data_4OIN
# 
_entry.id   4OIN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OIN         
NDB   NA2886       
RCSB  RCSB084540   
WWPDB D_1000084540 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OIO . unspecified 
PDB 4OIP . unspecified 
PDB 4OIQ . unspecified 
PDB 4OIR . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4OIN 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
'Arnold, E.'    3 
# 
_citation.id                        primary 
_citation.title                     
;GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
;
_citation.journal_abbrev            Elife 
_citation.journal_volume            3 
_citation.page_first                e02450 
_citation.page_last                 e02450 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24755292 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.'            1  
primary 'Degen, D.'            2  
primary 'Ho, M.X.'             3  
primary 'Sineva, E.'           4  
primary 'Ebright, K.Y.'        5  
primary 'Ebright, Y.W.'        6  
primary 'Mekler, V.'           7  
primary 'Vahedian-Movahed, H.' 8  
primary 'Feng, Y.'             9  
primary 'Yin, R.'              10 
primary 'Tuske, S.'            11 
primary 'Irschik, H.'          12 
primary 'Jansen, R.'           13 
primary 'Maffioli, S.'         14 
primary 'Donadio, S.'          15 
primary 'Arnold, E.'           16 
primary 'Ebright, R.H.'        17 
# 
_cell.entry_id           4OIN 
_cell.length_a           183.770 
_cell.length_b           103.200 
_cell.length_c           294.770 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.18 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4OIN 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                 35056.164  2   
2.7.7.6 ? ? ?                                 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                  125436.539 1   
2.7.7.6 ? ? ?                                 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1   2.7.7.6 ? ? ?                                 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                 11533.316  1   
2.7.7.6 ? ? ?                                 
5  polymer     man 'DNA directed RNA polymerase sigma factor A'                                                50769.398  1   ? ? 
? ?                                 
6  polymer     syn "5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*G)-3'"                          5821.760   1   ? ? 
? 'promoter DNA template strand'    
7  polymer     syn "5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G)-3'" 8421.432   1   ? ? 
? 'promoter DNA nontemplate strand' 
8  polymer     syn GE23077                                                                                     739.687    1   ? ? 
? ?                                 
9  non-polymer syn 'MAGNESIUM ION'                                                                             24.305     5   ? ? 
? ?                                 
10 non-polymer syn 'ZINC ION'                                                                                  65.409     2   ? ? 
? ?                                 
11 non-polymer syn '(2Z)-2-methylbut-2-enoic acid'                                                             100.116    1   ? ? 
? ?                                 
12 water       nat water                                                                                       18.015     622 ? ? 
? ?                                 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha, RNA polymerase subunit alpha, Transcriptase subunit alpha' 
2 'RNAP subunit beta, RNA polymerase subunit beta, Transcriptase subunit beta'    
3 
;RNAP subunit beta', RNA polymerase subunit beta', Transcriptase subunit beta'
;
4 'RNAP omega subunit, RNA polymerase omega subunit, Transcriptase subunit omega' 
5 'RNA polymerase sigma factor'                                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no  
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no  
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no  
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no  
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no  '(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)' 
CCTGCATCCGTGAGTCGAG G   ? 
7 polydeoxyribonucleotide no no  
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H   ? 
8 'polypeptide(L)'        no yes '(2RA)(DSN)(DVA)(R2T)(2TL)(0QZ)(FGL)' XSVXTXG I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    2RA n 
8 2    DSN n 
8 3    DVA n 
8 4    R2T n 
8 5    2TL n 
8 6    0QZ n 
8 7    FGL n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rpoD, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB8 / ATCC 27634 / DSM 579' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              8 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Actinomadura sp.' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       1989 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THET8   Q5SHR6 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8   Q8RQE9 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8   Q8RQE8 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8   Q8RQE7 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 UNP Q5SKW1_THET8 Q5SKW1 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 ? 
6 PDB 4OIN         4OIN   6 CCTGCATCCGTGAGTCGAG 1 ? 
7 PDB 4OIN         4OIN   7 TATAATGGGAGCTGTCACGGATGCAGG 1 ? 
8 PDB 4OIN         4OIN   8 '(2RA)(DSN)(DVA)(R2T)(2TL)(0QZ)(FGL)' 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4OIN A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2 1 4OIN B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3 2 4OIN C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4 3 4OIN D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5 4 4OIN E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6 5 4OIN F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7 6 4OIN G 1  ? 19   ? 4OIN   1 ? 19   ? 1 19   
8 7 4OIN H 1  ? 27   ? 4OIN   1 ? 27   ? 1 27   
9 8 4OIN I 1  ? 7    ? 4OIN   1 ? 7    ? 1 7    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6 4OIN MET F 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 1  
6 4OIN GLY F 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 2  
6 4OIN SER F 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 3  
6 4OIN SER F 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 4  
6 4OIN HIS F 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 5  
6 4OIN HIS F 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 6  
6 4OIN HIS F 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 7  
6 4OIN HIS F 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 8  
6 4OIN HIS F 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 9  
6 4OIN HIS F 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 10 
6 4OIN SER F 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  11 
6 4OIN SER F 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  12 
6 4OIN GLY F 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  13 
6 4OIN LEU F 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  14 
6 4OIN VAL F 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  15 
6 4OIN PRO F 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  16 
6 4OIN ARG F 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  17 
6 4OIN GLY F 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  18 
6 4OIN SER F 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  19 
6 4OIN HIS F 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0QZ 'D-peptide linking' . D-Isoserine                          '(2R)-3-amino-2-hydroxypropanoic acid' 'C3 H7 N O3'      105.093 
2RA 'D-peptide linking' n 3-amino-D-alanine                    'diaminopropanoic acid'                'C3 H8 N2 O2'     104.108 
2TL 'D-peptide linking' . D-allothreonine                      ?                                      'C4 H9 N O3'      119.119 
ALA 'L-peptide linking' y ALANINE                              ?                                      'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                                      'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                                      'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                                      'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                                      'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                                      'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                                      'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                                      'C10 H14 N5 O7 P' 347.221 
DSN 'D-peptide linking' . D-SERINE                             ?                                      'C3 H7 N O3'      105.093 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                                      'C10 H15 N2 O8 P' 322.208 
DVA 'D-peptide linking' . D-VALINE                             ?                                      'C5 H11 N O2'     117.146 
FGL 'L-peptide linking' n '2-AMINOPROPANEDIOIC ACID'           ?                                      'C3 H5 N O4'      119.076 
GLN 'L-peptide linking' y GLUTAMINE                            ?                                      'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                                      'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                                      'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                                      'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                                      'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                                      'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                                      'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                                      'C6 H15 N2 O2 1'  147.195 
MB8 non-polymer         . '(2Z)-2-methylbut-2-enoic acid'      ?                                      'C5 H8 O2'        100.116 
MET 'L-peptide linking' y METHIONINE                           ?                                      'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                                      'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                                      'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                                      'C5 H9 N O2'      115.130 
R2T 'L-peptide linking' . beta,gamma-dihydroxyglutamine        ?                                      'C5 H10 N2 O5'    178.143 
SER 'L-peptide linking' y SERINE                               ?                                      'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                                      'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                                      'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                                      'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                                      'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                                      'Zn 2'            65.409  
# 
_exptl.entry_id          4OIN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.11 
_exptl_crystal.density_percent_sol   60.50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl, pH 8.4, 200 mM potassium chloride, 50 mM magnesium chloride, 9.5% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 270'  2013-12-07 ? 
2 CCD 'ADSC QUANTUM 315r' 2013-11-26 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Si(111)' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'Si(111)' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9180 1.0 
2 1.1    1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'CHESS BEAMLINE F1'  CHESS F1   ? 0.9180 
2 SYNCHROTRON 'NSLS BEAMLINE X29A' NSLS  X29A ? 1.1    
# 
_reflns.entry_id                     4OIN 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   131716 
_reflns.number_all                   131716 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.143 
_reflns.pdbx_Rsym_value              0.143 
_reflns.pdbx_netI_over_sigmaI        9.1 
_reflns.B_iso_Wilson_estimate        47.83 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.718 
_reflns_shell.pdbx_Rsym_value        0.718 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        4.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6563 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 4OIN 
_refine.ls_number_reflns_obs                     131601 
_refine.ls_number_reflns_all                     131716 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.32 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.499 
_refine.ls_d_res_high                            2.800 
_refine.ls_percent_reflns_obs                    98.00 
_refine.ls_R_factor_obs                          0.2081 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2058 
_refine.ls_R_factor_R_free                       0.2517 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  6580 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               40.15 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4G7H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.40 
_refine.pdbx_overall_phase_error                 26.24 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27718 
_refine_hist.pdbx_number_atoms_nucleic_acid   823 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             622 
_refine_hist.number_atoms_total               29172 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        48.499 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.004  ? ? 29163 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.812  ? ? 39598 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 13.851 ? ? 11302 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.061  ? ? 4458  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 5054  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.800  2.8319  2560 0.3226 61.0  0.3836 . . 125 . . . . 'X-RAY DIFFRACTION' 
. 2.8319 2.8652  4230 0.3198 99.0  0.3532 . . 237 . . . . 'X-RAY DIFFRACTION' 
. 2.8652 2.9002  4154 0.3106 100.0 0.3503 . . 214 . . . . 'X-RAY DIFFRACTION' 
. 2.9002 2.9369  4238 0.2988 99.0  0.3724 . . 228 . . . . 'X-RAY DIFFRACTION' 
. 2.9369 2.9755  4156 0.3037 99.0  0.3294 . . 222 . . . . 'X-RAY DIFFRACTION' 
. 2.9755 3.0163  4255 0.2952 100.0 0.3667 . . 229 . . . . 'X-RAY DIFFRACTION' 
. 3.0163 3.0594  4177 0.2842 99.0  0.3059 . . 202 . . . . 'X-RAY DIFFRACTION' 
. 3.0594 3.1050  4265 0.2756 99.0  0.3379 . . 232 . . . . 'X-RAY DIFFRACTION' 
. 3.1050 3.1535  4106 0.2631 99.0  0.2977 . . 237 . . . . 'X-RAY DIFFRACTION' 
. 3.1535 3.2052  4226 0.2609 99.0  0.3378 . . 218 . . . . 'X-RAY DIFFRACTION' 
. 3.2052 3.2605  4161 0.2523 99.0  0.3123 . . 233 . . . . 'X-RAY DIFFRACTION' 
. 3.2605 3.3198  4234 0.2398 99.0  0.2832 . . 211 . . . . 'X-RAY DIFFRACTION' 
. 3.3198 3.3836  4198 0.2309 99.0  0.2607 . . 233 . . . . 'X-RAY DIFFRACTION' 
. 3.3836 3.4526  4201 0.2250 99.0  0.2710 . . 210 . . . . 'X-RAY DIFFRACTION' 
. 3.4526 3.5277  4221 0.2212 99.0  0.2765 . . 231 . . . . 'X-RAY DIFFRACTION' 
. 3.5277 3.6097  4193 0.2184 99.0  0.2651 . . 202 . . . . 'X-RAY DIFFRACTION' 
. 3.6097 3.7000  4177 0.2108 99.0  0.2355 . . 231 . . . . 'X-RAY DIFFRACTION' 
. 3.7000 3.8000  4198 0.2087 99.0  0.2805 . . 221 . . . . 'X-RAY DIFFRACTION' 
. 3.8000 3.9117  4247 0.1994 99.0  0.2385 . . 216 . . . . 'X-RAY DIFFRACTION' 
. 3.9117 4.0379  4152 0.1850 99.0  0.2379 . . 218 . . . . 'X-RAY DIFFRACTION' 
. 4.0379 4.1822  4219 0.1831 99.0  0.2456 . . 224 . . . . 'X-RAY DIFFRACTION' 
. 4.1822 4.3495  4206 0.1750 99.0  0.2211 . . 218 . . . . 'X-RAY DIFFRACTION' 
. 4.3495 4.5474  4249 0.1648 99.0  0.2150 . . 223 . . . . 'X-RAY DIFFRACTION' 
. 4.5474 4.7869  4251 0.1634 100.0 0.1943 . . 231 . . . . 'X-RAY DIFFRACTION' 
. 4.7869 5.0865  4248 0.1621 100.0 0.2110 . . 218 . . . . 'X-RAY DIFFRACTION' 
. 5.0865 5.4788  4276 0.1720 100.0 0.2146 . . 227 . . . . 'X-RAY DIFFRACTION' 
. 5.4788 6.0292  4266 0.1802 100.0 0.2440 . . 224 . . . . 'X-RAY DIFFRACTION' 
. 6.0292 6.8995  4325 0.1776 100.0 0.2408 . . 217 . . . . 'X-RAY DIFFRACTION' 
. 6.8995 8.6845  4333 0.1563 100.0 0.1727 . . 225 . . . . 'X-RAY DIFFRACTION' 
. 8.6845 48.5064 4299 0.1688 97.0  0.1986 . . 223 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OIN 
_struct.title                     'Crystal structure of Thermus thermophilus transcription initiation complex soaked with GE23077' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase subunit alpha (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta' (E.C.2.7.7.6), DNA-directed RNA polymerase subunit omega (E.C.2.7.7.6), DNA directed RNA polymerase sigma factor A
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OIN 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/ANTIBIOTIC' 
_struct_keywords.text            
;GE23077, transcription inhibitor, transcription open complex, transcription initiation complex, i site, i+1 site, RNA polymerase, DNA/RNA/NTP binding, polymerization of ribonucleotides, nucleoid, TRANSCRIPTION, TRANSFERASE-ANTIBIOTIC complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 10 ? 
