2460 0.1753 0.1273 0.0320  0.0758  0.0175  136 ASN A CG  
1002 O OD1 . ASN A 139 ? 0.2663 0.1872 0.1361 0.0348  0.0780  0.0223  136 ASN A OD1 
1003 N ND2 . ASN A 139 ? 0.2235 0.1622 0.1305 0.0285  0.0804  0.0174  136 ASN A ND2 
1004 N N   . TYR A 140 ? 0.2699 0.1967 0.1088 0.0293  0.0427  -0.0025 137 TYR A N   
1005 C CA  . TYR A 140 ? 0.2921 0.2103 0.1135 0.0279  0.0368  -0.0095 137 TYR A CA  
1006 C C   . TYR A 140 ? 0.3065 0.2263 0.1143 0.0291  0.0235  -0.0130 137 TYR A C   
1007 O O   . TYR A 140 ? 0.3355 0.2415 0.1174 0.0321  0.0195  -0.0171 137 TYR A O   
1008 C CB  . TYR A 140 ? 0.2821 0.2059 0.1185 0.0202  0.0337  -0.0144 137 TYR A CB  
1009 C CG  . TYR A 140 ? 0.2916 0.2086 0.1336 0.0214  0.0439  -0.0131 137 TYR A CG  
1010 C CD1 . TYR A 140 ? 0.3179 0.2296 0.1591 0.0280  0.0561  -0.0083 137 TYR A CD1 
1011 C CD2 . TYR A 140 ? 0.3144 0.2308 0.1645 0.0162  0.0417  -0.0163 137 TYR A CD2 
1012 C CE1 . TYR A 140 ? 0.3214 0.2307 0.1727 0.0304  0.0644  -0.0077 137 TYR A CE1 
1013 C CE2 . TYR A 140 ? 0.3166 0.2268 0.1720 0.0195  0.0491  -0.0149 137 TYR A CE2 
1014 C CZ  . TYR A 140 ? 0.3250 0.2334 0.1827 0.0270  0.0597  -0.0111 137 TYR A CZ  
1015 O OH  . TYR A 140 ? 0.3454 0.2512 0.2131 0.0315  0.0661  -0.0103 137 TYR A OH  
1016 N N   . SER A 141 ? 0.2884 0.2247 0.1132 0.0277  0.0160  -0.0119 138 SER A N   
1017 C CA  . SER A 141 ? 0.3045 0.2462 0.1215 0.0312  0.0024  -0.0144 138 SER A CA  
1018 C C   . SER A 141 ? 0.3238 0.2483 0.1109 0.0420  0.0034  -0.0096 138 SER A C   
1019 O O   . SER A 141 ? 0.3468 0.2650 0.1122 0.0461  -0.0082 -0.0139 138 SER A O   
1020 C CB  . SER A 141 ? 0.2871 0.2494 0.1297 0.0303  -0.0025 -0.0130 138 SER A CB  
1021 O OG  . SER A 141 ? 0.3076 0.2863 0.1695 0.0216  -0.0098 -0.0201 138 SER A OG  
1022 N N   . VAL A 142 ? 0.3198 0.2356 0.1048 0.0464  0.0168  -0.0008 139 VAL A N   
1023 C CA  . VAL A 142 ? 0.3539 0.2488 0.1076 0.0564  0.0216  0.0055  139 VAL A CA  
1024 C C   . VAL A 142 ? 0.3878 0.2620 0.1094 0.0592  0.0263  0.0026  139 VAL A C   
1025 O O   . VAL A 142 ? 0.4201 0.2780 0.1076 0.0671  0.0198  0.0022  139 VAL A O   
1026 C CB  . VAL A 142 ? 0.3497 0.2382 0.1105 0.0579  0.0380  0.0154  139 VAL A CB  
1027 C CG1 . VAL A 142 ? 0.3901 0.2516 0.1143 0.0669  0.0483  0.0226  139 VAL A CG1 
1028 C CG2 . VAL A 142 ? 0.3195 0.2209 0.1015 0.0580  0.0325  0.0182  139 VAL A CG2 
1029 N N   . ARG A 143 ? 0.3831 0.2568 0.1143 0.0537  0.0364  0.0000  140 ARG A N   
1030 C CA  . ARG A 143 ? 0.4211 0.2742 0.1234 0.0567  0.0427  -0.0039 140 ARG A CA  
1031 C C   . ARG A 143 ? 0.4427 0.2912 0.1256 0.0554  0.0246  -0.0147 140 ARG A C   
1032 O O   . ARG A 143 ? 0.4803 0.3068 0.1286 0.0602  0.0260  -0.0185 140 ARG A O   
1033 C CB  . ARG A 143 ? 0.3987 0.2547 0.1209 0.0522  0.0564  -0.0048 140 ARG A CB  
1034 C CG  . ARG A 143 ? 0.3940 0.2530 0.1341 0.0536  0.0747  0.0044  140 ARG A CG  
1035 C CD  . ARG A 143 ? 0.3663 0.2367 0.1367 0.0491  0.0824  0.0030  140 ARG A CD  
1036 N NE  . ARG A 143 ? 0.3856 0.2419 0.1400 0.0521  0.0883  -0.0024 140 ARG A NE  
1037 C CZ  . ARG A 143 ? 0.3848 0.2457 0.1589 0.0518  0.0963  -0.0036 140 ARG A CZ  
1038 N NH1 . ARG A 143 ? 0.3567 0.2366 0.1668 0.0482  0.0982  0.0000  140 ARG A NH1 
1039 N NH2 . ARG A 143 ? 0.4048 0.2500 0.1613 0.0560  0.1015  -0.0089 140 ARG A NH2 
1040 N N   . GLN A 144 ? 0.4278 0.2973 0.1343 0.0484  0.0085  -0.0200 141 GLN A N   
1041 C CA  . GLN A 144 ? 0.4423 0.3134 0.1388 0.0454  -0.0112 -0.0307 141 GLN A CA  
1042 C C   . GLN A 144 ? 0.4636 0.3307 0.1366 0.0550  -0.0254 -0.0298 141 GLN A C   
1043 O O   . GLN A 144 ? 0.4895 0.3552 0.1485 0.0548  -0.0436 -0.0390 141 GLN A O   
1044 C CB  . GLN A 144 ? 0.4151 0.3129 0.1512 0.0338  -0.0201 -0.0357 141 GLN A CB  
1045 C CG  . GLN A 144 ? 0.4395 0.3424 0.1758 0.0262  -0.0384 -0.0481 141 GLN A CG  
1046 C CD  . GLN A 144 ? 0.4837 0.3665 0.2040 0.0204  -0.0346 -0.0556 141 GLN A CD  
1047 O OE1 . GLN A 144 ? 0.5188 0.3820 0.2064 0.0236  -0.0423 -0.0625 141 GLN A OE1 
1048 N NE2 . GLN A 144 ? 0.4603 0.3450 0.2006 0.0131  -0.0229 -0.0543 141 GLN A NE2 
1049 N N   . GLY A 145 ? 0.4611 0.3252 0.1297 0.0635  -0.0181 -0.0191 142 GLY A N   
1050 C CA  . GLY A 145 ? 0.4903 0.3479 0.1349 0.0749  -0.0311 -0.0163 142 GLY A CA  
1051 C C   . GLY A 145 ? 0.4628 0.3472 0.1390 0.0753  -0.0441 -0.0154 142 GLY A C   
1052 O O   . GLY A 145 ? 0.4848 0.3676 0.1457 0.0856  -0.0587 -0.0143 142 GLY A O   
1053 N N   . ARG A 146 ? 0.4208 0.3282 0.1389 0.0656  -0.0385 -0.0156 143 ARG A N   
1054 C CA  . ARG A 146 ? 0.3954 0.3293 0.1461 0.0656  -0.0481 -0.0157 143 ARG A CA  
1055 C C   . ARG A 146 ? 0.3865 0.3165 0.1432 0.0712  -0.0353 -0.0046 143 ARG A C   
1056 O O   . ARG A 146 ? 0.3868 0.3003 0.1343 0.0704  -0.0178 0.0020  143 ARG A O   
1057 C CB  . ARG A 146 ? 0.3604 0.3186 0.1500 0.0515  -0.0479 -0.0227 143 ARG A CB  
1058 C CG  . ARG A 146 ? 0.3665 0.3275 0.1550 0.0425  -0.0584 -0.0343 143 ARG A CG  
1059 C CD  . ARG A 146 ? 0.3914 0.3627 0.1757 0.0471  -0.0816 -0.0416 143 ARG A CD  
1060 N NE  . ARG A 146 ? 0.3931 0.3702 0.1836 0.0356  -0.0928 -0.0542 143 ARG A NE  
1061 C CZ  . ARG A 146 ? 0.4047 0.3957 0.2001 0.0354  -0.1150 -0.0639 143 ARG A CZ  
1062 N NH1 . ARG A 146 ? 0.4156 0.4165 0.2092 0.0483  -0.1296 -0.0619 143 ARG A NH1 
1063 N NH2 . ARG A 146 ? 0.4247 0.4190 0.2275 0.0224  -0.1237 -0.0759 143 ARG A NH2 
1064 N N   . THR A 147 ? 0.3789 0.3246 0.1532 0.0766  -0.0442 -0.0033 144 THR A N   
1065 C CA  . THR A 147 ? 0.3654 0.3087 0.1498 0.0808  -0.0337 0.0055  144 THR A CA  
1066 C C   . THR A 147 ? 0.3280 0.2995 0.1534 0.0746  -0.0353 0.0013  144 THR A C   
1067 O O   . THR A 147 ? 0.3255 0.3134 0.1649 0.0810  -0.0471 -0.0009 144 THR A O   
1068 C CB  . THR A 147 ? 0.3971 0.3268 0.1588 0.0967  -0.0412 0.0122  144 THR A CB  
1069 O OG1 . THR A 147 ? 0.4146 0.3648 0.1863 0.1029  -0.0628 0.0053  144 THR A OG1 
1070 C CG2 . THR A 147 ? 0.4350 0.3320 0.1505 0.1038  -0.0366 0.0180  144 THR A CG2 
1071 N N   . PRO A 148 ? 0.2989 0.2757 0.1429 0.0631  -0.0235 0.0001  145 PRO A N   
1072 C CA  . PRO A 148 ? 0.2782 0.2773 0.1551 0.0577  -0.0231 -0.0032 145 PRO A CA  
1073 C C   . PRO A 148 ? 0.2759 0.2701 0.1588 0.0636  -0.0158 0.0032  145 PRO A C   
1074 O O   . PRO A 148 ? 0.2795 0.2521 0.1447 0.0677  -0.0078 0.0106  145 PRO A O   
1075 C CB  . PRO A 148 ? 0.2603 0.2602 0.1463 0.0449  -0.0138 -0.0059 145 PRO A CB  
1076 C CG  . PRO A 148 ? 0.2733 0.2500 0.1375 0.0461  -0.0035 -0.0002 145 PRO A CG  
1077 C CD  . PRO A 148 ? 0.2945 0.2569 0.1299 0.0559  -0.0100 0.0020  145 PRO A CD  
1078 N N   . ILE A 149 ? 0.2620 0.2749 0.1693 0.0635  -0.0177 0.0000  146 ILE A N   
1079 C CA  . ILE A 149 ? 0.2610 0.2686 0.1749 0.0678  -0.0106 0.0040  146 ILE A CA  
1080 C C   . ILE A 149 ? 0.2448 0.2530 0.1704 0.0565  0.0000  0.0025  146 ILE A C   
1081 O O   . ILE A 149 ? 0.2340 0.2574 0.1739 0.0484  -0.0002 -0.0029 146 ILE A O   
1082 C CB  . ILE A 149 ? 0.2636 0.2897 0.1955 0.0766  -0.0178 0.0009  146 ILE A CB  
1083 C CG1 . ILE A 149 ? 0.2930 0.3172 0.2116 0.0902  -0.0310 0.0028  146 ILE A CG1 
1084 C CG2 . ILE A 149 ? 0.2549 0.2729 0.1922 0.0807  -0.0095 0.0037  146 ILE A CG2 
1085 C CD1 . ILE A 149 ? 0.2991 0.3419 0.2364 0.1019  -0.0394 0.0002  146 ILE A CD1 
1086 N N   . PHE A 150 ? 0.2503 0.2406 0.1690 0.0556  0.0088  0.0075  147 PHE A N   
1087 C CA  . PHE A 150 ? 0.2377 0.2279 0.1669 0.0466  0.0161  0.0058  147 PHE A CA  
1088 C C   . PHE A 150 ? 0.2349 0.2252 0.1730 0.0502  0.0179  0.0047  147 PHE A C   
1089 O O   . PHE A 150 ? 0.2554 0.2325 0.1869 0.0572  0.0191  0.0086  147 PHE A O   
1090 C CB  . PHE A 150 ? 0.2379 0.2120 0.1597 0.0421  0.0237  0.0101  147 PHE A CB  
1091 C CG  . PHE A 150 ? 0.2512 0.2257 0.1847 0.0345  0.0281  0.0078  147 PHE A CG  
1092 C CD1 . PHE A 150 ? 0.2681 0.2538 0.2091 0.0286  0.0264  0.0031  147 PHE A CD1 
1093 C CD2 . PHE A 150 ? 0.2728 0.2352 0.2090 0.0331  0.0329  0.0103  147 PHE A CD2 
1094 C CE1 . PHE A 150 ? 0.2632 0.2471 0.2108 0.0233  0.0284  0.0012  147 PHE A CE1 
1095 C CE2 . PHE A 150 ? 0.2722 0.2355 0.2187 0.0267  0.0337  0.0071  147 PHE A CE2 
1096 C CZ  . PHE A 150 ? 0.2509 0.2246 0.2016 0.0227  0.0308  0.0027  147 PHE A CZ  
1097 N N   . VAL A 151 ? 0.2244 0.2267 0.1746 0.0455  0.0191  -0.0003 148 VAL A N   
1098 C CA  . VAL A 151 ? 0.2230 0.2255 0.1793 0.0493  0.0216  -0.0029 148 VAL A CA  
1099 C C   . VAL A 151 ? 0.2259 0.2192 0.1811 0.0418  0.0262  -0.0046 148 VAL A C   
1100 O O   . VAL A 151 ? 0.2122 0.2111 0.1692 0.0343  0.0272  -0.0069 148 VAL A O   
1101 C CB  . VAL A 151 ? 0.2263 0.2507 0.1967 0.0513  0.0206  -0.0079 148 VAL A CB  
1102 C CG1 . VAL A 151 ? 0.2151 0.2381 0.1897 0.0574  0.0254  -0.0107 148 VAL A CG1 
1103 C CG2 . VAL A 151 ? 0.2067 0.2446 0.1821 0.0584  0.0126  -0.0076 148 VAL A CG2 
1104 N N   . GLU A 152 ? 0.2384 0.2156 0.1893 0.0441  0.0281  -0.0038 149 GLU A N   
1105 C CA  . GLU A 152 ? 0.2421 0.2092 0.1917 0.0376  0.0296  -0.0064 149 GLU A CA  
1106 C C   . GLU A 152 ? 0.2477 0.2108 0.1948 0.0415  0.0313  -0.0116 149 GLU A C   
1107 O O   . GLU A 152 ? 0.2630 0.2152 0.2072 0.0485  0.0324  -0.0118 149 GLU A O   
1108 C CB  . GLU A 152 ? 0.2520 0.2023 0.1999 0.0354  0.0306  -0.0028 149 GLU A CB  
1109 C CG  . GLU A 152 ? 0.2622 0.2026 0.2123 0.0286  0.0295  -0.0066 149 GLU A CG  
1110 C CD  . GLU A 152 ? 0.2596 0.2092 0.2137 0.0217  0.0268  -0.0083 149 GLU A CD  
1111 O OE1 . GLU A 152 ? 0.2840 0.2389 0.2334 0.0218  0.0253  -0.0121 149 GLU A OE1 
1112 O OE2 . GLU A 152 ? 0.2282 0.1785 0.1894 0.0169  0.0272  -0.0056 149 GLU A OE2 
1113 N N   . LEU A 153 ? 0.2403 0.2090 0.1856 0.0377  0.0325  -0.0156 150 LEU A N   
1114 C CA  . LEU A 153 ? 0.2453 0.2075 0.1837 0.0416  0.0359  -0.0209 150 LEU A CA  
1115 C C   . LEU A 153 ? 0.2569 0.2014 0.1841 0.0368  0.0327  -0.0247 150 LEU A C   
1116 O O   . LEU A 153 ? 0.2693 0.2033 0.1851 0.0401  0.0348  -0.0299 150 LEU A O   
1117 C CB  . LEU A 153 ? 0.2414 0.2190 0.1820 0.0415  0.0414  -0.0229 150 LEU A CB  
1118 C CG  . LEU A 153 ? 0.2314 0.2306 0.1876 0.0452  0.0426  -0.0210 150 LEU A CG  
1119 C CD1 . LEU A 153 ? 0.2009 0.2161 0.1634 0.0414  0.0495  -0.0233 150 LEU A CD1 
1120 C CD2 . LEU A 153 ? 0.2184 0.2178 0.1798 0.0570  0.0431  -0.0214 150 LEU A CD2 
1121 N N   . ASP A 154 ? 0.2482 0.1894 0.1787 0.0298  0.0273  -0.0228 151 ASP A N   
1122 C CA  . ASP A 154 ? 0.2564 0.1845 0.1802 0.0251  0.0212  -0.0272 151 ASP A CA  
1123 C C   . ASP A 154 ? 0.2744 0.1858 0.1990 0.0255  0.0193  -0.0296 151 ASP A C   
1124 O O   . ASP A 154 ? 0.2708 0.1803 0.2067 0.0223  0.0190  -0.0258 151 ASP A O   
1125 C CB  . ASP A 154 ? 0.2478 0.1824 0.1794 0.0183  0.0160  -0.0248 151 ASP A CB  
1126 C CG  . ASP A 154 ? 0.2581 0.1830 0.1828 0.0148  0.0070  -0.0300 151 ASP A CG  
1127 O OD1 . ASP A 154 ? 0.2575 0.1677 0.1737 0.0156  0.0034  -0.0359 151 ASP A OD1 
1128 O OD2 . ASP A 154 ? 0.2346 0.1654 0.1618 0.0120  0.0024  -0.0287 151 ASP A OD2 
1129 N N   . VAL A 155 ? 0.2963 0.1932 0.2069 0.0297  0.0195  -0.0359 152 VAL A N   
1130 C CA  . VAL A 155 ? 0.3109 0.1873 0.2191 0.0300  0.0177  -0.0396 152 VAL A CA  
1131 C C   . VAL A 155 ? 0.3292 0.1959 0.2414 0.0201  0.0076  -0.0442 152 VAL A C   
1132 O O   . VAL A 155 ? 0.3501 0.2005 0.2661 0.0166  0.0056  -0.0468 152 VAL A O   
1133 C CB  . VAL A 155 ? 0.3335 0.1949 0.2236 0.0389  0.0219  -0.0460 152 VAL A CB  
1134 C CG1 . VAL A 155 ? 0.3133 0.1849 0.2076 0.0495  0.0312  -0.0417 152 VAL A CG1 
1135 C CG2 . VAL A 155 ? 0.3316 0.1903 0.2029 0.0394  0.0203  -0.0522 152 VAL A CG2 
1136 N N   . GLY A 156 ? 0.3251 0.2014 0.2381 0.0156  0.0008  -0.0453 153 GLY A N   
1137 C CA  . GLY A 156 ? 0.3360 0.2091 0.2586 0.0071  -0.0107 -0.0496 153 GLY A CA  
1138 C C   . GLY A 156 ? 0.3229 0.2106 0.2725 0.0004  -0.0098 -0.0434 153 GLY A C   
1139 O O   . GLY A 156 ? 0.3377 0.2196 0.3033 -0.0063 -0.0105 -0.0441 153 GLY A O   
1140 N N   . GLN A 157 ? 0.3033 0.2085 0.2573 0.0018  -0.0072 -0.0376 154 GLN A N   
1141 C CA  . GLN A 157 ? 0.2919 0.2114 0.2681 -0.0025 -0.0044 -0.0316 154 GLN A CA  
1142 C C   . GLN A 157 ? 0.2783 0.2027 0.2533 0.0016  0.0075  -0.0235 154 GLN A C   
1143 O O   . GLN A 157 ? 0.2700 0.2044 0.2384 0.0056  0.0104  -0.0203 154 GLN A O   
1144 C CB  . GLN A 157 ? 0.2817 0.2139 0.2608 -0.0026 -0.0110 -0.0315 154 GLN A CB  
1145 C CG  . GLN A 157 ? 0.2935 0.2214 0.2734 -0.0053 -0.0260 -0.0395 154 GLN A CG  
1146 C CD  . GLN A 157 ? 0.2935 0.2239 0.3013 -0.0137 -0.0310 -0.0428 154 GLN A CD  
1147 O OE1 . GLN A 157 ? 0.2816 0.2247 0.3132 -0.0172 -0.0247 -0.0378 154 GLN A OE1 
1148 N NE2 . GLN A 157 ? 0.2776 0.1950 0.2825 -0.0174 -0.0415 -0.0516 154 GLN A NE2 
1149 N N   . ASN A 158 ? 0.2866 0.2018 0.2667 0.0006  0.0136  -0.0205 155 ASN A N   
1150 C CA  . ASN A 158 ? 0.2858 0.1998 0.2584 0.0071  0.0224  -0.0140 155 ASN A CA  
1151 C C   . ASN A 158 ? 0.2874 0.2038 0.2707 0.0040  0.0297  -0.0066 155 ASN A C   
1152 O O   . ASN A 158 ? 0.2957 0.2040 0.2912 -0.0026 0.0324  -0.0060 155 ASN A O   
1153 C CB  . ASN A 158 ? 0.3045 0.1995 0.2669 0.0113  0.0240  -0.0160 155 ASN A CB  
1154 C CG  . ASN A 158 ? 0.3027 0.1973 0.2549 0.0215  0.0298  -0.0107 155 ASN A CG  
1155 O OD1 . ASN A 158 ? 0.2978 0.1927 0.2511 0.0230  0.0348  -0.0034 155 ASN A OD1 
1156 N ND2 . ASN A 158 ? 0.2835 0.1773 0.2254 0.0295  0.0291  -0.0145 155 ASN A ND2 
1157 N N   . SER A 159 ? 0.2826 0.2092 0.2612 0.0082  0.0335  -0.0015 156 SER A N   
1158 C CA  . SER A 159 ? 0.2901 0.2177 0.2743 0.0062  0.0415  0.0051  156 SER A CA  
1159 C C   . SER A 159 ? 0.3059 0.2208 0.2755 0.0127  0.0484  0.0121  156 SER A C   
1160 O O   . SER A 159 ? 0.3162 0.2278 0.2833 0.0127  0.0563  0.0183  156 SER A O   
1161 C CB  . SER A 159 ? 0.2802 0.2236 0.2662 0.0066  0.0408  0.0057  156 SER A CB  
1162 O OG  . SER A 159 ? 0.2973 0.2470 0.2700 0.0123  0.0372  0.0047  156 SER A OG  
1163 N N   . VAL A 160 ? 0.3100 0.2159 0.2687 0.0192  0.0457  0.0110  157 VAL A N   
1164 C CA  . VAL A 160 ? 0.3180 0.2109 0.2610 0.0280  0.0496  0.0175  157 VAL A CA  
1165 C C   . VAL A 160 ? 0.3299 0.1981 0.2699 0.0277  0.0538  0.0192  157 VAL A C   
1166 O O   . VAL A 160 ? 0.3474 0.1985 0.2782 0.0294  0.0614  0.0268  157 VAL A O   
1167 C CB  . VAL A 160 ? 0.3172 0.2213 0.2516 0.0384  0.0430  0.0154  157 VAL A CB  
1168 C CG1 . VAL A 160 ? 0.3303 0.2201 0.2497 0.0501  0.0437  0.0208  157 VAL A CG1 
1169 C CG2 . VAL A 160 ? 0.2853 0.2090 0.2203 0.0379  0.0403  0.0150  157 VAL A CG2 
1170 N N   . SER A 161 ? 0.3246 0.1878 0.2695 0.0254  0.0493  0.0120  158 SER A N   
1171 C CA  . SER A 161 ? 0.3387 0.1752 0.2797 0.0246  0.0525  0.0120  158 SER A CA  
1172 C C   . SER A 161 ? 0.3301 0.1643 0.2854 0.0130  0.0481  0.0030  158 SER A C   
1173 O O   . SER A 161 ? 0.3116 0.1636 0.2813 0.0053  0.0442  -0.0004 158 SER A O   
1174 C CB  . SER A 161 ? 0.3496 0.1761 0.2747 0.0387  0.0501  0.0115  158 SER A CB  
1175 O OG  . SER A 161 ? 0.3659 0.1615 0.2829 0.0399  0.0543  0.0129  158 SER A OG  
1176 N N   . VAL A 162 ? 0.3451 0.1558 0.2954 0.0124  0.0477  -0.0008 159 VAL A N   
1177 C CA  . VAL A 162 ? 0.3431 0.1487 0.3038 0.0019  0.0409  -0.0110 159 VAL A CA  
1178 C C   . VAL A 162 ? 0.3302 0.1501 0.2848 0.0065  0.0311  -0.0198 159 VAL A C   
1179 O O   . VAL A 162 ? 0.3196 0.1497 0.2630 0.0177  0.0317  -0.0181 159 VAL A O   
1180 C CB  . VAL A 162 ? 0.3818 0.1533 0.3345 0.0005  0.0430  -0.0139 159 VAL A CB  
1181 C CG1 . VAL A 162 ? 0.3899 0.1434 0.3490 -0.0069 0.0544  -0.0050 159 VAL A CG1 
1182 C CG2 . VAL A 162 ? 0.3889 0.1474 0.3188 0.0169  0.0436  -0.0141 159 VAL A CG2 
1183 N N   . PRO A 163 ? 0.3283 0.1483 0.2899 -0.0020 0.0220  -0.0293 160 PRO A N   
1184 C CA  . PRO A 163 ? 0.3245 0.1494 0.2724 0.0033  0.0141  -0.0374 160 PRO A CA  
1185 C C   . PRO A 163 ? 0.3440 0.1490 0.2707 0.0139  0.0168  -0.0413 160 PRO A C   
1186 O O   . PRO A 163 ? 0.3659 0.1475 0.2887 0.0149  0.0209  -0.0406 160 PRO A O   
1187 C CB  . PRO A 163 ? 0.3370 0.1597 0.2938 -0.0077 0.0023  -0.0470 160 PRO A CB  
1188 C CG  . PRO A 163 ? 0.3363 0.1614 0.3198 -0.0201 0.0045  -0.0435 160 PRO A CG  
1189 C CD  . PRO A 163 ? 0.3367 0.1512 0.3184 -0.0168 0.0184  -0.0333 160 PRO A CD  
1190 N N   . GLY A 164 ? 0.3440 0.1571 0.2569 0.0223  0.0157  -0.0450 161 GLY A N   
1191 C CA  . GLY A 164 ? 0.3589 0.1583 0.2540 0.0347  0.0206  -0.0483 161 GLY A CA  
1192 C C   . GLY A 164 ? 0.3499 0.1580 0.2475 0.0460  0.0291  -0.0394 161 GLY A C   
1193 O O   . GLY A 164 ? 0.3640 0.1585 0.2517 0.0574  0.0337  -0.0405 161 GLY A O   
1194 N N   . THR A 165 ? 0.3285 0.1584 0.2387 0.0439  0.0303  -0.0311 162 THR A N   
1195 C CA  . THR A 165 ? 0.3256 0.1669 0.2369 0.0552  0.0352  -0.0240 162 THR A CA  
1196 C C   . THR A 165 ? 0.3113 0.1827 0.2292 0.0561  0.0349  -0.0225 162 THR A C   
1197 O O   . THR A 165 ? 0.2947 0.1774 0.2168 0.0470  0.0317  -0.0239 162 THR A O   
1198 C CB  . THR A 165 ? 0.3260 0.1599 0.2410 0.0545  0.0378  -0.0144 162 THR A CB  
1199 O OG1 . THR A 165 ? 0.2922 0.1403 0.2181 0.0436  0.0366  -0.0107 162 THR A OG1 
1200 C CG2 . THR A 165 ? 0.3468 0.1478 0.2556 0.0522  0.0400  -0.0148 162 THR A CG2 
1201 N N   . VAL A 166 ? 0.3232 0.2064 0.2427 0.0677  0.0377  -0.0200 163 VAL A N   
1202 C CA  . VAL A 166 ? 0.3065 0.2178 0.2356 0.0690  0.0375  -0.0174 163 VAL A CA  
1203 C C   . VAL A 166 ? 0.3085 0.2218 0.2399 0.0747  0.0358  -0.0094 163 VAL A C   
1204 O O   . VAL A 166 ? 0.3316 0.2333 0.2584 0.0858  0.0364  -0.0072 163 VAL A O   
1205 C CB  . VAL A 166 ? 0.3136 0.2380 0.2452 0.0782  0.0417  -0.0223 163 VAL A CB  
1206 C CG1 . VAL A 166 ? 0.3004 0.2543 0.2465 0.0807  0.0411  -0.0198 163 VAL A CG1 
1207 C CG2 . VAL A 166 ? 0.3154 0.2354 0.2383 0.0724  0.0444  -0.0294 163 VAL A CG2 
1208 N N   . ALA A 167 ? 0.2992 0.2240 0.2345 0.0682  0.0335  -0.0050 164 ALA A N   
1209 C CA  . ALA A 167 ? 0.3102 0.2299 0.2408 0.0726  0.0321  0.0027  164 ALA A CA  
1210 C C   . ALA A 167 ? 0.2956 0.2373 0.2308 0.0714  0.0283  0.0045  164 ALA A C   
1211 O O   . ALA A 167 ? 0.2814 0.2397 0.2244 0.0638  0.0278  0.0006  164 ALA A O   
1212 C CB  . ALA A 167 ? 0.3107 0.2088 0.2356 0.0642  0.0356  0.0071  164 ALA A CB  
1213 N N   . ALA A 168 ? 0.3073 0.2457 0.2345 0.0791  0.0252  0.0104  165 ALA A N   
1214 C CA  . ALA A 168 ? 0.2964 0.2516 0.2239 0.0789  0.0197  0.0115  165 ALA A CA  
1215 C C   . ALA A 168 ? 0.3149 0.2523 0.2235 0.0835  0.0191  0.0195  165 ALA A C   
1216 O O   . ALA A 168 ? 0.3386 0.2573 0.2353 0.0935  0.0195  0.0245  165 ALA A O   
1217 C CB  . ALA A 168 ? 0.2858 0.2641 0.2251 0.0878  0.0128  0.0073  165 ALA A CB  
1218 N N   . VAL A 169 ? 0.3071 0.2475 0.2101 0.0771  0.0192  0.0210  166 VAL A N   
1219 C CA  . VAL A 169 ? 0.3267 0.2486 0.2074 0.0816  0.0205  0.0287  166 VAL A CA  
1220 C C   . VAL A 169 ? 0.3215 0.2557 0.1950 0.0822  0.0130  0.0270  166 VAL A C   
1221 O O   . VAL A 169 ? 0.3010 0.2530 0.1871 0.0734  0.0116  0.0211  166 VAL A O   
1222 C CB  . VAL A 169 ? 0.3358 0.2385 0.2125 0.0722  0.0330  0.0333  166 VAL A CB  
1223 C CG1 . VAL A 169 ? 0.3100 0.2263 0.1981 0.0601  0.0360  0.0292  166 VAL A CG1 
1224 C CG2 . VAL A 169 ? 0.3614 0.2387 0.2126 0.0781  0.0385  0.0427  166 VAL A CG2 
1225 N N   . LEU A 170 ? 0.3406 0.2631 0.1915 0.0932  0.0073  0.0319  167 LEU A N   
1226 C CA  . LEU A 170 ? 0.3464 0.2743 0.1837 0.0941  -0.0004 0.0300  167 LEU A CA  
1227 C C   . LEU A 170 ? 0.3470 0.2578 0.1690 0.0864  0.0118  0.0341  167 LEU A C   
1228 O O   . LEU A 170 ? 0.3801 0.2660 0.1846 0.0889  0.0221  0.0423  167 LEU A O   
1229 C CB  . LEU A 170 ? 0.3732 0.2918 0.1873 0.1102  -0.0124 0.0337  167 LEU A CB  
1230 C CG  . LEU A 170 ? 0.3823 0.3049 0.1788 0.1128  -0.0244 0.0303  167 LEU A CG  
1231 C CD1 . LEU A 170 ? 0.3417 0.2986 0.1669 0.1066  -0.0361 0.0191  167 LEU A CD1 
1232 C CD2 . LEU A 170 ? 0.4076 0.3133 0.1738 0.1307  -0.0362 0.0358  167 LEU A CD2 
1233 N N   . VAL A 171 ? 0.3260 0.2495 0.1555 0.0770  0.0119  0.0283  168 VAL A N   
1234 C CA  . VAL A 171 ? 0.3268 0.2378 0.1465 0.0704  0.0243  0.0309  168 VAL A CA  
1235 C C   . VAL A 171 ? 0.3633 0.2613 0.1509 0.0767  0.0205  0.0319  168 VAL A C   
1236 O O   . VAL A 171 ? 0.3609 0.2713 0.1474 0.0764  0.0083  0.0247  168 VAL A O   
1237 C CB  . VAL A 171 ? 0.3016 0.2304 0.1453 0.0584  0.0266  0.0241  168 VAL A CB  
1238 C CG1 . VAL A 171 ? 0.3033 0.2216 0.1420 0.0530  0.0398  0.0265  168 VAL A CG1 
1239 C CG2 . VAL A 171 ? 0.2591 0.1995 0.1295 0.0536  0.0276  0.0221  168 VAL A CG2 
1240 N N   . GLN A 172 ? 0.3900 0.2613 0.1502 0.0821  0.0311  0.0406  169 GLN A N   
1241 C CA  . GLN A 172 ? 0.4331 0.2855 0.1546 0.0895  0.0295  0.0424  169 GLN A CA  
1242 C C   . GLN A 172 ? 0.4429 0.2794 0.1510 0.0849  0.0482  0.0457  169 GLN A C   
1243 O O   . GLN A 172 ? 0.4669 0.2855 0.1398 0.0910  0.0489  0.0465  169 GLN A O   
1244 C CB  . GLN A 172 ? 0.4743 0.3024 0.1637 0.1035  0.0266  0.0512  169 GLN A CB  
1245 C CG  . GLN A 172 ? 0.4837 0.3255 0.1848 0.1115  0.0087  0.0490  169 GLN A CG  
1246 C CD  . GLN A 172 ? 0.5468 0.3627 0.2108 0.1280  0.0027  0.0573  169 GLN A CD  
1247 O OE1 . GLN A 172 ? 0.5522 0.3547 0.2156 0.1336  0.0076  0.0648  169 GLN A OE1 
1248 N NE2 . GLN A 172 ? 0.6024 0.4074 0.2315 0.1366  -0.0082 0.0560  169 GLN A NE2 
1249 N N   . LYS A 173 ? 0.4227 0.2649 0.1578 0.0753  0.0633  0.0475  170 LYS A N   
1250 C CA  A LYS A 173 ? 0.4328 0.2658 0.1654 0.0706  0.0825  0.0500  170 LYS A CA  
1251 C CA  B LYS A 173 ? 0.4340 0.2669 0.1666 0.0706  0.0825  0.0501  170 LYS A CA  
1252 C C   . LYS A 173 ? 0.3938 0.2506 0.1664 0.0596  0.0849  0.0439  170 LYS A C   
1253 O O   . LYS A 173 ? 0.3682 0.2416 0.1691 0.0546  0.0778  0.0412  170 LYS A O   
1254 C CB  A LYS A 173 ? 0.4603 0.2710 0.1844 0.0712  0.1018  0.0612  170 LYS A CB  
1255 C CB  B LYS A 173 ? 0.4618 0.2726 0.1862 0.0713  0.1014  0.0613  170 LYS A CB  
1256 C CG  A LYS A 173 ? 0.5159 0.2942 0.1906 0.0829  0.1061  0.0695  170 LYS A CG  
1257 C CG  B LYS A 173 ? 0.5128 0.2967 0.1974 0.0834  0.0980  0.0693  170 LYS A CG  
1258 C CD  A LYS A 173 ? 0.5463 0.3006 0.2146 0.0811  0.1297  0.0813  170 LYS A CD  
1259 C CD  B LYS A 173 ? 0.5510 0.3081 0.2248 0.0829  0.1195  0.0814  170 LYS A CD  
1260 C CE  A LYS A 173 ? 0.5964 0.3142 0.2133 0.0941  0.1317  0.0915  170 LYS A CE  
1261 C CE  B LYS A 173 ? 0.6022 0.3288 0.2320 0.0967  0.1149  0.0901  170 LYS A CE  
1262 N NZ  A LYS A 173 ? 0.6273 0.3268 0.1995 0.1027  0.1340  0.0915  170 LYS A NZ  
1263 N NZ  B LYS A 173 ? 0.6424 0.3357 0.2530 0.0963  0.1393  0.1033  170 LYS A NZ  
1264 N N   . THR A 174 ? 0.3917 0.2486 0.1647 0.0569  0.0946  0.0415  171 THR A N   
1265 C CA  . THR A 174 ? 0.3615 0.2387 0.1705 0.0485  0.0965  0.0364  171 THR A CA  
1266 C C   . THR A 174 ? 0.3472 0.2293 0.1851 0.0423  0.1068  0.0412  171 THR A C   
1267 O O   . THR A 174 ? 0.3710 0.2374 0.1996 0.0436  0.1182  0.0489  171 THR A O   
1268 C CB  . THR A 174 ? 0.3657 0.2405 0.1701 0.0489  0.1062  0.0334  171 THR A CB  
1269 O OG1 . THR A 174 ? 0.4122 0.2681 0.1984 0.0529  0.1256  0.0403  171 THR A OG1 
1270 C CG2 . THR A 174 ? 0.3663 0.2376 0.1471 0.0523  0.0933  0.0261  171 THR A CG2 
1271 N N   . ALA A 175 ? 0.3161 0.2178 0.1872 0.0354  0.1019  0.0364  172 ALA A N   
1272 C CA  . ALA A 175 ? 0.3116 0.2184 0.2113 0.0288  0.1094  0.0391  172 ALA A CA  
1273 C C   . ALA A 175 ? 0.3261 0.2271 0.2322 0.0273  0.1298  0.0439  172 ALA A C   
1274 O O   . ALA A 175 ? 0.3249 0.2252 0.2235 0.0307  0.1372  0.0427  172 ALA A O   
1275 C CB  . ALA A 175 ? 0.2816 0.2093 0.2123 0.0228  0.0990  0.0322  172 ALA A CB  
1276 N N   . ASP A 176 ? 0.3385 0.2343 0.2588 0.0220  0.1403  0.0491  173 ASP A N   
1277 C CA  . ASP A 176 ? 0.3573 0.2544 0.2971 0.0176  0.1605  0.0526  173 ASP A CA  
1278 C C   . ASP A 176 ? 0.3402 0.2643 0.3202 0.0129  0.1554  0.0453  173 ASP A C   
1279 O O   . ASP A 176 ? 0.3114 0.2487 0.3095 0.0091  0.1390  0.0397  173 ASP A O   
1280 C CB  . ASP A 176 ? 0.3713 0.2569 0.3212 0.0106  0.1714  0.0590  173 ASP A CB  
1281 C CG  . ASP A 176 ? 0.3798 0.2671 0.3520 0.0048  0.1948  0.0632  173 ASP A CG  
1282 O OD1 . ASP A 176 ? 0.4435 0.3119 0.3891 0.0096  0.2133  0.0703  173 ASP A OD1 
1283 O OD2 . ASP A 176 ? 0.3515 0.2597 0.3683 -0.0042 0.1947  0.0589  173 ASP A OD2 
1284 N N   . VAL A 177 ? 0.3617 0.2926 0.3534 0.0146  0.1693  0.0452  174 VAL A N   
1285 C CA  . VAL A 177 ? 0.3558 0.3114 0.3827 0.0135  0.1633  0.0385  174 VAL A CA  
1286 C C   . VAL A 177 ? 0.3521 0.3249 0.4217 0.0036  0.1576  0.0360  174 VAL A C   
1287 O O   . VAL A 177 ? 0.3381 0.3261 0.4251 0.0026  0.1401  0.0295  174 VAL A O   
1288 C CB  . VAL A 177 ? 0.3705 0.3301 0.4051 0.0186  0.1820  0.0393  174 VAL A CB  
1289 C CG1 . VAL A 177 ? 0.3499 0.3362 0.4280 0.0177  0.1770  0.0334  174 VAL A CG1 
1290 C CG2 . VAL A 177 ? 0.3904 0.3341 0.3831 0.0287  0.1818  0.0382  174 VAL A CG2 
1291 N N   . ILE A 178 ? 0.3756 0.3427 0.4584 -0.0038 0.1720  0.0411  175 ILE A N   
1292 C CA  . ILE A 178 ? 0.3731 0.3544 0.4976 -0.0150 0.1680  0.0381  175 ILE A CA  
1293 C C   . ILE A 178 ? 0.3814 0.3509 0.4931 -0.0192 0.1524  0.0367  175 ILE A C   
1294 O O   . ILE A 178 ? 0.3684 0.3508 0.5013 -0.0237 0.1353  0.0297  175 ILE A O   
1295 C CB  . ILE A 178 ? 0.3964 0.3762 0.5445 -0.0230 0.1935  0.0441  175 ILE A CB  
1296 C CG1 . ILE A 178 ? 0.3898 0.3853 0.5569 -0.0180 0.2099  0.0442  175 ILE A CG1 
1297 C CG2 . ILE A 178 ? 0.3942 0.3858 0.5856 -0.0371 0.1889  0.0404  175 ILE A CG2 
1298 C CD1 . ILE A 178 ? 0.4201 0.4011 0.5808 -0.0196 0.2413  0.0533  175 ILE A CD1 
1299 N N   . ASP A 179 ? 0.4068 0.3508 0.4815 -0.0162 0.1575  0.0432  176 ASP A N   
1300 C CA  . ASP A 179 ? 0.4132 0.3430 0.4776 -0.0195 0.1475  0.0431  176 ASP A CA  
1301 C C   . ASP A 179 ? 0.3988 0.3256 0.4362 -0.0117 0.1284  0.0395  176 ASP A C   
1302 O O   . ASP A 179 ? 0.4068 0.3233 0.4372 -0.0129 0.1203  0.0386  176 ASP A O   
1303 C CB  . ASP A 179 ? 0.4502 0.3510 0.4910 -0.0201 0.1647  0.0532  176 ASP A CB  
1304 C CG  . ASP A 179 ? 0.4746 0.3739 0.5463 -0.0324 0.1834  0.0567  176 ASP A CG  
1305 O OD1 . ASP A 179 ? 0.4680 0.3914 0.5841 -0.0412 0.1805  0.0501  176 ASP A OD1 
1306 O OD2 . ASP A 179 ? 0.5427 0.4156 0.5942 -0.0332 0.2009  0.0662  176 ASP A OD2 
1307 N N   . GLY A 180 ? 0.3848 0.3190 0.4069 -0.0037 0.1224  0.0374  177 GLY A N   
1308 C CA  . GLY A 180 ? 0.3707 0.3030 0.3694 0.0026  0.1065  0.0343  177 GLY A CA  
1309 C C   . GLY A 180 ? 0.3929 0.3048 0.3559 0.0099  0.1095  0.0404  177 GLY A C   
1310 O O   . GLY A 180 ? 0.4058 0.3028 0.3542 0.0119  0.1242  0.0475  177 GLY A O   