M N N 9  ? 
N N N 9  ? 
O N N 9  ? 
P N N 9  ? 
Q N N 11 ? 
R N N 12 ? 
S N N 12 ? 
T N N 12 ? 
U N N 12 ? 
V N N 12 ? 
W N N 12 ? 
X N N 12 ? 
Y N N 12 ? 
Z N N 12 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   2   ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   3   ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   6   TYR A 224  ? ASN A 227  ? TYR A 224  ASN A 227  5 ? 4  
HELX_P HELX_P7   7   GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   8   ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   9   ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  10  PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  11  THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P12  12  TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P13  13  THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P14  14  PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P15  15  GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P16  16  PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P17  17  LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P18  18  ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P19  19  TYR C 214  ? MET C 222  ? TYR C 214  MET C 222  1 ? 9  
HELX_P HELX_P20  20  ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P21  21  ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P22  22  LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P23  23  GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P24  24  VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P25  25  THR C 335  ? GLY C 362  ? THR C 335  GLY C 362  1 ? 28 
HELX_P HELX_P26  26  THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P27  27  SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P28  28  ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P29  29  GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P30  30  HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P31  31  THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P32  32  SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P33  33  SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P34  34  ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P35  35  PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P36  36  ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P37  37  LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P38  38  ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P39  39  GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P40  40  THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P41  41  PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P42  42  ASN C 872  ? VAL C 876  ? ASN C 872  VAL C 876  5 ? 5  
HELX_P HELX_P43  43  LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P44  44  LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P45  45  ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P46  46  THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P47  47  MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P48  48  GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P49  49  ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P50  50  ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P51  51  PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P52  52  SER D 14   ? TRP D 21   ? SER D 14   TRP D 21   1 ? 8  
HELX_P HELX_P53  53  ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P54  54  LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P55  55  ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P56  56  SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P57  57  SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P58  58  THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P59  59  ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P60  60  GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P61  61  ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P62  62  SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P63  63  ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P64  64  PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P65  65  SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P66  66  PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P67  67  SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P68  68  GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P69  69  LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P70  70  PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P71  71  ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P72  72  LYS D 684  ? ILE D 695  ? LYS D 684  ILE D 695  1 ? 12 
HELX_P HELX_P73  73  HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P74  74  HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P75  75  VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P76  76  SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P77  77  LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P78  78  ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P79  79  THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P80  80  VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P81  81  ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P82  82  SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P83  83  ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P84  84  GLU D 907  ? SER D 945  ? GLU D 907  SER D 945  1 ? 39 
HELX_P HELX_P85  85  GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P86  86  GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P87  87  THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P88  88  ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P89  89  ASN D 1031 ? CYS D 1039 ? ASN D 1031 CYS D 1039 1 ? 9  
HELX_P HELX_P90  90  THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P91  91  LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P92  92  SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P93  93  GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P94  94  ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P95  95  PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P96  96  GLN D 1254 ? GLU D 1264 ? GLN D 1254 GLU D 1264 1 ? 11 
HELX_P HELX_P97  97  ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P98  98  GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P99  99  HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P100 100 LYS D 1397 ? GLY D 1411 ? LYS D 1397 GLY D 1411 1 ? 15 
HELX_P HELX_P101 101 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P102 102 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P103 103 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P104 104 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P105 105 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P106 106 GLN D 1489 ? ALA D 1502 ? GLN D 1489 ALA D 1502 1 ? 14 
HELX_P HELX_P107 107 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P108 108 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P109 109 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P110 110 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P111 111 ASP F 99   ? VAL F 111  ? ASP F 79   VAL F 91   1 ? 13 
HELX_P HELX_P112 112 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P113 113 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P114 114 ASP F 172  ? SER F 185  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P115 115 PRO F 187  ? LYS F 220  ? PRO F 167  LYS F 200  1 ? 34 
HELX_P HELX_P116 116 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P117 117 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P118 118 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P119 119 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P120 120 THR F 307  ? GLY F 316  ? THR F 287  GLY F 296  1 ? 10 
HELX_P HELX_P121 121 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P122 122 PHE F 348  ? ILE F 353  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P123 123 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P124 124 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P125 125 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P126 126 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P127 127 ARG F 439  ? ASP F 443  ? ARG F 419  ASP F 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? I 2RA 1    C   ? ? ? 1_555 I DSN 2  N  ? ? I 2RA 1    I DSN 2    1_555 ? ? ? ? ? ? ?            1.471 ? 
covale2  covale ? ? I DSN 2    C   ? ? ? 1_555 I DVA 3  N  ? ? I DSN 2    I DVA 3    1_555 ? ? ? ? ? ? ?            1.477 ? 
covale3  covale ? ? I DVA 3    C   ? ? ? 1_555 I R2T 4  N  ? ? I DVA 3    I R2T 4    1_555 ? ? ? ? ? ? ?            1.452 ? 
covale4  covale ? ? I R2T 4    C   ? ? ? 1_555 I 2TL 5  N  ? ? I R2T 4    I 2TL 5    1_555 ? ? ? ? ? ? ?            1.462 ? 
covale5  covale ? ? I 2TL 5    C   ? ? ? 1_555 I 0QZ 6  N  ? ? I 2TL 5    I 0QZ 6    1_555 ? ? ? ? ? ? ?            1.459 ? 
covale6  covale ? ? I 0QZ 6    C   ? ? ? 1_555 I FGL 7  N  ? ? I 0QZ 6    I FGL 7    1_555 ? ? ? ? ? ? ?            1.437 ? 
metalc1  metalc ? ? D ASP 739  OD1 ? ? ? 1_555 M MG  .  MG ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            2.039 ? 
metalc2  metalc ? ? N MG  .    MG  ? ? ? 1_555 U HOH .  O  ? ? D MG  2004 D HOH 2109 1_555 ? ? ? ? ? ? ?            2.043 ? 
metalc3  metalc ? ? M MG  .    MG  ? ? ? 1_555 U HOH .  O  ? ? D MG  2003 D HOH 2106 1_555 ? ? ? ? ? ? ?            2.057 ? 
metalc4  metalc ? ? D LYS 840  O   ? ? ? 1_555 N MG  .  MG ? ? D LYS 840  D MG  2004 1_555 ? ? ? ? ? ? ?            2.061 ? 
metalc5  metalc ? ? M MG  .    MG  ? ? ? 1_555 U HOH .  O  ? ? D MG  2003 D HOH 2107 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc6  metalc ? ? D ASP 743  OD1 ? ? ? 1_555 M MG  .  MG ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.068 ? 
metalc7  metalc ? ? M MG  .    MG  ? ? ? 1_555 U HOH .  O  ? ? D MG  2003 D HOH 2105 1_555 ? ? ? ? ? ? ?            2.084 ? 
metalc8  metalc ? ? D ASP 741  OD1 ? ? ? 1_555 M MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.107 ? 
metalc9  metalc ? ? D CYS 76   SG  ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.216 ? 
metalc10 metalc ? ? N MG  .    MG  ? ? ? 1_555 S HOH .  O  ? ? D MG  2004 B HOH 2103 1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc11 metalc ? ? D CYS 1201 SG  ? ? ? 1_555 K ZN  .  ZN ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.249 ? 
metalc12 metalc ? ? D CYS 73   SG  ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.265 ? 
metalc13 metalc ? ? N MG  .    MG  ? ? ? 1_555 S HOH .  O  ? ? D MG  2004 B HOH 2102 1_555 ? ? ? ? ? ? ?            2.267 ? 
metalc14 metalc ? ? D CYS 1194 SG  ? ? ? 1_555 K ZN  .  ZN ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.277 ? 
metalc15 metalc ? ? D CYS 60   SG  ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc16 metalc ? ? D CYS 58   SG  ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.299 ? 
metalc17 metalc ? ? N MG  .    MG  ? ? ? 1_555 U HOH .  O  ? ? D MG  2004 D HOH 2108 1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc18 metalc ? ? D CYS 1204 SG  ? ? ? 1_555 K ZN  .  ZN ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc19 metalc ? ? D CYS 1112 SG  ? ? ? 1_555 K ZN  .  ZN ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc20 metalc ? ? F TRP 319  O   ? ? ? 1_555 P MG  .  MG ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?            2.452 ? 
metalc21 metalc ? ? B ASP 193  OD1 ? ? ? 1_555 J MG  .  MG ? ? B ASP 193  B MG  2001 1_555 ? ? ? ? ? ? ?            2.464 ? 
metalc22 metalc ? ? P MG  .    MG  ? ? ? 1_555 W HOH .  O  ? ? F MG  2001 F HOH 2105 1_555 ? ? ? ? ? ? ?            2.474 ? 
metalc23 metalc ? ? N MG  .    MG  ? ? ? 1_555 S HOH .  O  ? ? D MG  2004 B HOH 2101 1_555 ? ? ? ? ? ? ?            2.768 ? 
metalc24 metalc ? ? F GLY 316  O   ? ? ? 1_555 P MG  .  MG ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?            2.877 ? 
metalc25 metalc ? ? F ALA 312  O   ? ? ? 1_555 P MG  .  MG ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?            2.923 ? 
metalc26 metalc ? ? B ASP 191  O   ? ? ? 1_555 J MG  .  MG ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?            2.970 ? 
covale7  covale ? ? I 2RA 1    NG  ? ? ? 1_555 Q MB8 .  C  ? ? I 2RA 1    I MB8 101  1_555 ? ? ? ? ? ? ?            1.456 ? 
covale8  covale ? ? I 2RA 1    N   ? ? ? 1_555 I FGL 7  C  ? ? I 2RA 1    I FGL 7    1_555 ? ? ? ? ? ? ?            1.452 ? 
hydrog1  hydrog ? ? G DG  4    N2  ? ? ? 1_555 H DC  24 N3 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog2  hydrog ? ? G DC  5    N3  ? ? ? 1_555 H DG  23 N1 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DC  5    N4  ? ? ? 1_555 H DG  23 O6 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DC  5    O2  ? ? ? 1_555 H DG  23 N2 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DA  6    N1  ? ? ? 1_555 H DT  22 N3 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DA  6    N6  ? ? ? 1_555 H DT  22 O4 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DT  7    N3  ? ? ? 1_555 H DA  21 N1 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog8  hydrog ? ? G DC  8    O2  ? ? ? 1_555 H DG  20 N2 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog9  hydrog ? ? G DC  9    O2  ? ? ? 1_555 H DG  19 N1 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog10 hydrog ? ? G DG  10   N1  ? ? ? 1_555 H DC  18 N3 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog11 hydrog ? ? G DT  11   N3  ? ? ? 1_555 H DA  17 N1 ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog12 hydrog ? ? G DG  12   N1  ? ? ? 1_555 H DC  16 O2 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog13 hydrog ? ? G DA  13   N1  ? ? ? 1_555 H DT  15 N3 ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -8.85 
2 GLY 105 A . ? GLY 105 A PRO 106 A ? PRO 106 A 1 -2.23 
3 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -8.19 
4 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 1.80  
5 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -6.52 
6 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -1.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 3 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 8 ? 
Y  ? 4 ? 
Z  ? 3 ? 
AA ? 2 ? 
AB ? 8 ? 
AC ? 2 ? 
AD ? 4 ? 
AE ? 3 ? 
AF ? 3 ? 
AG ? 2 ? 
AH ? 5 ? 
AI ? 4 ? 
AJ ? 3 ? 
AK ? 3 ? 
AL ? 4 ? 
AM ? 3 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 3 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 2 ? 
AW ? 2 ? 
AX ? 4 ? 
AY ? 3 ? 
AZ ? 2 ? 
BA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? parallel      
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? parallel      
X  5 6 ? anti-parallel 
X  6 7 ? parallel      
X  7 8 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? parallel      
AB 6 7 ? anti-parallel 
AB 7 8 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? parallel      
AQ 1 2 ? parallel      
AQ 2 3 ? anti-parallel 
AR 1 2 ? parallel      
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AZ 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
A  2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
A  3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
A  4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
B  1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
B  2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
B  3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
B  4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
C  1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
C  2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
D  1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
D  2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
E  1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
E  2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
F  1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
F  2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
F  3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
F  4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
G  1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
G  2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
G  3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
G  4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
H  1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
H  2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
I  1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
I  2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
J  1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
J  2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
K  1 ILE C 3    ? ARG C 5    ? ILE C 3    ARG C 5    
K  2 ARG C 900  ? ILE C 902  ? ARG C 900  ILE C 902  
K  3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
L  1 LEU C 64   ? LEU C 73   ? LEU C 64   LEU C 73   
L  2 GLN C 91   ? HIS C 102  ? GLN C 91   HIS C 102  
L  3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
M  1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
M  2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
M  3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
N  1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
N  2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
N  3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
N  4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
O  1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
O  2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
O  3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
O  4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
O  5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
P  1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
P  2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
Q  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
Q  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
Q  3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
R  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
R  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
R  3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
R  4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
R  5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
R  6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
S  1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
S  2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
T  1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
T  2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
T  3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
U  1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
U  2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
U  3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
U  4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
V  1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
V  2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
W  1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
W  2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
X  1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
X  2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
X  3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
X  4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
X  5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
X  6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
X  7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
X  8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
Y  1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
Y  2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
Y  3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
Y  4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
Z  1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
Z  2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
Z  3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AA 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AA 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AB 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AB 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AB 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AB 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AB 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AB 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AB 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AB 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AC 1 ARG C 1031 ? PHE C 1032 ? ARG C 1031 PHE C 1032 
AC 2 LYS D 621  ? ARG D 622  ? LYS D 621  ARG D 622  
AD 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AD 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AE 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AE 2 MET D 90   ? ALA D 100  ? MET D 90   ALA D 100  
AE 3 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AF 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AF 2 TYR D 132  ? LEU D 135  ? TYR D 132  LEU D 135  
AF 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AG 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AG 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AH 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AH 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AH 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AH 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AH 5 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AI 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AI 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AI 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AI 4 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AJ 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AJ 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AJ 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AK 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AK 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AK 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AL 1 PRO D 278  ? LEU D 284  ? PRO D 278  LEU D 284  
AL 2 ALA D 268  ? ARG D 273  ? ALA D 268  ARG D 273  
AL 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AL 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AM 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AM 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AM 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AN 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AN 2 VAL D 443  ? VAL D 447  ? VAL D 443  VAL D 447  
AN 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AN 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AO 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AO 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AP 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AP 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AP 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AQ 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AQ 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AQ 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AR 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AR 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AR 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AS 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AS 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AT 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AT 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AU 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AU 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AV 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AV 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AW 1 TYR D 1207 ? ASP D 1208 ? TYR D 1207 ASP D 1208 
AW 2 ARG D 1213 ? PRO D 1214 ? ARG D 1213 PRO D 1214 
AX 1 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AX 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AX 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AX 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AY 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AY 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AY 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AZ 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AZ 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
BA 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
BA 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
A  2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
A  3 4 O TRP A 200  ? O TRP A 200  N ARG A 176  ? N ARG A 176  
B  1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
B  2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
B  3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
C  1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
D  1 2 N LYS A 107  ? N LYS A 107  O LEU A 132  ? O LEU A 132  
E  1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
F  1 2 N ARG B 14   ? N ARG B 14   O GLU B 22   ? O GLU B 22   
F  2 3 N LEU B 25   ? N LEU B 25   O LEU B 195  ? O LEU B 195  
F  3 4 O ARG B 198  ? O ARG B 198  N ALA B 178  ? N ALA B 178  
G  1 2 N LEU B 101  ? N LEU B 101  O MET B 140  ? O MET B 140  
G  2 3 O ARG B 143  ? O ARG B 143  N SER B 55   ? N SER B 55   
G  3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
H  1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
I  1 2 N LYS B 107  ? N LYS B 107  O LEU B 132  ? O LEU B 132  
J  1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
K  1 2 N LYS C 4    ? N LYS C 4    O ILE C 902  ? O ILE C 902  
K  2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
L  1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
L  2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
M  1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
M  2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
N  1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
N  2 3 N ILE C 140  ? N ILE C 140  O SER C 411  ? O SER C 411  
N  3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
O  1 2 N TYR C 147  ? N TYR C 147  O SER C 161  ? O SER C 161  
O  2 3 N ILE C 162  ? N ILE C 162  O ILE C 172  ? O ILE C 172  
O  3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
O  4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
P  1 2 N GLU C 294  ? N GLU C 294  O GLU C 297  ? O GLU C 297  
Q  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
Q  2 3 N ARG C 473  ? N ARG C 473  O THR C 480  ? O THR C 480  
R  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
R  2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
R  3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
R  4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
R  5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
S  1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
T  1 2 N LEU C 595  ? N LEU C 595  O ALA C 656  ? O ALA C 656  
T  2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
U  1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
U  2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
U  3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
V  1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
W  1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
X  1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
X  2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
X  3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
X  4 5 O LYS C 851  ? O LYS C 851  N ILE C 690  ? N ILE C 690  
X  5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
X  6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
X  7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
Y  1 2 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
Y  2 3 O ALA C 828  ? O ALA C 828  N ILE C 799  ? N ILE C 799  
Y  3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
Z  1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
Z  2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AA 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AB 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AB 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AB 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AB 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AB 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AB 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AB 7 8 O LEU D 728  ? O LEU D 728  N VAL D 632  ? N VAL D 632  
AC 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AD 2 3 N LEU C 1102 ? N LEU C 1102 O LYS D 7    ? O LYS D 7    
AD 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AE 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AE 2 3 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AF 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AF 2 3 N LEU D 135  ? N LEU D 135  O ASP D 453  ? O ASP D 453  
AG 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AH 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AH 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AH 3 4 N LEU D 225  ? N LEU D 225  O VAL D 331  ? O VAL D 331  
AH 4 5 O THR D 330  ? O THR D 330  N GLU D 327  ? N GLU D 327  
AI 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AI 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AI 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AJ 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AJ 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AK 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AK 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AL 1 2 O VAL D 279  ? O VAL D 279  N LEU D 272  ? N LEU D 272  
AL 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AL 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AM 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AM 2 3 N VAL D 368  ? N VAL D 368  O VAL D 377  ? O VAL D 377  
AN 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AN 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AN 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AO 1 2 N ALA D 422  ? N ALA D 422  O VAL D 427  ? O VAL D 427  
AP 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AP 2 3 N THR D 537  ? N THR D 537  O VAL F 335  ? O VAL F 315  
AQ 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AQ 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AR 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AR 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AS 1 2 N VAL D 1106 ? N VAL D 1106 O VAL D 1200 ? O VAL D 1200 
AT 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AU 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AV 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AW 1 2 N ASP D 1208 ? N ASP D 1208 O ARG D 1213 ? O ARG D 1213 
AX 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AX 2 3 O SER D 1291 ? O SER D 1291 N GLU D 1284 ? N GLU D 1284 
AX 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AY 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AY 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AZ 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
BA 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 2001' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 2001' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 2002' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 2003' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 2004' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 2005' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG F 2001' 
AC8 Software ? ? ? ? 24 'BINDING SITE FOR GE23077'           
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  ASP B 183  ? ASP B 183  . ? 1_555 ? 