1311 N N   . PHE A 181 ? 0.3890 0.2999 0.3376 0.0147  0.0959  0.0378  178 PHE A N   
1312 C CA  . PHE A 181 ? 0.4230 0.3182 0.3393 0.0237  0.0947  0.0425  178 PHE A CA  
1313 C C   . PHE A 181 ? 0.4622 0.3344 0.3679 0.0248  0.1026  0.0499  178 PHE A C   
1314 O O   . PHE A 181 ? 0.4555 0.3250 0.3788 0.0185  0.1034  0.0490  178 PHE A O   
1315 C CB  . PHE A 181 ? 0.4001 0.3052 0.3102 0.0287  0.0781  0.0370  178 PHE A CB  
1316 C CG  . PHE A 181 ? 0.3861 0.3069 0.2973 0.0287  0.0714  0.0313  178 PHE A CG  
1317 C CD1 . PHE A 181 ? 0.3882 0.3042 0.2779 0.0337  0.0727  0.0324  178 PHE A CD1 
1318 C CD2 . PHE A 181 ? 0.3557 0.2926 0.2860 0.0238  0.0638  0.0247  178 PHE A CD2 
1319 C CE1 . PHE A 181 ? 0.3545 0.2816 0.2444 0.0329  0.0667  0.0266  178 PHE A CE1 
1320 C CE2 . PHE A 181 ? 0.3396 0.2868 0.2688 0.0235  0.0588  0.0202  178 PHE A CE2 
1321 C CZ  . PHE A 181 ? 0.3529 0.2951 0.2631 0.0275  0.0604  0.0209  178 PHE A CZ  
1322 N N   . GLU A 182 ? 0.5129 0.3655 0.3869 0.0331  0.1083  0.0572  179 GLU A N   
1323 C CA  . GLU A 182 ? 0.5603 0.3865 0.4161 0.0373  0.1135  0.0651  179 GLU A CA  
1324 C C   . GLU A 182 ? 0.5582 0.3880 0.4117 0.0440  0.0968  0.0612  179 GLU A C   
1325 O O   . GLU A 182 ? 0.5565 0.4001 0.4031 0.0507  0.0836  0.0566  179 GLU A O   
1326 C CB  . GLU A 182 ? 0.6055 0.4080 0.4211 0.0473  0.1208  0.0739  179 GLU A CB  
1327 C CG  . GLU A 182 ? 0.6480 0.4394 0.4580 0.0429  0.1423  0.0800  179 GLU A CG  
1328 C CD  . GLU A 182 ? 0.7337 0.4924 0.4956 0.0539  0.1511  0.0904  179 GLU A CD  
1329 O OE1 . GLU A 182 ? 0.7564 0.4991 0.4919 0.0648  0.1402  0.0939  179 GLU A OE1 
1330 O OE2 . GLU A 182 ? 0.7758 0.5237 0.5252 0.0528  0.1692  0.0953  179 GLU A OE2 
1331 N N   . ARG A 183 ? 0.5746 0.3921 0.4351 0.0420  0.0979  0.0623  180 ARG A N   
1332 C CA  . ARG A 183 ? 0.5777 0.3962 0.4348 0.0503  0.0844  0.0589  180 ARG A CA  
1333 C C   . ARG A 183 ? 0.6070 0.4006 0.4308 0.0646  0.0838  0.0675  180 ARG A C   
1334 O O   . ARG A 183 ? 0.6321 0.3999 0.4474 0.0665  0.0897  0.0730  180 ARG A O   
1335 C CB  . ARG A 183 ? 0.5829 0.3964 0.4600 0.0429  0.0851  0.0550  180 ARG A CB  
1336 C CG  . ARG A 183 ? 0.5793 0.4154 0.4872 0.0303  0.0827  0.0460  180 ARG A CG  
1337 C CD  . ARG A 183 ? 0.6109 0.4438 0.5362 0.0172  0.0960  0.0484  180 ARG A CD  
1338 N NE  . ARG A 183 ? 0.6182 0.4631 0.5727 0.0061  0.0911  0.0397  180 ARG A NE  
1339 C CZ  . ARG A 183 ? 0.6103 0.4800 0.5839 0.0015  0.0842  0.0326  180 ARG A CZ  
1340 N NH1 . ARG A 183 ? 0.6114 0.4973 0.5805 0.0057  0.0825  0.0327  180 ARG A NH1 
1341 N NH2 . ARG A 183 ? 0.5997 0.4758 0.5955 -0.0071 0.0780  0.0250  180 ARG A NH2 
1342 N N   . ASN A 184 ? 0.6045 0.4039 0.4084 0.0747  0.0757  0.0682  181 ASN A N   
1343 C CA  . ASN A 184 ? 0.6417 0.4186 0.4114 0.0905  0.0714  0.0759  181 ASN A CA  
1344 C C   . ASN A 184 ? 0.6244 0.4096 0.3997 0.1017  0.0561  0.0718  181 ASN A C   
1345 O O   . ASN A 184 ? 0.6084 0.4206 0.3936 0.1061  0.0418  0.0643  181 ASN A O   
1346 C CB  . ASN A 184 ? 0.6587 0.4378 0.4033 0.0972  0.0665  0.0772  181 ASN A CB  
1347 C CG  . ASN A 184 ? 0.7290 0.4777 0.4310 0.1136  0.0639  0.0869  181 ASN A CG  
1348 O OD1 . ASN A 184 ? 0.7997 0.5214 0.4889 0.1194  0.0692  0.0947  181 ASN A OD1 
1349 N ND2 . ASN A 184 ? 0.7587 0.5086 0.4355 0.1215  0.0551  0.0864  181 ASN A ND2 
1350 N N   . GLN A 185 ? 0.6263 0.3881 0.3976 0.1054  0.0606  0.0762  182 GLN A N   
1351 C CA  . GLN A 185 ? 0.6188 0.3820 0.3923 0.1189  0.0489  0.0736  182 GLN A CA  
1352 C C   . GLN A 185 ? 0.5545 0.3560 0.3592 0.1165  0.0380  0.0612  182 GLN A C   
1353 O O   . GLN A 185 ? 0.5451 0.3673 0.3522 0.1269  0.0245  0.0574  182 GLN A O   
1354 C CB  . GLN A 185 ? 0.6604 0.4101 0.4023 0.1388  0.0389  0.0805  182 GLN A CB  
1355 C CG  . GLN A 185 ? 0.7308 0.4381 0.4351 0.1418  0.0514  0.0940  182 GLN A CG  
1356 C CD  . GLN A 185 ? 0.8232 0.5055 0.4930 0.1643  0.0418  0.1023  182 GLN A CD  
1357 O OE1 . GLN A 185 ? 0.8628 0.5387 0.5029 0.1744  0.0348  0.1068  182 GLN A OE1 
1358 N NE2 . GLN A 185 ? 0.8589 0.5248 0.5301 0.1735  0.0406  0.1041  182 GLN A NE2 
1359 N N   . PRO A 186 ? 0.5005 0.3107 0.3290 0.1027  0.0438  0.0548  183 PRO A N   
1360 C CA  . PRO A 186 ? 0.4528 0.2940 0.3060 0.1000  0.0363  0.0441  183 PRO A CA  
1361 C C   . PRO A 186 ? 0.4487 0.2898 0.3058 0.1131  0.0304  0.0409  183 PRO A C   
1362 O O   . PRO A 186 ? 0.4665 0.2794 0.3105 0.1206  0.0340  0.0458  183 PRO A O   
1363 C CB  . PRO A 186 ? 0.4359 0.2777 0.3060 0.0831  0.0443  0.0398  183 PRO A CB  
1364 C CG  . PRO A 186 ? 0.4638 0.2728 0.3236 0.0798  0.0547  0.0464  183 PRO A CG  
1365 C CD  . PRO A 186 ? 0.5099 0.2990 0.3426 0.0898  0.0572  0.0571  183 PRO A CD  
1366 N N   . ILE A 187 ? 0.4115 0.2831 0.2863 0.1163  0.0225  0.0331  184 ILE A N   
1367 C CA  . ILE A 187 ? 0.4030 0.2796 0.2882 0.1261  0.0204  0.0277  184 ILE A CA  
1368 C C   . ILE A 187 ? 0.3703 0.2458 0.2669 0.1131  0.0276  0.0210  184 ILE A C   
1369 O O   . ILE A 187 ? 0.3402 0.2335 0.2478 0.1006  0.0282  0.0167  184 ILE A O   
1370 C CB  . ILE A 187 ? 0.3923 0.3046 0.2953 0.1337  0.0110  0.0219  184 ILE A CB  
1371 C CG1 . ILE A 187 ? 0.4310 0.3459 0.3230 0.1477  0.0000  0.0272  184 ILE A CG1 
1372 C CG2 . ILE A 187 ? 0.3994 0.3186 0.3161 0.1431  0.0125  0.0157  184 ILE A CG2 
1373 C CD1 . ILE A 187 ? 0.4327 0.3868 0.3469 0.1520  -0.0108 0.0204  184 ILE A CD1 
1374 N N   . VAL A 188 ? 0.3694 0.2209 0.2606 0.1165  0.0322  0.0200  185 VAL A N   
1375 C CA  . VAL A 188 ? 0.3509 0.1957 0.2481 0.1044  0.0371  0.0132  185 VAL A CA  
1376 C C   . VAL A 188 ? 0.3581 0.1968 0.2560 0.1146  0.0382  0.0065  185 VAL A C   
1377 O O   . VAL A 188 ? 0.3674 0.1859 0.2551 0.1281  0.0387  0.0097  185 VAL A O   
1378 C CB  . VAL A 188 ? 0.3710 0.1846 0.2591 0.0941  0.0433  0.0175  185 VAL A CB  
1379 C CG1 . VAL A 188 ? 0.3493 0.1563 0.2446 0.0817  0.0451  0.0086  185 VAL A CG1 
1380 C CG2 . VAL A 188 ? 0.3459 0.1635 0.2326 0.0853  0.0453  0.0246  185 VAL A CG2 
1381 N N   . PHE A 189 ? 0.3429 0.1966 0.2501 0.1090  0.0392  -0.0022 186 PHE A N   
1382 C CA  . PHE A 189 ? 0.3625 0.2073 0.2672 0.1172  0.0425  -0.0099 186 PHE A CA  
1383 C C   . PHE A 189 ? 0.3742 0.1987 0.2716 0.1045  0.0446  -0.0165 186 PHE A C   
1384 O O   . PHE A 189 ? 0.3602 0.1950 0.2625 0.0901  0.0427  -0.0184 186 PHE A O   
1385 C CB  . PHE A 189 ? 0.3441 0.2212 0.2624 0.1224  0.0435  -0.0154 186 PHE A CB  
1386 C CG  . PHE A 189 ? 0.3388 0.2382 0.2689 0.1367  0.0399  -0.0117 186 PHE A CG  
1387 C CD1 . PHE A 189 ? 0.3406 0.2373 0.2728 0.1554  0.0414  -0.0133 186 PHE A CD1 
1388 C CD2 . PHE A 189 ? 0.3214 0.2439 0.2605 0.1323  0.0338  -0.0072 186 PHE A CD2 
1389 C CE1 . PHE A 189 ? 0.3505 0.2706 0.2969 0.1695  0.0357  -0.0105 186 PHE A CE1 
1390 C CE2 . PHE A 189 ? 0.3195 0.2633 0.2700 0.1453  0.0276  -0.0050 186 PHE A CE2 
1391 C CZ  . PHE A 189 ? 0.3334 0.2774 0.2891 0.1640  0.0279  -0.0066 186 PHE A CZ  
1392 N N   . ASN A 190 ? 0.4042 0.1990 0.2895 0.1105  0.0474  -0.0204 187 ASN A N   
1393 C CA  . ASN A 190 ? 0.4203 0.1924 0.2970 0.0992  0.0472  -0.0284 187 ASN A CA  
1394 C C   . ASN A 190 ? 0.4230 0.2037 0.2955 0.1016  0.0487  -0.0387 187 ASN A C   
1395 O O   . ASN A 190 ? 0.4479 0.2203 0.3127 0.1156  0.0537  -0.0434 187 ASN A O   
1396 C CB  . ASN A 190 ? 0.4557 0.1867 0.3186 0.1031  0.0495  -0.0288 187 ASN A CB  
1397 C CG  . ASN A 190 ? 0.4783 0.1849 0.3326 0.0909  0.0473  -0.0393 187 ASN A CG  
1398 O OD1 . ASN A 190 ? 0.4485 0.1622 0.3102 0.0742  0.0423  -0.0416 187 ASN A OD1 
1399 N ND2 . ASN A 190 ? 0.5150 0.1922 0.3532 0.1001  0.0500  -0.0464 187 ASN A ND2 
1400 N N   . PHE A 191 ? 0.3969 0.1925 0.2726 0.0890  0.0454  -0.0420 188 PHE A N   
1401 C CA  . PHE A 191 ? 0.4038 0.2020 0.2694 0.0897  0.0472  -0.0511 188 PHE A CA  
1402 C C   . PHE A 191 ? 0.4329 0.1968 0.2798 0.0849  0.0437  -0.0607 188 PHE A C   
1403 O O   . PHE A 191 ? 0.4538 0.2028 0.2840 0.0939  0.0482  -0.0687 188 PHE A O   
1404 C CB  . PHE A 191 ? 0.3723 0.1963 0.2450 0.0792  0.0442  -0.0500 188 PHE A CB  
1405 C CG  . PHE A 191 ? 0.3936 0.2151 0.2504 0.0789  0.0461  -0.0582 188 PHE A CG  
1406 C CD1 . PHE A 191 ? 0.4062 0.2318 0.2566 0.0912  0.0564  -0.0618 188 PHE A CD1 
1407 C CD2 . PHE A 191 ? 0.4109 0.2251 0.2583 0.0673  0.0380  -0.0625 188 PHE A CD2 
1408 C CE1 . PHE A 191 ? 0.4169 0.2366 0.2478 0.0915  0.0607  -0.0687 188 PHE A CE1 
1409 C CE2 . PHE A 191 ? 0.4315 0.2389 0.2577 0.0684  0.0393  -0.0696 188 PHE A CE2 
1410 C CZ  . PHE A 191 ? 0.4333 0.2419 0.2492 0.0803  0.0518  -0.0724 188 PHE A CZ  
1411 N N   . GLY A 192 ? 0.4302 0.1827 0.2810 0.0705  0.0358  -0.0605 189 GLY A N   
1412 C CA  . GLY A 192 ? 0.4624 0.1810 0.3001 0.0639  0.0304  -0.0697 189 GLY A CA  
1413 C C   . GLY A 192 ? 0.4679 0.1846 0.2974 0.0529  0.0203  -0.0791 189 GLY A C   
1414 O O   . GLY A 192 ? 0.4914 0.1799 0.3074 0.0482  0.0140  -0.0892 189 GLY A O   
1415 N N   . HIS A 193 ? 0.4430 0.1875 0.2793 0.0490  0.0177  -0.0762 190 HIS A N   
1416 C CA  . HIS A 193 ? 0.4526 0.1956 0.2772 0.0417  0.0073  -0.0842 190 HIS A CA  
1417 C C   . HIS A 193 ? 0.4239 0.1960 0.2670 0.0336  0.0027  -0.0772 190 HIS A C   
1418 O O   . HIS A 193 ? 0.3922 0.1870 0.2499 0.0365  0.0101  -0.0674 190 HIS A O   
1419 C CB  . HIS A 193 ? 0.4735 0.2113 0.2703 0.0524  0.0127  -0.0902 190 HIS A CB  
1420 C CG  . HIS A 193 ? 0.5051 0.2165 0.2826 0.0640  0.0206  -0.0969 190 HIS A CG  
1421 N ND1 . HIS A 193 ? 0.5540 0.2308 0.3083 0.0625  0.0135  -0.1092 190 HIS A ND1 
1422 C CD2 . HIS A 193 ? 0.5102 0.2245 0.2882 0.0782  0.0345  -0.0937 190 HIS A CD2 
1423 C CE1 . HIS A 193 ? 0.5795 0.2366 0.3190 0.0756  0.0241  -0.1130 190 HIS A CE1 
1424 N NE2 . HIS A 193 ? 0.5528 0.2335 0.3077 0.0860  0.0370  -0.1035 190 HIS A NE2 
1425 N N   . THR A 194 ? 0.4308 0.2017 0.2726 0.0244  -0.0104 -0.0827 191 THR A N   
1426 C CA  . THR A 194 ? 0.4076 0.2040 0.2677 0.0176  -0.0156 -0.0767 191 THR A CA  
1427 C C   . THR A 194 ? 0.4023 0.2123 0.2481 0.0233  -0.0128 -0.0742 191 THR A C   
1428 O O   . THR A 194 ? 0.3849 0.2155 0.2446 0.0196  -0.0147 -0.0679 191 THR A O   
1429 C CB  . THR A 194 ? 0.4152 0.2081 0.2860 0.0061  -0.0318 -0.0830 191 THR A CB  
1430 O OG1 . THR A 194 ? 0.4443 0.2171 0.2869 0.0080  -0.0425 -0.0945 191 THR A OG1 
1431 C CG2 . THR A 194 ? 0.4180 0.2003 0.3092 -0.0023 -0.0318 -0.0837 191 THR A CG2 
1432 N N   . SER A 195 ? 0.4251 0.2222 0.2429 0.0321  -0.0071 -0.0789 192 SER A N   
1433 C CA  A SER A 195 ? 0.4217 0.2301 0.2262 0.0370  0.0000  -0.0753 192 SER A CA  
1434 C CA  B SER A 195 ? 0.4241 0.2318 0.2275 0.0371  -0.0002 -0.0756 192 SER A CA  
1435 C C   . SER A 195 ? 0.4296 0.2376 0.2242 0.0477  0.0167  -0.0746 192 SER A C   
1436 O O   . SER A 195 ? 0.4454 0.2352 0.2296 0.0537  0.0204  -0.0805 192 SER A O   
1437 C CB  A SER A 195 ? 0.4508 0.2440 0.2264 0.0366  -0.0102 -0.0818 192 SER A CB  
1438 C CB  B SER A 195 ? 0.4559 0.2468 0.2291 0.0369  -0.0106 -0.0827 192 SER A CB  
1439 O OG  A SER A 195 ? 0.4383 0.2417 0.2030 0.0395  -0.0026 -0.0762 192 SER A OG  
1440 O OG  B SER A 195 ? 0.4937 0.2594 0.2342 0.0447  -0.0058 -0.0911 192 SER A OG  
1441 N N   . PRO A 196 ? 0.4143 0.2429 0.2143 0.0500  0.0273  -0.0679 193 PRO A N   
1442 C CA  . PRO A 196 ? 0.4265 0.2595 0.2232 0.0598  0.0436  -0.0678 193 PRO A CA  
1443 C C   . PRO A 196 ? 0.4659 0.2744 0.2279 0.0671  0.0499  -0.0763 193 PRO A C   
1444 O O   . PRO A 196 ? 0.4840 0.2889 0.2434 0.0769  0.0620  -0.0792 193 PRO A O   
1445 C CB  . PRO A 196 ? 0.4043 0.2631 0.2135 0.0572  0.0515  -0.0601 193 PRO A CB  
1446 C CG  . PRO A 196 ? 0.3722 0.2423 0.1989 0.0481  0.0403  -0.0548 193 PRO A CG  
1447 C CD  . PRO A 196 ? 0.3925 0.2422 0.2058 0.0438  0.0257  -0.0602 193 PRO A CD  
1448 N N   . SER A 197 ? 0.4933 0.2840 0.2275 0.0637  0.0413  -0.0806 194 SER A N   
1449 C CA  . SER A 197 ? 0.5423 0.3058 0.2357 0.0710  0.0471  -0.0886 194 SER A CA  
1450 C C   . SER A 197 ? 0.5711 0.3083 0.2505 0.0768  0.0444  -0.0988 194 SER A C   
1451 O O   . SER A 197 ? 0.6136 0.3290 0.2609 0.0855  0.0537  -0.1057 194 SER A O   
1452 C CB  . SER A 197 ? 0.5637 0.3110 0.2270 0.0667  0.0345  -0.0908 194 SER A CB  
1453 O OG  . SER A 197 ? 0.5775 0.3149 0.2447 0.0602  0.0125  -0.0961 194 SER A OG  
1454 N N   . ALA A 198 ? 0.5612 0.2972 0.2620 0.0720  0.0330  -0.1000 195 ALA A N   
1455 C CA  . ALA A 198 ? 0.5917 0.3004 0.2811 0.0772  0.0320  -0.1093 195 ALA A CA  
1456 C C   . ALA A 198 ? 0.5986 0.3086 0.2872 0.0914  0.0524  -0.1091 195 ALA A C   
1457 O O   . ALA A 198 ? 0.6364 0.3186 0.2991 0.1001  0.0572  -0.1184 195 ALA A O   
1458 C CB  . ALA A 198 ? 0.5755 0.2848 0.2928 0.0688  0.0204  -0.1079 195 ALA A CB  
1459 N N   . ASN A 199 ? 0.5656 0.3084 0.2835 0.0940  0.0638  -0.0991 196 ASN A N   
1460 C CA  . ASN A 199 ? 0.5691 0.3213 0.2948 0.1081  0.0825  -0.0984 196 ASN A CA  
1461 C C   . ASN A 199 ? 0.5351 0.3275 0.2911 0.1069  0.0916  -0.0882 196 ASN A C   
1462 O O   . ASN A 199 ? 0.5031 0.3172 0.2910 0.1070  0.0894  -0.0815 196 ASN A O   
1463 C CB  . ASN A 199 ? 0.5769 0.3187 0.3156 0.1150  0.0808  -0.0996 196 ASN A CB  
1464 C CG  . ASN A 199 ? 0.5817 0.3310 0.3280 0.1325  0.0985  -0.1001 196 ASN A CG  
1465 O OD1 . ASN A 199 ? 0.5579 0.3328 0.3147 0.1374  0.1124  -0.0970 196 ASN A OD1 
1466 N ND2 . ASN A 199 ? 0.6053 0.3325 0.3487 0.1418  0.0981  -0.1040 196 ASN A ND2 
1467 N N   . LEU A 200 ? 0.5424 0.3421 0.2862 0.1054  0.1015  -0.0873 197 LEU A N   
1468 C CA  . LEU A 200 ? 0.5109 0.3452 0.2808 0.0998  0.1075  -0.0784 197 LEU A CA  
1469 C C   . LEU A 200 ? 0.4916 0.3550 0.2950 0.1089  0.1205  -0.0754 197 LEU A C   
1470 O O   . LEU A 200 ? 0.4583 0.3510 0.2932 0.1040  0.1175  -0.0685 197 LEU A O   
1471 C CB  . LEU A 200 ? 0.5328 0.3624 0.2780 0.0957  0.1168  -0.0780 197 LEU A CB  
1472 C CG  . LEU A 200 ? 0.5068 0.3627 0.2728 0.0846  0.1158  -0.0689 197 LEU A CG  
1473 C CD1 . LEU A 200 ? 0.5113 0.3623 0.2781 0.0745  0.0944  -0.0662 197 LEU A CD1 
1474 C CD2 . LEU A 200 ? 0.5321 0.3834 0.2759 0.0824  0.1306  -0.0673 197 LEU A CD2 
1475 N N   . SER A 201 ? 0.5133 0.3685 0.3105 0.1229  0.1336  -0.0813 198 SER A N   
1476 C CA  . SER A 201 ? 0.5011 0.3863 0.3332 0.1338  0.1451  -0.0793 198 SER A CA  
1477 C C   . SER A 201 ? 0.4785 0.3714 0.3356 0.1386  0.1321  -0.0758 198 SER A C   
1478 O O   . SER A 201 ? 0.4547 0.3802 0.3464 0.1423  0.1333  -0.0712 198 SER A O   
1479 C CB  . SER A 201 ? 0.5373 0.4126 0.3568 0.1493  0.1649  -0.0867 198 SER A CB  
1480 O OG  . SER A 201 ? 0.5762 0.4200 0.3770 0.1601  0.1600  -0.0932 198 SER A OG  
1481 N N   . LEU A 202 ? 0.4879 0.3500 0.3268 0.1381  0.1194  -0.0782 199 LEU A N   
1482 C CA  . LEU A 202 ? 0.4748 0.3388 0.3317 0.1396  0.1070  -0.0730 199 LEU A CA  
1483 C C   . LEU A 202 ? 0.4392 0.3270 0.3162 0.1262  0.0963  -0.0644 199 LEU A C   
1484 O O   . LEU A 202 ? 0.4168 0.3240 0.3178 0.1300  0.0920  -0.0584 199 LEU A O   
1485 C CB  . LEU A 202 ? 0.5011 0.3247 0.3340 0.1382  0.0972  -0.0773 199 LEU A CB  
1486 C CG  . LEU A 202 ? 0.4967 0.3156 0.3430 0.1372  0.0858  -0.0709 199 LEU A CG  
1487 C CD1 . LEU A 202 ? 0.4939 0.3243 0.3585 0.1554  0.0912  -0.0677 199 LEU A CD1 
1488 C CD2 . LEU A 202 ? 0.5182 0.2964 0.3424 0.1316  0.0773  -0.0756 199 LEU A CD2 
1489 N N   . TYR A 203 ? 0.4345 0.3182 0.2989 0.1118  0.0916  -0.0640 200 TYR A N   
1490 C CA  . TYR A 203 ? 0.4072 0.3096 0.2866 0.0992  0.0825  -0.0568 200 TYR A CA  
1491 C C   . TYR A 203 ? 0.3908 0.3296 0.2979 0.1007  0.0887  -0.0524 200 TYR A C   
1492 O O   . TYR A 203 ? 0.3631 0.3188 0.2899 0.0988  0.0813  -0.0467 200 TYR A O   
1493 C CB  . TYR A 203 ? 0.4066 0.2992 0.2664 0.0870  0.0791  -0.0582 200 TYR A CB  
1494 C CG  . TYR A 203 ? 0.3704 0.2781 0.2429 0.0748  0.0701  -0.0516 200 TYR A CG  
1495 C CD1 . TYR A 203 ? 0.3388 0.2426 0.2196 0.0700  0.0586  -0.0481 200 TYR A CD1 
1496 C CD2 . TYR A 203 ? 0.3600 0.2830 0.2343 0.0680  0.0746  -0.0489 200 TYR A CD2 
1497 C CE1 . TYR A 203 ? 0.3128 0.2287 0.2037 0.0602  0.0519  -0.0426 200 TYR A CE1 
1498 C CE2 . TYR A 203 ? 0.3393 0.2728 0.2231 0.0580  0.0665  -0.0435 200 TYR A CE2 
1499 C CZ  . TYR A 203 ? 0.3121 0.2426 0.2042 0.0547  0.0552  -0.0406 200 TYR A CZ  
1500 O OH  . TYR A 203 ? 0.2932 0.2331 0.1940 0.0462  0.0488  -0.0357 200 TYR A OH  
1501 N N   . GLU A 204 ? 0.4086 0.3580 0.3160 0.1038  0.1029  -0.0555 201 GLU A N   
1502 C CA  . GLU A 204 ? 0.4009 0.3861 0.3379 0.1037  0.1105  -0.0529 201 GLU A CA  
1503 C C   . GLU A 204 ? 0.3947 0.3988 0.3589 0.1171  0.1086  -0.0522 201 GLU A C   
1504 O O   . GLU A 204 ? 0.3758 0.4062 0.3657 0.1149  0.1018  -0.0481 201 GLU A O   
1505 C CB  . GLU A 204 ? 0.4261 0.4147 0.3558 0.1034  0.1291  -0.0565 201 GLU A CB  
1506 C CG  . GLU A 204 ? 0.4616 0.4325 0.3635 0.0897  0.1279  -0.0551 201 GLU A CG  
1507 C CD  . GLU A 204 ? 0.5248 0.4869 0.4061 0.0894  0.1463  -0.0579 201 GLU A CD  
1508 O OE1 . GLU A 204 ? 0.5787 0.5386 0.4568 0.1006  0.1614  -0.0628 201 GLU A OE1 
1509 O OE2 . GLU A 204 ? 0.5717 0.5266 0.4370 0.0783  0.1464  -0.0548 201 GLU A OE2 
1510 N N   . ALA A 205 ? 0.4156 0.4040 0.3721 0.1319  0.1130  -0.0564 202 ALA A N   
1511 C CA  . ALA A 205 ? 0.4156 0.4160 0.3936 0.1473  0.1089  -0.0551 202 ALA A CA  
1512 C C   . ALA A 205 ? 0.4018 0.3992 0.3827 0.1438  0.0913  -0.0482 202 ALA A C   
1513 O O   . ALA A 205 ? 0.3907 0.4123 0.3956 0.1496  0.0847  -0.0446 202 ALA A O   
1514 C CB  . ALA A 205 ? 0.4477 0.4218 0.4096 0.1635  0.1154  -0.0604 202 ALA A CB  
1515 N N   . LEU A 206 ? 0.4036 0.3719 0.3604 0.1342  0.0837  -0.0465 203 LEU A N   
1516 C CA  . LEU A 206 ? 0.3914 0.3548 0.3491 0.1303  0.0704  -0.0395 203 LEU A CA  
1517 C C   . LEU A 206 ? 0.3659 0.3578 0.3413 0.1207  0.0643  -0.0348 203 LEU A C   
1518 O O   . LEU A 206 ? 0.3592 0.3607 0.3450 0.1257  0.0557  -0.0299 203 LEU A O   
1519 C CB  . LEU A 206 ? 0.3955 0.3248 0.3290 0.1205  0.0653  -0.0392 203 LEU A CB  
1520 C CG  . LEU A 206 ? 0.4262 0.3220 0.3429 0.1303  0.0668  -0.0425 203 LEU A CG  
1521 C CD1 . LEU A 206 ? 0.4352 0.3015 0.3339 0.1176  0.0608  -0.0432 203 LEU A CD1 
1522 C CD2 . LEU A 206 ? 0.4315 0.3253 0.3559 0.1457  0.0638  -0.0376 203 LEU A CD2 
1523 N N   . PHE A 207 ? 0.3566 0.3593 0.3327 0.1076  0.0681  -0.0362 204 PHE A N   
1524 C CA  . PHE A 207 ? 0.3428 0.3683 0.3338 0.0986  0.0618  -0.0322 204 PHE A CA  
1525 C C   . PHE A 207 ? 0.3385 0.3985 0.3589 0.1053  0.0631  -0.0335 204 PHE A C   
1526 O O   . PHE A 207 ? 0.3245 0.4016 0.3580 0.1023  0.0539  -0.0307 204 PHE A O   
1527 C CB  . PHE A 207 ? 0.3376 0.3591 0.3184 0.0821  0.0622  -0.0316 204 PHE A CB  
1528 C CG  . PHE A 207 ? 0.3526 0.3789 0.3306 0.0771  0.0740  -0.0356 204 PHE A CG  
1529 C CD1 . PHE A 207 ? 0.3669 0.4204 0.3667 0.0776  0.0824  -0.0374 204 PHE A CD1 
1530 C CD2 . PHE A 207 ? 0.3826 0.3858 0.3359 0.0705  0.0760  -0.0371 204 PHE A CD2 
1531 C CE1 . PHE A 207 ? 0.3750 0.4296 0.3695 0.0716  0.0960  -0.0398 204 PHE A CE1 
1532 C CE2 . PHE A 207 ? 0.3948 0.3975 0.3390 0.0663  0.0872  -0.0396 204 PHE A CE2 
1533 C CZ  . PHE A 207 ? 0.3948 0.4219 0.3584 0.0666  0.0985  -0.0404 204 PHE A CZ  
1534 N N   . LYS A 208 ? 0.3549 0.4249 0.3863 0.1148  0.0739  -0.0382 205 LYS A N   
1535 C CA  . LYS A 208 ? 0.3534 0.4582 0.4185 0.1243  0.0744  -0.0402 205 LYS A CA  
1536 C C   . LYS A 208 ? 0.3575 0.4628 0.4284 0.1398  0.0610  -0.0371 205 LYS A C   
1537 O O   . LYS A 208 ? 0.3465 0.4797 0.4417 0.1430  0.0516  -0.0366 205 LYS A O   
1538 C CB  . LYS A 208 ? 0.3696 0.4842 0.4459 0.1330  0.0917  -0.0461 205 LYS A CB  
1539 C CG  . LYS A 208 ? 0.3766 0.5116 0.4663 0.1201  0.1058  -0.0488 205 LYS A CG  
1540 C CD  . LYS A 208 ? 0.4190 0.5639 0.5200 0.1301  0.1262  -0.0544 205 LYS A CD  
1541 C CE  . LYS A 208 ? 0.4298 0.5988 0.5624 0.1503  0.1242  -0.0570 205 LYS A CE  
1542 N NZ  . LYS A 208 ? 0.4597 0.6466 0.6124 0.1598  0.1459  -0.0627 205 LYS A NZ  
1543 N N   . GLU A 209 ? 0.3733 0.4468 0.4215 0.1497  0.0597  -0.0353 206 GLU A N   
1544 C CA  . GLU A 209 ? 0.3894 0.4554 0.4359 0.1645  0.0475  -0.0306 206 GLU A CA  
1545 C C   . GLU A 209 ? 0.3736 0.4334 0.4091 0.1556  0.0341  -0.0239 206 GLU A C   
1546 O O   . GLU A 209 ? 0.3773 0.4465 0.4192 0.1648  0.0220  -0.0204 206 GLU A O   
1547 C CB  . GLU A 209 ? 0.4233 0.4518 0.4462 0.1759  0.0515  -0.0303 206 GLU A CB  
1548 C CG  . GLU A 209 ? 0.4663 0.4805 0.4831 0.1934  0.0409  -0.0245 206 GLU A CG  
1549 C CD  . GLU A 209 ? 0.5099 0.5492 0.5525 0.2154  0.0389  -0.0268 206 GLU A CD  
1550 O OE1 . GLU A 209 ? 0.5247 0.6018 0.5980 0.2153  0.0440  -0.0325 206 GLU A OE1 
1551 O OE2 . GLU A 209 ? 0.5528 0.5733 0.5857 0.2333  0.0325  -0.0227 206 GLU A OE2 
1552 N N   . MET A 210 ? 0.3603 0.4038 0.3784 0.1387  0.0361  -0.0224 207 MET A N   
1553 C CA  . MET A 210 ? 0.3538 0.3934 0.3627 0.1291  0.0267  -0.0169 207 MET A CA  
1554 C C   . MET A 210 ? 0.3334 0.4074 0.3644 0.1262  0.0193  -0.0184 207 MET A C   
1555 O O   . MET A 210 ? 0.3395 0.4175 0.3697 0.1323  0.0073  -0.0150 207 MET A O   
1556 C CB  . MET A 210 ? 0.3422 0.3651 0.3356 0.1118  0.0317  -0.0168 207 MET A CB  
1557 C CG  . MET A 210 ? 0.3524 0.3749 0.3395 0.1007  0.0251  -0.0124 207 MET A CG  
1558 S SD  . MET A 210 ? 0.3981 0.3917 0.3637 0.1059  0.0194  -0.0040 207 MET A SD  
1559 C CE  . MET A 210 ? 0.3678 0.3326 0.3194 0.0956  0.0275  -0.0046 207 MET A CE  
1560 N N   . ALA A 211 ? 0.3181 0.4149 0.3674 0.1170  0.0265  -0.0239 208 ALA A N   
1561 C CA  . ALA A 211 ? 0.3054 0.4359 0.3800 0.1115  0.0208  -0.0269 208 ALA A CA  
1562 C C   . ALA A 211 ? 0.3118 0.4656 0.4085 0.1276  0.0099  -0.0282 208 ALA A C   
1563 O O   . ALA A 211 ? 0.3120 0.4818 0.4174 0.1265  -0.0036 -0.0284 208 ALA A O   
1564 C CB  . ALA A 211 ? 0.2927 0.4414 0.3848 0.1008  0.0342  -0.0322 208 ALA A CB  
1565 N N   . THR A 212 ? 0.3232 0.4783 0.4281 0.1435  0.0149  -0.0296 209 THR A N   
1566 C CA  . THR A 212 ? 0.3340 0.5125 0.4625 0.1618  0.0043  -0.0311 209 THR A CA  
1567 C C   . THR A 212 ? 0.3431 0.5012 0.4483 0.1732  -0.0124 -0.0243 209 THR A C   
1568 O O   . THR A 212 ? 0.3399 0.5185 0.4587 0.1810  -0.0285 -0.0249 209 THR A O   
1569 C CB  . THR A 212 ? 0.3475 0.5292 0.4888 0.1780  0.0157  -0.0343 209 THR A CB  
1570 O OG1 . THR A 212 ? 0.3546 0.5625 0.5223 0.1689  0.0311  -0.0409 209 THR A OG1 
1571 C CG2 . THR A 212 ? 0.3605 0.5607 0.5222 0.2011  0.0029  -0.0345 209 THR A CG2 
1572 N N   . THR A 213 ? 0.3526 0.4695 0.4223 0.1735  -0.0085 -0.0180 210 THR A N   
1573 C CA  . THR A 213 ? 0.3719 0.4625 0.4140 0.1831  -0.0203 -0.0100 210 THR A CA  
1574 C C   . THR A 213 ? 0.3583 0.4544 0.3926 0.1721  -0.0314 -0.0082 210 THR A C   
1575 O O   . THR A 213 ? 0.3764 0.4750 0.4048 0.1830  -0.0469 -0.0056 210 THR A O   
1576 C CB  . THR A 213 ? 0.3877 0.4327 0.3962 0.1814  -0.0110 -0.0039 210 THR A CB  
1577 O OG1 . THR A 213 ? 0.4051 0.4411 0.4177 0.1907  -0.0005 -0.0069 210 THR A OG1 
1578 C CG2 . THR A 213 ? 0.4153 0.4313 0.3951 0.1926  -0.0205 0.0053  210 THR A CG2 
1579 N N   . LEU A 214 ? 0.3323 0.4290 0.3647 0.1517  -0.0239 -0.0101 211 LEU A N   
1580 C CA  . LEU A 214 ? 0.3237 0.4230 0.3471 0.1407  -0.0326 -0.0094 211 LEU A CA  
1581 C C   . LEU A 214 ? 0.3241 0.4597 0.3734 0.1432  -0.0474 -0.0155 211 LEU A C   
1582 O O   . LEU A 214 ? 0.3338 0.4663 0.3691 0.1463  -0.0620 -0.0139 211 LEU A O   
1583 C CB  . LEU A 214 ? 0.2983 0.3921 0.3174 0.1199  -0.0215 -0.0108 211 LEU A CB  
1584 C CG  . LEU A 214 ? 0.2893 0.3496 0.2846 0.1147  -0.0101 -0.0057 211 LEU A CG  
1585 C CD1 . LEU A 214 ? 0.2550 0.3153 0.2497 0.0960  -0.0024 -0.0079 211 LEU A CD1 
1586 C CD2 . LEU A 214 ? 0.3162 0.3472 0.2825 0.1208  -0.0142 0.0024  211 LEU A CD2 
1587 N N   . ASN A 215 ? 0.3103 0.4794 0.3967 0.1419  -0.0436 -0.0229 212 ASN A N   
1588 C CA  . ASN A 215 ? 0.3096 0.5178 0.4287 0.1429  -0.0577 -0.0301 212 ASN A CA  
1589 C C   . ASN A 215 ? 0.3363 0.5502 0.4555 0.1648  -0.0776 -0.0286 212 ASN A C   
1590 O O   . ASN A 215 ? 0.3402 0.5744 0.4701 0.1654  -0.0960 -0.0330 212 ASN A O   
1591 C CB  . ASN A 215 ? 0.2917 0.5354 0.4544 0.1382  -0.0464 -0.0377 212 ASN A CB  
1592 C CG  . ASN A 215 ? 0.2626 0.5056 0.4272 0.1154  -0.0307 -0.0401 212 ASN A CG  
1593 O OD1 . ASN A 215 ? 0.2457 0.4693 0.3862 0.1027  -0.0320 -0.0377 212 ASN A OD1 
1594 N ND2 . ASN A 215 ? 0.2296 0.4926 0.4217 0.1111  -0.0152 -0.0445 212 ASN A ND2 
1595 N N   . ALA A 216 ? 0.3555 0.5506 0.4623 0.1832  -0.0747 -0.0231 213 ALA A N   
1596 C CA  . ALA A 216 ? 0.3846 0.5799 0.4871 0.2070  -0.0934 -0.0203 213 ALA A CA  
1597 C C   . ALA A 216 ? 0.4096 0.5673 0.4636 0.2106  -0.1041 -0.0117 213 ALA A C   
1598 O O   . ALA A 216 ? 0.4362 0.5973 0.4822 0.2243  -0.1249 -0.0110 213 ALA A O   
1599 C CB  . ALA A 216 ? 0.3978 0.5838 0.5039 0.2265  -0.0852 -0.0174 213 ALA A CB  
1600 N N   . GLN A 217 ? 0.4089 0.5306 0.4303 0.1988  -0.0896 -0.0054 214 GLN A N   
1601 C CA  . GLN A 217 ? 0.4365 0.5211 0.4120 0.2001  -0.0946 0.0030  214 GLN A CA  
1602 C C   . GLN A 217 ? 0.4274 0.5214 0.3960 0.1885  -0.1061 -0.0008 214 GLN A C   
1603 O O   . GLN A 217 ? 0.4568 0.5333 0.3945 0.1977  -0.1197 0.0033  214 GLN A O   
1604 C CB  . GLN A 217 ? 0.4382 0.4855 0.3879 0.1898  -0.0745 0.0100  214 GLN A CB  
1605 C CG  . GLN A 217 ? 0.4825 0.5027 0.4201 0.2043  -0.0667 0.0165  214 GLN A CG  
1606 C CD  . GLN A 217 ? 0.5336 0.5090 0.4345 0.1978  -0.0540 0.0259  214 GLN A CD  
1607 O OE1 . GLN A 217 ? 0.5510 0.5217 0.4471 0.1792  -0.0448 0.0254  214 GLN A OE1 
1608 N NE2 . GLN A 217 ? 0.5939 0.5358 0.4699 0.2132  -0.0532 0.0344  214 GLN A NE2 
1609 N N   . ILE A 218 ? 0.3894 0.5073 0.3829 0.1689  -0.1002 -0.0087 215 ILE A N   
1610 C CA  . ILE A 218 ? 0.3862 0.5120 0.3745 0.1571  -0.1108 -0.0139 215 ILE A CA  
1611 C C   . ILE A 218 ? 0.4022 0.5565 0.4074 0.1676  -0.1361 -0.0208 215 ILE A C   
1612 O O   . ILE A 218 ? 0.4080 0.5600 0.3973 0.1632  -0.1499 -0.0243 215 ILE A O   
1613 C CB  . ILE A 218 ? 0.3520 0.4933 0.3618 0.1336  -0.0984 -0.0204 215 ILE A CB  
1614 C CG1 . ILE A 218 ? 0.3314 0.5139 0.3913 0.1299  -0.0962 -0.0289 215 ILE A CG1 
1615 C CG2 . ILE A 218 ? 0.3474 0.4598 0.3376 0.1245  -0.0775 -0.0139 215 ILE A CG2 
1616 C CD1 . ILE A 218 ? 0.3051 0.4974 0.3816 0.1076  -0.0821 -0.0339 215 ILE A CD1 
1617 N N   . GLN A 219 ? 0.4029 0.5834 0.4401 0.1821  -0.1427 -0.0235 216 GLN A N   
1618 C CA  . GLN A 219 ? 0.4252 0.6343 0.4811 0.1955  -0.1692 -0.0299 216 GLN A CA  
1619 C C   . GLN A 219 ? 0.4692 0.6466 0.4771 0.2147  -0.1876 -0.0225 216 GLN A C   
1620 O O   . GLN A 219 ? 0.4868 0.6794 0.4959 0.2221  -0.2130 -0.0282 216 GLN A O   
1621 C CB  . GLN A 219 ? 0.4220 0.6651 0.5238 0.2096  -0.1698 -0.0334 216 GLN A CB  
1622 C CG  . GLN A 219 ? 0.3877 0.6672 0.5397 0.1922  -0.1536 -0.0419 216 GLN A CG  
1623 C CD  . GLN A 219 ? 0.3779 0.6911 0.5593 0.1750  -0.1656 -0.0532 216 GLN A CD  
1624 O OE1 . GLN A 219 ? 0.3543 0.6629 0.5334 0.1523  -0.1536 -0.0557 216 GLN A OE1 
1625 N NE2 . GLN A 219 ? 0.3792 0.7250 0.5876 0.1862  -0.1907 -0.0605 216 GLN A NE2 
1626 N N   . GLU A 220 ? 0.4887 0.6210 0.4538 0.2219  -0.1743 -0.0100 217 GLU A N   
1627 C CA  A GLU A 220 ? 0.5362 0.6298 0.4491 0.2405  -0.1860 -0.0002 217 GLU A CA  
1628 C CA  B GLU A 220 ? 0.5370 0.6314 0.4502 0.2405  -0.1868 -0.0005 217 GLU A CA  
1629 C C   . GLU A 220 ? 0.5509 0.6070 0.4152 0.2285  -0.1788 0.0048  217 GLU A C   
1630 O O   . GLU A 220 ? 0.5926 0.6097 0.4070 0.2412  -0.1825 0.0144  217 GLU A O   
1631 C CB  A GLU A 220 ? 0.5518 0.6170 0.4499 0.2570  -0.1740 0.0108  217 GLU A CB  
1632 C CB  B GLU A 220 ? 0.5561 0.6235 0.4546 0.2592  -0.1774 0.0104  217 GLU A CB  
1633 C CG  A GLU A 220 ? 0.5372 0.6355 0.4823 0.2696  -0.1758 0.0061  217 GLU A CG  
1634 C CG  B GLU A 220 ? 0.5550 0.6559 0.4953 0.2775  -0.1878 0.0058  217 GLU A CG  
1635 C CD  A GLU A 220 ? 0.5499 0.6150 0.4773 0.2850  -0.1626 0.0164  217 GLU A CD  
1636 C CD  B GLU A 220 ? 0.5677 0.6999 0.5232 0.2911  -0.2197 -0.0016 217 GLU A CD  
1637 O OE1 A GLU A 220 ? 0.5142 0.5580 0.4347 0.2718  -0.1388 0.0201  217 GLU A OE1 
1638 O OE1 B GLU A 220 ? 0.6106 0.7159 0.5231 0.3081  -0.2376 0.0046  217 GLU A OE1 
1639 O OE2 A GLU A 220 ? 0.5812 0.6407 0.5016 0.3107  -0.1770 0.0204  217 GLU A OE2 
1640 O OE2 B GLU A 220 ? 0.5490 0.7323 0.5592 0.2847  -0.2271 -0.0139 217 GLU A OE2 
1641 N N   . ASN A 221 ? 0.5185 0.5850 0.3962 0.2048  -0.1673 -0.0013 218 ASN A N   
1642 C CA  . ASN A 221 ? 0.5300 0.5649 0.3673 0.1930  -0.1585 0.0022  218 ASN A CA  
1643 C C   . ASN A 221 ? 0.4990 0.5589 0.3598 0.1715  -0.1595 -0.0096 218 ASN A C   
1644 O O   . ASN A 221 ? 0.4586 0.5311 0.3467 0.1548  -0.1423 -0.0123 218 ASN A O   
1645 C CB  . ASN A 221 ? 0.5244 0.5259 0.3431 0.1880  -0.1314 0.0132  218 ASN A CB  
1646 C CG  . ASN A 221 ? 0.5486 0.5243 0.3371 0.1736  -0.1178 0.0160  218 ASN A CG  
1647 O OD1 . ASN A 221 ? 0.6160 0.5912 0.3883 0.1693  -0.1277 0.0108  218 ASN A OD1 
1648 N ND2 . ASN A 221 ? 0.5623 0.5166 0.3446 0.1662  -0.0949 0.0235  218 ASN A ND2 
1649 N N   . ASP A 222 ? 0.5212 0.5854 0.3684 0.1725  -0.1805 -0.0167 219 ASP A N   
1650 C CA  . ASP A 222 ? 0.5054 0.5921 0.3742 0.1531  -0.1854 -0.0293 219 ASP A CA  
1651 C C   . ASP A 222 ? 0.4876 0.5529 0.3401 0.1347  -0.1638 -0.0277 219 ASP A C   
1652 O O   . ASP A 222 ? 0.4664 0.5511 0.3465 0.1166  -0.1596 -0.0363 219 ASP A O   
1653 C CB  . ASP A 222 ? 0.5430 0.6306 0.3915 0.1590  -0.2139 -0.0375 219 ASP A CB  
1654 C CG  . ASP A 222 ? 0.5654 0.6822 0.4379 0.1762  -0.2401 -0.0421 219 ASP A CG  
1655 O OD1 . ASP A 222 ? 0.5662 0.6963 0.4637 0.1869  -0.2346 -0.0369 219 ASP A OD1 
1656 O OD2 . ASP A 222 ? 0.6142 0.7397 0.4796 0.1801  -0.2672 -0.0513 219 ASP A OD2 
1657 N N   . GLU A 223 ? 0.5027 0.5280 0.3113 0.1397  -0.1501 -0.0167 220 GLU A N   
1658 C CA  A GLU A 223 ? 0.4886 0.4933 0.2810 0.1249  -0.1303 -0.0148 220 GLU A CA  
1659 C CA  B GLU A 223 ? 0.4913 0.4957 0.2835 0.1250  -0.1301 -0.0146 220 GLU A CA  
1660 C C   . GLU A 223 ? 0.4452 0.4616 0.2713 0.1133  -0.1093 -0.0125 220 GLU A C   
1661 O O   . GLU A 223 ? 0.4242 0.4454 0.2628 0.0973  -0.0991 -0.0168 220 GLU A O   
1662 C CB  A GLU A 223 ? 0.5225 0.4833 0.2609 0.1342  -0.1210 -0.0038 220 GLU A CB  
1663 C CB  B GLU A 223 ? 0.5264 0.4869 0.2653 0.1344  -0.1202 -0.0033 220 GLU A CB  
1664 C CG  A GLU A 223 ? 0.5671 0.5090 0.2616 0.1442  -0.1396 -0.0066 220 GLU A CG  
1665 C CG  B GLU A 223 ? 0.5810 0.5215 0.2755 0.1430  -0.1370 -0.0061 220 GLU A CG  
1666 C CD  A GLU A 223 ? 0.5859 0.5359 0.2761 0.1632  -0.1647 -0.0069 220 GLU A CD  
1667 C CD  B GLU A 223 ? 0.5850 0.5213 0.2706 0.1286  -0.1346 -0.0148 220 GLU A CD  
1668 O OE1 A GLU A 223 ? 0.6198 0.5680 0.2883 0.1692  -0.1875 -0.0141 220 GLU A OE1 
1669 O OE1 B GLU A 223 ? 0.5698 0.5160 0.2818 0.1130  -0.1182 -0.0166 220 GLU A OE1 
1670 O OE2 A GLU A 223 ? 0.5623 0.5197 0.2701 0.1729  -0.1629 -0.0005 220 GLU A OE2 
1671 O OE2 B GLU A 223 ? 0.6410 0.5620 0.2912 0.1335  -0.1494 -0.0199 220 GLU A OE2 
1672 N N   . ALA A 224 ? 0.4350 0.4533 0.2728 0.1224  -0.1039 -0.0060 221 ALA A N   
1673 C CA  . ALA A 224 ? 0.3970 0.4272 0.2660 0.1134  -0.0873 -0.0052 221 ALA A CA  
1674 C C   . ALA A 224 ? 0.3690 0.4367 0.2805 0.1022  -0.0922 -0.0161 221 ALA A C   
1675 O O   . ALA A 224 ? 0.3386 0.4118 0.2661 0.0876  -0.0790 -0.0184 221 ALA A O   
1676 C CB  . ALA A 224 ? 0.4013 0.4255 0.2729 0.1273  -0.0836 0.0021  221 ALA A CB  
1677 N N   . LYS A 225 ? 0.3835 0.4762 0.3129 0.1091  -0.1113 -0.0229 222 LYS A N   
1678 C CA  . LYS A 225 ? 0.3625 0.4937 0.3372 0.0986  -0.1154 -0.0334 222 LYS A CA  
1679 C C   . LYS A 225 ? 0.3537 0.4861 0.3308 0.0787  -0.1121 -0.0403 222 LYS A C   
1680 O O   . LYS A 225 ? 0.3303 0.4769 0.3343 0.0650  -0.0998 -0.0434 222 LYS A O   
1681 C CB  . LYS A 225 ? 0.3810 0.5398 0.3754 0.1099  -0.1392 -0.0401 222 LYS A CB  
1682 C CG  . LYS A 225 ? 0.3647 0.5677 0.4141 0.0996  -0.1409 -0.0505 222 LYS A CG  
1683 C CD  . LYS A 225 ? 0.3883 0.6235 0.4662 0.1145  -0.1622 -0.0559 222 LYS A CD  
1684 C CE  . LYS A 225 ? 0.3756 0.6561 0.5134 0.1043  -0.1579 -0.0650 222 LYS A CE  
1685 N NZ  . LYS A 225 ? 0.3738 0.6916 0.5476 0.1193  -0.1785 -0.0711 222 LYS A NZ  
1686 N N   . ILE A 226 ? 0.3763 0.4908 0.3225 0.0778  -0.1225 -0.0425 223 ILE A N   
1687 C CA  . ILE A 226 ? 0.3703 0.4801 0.3133 0.0603  -0.1201 -0.0494 223 ILE A CA  
1688 C C   . ILE A 226 ? 0.3597 0.4427 0.2830 0.0528  -0.0981 -0.0425 223 ILE A C   
1689 O O   . ILE A 226 ? 0.3488 0.4310 0.2789 0.0379  -0.0907 -0.0469 223 ILE A O   
1690 C CB  . ILE A 226 ? 0.4076 0.5059 0.3219 0.0630  -0.1403 -0.0560 223 ILE A CB  
1691 C CG1 . ILE A 226 ? 0.4060 0.5030 0.3233 0.0443  -0.1403 -0.0658 223 ILE A CG1 
1692 C CG2 . ILE A 226 ? 0.4311 0.4911 0.2931 0.0761  -0.1373 -0.0467 223 ILE A CG2 
1693 C CD1 . ILE A 226 ? 0.3828 0.5135 0.3508 0.0283  -0.1384 -0.0739 223 ILE A CD1 
1694 N N   . GLY A 227 ? 0.3575 0.4185 0.2580 0.0630  -0.0880 -0.0319 224 GLY A N   
1695 C CA  . GLY A 227 ? 0.3401 0.3816 0.2307 0.0566  -0.0677 -0.0256 224 GLY A CA  
1696 C C   . GLY A 227 ? 0.3008 0.3587 0.2235 0.0452  -0.0559 -0.0272 224 GLY A C   
1697 O O   . GLY A 227 ? 0.2822 0.3302 0.2022 0.0356  -0.0444 -0.0266 224 GLY A O   
1698 N N   . GLY A 228 ? 0.2887 0.3710 0.2406 0.0475  -0.0588 -0.0293 225 GLY A N   
1699 C CA  . GLY A 228 ? 0.2597 0.3557 0.2381 0.0381  -0.0468 -0.0307 225 GLY A CA  
1700 C C   . GLY A 228 ? 0.2488 0.3298 0.2202 0.0417  -0.0327 -0.0229 225 GLY A C   
1701 O O   . GLY A 228 ? 0.2565 0.3228 0.2113 0.0526  -0.0329 -0.0167 225 GLY A O   
1702 N N   . MET A 229 ? 0.2318 0.3151 0.2149 0.0322  -0.0209 -0.0235 226 MET A N   
1703 C CA  . MET A 229 ? 0.2247 0.2965 0.2045 0.0346  -0.0096 -0.0182 226 MET A CA  
1704 C C   . MET A 229 ? 0.2113 0.2725 0.1866 0.0237  0.0000  -0.0177 226 MET A C   
1705 O O   . MET A 229 ? 0.1980 0.2670 0.1825 0.0140  0.0020  -0.0219 226 MET A O   
1706 C CB  . MET A 229 ? 0.2164 0.3049 0.2173 0.0388  -0.0062 -0.0200 226 MET A CB  
1707 C CG  . MET A 229 ? 0.2341 0.3350 0.2435 0.0520  -0.0157 -0.0205 226 MET A CG  
1708 S SD  . MET A 229 ? 0.2293 0.3430 0.2595 0.0592  -0.0071 -0.0217 226 MET A SD  
1709 C CE  . MET A 229 ? 0.2283 0.3573 0.2688 0.0770  -0.0214 -0.0223 226 MET A CE  
1710 N N   . ILE A 230 ? 0.2104 0.2532 0.1722 0.0257  0.0057  -0.0126 227 ILE A N   
1711 C CA  . ILE A 230 ? 0.2016 0.2351 0.1608 0.0184  0.0134  -0.0118 227 ILE A CA  
1712 C C   . ILE A 230 ? 0.2002 0.2298 0.1624 0.0221  0.0183  -0.0100 227 ILE A C   
1713 O O   . ILE A 230 ? 0.2099 0.2302 0.1666 0.0286  0.0183  -0.0065 227 ILE A O   
1714 C CB  . ILE A 230 ? 0.2081 0.2258 0.1528 0.0169  0.0148  -0.0090 227 ILE A CB  
1715 C CG1 . ILE A 230 ? 0.2253 0.2445 0.1646 0.0127  0.0101  -0.0126 227 ILE A CG1 
1716 C CG2 . ILE A 230 ? 0.1887 0.1980 0.1334 0.0122  0.0210  -0.0078 227 ILE A CG2 
1717 C CD1 . ILE A 230 ? 0.2526 0.2586 0.1741 0.0169  0.0089  -0.0104 227 ILE A CD1 
1718 N N   . ILE A 231 ? 0.1945 0.2288 0.1632 0.0177  0.0230  -0.0125 228 ILE A N   
1719 C CA  . ILE A 231 ? 0.1946 0.2254 0.1643 0.0214  0.0274  -0.0128 228 ILE A CA  
1720 C C   . ILE A 231 ? 0.2009 0.2181 0.1615 0.0166  0.0307  -0.0123 228 ILE A C   
1721 O O   . ILE A 231 ? 0.2133 0.2302 0.1713 0.0104  0.0335  -0.0135 228 ILE A O   
1722 C CB  . ILE A 231 ? 0.1922 0.2391 0.1748 0.0226  0.0312  -0.0166 228 ILE A CB  
1723 C CG1 . ILE A 231 ? 0.1913 0.2562 0.1875 0.0274  0.0250  -0.0181 228 ILE A CG1 
1724 C CG2 . ILE A 231 ? 0.1763 0.2171 0.1567 0.0292  0.0357  -0.0174 228 ILE A CG2 
1725 C CD1 . ILE A 231 ? 0.1704 0.2577 0.1874 0.0264  0.0290  -0.0227 228 ILE A CD1 
1726 N N   . ASN A 232 ? 0.2048 0.2097 0.1603 0.0195  0.0297  -0.0107 229 ASN A N   
1727 C CA  . ASN A 232 ? 0.2049 0.1982 0.1539 0.0161  0.0295  -0.0110 229 ASN A CA  
1728 C C   . ASN A 232 ? 0.2212 0.2087 0.1648 0.0186  0.0317  -0.0144 229 ASN A C   
1729 O O   . ASN A 232 ? 0.2270 0.2118 0.1721 0.0241  0.0322  -0.0152 229 ASN A O   
1730 C CB  . ASN A 232 ? 0.2023 0.1872 0.1528 0.0165  0.0270  -0.0084 229 ASN A CB  
1731 C CG  . ASN A 232 ? 0.2058 0.1825 0.1547 0.0132  0.0242  -0.0097 229 ASN A CG  
1732 O OD1 . ASN A 232 ? 0.2083 0.1852 0.1542 0.0104  0.0230  -0.0097 229 ASN A OD1 
1733 N ND2 . ASN A 232 ? 0.2039 0.1721 0.1548 0.0138  0.0221  -0.0111 229 ASN A ND2 
1734 N N   . THR A 233 ? 0.2266 0.2094 0.1608 0.0156  0.0336  -0.0161 230 THR A N   
1735 C CA  . THR A 233 ? 0.2441 0.2165 0.1666 0.0184  0.0356  -0.0198 230 THR A CA  
1736 C C   . THR A 233 ? 0.2526 0.2097 0.1649 0.0172  0.0282  -0.0212 230 THR A C   
1737 O O   . THR A 233 ? 0.2419 0.1989 0.1586 0.0141  0.0227  -0.0191 230 THR A O   
1738 C CB  . THR A 233 ? 0.2518 0.2248 0.1648 0.0167  0.0437  -0.0209 230 THR A CB  
1739 O OG1 . THR A 233 ? 0.2486 0.2160 0.1533 0.0113  0.0421  -0.0184 230 THR A OG1 
1740 C CG2 . THR A 233 ? 0.2377 0.2295 0.1662 0.0173  0.0511  -0.0209 230 THR A CG2 
1741 N N   . CYS A 234 ? 0.2736 0.2180 0.1727 0.0202  0.0277  -0.0256 231 CYS A N   
1742 C CA  . CYS A 234 ? 0.2887 0.2185 0.1766 0.0191  0.0182  -0.0287 231 CYS A CA  
1743 C C   . CYS A 234 ? 0.2917 0.2139 0.1606 0.0182  0.0176  -0.0280 231 CYS A C   
1744 O O   . CYS A 234 ? 0.2777 0.2038 0.1411 0.0175  0.0269  -0.0254 231 CYS A O   
1745 C CB  . CYS A 234 ? 0.3085 0.2238 0.1863 0.0227  0.0164  -0.0348 231 CYS A CB  
1746 S SG  . CYS A 234 ? 0.3768 0.2799 0.2275 0.0283  0.0256  -0.0389 231 CYS A SG  
1747 N N   . GLY A 235 ? 0.3026 0.2141 0.1627 0.0181  0.0060  -0.0301 232 GLY A N   
1748 C CA  . GLY A 235 ? 0.3204 0.2206 0.1587 0.0191  0.0030  -0.0287 232 GLY A CA  
1749 C C   . GLY A 235 ? 0.3528 0.2341 0.1583 0.0229  0.0076  -0.0316 232 GLY A C   
1750 O O   . GLY A 235 ? 0.3803 0.2464 0.1610 0.0250  0.0041  -0.0304 232 GLY A O   
1751 N N   . TRP A 236 ? 0.3583 0.2380 0.1607 0.0252  0.0162  -0.0352 233 TRP A N   
1752 C CA  . TRP A 236 ? 0.3942 0.2545 0.1632 0.0297  0.0232  -0.0383 233 TRP A CA  
1753 C C   . TRP A 236 ? 0.3963 0.2607 0.1596 0.0282  0.0408  -0.0329 233 TRP A C   
1754 O O   . TRP A 236 ? 0.3961 0.2760 0.1769 0.0276  0.0537  -0.0324 233 TRP A O   
1755 C CB  . TRP A 236 ? 0.4014 0.2562 0.1682 0.0340  0.0265  -0.0451 233 TRP A CB  
1756 C CG  . TRP A 236 ? 0.4412 0.2712 0.1690 0.0399  0.0319  -0.0500 233 TRP A CG  
1757 C CD1 . TRP A 236 ? 0.4602 0.2684 0.1519 0.0420  0.0279  -0.0500 233 TRP A CD1 
1758 C CD2 . TRP A 236 ? 0.4500 0.2719 0.1678 0.0460  0.0428  -0.0557 233 TRP A CD2 
1759 N NE1 . TRP A 236 ? 0.4891 0.2753 0.1466 0.0484  0.0365  -0.0552 233 TRP A NE1 
1760 C CE2 . TRP A 236 ? 0.4881 0.2826 0.1619 0.0510  0.0462  -0.0592 233 TRP A CE2 
1761 C CE3 . TRP A 236 ? 0.4449 0.2781 0.1845 0.0490  0.0501  -0.0579 233 TRP A CE3 
1762 C CZ2 . TRP A 236 ? 0.5117 0.2903 0.1632 0.0586  0.0579  -0.0656 233 TRP A CZ2 
1763 C CZ3 . TRP A 236 ? 0.4699 0.2884 0.1902 0.0572  0.0610  -0.0641 233 TRP A CZ3 
1764 C CH2 . TRP A 236 ? 0.5253 0.3170 0.2022 0.0617  0.0655  -0.0682 233 TRP A CH2 
1765 N N   . VAL A 237 ? 0.4161 0.2666 0.1564 0.0275  0.0409  -0.0289 234 VAL A N   
1766 C CA  . VAL A 237 ? 0.4191 0.2715 0.1554 0.0235  0.0581  -0.0231 234 VAL A CA  
1767 C C   . VAL A 237 ? 0.4722 0.3000 0.1685 0.0271  0.0711  -0.0230 234 VAL A C   
1768 O O   . VAL A 237 ? 0.4790 0.3097 0.1749 0.0233  0.0902  -0.0193 234 VAL A O   
1769 C CB  . VAL A 237 ? 0.4100 0.2629 0.1507 0.0189  0.0526  -0.0168 234 VAL A CB  
1770 C CG1 . VAL A 237 ? 0.3517 0.2284 0.1304 0.0158  0.0435  -0.0168 234 VAL A CG1 
1771 C CG2 . VAL A 237 ? 0.4305 0.2575 0.1384 0.0240  0.0390  -0.0157 234 VAL A CG2 
1772 N N   . ASP A 238 ? 0.5089 0.3125 0.1720 0.0340  0.0611  -0.0276 235 ASP A N   
1773 C CA  . ASP A 238 ? 0.5652 0.3401 0.1824 0.0390  0.0728  -0.0278 235 ASP A CA  
1774 C C   . ASP A 238 ? 0.5740 0.3490 0.1875 0.0435  0.0871  -0.0341 235 ASP A C   
1775 O O   . ASP A 238 ? 0.5389 0.3294 0.1784 0.0449  0.0819  -0.0398 235 ASP A O   
1776 C CB  . ASP A 238 ? 0.6051 0.3502 0.1821 0.0458  0.0529  -0.0305 235 ASP A CB  
1777 C CG  . ASP A 238 ? 0.6309 0.3700 0.2027 0.0445  0.0414  -0.0235 235 ASP A CG  
1778 O OD1 . ASP A 238 ? 0.6486 0.3946 0.2309 0.0386  0.0547  -0.0157 235 ASP A OD1 
1779 O OD2 . ASP A 238 ? 0.6922 0.4199 0.2512 0.0495  0.0185  -0.0264 235 ASP A OD2 
1780 N N   . GLY A 239 ? 0.6208 0.3755 0.1995 0.0465  0.1063  -0.0327 236 GLY A N   
1781 C CA  . GLY A 239 ? 0.6452 0.3951 0.2134 0.0530  0.1226  -0.0389 236 GLY A CA  
1782 C C   . GLY A 239 ? 0.6086 0.3945 0.2279 0.0511  0.1313  -0.0410 236 GLY A C   
1783 O O   . GLY A 239 ? 0.5853 0.3969 0.2377 0.0439  0.1426  -0.0354 236 GLY A O   
1784 N N   . GLU A 240 ? 0.6114 0.3977 0.2368 0.0576  0.1238  -0.0491 237 GLU A N   
1785 C CA  A GLU A 240 ? 0.5834 0.3989 0.2514 0.0593  0.1313  -0.0515 237 GLU A CA  
1786 C CA  B GLU A 240 ? 0.5812 0.3970 0.2494 0.0593  0.1313  -0.0514 237 GLU A CA  
1787 C C   . GLU A 240 ? 0.5355 0.3798 0.2481 0.0524  0.1172  -0.0478 237 GLU A C   
1788 O O   . GLU A 240 ? 0.5150 0.3859 0.2644 0.0531  0.1224  -0.0477 237 GLU A O   
1789 C CB  A GLU A 240 ? 0.6059 0.4059 0.2605 0.0695  0.1277  -0.0611 237 GLU A CB  
1790 C CB  B GLU A 240 ? 0.6016 0.4024 0.2573 0.0694  0.1279  -0.0610 237 GLU A CB  
1791 C CG  A GLU A 240 ? 0.6611 0.4322 0.2705 0.0783  0.1447  -0.0660 237 GLU A CG  
1792 C CG  B GLU A 240 ? 0.6457 0.4210 0.2608 0.0784  0.1468  -0.0658 237 GLU A CG  
1793 C CD  A GLU A 240 ? 0.7026 0.4459 0.2847 0.0871  0.1339  -0.0769 237 GLU A CD  
1794 C CD  B GLU A 240 ? 0.6428 0.4409 0.2809 0.0810  0.1753  -0.0637 237 GLU A CD  
1795 O OE1 A GLU A 240 ? 0.6873 0.4363 0.2909 0.0856  0.1153  -0.0803 237 GLU A OE1 
1796 O OE1 B GLU A 240 ? 0.5891 0.4224 0.2766 0.0789  0.1765  -0.0615 237 GLU A OE1 
1797 O OE2 A GLU A 240 ? 0.7606 0.4739 0.2978 0.0951  0.1446  -0.0823 237 GLU A OE2 
1798 O OE2 B GLU A 240 ? 0.6853 0.4659 0.2918 0.0855  0.1965  -0.0643 237 GLU A OE2 
1799 N N   . GLY A 241 ? 0.5244 0.3626 0.2325 0.0469  0.0991  -0.0449 238 GLY A N   
1800 C CA  . GLY A 241 ? 0.4804 0.3423 0.2252 0.0403  0.0877  -0.0408 238 GLY A CA  
1801 C C   . GLY A 241 ? 0.4640 0.3466 0.2297 0.0333  0.1004  -0.0343 238 GLY A C   
1802 O O   . GLY A 241 ? 0.4330 0.3409 0.2338 0.0299  0.0984  -0.0325 238 GLY A O   
1803 N N   . TYR A 242 ? 0.4927 0.3622 0.2348 0.0309  0.1135  -0.0309 239 TYR A N   
1804 C CA  . TYR A 242 ? 0.4790 0.3653 0.2401 0.0223  0.1277  -0.0253 239 TYR A CA  
1805 C C   . TYR A 242 ? 0.4679 0.3843 0.2655 0.0228  0.1415  -0.0277 239 TYR A C   
1806 O O   . TYR A 242 ? 0.4350 0.3773 0.2673 0.0162  0.1416  -0.0258 239 TYR A O   
1807 C CB  . TYR A 242 ? 0.5103 0.3716 0.2348 0.0200  0.1428  -0.0210 239 TYR A CB  
1808 C CG  . TYR A 242 ? 0.4858 0.3627 0.2314 0.0093  0.1598  -0.0158 239 TYR A CG  
1809 C CD1 . TYR A 242 ? 0.4398 0.3236 0.2011 0.0004  0.1512  -0.0114 239 TYR A CD1 
1810 C CD2 . TYR A 242 ? 0.4802 0.3656 0.2328 0.0077  0.1850  -0.0162 239 TYR A CD2 
1811 C CE1 . TYR A 242 ? 0.4255 0.3222 0.2071 -0.0108 0.1655  -0.0078 239 TYR A CE1 
1812 C CE2 . TYR A 242 ? 0.4754 0.3773 0.2527 -0.0043 0.2004  -0.0122 239 TYR A CE2 
1813 C CZ  . TYR A 242 ? 0.4376 0.3442 0.2289 -0.0141 0.1897  -0.0084 239 TYR A CZ  
1814 O OH  . TYR A 242 ? 0.4171 0.3375 0.2326 -0.0276 0.2037  -0.0055 239 TYR A OH  
1815 N N   . LYS A 243 ? 0.5005 0.4130 0.2899 0.0315  0.1527  -0.0326 240 LYS A N   
1816 C CA  . LYS A 243 ? 0.4980 0.4406 0.3240 0.0344  0.1654  -0.0353 240 LYS A CA  
1817 C C   . LYS A 243 ? 0.4662 0.4307 0.3256 0.0379  0.1494  -0.0374 240 LYS A C   
1818 O O   . LYS A 243 ? 0.4512 0.4462 0.3480 0.0377  0.1542  -0.0378 240 LYS A O   
1819 C CB  . LYS A 243 ? 0.5379 0.4699 0.3464 0.0448  0.1834  -0.0402 240 LYS A CB  
1820 C CG  . LYS A 243 ? 0.5868 0.5082 0.3751 0.0404  0.2079  -0.0371 240 LYS A CG  
1821 C CD  . LYS A 243 ? 0.6315 0.5730 0.4416 0.0459  0.2331  -0.0405 240 LYS A CD  
1822 C CE  . LYS A 243 ? 0.6780 0.6118 0.4740 0.0382  0.2600  -0.0359 240 LYS A CE  
1823 N NZ  . LYS A 243 ? 0.7265 0.6688 0.5288 0.0461  0.2887  -0.0397 240 LYS A NZ  
1824 N N   . CYS A 244 ? 0.4633 0.4122 0.3095 0.0411  0.1307  -0.0386 241 CYS A N   
1825 C CA  . CYS A 244 ? 0.4397 0.4046 0.3131 0.0432  0.1162  -0.0388 241 CYS A CA  
1826 C C   . CYS A 244 ? 0.3972 0.3847 0.2972 0.0338  0.1117  -0.0342 241 CYS A C   
1827 O O   . CYS A 244 ? 0.3752 0.3866 0.3053 0.0356  0.1090  -0.0343 241 CYS A O   
1828 C CB  . CYS A 244 ? 0.4415 0.3854 0.2980 0.0445  0.0982  -0.0400 241 CYS A CB  
1829 S SG  . CYS A 244 ? 0.5291 0.4489 0.3643 0.0558  0.0968  -0.0475 241 CYS A SG  
1830 N N   . ILE A 245 ? 0.3911 0.3682 0.2769 0.0247  0.1097  -0.0303 242 ILE A N   
1831 C CA  . ILE A 245 ? 0.3586 0.3507 0.2635 0.0152  0.1056  -0.0265 242 ILE A CA  
1832 C C   . ILE A 245 ? 0.3434 0.3630 0.2782 0.0109  0.1180  -0.0273 242 ILE A C   
1833 O O   . ILE A 245 ? 0.3209 0.3626 0.2835 0.0087  0.1108  -0.0275 242 ILE A O   
1834 C CB  . ILE A 245 ? 0.3705 0.3413 0.2502 0.0078  0.1040  -0.0224 242 ILE A CB  
1835 C CG1 . ILE A 245 ? 0.3749 0.3267 0.2360 0.0116  0.0876  -0.0223 242 ILE A CG1 
1836 C CG2 . ILE A 245 ? 0.3407 0.3237 0.2377 -0.0023 0.1034  -0.0193 242 ILE A CG2 
1837 C CD1 . ILE A 245 ? 0.3932 0.3236 0.2292 0.0075  0.0835  -0.0184 242 ILE A CD1 
1838 N N   . VAL A 246 ? 0.3526 0.3705 0.2816 0.0101  0.1366  -0.0280 243 VAL A N   
1839 C CA  . VAL A 246 ? 0.3443 0.3902 0.3057 0.0048  0.1509  -0.0292 243 VAL A CA  
1840 C C   . VAL A 246 ? 0.3238 0.3990 0.3196 0.0142  0.1474  -0.0337 243 VAL A C   
1841 O O   . VAL A 246 ? 0.3004 0.4051 0.3319 0.0099  0.1450  -0.0351 243 VAL A O   
1842 C CB  . VAL A 246 ? 0.3768 0.4127 0.3230 0.0032  0.1753  -0.0288 243 VAL A CB  
1843 C CG1 . VAL A 246 ? 0.3555 0.4263 0.3435 0.0003  0.1918  -0.0317 243 VAL A CG1 
1844 C CG2 . VAL A 246 ? 0.3900 0.3996 0.3064 -0.0076 0.1803  -0.0231 243 VAL A CG2 
1845 N N   . LYS A 247 ? 0.3305 0.3956 0.3139 0.0275  0.1461  -0.0362 244 LYS A N   
1846 C CA  . LYS A 247 ? 0.3199 0.4065 0.3302 0.0395  0.1418  -0.0398 244 LYS A CA  
1847 C C   . LYS A 247 ? 0.2892 0.3830 0.3113 0.0410  0.1204  -0.0384 244 LYS A C   
1848 O O   . LYS A 247 ? 0.2792 0.3981 0.3308 0.0473  0.1153  -0.0401 244 LYS A O   
1849 C CB  . LYS A 247 ? 0.3492 0.4162 0.3379 0.0533  0.1470  -0.0431 244 LYS A CB  
1850 C CG  . LYS A 247 ? 0.3886 0.4529 0.3695 0.0559  0.1709  -0.0457 244 LYS A CG  
1851 C CD  . LYS A 247 ? 0.4332 0.4717 0.3855 0.0698  0.1746  -0.0500 244 LYS A CD  
1852 C CE  . LYS A 247 ? 0.4837 0.5193 0.4271 0.0747  0.2010  -0.0531 244 LYS A CE  
1853 N NZ  . LYS A 247 ? 0.5043 0.5647 0.4798 0.0889  0.2106  -0.0578 244 LYS A NZ  
1854 N N   . ALA A 248 ? 0.2776 0.3493 0.2765 0.0363  0.1082  -0.0351 245 ALA A N   
1855 C CA  . ALA A 248 ? 0.2568 0.3336 0.2643 0.0360  0.0910  -0.0329 245 ALA A CA  
1856 C C   . ALA A 248 ? 0.2385 0.3393 0.2706 0.0266  0.0882  -0.0327 245 ALA A C   
1857 O O   . ALA A 248 ? 0.2241 0.3431 0.2764 0.0306  0.0781  -0.0335 245 ALA A O   
1858 C CB  . ALA A 248 ? 0.2497 0.3000 0.2306 0.0323  0.0814  -0.0299 245 ALA A CB  
1859 N N   . ALA A 249 ? 0.2429 0.3410 0.2711 0.0143  0.0965  -0.0318 246 ALA A N   
1860 C CA  . ALA A 249 ? 0.2359 0.3540 0.2871 0.0030  0.0953  -0.0327 246 ALA A CA  
1861 C C   . ALA A 249 ? 0.2276 0.3809 0.3175 0.0065  0.0978  -0.0374 246 ALA A C   
1862 O O   . ALA A 249 ? 0.2212 0.3944 0.3331 0.0051  0.0856  -0.0395 246 ALA A O   
1863 C CB  . ALA A 249 ? 0.2473 0.3533 0.2868 -0.0102 0.1082  -0.0309 246 ALA A CB  
1864 N N   . SER A 250 ? 0.2383 0.3989 0.3359 0.0121  0.1133  -0.0393 247 SER A N   
1865 C CA  . SER A 250 ? 0.2415 0.4381 0.3797 0.0182  0.1175  -0.0441 247 SER A CA  
1866 C C   . SER A 250 ? 0.2320 0.4400 0.3818 0.0341  0.1006  -0.0454 247 SER A C   
1867 O O   . SER A 250 ? 0.2323 0.4691 0.4136 0.0350  0.0898  -0.0485 247 SER A O   
1868 C CB  . SER A 250 ? 0.2590 0.4558 0.3973 0.0230  0.1403  -0.0456 247 SER A CB  
1869 O OG  . SER A 250 ? 0.2831 0.5121 0.4583 0.0347  0.1432  -0.0502 247 SER A OG  
1870 N N   . ALA A 251 ? 0.2332 0.4170 0.3564 0.0464  0.0977  -0.0433 248 ALA A N   
1871 C CA  . ALA A 251 ? 0.2346 0.4223 0.3633 0.0627  0.0843  -0.0433 248 ALA A CA  
1872 C C   . ALA A 251 ? 0.2224 0.4146 0.3538 0.0614  0.0636  -0.0414 248 ALA A C   
1873 O O   . ALA A 251 ? 0.2205 0.4306 0.3706 0.0727  0.0523  -0.0427 248 ALA A O   
1874 C CB  . ALA A 251 ? 0.2453 0.3991 0.3405 0.0723  0.0857  -0.0412 248 ALA A CB  
1875 N N   . PHE A 252 ? 0.2181 0.3922 0.3285 0.0492  0.0587  -0.0384 249 PHE A N   
1876 C CA  . PHE A 252 ? 0.2101 0.3836 0.3168 0.0472  0.0415  -0.0367 249 PHE A CA  
1877 C C   . PHE A 252 ? 0.2038 0.4007 0.3334 0.0347  0.0371  -0.0406 249 PHE A C   
1878 O O   . PHE A 252 ? 0.1994 0.3956 0.3246 0.0324  0.0228  -0.0406 249 PHE A O   
1879 C CB  . PHE A 252 ? 0.2106 0.3513 0.2831 0.0423  0.0391  -0.0317 249 PHE A CB  
1880 C CG  . PHE A 252 ? 0.2244 0.3426 0.2771 0.0538  0.0381  -0.0282 249 PHE A CG  
1881 C CD1 . PHE A 252 ? 0.2402 0.3517 0.2860 0.0633  0.0265  -0.0251 249 PHE A CD1 
1882 C CD2 . PHE A 252 ? 0.2277 0.3291 0.2668 0.0549  0.0488  -0.0284 249 PHE A CD2 
1883 C CE1 . PHE A 252 ? 0.2505 0.3388 0.2787 0.0725  0.0270  -0.0217 249 PHE A CE1 
1884 C CE2 . PHE A 252 ? 0.2491 0.3286 0.2713 0.0640  0.0473  -0.0264 249 PHE A CE2 
1885 C CZ  . PHE A 252 ? 0.2589 0.3318 0.2771 0.0721  0.0369  -0.0228 249 PHE A CZ  
1886 N N   . GLU A 253 ? 0.2059 0.4216 0.3587 0.0264  0.0502  -0.0444 250 GLU A N   
1887 C CA  . GLU A 253 ? 0.2073 0.4464 0.3870 0.0124  0.0483  -0.0492 250 GLU A CA  
1888 C C   . GLU A 253 ? 0.2026 0.4211 0.3596 0.0003  0.0404  -0.0475 250 GLU A C   
1889 O O   . GLU A 253 ? 0.1975 0.4260 0.3631 -0.0031 0.0255  -0.0509 250 GLU A O   
1890 C CB  . GLU A 253 ? 0.2092 0.4830 0.4241 0.0203  0.0335  -0.0546 250 GLU A CB  
1891 C CG  . GLU A 253 ? 0.2317 0.5296 0.4743 0.0344  0.0405  -0.0569 250 GLU A CG  
1892 C CD  . GLU A 253 ? 0.2601 0.5881 0.5318 0.0466  0.0208  -0.0613 250 GLU A CD  
1893 O OE1 . GLU A 253 ? 0.2866 0.6516 0.6013 0.0404  0.0189  -0.0682 250 GLU A OE1 
1894 O OE2 . GLU A 253 ? 0.2860 0.5999 0.5372 0.0618  0.0065  -0.0578 250 GLU A OE2 
1895 N N   . VAL A 254 ? 0.2043 0.3930 0.3309 -0.0049 0.0497  -0.0427 251 VAL A N   
1896 C CA  . VAL A 254 ? 0.2086 0.3752 0.3120 -0.0139 0.0438  -0.0407 251 VAL A CA  
1897 C C   . VAL A 254 ? 0.2188 0.3940 0.3373 -0.0309 0.0464  -0.0448 251 VAL A C   
1898 O O   . VAL A 254 ? 0.2195 0.4085 0.3585 -0.0389 0.0598  -0.0469 251 VAL A O   
1899 C CB  . VAL A 254 ? 0.2178 0.3520 0.2875 -0.0135 0.0516  -0.0347 251 VAL A CB  
1900 C CG1 . VAL A 254 ? 0.2010 0.3258 0.2578 0.0010  0.0483  -0.0317 251 VAL A CG1 
1901 C CG2 . VAL A 254 ? 0.2181 0.3466 0.2855 -0.0212 0.0696  -0.0339 251 VAL A CG2 
1902 N N   . ASP A 255 ? 0.2307 0.3961 0.3384 -0.0362 0.0343  -0.0461 252 ASP A N   
1903 C CA  . ASP A 255 ? 0.2477 0.4139 0.3640 -0.0529 0.0343  -0.0505 252 ASP A CA  
1904 C C   . ASP A 255 ? 0.2522 0.3860 0.3398 -0.0608 0.0446  -0.0456 252 ASP A C   
1905 O O   . ASP A 255 ? 0.2732 0.4022 0.3656 -0.0754 0.0522  -0.0474 252 ASP A O   
1906 C CB  . ASP A 255 ? 0.2605 0.4265 0.3724 -0.0530 0.0150  -0.0551 252 ASP A CB  
1907 C CG  . ASP A 255 ? 0.2734 0.4684 0.4089 -0.0440 0.0003  -0.0600 252 ASP A CG  
1908 O OD1 . ASP A 255 ? 0.3107 0.5348 0.4823 -0.0512 -0.0004 -0.0666 252 ASP A OD1 
1909 O OD2 . ASP A 255 ? 0.2942 0.4824 0.4127 -0.0295 -0.0102 -0.0572 252 ASP A OD2 
1910 N N   . VAL A 256 ? 0.2437 0.3545 0.3021 -0.0511 0.0435  -0.0397 253 VAL A N   
1911 C CA  . VAL A 256 ? 0.2445 0.3246 0.2748 -0.0553 0.0489  -0.0352 253 VAL A CA  
1912 C C   . VAL A 256 ? 0.2380 0.3032 0.2490 -0.0457 0.0552  -0.0290 253 VAL A C   
1913 O O   . VAL A 256 ? 0.2127 0.2821 0.2222 -0.0342 0.0496  -0.0278 253 VAL A O   
1914 C CB  . VAL A 256 ? 0.2466 0.3118 0.2601 -0.0539 0.0369  -0.0359 253 VAL A CB  
1915 C CG1 . VAL A 256 ? 0.2604 0.2953 0.2478 -0.0561 0.0424  -0.0312 253 VAL A CG1 
1916 C CG2 . VAL A 256 ? 0.2453 0.3209 0.2729 -0.0635 0.0286  -0.0433 253 VAL A CG2 
1917 N N   . VAL A 257 ? 0.2423 0.2885 0.2376 -0.0507 0.0663  -0.0254 254 VAL A N   
1918 C CA  . VAL A 257 ? 0.2411 0.2682 0.2130 -0.0426 0.0693  -0.0204 254 VAL A CA  
1919 C C   . VAL A 257 ? 0.2423 0.2427 0.1906 -0.0443 0.0669  -0.0168 254 VAL A C   
1920 O O   . VAL A 257 ? 0.2499 0.2376 0.1918 -0.0537 0.0728  -0.0161 254 VAL A O   
1921 C CB  . VAL A 257 ? 0.2618 0.2865 0.2296 -0.0435 0.0841  -0.0188 254 VAL A CB  
1922 C CG1 . VAL A 257 ? 0.2584 0.2597 0.1973 -0.0351 0.0839  -0.0147 254 VAL A CG1 
1923 C CG2 . VAL A 257 ? 0.2354 0.2879 0.2290 -0.0395 0.0878  -0.0227 254 VAL A CG2 
1924 N N   . ILE A 258 ? 0.2292 0.2213 0.1664 -0.0351 0.0585  -0.0148 255 ILE A N   
1925 C CA  . ILE A 258 ? 0.2300 0.1995 0.1477 -0.0333 0.0553  -0.0114 255 ILE A CA  
1926 C C   . ILE A 258 ? 0.2355 0.1919 0.1366 -0.0269 0.0566  -0.0081 255 ILE A C   
1927 O O   . ILE A 258 ? 0.2224 0.1850 0.1263 -0.0196 0.0523  -0.0086 255 ILE A O   
1928 C CB  . ILE A 258 ? 0.2205 0.1914 0.1405 -0.0275 0.0455  -0.0119 255 ILE A CB  
1929 C CG1 . ILE A 258 ? 0.2251 0.2068 0.1564 -0.0323 0.0421  -0.0161 255 ILE A CG1 