2  AC1 3  ASP B 191  ? ASP B 191  . ? 1_555 ? 
3  AC1 3  ASP B 193  ? ASP B 193  . ? 1_555 ? 
4  AC2 4  CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
5  AC2 4  CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
6  AC2 4  CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
7  AC2 4  CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
8  AC3 4  CYS D 58   ? CYS D 58   . ? 1_555 ? 
9  AC3 4  CYS D 60   ? CYS D 60   . ? 1_555 ? 
10 AC3 4  CYS D 73   ? CYS D 73   . ? 1_555 ? 
11 AC3 4  CYS D 76   ? CYS D 76   . ? 1_555 ? 
12 AC4 6  ASP D 739  ? ASP D 739  . ? 1_555 ? 
13 AC4 6  ASP D 741  ? ASP D 741  . ? 1_555 ? 
14 AC4 6  ASP D 743  ? ASP D 743  . ? 1_555 ? 
15 AC4 6  HOH U .    ? HOH D 2105 . ? 1_555 ? 
16 AC4 6  HOH U .    ? HOH D 2106 . ? 1_555 ? 
17 AC4 6  HOH U .    ? HOH D 2107 . ? 1_555 ? 
18 AC5 6  HOH S .    ? HOH B 2101 . ? 1_555 ? 
19 AC5 6  HOH S .    ? HOH B 2102 . ? 1_555 ? 
20 AC5 6  HOH S .    ? HOH B 2103 . ? 1_555 ? 
21 AC5 6  LYS D 840  ? LYS D 840  . ? 1_555 ? 
22 AC5 6  HOH U .    ? HOH D 2108 . ? 1_555 ? 
23 AC5 6  HOH U .    ? HOH D 2109 . ? 1_555 ? 
24 AC6 3  TRP D 897  ? TRP D 897  . ? 1_555 ? 
25 AC6 3  GLU D 898  ? GLU D 898  . ? 1_555 ? 
26 AC6 3  ILE D 900  ? ILE D 900  . ? 1_555 ? 
27 AC7 4  ALA F 312  ? ALA F 292  . ? 1_555 ? 
28 AC7 4  GLY F 316  ? GLY F 296  . ? 1_555 ? 
29 AC7 4  TRP F 319  ? TRP F 299  . ? 1_555 ? 
30 AC7 4  HOH W .    ? HOH F 2105 . ? 1_555 ? 
31 AC8 24 ARG A 146  ? ARG A 146  . ? 1_555 ? 
32 AC8 24 ILE A 158  ? ILE A 158  . ? 1_555 ? 
33 AC8 24 PHE A 171  ? PHE A 171  . ? 1_555 ? 
34 AC8 24 ALA B 8    ? ALA B 8    . ? 1_555 ? 
35 AC8 24 PRO B 27   ? PRO B 27   . ? 1_555 ? 
36 AC8 24 LEU B 186  ? LEU B 186  . ? 1_555 ? 
37 AC8 24 ARG B 189  ? ARG B 189  . ? 1_555 ? 
38 AC8 24 PRO C 444  ? PRO C 444  . ? 1_555 ? 
39 AC8 24 GLU C 445  ? GLU C 445  . ? 1_555 ? 
40 AC8 24 GLY C 446  ? GLY C 446  . ? 1_555 ? 
41 AC8 24 ASN C 448  ? ASN C 448  . ? 1_555 ? 
42 AC8 24 ARG C 557  ? ARG C 557  . ? 1_555 ? 
43 AC8 24 MET C 560  ? MET C 560  . ? 1_555 ? 
44 AC8 24 ASN C 563  ? ASN C 563  . ? 1_555 ? 
45 AC8 24 GLN C 567  ? GLN C 567  . ? 1_555 ? 
46 AC8 24 LYS C 838  ? LYS C 838  . ? 1_555 ? 
47 AC8 24 LYS C 846  ? LYS C 846  . ? 1_555 ? 
48 AC8 24 HOH T .    ? HOH C 1314 . ? 1_555 ? 
49 AC8 24 ASP D 741  ? ASP D 741  . ? 1_555 ? 
50 AC8 24 HOH U .    ? HOH D 2104 . ? 1_555 ? 
51 AC8 24 HOH U .    ? HOH D 2106 . ? 1_555 ? 
52 AC8 24 HOH Z .    ? HOH I 201  . ? 1_555 ? 
53 AC8 24 HOH Z .    ? HOH I 202  . ? 1_555 ? 
54 AC8 24 HOH Z .    ? HOH I 207  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4OIN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4OIN 
_atom_sites.fract_transf_matrix[1][1]   0.005442 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000879 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009690 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003436 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? -16.850 18.950  143.773 1.00 55.95  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? -16.783 17.748  142.950 1.00 64.15  ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? -15.709 17.876  141.872 1.00 69.01  ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? -15.715 17.140  140.886 1.00 68.94  ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? -18.144 17.459  142.311 1.00 67.10  ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? -18.116 16.255  141.564 1.00 61.57  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? -14.790 18.816  142.071 1.00 72.81  ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? -13.684 19.034  141.142 1.00 63.16  ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? -12.430 18.293  141.599 1.00 59.55  ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? -11.940 18.512  142.708 1.00 59.67  ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? -13.393 20.533  141.009 1.00 66.78  ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? -12.045 20.871  140.379 1.00 66.91  ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? -11.968 20.425  138.927 1.00 66.33  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? -10.647 20.834  138.287 1.00 59.68  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? -10.492 22.313  138.196 1.00 52.76  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? -11.919 17.412  140.742 1.00 53.19  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? -10.699 16.667  141.034 1.00 42.95  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? -9.529  17.638  141.144 1.00 44.00  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? -9.533  18.696  140.516 1.00 50.01  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? -10.431 15.639  139.932 1.00 43.19  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? -10.025 14.213  140.324 1.00 44.09  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? -8.642  14.172  140.962 1.00 49.19  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? -11.061 13.586  141.243 1.00 47.97  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? -8.533  17.287  141.950 1.00 41.64  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? -7.372  18.152  142.138 1.00 45.55  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? -6.068  17.406  141.869 1.00 41.85  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? -6.092  16.261  141.415 1.00 43.93  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? -7.377  18.785  143.532 1.00 42.24  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? -8.652  19.562  143.830 1.00 48.73  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? -8.389  20.798  144.672 1.00 52.85  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? -9.670  21.594  144.879 1.00 50.64  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? -9.442  22.819  145.692 1.00 55.30  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? -4.942  18.059  142.148 1.00 33.49  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? -3.625  17.545  141.767 1.00 34.37  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? -3.381  16.102  142.211 1.00 37.42  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? -3.472  15.786  143.396 1.00 46.08  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? -2.530  18.457  142.300 1.00 34.30  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? -3.085  15.221  141.240 1.00 36.56  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? -2.846  13.785  141.406 1.00 31.76  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? -1.437  13.459  141.885 1.00 30.09  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? -0.500  14.210  141.619 1.00 33.46  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? -3.045  13.229  139.990 1.00 35.69  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? -3.249  14.429  139.085 1.00 40.06  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? -2.849  15.637  139.852 1.00 36.12  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? -1.294  12.334  142.575 1.00 32.20  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 0.020   11.846  142.964 1.00 37.11  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 0.810   11.393  141.729 1.00 37.95  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 0.263   10.762  140.799 1.00 39.48  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? -0.057  10.734  144.057 1.00 36.50  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? -0.703  9.467   143.517 1.00 46.22  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 1.322   10.434  144.621 1.00 32.07  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 2.090   11.761  141.731 1.00 41.75  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 3.014   11.526  140.628 1.00 38.45  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 4.132   10.572  141.048 1.00 37.27  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 4.997   10.929  141.847 1.00 39.64  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 3.603   12.866  140.176 1.00 37.35  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 4.722   12.744  139.182 1.00 44.62  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 5.971   13.271  139.463 1.00 49.26  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 4.524   12.115  137.964 1.00 41.97  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 7.004   13.169  138.549 1.00 48.51  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 5.553   12.009  137.046 1.00 38.03  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 6.794   12.538  137.339 1.00 41.85  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 4.112   9.363   140.496 1.00 34.54  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 5.070   8.321   140.856 1.00 34.33  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 6.147   8.173   139.782 1.00 33.22  ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 5.878   8.357   138.598 1.00 33.93  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 4.355   6.968   141.064 1.00 31.61  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 3.245   7.148   141.952 1.00 32.24  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 5.301   5.925   141.645 1.00 21.48  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 7.368   7.856   140.203 1.00 34.89  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 8.482   7.685   139.278 1.00 26.09  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 9.221   6.373   139.533 1.00 29.78  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 9.631   6.097   140.657 1.00 33.96  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 9.483   8.845   139.398 1.00 23.75  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 10.737  8.548   138.601 1.00 34.67  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 8.848   10.144  138.936 1.00 29.65  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 9.382   5.567   138.487 1.00 32.20  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 10.122  4.312   138.592 1.00 31.82  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 11.190  4.224   137.505 1.00 32.36  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 10.869  4.156   136.327 1.00 36.48  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 9.169   3.118   138.488 1.00 35.52  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 8.106   3.073   139.579 1.00 37.65  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 7.269   1.805   139.497 1.00 31.33  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 6.311   1.837   138.395 1.00 38.76  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 5.013   2.092   138.538 1.00 41.07  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 4.508   2.337   139.741 1.00 39.20  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 4.215   2.097   137.478 1.00 39.73  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 12.460  4.214   137.897 1.00 39.93  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 13.544  4.242   136.917 1.00 37.98  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 14.503  3.059   137.034 1.00 37.82  ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 14.895  2.670   138.133 1.00 41.99  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 14.368  5.543   137.018 1.00 36.47  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 15.152  5.525   138.218 1.00 36.72  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 13.457  6.760   137.022 1.00 28.88  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 14.870  2.495   135.887 1.00 39.33  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 15.916  1.480   135.815 1.00 44.78  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 17.091  2.021   135.014 1.00 43.13  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 16.982  2.211   133.803 1.00 45.66  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 15.398  0.208   135.147 1.00 43.93  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 14.250  -0.464  135.871 1.00 55.57  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 13.863  -1.779  135.228 1.00 60.96  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 14.697  -2.453  134.622 1.00 62.66  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 12.592  -2.148  135.349 1.00 61.49  ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 18.212  2.259   135.687 1.00 43.69  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 19.389  2.806   135.038 1.00 35.43  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 19.097  4.140   134.380 1.00 35.57  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 18.193  4.859   134.801 1.00 37.04  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 19.868  4.475   133.350 1.00 37.73  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 19.626  5.695   132.587 1.00 39.93  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 18.729  5.433   131.378 1.00 34.73  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 18.286  6.365   130.711 1.00 31.30  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 20.952  6.306   132.123 1.00 40.23  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 21.902  6.690   133.247 1.00 31.18  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 23.182  7.312   132.703 1.00 27.98  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 22.911  8.480   131.870 1.00 34.34  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 22.799  9.721   132.334 1.00 42.28  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 22.938  9.962   133.630 1.00 45.24  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 22.548  10.723  131.500 1.00 37.20  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 18.488  4.159   131.088 1.00 40.67  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 17.779  3.760   129.869 1.00 41.94  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 16.242  3.770   129.901 1.00 37.67  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 15.603  4.192   128.938 1.00 38.73  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 18.310  2.414   129.362 1.00 39.75  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 19.810  2.434   129.098 1.00 41.46  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 20.274  1.296   128.215 1.00 53.68  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 19.460  0.394   127.927 1.00 64.38  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 21.456  1.311   127.805 1.00 51.21  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 15.653  3.301   130.995 1.00 35.12  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 14.211  3.059   131.026 1.00 31.21  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 13.507  3.772   132.176 1.00 35.28  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 14.103  4.017   133.222 1.00 43.29  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 13.943  1.556   131.104 1.00 30.25  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 12.484  1.184   131.229 1.00 38.23  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 11.982  0.650   132.408 1.00 40.39  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 11.607  1.368   130.167 1.00 34.60  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 10.646  0.304   132.525 1.00 38.13  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 10.272  1.028   130.276 1.00 30.84  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 9.797   0.495   131.454 1.00 34.75  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 8.467   0.155   131.558 1.00 37.07  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 12.235  4.109   131.976 1.00 33.30  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 11.460  4.752   133.021 1.00 33.28  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 9.959   4.581   132.891 1.00 30.67  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 9.439   4.347   131.804 1.00 34.06  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 9.266   4.699   134.019 1.00 30.22  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 7.811   4.666   134.068 1.00 29.44  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 7.355   5.820   134.938 1.00 32.40  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 7.886   6.029   136.029 1.00 33.45  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 7.308   3.353   134.665 1.00 26.31  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 7.720   2.121   133.893 1.00 32.53  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 7.126   0.852   134.468 1.00 37.59  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 6.443   0.935   135.511 1.00 38.69  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 7.338   -0.227  133.874 1.00 36.74  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 6.376   6.573   134.454 1.00 28.22  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 5.923   7.759   135.160 1.00 30.71  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 4.411   7.746   135.319 1.00 35.10  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 3.675   7.830   134.341 1.00 39.43  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 6.398   9.008   134.421 1.00 31.05  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 7.867   8.994   134.119 1.00 32.00  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 8.774   9.555   135.001 1.00 36.60  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 8.346   8.393   132.967 1.00 27.56  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 10.129  9.532   134.730 1.00 35.77  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 9.699   8.365   132.693 1.00 29.08  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 10.591  8.936   133.575 1.00 33.90  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 3.953   7.644   136.562 1.00 36.83  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 2.531   7.498   136.834 1.00 33.91  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 1.915   8.797   137.331 1.00 31.48  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 2.529   9.541   138.093 1.00 32.94  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 2.266   6.386   137.868 1.00 31.85  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 0.802   5.967   137.830 1.00 30.32  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 3.166   5.192   137.603 1.00 23.43  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 0.698   9.065   136.876 1.00 29.46  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? -0.087  10.189  137.347 1.00 32.04  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? -1.478  9.658   137.667 1.00 34.53  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? -2.193  9.198   136.761 1.00 37.34  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? -0.178  11.240  136.244 1.00 24.32  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? -0.100  12.708  136.647 1.00 31.85  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 1.230   12.991  137.315 1.00 29.38  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? -0.293  13.598  135.430 1.00 28.35  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? -1.852  9.669   138.947 1.00 39.05  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? -3.226  9.292   139.312 1.00 41.08  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? -3.740  9.967   140.586 1.00 37.78  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? -2.955  10.306  141.458 1.00 38.39  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? -3.376  7.768   139.405 1.00 33.36  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? -2.722  7.128   140.609 1.00 32.69  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? -3.209  5.709   140.827 1.00 41.68  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? -4.433  5.477   140.708 1.00 34.00  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? -2.370  4.826   141.109 1.00 43.45  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? -5.066  10.148  140.708 1.00 35.58  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? -6.116  9.946   139.705 1.00 36.13  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? -6.238  11.137  138.762 1.00 34.49  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? -5.924  12.264  139.149 1.00 33.97  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? -7.377  9.820   140.558 1.00 39.06  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? -7.105  10.697  141.722 1.00 30.92  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? -5.630  10.571  142.002 1.00 32.20  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? -6.702  10.885  137.542 1.00 33.31  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? -6.967  11.943  136.574 1.00 29.14  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? -8.414  11.857  136.126 1.00 25.33  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? -9.009  10.780  136.151 1.00 28.35  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? -6.047  11.806  135.361 1.00 26.38  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? -4.584  12.211  135.535 1.00 27.38  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? -3.763  11.739  134.344 1.00 32.24  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? -4.475  13.717  135.698 1.00 28.23  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? -8.981  12.985  135.710 1.00 23.58  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? -10.352 12.995  135.215 1.00 27.71  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? -10.474 12.175  133.936 1.00 33.31  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? -9.486  11.955  133.232 1.00 35.88  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? -10.851 14.425  134.981 1.00 31.70  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? -11.348 15.137  136.237 1.00 38.88  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? -12.676 14.591  136.752 1.00 47.57  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? -13.244 13.669  136.123 1.00 37.79  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? -13.155 15.090  137.793 1.00 52.33  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? -11.690 11.719  133.654 1.00 32.84  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? -11.962 10.860  132.506 1.00 28.59  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? -11.461 11.472  131.200 1.00 31.30  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? -11.739 12.633  130.897 1.00 30.72  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? -13.462 10.569  132.419 1.00 29.15  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? -13.888 9.754   131.212 1.00 41.98  