1930 C CG2 . ILE A 258 ? 0.2088 0.1591 0.1128 -0.0241 0.0431  -0.0088 255 ILE A CG2 
1931 C CD1 . ILE A 258 ? 0.2435 0.2191 0.1746 -0.0437 0.0464  -0.0185 255 ILE A CD1 
1932 N N   . VAL A 259 ? 0.2579 0.1936 0.1395 -0.0295 0.0620  -0.0048 256 VAL A N   
1933 C CA  . VAL A 259 ? 0.2724 0.1913 0.1324 -0.0226 0.0609  -0.0019 256 VAL A CA  
1934 C C   . VAL A 259 ? 0.2850 0.1885 0.1338 -0.0169 0.0513  0.0006  256 VAL A C   
1935 O O   . VAL A 259 ? 0.3004 0.1905 0.1419 -0.0201 0.0529  0.0025  256 VAL A O   
1936 C CB  . VAL A 259 ? 0.3011 0.2029 0.1409 -0.0272 0.0735  0.0010  256 VAL A CB  
1937 C CG1 . VAL A 259 ? 0.3069 0.1899 0.1196 -0.0184 0.0703  0.0033  256 VAL A CG1 
1938 C CG2 . VAL A 259 ? 0.2892 0.2092 0.1458 -0.0339 0.0859  -0.0016 256 VAL A CG2 
1939 N N   . LEU A 260 ? 0.2821 0.1876 0.1312 -0.0084 0.0416  0.0000  257 LEU A N   
1940 C CA  A LEU A 260 ? 0.2908 0.1869 0.1354 -0.0014 0.0315  0.0017  257 LEU A CA  
1941 C CA  B LEU A 260 ? 0.2886 0.1850 0.1334 -0.0014 0.0314  0.0016  257 LEU A CA  
1942 C C   . LEU A 260 ? 0.3177 0.1941 0.1376 0.0048  0.0263  0.0039  257 LEU A C   
1943 O O   . LEU A 260 ? 0.3241 0.2027 0.1408 0.0086  0.0213  0.0017  257 LEU A O   
1944 C CB  A LEU A 260 ? 0.2691 0.1824 0.1350 0.0029  0.0233  -0.0008 257 LEU A CB  
1945 C CB  B LEU A 260 ? 0.2648 0.1787 0.1309 0.0027  0.0235  -0.0010 257 LEU A CB  
1946 C CG  A LEU A 260 ? 0.2540 0.1828 0.1396 0.0000  0.0258  -0.0024 257 LEU A CG  
1947 C CG  B LEU A 260 ? 0.2449 0.1722 0.1296 0.0004  0.0252  -0.0021 257 LEU A CG  
1948 C CD1 A LEU A 260 ? 0.2485 0.1915 0.1433 -0.0038 0.0303  -0.0047 257 LEU A CD1 
1949 C CD1 B LEU A 260 ? 0.2169 0.1609 0.1188 0.0018  0.0231  -0.0043 257 LEU A CD1 
1950 C CD2 A LEU A 260 ? 0.2420 0.1786 0.1423 0.0055  0.0193  -0.0027 257 LEU A CD2 
1951 C CD2 B LEU A 260 ? 0.2323 0.1526 0.1178 0.0051  0.0212  -0.0006 257 LEU A CD2 
1952 N N   . ASP A 261 ? 0.3466 0.2014 0.1469 0.0067  0.0266  0.0081  258 ASP A N   
1953 C CA  . ASP A 261 ? 0.3826 0.2159 0.1567 0.0155  0.0182  0.0109  258 ASP A CA  
1954 C C   . ASP A 261 ? 0.4059 0.2279 0.1560 0.0156  0.0220  0.0109  258 ASP A C   
1955 O O   . ASP A 261 ? 0.4170 0.2357 0.1577 0.0229  0.0106  0.0087  258 ASP A O   
1956 C CB  . ASP A 261 ? 0.3771 0.2208 0.1665 0.0249  0.0016  0.0085  258 ASP A CB  
1957 C CG  . ASP A 261 ? 0.4104 0.2330 0.1754 0.0358  -0.0110 0.0110  258 ASP A CG  
1958 O OD1 . ASP A 261 ? 0.4632 0.2590 0.1984 0.0377  -0.0068 0.0164  258 ASP A OD1 
1959 O OD2 . ASP A 261 ? 0.4270 0.2589 0.2019 0.0424  -0.0258 0.0074  258 ASP A OD2 
1960 N N   . HIS A 262 ? 0.4170 0.2333 0.1579 0.0072  0.0385  0.0127  259 HIS A N   
1961 C CA  . HIS A 262 ? 0.4492 0.2489 0.1610 0.0079  0.0464  0.0140  259 HIS A CA  
1962 C C   . HIS A 262 ? 0.4661 0.2539 0.1674 -0.0021 0.0668  0.0184  259 HIS A C   
1963 O O   . HIS A 262 ? 0.4404 0.2476 0.1637 -0.0113 0.0793  0.0158  259 HIS A O   
1964 C CB  . HIS A 262 ? 0.4336 0.2527 0.1589 0.0081  0.0465  0.0078  259 HIS A CB  
1965 C CG  . HIS A 262 ? 0.4766 0.2758 0.1678 0.0142  0.0470  0.0070  259 HIS A CG  
1966 N ND1 . HIS A 262 ? 0.5099 0.2861 0.1690 0.0122  0.0630  0.0113  259 HIS A ND1 
1967 C CD2 . HIS A 262 ? 0.4866 0.2835 0.1689 0.0218  0.0339  0.0020  259 HIS A CD2 
1968 C CE1 . HIS A 262 ? 0.5423 0.3018 0.1710 0.0197  0.0599  0.0091  259 HIS A CE1 
1969 N NE2 . HIS A 262 ? 0.5123 0.2839 0.1546 0.0254  0.0411  0.0029  259 HIS A NE2 
1970 N N   . GLU A 263 ? 0.5003 0.2560 0.1696 -0.0004 0.0697  0.0251  260 GLU A N   
1971 C CA  A GLU A 263 ? 0.5253 0.2666 0.1862 -0.0118 0.0896  0.0298  260 GLU A CA  
1972 C CA  B GLU A 263 ? 0.5249 0.2652 0.1846 -0.0117 0.0897  0.0300  260 GLU A CA  
1973 C C   . GLU A 263 ? 0.5437 0.2807 0.1906 -0.0169 0.1087  0.0306  260 GLU A C   
1974 O O   . GLU A 263 ? 0.5412 0.2859 0.2031 -0.0297 0.1267  0.0309  260 GLU A O   
1975 C CB  A GLU A 263 ? 0.5659 0.2702 0.1953 -0.0083 0.0881  0.0375  260 GLU A CB  
1976 C CB  B GLU A 263 ? 0.5677 0.2690 0.1924 -0.0074 0.0884  0.0380  260 GLU A CB  
1977 C CG  A GLU A 263 ? 0.5495 0.2614 0.2030 -0.0107 0.0812  0.0363  260 GLU A CG  
1978 C CG  B GLU A 263 ? 0.5499 0.2534 0.1911 -0.0050 0.0766  0.0377  260 GLU A CG  
1979 C CD  A GLU A 263 ? 0.5896 0.2728 0.2186 0.0014  0.0688  0.0415  260 GLU A CD  
1980 C CD  B GLU A 263 ? 0.5495 0.2574 0.2111 -0.0199 0.0894  0.0370  260 GLU A CD  
1981 O OE1 A GLU A 263 ? 0.6370 0.2924 0.2280 0.0114  0.0648  0.0468  260 GLU A OE1 
1982 O OE1 B GLU A 263 ? 0.5368 0.2535 0.2085 -0.0331 0.1060  0.0360  260 GLU A OE1 
1983 O OE2 A GLU A 263 ? 0.5795 0.2674 0.2261 0.0022  0.0627  0.0400  260 GLU A OE2 
1984 O OE2 B GLU A 263 ? 0.5547 0.2576 0.2235 -0.0182 0.0824  0.0369  260 GLU A OE2 
1985 N N   . ARG A 264 ? 0.5651 0.2914 0.1855 -0.0071 0.1048  0.0299  261 ARG A N   
1986 C CA  . ARG A 264 ? 0.5866 0.3092 0.1929 -0.0099 0.1239  0.0296  261 ARG A CA  
1987 C C   . ARG A 264 ? 0.5468 0.3103 0.1982 -0.0162 0.1303  0.0221  261 ARG A C   
1988 O O   . ARG A 264 ? 0.5640 0.3360 0.2263 -0.0252 0.1514  0.0223  261 ARG A O   
1989 C CB  . ARG A 264 ? 0.6244 0.3236 0.1885 0.0034  0.1156  0.0292  261 ARG A CB  
1990 C CG  . ARG A 264 ? 0.6712 0.3575 0.2091 0.0026  0.1380  0.0297  261 ARG A CG  
1991 C CD  . ARG A 264 ? 0.7020 0.3777 0.2116 0.0157  0.1261  0.0242  261 ARG A CD  
1992 N NE  . ARG A 264 ? 0.6779 0.3892 0.2272 0.0166  0.1168  0.0145  261 ARG A NE  
1993 C CZ  . ARG A 264 ? 0.6731 0.3857 0.2186 0.0260  0.0951  0.0078  261 ARG A CZ  
1994 N NH1 . ARG A 264 ? 0.7278 0.4123 0.2347 0.0359  0.0770  0.0086  261 ARG A NH1 
1995 N NH2 . ARG A 264 ? 0.6289 0.3709 0.2102 0.0254  0.0903  0.0002  261 ARG A NH2 
1996 N N   . LEU A 265 ? 0.5020 0.2898 0.1794 -0.0110 0.1127  0.0159  262 LEU A N   
1997 C CA  . LEU A 265 ? 0.4701 0.2947 0.1891 -0.0148 0.1157  0.0094  262 LEU A CA  
1998 C C   . LEU A 265 ? 0.4539 0.2979 0.2057 -0.0279 0.1260  0.0098  262 LEU A C   
1999 O O   . LEU A 265 ? 0.4474 0.3121 0.2222 -0.0340 0.1398  0.0071  262 LEU A O   
2000 C CB  . LEU A 265 ? 0.4334 0.2755 0.1727 -0.0081 0.0944  0.0045  262 LEU A CB  
2001 C CG  . LEU A 265 ? 0.4062 0.2802 0.1810 -0.0085 0.0945  -0.0015 262 LEU A CG  
2002 C CD1 . LEU A 265 ? 0.4208 0.2926 0.1840 -0.0045 0.1063  -0.0044 262 LEU A CD1 
2003 C CD2 . LEU A 265 ? 0.3653 0.2494 0.1543 -0.0026 0.0753  -0.0047 262 LEU A CD2 
2004 N N   . TYR A 266 ? 0.4479 0.2850 0.2021 -0.0314 0.1181  0.0125  263 TYR A N   
2005 C CA  . TYR A 266 ? 0.4404 0.2871 0.2175 -0.0444 0.1261  0.0126  263 TYR A CA  
2006 C C   . TYR A 266 ? 0.4631 0.3012 0.2343 -0.0553 0.1498  0.0157  263 TYR A C   
2007 O O   . TYR A 266 ? 0.4443 0.3080 0.2492 -0.0657 0.1593  0.0119  263 TYR A O   
2008 C CB  . TYR A 266 ? 0.4500 0.2764 0.2151 -0.0444 0.1164  0.0162  263 TYR A CB  
2009 C CG  . TYR A 266 ? 0.4461 0.2754 0.2293 -0.0582 0.1232  0.0156  263 TYR A CG  
2010 C CD1 . TYR A 266 ? 0.4235 0.2831 0.2434 -0.0633 0.1167  0.0090  263 TYR A CD1 
2011 C CD2 . TYR A 266 ? 0.4927 0.2913 0.2535 -0.0659 0.1351  0.0214  263 TYR A CD2 
2012 C CE1 . TYR A 266 ? 0.4329 0.2938 0.2679 -0.0762 0.1205  0.0069  263 TYR A CE1 
2013 C CE2 . TYR A 266 ? 0.5053 0.3040 0.2826 -0.0799 0.1406  0.0198  263 TYR A CE2 
2014 C CZ  . TYR A 266 ? 0.4593 0.2901 0.2743 -0.0851 0.1323  0.0118  263 TYR A CZ  
2015 O OH  . TYR A 266 ? 0.4713 0.3011 0.3013 -0.0992 0.1356  0.0087  263 TYR A OH  
2016 N N   . SER A 267 ? 0.5016 0.3035 0.2306 -0.0529 0.1588  0.0226  264 SER A N   
2017 C CA  A SER A 267 ? 0.5349 0.3227 0.2534 -0.0639 0.1846  0.0270  264 SER A CA  
2018 C CA  B SER A 267 ? 0.5389 0.3257 0.2560 -0.0637 0.1847  0.0272  264 SER A CA  
2019 C C   . SER A 267 ? 0.5316 0.3441 0.2691 -0.0654 0.2006  0.0229  264 SER A C   
2020 O O   . SER A 267 ? 0.5304 0.3594 0.2951 -0.0787 0.2190  0.0218  264 SER A O   
2021 C CB  A SER A 267 ? 0.5883 0.3275 0.2498 -0.0581 0.1907  0.0362  264 SER A CB  
2022 C CB  B SER A 267 ? 0.5927 0.3313 0.2518 -0.0569 0.1905  0.0361  264 SER A CB  
2023 O OG  A SER A 267 ? 0.6098 0.3320 0.2607 -0.0706 0.2178  0.0417  264 SER A OG  
2024 O OG  B SER A 267 ? 0.6084 0.3199 0.2474 -0.0549 0.1788  0.0412  264 SER A OG  
2025 N N   . ASP A 268 ? 0.5269 0.3421 0.2518 -0.0518 0.1937  0.0200  265 ASP A N   
2026 C CA  . ASP A 268 ? 0.5274 0.3645 0.2686 -0.0500 0.2079  0.0153  265 ASP A CA  
2027 C C   . ASP A 268 ? 0.4884 0.3726 0.2883 -0.0558 0.2045  0.0080  265 ASP A C   
2028 O O   . ASP A 268 ? 0.4853 0.3919 0.3133 -0.0630 0.2227  0.0057  265 ASP A O   
2029 C CB  . ASP A 268 ? 0.5335 0.3613 0.2485 -0.0337 0.1975  0.0123  265 ASP A CB  
2030 C CG  . ASP A 268 ? 0.5837 0.3655 0.2377 -0.0264 0.2017  0.0182  265 ASP A CG  
2031 O OD1 . ASP A 268 ? 0.6475 0.4038 0.2779 -0.0335 0.2175  0.0257  265 ASP A OD1 
2032 O OD2 . ASP A 268 ? 0.5963 0.3656 0.2243 -0.0134 0.1888  0.0151  265 ASP A OD2 
2033 N N   . LEU A 269 ? 0.4594 0.3588 0.2777 -0.0520 0.1814  0.0045  266 LEU A N   
2034 C CA  . LEU A 269 ? 0.4305 0.3705 0.2985 -0.0560 0.1758  -0.0018 266 LEU A CA  
2035 C C   . LEU A 269 ? 0.4395 0.3925 0.3357 -0.0730 0.1864  -0.0021 266 LEU A C   
2036 O O   . LEU A 269 ? 0.4258 0.4128 0.3625 -0.0782 0.1926  -0.0072 266 LEU A O   
2037 C CB  . LEU A 269 ? 0.4001 0.3483 0.2767 -0.0492 0.1507  -0.0044 266 LEU A CB  
2038 C CG  . LEU A 269 ? 0.3863 0.3351 0.2541 -0.0347 0.1383  -0.0069 266 LEU A CG  
2039 C CD1 . LEU A 269 ? 0.3587 0.3163 0.2393 -0.0316 0.1174  -0.0085 266 LEU A CD1 
2040 C CD2 . LEU A 269 ? 0.3641 0.3359 0.2520 -0.0292 0.1465  -0.0117 266 LEU A CD2 
2041 N N   . SER A 270 ? 0.4703 0.3961 0.3461 -0.0815 0.1883  0.0029  267 SER A N   
2042 C CA  . SER A 270 ? 0.4869 0.4195 0.3866 -0.0995 0.1984  0.0023  267 SER A CA  
2043 C C   . SER A 270 ? 0.5142 0.4602 0.4323 -0.1090 0.2249  0.0020  267 SER A C   
2044 O O   . SER A 270 ? 0.5040 0.4794 0.4655 -0.1220 0.2303  -0.0030 267 SER A O   
2045 C CB  . SER A 270 ? 0.5156 0.4078 0.3822 -0.1058 0.1988  0.0089  267 SER A CB  
2046 O OG  . SER A 270 ? 0.5721 0.4334 0.4076 -0.1106 0.2217  0.0165  267 SER A OG  
2047 N N   . LYS A 271 ? 0.5535 0.4786 0.4392 -0.1023 0.2414  0.0070  268 LYS A N   
2048 C CA  . LYS A 271 ? 0.5863 0.5208 0.4851 -0.1101 0.2707  0.0076  268 LYS A CA  
2049 C C   . LYS A 271 ? 0.5678 0.5464 0.5077 -0.1032 0.2733  -0.0001 268 LYS A C   
2050 O O   . LYS A 271 ? 0.5791 0.5798 0.5497 -0.1117 0.2955  -0.0020 268 LYS A O   
2051 C CB  . LYS A 271 ? 0.6357 0.5260 0.4773 -0.1043 0.2890  0.0162  268 LYS A CB  
2052 C CG  . LYS A 271 ? 0.6840 0.5280 0.4838 -0.1107 0.2899  0.0251  268 LYS A CG  
2053 C CD  . LYS A 271 ? 0.7561 0.5540 0.4961 -0.1049 0.3091  0.0343  268 LYS A CD  
2054 C CE  . LYS A 271 ? 0.8053 0.5542 0.4986 -0.1058 0.3026  0.0434  268 LYS A CE  
2055 N NZ  . LYS A 271 ? 0.8873 0.5871 0.5184 -0.1008 0.3221  0.0534  268 LYS A NZ  
2056 N N   . GLU A 272 ? 0.5471 0.5381 0.4888 -0.0876 0.2518  -0.0044 269 GLU A N   
2057 C CA  . GLU A 272 ? 0.5375 0.5625 0.5093 -0.0776 0.2547  -0.0108 269 GLU A CA  
2058 C C   . GLU A 272 ? 0.4934 0.5617 0.5171 -0.0776 0.2362  -0.0183 269 GLU A C   
2059 O O   . GLU A 272 ? 0.4811 0.5852 0.5452 -0.0757 0.2439  -0.0237 269 GLU A O   
2060 C CB  . GLU A 272 ? 0.5468 0.5520 0.4811 -0.0586 0.2474  -0.0105 269 GLU A CB  
2061 C CG  . GLU A 272 ? 0.5679 0.5971 0.5223 -0.0479 0.2594  -0.0159 269 GLU A CG  
2062 C CD  . GLU A 272 ? 0.6067 0.6128 0.5223 -0.0304 0.2525  -0.0168 269 GLU A CD  
2063 O OE1 . GLU A 272 ? 0.6122 0.6381 0.5462 -0.0187 0.2525  -0.0225 269 GLU A OE1 
2064 O OE2 . GLU A 272 ? 0.6500 0.6173 0.5170 -0.0279 0.2462  -0.0123 269 GLU A OE2 
2065 N N   . LEU A 273 ? 0.4726 0.5370 0.4939 -0.0782 0.2121  -0.0188 270 LEU A N   
2066 C CA  . LEU A 273 ? 0.4395 0.5390 0.5004 -0.0756 0.1926  -0.0255 270 LEU A CA  
2067 C C   . LEU A 273 ? 0.4336 0.5667 0.5438 -0.0909 0.1992  -0.0305 270 LEU A C   
2068 O O   . LEU A 273 ? 0.4510 0.5727 0.5601 -0.1071 0.2135  -0.0282 270 LEU A O   
2069 C CB  . LEU A 273 ? 0.4262 0.5103 0.4699 -0.0742 0.1687  -0.0244 270 LEU A CB  
2070 C CG  . LEU A 273 ? 0.4380 0.4981 0.4452 -0.0592 0.1565  -0.0213 270 LEU A CG  
2071 C CD1 . LEU A 273 ? 0.4358 0.4829 0.4313 -0.0604 0.1370  -0.0202 270 LEU A CD1 
2072 C CD2 . LEU A 273 ? 0.4382 0.5178 0.4588 -0.0443 0.1503  -0.0251 270 LEU A CD2 
2073 N N   . PRO A 274 ? 0.4089 0.5824 0.5623 -0.0859 0.1876  -0.0377 271 PRO A N   
2074 C CA  . PRO A 274 ? 0.4058 0.6138 0.6094 -0.1010 0.1897  -0.0439 271 PRO A CA  
2075 C C   . PRO A 274 ? 0.4095 0.6015 0.6067 -0.1177 0.1801  -0.0441 271 PRO A C   
2076 O O   . PRO A 274 ? 0.4032 0.5670 0.5652 -0.1135 0.1650  -0.0410 271 PRO A O   
2077 C CB  . PRO A 274 ? 0.3788 0.6257 0.6189 -0.0884 0.1701  -0.0510 271 PRO A CB  
2078 C CG  . PRO A 274 ? 0.3765 0.6123 0.5912 -0.0674 0.1694  -0.0479 271 PRO A CG  
2079 C CD  . PRO A 274 ? 0.3878 0.5757 0.5461 -0.0671 0.1706  -0.0404 271 PRO A CD  
2080 N N   . GLU A 275 ? 0.4210 0.6310 0.6537 -0.1368 0.1901  -0.0483 272 GLU A N   
2081 C CA  . GLU A 275 ? 0.4331 0.6233 0.6589 -0.1554 0.1861  -0.0488 272 GLU A CA  
2082 C C   . GLU A 275 ? 0.4082 0.6019 0.6345 -0.1525 0.1554  -0.0544 272 GLU A C   
2083 O O   . GLU A 275 ? 0.4171 0.5796 0.6159 -0.1597 0.1484  -0.0528 272 GLU A O   
2084 C CB  . GLU A 275 ? 0.4517 0.6656 0.7234 -0.1775 0.2034  -0.0536 272 GLU A CB  
2085 C CG  . GLU A 275 ? 0.4885 0.6788 0.7545 -0.1994 0.2030  -0.0546 272 GLU A CG  
2086 C CD  . GLU A 275 ? 0.5432 0.7532 0.8534 -0.2232 0.2253  -0.0582 272 GLU A CD  
2087 O OE1 . GLU A 275 ? 0.5573 0.7971 0.8993 -0.2218 0.2448  -0.0585 272 GLU A OE1 
2088 O OE2 . GLU A 275 ? 0.5851 0.7799 0.8991 -0.2436 0.2245  -0.0609 272 GLU A OE2 
2089 N N   . PHE A 276 ? 0.3790 0.6077 0.6334 -0.1408 0.1376  -0.0607 273 PHE A N   
2090 C CA  . PHE A 276 ? 0.3634 0.5947 0.6151 -0.1364 0.1090  -0.0660 273 PHE A CA  
2091 C C   . PHE A 276 ? 0.3490 0.5452 0.5496 -0.1212 0.0982  -0.0593 273 PHE A C   
2092 O O   . PHE A 276 ? 0.3409 0.5289 0.5291 -0.1189 0.0785  -0.0620 273 PHE A O   
2093 C CB  . PHE A 276 ? 0.3524 0.6301 0.6476 -0.1273 0.0927  -0.0742 273 PHE A CB  
2094 C CG  . PHE A 276 ? 0.3529 0.6368 0.6383 -0.1034 0.0891  -0.0703 273 PHE A CG  
2095 C CD1 . PHE A 276 ? 0.3760 0.6765 0.6783 -0.0963 0.1077  -0.0683 273 PHE A CD1 
2096 C CD2 . PHE A 276 ? 0.3798 0.6513 0.6387 -0.0882 0.0679  -0.0689 273 PHE A CD2 
2097 C CE1 . PHE A 276 ? 0.3731 0.6760 0.6651 -0.0744 0.1041  -0.0656 273 PHE A CE1 
2098 C CE2 . PHE A 276 ? 0.3632 0.6372 0.6128 -0.0673 0.0652  -0.0652 273 PHE A CE2 
2099 C CZ  . PHE A 276 ? 0.3613 0.6504 0.6274 -0.0606 0.0825  -0.0639 273 PHE A CZ  
2100 N N   . VAL A 277 ? 0.3388 0.5147 0.5106 -0.1110 0.1109  -0.0512 274 VAL A N   
2101 C CA  . VAL A 277 ? 0.3265 0.4736 0.4568 -0.0975 0.1008  -0.0456 274 VAL A CA  
2102 C C   . VAL A 277 ? 0.3395 0.4485 0.4366 -0.1064 0.1028  -0.0415 274 VAL A C   
2103 O O   . VAL A 277 ? 0.3530 0.4430 0.4380 -0.1156 0.1201  -0.0373 274 VAL A O   
2104 C CB  . VAL A 277 ? 0.3241 0.4635 0.4363 -0.0829 0.1103  -0.0399 274 VAL A CB  
2105 C CG1 . VAL A 277 ? 0.3180 0.4295 0.3922 -0.0712 0.0988  -0.0351 274 VAL A CG1 
2106 C CG2 . VAL A 277 ? 0.2900 0.4644 0.4339 -0.0722 0.1086  -0.0441 274 VAL A CG2 
2107 N N   . ARG A 278 ? 0.3288 0.4255 0.4100 -0.1027 0.0856  -0.0427 275 ARG A N   
2108 C CA  . ARG A 278 ? 0.3457 0.4060 0.3949 -0.1076 0.0858  -0.0391 275 ARG A CA  
2109 C C   . ARG A 278 ? 0.3294 0.3644 0.3435 -0.0940 0.0873  -0.0310 275 ARG A C   
2110 O O   . ARG A 278 ? 0.3157 0.3562 0.3251 -0.0806 0.0772  -0.0303 275 ARG A O   
2111 C CB  . ARG A 278 ? 0.3503 0.4084 0.3983 -0.1092 0.0681  -0.0448 275 ARG A CB  
2112 C CG  . ARG A 278 ? 0.4021 0.4226 0.4169 -0.1108 0.0677  -0.0415 275 ARG A CG  
2113 C CD  . ARG A 278 ? 0.4593 0.4755 0.4752 -0.1177 0.0548  -0.0491 275 ARG A CD  
2114 N NE  . ARG A 278 ? 0.4903 0.4799 0.4745 -0.1075 0.0479  -0.0463 275 ARG A NE  
2115 C CZ  . ARG A 278 ? 0.5396 0.5035 0.5067 -0.1129 0.0451  -0.0490 275 ARG A CZ  
2116 N NH1 . ARG A 278 ? 0.5659 0.5237 0.5422 -0.1301 0.0478  -0.0549 275 ARG A NH1 
2117 N NH2 . ARG A 278 ? 0.5640 0.5075 0.5054 -0.1011 0.0405  -0.0462 275 ARG A NH2 
2118 N N   . LEU A 279 ? 0.3389 0.3452 0.3286 -0.0980 0.0994  -0.0250 276 LEU A N   
2119 C CA  A LEU A 279 ? 0.3351 0.3177 0.2926 -0.0860 0.1002  -0.0180 276 LEU A CA  
2120 C CA  B LEU A 279 ? 0.3361 0.3187 0.2936 -0.0858 0.0998  -0.0181 276 LEU A CA  
2121 C C   . LEU A 279 ? 0.3462 0.2970 0.2770 -0.0859 0.0952  -0.0149 276 LEU A C   
2122 O O   . LEU A 279 ? 0.3667 0.2996 0.2910 -0.0973 0.1024  -0.0142 276 LEU A O   
2123 C CB  A LEU A 279 ? 0.3530 0.3258 0.2992 -0.0878 0.1182  -0.0133 276 LEU A CB  
2124 C CB  B LEU A 279 ? 0.3540 0.3266 0.2989 -0.0862 0.1170  -0.0131 276 LEU A CB  
2125 C CG  A LEU A 279 ? 0.3562 0.3049 0.2680 -0.0755 0.1191  -0.0070 276 LEU A CG  
2126 C CG  B LEU A 279 ? 0.3413 0.3388 0.3032 -0.0800 0.1228  -0.0150 276 LEU A CG  
2127 C CD1 A LEU A 279 ? 0.3153 0.2820 0.2340 -0.0626 0.1122  -0.0090 276 LEU A CD1 
2128 C CD1 B LEU A 279 ? 0.3498 0.3666 0.3395 -0.0927 0.1389  -0.0179 276 LEU A CD1 
2129 C CD2 A LEU A 279 ? 0.3816 0.3104 0.2742 -0.0811 0.1388  -0.0019 276 LEU A CD2 
2130 C CD2 B LEU A 279 ? 0.3463 0.3227 0.2766 -0.0695 0.1283  -0.0097 276 LEU A CD2 
2131 N N   . THR A 280 ? 0.3270 0.2706 0.2435 -0.0730 0.0839  -0.0130 277 THR A N   
2132 C CA  . THR A 280 ? 0.3303 0.2471 0.2248 -0.0699 0.0788  -0.0103 277 THR A CA  
2133 C C   . THR A 280 ? 0.3275 0.2291 0.2000 -0.0569 0.0759  -0.0045 277 THR A C   
2134 O O   . THR A 280 ? 0.3067 0.2225 0.1851 -0.0478 0.0697  -0.0050 277 THR A O   
2135 C CB  . THR A 280 ? 0.3179 0.2426 0.2209 -0.0673 0.0665  -0.0151 277 THR A CB  
2136 O OG1 . THR A 280 ? 0.3177 0.2555 0.2397 -0.0795 0.0663  -0.0217 277 THR A OG1 
2137 C CG2 . THR A 280 ? 0.3197 0.2168 0.2010 -0.0623 0.0629  -0.0126 277 THR A CG2 
2138 N N   . HIS A 281 ? 0.3528 0.2244 0.1998 -0.0563 0.0800  0.0006  278 HIS A N   
2139 C CA  . HIS A 281 ? 0.3566 0.2126 0.1824 -0.0435 0.0741  0.0054  278 HIS A CA  
2140 C C   . HIS A 281 ? 0.3503 0.1975 0.1732 -0.0362 0.0638  0.0053  278 HIS A C   
2141 O O   . HIS A 281 ? 0.3582 0.1879 0.1738 -0.0406 0.0660  0.0054  278 HIS A O   
2142 C CB  . HIS A 281 ? 0.3985 0.2244 0.1940 -0.0440 0.0830  0.0119  278 HIS A CB  
2143 C CG  . HIS A 281 ? 0.4239 0.2375 0.1983 -0.0300 0.0743  0.0156  278 HIS A CG  
2144 N ND1 . HIS A 281 ? 0.4572 0.2538 0.2184 -0.0199 0.0637  0.0183  278 HIS A ND1 
2145 C CD2 . HIS A 281 ? 0.4459 0.2644 0.2132 -0.0238 0.0727  0.0157  278 HIS A CD2 
2146 C CE1 . HIS A 281 ? 0.4837 0.2764 0.2317 -0.0087 0.0549  0.0199  278 HIS A CE1 
2147 N NE2 . HIS A 281 ? 0.4532 0.2572 0.2026 -0.0113 0.0600  0.0181  278 HIS A NE2 
2148 N N   . VAL A 282 ? 0.3336 0.1925 0.1630 -0.0252 0.0536  0.0047  279 VAL A N   
2149 C CA  . VAL A 282 ? 0.3290 0.1836 0.1594 -0.0164 0.0452  0.0047  279 VAL A CA  
2150 C C   . VAL A 282 ? 0.3351 0.1853 0.1580 -0.0043 0.0367  0.0077  279 VAL A C   
2151 O O   . VAL A 282 ? 0.3349 0.1929 0.1575 -0.0025 0.0347  0.0077  279 VAL A O   
2152 C CB  . VAL A 282 ? 0.3075 0.1855 0.1604 -0.0161 0.0415  0.0000  279 VAL A CB  
2153 C CG1 . VAL A 282 ? 0.2920 0.1795 0.1545 -0.0277 0.0465  -0.0043 279 VAL A CG1 
2154 C CG2 . VAL A 282 ? 0.2829 0.1801 0.1480 -0.0109 0.0368  -0.0004 279 VAL A CG2 
2155 N N   . PRO A 283 ? 0.3450 0.1825 0.1622 0.0046  0.0309  0.0096  280 PRO A N   
2156 C CA  . PRO A 283 ? 0.3455 0.1823 0.1605 0.0166  0.0200  0.0114  280 PRO A CA  
2157 C C   . PRO A 283 ? 0.3153 0.1795 0.1579 0.0202  0.0137  0.0077  280 PRO A C   
2158 O O   . PRO A 283 ? 0.3024 0.1807 0.1617 0.0167  0.0177  0.0050  280 PRO A O   
2159 C CB  . PRO A 283 ? 0.3704 0.1866 0.1745 0.0253  0.0169  0.0143  280 PRO A CB  
2160 C CG  . PRO A 283 ? 0.3718 0.1856 0.1814 0.0186  0.0253  0.0118  280 PRO A CG  
2161 C CD  . PRO A 283 ? 0.3593 0.1838 0.1740 0.0046  0.0334  0.0091  280 PRO A CD  
2162 N N   . LYS A 284 ? 0.3079 0.1774 0.1533 0.0270  0.0037  0.0075  281 LYS A N   
2163 C CA  . LYS A 284 ? 0.2865 0.1787 0.1595 0.0304  -0.0022 0.0043  281 LYS A CA  
2164 C C   . LYS A 284 ? 0.2854 0.1787 0.1708 0.0392  -0.0057 0.0049  281 LYS A C   
2165 O O   . LYS A 284 ? 0.3020 0.1768 0.1720 0.0458  -0.0083 0.0077  281 LYS A O   
2166 C CB  . LYS A 284 ? 0.2913 0.1883 0.1651 0.0333  -0.0129 0.0024  281 LYS A CB  
2167 C CG  . LYS A 284 ? 0.3094 0.1977 0.1771 0.0441  -0.0268 0.0033  281 LYS A CG  
2168 C CD  . LYS A 284 ? 0.3453 0.2360 0.2097 0.0456  -0.0387 -0.0001 281 LYS A CD  
2169 C CE  . LYS A 284 ? 0.3856 0.2668 0.2415 0.0575  -0.0559 0.0001  281 LYS A CE  
2170 N NZ  . LYS A 284 ? 0.4406 0.3078 0.2699 0.0593  -0.0658 -0.0017 281 LYS A NZ  
2171 N N   . SER A 285 ? 0.2679 0.1816 0.1805 0.0397  -0.0044 0.0025  282 SER A N   
2172 C CA  . SER A 285 ? 0.2764 0.1961 0.2068 0.0487  -0.0057 0.0025  282 SER A CA  
2173 C C   . SER A 285 ? 0.2860 0.2110 0.2270 0.0579  -0.0202 0.0020  282 SER A C   
2174 O O   . SER A 285 ? 0.2748 0.2080 0.2209 0.0553  -0.0285 0.0000  282 SER A O   
2175 C CB  . SER A 285 ? 0.2546 0.1944 0.2106 0.0457  0.0022  0.0005  282 SER A CB  
2176 O OG  . SER A 285 ? 0.2582 0.2060 0.2345 0.0547  0.0036  0.0002  282 SER A OG  
2177 N N   . GLY A 286 ? 0.3064 0.2268 0.2516 0.0692  -0.0240 0.0032  283 GLY A N   
2178 C CA  . GLY A 286 ? 0.3211 0.2512 0.2831 0.0799  -0.0396 0.0019  283 GLY A CA  
2179 C C   . GLY A 286 ? 0.3048 0.2663 0.3087 0.0777  -0.0421 -0.0022 283 GLY A C   
2180 O O   . GLY A 286 ? 0.3207 0.2940 0.3420 0.0832  -0.0575 -0.0049 283 GLY A O   
2181 N N   . GLY A 287 ? 0.2903 0.2640 0.3096 0.0696  -0.0276 -0.0029 284 GLY A N   
2182 C CA  . GLY A 287 ? 0.2763 0.2763 0.3332 0.0652  -0.0266 -0.0060 284 GLY A CA  
2183 C C   . GLY A 287 ? 0.2748 0.2787 0.3310 0.0548  -0.0321 -0.0086 284 GLY A C   
2184 O O   . GLY A 287 ? 0.2646 0.2876 0.3519 0.0505  -0.0340 -0.0117 284 GLY A O   
2185 N N   . VAL A 288 ? 0.2863 0.2716 0.3084 0.0505  -0.0335 -0.0075 285 VAL A N   
2186 C CA  . VAL A 288 ? 0.2908 0.2772 0.3094 0.0422  -0.0376 -0.0103 285 VAL A CA  
2187 C C   . VAL A 288 ? 0.3139 0.3068 0.3448 0.0459  -0.0565 -0.0149 285 VAL A C   
2188 O O   . VAL A 288 ? 0.3365 0.3227 0.3586 0.0554  -0.0684 -0.0146 285 VAL A O   
2189 C CB  . VAL A 288 ? 0.2974 0.2637 0.2784 0.0384  -0.0349 -0.0088 285 VAL A CB  
2190 C CG1 . VAL A 288 ? 0.2826 0.2502 0.2621 0.0319  -0.0385 -0.0124 285 VAL A CG1 
2191 C CG2 . VAL A 288 ? 0.2722 0.2334 0.2425 0.0343  -0.0191 -0.0055 285 VAL A CG2 
2192 N N   . GLU A 289 ? 0.3253 0.3298 0.3762 0.0386  -0.0602 -0.0194 286 GLU A N   
2193 C CA  . GLU A 289 ? 0.3563 0.3683 0.4219 0.0405  -0.0802 -0.0257 286 GLU A CA  
2194 C C   . GLU A 289 ? 0.3653 0.3638 0.4084 0.0348  -0.0881 -0.0301 286 GLU A C   
2195 O O   . GLU A 289 ? 0.3584 0.3536 0.3972 0.0264  -0.0767 -0.0300 286 GLU A O   
2196 C CB  . GLU A 289 ? 0.3560 0.3955 0.4727 0.0369  -0.0798 -0.0289 286 GLU A CB  
2197 C CG  . GLU A 289 ? 0.3922 0.4475 0.5352 0.0481  -0.0845 -0.0281 286 GLU A CG  
2198 C CD  . GLU A 289 ? 0.4692 0.5190 0.6009 0.0594  -0.1092 -0.0312 286 GLU A CD  
2199 O OE1 . GLU A 289 ? 0.5010 0.5396 0.6130 0.0568  -0.1243 -0.0358 286 GLU A OE1 
2200 O OE2 . GLU A 289 ? 0.5168 0.5713 0.6568 0.0720  -0.1136 -0.0291 286 GLU A OE2 
2201 N N   . GLN A 290 ? 0.3894 0.3779 0.4149 0.0409  -0.1076 -0.0341 287 GLN A N   
2202 C CA  . GLN A 290 ? 0.4104 0.3829 0.4102 0.0373  -0.1165 -0.0395 287 GLN A CA  
2203 C C   . GLN A 290 ? 0.3968 0.3844 0.4307 0.0278  -0.1226 -0.0473 287 GLN A C   
2204 O O   . GLN A 290 ? 0.3895 0.3993 0.4644 0.0270  -0.1308 -0.0506 287 GLN A O   
2205 C CB  . GLN A 290 ? 0.4512 0.4059 0.4187 0.0478  -0.1369 -0.0417 287 GLN A CB  
2206 C CG  . GLN A 290 ? 0.4937 0.4627 0.4876 0.0515  -0.1628 -0.0499 287 GLN A CG  
2207 C CD  . GLN A 290 ? 0.5598 0.5117 0.5216 0.0657  -0.1841 -0.0501 287 GLN A CD  
2208 O OE1 . GLN A 290 ? 0.5823 0.5447 0.5607 0.0759  -0.1929 -0.0477 287 GLN A OE1 
2209 N NE2 . GLN A 290 ? 0.6075 0.5311 0.5215 0.0677  -0.1922 -0.0529 287 GLN A NE2 
2210 N N   . ARG A 291 ? 0.3926 0.3680 0.4111 0.0204  -0.1177 -0.0504 288 ARG A N   
2211 C CA  . ARG A 291 ? 0.3817 0.3652 0.4278 0.0102  -0.1220 -0.0578 288 ARG A CA  
2212 C C   . ARG A 291 ? 0.4017 0.3640 0.4175 0.0099  -0.1370 -0.0664 288 ARG A C   
2213 O O   . ARG A 291 ? 0.4087 0.3492 0.3836 0.0129  -0.1300 -0.0646 288 ARG A O   
2214 C CB  . ARG A 291 ? 0.3600 0.3458 0.4169 0.0019  -0.0995 -0.0532 288 ARG A CB  
2215 C CG  . ARG A 291 ? 0.3459 0.3501 0.4297 0.0021  -0.0839 -0.0453 288 ARG A CG  
2216 C CD  . ARG A 291 ? 0.3483 0.3478 0.4269 -0.0026 -0.0626 -0.0394 288 ARG A CD  
2217 N NE  . ARG A 291 ? 0.3661 0.3486 0.4051 0.0019  -0.0564 -0.0360 288 ARG A NE  
2218 C CZ  . ARG A 291 ? 0.3926 0.3665 0.4183 -0.0006 -0.0437 -0.0334 288 ARG A CZ  
2219 N NH1 . ARG A 291 ? 0.4184 0.3948 0.4623 -0.0071 -0.0355 -0.0328 288 ARG A NH1 
2220 N NH2 . ARG A 291 ? 0.3792 0.3417 0.3741 0.0034  -0.0387 -0.0310 288 ARG A NH2 
2221 N N   . THR A 292 ? 0.4074 0.3764 0.4442 0.0063  -0.1574 -0.0763 289 THR A N   
2222 C CA  . THR A 292 ? 0.4364 0.3839 0.4451 0.0054  -0.1739 -0.0866 289 THR A CA  
2223 C C   . THR A 292 ? 0.4355 0.3695 0.4386 -0.0041 -0.1608 -0.0894 289 THR A C   
2224 O O   . THR A 292 ? 0.4006 0.3450 0.4285 -0.0111 -0.1420 -0.0840 289 THR A O   
2225 C CB  . THR A 292 ? 0.4540 0.4149 0.4930 0.0025  -0.2014 -0.0980 289 THR A CB  
2226 O OG1 . THR A 292 ? 0.4175 0.4035 0.5132 -0.0099 -0.1948 -0.0996 289 THR A OG1 
2227 C CG2 . THR A 292 ? 0.4524 0.4244 0.4936 0.0152  -0.2184 -0.0961 289 THR A CG2 
2228 N N   . GLY A 293 ? 0.4680 0.3764 0.4355 -0.0033 -0.1708 -0.0980 290 GLY A N   
2229 C CA  . GLY A 293 ? 0.4768 0.3685 0.4356 -0.0104 -0.1600 -0.1018 290 GLY A CA  
2230 C C   . GLY A 293 ? 0.4704 0.3742 0.4754 -0.0244 -0.1621 -0.1074 290 GLY A C   
2231 O O   . GLY A 293 ? 0.4658 0.3616 0.4753 -0.0308 -0.1464 -0.1059 290 GLY A O   
2232 N N   . GLN A 294 ? 0.4746 0.3977 0.5150 -0.0287 -0.1814 -0.1137 291 GLN A N   
2233 C CA  . GLN A 294 ? 0.4723 0.4101 0.5631 -0.0438 -0.1835 -0.1195 291 GLN A CA  
2234 C C   . GLN A 294 ? 0.4319 0.3900 0.5576 -0.0485 -0.1581 -0.1073 291 GLN A C   
2235 O O   . GLN A 294 ? 0.4285 0.3820 0.5714 -0.0593 -0.1440 -0.1063 291 GLN A O   
2236 C CB  . GLN A 294 ? 0.4876 0.4465 0.6120 -0.0461 -0.2113 -0.1294 291 GLN A CB  
2237 C CG  . GLN A 294 ? 0.5187 0.4783 0.6758 -0.0621 -0.2253 -0.1431 291 GLN A CG  
2238 C CD  . GLN A 294 ? 0.5484 0.5355 0.7467 -0.0641 -0.2540 -0.1530 291 GLN A CD  