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? -15.371 9.415   131.277 1.00 40.91  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? -16.217 10.605  131.357 1.00 48.91  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? -17.018 11.023  130.381 1.00 44.25  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? -17.087 10.343  129.244 1.00 38.24  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? -17.755 12.116  130.542 1.00 38.34  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? -10.703 10.685  130.441 1.00 30.24  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? -10.210 11.117  129.146 1.00 33.72  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? -8.867  11.822  129.179 1.00 29.51  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? -8.280  12.098  128.132 1.00 31.14  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? -8.370  12.117  130.374 1.00 26.87  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? -7.117  12.855  130.491 1.00 24.75  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? -5.884  11.965  130.390 1.00 27.29  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? -4.766  12.460  130.235 1.00 23.41  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? -7.090  13.692  131.769 1.00 26.50  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? -7.718  15.043  131.608 1.00 25.96  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? -9.094  15.177  131.552 1.00 30.39  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? -6.932  16.178  131.499 1.00 23.01  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? -9.676  16.417  131.396 1.00 29.52  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? -7.509  17.423  131.342 1.00 26.59  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? -8.883  17.543  131.291 1.00 28.05  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? -6.091  10.654  130.474 1.00 29.99  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? -5.014  9.708   130.255 1.00 24.27  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? -4.474  9.863   128.846 1.00 21.27  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? -3.267  9.938   128.633 1.00 23.62  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? -5.384  9.929   127.881 1.00 23.39  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? -5.013  10.138  126.489 1.00 22.76  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? -4.631  11.596  126.228 1.00 24.23  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? -3.629  11.873  125.558 1.00 26.50  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? -6.147  9.707   125.541 1.00 19.52  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? -5.871  10.177  124.120 1.00 28.56  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? -6.319  8.198   125.584 1.00 18.92  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? -5.426  12.515  126.773 1.00 19.80  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? -5.198  13.951  126.602 1.00 22.79  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? -3.790  14.379  127.018 1.00 22.75  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? -3.147  15.169  126.331 1.00 19.82  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? -6.228  14.786  127.389 1.00 18.39  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? -7.551  14.440  126.965 1.00 22.33  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? -6.005  16.270  127.155 1.00 14.49  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? -3.325  13.877  128.157 1.00 24.51  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? -1.957  14.135  128.595 1.00 24.38  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? -0.946  13.205  127.936 1.00 22.43  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 0.132   13.635  127.528 1.00 18.78  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? -1.845  14.020  130.115 1.00 25.74  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? -2.104  15.300  130.905 1.00 28.93  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? -1.954  15.033  132.395 1.00 32.43  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? -1.155  16.398  130.449 1.00 25.38  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? -1.306  11.929  127.838 1.00 23.62  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? -0.381  10.900  127.402 1.00 21.59  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 0.102   11.041  125.973 1.00 22.68  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 1.306   11.076  125.714 1.00 23.33  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? -0.835  11.133  125.039 1.00 23.02  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? -0.475  11.138  123.622 1.00 22.56  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 0.397   12.299  123.110 1.00 18.81  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 1.357   12.060  122.380 1.00 19.21  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? -1.711  10.954  122.745 1.00 24.85  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? -1.372  10.373  121.397 1.00 20.62  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? -1.054  9.188   121.285 1.00 17.32  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? -1.434  11.204  120.360 1.00 18.34  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 0.067   13.552  123.475 1.00 16.63  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 0.904   14.665  123.017 1.00 15.45  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 2.336   14.514  123.490 1.00 19.17  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 3.262   14.815  122.740 1.00 20.42  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 0.287   15.877  123.712 1.00 13.94  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? -1.071  15.485  124.012 1.00 14.92  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? -1.074  14.028  124.271 1.00 17.19  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 2.509   14.057  124.726 1.00 18.89  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 3.844   13.855  125.267 1.00 20.79  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 4.581   12.804  124.451 1.00 26.45  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 5.753   12.983  124.124 1.00 28.45  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 3.792   13.463  126.745 1.00 21.37  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 3.304   14.561  127.693 1.00 23.30  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 3.335   14.088  129.133 1.00 19.21  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 4.133   15.825  127.523 1.00 26.89  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 3.887   11.722  124.103 1.00 20.58  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 4.493   10.680  123.283 1.00 19.44  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 4.952   11.227  121.936 1.00 18.50  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 6.073   10.966  121.500 1.00 21.94  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 3.537   9.509   123.062 1.00 17.75  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 4.110   8.476   122.115 1.00 13.21  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 3.231   7.265   121.971 1.00 16.44  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 3.898   6.256   121.156 1.00 20.74  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 3.771   6.155   119.837 1.00 15.68  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 2.990   6.999   119.179 1.00 13.17  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 4.425   5.207   119.179 1.00 14.28  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 4.082   11.990  121.283 1.00 16.44  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 4.418   12.585  119.995 1.00 24.24  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 5.648   13.491  120.098 1.00 27.56  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 6.494   13.507  119.201 1.00 24.66  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 3.221   13.350  119.424 1.00 17.15  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 2.025   12.462  119.103 1.00 19.83  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 0.877   13.260  118.501 1.00 18.54  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 1.339   14.140  117.433 1.00 23.75  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 1.571   13.745  116.184 1.00 23.01  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 1.378   12.480  115.833 1.00 20.02  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 1.990   14.620  115.283 1.00 20.05  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 5.750   14.224  121.203 1.00 21.30  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 6.872   15.130  121.419 1.00 20.44  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 8.129   14.350  121.798 1.00 21.70  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 9.236   14.689  121.376 1.00 22.69  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 6.534   16.186  122.495 1.00 19.98  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 5.383   17.070  122.012 1.00 18.27  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 7.744   17.046  122.820 1.00 17.69  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 4.860   18.014  123.059 1.00 20.20  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 7.949   13.291  122.579 1.00 20.05  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 9.067   12.454  123.006 1.00 22.29  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 9.724   11.716  121.840 1.00 22.76  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 10.941  11.536  121.817 1.00 22.46  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 8.611   11.452  124.069 1.00 21.55  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 8.336   11.993  125.471 1.00 19.25  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 7.545   10.976  126.274 1.00 15.54  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 9.635   12.351  126.172 1.00 18.09  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 8.917   11.289  120.875 1.00 22.87  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 9.427   10.539  119.734 1.00 19.28  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 10.111  11.434  118.708 1.00 22.12  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 10.968  10.977  117.948 1.00 24.26  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 8.298   9.759   119.063 1.00 16.76  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 7.790   8.533   119.820 1.00 18.43  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 6.618   7.916   119.087 1.00 16.72  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 8.905   7.514   120.003 1.00 19.69  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 9.741   12.710  118.697 1.00 21.57  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 10.178  13.625  117.643 1.00 22.61  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 11.162  14.709  118.090 1.00 22.85  ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 12.286  14.777  117.595 1.00 28.27  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 8.971   14.257  116.940 1.00 18.74  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 8.130   14.931  117.857 1.00 19.03  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 10.727  15.561  119.011 1.00 21.73  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 11.420  16.818  119.290 1.00 25.49  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 12.468  16.823  120.416 1.00 23.75  ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 12.985  17.885  120.770 1.00 20.39  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 10.394  17.929  119.511 1.00 21.05  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 9.537   18.026  118.388 1.00 22.55  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 12.773  15.662  120.988 1.00 21.25  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 13.776  15.600  122.053 1.00 26.32  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 15.196  15.644  121.494 1.00 29.13  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 15.611  14.732  120.780 1.00 27.35  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 13.628  14.338  122.924 1.00 25.78  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 12.191  14.198  123.432 1.00 22.80  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 14.609  14.381  124.080 1.00 27.28  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 11.653  15.435  124.119 1.00 20.20  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 15.946  16.707  121.824 1.00 29.81  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 17.307  16.911  121.311 1.00 24.52  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 18.258  15.807  121.762 1.00 26.49  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 17.977  15.128  122.750 1.00 29.76  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 17.716  18.252  121.931 1.00 22.12  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 16.428  18.931  122.260 1.00 23.18  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 15.513  17.824  122.679 1.00 23.70  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 19.369  15.638  121.049 1.00 26.94  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 20.309  14.570  121.344 1.00 26.23  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 21.588  14.626  120.526 1.00 27.28  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 21.934  15.664  119.961 1.00 30.33  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 22.299  13.505  120.473 1.00 25.56  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 23.569  13.442  119.760 1.00 28.31  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 23.615  12.299  118.752 1.00 29.80  ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 22.994  11.254  118.955 1.00 31.70  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 24.746  13.274  120.733 1.00 28.58  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 24.479  12.178  121.617 1.00 24.35  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 24.954  14.542  121.549 1.00 32.74  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 24.351  12.512  117.664 1.00 27.28  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 24.587  11.473  116.666 1.00 25.95  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 25.842  11.782  115.856 1.00 25.32  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 26.285  12.931  115.804 1.00 26.35  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 23.386  11.334  115.749 1.00 31.44  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 26.409  10.760  115.220 1.00 21.28  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 27.570  10.963  114.363 1.00 26.06  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 27.126  11.711  113.115 1.00 28.27  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 26.276  11.228  112.366 1.00 24.31  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 28.180  9.610   113.933 1.00 22.25  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 29.090  9.783   112.726 1.00 21.56  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 28.928  8.965   115.089 1.00 25.16  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 27.682  12.901  112.900 1.00 29.43  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 27.377  13.651  111.687 1.00 25.91  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 28.398  13.509  110.565 1.00 27.95  ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 28.116  13.890  109.428 1.00 32.17  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 27.168  15.142  111.980 1.00 27.43  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 28.397  15.718  112.437 1.00 29.45  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 26.099  15.316  113.040 1.00 39.55  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 29.576  12.964  110.864 1.00 27.15  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 30.569  12.771  109.799 1.00 23.88  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 31.638  11.735  110.117 1.00 23.22  ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 31.898  11.436  111.279 1.00 25.43  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 31.235  14.096  109.427 1.00 24.66  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 32.002  13.953  108.247 1.00 28.77  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 32.263  11.195  109.075 1.00 19.69  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 33.346  10.230  109.248 1.00 25.39  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 34.476  10.459  108.253 1.00 31.32  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 34.242  10.522  107.045 1.00 32.01  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 32.861  8.777   109.065 1.00 25.21  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 34.040  7.813   109.127 1.00 23.73  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 31.819  8.416   110.108 1.00 31.50  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 35.699  10.578  108.758 1.00 32.00  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 36.868  10.530  107.891 1.00 30.94  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 37.690  9.291   108.193 1.00 33.22  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 37.947  8.978   109.352 1.00 38.80  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 37.748  11.771  108.030 1.00 31.09  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 39.087  11.598  107.343 1.00 41.08  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 39.179  11.574  105.957 1.00 41.19  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 40.255  11.431  108.079 1.00 45.17  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 40.397  11.402  105.322 1.00 47.48  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 41.477  11.259  107.452 1.00 44.21  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 41.543  11.246  106.074 1.00 49.71  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 42.757  11.075  105.446 1.00 52.49  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 38.095  8.584   107.146 1.00 32.63  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 38.983  7.443   107.297 1.00 33.61  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 40.184  7.624   106.380 1.00 36.32  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 40.029  7.984   105.214 1.00 37.56  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 38.277  6.120   106.959 1.00 31.43  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 36.974  5.991   107.751 1.00 31.33  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 39.193  4.946   107.242 1.00 30.27  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 36.232  4.700   107.495 1.00 31.18  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 41.377  7.385   106.914 1.00 39.96  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 42.605  7.548   106.144 1.00 41.01  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 42.632  6.608   104.942 1.00 37.74  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 42.264  5.437   105.053 1.00 37.68  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 43.828  7.321   107.034 1.00 41.54  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 45.157  7.489   106.320 1.00 51.58  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 46.336  7.457   107.271 1.00 59.56  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 46.169  7.878   108.435 1.00 65.59  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 47.427  7.010   106.855 1.00 63.23  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 43.053  7.143   103.797 1.00 37.05  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 43.118  6.398   102.538 1.00 39.96  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 41.744  5.923   102.061 1.00 38.85  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 41.633  4.934   101.335 1.00 38.99  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 44.096  5.222   102.636 1.00 40.42  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 45.486  5.655   103.056 1.00 48.04  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 45.872  6.804   102.752 1.00 46.00  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 46.191  4.845   103.694 1.00 51.67  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 40.703  6.637   102.476 1.00 35.41  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 39.349  6.366   102.011 1.00 28.29  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 38.746  7.641   101.429 1.00 31.86  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 38.519  8.618   102.144 1.00 28.36  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 38.457  5.831   103.143 1.00 27.62  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 37.002  5.815   102.712 1.00 22.80  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 38.910  4.440   103.561 1.00 27.25  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 38.506  7.626   100.122 1.00 33.31  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 38.015  8.805   99.418  1.00 30.01  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 36.497  8.982   99.493  1.00 26.40  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 35.990  10.092  99.317  1.00 25.34  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 38.479  8.771   97.960  1.00 32.88  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 39.996  8.661   97.776  1.00 30.88  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 40.363  8.453   96.313  1.00 31.02  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 40.685  9.893   98.330  1.00 27.85  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 35.781  7.891   99.764  1.00 21.11  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 34.318  7.913   99.784  1.00 21.50  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 33.712  6.681   100.454 1.00 23.94  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 34.429  5.774   100.871 1.00 31.77  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 33.767  8.048   98.363  1.00 25.51  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 34.295  7.022   97.411  1.00 22.25  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 33.945  5.690   97.481  1.00 21.06  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 35.155  7.131   96.370  1.00 18.44  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 34.562  5.024   96.522  1.00 19.86  