2239 O OE1 . GLN A 294 ? 0.5465 0.5601 0.7655 -0.0553 -0.2568 -0.1469 291 GLN A OE1 
2240 N NE2 . GLN A 294 ? 0.5571 0.5380 0.7684 -0.0753 -0.2761 -0.1690 291 GLN A NE2 
2241 N N   . ILE A 295 ? 0.4046 0.3813 0.5365 -0.0397 -0.1522 -0.0980 292 ILE A N   
2242 C CA  . ILE A 295 ? 0.3736 0.3672 0.5311 -0.0417 -0.1282 -0.0863 292 ILE A CA  
2243 C C   . ILE A 295 ? 0.3624 0.3365 0.4904 -0.0408 -0.1055 -0.0782 292 ILE A C   
2244 O O   . ILE A 295 ? 0.3444 0.3217 0.4915 -0.0475 -0.0874 -0.0724 292 ILE A O   
2245 C CB  . ILE A 295 ? 0.3557 0.3682 0.5184 -0.0305 -0.1275 -0.0790 292 ILE A CB  
2246 C CG1 . ILE A 295 ? 0.3758 0.4132 0.5779 -0.0304 -0.1484 -0.0861 292 ILE A CG1 
2247 C CG2 . ILE A 295 ? 0.3159 0.3398 0.4948 -0.0314 -0.1017 -0.0675 292 ILE A CG2 
2248 C CD1 . ILE A 295 ? 0.3809 0.4340 0.5859 -0.0168 -0.1502 -0.0796 292 ILE A CD1 
2249 N N   . ARG A 296 ? 0.3717 0.3257 0.4532 -0.0318 -0.1066 -0.0778 293 ARG A N   
2250 C CA  . ARG A 296 ? 0.3685 0.3058 0.4227 -0.0292 -0.0881 -0.0716 293 ARG A CA  
2251 C C   . ARG A 296 ? 0.3803 0.3005 0.4370 -0.0378 -0.0834 -0.0761 293 ARG A C   
2252 O O   . ARG A 296 ? 0.3773 0.2924 0.4332 -0.0387 -0.0654 -0.0689 293 ARG A O   
2253 C CB  . ARG A 296 ? 0.3815 0.3024 0.3894 -0.0186 -0.0907 -0.0719 293 ARG A CB  
2254 C CG  . ARG A 296 ? 0.3697 0.3018 0.3700 -0.0102 -0.0886 -0.0644 293 ARG A CG  
2255 C CD  . ARG A 296 ? 0.3942 0.3097 0.3525 -0.0013 -0.0970 -0.0667 293 ARG A CD  
2256 N NE  . ARG A 296 ? 0.3859 0.3087 0.3363 0.0054  -0.0908 -0.0582 293 ARG A NE  
2257 C CZ  . ARG A 296 ? 0.3678 0.2914 0.3090 0.0072  -0.0728 -0.0502 293 ARG A CZ  
2258 N NH1 . ARG A 296 ? 0.3563 0.2751 0.2946 0.0046  -0.0598 -0.0493 293 ARG A NH1 
2259 N NH2 . ARG A 296 ? 0.3687 0.2970 0.3038 0.0121  -0.0687 -0.0436 293 ARG A NH2 
2260 N N   . SER A 297 ? 0.4005 0.3096 0.4577 -0.0435 -0.1004 -0.0881 294 SER A N   
2261 C CA  A SER A 297 ? 0.4183 0.3079 0.4791 -0.0529 -0.0975 -0.0937 294 SER A CA  
2262 C CA  B SER A 297 ? 0.4181 0.3077 0.4790 -0.0529 -0.0975 -0.0938 294 SER A CA  
2263 C C   . SER A 297 ? 0.4056 0.3090 0.5115 -0.0652 -0.0865 -0.0893 294 SER A C   
2264 O O   . SER A 297 ? 0.4130 0.3011 0.5189 -0.0701 -0.0717 -0.0856 294 SER A O   
2265 C CB  A SER A 297 ? 0.4503 0.3246 0.5019 -0.0571 -0.1206 -0.1093 294 SER A CB  
2266 C CB  B SER A 297 ? 0.4499 0.3245 0.5029 -0.0575 -0.1207 -0.1094 294 SER A CB  
2267 O OG  A SER A 297 ? 0.4644 0.3228 0.5305 -0.0695 -0.1193 -0.1157 294 SER A OG  
2268 O OG  B SER A 297 ? 0.4608 0.3197 0.4681 -0.0457 -0.1300 -0.1134 294 SER A OG  
2269 N N   . LYS A 298 ? 0.3920 0.3232 0.5356 -0.0695 -0.0927 -0.0892 295 LYS A N   
2270 C CA  . LYS A 298 ? 0.3848 0.3313 0.5733 -0.0812 -0.0797 -0.0847 295 LYS A CA  
2271 C C   . LYS A 298 ? 0.3571 0.3026 0.5357 -0.0758 -0.0542 -0.0700 295 LYS A C   
2272 O O   . LYS A 298 ? 0.3594 0.2951 0.5481 -0.0834 -0.0377 -0.0648 295 LYS A O   
2273 C CB  . LYS A 298 ? 0.3785 0.3587 0.6107 -0.0841 -0.0905 -0.0875 295 LYS A CB  
2274 C CG  . LYS A 298 ? 0.3967 0.3945 0.6818 -0.0983 -0.0774 -0.0851 295 LYS A CG  
2275 C CD  . LYS A 298 ? 0.4088 0.4444 0.7353 -0.0959 -0.0823 -0.0845 295 LYS A CD  
2276 C CE  . LYS A 298 ? 0.4248 0.4816 0.8116 -0.1117 -0.0724 -0.0854 295 LYS A CE  
2277 N NZ  . LYS A 298 ? 0.4294 0.5244 0.8563 -0.1063 -0.0736 -0.0836 295 LYS A NZ  
2278 N N   . MET A 299 ? 0.3369 0.2895 0.4930 -0.0627 -0.0514 -0.0635 296 MET A N   
2279 C CA  . MET A 299 ? 0.3220 0.2730 0.4652 -0.0568 -0.0303 -0.0510 296 MET A CA  
2280 C C   . MET A 299 ? 0.3268 0.2504 0.4394 -0.0545 -0.0209 -0.0484 296 MET A C   
2281 O O   . MET A 299 ? 0.3201 0.2381 0.4315 -0.0543 -0.0036 -0.0392 296 MET A O   
2282 C CB  . MET A 299 ? 0.3108 0.2742 0.4373 -0.0446 -0.0309 -0.0460 296 MET A CB  
2283 C CG  . MET A 299 ? 0.3113 0.3010 0.4684 -0.0443 -0.0349 -0.0455 296 MET A CG  
2284 S SD  . MET A 299 ? 0.3588 0.3550 0.4900 -0.0301 -0.0370 -0.0407 296 MET A SD  
2285 C CE  . MET A 299 ? 0.3499 0.3752 0.5230 -0.0294 -0.0413 -0.0410 296 MET A CE  
2286 N N   . ARG A 300 ? 0.3344 0.2398 0.4212 -0.0514 -0.0317 -0.0562 297 ARG A N   
2287 C CA  . ARG A 300 ? 0.3469 0.2258 0.4082 -0.0483 -0.0231 -0.0549 297 ARG A CA  
2288 C C   . ARG A 300 ? 0.3579 0.2219 0.4380 -0.0600 -0.0152 -0.0546 297 ARG A C   
2289 O O   . ARG A 300 ? 0.3643 0.2132 0.4340 -0.0574 -0.0001 -0.0465 297 ARG A O   
2290 C CB  . ARG A 300 ? 0.3639 0.2250 0.3939 -0.0423 -0.0349 -0.0644 297 ARG A CB  
2291 C CG  . ARG A 300 ? 0.3477 0.2165 0.3516 -0.0297 -0.0361 -0.0622 297 ARG A CG  
2292 C CD  . ARG A 300 ? 0.3680 0.2150 0.3369 -0.0224 -0.0404 -0.0695 297 ARG A CD  
2293 N NE  . ARG A 300 ? 0.3877 0.2203 0.3526 -0.0281 -0.0571 -0.0824 297 ARG A NE  
2294 C CZ  . ARG A 300 ? 0.3962 0.2333 0.3534 -0.0272 -0.0734 -0.0892 297 ARG A CZ  
2295 N NH1 . ARG A 300 ? 0.3912 0.2451 0.3435 -0.0208 -0.0741 -0.0837 297 ARG A NH1 
2296 N NH2 . ARG A 300 ? 0.4232 0.2452 0.3756 -0.0325 -0.0902 -0.1019 297 ARG A NH2 
2297 N N   . GLY A 301 ? 0.3650 0.2329 0.4734 -0.0729 -0.0255 -0.0632 298 GLY A N   
2298 C CA  . GLY A 301 ? 0.3825 0.2377 0.5149 -0.0873 -0.0171 -0.0632 298 GLY A CA  
2299 C C   . GLY A 301 ? 0.3690 0.2337 0.5207 -0.0904 0.0041  -0.0499 298 GLY A C   
2300 O O   . GLY A 301 ? 0.3767 0.2193 0.5255 -0.0951 0.0193  -0.0437 298 GLY A O   
2301 N N   . GLU A 302 ? 0.3449 0.2392 0.5126 -0.0868 0.0059  -0.0452 299 GLU A N   
2302 C CA  . GLU A 302 ? 0.3408 0.2447 0.5245 -0.0886 0.0265  -0.0333 299 GLU A CA  
2303 C C   . GLU A 302 ? 0.3366 0.2248 0.4824 -0.0758 0.0399  -0.0221 299 GLU A C   
2304 O O   . GLU A 302 ? 0.3476 0.2253 0.4920 -0.0773 0.0585  -0.0120 299 GLU A O   
2305 C CB  . GLU A 302 ? 0.3173 0.2564 0.5289 -0.0873 0.0239  -0.0329 299 GLU A CB  
2306 C CG  . GLU A 302 ? 0.3365 0.2960 0.5956 -0.1004 0.0121  -0.0430 299 GLU A CG  
2307 C CD  . GLU A 302 ? 0.3447 0.3391 0.6282 -0.0949 0.0041  -0.0445 299 GLU A CD  
2308 O OE1 . GLU A 302 ? 0.3713 0.3887 0.7023 -0.1046 0.0014  -0.0492 299 GLU A OE1 
2309 O OE2 . GLU A 302 ? 0.3428 0.3418 0.6001 -0.0809 0.0002  -0.0414 299 GLU A OE2 
2310 N N   . ASN A 303 ? 0.3267 0.2128 0.4416 -0.0631 0.0307  -0.0238 300 ASN A N   
2311 C CA  . ASN A 303 ? 0.3311 0.2029 0.4128 -0.0510 0.0403  -0.0152 300 ASN A CA  
2312 C C   . ASN A 303 ? 0.3504 0.1897 0.4188 -0.0530 0.0485  -0.0126 300 ASN A C   
2313 O O   . ASN A 303 ? 0.3640 0.1909 0.4213 -0.0495 0.0631  -0.0020 300 ASN A O   
2314 C CB  . ASN A 303 ? 0.3278 0.2044 0.3841 -0.0388 0.0292  -0.0191 300 ASN A CB  
2315 C CG  . ASN A 303 ? 0.3524 0.2248 0.3828 -0.0263 0.0377  -0.0104 300 ASN A CG  
2316 O OD1 . ASN A 303 ? 0.3992 0.2715 0.4295 -0.0250 0.0497  -0.0012 300 ASN A OD1 
2317 N ND2 . ASN A 303 ? 0.3662 0.2354 0.3748 -0.0167 0.0314  -0.0138 300 ASN A ND2 
2318 N N   . VAL A 304 ? 0.3558 0.1786 0.4228 -0.0579 0.0387  -0.0223 301 VAL A N   
2319 C CA  . VAL A 304 ? 0.3802 0.1680 0.4350 -0.0604 0.0459  -0.0210 301 VAL A CA  
2320 C C   . VAL A 304 ? 0.3996 0.1776 0.4754 -0.0734 0.0618  -0.0137 301 VAL A C   
2321 O O   . VAL A 304 ? 0.4159 0.1672 0.4742 -0.0703 0.0756  -0.0043 301 VAL A O   
2322 C CB  . VAL A 304 ? 0.3985 0.1692 0.4509 -0.0659 0.0317  -0.0351 301 VAL A CB  
2323 C CG1 . VAL A 304 ? 0.4234 0.1547 0.4630 -0.0686 0.0401  -0.0337 301 VAL A CG1 
2324 C CG2 . VAL A 304 ? 0.3651 0.1408 0.3922 -0.0526 0.0188  -0.0422 301 VAL A CG2 
2325 N N   . HIS A 305 ? 0.3959 0.1953 0.5095 -0.0875 0.0603  -0.0177 302 HIS A N   
2326 C CA  . HIS A 305 ? 0.4171 0.2118 0.5566 -0.1014 0.0778  -0.0110 302 HIS A CA  
2327 C C   . HIS A 305 ? 0.4226 0.2153 0.5454 -0.0925 0.0974  0.0045  302 HIS A C   
2328 O O   . HIS A 305 ? 0.4465 0.2126 0.5605 -0.0959 0.1152  0.0141  302 HIS A O   
2329 C CB  . HIS A 305 ? 0.4028 0.2300 0.5911 -0.1157 0.0725  -0.0182 302 HIS A CB  
2330 C CG  . HIS A 305 ? 0.4080 0.2330 0.6285 -0.1316 0.0926  -0.0121 302 HIS A CG  
2331 N ND1 . HIS A 305 ? 0.4425 0.2423 0.6769 -0.1479 0.0975  -0.0154 302 HIS A ND1 
2332 C CD2 . HIS A 305 ? 0.3971 0.2390 0.6364 -0.1336 0.1113  -0.0025 302 HIS A CD2 
2333 C CE1 . HIS A 305 ? 0.4351 0.2379 0.6979 -0.1604 0.1192  -0.0076 302 HIS A CE1 
2334 N NE2 . HIS A 305 ? 0.4001 0.2285 0.6657 -0.1514 0.1284  0.0003  302 HIS A NE2 
2335 N N   . ARG A 306 ? 0.4027 0.2206 0.5184 -0.0810 0.0938  0.0068  303 ARG A N   
2336 C CA  . ARG A 306 ? 0.4160 0.2338 0.5136 -0.0716 0.1094  0.0198  303 ARG A CA  
2337 C C   . ARG A 306 ? 0.4345 0.2202 0.4895 -0.0591 0.1149  0.0283  303 ARG A C   
2338 O O   . ARG A 306 ? 0.4554 0.2240 0.4946 -0.0564 0.1319  0.0402  303 ARG A O   
2339 C CB  . ARG A 306 ? 0.3932 0.2419 0.4892 -0.0616 0.1010  0.0182  303 ARG A CB  
2340 C CG  . ARG A 306 ? 0.4382 0.2885 0.5186 -0.0537 0.1164  0.0297  303 ARG A CG  
2341 C CD  . ARG A 306 ? 0.4678 0.3407 0.5375 -0.0422 0.1067  0.0278  303 ARG A CD  
2342 N NE  . ARG A 306 ? 0.5295 0.3936 0.5695 -0.0315 0.1174  0.0377  303 ARG A NE  
2343 C CZ  . ARG A 306 ? 0.5446 0.4247 0.5747 -0.0230 0.1141  0.0379  303 ARG A CZ  
2344 N NH1 . ARG A 306 ? 0.5368 0.4414 0.5838 -0.0235 0.1021  0.0300  303 ARG A NH1 
2345 N NH2 . ARG A 306 ? 0.5683 0.4371 0.5690 -0.0137 0.1224  0.0460  303 ARG A NH2 
2346 N N   . TYR A 307 ? 0.4278 0.2053 0.4637 -0.0504 0.1006  0.0222  304 TYR A N   
2347 C CA  . TYR A 307 ? 0.4424 0.1917 0.4416 -0.0367 0.1033  0.0288  304 TYR A CA  
2348 C C   . TYR A 307 ? 0.4779 0.1893 0.4688 -0.0424 0.1192  0.0372  304 TYR A C   
2349 O O   . TYR A 307 ? 0.4950 0.1846 0.4563 -0.0312 0.1282  0.0484  304 TYR A O   
2350 C CB  . TYR A 307 ? 0.4425 0.1876 0.4299 -0.0291 0.0875  0.0189  304 TYR A CB  
2351 C CG  . TYR A 307 ? 0.4576 0.1764 0.4119 -0.0133 0.0897  0.0250  304 TYR A CG  
2352 C CD1 . TYR A 307 ? 0.4528 0.1830 0.3875 0.0029  0.0874  0.0304  304 TYR A CD1 
2353 C CD2 . TYR A 307 ? 0.4866 0.1686 0.4302 -0.0144 0.0935  0.0251  304 TYR A CD2 
2354 C CE1 . TYR A 307 ? 0.4729 0.1819 0.3803 0.0190  0.0876  0.0358  304 TYR A CE1 
2355 C CE2 . TYR A 307 ? 0.5287 0.1861 0.4420 0.0025  0.0950  0.0312  304 TYR A CE2 
2356 C CZ  . TYR A 307 ? 0.5070 0.1801 0.4035 0.0197  0.0914  0.0365  304 TYR A CZ  
2357 O OH  . TYR A 307 ? 0.5578 0.2099 0.4276 0.0380  0.0909  0.0421  304 TYR A OH  
2358 N N   . PHE A 308 ? 0.4861 0.1880 0.5021 -0.0598 0.1218  0.0317  305 PHE A N   
2359 C CA  . PHE A 308 ? 0.5265 0.1890 0.5362 -0.0677 0.1377  0.0391  305 PHE A CA  
2360 C C   . PHE A 308 ? 0.5380 0.2017 0.5640 -0.0792 0.1593  0.0492  305 PHE A C   
2361 O O   . PHE A 308 ? 0.5710 0.2011 0.5744 -0.0776 0.1772  0.0621  305 PHE A O   
2362 C CB  . PHE A 308 ? 0.5419 0.1882 0.5693 -0.0820 0.1302  0.0271  305 PHE A CB  
2363 C CG  . PHE A 308 ? 0.5400 0.1734 0.5437 -0.0695 0.1140  0.0186  305 PHE A CG  
2364 C CD1 . PHE A 308 ? 0.5759 0.1722 0.5431 -0.0554 0.1189  0.0257  305 PHE A CD1 
2365 C CD2 . PHE A 308 ? 0.5087 0.1659 0.5245 -0.0702 0.0948  0.0040  305 PHE A CD2 
2366 C CE1 . PHE A 308 ? 0.5787 0.1643 0.5257 -0.0423 0.1059  0.0177  305 PHE A CE1 
2367 C CE2 . PHE A 308 ? 0.5226 0.1669 0.5146 -0.0579 0.0827  -0.0036 305 PHE A CE2 
2368 C CZ  . PHE A 308 ? 0.5535 0.1631 0.5127 -0.0439 0.0889  0.0029  305 PHE A CZ  
2369 N N   . TYR A 309 ? 0.5130 0.2138 0.5768 -0.0898 0.1583  0.0438  306 TYR A N   
2370 C CA  . TYR A 309 ? 0.5318 0.2377 0.6216 -0.1036 0.1802  0.0510  306 TYR A CA  
2371 C C   . TYR A 309 ? 0.5226 0.2523 0.6068 -0.0941 0.1889  0.0585  306 TYR A C   
2372 O O   . TYR A 309 ? 0.5341 0.2642 0.6310 -0.1017 0.2109  0.0667  306 TYR A O   
2373 C CB  . TYR A 309 ? 0.5174 0.2460 0.6623 -0.1251 0.1752  0.0388  306 TYR A CB  
2374 C CG  . TYR A 309 ? 0.5291 0.2276 0.6818 -0.1391 0.1722  0.0323  306 TYR A CG  
2375 C CD1 . TYR A 309 ? 0.5704 0.2364 0.7279 -0.1532 0.1949  0.0406  306 TYR A CD1 
2376 C CD2 . TYR A 309 ? 0.5013 0.2012 0.6548 -0.1387 0.1476  0.0176  306 TYR A CD2 
2377 C CE1 . TYR A 309 ? 0.5952 0.2303 0.7595 -0.1672 0.1921  0.0339  306 TYR A CE1 
2378 C CE2 . TYR A 309 ? 0.5270 0.1968 0.6848 -0.1512 0.1440  0.0103  306 TYR A CE2 
2379 C CZ  . TYR A 309 ? 0.5821 0.2194 0.7464 -0.1659 0.1657  0.0181  306 TYR A CZ  
2380 O OH  . TYR A 309 ? 0.5937 0.1981 0.7619 -0.1793 0.1618  0.0100  306 TYR A OH  
2381 N N   . GLY A 310 ? 0.5109 0.2588 0.5755 -0.0779 0.1731  0.0556  307 GLY A N   
2382 C CA  . GLY A 310 ? 0.5049 0.2721 0.5595 -0.0678 0.1787  0.0613  307 GLY A CA  
2383 C C   . GLY A 310 ? 0.4872 0.2940 0.5855 -0.0765 0.1776  0.0542  307 GLY A C   
2384 O O   . GLY A 310 ? 0.4702 0.2983 0.5980 -0.0832 0.1608  0.0422  307 GLY A O   
2385 N N   . THR A 311 ? 0.5045 0.3195 0.6049 -0.0752 0.1955  0.0616  308 THR A N   
2386 C CA  . THR A 311 ? 0.4866 0.3393 0.6271 -0.0802 0.1963  0.0559  308 THR A CA  
2387 C C   . THR A 311 ? 0.5138 0.3666 0.6818 -0.0923 0.2240  0.0625  308 THR A C   
2388 O O   . THR A 311 ? 0.5507 0.3715 0.6995 -0.0958 0.2442  0.0731  308 THR A O   
2389 C CB  . THR A 311 ? 0.4668 0.3341 0.5844 -0.0644 0.1920  0.0571  308 THR A CB  
2390 O OG1 . THR A 311 ? 0.5010 0.3443 0.5807 -0.0562 0.2116  0.0695  308 THR A OG1 
2391 C CG2 . THR A 311 ? 0.4530 0.3217 0.5454 -0.0532 0.1672  0.0511  308 THR A CG2 
2392 N N   . ARG A 312 ? 0.5012 0.3903 0.7147 -0.0979 0.2252  0.0565  309 ARG A N   
2393 C CA  . ARG A 312 ? 0.5221 0.4200 0.7650 -0.1063 0.2534  0.0623  309 ARG A CA  
2394 C C   . ARG A 312 ? 0.5429 0.4159 0.7395 -0.0949 0.2774  0.0761  309 ARG A C   
2395 O O   . ARG A 312 ? 0.5778 0.4296 0.7719 -0.1023 0.3053  0.0862  309 ARG A O   
2396 C CB  . ARG A 312 ? 0.4993 0.4431 0.7904 -0.1065 0.2468  0.0533  309 ARG A CB  
2397 C CG  . ARG A 312 ? 0.5128 0.4835 0.8639 -0.1223 0.2322  0.0412  309 ARG A CG  
2398 C CD  . ARG A 312 ? 0.5105 0.5260 0.9024 -0.1175 0.2203  0.0322  309 ARG A CD  
2399 N NE  . ARG A 312 ? 0.5386 0.5830 0.9982 -0.1328 0.2317  0.0281  309 ARG A NE  
2400 C CZ  . ARG A 312 ? 0.5371 0.6194 1.0390 -0.1291 0.2354  0.0245  309 ARG A CZ  
2401 N NH1 . ARG A 312 ? 0.5185 0.6113 0.9991 -0.1106 0.2285  0.0244  309 ARG A NH1 
2402 N NH2 . ARG A 312 ? 0.5473 0.6574 1.1157 -0.1442 0.2463  0.0205  309 ARG A NH2 
2403 N N   . ALA A 313 ? 0.5230 0.3971 0.6819 -0.0773 0.2665  0.0763  310 ALA A N   
2404 C CA  . ALA A 313 ? 0.5464 0.3953 0.6546 -0.0646 0.2843  0.0876  310 ALA A CA  
2405 C C   . ALA A 313 ? 0.5778 0.3813 0.6374 -0.0615 0.2896  0.0980  310 ALA A C   
2406 O O   . ALA A 313 ? 0.6233 0.3990 0.6611 -0.0624 0.3163  0.1098  310 ALA A O   
2407 C CB  . ALA A 313 ? 0.5248 0.3859 0.6065 -0.0480 0.2675  0.0832  310 ALA A CB  
2408 N N   . ASN A 314 ? 0.9414 0.6172 0.7989 0.0821  0.4178  -0.2189 311 ASN A N   
2409 C CA  . ASN A 314 ? 0.9338 0.5981 0.7227 0.0497  0.4003  -0.1968 311 ASN A CA  
2410 C C   . ASN A 314 ? 0.8451 0.5586 0.6920 0.0417  0.3761  -0.1674 311 ASN A C   
2411 O O   . ASN A 314 ? 0.7871 0.5018 0.6488 0.0420  0.3323  -0.1511 311 ASN A O   
2412 C CB  . ASN A 314 ? 0.9553 0.5643 0.6688 0.0380  0.3613  -0.1948 311 ASN A CB  
2413 C CG  . ASN A 314 ? 1.0656 0.6171 0.6793 0.0273  0.3829  -0.2183 311 ASN A CG  
2414 O OD1 . ASN A 314 ? 1.1077 0.6423 0.7185 0.0430  0.4205  -0.2477 311 ASN A OD1 
2415 N ND2 . ASN A 314 ? 1.1139 0.6344 0.6445 0.0013  0.3577  -0.2066 311 ASN A ND2 
2416 N N   . ASN A 315 ? 0.8335 0.5853 0.7113 0.0330  0.4069  -0.1619 312 ASN A N   
2417 C CA  . ASN A 315 ? 0.7647 0.5576 0.6946 0.0229  0.3869  -0.1374 312 ASN A CA  
2418 C C   . ASN A 315 ? 0.7539 0.5167 0.6158 0.0000  0.3558  -0.1141 312 ASN A C   
2419 O O   . ASN A 315 ? 0.8172 0.5402 0.5924 -0.0165 0.3654  -0.1127 312 ASN A O   
2420 C CB  . ASN A 315 ? 0.7753 0.6123 0.7535 0.0139  0.4297  -0.1374 312 ASN A CB  
2421 C CG  . ASN A 315 ? 0.7734 0.6575 0.8469 0.0395  0.4553  -0.1582 312 ASN A CG  
2422 O OD1 . ASN A 315 ? 0.8340 0.7010 0.8969 0.0581  0.4795  -0.1819 312 ASN A OD1 
2423 N ND2 . ASN A 315 ? 0.7273 0.6703 0.8965 0.0411  0.4485  -0.1504 312 ASN A ND2 
2424 N N   . LEU A 316 ? 0.6782 0.4590 0.5783 0.0005  0.3173  -0.0967 313 LEU A N   
2425 C CA  . LEU A 316 ? 0.6666 0.4301 0.5252 -0.0178 0.2903  -0.0734 313 LEU A CA  
2426 C C   . LEU A 316 ? 0.6311 0.4285 0.5414 -0.0279 0.2974  -0.0599 313 LEU A C   
2427 O O   . LEU A 316 ? 0.5970 0.4368 0.5853 -0.0184 0.3069  -0.0677 313 LEU A O   
2428 C CB  . LEU A 316 ? 0.6198 0.3749 0.4804 -0.0101 0.2445  -0.0662 313 LEU A CB  
2429 C CG  . LEU A 316 ? 0.6564 0.3750 0.4682 -0.0057 0.2311  -0.0772 313 LEU A CG  
2430 C CD1 . LEU A 316 ? 0.6078 0.3269 0.4330 -0.0023 0.1895  -0.0661 313 LEU A CD1 
2431 C CD2 . LEU A 316 ? 0.7233 0.4005 0.4449 -0.0232 0.2386  -0.0778 313 LEU A CD2 
2432 N N   . TYR A 317 ? 0.6442 0.4210 0.5125 -0.0473 0.2908  -0.0395 314 TYR A N   
2433 C CA  . TYR A 317 ? 0.6324 0.4287 0.5382 -0.0624 0.3022  -0.0262 314 TYR A CA  
2434 C C   . TYR A 317 ? 0.6020 0.3854 0.5055 -0.0663 0.2633  -0.0068 314 TYR A C   
2435 O O   . TYR A 317 ? 0.6352 0.3825 0.4801 -0.0791 0.2556  0.0115  314 TYR A O   
2436 C CB  . TYR A 317 ? 0.7028 0.4779 0.5552 -0.0843 0.3418  -0.0185 314 TYR A CB  
2437 C CG  . TYR A 317 ? 0.7375 0.5257 0.5908 -0.0798 0.3880  -0.0406 314 TYR A CG  
2438 C CD1 . TYR A 317 ? 0.7999 0.5476 0.5647 -0.0813 0.4037  -0.0493 314 TYR A CD1 
2439 C CD2 . TYR A 317 ? 0.6999 0.5416 0.6444 -0.0734 0.4154  -0.0548 314 TYR A CD2 
2440 C CE1 . TYR A 317 ? 0.8369 0.5931 0.6007 -0.0751 0.4501  -0.0732 314 TYR A CE1 
2441 C CE2 . TYR A 317 ? 0.7270 0.5843 0.6814 -0.0656 0.4607  -0.0768 314 TYR A CE2 
2442 C CZ  . TYR A 317 ? 0.8042 0.6166 0.6665 -0.0657 0.4802  -0.0868 314 TYR A CZ  
2443 O OH  . TYR A 317 ? 0.8579 0.6829 0.7290 -0.0560 0.5295  -0.1123 314 TYR A OH  
2444 N N   . PRO A 318 ? 0.5432 0.3542 0.5084 -0.0536 0.2381  -0.0114 315 PRO A N   
2445 C CA  . PRO A 318 ? 0.5191 0.3187 0.4841 -0.0524 0.2031  0.0013  315 PRO A CA  
2446 C C   . PRO A 318 ? 0.5300 0.3260 0.5145 -0.0691 0.2073  0.0139  315 PRO A C   
2447 O O   . PRO A 318 ? 0.5339 0.3515 0.5567 -0.0807 0.2330  0.0097  315 PRO A O   
2448 C CB  . PRO A 318 ? 0.4596 0.2893 0.4775 -0.0339 0.1824  -0.0114 315 PRO A CB  
2449 C CG  . PRO A 318 ? 0.4547 0.3207 0.5270 -0.0309 0.2055  -0.0259 315 PRO A CG  
2450 C CD  . PRO A 318 ? 0.5014 0.3565 0.5409 -0.0395 0.2426  -0.0287 315 PRO A CD  
2451 N N   . PHE A 319 ? 0.5362 0.3055 0.5000 -0.0700 0.1823  0.0285  316 PHE A N   
2452 C CA  . PHE A 319 ? 0.5575 0.3094 0.5325 -0.0851 0.1828  0.0417  316 PHE A CA  
2453 C C   . PHE A 319 ? 0.5146 0.2845 0.5440 -0.0766 0.1602  0.0316  316 PHE A C   
2454 O O   . PHE A 319 ? 0.4773 0.2568 0.5114 -0.0582 0.1375  0.0237  316 PHE A O   
2455 C CB  . PHE A 319 ? 0.6015 0.3049 0.5160 -0.0886 0.1685  0.0650  316 PHE A CB  
2456 C CG  . PHE A 319 ? 0.6615 0.3403 0.5062 -0.0977 0.1846  0.0758  316 PHE A CG  
2457 C CD1 . PHE A 319 ? 0.6595 0.3406 0.4697 -0.0862 0.1755  0.0679  316 PHE A CD1 
2458 C CD2 . PHE A 319 ? 0.7368 0.3862 0.5451 -0.1200 0.2093  0.0935  316 PHE A CD2 
2459 C CE1 . PHE A 319 ? 0.7366 0.3906 0.4734 -0.0959 0.1884  0.0745  316 PHE A CE1 
2460 C CE2 . PHE A 319 ? 0.8111 0.4339 0.5425 -0.1293 0.2251  0.1027  316 PHE A CE2 
2461 C CZ  . PHE A 319 ? 0.8009 0.4257 0.4946 -0.1167 0.2134  0.0916  316 PHE A CZ  
2462 N N   . THR A 320 ? 0.5256 0.2994 0.5939 -0.0924 0.1681  0.0307  317 THR A N   
2463 C CA  . THR A 320 ? 0.5069 0.2851 0.6148 -0.0890 0.1458  0.0210  317 THR A CA  
2464 C C   . THR A 320 ? 0.5528 0.2822 0.6417 -0.1017 0.1420  0.0374  317 THR A C   
2465 O O   . THR A 320 ? 0.5984 0.3087 0.6793 -0.1243 0.1637  0.0511  317 THR A O   
2466 C CB  . THR A 320 ? 0.4913 0.3121 0.6661 -0.0989 0.1522  0.0039  317 THR A CB  
2467 O OG1 . THR A 320 ? 0.4595 0.3220 0.6549 -0.0817 0.1500  -0.0101 317 THR A OG1 
2468 C CG2 . THR A 320 ? 0.4799 0.2944 0.6847 -0.1014 0.1278  -0.0068 317 THR A CG2 
2469 N N   . PHE A 321 ? 0.5468 0.2533 0.6269 -0.0867 0.1168  0.0370  318 PHE A N   
2470 C CA  . PHE A 321 ? 0.5954 0.2505 0.6643 -0.0937 0.1097  0.0502  318 PHE A CA  
2471 C C   . PHE A 321 ? 0.5782 0.2251 0.6638 -0.0756 0.0855  0.0352  318 PHE A C   
2472 O O   . PHE A 321 ? 0.5338 0.2138 0.6309 -0.0586 0.0749  0.0179  318 PHE A O   
2473 C CB  . PHE A 321 ? 0.6385 0.2528 0.6504 -0.0912 0.1092  0.0782  318 PHE A CB  
2474 C CG  . PHE A 321 ? 0.6124 0.2391 0.5996 -0.0667 0.0917  0.0789  318 PHE A CG  
2475 C CD1 . PHE A 321 ? 0.5819 0.2324 0.5437 -0.0662 0.1008  0.0791  318 PHE A CD1 
2476 C CD2 . PHE A 321 ? 0.5933 0.2083 0.5865 -0.0450 0.0679  0.0775  318 PHE A CD2 
2477 C CE1 . PHE A 321 ? 0.5690 0.2298 0.5115 -0.0480 0.0833  0.0791  318 PHE A CE1 
2478 C CE2 . PHE A 321 ? 0.5693 0.2020 0.5495 -0.0258 0.0531  0.0784  318 PHE A CE2 
2479 C CZ  . PHE A 321 ? 0.5550 0.2102 0.5098 -0.0291 0.0593  0.0797  318 PHE A CZ  
2480 N N   . ASP A 322 ? 0.6229 0.2207 0.7058 -0.0792 0.0789  0.0422  319 ASP A N   
2481 C CA  . ASP A 322 ? 0.6252 0.2066 0.7222 -0.0627 0.0607  0.0252  319 ASP A CA  
2482 C C   . ASP A 322 ? 0.6375 0.1965 0.7105 -0.0360 0.0476  0.0377  319 ASP A C   
2483 O O   . ASP A 322 ? 0.6700 0.2007 0.7150 -0.0363 0.0472  0.0644  319 ASP A O   
2484 C CB  . ASP A 322 ? 0.6717 0.2090 0.7870 -0.0822 0.0611  0.0206  319 ASP A CB  
2485 C CG  . ASP A 322 ? 0.6550 0.2247 0.8088 -0.1075 0.0679  0.0022  319 ASP A CG  
2486 O OD1 . ASP A 322 ? 0.6098 0.2291 0.7803 -0.0992 0.0615  -0.0176 319 ASP A OD1 
2487 O OD2 . ASP A 322 ? 0.7058 0.2517 0.8757 -0.1364 0.0783  0.0085  319 ASP A OD2 
2488 N N   . VAL A 323 ? 0.6165 0.1903 0.7011 -0.0132 0.0366  0.0186  320 VAL A N   
2489 C CA  . VAL A 323 ? 0.6279 0.1899 0.7064 0.0142  0.0251  0.0261  320 VAL A CA  
2490 C C   . VAL A 323 ? 0.6535 0.1877 0.7500 0.0291  0.0198  0.0053  320 VAL A C   
2491 O O   . VAL A 323 ? 0.6360 0.1868 0.7424 0.0271  0.0219  -0.0217 320 VAL A O   
2492 C CB  . VAL A 323 ? 0.5715 0.1858 0.6482 0.0293  0.0228  0.0218  320 VAL A CB  
2493 C CG1 . VAL A 323 ? 0.5756 0.1885 0.6605 0.0567  0.0118  0.0267  320 VAL A CG1 
2494 C CG2 . VAL A 323 ? 0.5557 0.1900 0.6104 0.0157  0.0280  0.0387  320 VAL A CG2 
2495 N N   . SER A 324 ? 0.7059 0.1949 0.8038 0.0449  0.0120  0.0174  321 SER A N   
2496 C CA  A SER A 324 ? 0.7398 0.1979 0.8550 0.0644  0.0094  -0.0046 321 SER A CA  
2497 C CA  B SER A 324 ? 0.7399 0.1982 0.8552 0.0642  0.0095  -0.0048 321 SER A CA  
2498 C C   . SER A 324 ? 0.7062 0.2088 0.8342 0.0926  0.0104  -0.0198 321 SER A C   
2499 O O   . SER A 324 ? 0.6790 0.2151 0.8096 0.1040  0.0058  -0.0025 321 SER A O   
2500 C CB  A SER A 324 ? 0.8087 0.2012 0.9260 0.0759  0.0005  0.0150  321 SER A CB  
2501 C CB  B SER A 324 ? 0.8101 0.2013 0.9276 0.0753  0.0008  0.0138  321 SER A CB  
2502 O OG  A SER A 324 ? 0.8446 0.1990 0.9791 0.0944  0.0007  -0.0103 321 SER A OG  
2503 O OG  B SER A 324 ? 0.8072 0.2085 0.9372 0.1079  -0.0093 0.0268  321 SER A OG  
2504 N N   . PHE A 325 ? 0.7183 0.2205 0.8523 0.1016  0.0169  -0.0526 322 PHE A N   
2505 C CA  . PHE A 325 ? 0.7015 0.2430 0.8458 0.1271  0.0242  -0.0684 322 PHE A CA  
2506 C C   . PHE A 325 ? 0.7274 0.2587 0.9004 0.1595  0.0215  -0.0589 322 PHE A C   
2507 O O   . PHE A 325 ? 0.7005 0.2751 0.8923 0.1795  0.0285  -0.0641 322 PHE A O   
2508 C CB  . PHE A 325 ? 0.7194 0.2555 0.8520 0.1280  0.0337  -0.1067 322 PHE A CB  
2509 C CG  . PHE A 325 ? 0.7019 0.2630 0.8121 0.1015  0.0320  -0.1161 322 PHE A CG  
2510 C CD1 . PHE A 325 ? 0.7383 0.2680 0.8377 0.0823  0.0267  -0.1370 322 PHE A CD1 
2511 C CD2 . PHE A 325 ? 0.6590 0.2745 0.7631 0.0956  0.0331  -0.1037 322 PHE A CD2 
2512 C CE1 . PHE A 325 ? 0.7194 0.2774 0.8069 0.0597  0.0205  -0.1446 322 PHE A CE1 
2513 C CE2 . PHE A 325 ? 0.6495 0.2875 0.7385 0.0751  0.0291  -0.1108 322 PHE A CE2 
2514 C CZ  . PHE A 325 ? 0.6796 0.2920 0.7627 0.0581  0.0218  -0.1308 322 PHE A CZ  
2515 N N   . ASP A 326 ? 0.7851 0.2597 0.9648 0.1643  0.0111  -0.0434 323 ASP A N   
2516 C CA  . ASP A 326 ? 0.8214 0.2825 1.0332 0.1972  0.0023  -0.0290 323 ASP A CA  
2517 C C   . ASP A 326 ? 0.7974 0.2912 1.0127 0.1975  -0.0144 0.0078  323 ASP A C   
2518 O O   . ASP A 326 ? 0.8247 0.3185 1.0709 0.2247  -0.0280 0.0236  323 ASP A O   
2519 C CB  . ASP A 326 ? 0.9004 0.2777 1.1133 0.2028  -0.0055 -0.0240 323 ASP A CB  
2520 C CG  . ASP A 326 ? 0.9444 0.2804 1.1510 0.2007  0.0080  -0.0634 323 ASP A CG  
2521 O OD1 . ASP A 326 ? 1.0108 0.2781 1.2046 0.1852  0.0032  -0.0620 323 ASP A OD1 
2522 O OD2 . ASP A 326 ? 0.9309 0.3006 1.1415 0.2123  0.0237  -0.0959 323 ASP A OD2 
2523 N N   . ASP A 327 ? 0.7564 0.2762 0.9409 0.1682  -0.0153 0.0202  324 ASP A N   
2524 C CA  . ASP A 327 ? 0.7406 0.2867 0.9166 0.1640  -0.0311 0.0511  324 ASP A CA  
2525 C C   . ASP A 327 ? 0.6747 0.2925 0.8573 0.1610  -0.0254 0.0433  324 ASP A C   
2526 O O   . ASP A 327 ? 0.6607 0.3031 0.8371 0.1569  -0.0395 0.0641  324 ASP A O   
2527 C CB  . ASP A 327 ? 0.7612 0.2755 0.8919 0.1325  -0.0342 0.0731  324 ASP A CB  
2528 C CG  . ASP A 327 ? 0.8400 0.2779 0.9599 0.1306  -0.0406 0.0888  324 ASP A CG  
2529 O OD1 . ASP A 327 ? 0.8805 0.2845 1.0282 0.1560  -0.0454 0.0821  324 ASP A OD1 
2530 O OD2 . ASP A 327 ? 0.8744 0.2835 0.9575 0.1030  -0.0384 0.1076  324 ASP A OD2 
2531 N N   . VAL A 328 ? 0.6423 0.2880 0.8319 0.1614  -0.0063 0.0142  325 VAL A N   
2532 C CA  . VAL A 328 ? 0.5891 0.2954 0.7828 0.1574  0.0013  0.0075  325 VAL A CA  
2533 C C   . VAL A 328 ? 0.5813 0.3139 0.7995 0.1755  0.0201  -0.0191 325 VAL A C   
2534 O O   . VAL A 328 ? 0.6074 0.3099 0.8249 0.1846  0.0307  -0.0406 325 VAL A O   
2535 C CB  . VAL A 328 ? 0.5591 0.2750 0.7157 0.1289  0.0085  0.0033  325 VAL A CB  
2536 C CG1 . VAL A 328 ? 0.5686 0.2696 0.6986 0.1099  -0.0030 0.0279  325 VAL A CG1 
2537 C CG2 . VAL A 328 ? 0.5714 0.2607 0.7143 0.1208  0.0193  -0.0195 325 VAL A CG2 
2538 N N   . THR A 329 ? 0.5486 0.3353 0.7844 0.1779  0.0258  -0.0186 326 THR A N   
2539 C CA  . THR A 329 ? 0.5435 0.3605 0.7918 0.1883  0.0499  -0.0422 326 THR A CA  
2540 C C   . THR A 329 ? 0.5101 0.3521 0.7237 0.1657  0.0591  -0.0462 326 THR A C   
2541 O O   . THR A 329 ? 0.4769 0.3491 0.6928 0.1538  0.0523  -0.0302 326 THR A O   
2542 C CB  . THR A 329 ? 0.5372 0.4012 0.8427 0.2092  0.0537  -0.0377 326 THR A CB  
2543 O OG1 . THR A 329 ? 0.5712 0.4135 0.9142 0.2328  0.0383  -0.0284 326 THR A OG1 
2544 C CG2 . THR A 329 ? 0.5442 0.4345 0.8609 0.2210  0.0860  -0.0636 326 THR A CG2 
2545 N N   . LEU A 330 ? 0.5281 0.3532 0.7079 0.1601  0.0717  -0.0675 327 LEU A N   
2546 C CA  . LEU A 330 ? 0.5106 0.3555 0.6563 0.1430  0.0790  -0.0712 327 LEU A CA  
2547 C C   . LEU A 330 ? 0.5173 0.3973 0.6710 0.1517  0.1022  -0.0803 327 LEU A C   
2548 O O   . LEU A 330 ? 0.5502 0.4256 0.7131 0.1695  0.1196  -0.0995 327 LEU A O   