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 35.301  5.875   95.833  1.00 18.97  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 32.383  6.650   100.531 1.00 18.38  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 31.660  5.618   101.276 1.00 21.17  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 31.684  4.255   100.583 1.00 18.16  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 31.491  3.218   101.212 1.00 22.33  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 30.213  6.071   101.499 1.00 24.53  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 29.374  5.145   102.366 1.00 23.24  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 28.048  5.767   102.762 1.00 30.95  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 27.846  6.968   102.480 1.00 34.20  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 27.205  5.056   103.352 1.00 31.24  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 31.966  4.276   99.288  1.00 18.69  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 31.837  3.115   98.410  1.00 20.63  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 33.095  2.256   98.334  1.00 25.93  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 33.252  1.439   97.427  1.00 24.13  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 31.335  3.539   97.032  1.00 21.45  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 30.037  4.278   97.088  1.00 20.89  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 30.002  5.657   96.953  1.00 14.16  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 28.853  3.599   97.328  1.00 15.42  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 28.808  6.340   97.027  1.00 13.26  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 27.654  4.277   97.403  1.00 15.12  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 27.631  5.651   97.252  1.00 15.70  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 34.008  2.484   99.270  1.00 28.26  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 35.334  1.885   99.229  1.00 28.29  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 35.532  0.865   100.348 1.00 27.30  ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 34.770  0.823   101.313 1.00 24.91  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 36.401  2.977   99.332  1.00 29.31  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 35.814  4.267   99.302  1.00 21.60  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 36.528  0.004   100.172 1.00 30.10  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 36.891  -0.992  101.173 1.00 28.47  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 38.304  -0.702  101.655 1.00 29.68  ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 39.043  0.042   101.010 1.00 34.33  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 36.861  -2.417  100.606 1.00 24.46  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 37.738  -2.496  99.476  1.00 24.94  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 35.452  -2.802  100.184 1.00 25.17  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 38.671  -1.269  102.799 1.00 28.74  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 40.002  -1.055  103.354 1.00 31.67  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 40.702  -2.400  103.502 1.00 28.20  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 40.084  -3.378  103.922 1.00 29.03  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 39.904  -0.385  104.742 1.00 32.49  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 39.073  0.898   104.658 1.00 29.13  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 41.283  -0.096  105.314 1.00 31.63  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 38.738  1.496   106.006 1.00 28.58  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 41.999  -2.453  103.155 1.00 28.99  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 42.772  -3.693  103.284 1.00 28.41  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 42.887  -4.130  104.737 1.00 31.26  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 43.240  -3.321  105.597 1.00 31.75  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 44.147  -3.304  102.741 1.00 24.86  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 43.876  -2.174  101.812 1.00 27.61  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 42.750  -1.410  102.434 1.00 26.98  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 42.592  -5.397  105.002 1.00 28.27  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 42.673  -5.929  106.349 1.00 35.76  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 41.408  -5.727  107.160 1.00 33.21  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 41.280  -6.257  108.261 1.00 40.02  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 40.472  -4.952  106.624 1.00 34.34  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 39.197  -4.736  107.296 1.00 27.66  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 38.093  -5.531  106.605 1.00 29.17  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 37.940  -5.472  105.385 1.00 31.68  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 38.820  -3.245  107.337 1.00 26.07  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 37.528  -3.051  108.103 1.00 27.44  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 39.938  -2.435  107.974 1.00 30.25  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 37.335  -6.287  107.392 1.00 26.58  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 36.261  -7.115  106.859 1.00 25.33  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 35.103  -6.260  106.360 1.00 21.62  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 34.666  -6.394  105.218 1.00 23.67  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 35.771  -8.099  107.923 1.00 25.49  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 34.686  -9.044  107.445 1.00 23.93  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 34.225  -9.966  108.561 1.00 23.47  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 33.058  -10.824 108.108 1.00 26.37  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 32.640  -11.815 109.135 1.00 33.53  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 34.614  -5.375  107.223 1.00 22.12  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 33.508  -4.490  106.876 1.00 21.69  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 33.913  -3.481  105.808 1.00 17.53  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 35.030  -2.971  105.817 1.00 17.26  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 33.004  -3.744  108.116 1.00 19.19  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 32.303  -4.615  109.154 1.00 24.09  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 33.266  -5.309  110.103 1.00 28.99  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 34.491  -5.213  109.890 1.00 30.88  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 32.794  -5.950  111.067 1.00 32.44  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 33.004  -3.202  104.882 1.00 14.97  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 33.214  -2.120  103.936 1.00 15.08  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 32.877  -0.817  104.646 1.00 18.10  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 32.413  -0.833  105.786 1.00 18.59  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 32.332  -2.306  102.698 1.00 19.49  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 30.881  -2.604  103.051 1.00 27.32  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 30.118  -1.647  103.313 1.00 18.80  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 30.502  -3.796  103.064 1.00 34.42  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 33.084  0.310   103.975 1.00 19.25  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 32.863  1.602   104.614 1.00 18.58  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 31.376  1.856   104.872 1.00 20.78  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 31.019  2.465   105.877 1.00 21.74  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 33.519  2.763   103.825 1.00 15.62  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 33.092  4.115   104.376 1.00 15.05  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 35.026  2.638   103.885 1.00 16.67  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 30.514  1.371   103.981 1.00 17.95  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 29.071  1.509   104.172 1.00 16.31  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 28.658  0.843   105.481 1.00 15.63  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 27.858  1.387   106.249 1.00 16.18  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 28.269  0.912   102.990 1.00 17.51  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 26.781  0.867   103.307 1.00 12.43  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 28.516  1.709   101.723 1.00 12.79  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 29.236  -0.323  105.746 1.00 18.54  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 28.946  -1.048  106.978 1.00 20.45  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 29.566  -0.363  108.189 1.00 19.32  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 28.958  -0.309  109.251 1.00 22.56  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 29.424  -2.496  106.889 1.00 17.37  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 28.965  -3.356  108.049 1.00 15.70  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 29.096  -4.836  107.758 1.00 29.59  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 28.640  -5.645  108.595 1.00 30.56  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 29.652  -5.187  106.692 1.00 25.56  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 30.779  0.155   108.024 1.00 19.29  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 31.449  0.882   109.096 1.00 21.70  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 30.621  2.086   109.542 1.00 24.69  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 30.436  2.317   110.736 1.00 27.53  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 32.867  1.326   108.676 1.00 23.75  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 33.805  0.117   108.644 1.00 19.69  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 33.409  2.386   109.624 1.00 22.83  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 35.206  0.443   108.191 1.00 21.81  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 30.107  2.836   108.573 1.00 24.83  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 29.234  3.971   108.851 1.00 21.15  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 27.915  3.500   109.457 1.00 19.56  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 27.389  4.135   110.367 1.00 20.48  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 28.975  4.807   107.577 1.00 20.89  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 30.294  5.365   107.039 1.00 23.40  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 27.996  5.939   107.857 1.00 13.69  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 30.157  6.118   105.741 1.00 24.11  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 27.390  2.382   108.963 1.00 22.19  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 26.161  1.815   109.519 1.00 20.97  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 26.321  1.463   110.993 1.00 22.62  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 25.382  1.599   111.776 1.00 26.75  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 25.715  0.580   108.735 1.00 17.68  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 24.861  0.835   107.493 1.00 18.09  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 24.393  -0.482  106.893 1.00 12.16  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 23.676  1.727   107.834 1.00 15.78  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 27.515  1.011   111.362 1.00 23.27  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 27.821  0.690   112.750 1.00 23.06  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 28.030  1.954   113.570 1.00 24.56  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 27.563  2.054   114.701 1.00 28.81  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 29.059  -0.203  112.838 1.00 20.51  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 28.835  -1.573  112.229 1.00 25.00  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 27.704  -2.053  112.148 1.00 28.01  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 29.918  -2.213  111.801 1.00 25.84  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 28.727  2.922   112.983 1.00 23.16  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 28.981  4.201   113.636 1.00 27.16  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 27.695  4.996   113.832 1.00 27.33  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 27.653  5.940   114.619 1.00 28.70  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 29.981  5.025   112.821 1.00 31.14  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 31.431  4.537   112.810 1.00 31.79  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 32.238  5.284   111.763 1.00 24.98  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 32.062  4.694   114.186 1.00 31.13  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 26.649  4.610   113.109 1.00 28.69  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 25.364  5.289   113.196 1.00 30.35  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 24.609  4.819   114.437 1.00 31.42  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 23.637  5.443   114.860 1.00 30.64  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 24.541  5.040   111.928 1.00 22.38  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 23.448  6.069   111.692 1.00 29.81  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 22.937  6.040   110.258 1.00 22.30  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 22.095  4.807   109.981 1.00 30.73  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 21.533  4.829   108.597 1.00 28.58  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 25.074  3.714   115.016 1.00 26.69  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 24.492  3.168   116.238 1.00 29.09  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 25.206  3.709   117.471 1.00 29.80  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 24.803  3.433   118.602 1.00 29.42  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 24.579  1.639   116.234 1.00 31.07  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 23.763  0.961   115.148 1.00 31.81  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 22.275  1.003   115.425 1.00 39.47  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 21.892  1.157   116.604 1.00 45.82  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 21.489  0.882   114.462 1.00 52.16  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 26.268  4.476   117.246 1.00 31.04  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 27.082  5.005   118.335 1.00 26.52  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 26.303  5.990   119.196 1.00 24.95  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 25.721  6.948   118.689 1.00 27.85  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 28.337  5.679   117.778 1.00 28.21  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 29.346  6.222   118.794 1.00 32.98  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 30.065  5.083   119.506 1.00 27.29  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 30.342  7.156   118.118 1.00 28.84  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 26.297  5.749   120.502 1.00 27.79  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 25.641  6.653   121.437 1.00 30.19  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 26.676  7.473   122.203 1.00 28.29  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 27.454  6.933   122.986 1.00 30.03  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 24.766  5.889   122.439 1.00 28.76  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 23.924  6.862   123.249 1.00 34.96  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 23.884  4.891   121.715 1.00 24.26  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 26.680  8.780   121.972 1.00 27.83  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 27.649  9.660   122.612 1.00 27.21  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 26.975  10.665  123.533 1.00 31.85  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 26.168  11.485  123.097 1.00 32.92  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 28.493  10.422  121.576 1.00 23.24  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 29.424  11.396  122.270 1.00 26.35  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 29.279  9.447   120.719 1.00 29.11  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 27.318  10.596  124.813 1.00 38.72  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 26.778  11.512  125.804 1.00 41.83  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 27.722  12.678  126.058 1.00 40.03  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 28.921  12.484  126.280 1.00 35.57  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 26.502  10.791  127.123 1.00 40.60  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 25.877  11.696  128.166 1.00 41.70  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 25.909  11.092  129.553 1.00 45.25  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 25.443  12.054  130.547 1.00 54.99  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 25.455  11.842  131.858 1.00 54.72  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 25.911  10.693  132.340 1.00 47.27  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 25.009  12.779  132.684 1.00 51.28  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 27.165  13.886  126.019 1.00 44.88  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 27.893  15.093  126.385 1.00 46.87  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 27.532  15.483  127.813 1.00 53.94  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 26.364  15.434  128.201 1.00 60.83  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 27.544  16.251  125.447 1.00 44.70  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 28.098  16.107  124.058 1.00 38.82  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 28.945  15.062  123.733 1.00 40.76  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 27.779  17.033  123.079 1.00 41.31  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 29.453  14.937  122.453 1.00 40.79  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 28.285  16.916  121.798 1.00 40.62  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 29.124  15.866  121.484 1.00 40.81  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 28.533  15.872  128.594 1.00 49.34  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 28.298  16.327  129.959 1.00 45.22  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 28.029  17.829  129.984 1.00 49.26  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 26.951  18.268  130.385 1.00 52.30  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 29.467  15.956  130.875 1.00 47.82  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 29.471  14.524  131.426 1.00 55.13  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 28.120  14.195  132.046 1.00 58.05  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 29.833  13.494  130.363 1.00 41.37  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 29.017  18.612  129.564 1.00 48.60  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 28.861  20.059  129.459 1.00 49.05  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 27.833  20.434  128.389 1.00 56.93  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 27.998  20.093  127.217 1.00 52.23  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 30.212  20.713  129.156 1.00 50.57  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 30.229  22.198  129.469 1.00 60.04  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 29.244  22.906  129.255 1.00 58.57  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 31.356  22.676  129.984 1.00 64.57  ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 26.764  21.138  128.797 1.00 56.31  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 25.663  21.542  127.914 1.00 49.73  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 26.091  22.559  126.862 1.00 52.47  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 25.392  22.746  125.866 1.00 55.37  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 24.665  22.197  128.877 1.00 54.98  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 25.028  21.681  130.227 1.00 48.50  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 26.510  21.520  130.196 1.00 49.87  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 27.224  23.212  127.090 1.00 56.42  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 27.707  24.252  126.190 1.00 63.23  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 28.356  23.661  124.939 1.00 57.74  ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 28.485  24.335  123.915 1.00 51.92  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 28.710  25.150  126.918 1.00 61.09  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 28.252  25.472  128.221 1.00 60.33  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 28.756  22.398  125.031 1.00 57.22  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 29.524  21.749  123.975 1.00 51.28  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 28.641  21.269  122.827 1.00 51.86  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 27.771  20.417  123.013 1.00 49.99  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 30.291  20.568  124.569 1.00 43.13  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 31.031  19.627  123.625 1.00 41.14  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 32.148  20.357  122.902 1.00 43.84  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 31.575  18.459  124.420 1.00 43.92  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 28.870  21.825  121.640 1.00 45.74  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 28.114  21.446  120.448 1.00 49.36  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 28.620  20.203  119.709 1.00 47.29  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 27.829  19.360  119.290 1.00 46.01  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 27.995  22.631  119.485 1.00 48.47  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 27.076  23.724  119.997 1.00 49.89  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 25.751  23.172  120.490 1.00 60.85  ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 24.883  22.809  119.695 1.00 73.91  ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 25.593  23.095  121.808 1.00 55.04  ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 29.935  20.092  119.550 1.00 48.49  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 30.497  19.040  118.708 1.00 45.66  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 31.780  18.429  119.258 1.00 40.09  ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 32.558  19.095  119.940 1.00 36.15  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 30.776  19.555  117.284 1.00 43.54  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 31.791  18.746  116.675 1.00 40.76  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 31.250  21.000  117.325 1.00 43.21  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 31.988  17.152  118.953 1.00 34.22  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 33.211  16.455  119.337 1.00 38.86  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 33.708  15.576  118.195 1.00 37.51  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 32.928  14.858  117.572 1.00 40.13  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 32.999  15.568  120.583 1.00 34.34  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 34.259  14.789  120.902 1.00 32.71  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 32.611  16.408  121.772 1.00 44.94  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 35.006  15.633  117.919 1.00 33.30  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 35.595  14.734  116.942 1.00 37.34  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 36.329  13.605  117.653 1.00 38.59  ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 37.403  13.808  118.217 1.00 47.09  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 36.583  15.473  116.024 1.00 47.74  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 35.899  16.525  115.330 1.00 50.69  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 37.192  14.510  115.014 1.00 36.29  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 35.749  12.410  117.605 1.00 35.34  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 36.348  11.237  118.228 1.00 34.29  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 37.452  10.674  117.346 1.00 34.35  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 37.224  10.351  116.182 1.00 32.19  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 35.292  10.159  118.477 1.00 32.41  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 34.569  10.112  119.825 1.00 38.25  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 33.839  11.405  120.109 1.00 32.83  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 33.600  8.940   119.851 1.00 43.26  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 38.651  10.556  117.907 1.00 40.25  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 39.784  10.024  117.163 1.00 36.57  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 39.992  8.551   117.489 1.00 36.99  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 40.001  8.160   118.657 1.00 38.25  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 41.052  10.821  117.472 1.00 31.69  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 40.935  12.341  117.339 1.00 35.06  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 42.297  13.005  117.466 1.00 38.21  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 40.272  12.723  116.026 1.00 45.37  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 40.145  7.735   116.451 1.00 36.23  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 40.403  6.312   116.629 1.00 31.09  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 41.607  5.893   115.797 1.00 40.42  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 41.728  6.258   114.630 1.00 41.89  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 39.174  5.484   116.249 1.00 27.68  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 39.116  4.022   116.708 1.00 33.90  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 37.668  3.567   116.812 1.00 40.46  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 39.888  3.090   115.781 1.00 34.10  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 42.505  5.137   116.412 1.00 45.01  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 43.665  4.606   115.715 1.00 37.13  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 43.848  3.170   116.167 1.00 40.16  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 43.951  2.901   117.364 1.00 50.17  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 44.905  5.439   116.037 1.00 35.77  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 46.029  5.315   115.025 1.00 43.30  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 46.908  6.556   115.046 1.00 46.14  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 46.079  7.813   114.806 1.00 47.88  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 46.879  9.063   114.935 1.00 47.00  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 43.869  2.243   115.218 1.00 39.31  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 43.941  0.833   115.571 1.00 40.20  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 44.551  -0.015  114.467 1.00 44.79  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 44.629  0.405   113.312 1.00 48.03  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 42.560  0.309   115.938 1.00 44.18  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 44.987  -1.212  114.843 1.00 44.76  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 45.529  -2.175  113.896 1.00 48.06  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 45.288  -3.599  114.389 1.00 49.12  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 45.086  -3.827  115.582 1.00 46.79  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 47.014  -1.911  113.632 1.00 52.64  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 47.773  -1.336  114.816 1.00 63.02  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 49.016  -0.574  114.391 1.00 68.73  ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 49.831  -0.224  115.271 1.00 59.32  ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 49.173  -0.320  113.176 1.00 70.71  ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 45.300  -4.552  113.463 1.00 49.98  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 44.886  -5.906  113.771 1.00 43.53  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 46.003  -6.918  113.942 1.00 49.06  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 47.180  -6.565  113.858 1.00 54.52  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 45.637  -8.193  114.166 1.00 43.26  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 44.243  -8.636  114.298 1.00 44.81  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 43.579  -8.169  115.590 1.00 50.84  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 44.131  -8.360  116.674 1.00 57.46  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 44.365  -10.160 114.298 1.00 49.58  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 45.717  -10.422 114.850 1.00 53.78  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 46.586  -9.304  114.350 1.00 51.45  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 42.407  -7.555  115.465 1.00 47.77  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 41.593  -7.206  116.626 1.00 42.54  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 40.169  -6.927  116.176 1.00 44.23  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 39.933  -6.661  115.004 1.00 43.03  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 42.159  -5.986  117.356 1.00 42.38  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 41.845  -4.655  116.694 1.00 37.29  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 42.322  -3.487  117.548 1.00 35.58  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 41.655  -3.493  118.916 1.00 38.76  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 42.028  -2.301  119.726 1.00 37.92  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 39.218  -6.974  117.098 1.00 39.01  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 37.881  -6.509  116.771 1.00 32.00  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 37.671  -5.133  117.388 1.00 29.35  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 37.491  -5.007  118.597 1.00 32.83  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 36.829  -7.497  117.268 1.00 26.67  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 36.888  -8.847  116.581 1.00 27.91  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 35.757  -9.764  117.004 1.00 49.42  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 35.074  -9.451  118.004 1.00 42.65  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 35.546  -10.797 116.332 1.00 62.84  ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 37.671  -4.106  116.547 1.00 27.41  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 37.589  -2.733  117.023 1.00 26.72  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 36.174  -2.386  117.466 1.00 35.36  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 35.219  -2.472  116.676 1.00 39.56  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 38.042  -1.732  115.947 1.00 25.98  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 37.935  -0.306  116.470 1.00 32.16  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 39.462  -2.037  115.506 1.00 28.29  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 36.063  -1.998  118.736 1.00 35.63  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 34.803  -1.600  119.350 1.00 35.35  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 34.736  -0.090  119.546 1.00 36.36  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 35.692  0.630   119.255 1.00 34.64  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 34.634  -2.294  120.703 1.00 33.83  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 34.564  -3.805  120.623 1.00 30.13  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 33.409  -4.241  119.746 1.00 35.35  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 33.248  -5.746  119.751 1.00 37.45  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 34.492  -6.427  119.314 1.00 35.74  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 33.607  0.380   120.065 1.00 34.78  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 33.396  1.804   120.291 1.00 38.01  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 34.208  2.271   121.488 1.00 43.46  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 34.465  3.463   121.660 1.00 48.88  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 31.918  2.088   120.508 1.00 39.77  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 34.607  1.314   122.315 1.00 47.03  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 35.404  1.588   123.499 1.00 43.01  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 36.810  2.036   123.104 1.00 43.23  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 37.471  2.761   123.846 1.00 47.27  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 35.467  0.329   124.365 1.00 41.31  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 35.993  0.530   125.771 1.00 51.24  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 35.803  -0.740  126.588 1.00 52.08  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 35.997  -1.937  125.771 1.00 54.73  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 35.059  -2.853  125.546 1.00 53.50  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 33.856  -2.720  126.089 1.00 49.34  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 35.328  -3.907  124.786 1.00 47.77  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 37.247  1.617   121.918 1.00 43.06  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 38.598  1.901   121.433 1.00 36.73  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 38.821  3.361   121.030 1.00 37.87  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 39.944  3.756   120.714 1.00 38.17  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 38.961  0.974   120.267 1.00 32.62  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 39.142  -0.471  120.700 1.00 44.12  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 40.199  -0.790  121.283 1.00 56.31  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 38.234  -1.291  120.448 1.00 42.55  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 37.756  4.157   121.028 1.00 35.78  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 37.876  5.578   120.722 1.00 36.63  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 38.667  6.293   121.807 1.00 42.06  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 38.450  6.056   122.995 1.00 44.45  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 36.497  6.225   120.586 1.00 41.13  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 35.884  6.071   119.223 1.00 44.77  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 34.832  5.194   119.015 1.00 44.80  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 36.358  6.807   118.150 1.00 43.56  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 34.266  5.053   117.762 1.00 41.23  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 35.797  6.671   116.895 1.00 39.17  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 34.750  5.793   116.700 1.00 41.20  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 39.586  7.162   121.398 1.00 40.80  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 40.359  7.945   122.354 1.00 40.37  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 39.432  8.842   123.162 1.00 43.54  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 38.631  9.585   122.592 1.00 42.96  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 41.425  8.788   121.651 1.00 43.21  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 42.538  8.041   120.913 1.00 38.28  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 43.726  8.962   120.677 1.00 29.84  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 42.957  6.794   121.673 1.00 43.31  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 39.535  8.763   124.499 1.00 47.10  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 38.677  9.495   125.438 1.00 40.02  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 38.766  11.006  125.260 1.00 35.15  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 39.827  11.525  124.919 1.00 39.15  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 39.244  9.100   126.805 1.00 30.51  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 39.913  7.793   126.573 1.00 35.74  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 40.493  7.890   125.200 1.00 40.56  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 37.651  11.696  125.477 1.00 35.86  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 37.628  13.154  125.462 1.00 38.81  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 36.989  13.647  126.759 1.00 45.76  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 36.176  12.945  127.364 1.00 41.50  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 36.841  13.704  124.248 1.00 38.54  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 37.076  15.203  124.080 1.00 29.76  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 37.233  12.966  122.978 1.00 44.44  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 37.371  14.846  127.191 1.00 52.22  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 36.823  15.442  128.403 1.00 50.90  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 35.323  15.688  128.272 1.00 46.05  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 34.864  16.246  127.274 1.00 45.76  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 37.549  16.738  128.727 1.00 60.53  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 34.574  15.264  129.288 1.00 50.20  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 33.118  15.402  129.312 1.00 52.28  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 32.447  14.703  128.129 1.00 50.04  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 31.507  15.231  127.535 1.00 54.05  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 32.705  16.877  129.369 1.00 51.45  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 33.201  17.575  130.621 1.00 60.73  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 33.250  16.925  131.688 1.00 61.34  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 33.541  18.775  130.536 1.00 59.01  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 32.947  13.523  127.780 1.00 39.22  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 32.350  12.719  126.722 1.00 40.87  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 32.269  11.253  127.144 1.00 38.41  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 33.294  10.624  127.403 1.00 39.09  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 33.158  12.827  125.409 1.00 45.98  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 32.676  11.797  124.398 1.00 45.12  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 33.069  14.237  124.833 1.00 38.84  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 31.057  10.706  127.205 1.00 34.51  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 30.888  9.308   127.603 1.00 35.99  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 30.150  8.467   126.563 1.00 37.23  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 29.015  8.765   126.206 1.00 34.27  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 30.160  9.208   128.946 1.00 38.45  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 29.918  7.773   129.404 1.00 36.71  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 28.921  7.676   130.548 1.00 44.05  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 28.549  8.729   131.114 1.00 41.01  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 28.504  6.543   130.876 1.00 36.28  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 30.791  7.403   126.093 1.00 31.96  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 30.139  6.473   125.181 1.00 33.87  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 29.243  5.530   125.979 1.00 36.12  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 29.716  4.797   126.846 1.00 41.42  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 31.162  5.646   124.376 1.00 34.43  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 31.824  6.504   123.295 1.00 30.50  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 30.492  4.440   123.740 1.00 37.56  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 33.022  7.289   123.776 1.00 40.68  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 27.949  5.544   125.681 1.00 32.83  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 26.993  4.766   126.459 1.00 31.83  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 26.915  3.317   125.979 1.00 34.14  ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 26.247  2.486   126.592 1.00 31.32  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 25.610  5.422   126.427 1.00 36.82  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 25.613  6.931   126.693 1.00 43.98  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 26.190  7.432   128.335 1.00 34.37  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 25.046  6.549   129.394 1.00 36.14  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 27.601  3.018   124.880 1.00 36.30  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 27.650  1.651   124.365 1.00 37.27  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 29.038  1.242   123.872 1.00 39.28  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 29.262  1.101   122.669 1.00 38.56  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 26.595  1.431   123.272 1.00 36.86  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 26.685  2.451   122.150 1.00 33.12  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 27.147  3.575   122.346 1.00 34.12  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 26.234  2.061   120.963 1.00 33.47  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 29.973  1.038   124.810 1.00 36.50  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 31.363  0.702   124.484 1.00 40.48  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 31.514  -0.655  123.799 1.00 42.04  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 32.498  -0.863  123.089 1.00 44.44  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 32.046  0.681   125.854 1.00 48.05  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 30.950  0.398   126.816 1.00 40.96  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 29.750  1.098   126.264 1.00 32.81  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 30.559  -1.559  124.005 1.00 42.87  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 30.624  -2.889  123.398 1.00 50.06  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 30.141  -2.909  121.947 1.00 49.38  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 30.240  -3.936  121.270 1.00 43.90  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 29.831  -3.906  124.223 1.00 54.33  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 30.654  -4.519  125.338 1.00 70.63  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 30.402  -5.693  125.683 1.00 79.89  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 31.553  -3.828  125.865 1.00 65.55  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 29.615  -1.778  121.481 1.00 40.78  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 29.153  -1.658  120.102 1.00 40.93  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 30.281  -1.975  119.134 1.00 43.55  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 31.368  -1.402  119.227 1.00 39.93  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 28.626  -0.248  119.827 1.00 40.24  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 28.325  0.065   118.359 1.00 31.31  