2549 C CB  . LEU A 330 ? 0.5324 0.3457 0.6374 0.1330  0.0775  -0.0891 327 LEU A CB  
2550 C CG  . LEU A 330 ? 0.5416 0.3196 0.6421 0.1214  0.0603  -0.0846 327 LEU A CG  
2551 C CD1 . LEU A 330 ? 0.5719 0.3294 0.6415 0.1104  0.0576  -0.1054 327 LEU A CD1 
2552 C CD2 . LEU A 330 ? 0.4969 0.2875 0.5988 0.1061  0.0485  -0.0602 327 LEU A CD2 
2553 N N   . CYS A 331 ? 0.4952 0.4073 0.6445 0.1385  0.1050  -0.0672 328 CYS A N   
2554 C CA  . CYS A 331 ? 0.5101 0.4561 0.6645 0.1409  0.1302  -0.0720 328 CYS A CA  
2555 C C   . CYS A 331 ? 0.5049 0.4577 0.6184 0.1204  0.1330  -0.0637 328 CYS A C   
2556 O O   . CYS A 331 ? 0.4877 0.4265 0.5811 0.1068  0.1138  -0.0528 328 CYS A O   
2557 C CB  . CYS A 331 ? 0.4953 0.4835 0.7144 0.1501  0.1339  -0.0608 328 CYS A CB  
2558 S SG  . CYS A 331 ? 0.4709 0.4787 0.7117 0.1320  0.1065  -0.0323 328 CYS A SG  
2559 N N   . LYS A 332 ? 0.5334 0.5061 0.6349 0.1193  0.1589  -0.0683 329 LYS A N   
2560 C CA  . LYS A 332 ? 0.5476 0.5152 0.5983 0.1023  0.1635  -0.0613 329 LYS A CA  
2561 C C   . LYS A 332 ? 0.5612 0.5644 0.6266 0.0953  0.1912  -0.0529 329 LYS A C   
2562 O O   . LYS A 332 ? 0.5900 0.6132 0.6720 0.1067  0.2199  -0.0657 329 LYS A O   
2563 C CB  . LYS A 332 ? 0.5937 0.5289 0.5833 0.1060  0.1670  -0.0808 329 LYS A CB  
2564 C CG  . LYS A 332 ? 0.6354 0.5637 0.5635 0.0938  0.1772  -0.0757 329 LYS A CG  
2565 C CD  . LYS A 332 ? 0.6906 0.5856 0.5545 0.0980  0.1744  -0.0971 329 LYS A CD  
2566 C CE  . LYS A 332 ? 0.6749 0.5444 0.5256 0.0935  0.1375  -0.0978 329 LYS A CE  
2567 N NZ  . LYS A 332 ? 0.7240 0.5651 0.5085 0.0917  0.1264  -0.1138 329 LYS A NZ  
2568 N N   . ILE A 333 ? 0.5503 0.5601 0.6116 0.0760  0.1848  -0.0324 330 ILE A N   
2569 C CA  . ILE A 333 ? 0.5700 0.6097 0.6431 0.0624  0.2107  -0.0210 330 ILE A CA  
2570 C C   . ILE A 333 ? 0.6257 0.6437 0.6264 0.0557  0.2313  -0.0222 330 ILE A C   
2571 O O   . ILE A 333 ? 0.6420 0.6229 0.5866 0.0508  0.2123  -0.0176 330 ILE A O   
2572 C CB  . ILE A 333 ? 0.5444 0.5889 0.6345 0.0411  0.1941  0.0010  330 ILE A CB  
2573 C CG1 . ILE A 333 ? 0.5008 0.5593 0.6462 0.0450  0.1677  0.0035  330 ILE A CG1 
2574 C CG2 . ILE A 333 ? 0.5612 0.6366 0.6697 0.0230  0.2226  0.0128  330 ILE A CG2 
2575 C CD1 . ILE A 333 ? 0.4992 0.5365 0.6317 0.0280  0.1414  0.0177  330 ILE A CD1 
2576 N N   . GLY A 334 ? 0.6640 0.7063 0.6662 0.0556  0.2700  -0.0273 331 GLY A N   
2577 C CA  . GLY A 334 ? 0.7299 0.7491 0.6525 0.0495  0.2934  -0.0290 331 GLY A CA  
2578 C C   . GLY A 334 ? 0.7636 0.7539 0.6373 0.0683  0.2923  -0.0559 331 GLY A C   
2579 O O   . GLY A 334 ? 0.8288 0.7999 0.6315 0.0667  0.3133  -0.0637 331 GLY A O   
2580 N N   . THR A 354 ? 0.7848 1.0074 0.9193 -0.0307 0.4479  0.0259  351 THR A N   
2581 C CA  . THR A 354 ? 0.7632 0.9449 0.8576 -0.0025 0.4139  0.0078  351 THR A CA  
2582 C C   . THR A 354 ? 0.6925 0.9020 0.8740 0.0160  0.3799  -0.0014 351 THR A C   
2583 O O   . THR A 354 ? 0.6516 0.8801 0.8874 0.0015  0.3551  0.0135  351 THR A O   
2584 C CB  . THR A 354 ? 0.7776 0.8899 0.7801 -0.0121 0.3795  0.0219  351 THR A CB  
2585 O OG1 . THR A 354 ? 0.7215 0.8276 0.7590 -0.0244 0.3406  0.0380  351 THR A OG1 
2586 C CG2 . THR A 354 ? 0.8514 0.9356 0.7723 -0.0342 0.4085  0.0397  351 THR A CG2 
2587 N N   . LYS A 355 ? 0.6864 0.8918 0.8735 0.0470  0.3777  -0.0258 352 LYS A N   
2588 C CA  . LYS A 355 ? 0.6370 0.8746 0.9118 0.0690  0.3575  -0.0351 352 LYS A CA  
2589 C C   . LYS A 355 ? 0.6135 0.8032 0.8588 0.0890  0.3186  -0.0460 352 LYS A C   
2590 O O   . LYS A 355 ? 0.6244 0.7621 0.7900 0.0841  0.3039  -0.0465 352 LYS A O   
2591 C CB  . LYS A 355 ? 0.6628 0.9490 0.9965 0.0910  0.4003  -0.0551 352 LYS A CB  
2592 C CG  . LYS A 355 ? 0.6949 1.0318 1.0566 0.0714  0.4496  -0.0477 352 LYS A CG  
2593 C CD  . LYS A 355 ? 0.7158 1.1068 1.1486 0.0973  0.4932  -0.0700 352 LYS A CD  
2594 C CE  . LYS A 355 ? 0.7657 1.1999 1.2062 0.0765  0.5531  -0.0656 352 LYS A CE  
2595 N NZ  . LYS A 355 ? 0.8035 1.2892 1.3077 0.1049  0.6035  -0.0919 352 LYS A NZ  
2596 N N   . LEU A 356 ? 0.5834 0.7920 0.8966 0.1111  0.3017  -0.0532 353 LEU A N   
2597 C CA  . LEU A 356 ? 0.5666 0.7310 0.8606 0.1279  0.2670  -0.0609 353 LEU A CA  
2598 C C   . LEU A 356 ? 0.6058 0.7420 0.8727 0.1537  0.2851  -0.0893 353 LEU A C   
2599 O O   . LEU A 356 ? 0.6307 0.7958 0.9361 0.1722  0.3184  -0.1054 353 LEU A O   
2600 C CB  . LEU A 356 ? 0.5261 0.7140 0.8964 0.1375  0.2355  -0.0507 353 LEU A CB  
2601 C CG  . LEU A 356 ? 0.5151 0.6539 0.8604 0.1467  0.1980  -0.0506 353 LEU A CG  
2602 C CD1 . LEU A 356 ? 0.4941 0.5981 0.7788 0.1223  0.1749  -0.0374 353 LEU A CD1 
2603 C CD2 . LEU A 356 ? 0.5017 0.6616 0.9173 0.1604  0.1710  -0.0406 353 LEU A CD2 
2604 N N   . VAL A 357 ? 0.6115 0.6919 0.8154 0.1541  0.2631  -0.0966 354 VAL A N   
2605 C CA  . VAL A 357 ? 0.6557 0.6975 0.8233 0.1732  0.2727  -0.1251 354 VAL A CA  
2606 C C   . VAL A 357 ? 0.6360 0.6367 0.8039 0.1796  0.2345  -0.1257 354 VAL A C   
2607 O O   . VAL A 357 ? 0.6032 0.5864 0.7464 0.1620  0.2054  -0.1096 354 VAL A O   
2608 C CB  . VAL A 357 ? 0.7035 0.7122 0.7757 0.1601  0.2850  -0.1358 354 VAL A CB  
2609 C CG1 . VAL A 357 ? 0.7701 0.7518 0.8097 0.1798  0.3090  -0.1708 354 VAL A CG1 
2610 C CG2 . VAL A 357 ? 0.7214 0.7598 0.7739 0.1403  0.3111  -0.1200 354 VAL A CG2 
2611 N N   . ILE A 358 ? 0.6594 0.6428 0.8558 0.2046  0.2368  -0.1439 355 ILE A N   
2612 C CA  . ILE A 358 ? 0.6537 0.5931 0.8509 0.2092  0.2039  -0.1430 355 ILE A CA  
2613 C C   . ILE A 358 ? 0.6893 0.5752 0.8141 0.2010  0.1977  -0.1631 355 ILE A C   
2614 O O   . ILE A 358 ? 0.7485 0.6138 0.8432 0.2119  0.2195  -0.1919 355 ILE A O   
2615 C CB  . ILE A 358 ? 0.6720 0.6063 0.9314 0.2399  0.2049  -0.1512 355 ILE A CB  
2616 C CG1 . ILE A 358 ? 0.6390 0.6302 0.9785 0.2483  0.2014  -0.1293 355 ILE A CG1 
2617 C CG2 . ILE A 358 ? 0.6814 0.5609 0.9317 0.2406  0.1730  -0.1477 355 ILE A CG2 
2618 C CD1 . ILE A 358 ? 0.5917 0.5891 0.9365 0.2282  0.1648  -0.0977 355 ILE A CD1 
2619 N N   . MET A 359 ? 0.6617 0.5266 0.7607 0.1814  0.1680  -0.1496 356 MET A N   
2620 C CA  . MET A 359 ? 0.6897 0.5126 0.7302 0.1698  0.1559  -0.1660 356 MET A CA  
2621 C C   . MET A 359 ? 0.7124 0.4887 0.7636 0.1777  0.1422  -0.1800 356 MET A C   
2622 O O   . MET A 359 ? 0.6895 0.4604 0.7845 0.1833  0.1290  -0.1643 356 MET A O   
2623 C CB  . MET A 359 ? 0.6497 0.4760 0.6690 0.1462  0.1314  -0.1456 356 MET A CB  
2624 C CG  . MET A 359 ? 0.6399 0.4977 0.6384 0.1348  0.1396  -0.1308 356 MET A CG  
2625 S SD  . MET A 359 ? 0.6167 0.4687 0.5968 0.1134  0.1091  -0.1118 356 MET A SD  
2626 C CE  . MET A 359 ? 0.6726 0.4938 0.5906 0.1072  0.0985  -0.1347 356 MET A CE  
2627 N N   . GLU A 360 ? 0.7656 0.5042 0.7713 0.1756  0.1433  -0.2086 357 GLU A N   
2628 C CA  . GLU A 360 ? 0.7995 0.4861 0.8081 0.1759  0.1278  -0.2235 357 GLU A CA  
2629 C C   . GLU A 360 ? 0.7696 0.4477 0.7588 0.1483  0.0991  -0.2130 357 GLU A C   
2630 O O   . GLU A 360 ? 0.7677 0.4598 0.7162 0.1342  0.0935  -0.2156 357 GLU A O   
2631 C CB  . GLU A 360 ? 0.8798 0.5272 0.8493 0.1862  0.1431  -0.2646 357 GLU A CB  
2632 C CG  . GLU A 360 ? 0.9295 0.5903 0.9163 0.2156  0.1797  -0.2804 357 GLU A CG  
2633 C CD  . GLU A 360 ? 0.9403 0.5977 1.0007 0.2408  0.1823  -0.2705 357 GLU A CD  
2634 O OE1 . GLU A 360 ? 0.9501 0.6402 1.0483 0.2650  0.2093  -0.2730 357 GLU A OE1 
2635 O OE2 . GLU A 360 ? 0.9501 0.5730 1.0323 0.2365  0.1573  -0.2591 357 GLU A OE2 
2636 N N   . PRO A 361 ? 0.7506 0.4066 0.7702 0.1408  0.0814  -0.1998 358 PRO A N   
2637 C CA  . PRO A 361 ? 0.7268 0.3817 0.7378 0.1145  0.0590  -0.1905 358 PRO A CA  
2638 C C   . PRO A 361 ? 0.7667 0.4034 0.7344 0.1013  0.0489  -0.2190 358 PRO A C   
2639 O O   . PRO A 361 ? 0.8230 0.4176 0.7758 0.1048  0.0501  -0.2473 358 PRO A O   
2640 C CB  . PRO A 361 ? 0.7340 0.3542 0.7781 0.1096  0.0491  -0.1792 358 PRO A CB  
2641 C CG  . PRO A 361 ? 0.7774 0.3641 0.8366 0.1343  0.0613  -0.1916 358 PRO A CG  
2642 C CD  . PRO A 361 ? 0.7666 0.3923 0.8264 0.1559  0.0817  -0.1943 358 PRO A CD  
2643 N N   . SER A 362 ? 0.7409 0.4075 0.6879 0.0872  0.0370  -0.2118 359 SER A N   
2644 C CA  . SER A 362 ? 0.7811 0.4389 0.6813 0.0764  0.0227  -0.2353 359 SER A CA  
2645 C C   . SER A 362 ? 0.7441 0.4220 0.6585 0.0549  -0.0039 -0.2235 359 SER A C   
2646 O O   . SER A 362 ? 0.6889 0.3910 0.6411 0.0506  -0.0045 -0.1972 359 SER A O   
2647 C CB  . SER A 362 ? 0.7970 0.4752 0.6495 0.0868  0.0370  -0.2376 359 SER A CB  
2648 O OG  . SER A 362 ? 0.8614 0.5226 0.6555 0.0786  0.0227  -0.2622 359 SER A OG  
2649 N N   . ALA A 363 ? 0.7792 0.4484 0.6638 0.0420  -0.0264 -0.2442 360 ALA A N   
2650 C CA  . ALA A 363 ? 0.7500 0.4451 0.6570 0.0235  -0.0540 -0.2354 360 ALA A CA  
2651 C C   . ALA A 363 ? 0.7009 0.4374 0.6021 0.0302  -0.0548 -0.2097 360 ALA A C   
2652 O O   . ALA A 363 ? 0.6596 0.4248 0.5980 0.0219  -0.0677 -0.1934 360 ALA A O   
2653 C CB  . ALA A 363 ? 0.8120 0.4901 0.6879 0.0088  -0.0833 -0.2651 360 ALA A CB  
2654 N N   . ASP A 364 ? 0.7075 0.4449 0.5644 0.0451  -0.0381 -0.2067 361 ASP A N   
2655 C CA  . ASP A 364 ? 0.6826 0.4478 0.5216 0.0502  -0.0390 -0.1842 361 ASP A CA  
2656 C C   . ASP A 364 ? 0.6070 0.3948 0.4857 0.0558  -0.0214 -0.1560 361 ASP A C   
2657 O O   . ASP A 364 ? 0.5897 0.3953 0.4573 0.0588  -0.0219 -0.1371 361 ASP A O   
2658 C CB  . ASP A 364 ? 0.7383 0.4916 0.5069 0.0593  -0.0263 -0.1921 361 ASP A CB  
2659 C CG  . ASP A 364 ? 0.8298 0.5599 0.5412 0.0524  -0.0493 -0.2188 361 ASP A CG  
2660 O OD1 . ASP A 364 ? 0.8631 0.5949 0.5957 0.0396  -0.0815 -0.2271 361 ASP A OD1 
2661 O OD2 . ASP A 364 ? 0.9063 0.6175 0.5511 0.0584  -0.0352 -0.2323 361 ASP A OD2 
2662 N N   . ILE A 365 ? 0.5667 0.3493 0.4868 0.0567  -0.0078 -0.1526 362 ILE A N   
2663 C CA  . ILE A 365 ? 0.5027 0.3046 0.4580 0.0585  0.0026  -0.1271 362 ILE A CA  
2664 C C   . ILE A 365 ? 0.4684 0.2857 0.4583 0.0470  -0.0119 -0.1168 362 ILE A C   
2665 O O   . ILE A 365 ? 0.4337 0.2665 0.4429 0.0474  -0.0054 -0.0976 362 ILE A O   
2666 C CB  . ILE A 365 ? 0.4914 0.2815 0.4722 0.0654  0.0200  -0.1239 362 ILE A CB  
2667 C CG1 . ILE A 365 ? 0.4934 0.2617 0.5032 0.0557  0.0126  -0.1291 362 ILE A CG1 
2668 C CG2 . ILE A 365 ? 0.5172 0.2967 0.4747 0.0799  0.0375  -0.1380 362 ILE A CG2 
2669 C CD1 . ILE A 365 ? 0.4896 0.2380 0.5204 0.0643  0.0246  -0.1231 362 ILE A CD1 
2670 N N   . LYS A 366 ? 0.4814 0.2954 0.4806 0.0360  -0.0307 -0.1313 363 LYS A N   
2671 C CA  . LYS A 366 ? 0.4569 0.2918 0.4993 0.0243  -0.0418 -0.1248 363 LYS A CA  
2672 C C   . LYS A 366 ? 0.4250 0.2881 0.4703 0.0310  -0.0476 -0.1090 363 LYS A C   
2673 O O   . LYS A 366 ? 0.4411 0.3065 0.4524 0.0383  -0.0599 -0.1096 363 LYS A O   
2674 C CB  . LYS A 366 ? 0.4940 0.3258 0.5472 0.0103  -0.0648 -0.1458 363 LYS A CB  
2675 C CG  . LYS A 366 ? 0.4844 0.3404 0.5966 -0.0055 -0.0721 -0.1425 363 LYS A CG  
2676 C CD  . LYS A 366 ? 0.5358 0.3907 0.6612 -0.0222 -0.0987 -0.1655 363 LYS A CD  
2677 C CE  . LYS A 366 ? 0.5311 0.4056 0.7243 -0.0437 -0.0983 -0.1643 363 LYS A CE  
2678 N NZ  . LYS A 366 ? 0.5847 0.4488 0.7923 -0.0652 -0.1220 -0.1887 363 LYS A NZ  
2679 N N   . HIS A 367 ? 0.3820 0.2608 0.4632 0.0286  -0.0376 -0.0949 364 HIS A N   
2680 C CA  . HIS A 367 ? 0.3609 0.2602 0.4506 0.0367  -0.0392 -0.0813 364 HIS A CA  
2681 C C   . HIS A 367 ? 0.3505 0.2400 0.4074 0.0472  -0.0259 -0.0671 364 HIS A C   
2682 O O   . HIS A 367 ? 0.3354 0.2328 0.3957 0.0537  -0.0260 -0.0560 364 HIS A O   
2683 C CB  . HIS A 367 ? 0.3813 0.2974 0.4727 0.0409  -0.0668 -0.0861 364 HIS A CB  
2684 C CG  . HIS A 367 ? 0.3930 0.3271 0.5268 0.0283  -0.0843 -0.1005 364 HIS A CG  
2685 N ND1 . HIS A 367 ? 0.3739 0.3259 0.5637 0.0170  -0.0724 -0.1002 364 HIS A ND1 
2686 C CD2 . HIS A 367 ? 0.4249 0.3621 0.5531 0.0226  -0.1129 -0.1160 364 HIS A CD2 
2687 C CE1 . HIS A 367 ? 0.3847 0.3535 0.6100 0.0036  -0.0918 -0.1144 364 HIS A CE1 
2688 N NE2 . HIS A 367 ? 0.4270 0.3869 0.6159 0.0068  -0.1193 -0.1251 364 HIS A NE2 
2689 N N   . HIS A 368 ? 0.3528 0.2253 0.3832 0.0488  -0.0144 -0.0683 365 HIS A N   
2690 C CA  . HIS A 368 ? 0.3455 0.2142 0.3538 0.0551  -0.0013 -0.0554 365 HIS A CA  
2691 C C   . HIS A 368 ? 0.3223 0.1913 0.3503 0.0519  0.0121  -0.0448 365 HIS A C   
2692 O O   . HIS A 368 ? 0.3288 0.1928 0.3755 0.0463  0.0163  -0.0471 365 HIS A O   
2693 C CB  . HIS A 368 ? 0.3616 0.2201 0.3409 0.0592  0.0073  -0.0620 365 HIS A CB  
2694 C CG  . HIS A 368 ? 0.3820 0.2359 0.3207 0.0625  -0.0016 -0.0681 365 HIS A CG  
2695 N ND1 . HIS A 368 ? 0.3695 0.2224 0.2762 0.0656  0.0041  -0.0557 365 HIS A ND1 
2696 C CD2 . HIS A 368 ? 0.4017 0.2485 0.3210 0.0611  -0.0177 -0.0844 365 HIS A CD2 
2697 C CE1 . HIS A 368 ? 0.4303 0.2742 0.2941 0.0671  -0.0068 -0.0622 365 HIS A CE1 
2698 N NE2 . HIS A 368 ? 0.4353 0.2761 0.3050 0.0648  -0.0218 -0.0810 365 HIS A NE2 
2699 N N   . LEU A 369 ? 0.3166 0.1868 0.3353 0.0540  0.0175  -0.0326 366 LEU A N   
2700 C CA  . LEU A 369 ? 0.2992 0.1667 0.3242 0.0502  0.0276  -0.0236 366 LEU A CA  
2701 C C   . LEU A 369 ? 0.3029 0.1703 0.3247 0.0523  0.0341  -0.0228 366 LEU A C   
2702 O O   . LEU A 369 ? 0.3102 0.1809 0.3184 0.0568  0.0373  -0.0260 366 LEU A O   
2703 C CB  . LEU A 369 ? 0.2967 0.1618 0.3124 0.0497  0.0294  -0.0137 366 LEU A CB  
2704 C CG  . LEU A 369 ? 0.3047 0.1686 0.3291 0.0521  0.0260  -0.0141 366 LEU A CG  
2705 C CD1 . LEU A 369 ? 0.3136 0.1648 0.3245 0.0515  0.0291  -0.0057 366 LEU A CD1 
2706 C CD2 . LEU A 369 ? 0.2887 0.1565 0.3348 0.0475  0.0321  -0.0190 366 LEU A CD2 
2707 N N   . PHE A 370 ? 0.2982 0.1621 0.3327 0.0499  0.0363  -0.0179 367 PHE A N   
2708 C CA  . PHE A 370 ? 0.2991 0.1683 0.3418 0.0543  0.0397  -0.0140 367 PHE A CA  
2709 C C   . PHE A 370 ? 0.2944 0.1654 0.3399 0.0478  0.0363  -0.0014 367 PHE A C   
2710 O O   . PHE A 370 ? 0.3063 0.1654 0.3457 0.0417  0.0334  0.0023  367 PHE A O   
2711 C CB  . PHE A 370 ? 0.3081 0.1658 0.3635 0.0602  0.0390  -0.0199 367 PHE A CB  
2712 C CG  . PHE A 370 ? 0.3186 0.1731 0.3691 0.0679  0.0432  -0.0358 367 PHE A CG  
2713 C CD1 . PHE A 370 ? 0.3245 0.1708 0.3629 0.0638  0.0380  -0.0473 367 PHE A CD1 
2714 C CD2 . PHE A 370 ? 0.3253 0.1863 0.3841 0.0794  0.0521  -0.0411 367 PHE A CD2 
2715 C CE1 . PHE A 370 ? 0.3396 0.1783 0.3638 0.0692  0.0392  -0.0645 367 PHE A CE1 
2716 C CE2 . PHE A 370 ? 0.3478 0.2009 0.3932 0.0866  0.0590  -0.0594 367 PHE A CE2 
2717 C CZ  . PHE A 370 ? 0.3562 0.1953 0.3791 0.0805  0.0512  -0.0714 367 PHE A CZ  
2718 N N   . ALA A 371 ? 0.2920 0.1784 0.3457 0.0475  0.0374  0.0041  368 ALA A N   
2719 C CA  . ALA A 371 ? 0.2916 0.1809 0.3486 0.0395  0.0289  0.0144  368 ALA A CA  
2720 C C   . ALA A 371 ? 0.3008 0.1935 0.3776 0.0462  0.0202  0.0199  368 ALA A C   
2721 O O   . ALA A 371 ? 0.2986 0.2025 0.3986 0.0583  0.0245  0.0160  368 ALA A O   
2722 C CB  . ALA A 371 ? 0.2818 0.1881 0.3454 0.0326  0.0316  0.0182  368 ALA A CB  
2723 N N   . PHE A 372 ? 0.3217 0.2015 0.3863 0.0397  0.0077  0.0289  369 PHE A N   
2724 C CA  . PHE A 372 ? 0.3464 0.2283 0.4274 0.0461  -0.0072 0.0391  369 PHE A CA  
2725 C C   . PHE A 372 ? 0.3453 0.2577 0.4525 0.0431  -0.0180 0.0443  369 PHE A C   
2726 O O   . PHE A 372 ? 0.3565 0.2669 0.4457 0.0284  -0.0282 0.0480  369 PHE A O   
2727 C CB  . PHE A 372 ? 0.3753 0.2279 0.4224 0.0382  -0.0180 0.0492  369 PHE A CB  
2728 C CG  . PHE A 372 ? 0.3930 0.2190 0.4227 0.0377  -0.0061 0.0461  369 PHE A CG  
2729 C CD1 . PHE A 372 ? 0.3896 0.2031 0.3911 0.0259  0.0052  0.0413  369 PHE A CD1 
2730 C CD2 . PHE A 372 ? 0.4099 0.2235 0.4563 0.0487  -0.0056 0.0469  369 PHE A CD2 
2731 C CE1 . PHE A 372 ? 0.4034 0.2003 0.3997 0.0229  0.0171  0.0383  369 PHE A CE1 
2732 C CE2 . PHE A 372 ? 0.4232 0.2125 0.4581 0.0437  0.0045  0.0438  369 PHE A CE2 
2733 C CZ  . PHE A 372 ? 0.4132 0.1979 0.4257 0.0296  0.0161  0.0400  369 PHE A CZ  
2734 N N   . SER A 373 ? 0.3434 0.2845 0.4955 0.0562  -0.0151 0.0430  370 SER A N   
2735 C CA  . SER A 373 ? 0.3419 0.3226 0.5334 0.0519  -0.0224 0.0472  370 SER A CA  
2736 C C   . SER A 373 ? 0.3704 0.3553 0.5719 0.0503  -0.0536 0.0608  370 SER A C   
2737 O O   . SER A 373 ? 0.3909 0.3552 0.5861 0.0624  -0.0666 0.0687  370 SER A O   
2738 C CB  . SER A 373 ? 0.3332 0.3481 0.5754 0.0683  -0.0055 0.0406  370 SER A CB  
2739 O OG  . SER A 373 ? 0.3270 0.3871 0.6142 0.0602  -0.0068 0.0441  370 SER A OG  
2740 N N   . ARG A 374 ? 0.3814 0.3899 0.5964 0.0340  -0.0679 0.0643  371 ARG A N   
2741 C CA  . ARG A 374 ? 0.4160 0.4357 0.6451 0.0315  -0.1038 0.0768  371 ARG A CA  
2742 C C   . ARG A 374 ? 0.4149 0.4813 0.7218 0.0516  -0.1128 0.0822  371 ARG A C   
2743 O O   . ARG A 374 ? 0.4397 0.5152 0.7653 0.0578  -0.1467 0.0951  371 ARG A O   
2744 C CB  . ARG A 374 ? 0.4310 0.4572 0.6465 0.0041  -0.1198 0.0759  371 ARG A CB  
2745 C CG  . ARG A 374 ? 0.4666 0.4405 0.6027 -0.0112 -0.1170 0.0710  371 ARG A CG  
2746 C CD  . ARG A 374 ? 0.5164 0.4865 0.6324 -0.0378 -0.1347 0.0670  371 ARG A CD  
2747 N NE  . ARG A 374 ? 0.5716 0.4893 0.6085 -0.0482 -0.1381 0.0627  371 ARG A NE  
2748 C CZ  . ARG A 374 ? 0.6306 0.5258 0.6240 -0.0517 -0.1647 0.0701  371 ARG A CZ  
2749 N NH1 . ARG A 374 ? 0.6548 0.5739 0.6777 -0.0443 -0.1968 0.0847  371 ARG A NH1 
2750 N NH2 . ARG A 374 ? 0.6755 0.5230 0.5935 -0.0618 -0.1590 0.0634  371 ARG A NH2 
2751 N N   . SER A 375 ? 0.3932 0.4884 0.7435 0.0630  -0.0826 0.0721  372 SER A N   
2752 C CA  . SER A 375 ? 0.3962 0.5348 0.8239 0.0876  -0.0810 0.0726  372 SER A CA  
2753 C C   . SER A 375 ? 0.4161 0.5195 0.8348 0.1146  -0.0886 0.0770  372 SER A C   
2754 O O   . SER A 375 ? 0.4248 0.4829 0.7937 0.1172  -0.0713 0.0703  372 SER A O   
2755 C CB  . SER A 375 ? 0.3729 0.5414 0.8317 0.0915  -0.0391 0.0578  372 SER A CB  
2756 O OG  . SER A 375 ? 0.3905 0.5937 0.9180 0.1199  -0.0294 0.0536  372 SER A OG  
2757 N N   . THR A 376 ? 0.4388 0.5620 0.9084 0.1341  -0.1164 0.0890  373 THR A N   
2758 C CA  . THR A 376 ? 0.4701 0.5509 0.9297 0.1595  -0.1288 0.0977  373 THR A CA  
2759 C C   . THR A 376 ? 0.4628 0.5454 0.9606 0.1874  -0.0960 0.0811  373 THR A C   
2760 O O   . THR A 376 ? 0.4844 0.5145 0.9508 0.2003  -0.0906 0.0796  373 THR A O   
2761 C CB  . THR A 376 ? 0.5064 0.5994 1.0019 0.1735  -0.1765 0.1201  373 THR A CB  
2762 O OG1 . THR A 376 ? 0.5068 0.6575 1.1030 0.2009  -0.1753 0.1166  373 THR A OG1 
2763 C CG2 . THR A 376 ? 0.5139 0.6216 0.9851 0.1447  -0.2106 0.1315  373 THR A CG2 
2764 N N   . LYS A 377 ? 0.4384 0.5794 1.0016 0.1946  -0.0725 0.0678  374 LYS A N   
2765 C CA  . LYS A 377 ? 0.4391 0.5836 1.0304 0.2186  -0.0344 0.0468  374 LYS A CA  
2766 C C   . LYS A 377 ? 0.4140 0.5602 0.9649 0.1986  0.0054  0.0284  374 LYS A C   
2767 O O   . LYS A 377 ? 0.3944 0.5591 0.9262 0.1702  0.0060  0.0326  374 LYS A O   
2768 C CB  . LYS A 377 ? 0.4456 0.6560 1.1417 0.2451  -0.0306 0.0439  374 LYS A CB  
2769 C CG  . LYS A 377 ? 0.4744 0.6837 1.2189 0.2720  -0.0727 0.0629  374 LYS A CG  
2770 C CD  . LYS A 377 ? 0.4754 0.7652 1.3379 0.2961  -0.0723 0.0610  374 LYS A CD  
2771 C CE  . LYS A 377 ? 0.5073 0.8025 1.4194 0.3197  -0.1256 0.0852  374 LYS A CE  
2772 N NZ  . LYS A 377 ? 0.5040 0.8904 1.5447 0.3415  -0.1300 0.0845  374 LYS A NZ  
2773 N N   . ALA A 378 ? 0.4237 0.5453 0.9581 0.2136  0.0364  0.0082  375 ALA A N   
2774 C CA  . ALA A 378 ? 0.4111 0.5314 0.9037 0.1988  0.0725  -0.0091 375 ALA A CA  
2775 C C   . ALA A 378 ? 0.4122 0.5929 0.9622 0.2064  0.1066  -0.0208 375 ALA A C   
2776 O O   . ALA A 378 ? 0.4348 0.6105 0.9844 0.2240  0.1395  -0.0422 375 ALA A O   
2777 C CB  . ALA A 378 ? 0.4312 0.4934 0.8712 0.2086  0.0861  -0.0269 375 ALA A CB  
2778 N N   . ASP A 379 ? 0.3955 0.6320 0.9927 0.1910  0.1005  -0.0079 376 ASP A N   
2779 C CA  . ASP A 379 ? 0.4002 0.7043 1.0658 0.1945  0.1342  -0.0158 376 ASP A CA  
2780 C C   . ASP A 379 ? 0.3858 0.7161 1.0349 0.1567  0.1467  -0.0077 376 ASP A C   
2781 O O   . ASP A 379 ? 0.3799 0.6663 0.9509 0.1338  0.1405  -0.0032 376 ASP A O   
2782 C CB  . ASP A 379 ? 0.4031 0.7620 1.1742 0.2173  0.1142  -0.0081 376 ASP A CB  
2783 C CG  . ASP A 379 ? 0.3863 0.7574 1.1731 0.1990  0.0631  0.0162  376 ASP A CG  
2784 O OD1 . ASP A 379 ? 0.3791 0.7114 1.0928 0.1705  0.0462  0.0251  376 ASP A OD1 
2785 O OD2 . ASP A 379 ? 0.3879 0.8071 1.2600 0.2143  0.0386  0.0254  376 ASP A OD2 
2786 N N   . GLU A 380 ? 0.3872 0.7881 1.1136 0.1505  0.1645  -0.0056 377 GLU A N   
2787 C CA  . GLU A 380 ? 0.3834 0.8085 1.1023 0.1124  0.1777  0.0036  377 GLU A CA  
2788 C C   . GLU A 380 ? 0.3640 0.7657 1.0526 0.0843  0.1329  0.0213  377 GLU A C   
2789 O O   . GLU A 380 ? 0.3652 0.7551 1.0150 0.0526  0.1399  0.0279  377 GLU A O   
2790 C CB  . GLU A 380 ? 0.3871 0.9001 1.2120 0.1079  0.2009  0.0046  377 GLU A CB  
2791 C CG  . GLU A 380 ? 0.4174 0.9706 1.3008 0.1407  0.2447  -0.0142 377 GLU A CG  
2792 C CD  . GLU A 380 ? 0.4175 1.0263 1.4150 0.1716  0.2213  -0.0136 377 GLU A CD  
2793 O OE1 . GLU A 380 ? 0.4192 0.9971 1.4111 0.1859  0.1714  -0.0047 377 GLU A OE1 
2794 O OE2 . GLU A 380 ? 0.4248 1.1088 1.5186 0.1821  0.2535  -0.0208 377 GLU A OE2 
2795 N N   . ASN A 381 ? 0.3561 0.7480 1.0599 0.0961  0.0879  0.0290  378 ASN A N   
2796 C CA  . ASN A 381 ? 0.3502 0.7167 1.0189 0.0713  0.0459  0.0429  378 ASN A CA  
2797 C C   . ASN A 381 ? 0.3479 0.6428 0.9115 0.0571  0.0489  0.0414  378 ASN A C   
2798 O O   . ASN A 381 ? 0.3455 0.6219 0.8749 0.0296  0.0332  0.0485  378 ASN A O   
2799 C CB  . ASN A 381 ? 0.3551 0.7171 1.0458 0.0890  -0.0014 0.0523  378 ASN A CB  
2800 C CG  . ASN A 381 ? 0.3761 0.8140 1.1791 0.1007  -0.0172 0.0575  378 ASN A CG  
2801 O OD1 . ASN A 381 ? 0.3803 0.8759 1.2553 0.1085  0.0167  0.0493  378 ASN A OD1 
2802 N ND2 . ASN A 381 ? 0.4073 0.8472 1.2260 0.1025  -0.0691 0.0712  378 ASN A ND2 
2803 N N   . VAL A 382 ? 0.3516 0.6074 0.8687 0.0763  0.0684  0.0308  379 VAL A N   
2804 C CA  . VAL A 382 ? 0.3534 0.5463 0.7814 0.0673  0.0677  0.0289  379 VAL A CA  
2805 C C   . VAL A 382 ? 0.3591 0.5439 0.7496 0.0398  0.0851  0.0314  379 VAL A C   
2806 O O   . VAL A 382 ? 0.3593 0.5058 0.6987 0.0239  0.0699  0.0362  379 VAL A O   
2807 C CB  . VAL A 382 ? 0.3624 0.5220 0.7572 0.0911  0.0856  0.0148  379 VAL A CB  
2808 C CG1 . VAL A 382 ? 0.3628 0.4712 0.6777 0.0799  0.0890  0.0116  379 VAL A CG1 
2809 C CG2 . VAL A 382 ? 0.3645 0.5084 0.7774 0.1145  0.0621  0.0158  379 VAL A CG2 
2810 N N   . LEU A 383 ? 0.3739 0.5935 0.7912 0.0349  0.1182  0.0287  380 LEU A N   
2811 C CA  . LEU A 383 ? 0.3891 0.5974 0.7693 0.0095  0.1388  0.0341  380 LEU A CA  
2812 C C   . LEU A 383 ? 0.3812 0.5773 0.7542 -0.0194 0.1137  0.0463  380 LEU A C   
2813 O O   . LEU A 383 ? 0.3932 0.5410 0.7037 -0.0309 0.1095  0.0495  380 LEU A O   
2814 C CB  . LEU A 383 ? 0.4122 0.6709 0.8374 0.0049  0.1789  0.0328  380 LEU A CB  
2815 C CG  . LEU A 383 ? 0.4579 0.6902 0.8188 -0.0044 0.2142  0.0329  380 LEU A CG  
2816 C CD1 . LEU A 383 ? 0.4861 0.6992 0.8103 0.0241  0.2321  0.0154  380 LEU A CD1 
2817 C CD2 . LEU A 383 ? 0.4895 0.7666 0.8887 -0.0266 0.2502  0.0408  380 LEU A CD2 
2818 N N   . LYS A 384 ? 0.3658 0.6048 0.8043 -0.0300 0.0951  0.0515  381 LYS A N   
2819 C CA  . LYS A 384 ? 0.3687 0.5974 0.8041 -0.0602 0.0697  0.0595  381 LYS A CA  
2820 C C   . LYS A 384 ? 0.3535 0.5676 0.7836 -0.0563 0.0249  0.0597  381 LYS A C   
2821 O O   . LYS A 384 ? 0.3648 0.5868 0.8119 -0.0792 -0.0012 0.0635  381 LYS A O   
2822 C CB  . LYS A 384 ? 0.3815 0.6678 0.8895 -0.0856 0.0811  0.0657  381 LYS A CB  
2823 C CG  . LYS A 384 ? 0.4125 0.6902 0.8975 -0.1051 0.1223  0.0711  381 LYS A CG  
2824 C CD  . LYS A 384 ? 0.4420 0.7660 0.9924 -0.1409 0.1310  0.0798  381 LYS A CD  
2825 C CE  . LYS A 384 ? 0.4800 0.7758 0.9882 -0.1660 0.1685  0.0903  381 LYS A CE  
2826 N NZ  . LYS A 384 ? 0.4825 0.7951 1.0321 -0.2107 0.1695  0.1012  381 LYS A NZ  
2827 N N   . SER A 385 ? 0.3312 0.5195 0.7317 -0.0299 0.0162  0.0556  382 SER A N   
2828 C CA  . SER A 385 ? 0.3303 0.4906 0.7030 -0.0277 -0.0211 0.0578  382 SER A CA  
2829 C C   . SER A 385 ? 0.3304 0.4271 0.6210 -0.0352 -0.0204 0.0544  382 SER A C   
2830 O O   . SER A 385 ? 0.3162 0.3887 0.5732 -0.0251 0.0026  0.0499  382 SER A O   
2831 C CB  . SER A 385 ? 0.3237 0.4863 0.7098 0.0032  -0.0303 0.0580  382 SER A CB  
2832 O OG  . SER A 385 ? 0.3378 0.5560 0.8031 0.0127  -0.0443 0.0628  382 SER A OG  
2833 N N   . PRO A 386 ? 0.3457 0.4161 0.6047 -0.0520 -0.0465 0.0551  383 PRO A N   
2834 C CA  . PRO A 386 ? 0.3523 0.3649 0.5393 -0.0528 -0.0438 0.0498  383 PRO A CA  
2835 C C   . PRO A 386 ? 0.3427 0.3373 0.5065 -0.0291 -0.0431 0.0492  383 PRO A C   
2836 O O   . PRO A 386 ? 0.3290 0.3484 0.5278 -0.0124 -0.0480 0.0534  383 PRO A O   
2837 C CB  . PRO A 386 ? 0.3852 0.3760 0.5448 -0.0742 -0.0718 0.0479  383 PRO A CB  
2838 C CG  . PRO A 386 ? 0.3988 0.4376 0.6177 -0.0873 -0.0944 0.0533  383 PRO A CG  
2839 C CD  . PRO A 386 ? 0.3673 0.4595 0.6538 -0.0691 -0.0803 0.0589  383 PRO A CD  
2840 N N   . VAL A 387 ? 0.3492 0.3007 0.4592 -0.0279 -0.0365 0.0440  384 VAL A N   
2841 C CA  . VAL A 387 ? 0.3487 0.2814 0.4378 -0.0106 -0.0324 0.0434  384 VAL A CA  
2842 C C   . VAL A 387 ? 0.3819 0.2791 0.4218 -0.0173 -0.0455 0.0436  384 VAL A C   
2843 O O   . VAL A 387 ? 0.4023 0.2805 0.4132 -0.0329 -0.0507 0.0388  384 VAL A O   
2844 C CB  . VAL A 387 ? 0.3335 0.2540 0.4100 -0.0014 -0.0077 0.0364  384 VAL A CB  
2845 C CG1 . VAL A 387 ? 0.3227 0.2730 0.4332 0.0029  0.0077  0.0360  384 VAL A CG1 
2846 C CG2 . VAL A 387 ? 0.3312 0.2214 0.3704 -0.0113 -0.0016 0.0310  384 VAL A CG2 
2847 N N   . PHE A 388 ? 0.3932 0.2781 0.4210 -0.0061 -0.0487 0.0486  385 PHE A N   
2848 C CA  . PHE A 388 ? 0.4285 0.2784 0.4040 -0.0126 -0.0551 0.0506  385 PHE A CA  
2849 C C   . PHE A 388 ? 0.4264 0.2513 0.3706 -0.0149 -0.0313 0.0394  385 PHE A C   
2850 O O   . PHE A 388 ? 0.4557 0.2541 0.3560 -0.0249 -0.0298 0.0347  385 PHE A O   
2851 C CB  . PHE A 388 ? 0.4458 0.2862 0.4191 -0.0010 -0.0616 0.0623  385 PHE A CB  
2852 C CG  . PHE A 388 ? 0.4694 0.3243 0.4622 0.0029  -0.0917 0.0764  385 PHE A CG  
2853 C CD1 . PHE A 388 ? 0.4737 0.3547 0.5219 0.0213  -0.0954 0.0817  385 PHE A CD1 
2854 C CD2 . PHE A 388 ? 0.5283 0.3687 0.4824 -0.0100 -0.1178 0.0837  385 PHE A CD2 
2855 C CE1 . PHE A 388 ? 0.4994 0.3971 0.5756 0.0294  -0.1260 0.0959  385 PHE A CE1 
2856 C CE2 . PHE A 388 ? 0.5603 0.4162 0.5349 -0.0049 -0.1523 0.0988  385 PHE A CE2 
2857 C CZ  . PHE A 388 ? 0.5417 0.4286 0.5829 0.0162  -0.1569 0.1058  385 PHE A CZ  
2858 N N   . GLY A 389 ? 0.3969 0.2314 0.3646 -0.0046 -0.0134 0.0342  386 GLY A N   
2859 C CA  . GLY A 389 ? 0.3854 0.2043 0.3376 -0.0027 0.0057  0.0251  386 GLY A CA  
2860 C C   . GLY A 389 ? 0.3588 0.1914 0.3395 0.0096  0.0157  0.0227  386 GLY A C   
2861 O O   . GLY A 389 ? 0.3360 0.1877 0.3434 0.0163  0.0117  0.0253  386 GLY A O   
2862 N N   . PHE A 390 ? 0.3535 0.1781 0.3301 0.0123  0.0287  0.0160  387 PHE A N   
2863 C CA  . PHE A 390 ? 0.3363 0.1717 0.3353 0.0214  0.0344  0.0106  387 PHE A CA  
2864 C C   . PHE A 390 ? 0.3503 0.1776 0.3520 0.0202  0.0413  0.0090  387 PHE A C   
2865 O O   . PHE A 390 ? 0.3738 0.1874 0.3573 0.0123  0.0475  0.0119  387 PHE A O   
2866 C CB  . PHE A 390 ? 0.3296 0.1691 0.3313 0.0249  0.0392  0.0037  387 PHE A CB  
2867 C CG  . PHE A 390 ? 0.3290 0.1736 0.3293 0.0238  0.0353  0.0072  387 PHE A CG  
2868 C CD1 . PHE A 390 ? 0.3421 0.1762 0.3285 0.0145  0.0322  0.0097  387 PHE A CD1 
2869 C CD2 . PHE A 390 ? 0.3200 0.1777 0.3301 0.0295  0.0361  0.0074  387 PHE A CD2 
2870 C CE1 . PHE A 390 ? 0.3510 0.1893 0.3406 0.0090  0.0297  0.0140  387 PHE A CE1 
2871 C CE2 . PHE A 390 ? 0.3327 0.1957 0.3415 0.0252  0.0372  0.0126  387 PHE A CE2 
2872 C CZ  . PHE A 390 ? 0.3394 0.1935 0.3416 0.0139  0.0338  0.0169  387 PHE A CZ  
2873 N N   . CYS A 391 ? 0.3417 0.1760 0.3634 0.0260  0.0413  0.0035  388 CYS A N   
2874 C CA  . CYS A 391 ? 0.3467 0.1769 0.3802 0.0221  0.0473  -0.0010 388 CYS A CA  
2875 C C   . CYS A 391 ? 0.3356 0.1806 0.3870 0.0279  0.0441  -0.0130 388 CYS A C   
2876 O O   . CYS A 391 ? 0.3313 0.1837 0.3780 0.0355  0.0386  -0.0152 388 CYS A O   
2877 C CB  . CYS A 391 ? 0.3674 0.1806 0.4028 0.0206  0.0441  0.0051  388 CYS A CB  
2878 S SG  . CYS A 391 ? 0.3630 0.1783 0.4138 0.0338  0.0357  -0.0017 388 CYS A SG  
2879 N N   . LEU A 392 ? 0.3362 0.1859 0.4067 0.0224  0.0472  -0.0197 389 LEU A N   
2880 C CA  . LEU A 392 ? 0.3321 0.1965 0.4205 0.0259  0.0382  -0.0315 389 LEU A CA  
2881 C C   . LEU A 392 ? 0.3466 0.2019 0.4487 0.0184  0.0348  -0.0387 389 LEU A C   
2882 O O   . LEU A 392 ? 0.3593 0.2069 0.4737 0.0065  0.0435  -0.0352 389 LEU A O   
2883 C CB  . LEU A 392 ? 0.3264 0.2099 0.4378 0.0253  0.0413  -0.0351 389 LEU A CB  
2884 C CG  . LEU A 392 ? 0.3293 0.2332 0.4648 0.0294  0.0258  -0.0455 389 LEU A CG  
2885 C CD1 . LEU A 392 ? 0.3102 0.2101 0.4184 0.0409  0.0110  -0.0456 389 LEU A CD1 
2886 C CD2 . LEU A 392 ? 0.3122 0.2395 0.4822 0.0323  0.0306  -0.0475 389 LEU A CD2 
2887 N N   . VAL A 393 ? 0.3552 0.2068 0.4505 0.0241  0.0239  -0.0490 390 VAL A N   
2888 C CA  . VAL A 393 ? 0.3774 0.2142 0.4831 0.0168  0.0186  -0.0604 390 VAL A CA  
2889 C C   . VAL A 393 ? 0.3856 0.2415 0.5192 0.0069  0.0086  -0.0714 390 VAL A C   
2890 O O   . VAL A 393 ? 0.3847 0.2568 0.5141 0.0132  -0.0056 -0.0793 390 VAL A O   
2891 C CB  . VAL A 393 ? 0.3970 0.2200 0.4802 0.0274  0.0129  -0.0717 390 VAL A CB  
2892 C CG1 . VAL A 393 ? 0.4214 0.2203 0.5122 0.0198  0.0073  -0.0871 390 VAL A CG1 
2893 C CG2 . VAL A 393 ? 0.3835 0.1986 0.4532 0.0387  0.0226  -0.0608 390 VAL A CG2 
2894 N N   . THR A 394 ? 0.3979 0.2528 0.5609 -0.0094 0.0154  -0.0704 391 THR A N   
2895 C CA  . THR A 394 ? 0.4056 0.2880 0.6108 -0.0216 0.0072  -0.0802 391 THR A CA  
2896 C C   . THR A 394 ? 0.4397 0.3088 0.6564 -0.0348 -0.0090 -0.0980 391 THR A C   
2897 O O   . THR A 394 ? 0.4452 0.3381 0.6842 -0.0392 -0.0292 -0.1115 391 THR A O   
2898 C CB  . THR A 394 ? 0.4014 0.2981 0.6393 -0.0352 0.0289  -0.0698 391 THR A CB  
2899 O OG1 . THR A 394 ? 0.4234 0.2853 0.6497 -0.0486 0.0435  -0.0604 391 THR A OG1 
2900 C CG2 . THR A 394 ? 0.3769 0.2865 0.6017 -0.0218 0.0421  -0.0587 391 THR A CG2 
2901 N N   . GLU A 395 ? 0.4691 0.2977 0.6704 -0.0408 -0.0030 -0.0986 392 GLU A N   
2902 C CA  . GLU A 395 ? 0.5112 0.3148 0.7157 -0.0526 -0.0177 -0.1185 392 GLU A CA  
2903 C C   . GLU A 395 ? 0.5335 0.2927 0.6973 -0.0385 -0.0150 -0.1230 392 GLU A C   
2904 O O   . GLU A 395 ? 0.5231 0.2709 0.6699 -0.0254 -0.0007 -0.1063 392 GLU A O   
2905 C CB  . GLU A 395 ? 0.5366 0.3290 0.7807 -0.0805 -0.0104 -0.1167 392 GLU A CB  
2906 C CG  . GLU A 395 ? 0.5258 0.3661 0.8217 -0.0958 -0.0027 -0.1096 392 GLU A CG  
2907 C CD  . GLU A 395 ? 0.5292 0.4138 0.8615 -0.1000 -0.0283 -0.1277 392 GLU A CD  
2908 O OE1 . GLU A 395 ? 0.5583 0.4283 0.8774 -0.1026 -0.0537 -0.1482 392 GLU A OE1 
2909 O OE2 . GLU A 395 ? 0.4970 0.4304 0.8710 -0.0998 -0.0238 -0.1221 392 GLU A OE2 
2910 N N   . VAL A 396 ? 0.5752 0.3104 0.7255 -0.0407 -0.0294 -0.1469 393 VAL A N   
2911 C CA  . VAL A 396 ? 0.6109 0.3002 0.7302 -0.0268 -0.0239 -0.1564 393 VAL A CA  
2912 C C   . VAL A 396 ? 0.6690 0.3137 0.7966 -0.0444 -0.0327 -0.1771 393 VAL A C   
2913 O O   . VAL A 396 ? 0.6979 0.3449 0.8225 -0.0562 -0.0523 -0.2015 393 VAL A O   
2914 C CB  . VAL A 396 ? 0.6170 0.3136 0.6940 -0.0057 -0.0277 -0.1705 393 VAL A CB  
2915 C CG1 . VAL A 396 ? 0.6497 0.3075 0.7045 0.0129  -0.0143 -0.1785 393 VAL A CG1 
2916 C CG2 . VAL A 396 ? 0.5662 0.3051 0.6367 0.0062  -0.0223 -0.1511 393 VAL A CG2 
2917 N N   . ASP A 397 ? 0.6931 0.2940 0.8296 -0.0473 -0.0209 -0.1666 394 ASP A N   
2918 C CA  . ASP A 397 ? 0.7587 0.3041 0.9007 -0.0630 -0.0273 -0.1850 394 ASP A CA  
2919 C C   . ASP A 397 ? 0.8030 0.2992 0.9141 -0.0373 -0.0219 -0.1999 394 ASP A C   
2920 O O   . ASP A 397 ? 0.8051 0.2768 0.9167 -0.0203 -0.0089 -0.1810 394 ASP A O   
2921 C CB  . ASP A 397 ? 0.7734 0.2934 0.9462 -0.0861 -0.0177 -0.1624 394 ASP A CB  
2922 C CG  . ASP A 397 ? 0.8418 0.3064 1.0272 -0.1111 -0.0268 -0.1819 394 ASP A CG  
2923 O OD1 . ASP A 397 ? 0.8642 0.3282 1.0842 -0.1433 -0.0242 -0.1712 394 ASP A OD1 
2924 O OD2 . ASP A 397 ? 0.8877 0.3082 1.0487 -0.1000 -0.0347 -0.2095 394 ASP A OD2 
2925 N N   . LEU A 398 ? 0.8455 0.3271 0.9298 -0.0342 -0.0327 -0.2348 395 LEU A N   
2926 C CA  . LEU A 398 ? 0.8901 0.3344 0.9425 -0.0062 -0.0229 -0.2547 395 LEU A CA  
2927 C C   . LEU A 398 ? 0.9615 0.3300 1.0235 -0.0064 -0.0192 -0.2628 395 LEU A C   
2928 O O   . LEU A 398 ? 0.9761 0.3185 1.0377 0.0218  -0.0046 -0.2564 395 LEU A O   
2929 C CB  . LEU A 398 ? 0.9221 0.3733 0.9308 -0.0039 -0.0334 -0.2905 395 LEU A CB  
2930 C CG  . LEU A 398 ? 0.8649 0.3830 0.8575 0.0008  -0.0370 -0.2791 395 LEU A CG  
2931 C CD1 . LEU A 398 ? 0.8977 0.4186 0.8431 -0.0054 -0.0556 -0.3105 395 LEU A CD1 
2932 C CD2 . LEU A 398 ? 0.8282 0.3688 0.8121 0.0309  -0.0132 -0.2609 395 LEU A CD2 
2933 N N   . GLU A 399 ? 1.0102 0.3431 1.0856 -0.0380 -0.0331 -0.2756 396 GLU A N   
2934 C CA  . GLU A 399 ? 1.0881 0.3392 1.1727 -0.0416 -0.0304 -0.2809 396 GLU A CA  
2935 C C   . GLU A 399 ? 1.0696 0.3054 1.1783 -0.0325 -0.0171 -0.2373 396 GLU A C   
2936 O O   . GLU A 399 ? 1.1127 0.2986 1.2184 -0.0056 -0.0087 -0.2346 396 GLU A O   
2937 C CB  . GLU A 399 ? 1.1432 0.3606 1.2427 -0.0842 -0.0485 -0.3002 396 GLU A CB  
2938 C CG  . GLU A 399 ? 1.1072 0.3700 1.2490 -0.1199 -0.0528 -0.2719 396 GLU A CG  
2939 C CD  . GLU A 399 ? 1.1688 0.4043 1.3372 -0.1648 -0.0695 -0.2900 396 GLU A CD  
2940 O OE1 . GLU A 399 ? 1.2509 0.4113 1.4056 -0.1714 -0.0766 -0.3181 396 GLU A OE1 
2941 O OE2 . GLU A 399 ? 1.1445 0.4349 1.3519 -0.1940 -0.0747 -0.2766 396 GLU A OE2 
2942 N N   . LYS A 400 ? 1.0130 0.2922 1.1436 -0.0524 -0.0155 -0.2038 397 LYS A N   
2943 C CA  . LYS A 400 ? 1.0007 0.2658 1.1420 -0.0475 -0.0048 -0.1611 397 LYS A CA  
2944 C C   . LYS A 400 ? 0.9484 0.2460 1.0787 -0.0086 0.0029  -0.1448 397 LYS A C   
2945 O O   . LYS A 400 ? 0.9463 0.2289 1.0794 0.0019  0.0070  -0.1117 397 LYS A O   
2946 C CB  . LYS A 400 ? 0.9643 0.2690 1.1257 -0.0807 -0.0009 -0.1340 397 LYS A CB  
2947 C CG  . LYS A 400 ? 1.0246 0.3030 1.2106 -0.1241 -0.0056 -0.1431 397 LYS A CG  
2948 C CD  . LYS A 400 ? 1.0044 0.3250 1.2151 -0.1540 0.0061  -0.1134 397 LYS A CD  
2949 C CE  . LYS A 400 ? 1.0550 0.3658 1.3031 -0.2005 0.0026  -0.1246 397 LYS A CE  
2950 N NZ  . LYS A 400 ? 1.0301 0.3942 1.2980 -0.2096 -0.0164 -0.1604 397 LYS A NZ  
2951 N N   . ARG A 401 ? 0.9066 0.2486 1.0231 0.0103  0.0035  -0.1669 398 ARG A N   
2952 C CA  . ARG A 401 ? 0.8587 0.2400 0.9709 0.0430  0.0118  -0.1543 398 ARG A CA  
2953 C C   . ARG A 401 ? 0.7934 0.2175 0.9130 0.0354  0.0135  -0.1158 398 ARG A C   
2954 O O   . ARG A 401 ? 0.7788 0.2041 0.9023 0.0545  0.0157  -0.0915 398 ARG A O   
2955 C CB  . ARG A 401 ? 0.9056 0.2403 1.0239 0.0767  0.0170  -0.1562 398 ARG A CB  
2956 C CG  . ARG A 401 ? 0.9705 0.2718 1.0750 0.0915  0.0216  -0.2005 398 ARG A CG  
2957 C CD  . ARG A 401 ? 1.0333 0.2864 1.1528 0.1286  0.0294  -0.2051 398 ARG A CD  
2958 N NE  . ARG A 401 ? 1.0022 0.2999 1.1441 0.1578  0.0351  -0.1787 398 ARG A NE  
2959 C CZ  . ARG A 401 ? 0.9654 0.3257 1.1072 0.1754  0.0472  -0.1862 398 ARG A CZ  
2960 N NH1 . ARG A 401 ? 0.9729 0.3570 1.0851 0.1689  0.0561  -0.2175 398 ARG A NH1 
2961 N NH2 . ARG A 401 ? 0.9237 0.3230 1.0939 0.1978  0.0490  -0.1609 398 ARG A NH2 
2962 N N   . THR A 402 ? 0.7561 0.2149 0.8786 0.0077  0.0115  -0.1125 399 THR A N   
2963 C CA  . THR A 402 ? 0.7071 0.2070 0.8321 -0.0002 0.0163  -0.0825 399 THR A CA  
2964 C C   . THR A 402 ? 0.6521 0.2149 0.7766 -0.0059 0.0152  -0.0922 399 THR A C   
2965 O O   . THR A 402 ? 0.6562 0.2287 0.7817 -0.0143 0.0072  -0.1177 399 THR A O   
2966 C CB  . THR A 402 ? 0.7321 0.2063 0.8665 -0.0301 0.0206  -0.0606 399 THR A CB  
2967 O OG1 . THR A 402 ? 0.7307 0.2130 0.8842 -0.0588 0.0178  -0.0794 399 THR A OG1 
2968 C CG2 . THR A 402 ? 0.7998 0.2007 0.9302 -0.0260 0.0195  -0.0467 399 THR A CG2 
2969 N N   . MET A 403 ? 0.6083 0.2097 0.7284 -0.0005 0.0206  -0.0720 400 MET A N   
2970 C CA  . MET A 403 ? 0.5709 0.2247 0.6940 -0.0074 0.0201  -0.0754 400 MET A CA  
2971 C C   . MET A 403 ? 0.5520 0.2213 0.6829 -0.0233 0.0298  -0.0523 400 MET A C   
2972 O O   . MET A 403 ? 0.5750 0.2220 0.6945 -0.0225 0.0362  -0.0301 400 MET A O   
2973 C CB  . MET A 403 ? 0.5411 0.2269 0.6476 0.0148  0.0199  -0.0784 400 MET A CB  
2974 C CG  . MET A 403 ? 0.5429 0.2279 0.6421 0.0321  0.0252  -0.0588 400 MET A CG  
2975 S SD  . MET A 403 ? 0.5454 0.2770 0.6328 0.0472  0.0274  -0.0592 400 MET A SD  
2976 C CE  . MET A 403 ? 0.5215 0.2565 0.6098 0.0550  0.0286  -0.0319 400 MET A CE  
2977 N N   . SER A 404 ? 0.5221 0.2279 0.6718 -0.0374 0.0307  -0.0582 401 SER A N   
2978 C CA  . SER A 404 ? 0.5010 0.2287 0.6581 -0.0492 0.0451  -0.0410 401 SER A CA  
2979 C C   . SER A 404 ? 0.4535 0.2142 0.5953 -0.0316 0.0454  -0.0375 401 SER A C   
2980 O O   . SER A 404 ? 0.4249 0.2097 0.5691 -0.0215 0.0348  -0.0516 401 SER A O   
2981 C CB  . SER A 404 ? 0.5003 0.2559 0.6981 -0.0712 0.0476  -0.0508 401 SER A CB  
2982 O OG  . SER A 404 ? 0.5462 0.2709 0.7623 -0.0914 0.0447  -0.0574 401 SER A OG  
2983 N N   . ILE A 405 ? 0.4492 0.2064 0.5704 -0.0296 0.0562  -0.0186 402 ILE A N   
2984 C CA  . ILE A 405 ? 0.4175 0.2008 0.5243 -0.0170 0.0570  -0.0158 402 ILE A CA  
2985 C C   . ILE A 405 ? 0.4144 0.2112 0.5191 -0.0270 0.0742  -0.0074 402 ILE A C   
2986 O O   . ILE A 405 ? 0.4410 0.2191 0.5372 -0.0417 0.0880  0.0045  402 ILE A O   
2987 C CB  . ILE A 405 ? 0.4188 0.1881 0.4983 -0.0015 0.0502  -0.0057 402 ILE A CB  
2988 C CG1 . ILE A 405 ? 0.4561 0.1930 0.5146 -0.0073 0.0535  0.0147  402 ILE A CG1 
2989 C CG2 . ILE A 405 ? 0.4131 0.1763 0.4979 0.0122  0.0391  -0.0179 402 ILE A CG2 
2990 C CD1 . ILE A 405 ? 0.4550 0.1903 0.4918 0.0060  0.0439  0.0266  402 ILE A CD1 
2991 N N   . LEU A 406 ? 0.3893 0.2147 0.4985 -0.0187 0.0751  -0.0139 403 LEU A N   
2992 C CA  . LEU A 406 ? 0.3944 0.2280 0.4938 -0.0223 0.0929  -0.0090 403 LEU A CA  
2993 C C   . LEU A 406 ? 0.4079 0.2241 0.4642 -0.0142 0.0882  0.0008  403 LEU A C   
2994 O O   . LEU A 406 ? 0.3889 0.2098 0.4410 -0.0017 0.0736  -0.0019 403 LEU A O   
2995 C CB  . LEU A 406 ? 0.3692 0.2371 0.4986 -0.0144 0.0940  -0.0217 403 LEU A CB  
2996 C CG  . LEU A 406 ? 0.3676 0.2468 0.4989 -0.0159 0.1169  -0.0228 403 LEU A CG  
2997 C CD1 . LEU A 406 ? 0.3854 0.2701 0.5379 -0.0351 0.1410  -0.0208 403 LEU A CD1 
2998 C CD2 . LEU A 406 ? 0.3265 0.2352 0.4903 -0.0008 0.1111  -0.0345 403 LEU A CD2 
2999 N N   . CYS A 407 ? 0.4522 0.2488 0.4753 -0.0232 0.1001  0.0123  404 CYS A N   
3000 C CA  . CYS A 407 ? 0.4777 0.2559 0.4591 -0.0189 0.0897  0.0226  404 CYS A CA  
3001 C C   . CYS A 407 ? 0.5141 0.2809 0.4556 -0.0274 0.1056  0.0254  404 CYS A C   
3002 O O   . CYS A 407 ? 0.5501 0.3078 0.4812 -0.0406 0.1268  0.0294  404 CYS A O   
3003 C CB  . CYS A 407 ? 0.5002 0.2517 0.4683 -0.0201 0.0767  0.0381  404 CYS A CB  
3004 S SG  . CYS A 407 ? 0.5346 0.2762 0.4727 -0.0107 0.0530  0.0501  404 CYS A SG  
3005 N N   . PRO A 408 ? 0.5247 0.2898 0.4415 -0.0219 0.0974  0.0222  405 PRO A N   
3006 C CA  . PRO A 408 ? 0.5722 0.3202 0.4423 -0.0300 0.1120  0.0203  405 PRO A CA  
3007 C C   . PRO A 408 ? 0.6338 0.3497 0.4507 -0.0432 0.1120  0.0377  405 PRO A C   
3008 O O   . PRO A 408 ? 0.6821 0.3812 0.4561 -0.0537 0.1329  0.0364  405 PRO A O   
3009 C CB  . PRO A 408 ? 0.5590 0.3062 0.4151 -0.0234 0.0950  0.0139  405 PRO A CB  
3010 C CG  . PRO A 408 ? 0.5066 0.2778 0.4098 -0.0114 0.0819  0.0102  405 PRO A CG  
3011 C CD  . PRO A 408 ? 0.4907 0.2681 0.4204 -0.0102 0.0774  0.0181  405 PRO A CD  
3012 N N   . GLN A 409 ? 0.6462 0.3514 0.4636 -0.0414 0.0896  0.0541  406 GLN A N   
3013 C CA  . GLN A 409 ? 0.7163 0.3860 0.4831 -0.0520 0.0844  0.0756  406 GLN A CA  
3014 C C   . GLN A 409 ? 0.7258 0.3819 0.5146 -0.0546 0.0853  0.0901  406 GLN A C   
3015 O O   . GLN A 409 ? 0.6809 0.3561 0.5252 -0.0472 0.0846  0.0815  406 GLN A O   
3016 C CB  . GLN A 409 ? 0.7404 0.3992 0.4762 -0.0473 0.0506  0.0858  406 GLN A CB  
3017 C CG  . GLN A 409 ? 0.7150 0.3954 0.5023 -0.0310 0.0241  0.0872  406 GLN A CG  
3018 C CD  . GLN A 409 ? 0.7656 0.4418 0.5316 -0.0281 -0.0097 0.0988  406 GLN A CD  
3019 O OE1 . GLN A 409 ? 0.7817 0.4615 0.5220 -0.0342 -0.0171 0.0908  406 GLN A OE1 
3020 N NE2 . GLN A 409 ? 0.7890 0.4570 0.5691 -0.0186 -0.0321 0.1170  406 GLN A NE2 
3021 N N   . ARG A 410 ? 0.7928 0.4099 0.5307 -0.0663 0.0856  0.1123  407 ARG A N   
3022 C CA  . ARG A 410 ? 0.8248 0.4147 0.5692 -0.0747 0.0918  0.1295  407 ARG A CA  
3023 C C   . ARG A 410 ? 0.8017 0.3856 0.5856 -0.0580 0.0632  0.1361  407 ARG A C   
3024 O O   . ARG A 410 ? 0.8000 0.3757 0.6201 -0.0604 0.0700  0.1354  407 ARG A O   
3025 C CB  . ARG A 410 ? 0.9211 0.4630 0.5857 -0.0909 0.0960  0.1558  407 ARG A CB  
3026 C CG  . ARG A 410 ? 0.9850 0.4900 0.6415 -0.1080 0.1134  0.1763  407 ARG A CG  
3027 C CD  . ARG A 410 ? 1.1074 0.5626 0.6702 -0.1249 0.1188  0.2040  407 ARG A CD  
3028 N NE  . ARG A 410 ? 1.1464 0.6137 0.6638 -0.1379 0.1501  0.1904  407 ARG A NE  
3029 C CZ  . ARG A 410 ? 1.1803 0.6535 0.6961 -0.1582 0.1976  0.1846  407 ARG A CZ  
3030 N NH1 . ARG A 410 ? 1.1848 0.6542 0.7432 -0.1724 0.2183  0.1925  407 ARG A NH1 
3031 N NH2 . ARG A 410 ? 1.2114 0.6951 0.6861 -0.1651 0.2259  0.1691  407 ARG A NH2 
3032 N N   . THR A 411 ? 0.7910 0.3785 0.5698 -0.0419 0.0321  0.1412  408 THR A N   
3033 C CA  . THR A 411 ? 0.7652 0.3541 0.5879 -0.0215 0.0077  0.1439  408 THR A CA  
3034 C C   . THR A 411 ? 0.6992 0.3335 0.5576 -0.0059 -0.0048 0.1256  408 THR A C   
3035 O O   . THR A 411 ? 0.6948 0.3473 0.5321 -0.0107 -0.0058 0.1191  408 THR A O   
3036 C CB  . THR A 411 ? 0.8303 0.3799 0.6220 -0.0146 -0.0206 0.1735  408 THR A CB  
3037 O OG1 . THR A 411 ? 0.8659 0.4135 0.6026 -0.0206 -0.0353 0.1835  408 THR A OG1 
3038 C CG2 . THR A 411 ? 0.8872 0.3832 0.6522 -0.0278 -0.0095 0.1948  408 THR A CG2 
3039 N N   . ILE A 412 ? 0.6557 0.3051 0.5661 0.0113  -0.0122 0.1166  409 ILE A N   
3040 C CA  . ILE A 412 ? 0.5944 0.2866 0.5402 0.0244  -0.0192 0.1006  409 ILE A CA  
3041 C C   . ILE A 412 ? 0.6011 0.3032 0.5358 0.0295  -0.0454 0.1131  409 ILE A C   
3042 O O   . ILE A 412 ? 0.6462 0.3254 0.5701 0.0359  -0.0665 0.1334  409 ILE A O   
3043 C CB  . ILE A 412 ? 0.5702 0.2727 0.5669 0.0424  -0.0187 0.0883  409 ILE A CB  
3044 C CG1 . ILE A 412 ? 0.6139 0.2891 0.6239 0.0584  -0.0365 0.1040  409 ILE A CG1 
3045 C CG2 . ILE A 412 ? 0.5587 0.2545 0.5652 0.0342  0.0021  0.0725  409 ILE A CG2 
3046 C CD1 . ILE A 412 ? 0.6044 0.2825 0.6595 0.0769  -0.0315 0.0879  409 ILE A CD1 
3047 N N   . PRO A 413 ? 0.5633 0.2968 0.5000 0.0254  -0.0467 0.1019  410 PRO A N   
3048 C CA  . PRO A 413 ? 0.5706 0.3190 0.5050 0.0270  -0.0746 0.1110  410 PRO A CA  
3049 C C   . PRO A 413 ? 0.5397 0.3217 0.5372 0.0467  -0.0898 0.1109  410 PRO A C   
3050 O O   . PRO A 413 ? 0.5560 0.3555 0.5652 0.0494  -0.1169 0.1205  410 PRO A O   
3051 C CB  . PRO A 413 ? 0.5524 0.3174 0.4694 0.0127  -0.0663 0.0962  410 PRO A CB  
3052 C CG  . PRO A 413 ? 0.5138 0.2900 0.4531 0.0144  -0.0380 0.0784  410 PRO A CG  
3053 C CD  . PRO A 413 ? 0.5243 0.2758 0.4613 0.0169  -0.0249 0.0824  410 PRO A CD  
3054 N N   A SER A 414 ? 0.5042 0.2965 0.5423 0.0599  -0.0724 0.0988  411 SER A N   
3055 N N   B SER A 414 ? 0.5036 0.2965 0.5420 0.0599  -0.0724 0.0986  411 SER A N   
3056 C CA  A SER A 414 ? 0.4859 0.3098 0.5846 0.0806  -0.0784 0.0953  411 SER A CA  
3057 C CA  B SER A 414 ? 0.4873 0.3104 0.5858 0.0809  -0.0791 0.0960  411 SER A CA  
3058 C C   A SER A 414 ? 0.4782 0.2887 0.5988 0.0948  -0.0591 0.0834  411 SER A C   
3059 C C   B SER A 414 ? 0.4791 0.2888 0.5991 0.0948  -0.0595 0.0838  411 SER A C   
3060 O O   A SER A 414 ? 0.4692 0.2647 0.5686 0.0851  -0.0393 0.0716  411 SER A O   
3061 O O   B SER A 414 ? 0.4708 0.2647 0.5688 0.0849  -0.0399 0.0724  411 SER A O   
3062 C CB  A SER A 414 ? 0.4466 0.3174 0.5724 0.0755  -0.0723 0.0829  411 SER A CB  
3063 C CB  B SER A 414 ? 0.4486 0.3202 0.5776 0.0770  -0.0743 0.0841  411 SER A CB  
3064 O OG  A SER A 414 ? 0.4259 0.3294 0.6099 0.0941  -0.0644 0.0745  411 SER A OG  
3065 O OG  B SER A 414 ? 0.4130 0.2942 0.5517 0.0783  -0.0465 0.0654  411 SER A OG  
3066 N N   . LYS A 415 ? 0.4886 0.3050 0.6540 0.1182  -0.0660 0.0848  412 LYS A N   
3067 C CA  . LYS A 415 ? 0.4910 0.2898 0.6761 0.1334  -0.0486 0.0697  412 LYS A CA  
3068 C C   . LYS A 415 ? 0.4499 0.2876 0.6645 0.1401  -0.0259 0.0459  412 LYS A C   
3069 O O   . LYS A 415 ? 0.4582 0.2828 0.6842 0.1527  -0.0103 0.0288  412 LYS A O   
3070 C CB  . LYS A 415 ? 0.5366 0.3142 0.7537 0.1589  -0.0650 0.0812  412 LYS A CB  
3071 C CG  . LYS A 415 ? 0.5950 0.3252 0.7752 0.1531  -0.0888 0.1093  412 LYS A CG  
3072 C CD  . LYS A 415 ? 0.6555 0.3511 0.8656 0.1810  -0.1038 0.1208  412 LYS A CD  
3073 C CE  . LYS A 415 ? 0.7236 0.3723 0.8922 0.1756  -0.1322 0.1551  412 LYS A CE  
3074 N NZ  . LYS A 415 ? 0.7792 0.3806 0.9706 0.2025  -0.1478 0.1696  412 LYS A NZ  
3075 N N   . VAL A 416 ? 0.4166 0.2969 0.6382 0.1301  -0.0238 0.0448  413 VAL A N   
3076 C CA  . VAL A 416 ? 0.3887 0.3040 0.6295 0.1322  -0.0004 0.0267  413 VAL A CA  
3077 C C   . VAL A 416 ? 0.3692 0.2795 0.5659 0.1103  0.0104  0.0204  413 VAL A C   
3078 O O   . VAL A 416 ? 0.3628 0.2843 0.5457 0.0942  0.0027  0.0290  413 VAL A O   
3079 C CB  . VAL A 416 ? 0.3751 0.3443 0.6661 0.1361  -0.0045 0.0319  413 VAL A CB  
3080 C CG1 . VAL A 416 ? 0.3433 0.3458 0.6529 0.1383  0.0255  0.0149  413 VAL A CG1 
3081 C CG2 . VAL A 416 ? 0.3964 0.3741 0.7386 0.1600  -0.0226 0.0416  413 VAL A CG2 
3082 N N   . LEU A 417 ? 0.3693 0.2599 0.5445 0.1107  0.0257  0.0048  414 LEU A N   
3083 C CA  . LEU A 417 ? 0.3548 0.2381 0.4926 0.0939  0.0320  -0.0003 414 LEU A CA  
3084 C C   . LEU A 417 ? 0.3452 0.2507 0.4800 0.0945  0.0495  -0.0123 414 LEU A C   
3085 O O   . LEU A 417 ? 0.3668 0.2700 0.5046 0.1063  0.0623  -0.0273 414 LEU A O   
3086 C CB  . LEU A 417 ? 0.3665 0.2142 0.4829 0.0906  0.0319  -0.0079 414 LEU A CB  
3087 C CG  . LEU A 417 ? 0.3785 0.2006 0.4814 0.0805  0.0204  0.0063  414 LEU A CG  
3088 C CD1 . LEU A 417 ? 0.3854 0.1980 0.5048 0.0906  0.0069  0.0217  414 LEU A CD1 
3089 C CD2 . LEU A 417 ? 0.3997 0.1925 0.4905 0.0732  0.0240  -0.0021 414 LEU A CD2 
3090 N N   . VAL A 418 ? 0.3249 0.2463 0.4484 0.0814  0.0508  -0.0059 415 VAL A N   
3091 C CA  . VAL A 418 ? 0.3279 0.2673 0.4441 0.0795  0.0678  -0.0115 415 VAL A CA  
3092 C C   . VAL A 418 ? 0.3327 0.2534 0.4069 0.0720  0.0692  -0.0166 415 VAL A C   
3093 O O   . VAL A 418 ? 0.3225 0.2321 0.3821 0.0622  0.0590  -0.0098 415 VAL A O   
3094 C CB  . VAL A 418 ? 0.3187 0.2864 0.4534 0.0684  0.0692  0.0006  415 VAL A CB  
3095 C CG1 . VAL A 418 ? 0.3336 0.3205 0.4652 0.0668  0.0927  -0.0034 415 VAL A CG1 
3096 C CG2 . VAL A 418 ? 0.3006 0.2905 0.4815 0.0736  0.0578  0.0084  415 VAL A CG2 
3097 N N   . PHE A 419 ? 0.3533 0.2709 0.4080 0.0779  0.0814  -0.0292 416 PHE A N   
3098 C CA  . PHE A 419 ? 0.3683 0.2686 0.3830 0.0737  0.0773  -0.0349 416 PHE A CA  
3099 C C   . PHE A 419 ? 0.3600 0.2621 0.3557 0.0628  0.0757  -0.0212 416 PHE A C   
3100 O O   . PHE A 419 ? 0.3594 0.2761 0.3595 0.0575  0.0875  -0.0122 416 PHE A O   
3101 C CB  . PHE A 419 ? 0.4104 0.3063 0.3995 0.0815  0.0909  -0.0512 416 PHE A CB  
3102 C CG  . PHE A 419 ? 0.4514 0.3307 0.3926 0.0771  0.0826  -0.0561 416 PHE A CG  
3103 C CD1 . PHE A 419 ? 0.4668 0.3277 0.3976 0.0780  0.0663  -0.0702 416 PHE A CD1 
3104 C CD2 . PHE A 419 ? 0.4789 0.3602 0.3858 0.0713  0.0897  -0.0459 416 PHE A CD2 
3105 C CE1 . PHE A 419 ? 0.5013 0.3510 0.3916 0.0747  0.0527  -0.0748 416 PHE A CE1 
3106 C CE2 . PHE A 419 ? 0.5183 0.3820 0.3772 0.0694  0.0771  -0.0477 416 PHE A CE2 
3107 C CZ  . PHE A 419 ? 0.5383 0.3888 0.3905 0.0719  0.0566  -0.0628 416 PHE A CZ  
3108 N N   . SER A 420 ? 0.3507 0.2377 0.3304 0.0596  0.0613  -0.0197 417 SER A N   
3109 C CA  . SER A 420 ? 0.3616 0.2410 0.3174 0.0539  0.0577  -0.0087 417 SER A CA  
3110 C C   . SER A 420 ? 0.3874 0.2544 0.3108 0.0586  0.0474  -0.0157 417 SER A C   
3111 O O   . SER A 420 ? 0.3804 0.2451 0.3105 0.0624  0.0370  -0.0287 417 SER A O   
3112 C CB  . SER A 420 ? 0.3385 0.2116 0.3090 0.0490  0.0480  -0.0007 417 SER A CB  
3113 O OG  . SER A 420 ? 0.3512 0.2104 0.3006 0.0471  0.0434  0.0087  417 SER A OG  
3114 N N   . ASP A 421 ? 0.4198 0.2773 0.3072 0.0567  0.0482  -0.0060 418 ASP A N   
3115 C CA  . ASP A 421 ? 0.4583 0.3026 0.3087 0.0613  0.0318  -0.0096 418 ASP A CA  
3116 C C   . ASP A 421 ? 0.4456 0.2851 0.3117 0.0651  0.0088  -0.0046 418 ASP A C   
3117 O O   . ASP A 421 ? 0.4731 0.3068 0.3197 0.0701  -0.0116 -0.0068 418 ASP A O   
3118 C CB  . ASP A 421 ? 0.5097 0.3405 0.3061 0.0583  0.0402  0.0017  418 ASP A CB  
3119 C CG  . ASP A 421 ? 0.5721 0.3898 0.3177 0.0628  0.0257  -0.0076 418 ASP A CG  
3120 O OD1 . ASP A 421 ? 0.5714 0.3941 0.3237 0.0662  0.0197  -0.0291 418 ASP A OD1 
3121 O OD2 . ASP A 421 ? 0.6432 0.4416 0.3381 0.0619  0.0182  0.0068  418 ASP A OD2 
3122 N N   . ILE A 422 ? 0.4104 0.2533 0.3116 0.0633  0.0116  0.0010  419 ILE A N   
3123 C CA  . ILE A 422 ? 0.4039 0.2455 0.3279 0.0690  -0.0036 0.0026  419 ILE A CA  
3124 C C   . ILE A 422 ? 0.3891 0.2472 0.3436 0.0703  -0.0124 -0.0133 419 ILE A C   
3125 O O   . ILE A 422 ? 0.3674 0.2324 0.3406 0.0650  -0.0017 -0.0213 419 ILE A O   
3126 C CB  . ILE A 422 ? 0.3797 0.2156 0.3255 0.0658  0.0057  0.0095  419 ILE A CB  
3127 C CG1 . ILE A 422 ? 0.4140 0.2265 0.3349 0.0638  0.0079  0.0259  419 ILE A CG1 
3128 C CG2 . ILE A 422 ? 0.3573 0.1983 0.3355 0.0731  -0.0024 0.0040  419 ILE A CG2 
3129 C CD1 . ILE A 422 ? 0.4508 0.2612 0.3465 0.0531  0.0224  0.0337  419 ILE A CD1 
3130 N N   . THR A 423 ? 0.4096 0.2733 0.3709 0.0767  -0.0334 -0.0167 420 THR A N   
3131 C CA  . THR A 423 ? 0.4065 0.2888 0.4042 0.0744  -0.0429 -0.0314 420 THR A CA  
3132 C C   . THR A 423 ? 0.4027 0.3004 0.4470 0.0800  -0.0476 -0.0297 420 THR A C   
3133 O O   . THR A 423 ? 0.4164 0.3064 0.4592 0.0899  -0.0506 -0.0187 420 THR A O   
3134 C CB  . THR A 423 ? 0.4370 0.3213 0.4146 0.0748  -0.0662 -0.0414 420 THR A CB  
3135 O OG1 . THR A 423 ? 0.4729 0.3528 0.4313 0.0849  -0.0878 -0.0300 420 THR A OG1 
3136 C CG2 . THR A 423 ? 0.4584 0.3267 0.3892 0.0702  -0.0562 -0.0487 420 THR A CG2 
3137 N N   . HIS A 424 ? 0.3999 0.3176 0.4870 0.0735  -0.0460 -0.0410 421 HIS A N   
3138 C CA  . HIS A 424 ? 0.3991 0.3383 0.5379 0.0779  -0.0441 -0.0424 421 HIS A CA  
3139 C C   . HIS A 424 ? 0.4105 0.3769 0.5957 0.0672  -0.0499 -0.0558 421 HIS A C   
3140 O O   . HIS A 424 ? 0.4019 0.3634 0.5890 0.0528  -0.0362 -0.0613 421 HIS A O   
3141 C CB  . HIS A 424 ? 0.3788 0.3080 0.5204 0.0757  -0.0163 -0.0379 421 HIS A CB  
3142 C CG  . HIS A 424 ? 0.3676 0.3154 0.5559 0.0823  -0.0070 -0.0411 421 HIS A CG  
3143 N ND1 . HIS A 424 ? 0.3655 0.3155 0.5693 0.1006  -0.0168 -0.0374 421 HIS A ND1 
3144 C CD2 . HIS A 424 ? 0.3435 0.3071 0.5659 0.0741  0.0140  -0.0477 421 HIS A CD2 
3145 C CE1 . HIS A 424 ? 0.3396 0.3096 0.5907 0.1054  -0.0010 -0.0444 421 HIS A CE1 
3146 N NE2 . HIS A 424 ? 0.3364 0.3157 0.5970 0.0880  0.0196  -0.0506 421 HIS A NE2 
3147 N N   . LEU A 425 ? 0.4426 0.4369 0.6679 0.0740  -0.0722 -0.0597 422 LEU A N   
3148 C CA  . LEU A 425 ? 0.4545 0.4832 0.7399 0.0620  -0.0778 -0.0723 422 LEU A CA  
3149 C C   . LEU A 425 ? 0.4515 0.5030 0.7908 0.0633  -0.0504 -0.0715 422 LEU A C   
3150 O O   . LEU A 425 ? 0.4512 0.5051 0.8002 0.0816  -0.0456 -0.0652 422 LEU A O   
3151 C CB  . LEU A 425 ? 0.4799 0.5347 0.7899 0.0686  -0.1184 -0.0772 422 LEU A CB  
3152 C CG  . LEU A 425 ? 0.5178 0.5457 0.7594 0.0717  -0.1470 -0.0764 422 LEU A CG  
3153 C CD1 . LEU A 425 ? 0.5502 0.6049 0.8152 0.0764  -0.1924 -0.0815 422 LEU A CD1 
3154 C CD2 . LEU A 425 ? 0.5194 0.5199 0.7171 0.0543  -0.1370 -0.0871 422 LEU A CD2 
3155 N N   . ASP A 426 ? 0.4618 0.5250 0.8318 0.0436  -0.0304 -0.0779 423 ASP A N   
3156 C CA  . ASP A 426 ? 0.4633 0.5420 0.8700 0.0407  0.0041  -0.0773 423 ASP A CA  
3157 C C   . ASP A 426 ? 0.4651 0.5955 0.9568 0.0303  0.0048  -0.0870 423 ASP A C   
3158 O O   . ASP A 426 ? 0.4702 0.6387 1.0183 0.0463  -0.0014 -0.0902 423 ASP A O   
3159 C CB  . ASP A 426 ? 0.4676 0.5122 0.8314 0.0240  0.0326  -0.0720 423 ASP A CB  
3160 C CG  . ASP A 426 ? 0.4842 0.5317 0.8576 0.0223  0.0703  -0.0695 423 ASP A CG  
3161 O OD1 . ASP A 426 ? 0.4967 0.5677 0.9050 0.0379  0.0780  -0.0734 423 ASP A OD1 
3162 O OD2 . ASP A 426 ? 0.5186 0.5416 0.8612 0.0064  0.0921  -0.0638 423 ASP A OD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   SER 2   -1  ?   ?   ?   A . n 
A 1 3   HIS 3   0   ?   ?   ?   A . n 
A 1 4   MET 4   1   ?   ?   ?   A . n 
A 1 5   SER 5   2   ?   ?   ?   A . n 
A 1 6   GLU 6   3   ?   ?   ?   A . n 
A 1 7   GLU 7   4   4   GLU GLU A . n 
A 1 8   ASN 8   5   5   ASN ASN A . n 
A 1 9   VAL 9   6   6   VAL VAL A . n 
A 1 10  GLN 10  7   7   GLN GLN A . n 
A 1 11  GLU 11  8   8   GLU GLU A . n 
A 1 12  PHE 12  9   9   PHE PHE A . n 
A 1 13  VAL 13  10  10  VAL VAL A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  LYS 15  12  12  LYS LYS A . n 
A 1 16  GLU 16  13  13  GLU GLU A . n 
A 1 17  ASP 17  14  14  ASP ASP A . n 
A 1 18  CYS 18  15  15  CYS CYS A . n 
A 1 19  GLU 19  16  16  GLU GLU A . n 
A 1 20  LEU 20  17  17  LEU LEU A . n 
A 1 21  ARG 21  18  18  ARG ARG A . n 
A 1 22  PHE 22  19  19  PHE PHE A . n 
A 1 23  ALA 23  20  20  ALA ALA A . n 
A 1 24  ALA 24  21  21  ALA ALA A . n 
A 1 25  GLY 25  22  22  GLY GLY A . n 
A 1 26  ASP 26  23  23  ASP ASP A . n 
A 1 27  ASP 27  24  24  ASP ASP A . n 
A 1 28  SER 28  25  25  SER SER A . n 
A 1 29  ASP 29  26  26  ASP ASP A . n 
A 1 30  VAL 30  27  27  VAL VAL A . n 
A 1 31  CYS 31  28  28  CYS CYS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  GLU 33  30  30  GLU GLU A . n 
A 1 34  LEU 34  31  31  LEU LEU A . n 
A 1 35  VAL 35  32  32  VAL VAL A . n 
A 1 36  LYS 36  33  33  LYS LYS A . n 
A 1 37  GLY 37  34  34  GLY GLY A . n 
A 1 38  TYR 38  35  35  TYR TYR A . n 
A 1 39  ALA 39  36  36  ALA ALA A . n 
A 1 40  GLU 40  37  37  GLU GLU A . n 
A 1 41  ILE 41  38  38  ILE ILE A . n 
A 1 42  PHE 42  39  39  PHE PHE A . n 
A 1 43  GLY 43  40  40  GLY GLY A . n 
A 1 44  THR 44  41  41  THR THR A . n 
A 1 45  GLU 45  42  42  GLU GLU A . n 
A 1 46  LEU 46  43  43  LEU LEU A . n 
A 1 47  LEU 47  44  44  LEU LEU A . n 
A 1 48  LEU 48  45  45  LEU LEU A . n 
A 1 49  ASN 49  46  46  ASN ASN A . n 
A 1 50  LYS 50  47  47  LYS LYS A . n 
A 1 51  LYS 51  48  48  LYS LYS A . n 
A 1 52  TYR 52  49  49  TYR TYR A . n 
A 1 53  THR 53  50  50  THR THR A . n 
A 1 54  PHE 54  51  51  PHE PHE A . n 
A 1 55  PRO 55  52  52  PRO PRO A . n 
A 1 56  ALA 56  53  53  ALA ALA A . n 
A 1 57  LYS 57  54  54  LYS LYS A . n 
A 1 58  SER 58  55  55  SER SER A . n 
A 1 59  ARG 59  56  56  ARG ARG A . n 
A 1 60  VAL 60  57  57  VAL VAL A . n 
A 1 61  ALA 61  58  58  ALA ALA A . n 
A 1 62  ALA 62  59  59  ALA ALA A . n 
A 1 63  PHE 63  60  60  PHE PHE A . n 
A 1 64  THR 64  61  61  THR THR A . n 
A 1 65  TRP 65  62  62  TRP TRP A . n 
A 1 66  LYS 66  63  63  LYS LYS A . n 
A 1 67  GLY 67  64  64  GLY GLY A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  THR 69  66  66  THR THR A . n 
A 1 70  ILE 70  67  67  ILE ILE A . n 
A 1 71  GLU 71  68  68  GLU GLU A . n 
A 1 72  LEU 72  69  69  LEU LEU A . n 
A 1 73  VAL 73  70  70  VAL VAL A . n 
A 1 74  GLY 74  71  71  GLY GLY A . n 
A 1 75  THR 75  72  72  THR THR A . n 
A 1 76  THR 76  73  73  THR THR A . n 
A 1 77  GLU 77  74  74  GLU GLU A . n 
A 1 78  SER 78  75  75  SER SER A . n 
A 1 79  ALA 79  76  76  ALA ALA A . n 
A 1 80  TYR 80  77  77  TYR TYR A . n 
A 1 81  VAL 81  78  78  VAL VAL A . n 
A 1 82  ALA 82  79  79  ALA ALA A . n 
A 1 83  GLU 83  80  80  GLU GLU A . n 
A 1 84  SER 84  81  81  SER SER A . n 
A 1 85  THR 85  82  82  THR THR A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  MET 87  84  84  MET MET A . n 
A 1 88  VAL 88  85  85  VAL VAL A . n 
A 1 89  ILE 89  86  86  ILE ILE A . n 
A 1 90  TYR 90  87  87  TYR TYR A . n 
A 1 91  LEU 91  88  88  LEU LEU A . n 
A 1 92  ASN 92  89  89  ASN ASN A . n 
A 1 93  ILE 93  90  90  ILE ILE A . n 
A 1 94  HIS 94  91  91  HIS HIS A . n 
A 1 95  ALA 95  92  92  ALA ALA A . n 
A 1 96  ALA 96  93  93  ALA ALA A . n 
A 1 97  MET 97  94  94  MET MET A . n 
A 1 98  GLU 98  95  95  GLU GLU A . n 
A 1 99  GLU 99  96  96  GLU GLU A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 ARG 101 98  98  ARG ARG A . n 
A 1 102 LYS 102 99  99  LYS LYS A . n 
A 1 103 LYS 103 100 100 LYS LYS A . n 
A 1 104 ARG 104 101 101 ARG ARG A . n 
A 1 105 GLU 105 102 102 GLU GLU A . n 
A 1 106 GLU 106 103 103 GLU GLU A . n 
A 1 107 GLN 107 104 104 GLN GLN A . n 
A 1 108 ALA 108 105 105 ALA ALA A . n 
A 1 109 ALA 109 106 ?   ?   ?   A . n 
A 1 110 GLY 110 107 ?   ?   ?   A . n 
A 1 111 ASN 111 108 ?   ?   ?   A . n 
A 1 112 SER 112 109 ?   ?   ?   A . n 
A 1 113 ASN 113 110 ?   ?   ?   A . n 
A 1 114 LYS 114 111 111 LYS LYS A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 LYS 116 113 113 LYS LYS A . n 
A 1 117 GLY 117 114 114 GLY GLY A . n 
A 1 118 PRO 118 115 115 PRO PRO A . n 
A 1 119 ARG 119 116 116 ARG ARG A . n 
A 1 120 LEU 120 117 117 LEU LEU A . n 
A 1 121 LEU 121 118 118 LEU LEU A . n 
A 1 122 LEU 122 119 119 LEU LEU A . n 
A 1 123 VAL 123 120 120 VAL VAL A . n 
A 1 124 GLY 124 121 121 GLY GLY A . n 
A 1 125 PRO 125 122 122 PRO PRO A . n 
A 1 126 THR 126 123 123 THR THR A . n 
A 1 127 ASP 127 124 124 ASP ASP A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLY 129 126 126 GLY GLY A . n 
A 1 130 LYS 130 127 127 LYS LYS A . n 
A 1 131 THR 131 128 128 THR THR A . n 
A 1 132 THR 132 129 129 THR THR A . n 
A 1 133 VAL 133 130 130 VAL VAL A . n 
A 1 134 SER 134 131 131 SER SER A . n 
A 1 135 ARG 135 132 132 ARG ARG A . n 
A 1 136 ILE 136 133 133 ILE ILE A . n 
A 1 137 LEU 137 134 134 LEU LEU A . n 
A 1 138 CYS 138 135 135 CYS CYS A . n 
A 1 139 ASN 139 136 136 ASN ASN A . n 
A 1 140 TYR 140 137 137 TYR TYR A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 VAL 142 139 139 VAL VAL A . n 
A 1 143 ARG 143 140 140 ARG ARG A . n 
A 1 144 GLN 144 141 141 GLN GLN A . n 
A 1 145 GLY 145 142 142 GLY GLY A . n 
A 1 146 ARG 146 143 143 ARG ARG A . n 
A 1 147 THR 147 144 144 THR THR A . n 
A 1 148 PRO 148 145 145 PRO PRO A . n 
A 1 149 ILE 149 146 146 ILE ILE A . n 
A 1 150 PHE 150 147 147 PHE PHE A . n 
A 1 151 VAL 151 148 148 VAL VAL A . n 
A 1 152 GLU 152 149 149 GLU GLU A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 ASP 154 151 151 ASP ASP A . n 
A 1 155 VAL 155 152 152 VAL VAL A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 GLN 157 154 154 GLN GLN A . n 
A 1 158 ASN 158 155 155 ASN ASN A . n 
A 1 159 SER 159 156 156 SER SER A . n 
A 1 160 VAL 160 157 157 VAL VAL A . n 
A 1 161 SER 161 158 158 SER SER A . n 
A 1 162 VAL 162 159 159 VAL VAL A . n 
A 1 163 PRO 163 160 160 PRO PRO A . n 
A 1 164 GLY 164 161 161 GLY GLY A . n 
A 1 165 THR 165 162 162 THR THR A . n 
A 1 166 VAL 166 163 163 VAL VAL A . n 
A 1 167 ALA 167 164 164 ALA ALA A . n 
A 1 168 ALA 168 165 165 ALA ALA A . n 
A 1 169 VAL 169 166 166 VAL VAL A . n 
A 1 170 LEU 170 167 167 LEU LEU A . n 
A 1 171 VAL 171 168 168 VAL VAL A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 LYS 173 170 170 LYS LYS A . n 
A 1 174 THR 174 171 171 THR THR A . n 
A 1 175 ALA 175 172 172 ALA ALA A . n 
A 1 176 ASP 176 173 173 ASP ASP A . n 
A 1 177 VAL 177 174 174 VAL VAL A . n 
A 1 178 ILE 178 175 175 ILE ILE A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 GLY 180 177 177 GLY GLY A . n 
A 1 181 PHE 181 178 178 PHE PHE A . n 
A 1 182 GLU 182 179 179 GLU GLU A . n 
A 1 183 ARG 183 180 180 ARG ARG A . n 
A 1 184 ASN 184 181 181 ASN ASN A . n 
A 1 185 GLN 185 182 182 GLN GLN A . n 
A 1 186 PRO 186 183 183 PRO PRO A . n 
A 1 187 ILE 187 184 184 ILE ILE A . n 
A 1 188 VAL 188 185 185 VAL VAL A . n 
A 1 189 PHE 189 186 186 PHE PHE A . n 
A 1 190 ASN 190 187 187 ASN ASN A . n 
A 1 191 PHE 191 188 188 PHE PHE A . n 
A 1 192 GLY 192 189 189 GLY GLY A . n 
A 1 193 HIS 193 190 190 HIS HIS A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 SER 195 192 192 SER SER A . n 
A 1 196 PRO 196 193 193 PRO PRO A . n 
A 1 197 SER 197 194 194 SER SER A . n 
A 1 198 ALA 198 195 195 ALA ALA A . n 
A 1 199 ASN 199 196 196 ASN ASN A . n 
A 1 200 LEU 200 197 197 LEU LEU A . n 
A 1 201 SER 201 198 198 SER SER A . n 
A 1 202 LEU 202 199 199 LEU LEU A . n 
A 1 203 TYR 203 200 200 TYR TYR A . n 
A 1 204 GLU 204 201 201 GLU GLU A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 LEU 206 203 203 LEU LEU A . n 
A 1 207 PHE 207 204 204 PHE PHE A . n 
A 1 208 LYS 208 205 205 LYS LYS A . n 
A 1 209 GLU 209 206 206 GLU GLU A . n 
A 1 210 MET 210 207 207 MET MET A . n 
A 1 211 ALA 211 208 208 ALA ALA A . n 
A 1 212 THR 212 209 209 THR THR A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 LEU 214 211 211 LEU LEU A . n 
A 1 215 ASN 215 212 212 ASN ASN A . n 
A 1 216 ALA 216 213 213 ALA ALA A . n 
A 1 217 GLN 217 214 214 GLN GLN A . n 
A 1 218 ILE 218 215 215 ILE ILE A . n 
A 1 219 GLN 219 216 216 GLN GLN A . n 
A 1 220 GLU 220 217 217 GLU GLU A . n 
A 1 221 ASN 221 218 218 ASN ASN A . n 
A 1 222 ASP 222 219 219 ASP ASP A . n 
A 1 223 GLU 223 220 220 GLU GLU A . n 
A 1 224 ALA 224 221 221 ALA ALA A . n 
A 1 225 LYS 225 222 222 LYS LYS A . n 
A 1 226 ILE 226 223 223 ILE ILE A . n 
A 1 227 GLY 227 224 224 GLY GLY A . n 
A 1 228 GLY 228 225 225 GLY GLY A . n 
A 1 229 MET 229 226 226 MET MET A . n 
A 1 230 ILE 230 227 227 ILE ILE A . n 
A 1 231 ILE 231 228 228 ILE ILE A . n 
A 1 232 ASN 232 229 229 ASN ASN A . n 
A 1 233 THR 233 230 230 THR THR A . n 
A 1 234 CYS 234 231 231 CYS CYS A . n 
A 1 235 GLY 235 232 232 GLY GLY A . n 
A 1 236 TRP 236 233 233 TRP TRP A . n 
A 1 237 VAL 237 234 234 VAL VAL A . n 
A 1 238 ASP 238 235 235 ASP ASP A . n 
A 1 239 GLY 239 236 236 GLY GLY A . n 
A 1 240 GLU 240 237 237 GLU GLU A . n 
A 1 241 GLY 241 238 238 GLY GLY A . n 
A 1 242 TYR 242 239 239 TYR TYR A . n 
A 1 243 LYS 243 240 240 LYS LYS A . n 
A 1 244 CYS 244 241 241 CYS CYS A . n 
A 1 245 ILE 245 242 242 ILE ILE A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 LYS 247 244 244 LYS LYS A . n 
A 1 248 ALA 248 245 245 ALA ALA A . n 
A 1 249 ALA 249 246 246 ALA ALA A . n 
A 1 250 SER 250 247 247 SER SER A . n 
A 1 251 ALA 251 248 248 ALA ALA A . n 
A 1 252 PHE 252 249 249 PHE PHE A . n 
A 1 253 GLU 253 250 250 GLU GLU A . n 
A 1 254 VAL 254 251 251 VAL VAL A . n 
A 1 255 ASP 255 252 252 ASP ASP A . n 
A 1 256 VAL 256 253 253 VAL VAL A . n 
A 1 257 VAL 257 254 254 VAL VAL A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 VAL 259 256 256 VAL VAL A . n 
A 1 260 LEU 260 257 257 LEU LEU A . n 
A 1 261 ASP 261 258 258 ASP ASP A . n 
A 1 262 HIS 262 259 259 HIS HIS A . n 
A 1 263 GLU 263 260 260 GLU GLU A . n 
A 1 264 ARG 264 261 261 ARG ARG A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 TYR 266 263 263 TYR TYR A . n 
A 1 267 SER 267 264 264 SER SER A . n 
A 1 268 ASP 268 265 265 ASP ASP A . n 
A 1 269 LEU 269 266 266 LEU LEU A . n 
A 1 270 SER 270 267 267 SER SER A . n 
A 1 271 LYS 271 268 268 LYS LYS A . n 
A 1 272 GLU 272 269 269 GLU GLU A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 PRO 274 271 271 PRO PRO A . n 
A 1 275 GLU 275 272 272 GLU GLU A . n 
A 1 276 PHE 276 273 273 PHE PHE A . n 
A 1 277 VAL 277 274 274 VAL VAL A . n 
A 1 278 ARG 278 275 275 ARG ARG A . n 
A 1 279 LEU 279 276 276 LEU LEU A . n 
A 1 280 THR 280 277 277 THR THR A . n 
A 1 281 HIS 281 278 278 HIS HIS A . n 
A 1 282 VAL 282 279 279 VAL VAL A . n 
A 1 283 PRO 283 280 280 PRO PRO A . n 
A 1 284 LYS 284 281 281 LYS LYS A . n 
A 1 285 SER 285 282 282 SER SER A . n 
A 1 286 GLY 286 283 283 GLY GLY A . n 
A 1 287 GLY 287 284 284 GLY GLY A . n 
A 1 288 VAL 288 285 285 VAL VAL A . n 
A 1 289 GLU 289 286 286 GLU GLU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 THR 292 289 289 THR THR A . n 
A 1 293 GLY 293 290 290 GLY GLY A . n 
A 1 294 GLN 294 291 291 GLN GLN A . n 
A 1 295 ILE 295 292 292 ILE ILE A . n 
A 1 296 ARG 296 293 293 ARG ARG A . n 
A 1 297 SER 297 294 294 SER SER A . n 
A 1 298 LYS 298 295 295 LYS LYS A . n 
A 1 299 MET 299 296 296 MET MET A . n 
A 1 300 ARG 300 297 297 ARG ARG A . n 
A 1 301 GLY 301 298 298 GLY GLY A . n 
A 1 302 GLU 302 299 299 GLU GLU A . n 
A 1 303 ASN 303 300 300 ASN ASN A . n 
A 1 304 VAL 304 301 301 VAL VAL A . n 
A 1 305 HIS 305 302 302 HIS HIS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 TYR 307 304 304 TYR TYR A . n 
A 1 308 PHE 308 305 305 PHE PHE A . n 
A 1 309 TYR 309 306 306 TYR TYR A . n 
A 1 310 GLY 310 307 307 GLY GLY A . n 
A 1 311 THR 311 308 308 THR THR A . n 
A 1 312 ARG 312 309 309 ARG ARG A . n 
A 1 313 ALA 313 310 310 ALA ALA A . n 
A 1 314 ASN 314 311 311 ASN ASN A . n 
A 1 315 ASN 315 312 312 ASN ASN A . n 
A 1 316 LEU 316 313 313 LEU LEU A . n 
A 1 317 TYR 317 314 314 TYR TYR A . n 
A 1 318 PRO 318 315 315 PRO PRO A . n 
A 1 319 PHE 319 316 316 PHE PHE A . n 
A 1 320 THR 320 317 317 THR THR A . n 
A 1 321 PHE 321 318 318 PHE PHE A . n 
A 1 322 ASP 322 319 319 ASP ASP A . n 
A 1 323 VAL 323 320 320 VAL VAL A . n 
A 1 324 SER 324 321 321 SER SER A . n 
A 1 325 PHE 325 322 322 PHE PHE A . n 
A 1 326 ASP 326 323 323 ASP ASP A . n 
A 1 327 ASP 327 324 324 ASP ASP A . n 
A 1 328 VAL 328 325 325 VAL VAL A . n 
A 1 329 THR 329 326 326 THR THR A . n 
A 1 330 LEU 330 327 327 LEU LEU A . n 
A 1 331 CYS 331 328 328 CYS CYS A . n 
A 1 332 LYS 332 329 329 LYS LYS A . n 
A 1 333 ILE 333 330 330 ILE ILE A . n 
A 1 334 GLY 334 331 331 GLY GLY A . n 
A 1 335 ALA 335 332 ?   ?   ?   A . n 
A 1 336 GLU 336 333 ?   ?   ?   A . n 
A 1 337 GLN 337 334 ?   ?   ?   A . n 
A 1 338 LEU 338 335 ?   ?   ?   A . n 
A 1 339 PRO 339 336 ?   ?   ?   A . n 
A 1 340 ASP 340 337 ?   ?   ?   A . n 
A 1 341 SER 341 338 ?   ?   ?   A . n 
A 1 342 CYS 342 339 ?   ?   ?   A . n 
A 1 343 LEU 343 340 ?   ?   ?   A . n 
A 1 344 PRO 344 341 ?   ?   ?   A . n 
A 1 345 PHE 345 342 ?   ?   ?   A . n 
A 1 346 GLY 346 343 ?   ?   ?   A . n 
A 1 347 MET 347 344 ?   ?   ?   A . n 
A 1 348 GLU 348 345 ?   ?   ?   A . n 
A 1 349 VAL 349 346 ?   ?   ?   A . n 
A 1 350 GLU 350 347 ?   ?   ?   A . n 
A 1 351 ASN 351 348 ?   ?   ?   A . n 
A 1 352 HIS 352 349 ?   ?   ?   A . n 
A 1 353 GLU 353 350 ?   ?   ?   A . n 
A 1 354 THR 354 351 351 THR THR A . n 
A 1 355 LYS 355 352 352 LYS LYS A . n 
A 1 356 LEU 356 353 353 LEU LEU A . n 
A 1 357 VAL 357 354 354 VAL VAL A . n 
A 1 358 ILE 358 355 355 ILE ILE A . n 
A 1 359 MET 359 356 356 MET MET A . n 
A 1 360 GLU 360 357 357 GLU GLU A . n 
A 1 361 PRO 361 358 358 PRO PRO A . n 
A 1 362 SER 362 359 359 SER SER A . n 
A 1 363 ALA 363 360 360 ALA ALA A . n 
A 1 364 ASP 364 361 361 ASP ASP A . n 
A 1 365 ILE 365 362 362 ILE ILE A . n 
A 1 366 LYS 366 363 363 LYS LYS A . n 
A 1 367 HIS 367 364 364 HIS HIS A . n 
A 1 368 HIS 368 365 365 HIS HIS A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 PHE 370 367 367 PHE PHE A . n 
A 1 371 ALA 371 368 368 ALA ALA A . n 
A 1 372 PHE 372 369 369 PHE PHE A . n 
A 1 373 SER 373 370 370 SER SER A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 SER 375 372 372 SER SER A . n 
A 1 376 THR 376 373 373 THR THR A . n 
A 1 377 LYS 377 374 374 LYS LYS A . n 
A 1 378 ALA 378 375 375 ALA ALA A . n 
A 1 379 ASP 379 376 376 ASP ASP A . n 
A 1 380 GLU 380 377 377 GLU GLU A . n 
A 1 381 ASN 381 378 378 ASN ASN A . n 
A 1 382 VAL 382 379 379 VAL VAL A . n 
A 1 383 LEU 383 380 380 LEU LEU A . n 
A 1 384 LYS 384 381 381 LYS LYS A . n 
A 1 385 SER 385 382 382 SER SER A . n 
A 1 386 PRO 386 383 383 PRO PRO A . n 
A 1 387 VAL 387 384 384 VAL VAL A . n 
A 1 388 PHE 388 385 385 PHE PHE A . n 
A 1 389 GLY 389 386 386 GLY GLY A . n 
A 1 390 PHE 390 387 387 PHE PHE A . n 
A 1 391 CYS 391 388 388 CYS CYS A . n 
A 1 392 LEU 392 389 389 LEU LEU A . n 
A 1 393 VAL 393 390 390 VAL VAL A . n 
A 1 394 THR 394 391 391 THR THR A . n 
A 1 395 GLU 395 392 392 GLU GLU A . n 
A 1 396 VAL 396 393 393 VAL VAL A . n 
A 1 397 ASP 397 394 394 ASP ASP A . n 
A 1 398 LEU 398 395 395 LEU LEU A . n 
A 1 399 GLU 399 396 396 GLU GLU A . n 
A 1 400 LYS 400 397 397 LYS LYS A . n 
A 1 401 ARG 401 398 398 ARG ARG A . n 
A 1 402 THR 402 399 399 THR THR A . n 
A 1 403 MET 403 400 400 MET MET A . n 
A 1 404 SER 404 401 401 SER SER A . n 
A 1 405 ILE 405 402 402 ILE ILE A . n 
A 1 406 LEU 406 403 403 LEU LEU A . n 
A 1 407 CYS 407 404 404 CYS CYS A . n 
A 1 408 PRO 408 405 405 PRO PRO A . n 
A 1 409 GLN 409 406 406 GLN GLN A . n 
A 1 410 ARG 410 407 407 ARG ARG A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 ILE 412 409 409 ILE ILE A . n 
A 1 413 PRO 413 410 410 PRO PRO A . n 
A 1 414 SER 414 411 411 SER SER A . n 
A 1 415 LYS 415 412 412 LYS LYS A . n 
A 1 416 VAL 416 413 413 VAL VAL A . n 
A 1 417 LEU 417 414 414 LEU LEU A . n 
A 1 418 VAL 418 415 415 VAL VAL A . n 
A 1 419 PHE 419 416 416 PHE PHE A . n 
A 1 420 SER 420 417 417 SER SER A . n 
A 1 421 ASP 421 418 418 ASP ASP A . n 
A 1 422 ILE 422 419 419 ILE ILE A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 HIS 424 421 421 HIS HIS A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 ASP 426 423 423 ASP ASP A . n 
A 1 427 ASP 427 424 ?   ?   ?   A . n 
A 1 428 GLN 428 425 ?   ?   ?   A . n 
A 1 429 ILE 429 426 ?   ?   ?   A . n 
A 1 430 LYS 430 427 ?   ?   ?   A . n 
A 1 431 ARG 431 428 ?   ?   ?   A . n 
B 2 1   G   1   1   1   G   G   B . n 
B 2 2   C   2   2   2   C   C   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ADP 1   501 1   ADP ADP A . 
D 4 MG  1   502 2   MG  MG  A . 
E 5 ALF 1   503 3   ALF ALF A . 
F 6 SAR 1   504 10  SAR SAR A . 
G 6 SAR 1   505 11  SAR SAR A . 
H 7 2PE 1   506 12  2PE 2PE A . 
I 8 HOH 1   601 1   HOH HOH A . 
I 8 HOH 2   602 2   HOH HOH A . 
I 8 HOH 3   603 3   HOH HOH A . 
I 8 HOH 4   604 4   HOH HOH A . 
I 8 HOH 5   605 5   HOH HOH A . 
I 8 HOH 6   606 6   HOH HOH A . 
I 8 HOH 7   607 7   HOH HOH A . 
I 8 HOH 8   608 8   HOH HOH A . 
I 8 HOH 9   609 9   HOH HOH A . 
I 8 HOH 10  610 10  HOH HOH A . 
I 8 HOH 11  611 12  HOH HOH A . 
I 8 HOH 12  612 13  HOH HOH A . 
I 8 HOH 13  613 14  HOH HOH A . 
I 8 HOH 14  614 15  HOH HOH A . 
I 8 HOH 15  615 16  HOH HOH A . 
I 8 HOH 16  616 17  HOH HOH A . 
I 8 HOH 17  617 18  HOH HOH A . 
I 8 HOH 18  618 19  HOH HOH A . 
I 8 HOH 19  619 20  HOH HOH A . 
I 8 HOH 20  620 21  HOH HOH A . 
I 8 HOH 21  621 22  HOH HOH A . 
I 8 HOH 22  622 23  HOH HOH A . 
I 8 HOH 23  623 24  HOH HOH A . 
I 8 HOH 24  624 26  HOH HOH A . 
I 8 HOH 25  625 27  HOH HOH A . 
I 8 HOH 26  626 28  HOH HOH A . 
I 8 HOH 27  627 29  HOH HOH A . 
I 8 HOH 28  628 30  HOH HOH A . 
I 8 HOH 29  629 31  HOH HOH A . 
I 8 HOH 30  630 32  HOH HOH A . 
I 8 HOH 31  631 33  HOH HOH A . 
I 8 HOH 32  632 34  HOH HOH A . 
I 8 HOH 33  633 35  HOH HOH A . 
I 8 HOH 34  634 36  HOH HOH A . 
I 8 HOH 35  635 37  HOH HOH A . 
I 8 HOH 36  636 38  HOH HOH A . 
I 8 HOH 37  637 39  HOH HOH A . 
I 8 HOH 38  638 40  HOH HOH A . 
I 8 HOH 39  639 41  HOH HOH A . 
I 8 HOH 40  640 42  HOH HOH A . 
I 8 HOH 41  641 43  HOH HOH A . 
I 8 HOH 42  642 44  HOH HOH A . 
I 8 HOH 43  643 45  HOH HOH A . 
I 8 HOH 44  644 46  HOH HOH A . 
I 8 HOH 45  645 47  HOH HOH A . 
I 8 HOH 46  646 48  HOH HOH A . 
I 8 HOH 47  647 49  HOH HOH A . 
I 8 HOH 48  648 50  HOH HOH A . 
I 8 HOH 49  649 51  HOH HOH A . 
I 8 HOH 50  650 52  HOH HOH A . 
I 8 HOH 51  651 53  HOH HOH A . 
I 8 HOH 52  652 54  HOH HOH A . 
I 8 HOH 53  653 55  HOH HOH A . 
I 8 HOH 54  654 56  HOH HOH A . 
I 8 HOH 55  655 57  HOH HOH A . 
I 8 HOH 56  656 58  HOH HOH A . 
I 8 HOH 57  657 59  HOH HOH A . 
I 8 HOH 58  658 60  HOH HOH A . 
I 8 HOH 59  659 61  HOH HOH A . 
I 8 HOH 60  660 62  HOH HOH A . 
I 8 HOH 61  661 63  HOH HOH A . 
I 8 HOH 62  662 64  HOH HOH A . 
I 8 HOH 63  663 65  HOH HOH A . 
I 8 HOH 64  664 66  HOH HOH A . 
I 8 HOH 65  665 67  HOH HOH A . 
I 8 HOH 66  666 68  HOH HOH A . 
I 8 HOH 67  667 69  HOH HOH A . 
I 8 HOH 68  668 70  HOH HOH A . 
I 8 HOH 69  669 71  HOH HOH A . 
I 8 HOH 70  670 72  HOH HOH A . 
I 8 HOH 71  671 73  HOH HOH A . 
I 8 HOH 72  672 74  HOH HOH A . 
I 8 HOH 73  673 75  HOH HOH A . 
I 8 HOH 74  674 76  HOH HOH A . 
I 8 HOH 75  675 77  HOH HOH A . 
I 8 HOH 76  676 78  HOH HOH A . 
I 8 HOH 77  677 79  HOH HOH A . 
I 8 HOH 78  678 80  HOH HOH A . 
I 8 HOH 79  679 81  HOH HOH A . 
I 8 HOH 80  680 82  HOH HOH A . 
I 8 HOH 81  681 83  HOH HOH A . 
I 8 HOH 82  682 84  HOH HOH A . 
I 8 HOH 83  683 85  HOH HOH A . 
I 8 HOH 84  684 86  HOH HOH A . 
I 8 HOH 85  685 87  HOH HOH A . 
I 8 HOH 86  686 88  HOH HOH A . 
I 8 HOH 87  687 89  HOH HOH A . 
I 8 HOH 88  688 90  HOH HOH A . 
I 8 HOH 89  689 91  HOH HOH A . 
I 8 HOH 90  690 92  HOH HOH A . 
I 8 HOH 91  691 93  HOH HOH A . 
I 8 HOH 92  692 94  HOH HOH A . 
I 8 HOH 93  693 95  HOH HOH A . 
I 8 HOH 94  694 96  HOH HOH A . 
I 8 HOH 95  695 97  HOH HOH A . 
I 8 HOH 96  696 98  HOH HOH A . 
I 8 HOH 97  697 99  HOH HOH A . 
I 8 HOH 98  698 100 HOH HOH A . 
I 8 HOH 99  699 101 HOH HOH A . 
I 8 HOH 100 700 102 HOH HOH A . 
I 8 HOH 101 701 103 HOH HOH A . 
I 8 HOH 102 702 104 HOH HOH A . 
I 8 HOH 103 703 105 HOH HOH A . 
I 8 HOH 104 704 106 HOH HOH A . 
I 8 HOH 105 705 107 HOH HOH A . 
I 8 HOH 106 706 108 HOH HOH A . 
I 8 HOH 107 707 109 HOH HOH A . 
I 8 HOH 108 708 110 HOH HOH A . 
I 8 HOH 109 709 111 HOH HOH A . 
I 8 HOH 110 710 112 HOH HOH A . 
I 8 HOH 111 711 113 HOH HOH A . 
I 8 HOH 112 712 114 HOH HOH A . 
I 8 HOH 113 713 115 HOH HOH A . 
I 8 HOH 114 714 116 HOH HOH A . 
I 8 HOH 115 715 117 HOH HOH A . 
I 8 HOH 116 716 118 HOH HOH A . 
I 8 HOH 117 717 119 HOH HOH A . 
I 8 HOH 118 718 120 HOH HOH A . 
I 8 HOH 119 719 121 HOH HOH A . 
I 8 HOH 120 720 122 HOH HOH A . 
I 8 HOH 121 721 123 HOH HOH A . 
I 8 HOH 122 722 124 HOH HOH A . 
I 8 HOH 123 723 125 HOH HOH A . 
I 8 HOH 124 724 126 HOH HOH A . 
I 8 HOH 125 725 127 HOH HOH A . 
I 8 HOH 126 726 128 HOH HOH A . 
I 8 HOH 127 727 129 HOH HOH A . 
I 8 HOH 128 728 130 HOH HOH A . 
I 8 HOH 129 729 131 HOH HOH A . 
I 8 HOH 130 730 132 HOH HOH A . 
I 8 HOH 131 731 133 HOH HOH A . 
I 8 HOH 132 732 134 HOH HOH A . 
I 8 HOH 133 733 135 HOH HOH A . 
J 8 HOH 1   101 11  HOH HOH B . 
J 8 HOH 2   102 25  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1950  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  18750 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2B ? C ADP . ? A ADP 501 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O   ? I HOH .   ? A HOH 602 ? 1_555 101.9 ? 
2  O2B ? C ADP . ? A ADP 501 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O   ? I HOH .   ? A HOH 601 ? 1_555 173.0 ? 
3  O   ? I HOH . ? A HOH 602 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O   ? I HOH .   ? A HOH 601 ? 1_555 82.1  ? 
4  O2B ? C ADP . ? A ADP 501 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O   ? I HOH .   ? A HOH 603 ? 1_555 86.2  ? 
5  O   ? I HOH . ? A HOH 602 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O   ? I HOH .   ? A HOH 603 ? 1_555 171.9 ? 
6  O   ? I HOH . ? A HOH 601 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O   ? I HOH .   ? A HOH 603 ? 1_555 89.8  ? 
7  O2B ? C ADP . ? A ADP 501 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OG1 ? A THR 131 ? A THR 128 ? 1_555 92.9  ? 
8  O   ? I HOH . ? A HOH 602 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OG1 ? A THR 131 ? A THR 128 ? 1_555 92.7  ? 
9  O   ? I HOH . ? A HOH 601 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OG1 ? A THR 131 ? A THR 128 ? 1_555 81.1  ? 
10 O   ? I HOH . ? A HOH 603 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OG1 ? A THR 131 ? A THR 128 ? 1_555 85.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-05-14 
2 'Structure model' 1 1 2014-07-02 
3 'Structure model' 1 2 2015-01-21 
4 'Structure model' 1 3 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Structure summary'      
3 4 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -2.5975  15.0663 -4.5305 0.1935 0.0284 0.0249 0.0557 0.0226 0.0132  11.8994 1.5016 2.3553 -0.8433 
-1.3695 -0.3709 -0.2834 -0.0452 0.2718 0.1555  0.1532  0.0050 0.0512  0.0497  0.1302  
'X-RAY DIFFRACTION' 2 ? refined -18.1330 25.7282 5.0976  0.0946 0.0865 0.0471 0.0229 0.0290 -0.0098 1.2145  3.1438 2.1761 -0.5399 
-0.2481 0.3239  0.0238  0.0076  0.1414 0.0688  -0.0456 0.0642 -0.1421 -0.2279 0.0218  
'X-RAY DIFFRACTION' 3 ? refined -14.9119 51.7238 6.1949  0.2449 0.0719 0.3189 0.0636 0.0324 -0.0131 4.1992  6.5264 4.5438 0.6224  
0.1789  0.2119  -0.1119 -0.1566 0.6506 -0.0227 0.1611  0.2428 -0.4480 -0.2357 -0.0492 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 4   ? ? A 106 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 111 ? ? A 310 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 311 ? ? A 423 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
REFMAC    refinement        5.5.0110 ? 2 
XDS       'data reduction'  .        ? 3 
XSCALE    'data scaling'    .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O3B   A ADP 501 ? ? AL A ALF 503 ? ? 2.00 
2 1 "O5'" B G   1   ? ? AL A ALF 503 ? ? 2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 39  ? ? 38.20   46.78   
2 1 LYS A 54  ? ? 73.11   -15.11  
3 1 ALA A 76  ? ? -167.89 118.97  
4 1 ASN A 196 ? ? -162.32 82.98   
5 1 HIS A 364 ? ? 78.22   -2.24   
6 1 ASP A 376 ? ? -128.62 -155.41 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 A 2PE 506 ? C14 ? H 2PE 1 C14 
2  1 N 1 A 2PE 506 ? C15 ? H 2PE 1 C15 
3  1 N 1 A 2PE 506 ? O16 ? H 2PE 1 O16 
4  1 N 1 A 2PE 506 ? C17 ? H 2PE 1 C17 
5  1 N 1 A 2PE 506 ? C18 ? H 2PE 1 C18 
6  1 N 1 A 2PE 506 ? O19 ? H 2PE 1 O19 
7  1 N 1 A 2PE 506 ? C20 ? H 2PE 1 C20 
8  1 N 1 A 2PE 506 ? C21 ? H 2PE 1 C21 
9  1 N 1 A 2PE 506 ? O22 ? H 2PE 1 O22 
10 1 N 1 A 2PE 506 ? C23 ? H 2PE 1 C23 
11 1 N 1 A 2PE 506 ? C24 ? H 2PE 1 C24 
12 1 N 1 A 2PE 506 ? O25 ? H 2PE 1 O25 
13 1 N 1 A 2PE 506 ? C26 ? H 2PE 1 C26 
14 1 N 1 A 2PE 506 ? C27 ? H 2PE 1 C27 
15 1 N 1 A 2PE 506 ? O28 ? H 2PE 1 O28 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2  ? A GLY 1   
2  1 Y 1 A SER -1  ? A SER 2   
3  1 Y 1 A HIS 0   ? A HIS 3   
4  1 Y 1 A MET 1   ? A MET 4   
5  1 Y 1 A SER 2   ? A SER 5   
6  1 Y 1 A GLU 3   ? A GLU 6   
7  1 Y 1 A ALA 106 ? A ALA 109 
8  1 Y 1 A GLY 107 ? A GLY 110 
9  1 Y 1 A ASN 108 ? A ASN 111 
10 1 Y 1 A SER 109 ? A SER 112 
11 1 Y 1 A ASN 110 ? A ASN 113 
12 1 Y 1 A ALA 332 ? A ALA 335 
13 1 Y 1 A GLU 333 ? A GLU 336 
14 1 Y 1 A GLN 334 ? A GLN 337 
15 1 Y 1 A LEU 335 ? A LEU 338 
16 1 Y 1 A PRO 336 ? A PRO 339 
17 1 Y 1 A ASP 337 ? A ASP 340 
18 1 Y 1 A SER 338 ? A SER 341 
19 1 Y 1 A CYS 339 ? A CYS 342 
20 1 Y 1 A LEU 340 ? A LEU 343 
21 1 Y 1 A PRO 341 ? A PRO 344 
22 1 Y 1 A PHE 342 ? A PHE 345 
23 1 Y 1 A GLY 343 ? A GLY 346 
24 1 Y 1 A MET 344 ? A MET 347 
25 1 Y 1 A GLU 345 ? A GLU 348 
26 1 Y 1 A VAL 346 ? A VAL 349 
27 1 Y 1 A GLU 347 ? A GLU 350 
28 1 Y 1 A ASN 348 ? A ASN 351 
29 1 Y 1 A HIS 349 ? A HIS 352 
30 1 Y 1 A GLU 350 ? A GLU 353 
31 1 Y 1 A ASP 424 ? A ASP 427 
32 1 Y 1 A GLN 425 ? A GLN 428 
33 1 Y 1 A ILE 426 ? A ILE 429 
34 1 Y 1 A LYS 427 ? A LYS 430 
35 1 Y 1 A ARG 428 ? A ARG 431 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 'MAGNESIUM ION'            MG  
5 'TETRAFLUOROALUMINATE ION' ALF 
6 SARCOSINE                  SAR 
7 'NONAETHYLENE GLYCOL'      2PE 
8 water                      HOH 
#