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 27.172  -0.784  117.853 1.00 31.32  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 28.035  1.543   118.164 1.00 24.08  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 30.023  -2.890  118.208 1.00 35.21  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 31.039  -3.272  117.240 1.00 35.49  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 31.256  -2.166  116.214 1.00 34.39  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 30.313  -1.490  115.805 1.00 35.43  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 30.668  -4.579  116.542 1.00 34.55  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 31.720  -5.074  115.601 1.00 32.61  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 32.708  -5.954  115.988 1.00 36.43  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 31.951  -4.798  114.296 1.00 33.28  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 33.496  -6.208  114.957 1.00 36.95  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 33.059  -5.518  113.919 1.00 36.22  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 32.509  -1.979  115.816 1.00 32.83  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 32.853  -1.008  114.786 1.00 30.74  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 33.424  -1.717  113.568 1.00 34.57  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 32.864  -1.640  112.473 1.00 35.57  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 33.856  0.050   115.282 1.00 29.24  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 33.230  0.900   116.386 1.00 29.32  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 34.307  0.932   114.129 1.00 31.75  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 31.928  1.548   115.989 1.00 28.46  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 34.550  -2.397  113.752 1.00 31.17  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 35.182  -3.062  112.616 1.00 26.34  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 35.885  -4.356  113.002 1.00 32.68  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 36.131  -4.614  114.175 1.00 37.79  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 36.153  -2.118  111.927 1.00 24.74  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 36.188  -5.178  112.007 1.00 28.89  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 37.004  -6.362  112.230 1.00 27.64  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 38.329  -6.220  111.487 1.00 36.46  ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 38.374  -6.219  110.258 1.00 38.47  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 36.276  -7.650  111.810 1.00 29.89  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 35.240  -7.941  112.758 1.00 31.60  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 37.244  -8.821  111.758 1.00 26.75  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 39.405  -6.081  112.250 1.00 44.39  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 40.734  -5.888  111.689 1.00 34.86  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 41.588  -7.154  111.739 1.00 42.74  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 41.509  -7.956  112.678 1.00 42.94  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 41.452  -4.718  112.365 1.00 35.46  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 41.277  -3.356  111.686 1.00 40.46  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 39.812  -2.943  111.638 1.00 36.29  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 42.114  -2.296  112.383 1.00 38.32  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 42.426  -7.288  110.719 1.00 40.78  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 43.158  -8.504  110.410 1.00 41.85  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 44.637  -8.148  110.423 1.00 46.77  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 44.980  -6.966  110.449 1.00 47.08  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 42.736  -8.977  109.019 1.00 41.39  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 43.344  -10.269 108.531 1.00 44.09  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 43.262  -10.384 107.025 1.00 46.78  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 43.272  -9.332  106.350 1.00 38.51  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 43.178  -11.520 106.517 1.00 48.70  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 45.509  -9.154  110.439 1.00 47.05  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 46.946  -8.909  110.419 1.00 52.73  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 47.306  -8.011  109.245 1.00 47.70  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 47.004  -8.325  108.095 1.00 47.90  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 47.713  -10.228 110.300 1.00 58.68  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 48.328  -10.718 111.600 1.00 63.07  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 49.409  -9.790  112.118 1.00 62.66  ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 49.626  -9.760  113.348 1.00 58.40  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 50.045  -9.094  111.296 1.00 59.52  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 47.960  -6.895  109.547 1.00 48.76  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 48.287  -5.906  108.539 1.00 50.49  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 47.186  -4.879  108.357 1.00 40.58  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 47.415  -3.801  107.810 1.00 45.49  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 45.984  -5.215  108.812 1.00 39.19  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 44.856  -4.307  108.715 1.00 41.07  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 45.014  -3.114  109.634 1.00 42.96  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 45.266  -3.271  110.827 1.00 42.66  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 44.862  -1.917  109.080 1.00 47.76  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 45.051  -0.694  109.852 1.00 52.33  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 43.905  0.293   109.635 1.00 48.45  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 43.543  0.600   108.499 1.00 43.86  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 46.399  -0.056  109.505 1.00 55.55  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 46.712  1.233   110.250 1.00 66.60  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 48.216  1.471   110.329 1.00 69.71  ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 48.928  0.847   109.217 1.00 85.25  ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 49.119  1.419   108.031 1.00 89.41  ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 48.648  2.636   107.796 1.00 92.68  ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 49.779  0.772   107.080 1.00 81.06  ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 43.337  0.784   110.732 1.00 46.67  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 42.205  1.702   110.661 1.00 45.14  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 42.461  2.997   111.433 1.00 45.51  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 42.757  2.971   112.629 1.00 52.30  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 40.939  1.017   111.181 1.00 43.88  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 39.635  1.810   111.085 1.00 45.06  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 39.386  2.248   109.654 1.00 36.88  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 38.469  0.982   111.602 1.00 37.49  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 42.352  4.126   110.738 1.00 40.17  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1  139  ? 42.494  5.436   111.365 1.00 42.22  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1  139  ? 41.302  6.336   111.035 1.00 37.16  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1  139  ? 41.112  6.726   109.884 1.00 35.91  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1  139  ? 43.804  6.096   110.926 1.00 43.08  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1  139  ? 44.028  7.448   111.583 1.00 60.71  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1  139  ? 43.546  7.703   112.687 1.00 63.84  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1  139  ? 44.760  8.323   110.901 1.00 55.52  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1  140  ? 40.510  6.672   112.051 1.00 37.79  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1  140  ? 39.261  7.404   111.853 1.00 37.16  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1  140  ? 39.157  8.685   112.671 1.00 29.29  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1  140  ? 39.695  8.782   113.772 1.00 37.69  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1  140  ? 38.059  6.524   112.205 1.00 37.05  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1  140  ? 37.861  5.307   111.321 1.00 40.22  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1  140  ? 36.245  4.554   111.609 1.00 39.78  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1  140  ? 36.288  4.327   113.385 1.00 40.59  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1  141  ? 38.446  9.661   112.118 1.00 26.89  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1  141  ? 38.013  10.832  112.866 1.00 32.78  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1  141  ? 36.513  10.983  112.659 1.00 29.08  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1  141  ? 36.067  11.289  111.554 1.00 31.65  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1  141  ? 38.722  12.086  112.359 1.00 29.66  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1  141  ? 40.232  12.023  112.425 1.00 31.75  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1  141  ? 40.884  13.166  111.683 1.00 41.50  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1  141  ? 40.176  14.144  111.362 1.00 44.28  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1  141  ? 42.101  13.084  111.413 1.00 48.28  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1  142  ? 35.732  10.783  113.714 1.00 25.75  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1  142  ? 34.280  10.825  113.571 1.00 29.33  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1  142  ? 33.643  12.020  114.288 1.00 29.05  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1  142  ? 33.772  12.179  115.500 1.00 34.57  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1  142  ? 33.610  9.471   113.963 1.00 31.15  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1  142  ? 34.238  8.329   113.174 1.00 34.14  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1  142  ? 33.729  9.193   115.445 1.00 27.72  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1  143  ? 32.977  12.877  113.521 1.00 27.39  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1  143  ? 32.340  14.062  114.085 1.00 25.92  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1  143  ? 30.921  13.783  114.577 1.00 31.19  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1  143  ? 30.040  13.377  113.799 1.00 33.30  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1  143  ? 32.341  15.218  113.085 1.00 22.48  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1  143  ? 31.455  16.377  113.505 1.00 24.78  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1  143  ? 31.687  17.603  112.644 1.00 28.47  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1  143  ? 30.641  18.605  112.830 1.00 30.52  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1  143  ? 30.716  19.855  112.383 1.00 36.02  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1  143  ? 31.795  20.266  111.730 1.00 34.55  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1  143  ? 29.714  20.698  112.593 1.00 38.67  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1  144  ? 30.730  14.012  115.876 1.00 30.02  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1  144  ? 29.455  13.829  116.558 1.00 28.39  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1  144  ? 28.928  15.181  117.029 1.00 32.02  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1  144  ? 29.636  15.923  117.716 1.00 36.85  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1  144  ? 29.618  12.928  117.795 1.00 28.50  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1  144  ? 28.266  12.642  118.430 1.00 23.69  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1  144  ? 30.326  11.635  117.423 1.00 29.14  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1  145  ? 27.686  15.492  116.669 1.00 32.67  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1  145  ? 27.087  16.785  116.996 1.00 34.32  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1  145  ? 25.825  16.651  117.840 1.00 34.98  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1  145  ? 25.209  15.587  117.894 1.00 36.68  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1  145  ? 26.736  17.552  115.719 1.00 31.33  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1  145  ? 27.905  18.335  115.163 1.00 35.55  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1  145  ? 27.996  19.547  115.452 1.00 44.18  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1  145  ? 28.725  17.747  114.430 1.00 33.75  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1  146  ? 25.457  17.741  118.506 1.00 41.74  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1  146  ? 24.143  17.858  119.120 1.00 40.41  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1  146  ? 23.148  18.172  118.014 1.00 38.78  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1  146  ? 23.520  18.723  116.977 1.00 43.85  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1  146  ? 24.118  18.985  120.154 1.00 42.01  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1  146  ? 24.851  18.694  121.450 1.00 42.48  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1  146  ? 24.652  19.835  122.443 1.00 49.73  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1  146  ? 25.309  19.581  123.722 1.00 50.58  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1  146  ? 24.733  18.963  124.749 1.00 57.77  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1  146  ? 23.482  18.533  124.647 1.00 51.90  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1  146  ? 25.406  18.773  125.877 1.00 56.63  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1  147  ? 21.885  17.826  118.228 1.00 33.30  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1  147  ? 20.860  18.103  117.240 1.00 30.26  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1  147  ? 19.511  17.548  117.637 1.00 24.31  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1  147  ? 19.357  16.988  118.721 1.00 21.04  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1  148  ? 18.532  17.699  116.753 1.00 29.19  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1  148  ? 17.185  17.211  117.025 1.00 33.40  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1  148  ? 16.575  16.559  115.787 1.00 26.01  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1  148  ? 16.843  16.972  114.657 1.00 28.79  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1  148  ? 16.266  18.343  117.556 1.00 28.99  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1  148  ? 15.995  19.379  116.472 1.00 27.74  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1  148  ? 14.968  17.774  118.113 1.00 24.65  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1  149  ? 15.773  15.522  116.007 1.00 23.33  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1  149  ? 15.076  14.852  114.925 1.00 23.34  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1  149  ? 15.990  14.079  113.997 1.00 24.65  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1  149  ? 17.112  13.724  114.360 1.00 26.86  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1  150  ? 15.505  13.824  112.786 1.00 29.94  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1  150  ? 16.242  13.031  111.808 1.00 22.94  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1  150  ? 16.715  13.890  110.645 1.00 24.15  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1  150  ? 15.913  14.346  109.830 1.00 28.92  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1  150  ? 15.362  11.888  111.300 1.00 20.20  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1  150  ? 15.868  11.198  110.054 1.00 24.07  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1  150  ? 17.000  10.392  110.090 1.00 28.27  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1  150  ? 15.197  11.330  108.847 1.00 18.90  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1  150  ? 17.458  9.749   108.950 1.00 22.11  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1  150  ? 15.645  10.691  107.706 1.00 24.76  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1  150  ? 16.775  9.902   107.761 1.00 22.65  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1  150  ? 17.220  9.268   106.621 1.00 19.79  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1  151  ? 18.024  14.109  110.580 1.00 23.40  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1  151  ? 18.625  14.891  109.508 1.00 20.12  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1  151  ? 19.528  14.002  108.663 1.00 21.23  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1  151  ? 20.591  13.580  109.120 1.00 22.42  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1  151  ? 19.440  16.072  110.066 1.00 17.50  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1  151  ? 20.163  16.797  108.944 1.00 22.82  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1  151  ? 18.535  17.024  110.824 1.00 15.28  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1  152  ? 19.102  13.710  107.424 1.00 22.20  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1  152  ? 19.835  12.802  106.536 1.00 25.07  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1  152  ? 21.159  13.403  106.092 1.00 24.20  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1  152  ? 21.295  14.626  106.072 1.00 23.77  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1  152  ? 18.902  12.659  105.327 1.00 23.71  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1  152  ? 17.565  13.130  105.801 1.00 21.77  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1  152  ? 17.863  14.197  106.800 1.00 22.53  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1  153  ? 22.114  12.545  105.743 1.00 23.41  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  153  ? 23.414  12.985  105.249 1.00 23.39  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  153  ? 23.258  13.961  104.087 1.00 26.81  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  153  ? 24.014  14.923  103.967 1.00 24.25  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  153  ? 24.250  11.787  104.824 1.00 16.96  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  154  ? 22.260  13.704  103.246 1.00 30.45  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  154  ? 21.984  14.526  102.076 1.00 27.74  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  154  ? 21.745  15.987  102.455 1.00 29.81  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  154  ? 22.180  16.897  101.753 1.00 34.63  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  154  ? 20.762  13.977  101.336 1.00 32.69  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1  154  ? 20.645  14.414  99.885  1.00 43.62  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1  154  ? 21.501  13.575  98.951  1.00 61.73  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1  154  ? 22.190  12.655  99.441  1.00 59.52  ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1  154  ? 21.480  13.831  97.727  1.00 62.88  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1  155  ? 21.052  16.205  103.567 1.00 31.95  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1  155  ? 20.647  17.550  103.961 1.00 30.55  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1  155  ? 21.758  18.384  104.606 1.00 29.62  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1  155  ? 21.960  19.538  104.230 1.00 39.64  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1  155  ? 19.422  17.492  104.882 1.00 30.84  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1  155  ? 18.737  18.835  105.099 1.00 40.24  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1  155  ? 18.216  19.417  103.790 1.00 48.46  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1  155  ? 17.594  20.793  104.003 1.00 55.62  ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1  155  ? 17.199  21.448  102.723 1.00 39.50  ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1  156  ? 22.469  17.813  105.575 1.00 28.44  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1  156  ? 23.483  18.578  106.308 1.00 29.55  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1  156  ? 24.828  18.700  105.589 1.00 35.89  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1  156  ? 25.528  19.703  105.744 1.00 36.48  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1  156  ? 23.659  18.073  107.750 1.00 27.56  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1  156  ? 24.160  16.666  107.859 1.00 24.72  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1  156  ? 25.450  16.305  107.535 1.00 28.56  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1  156  ? 23.553  15.535  108.292 1.00 24.21  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1  156  ? 25.611  15.011  107.747 1.00 24.23  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1  156  ? 24.476  14.521  108.209 1.00 20.36  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1  157  ? 25.176  17.678  104.810 1.00 35.35  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1  157  ? 26.403  17.665  104.029 1.00 31.15  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1  157  ? 27.654  18.026  104.808 1.00 32.84  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1  157  ? 28.532  18.719  104.296 1.00 35.74  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1  158  ? 27.742  17.549  106.045 1.00 36.51  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1  158  ? 28.825  17.958  106.934 1.00 38.39  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1  158  ? 30.129  17.228  106.632 1.00 35.65  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1  158  ? 30.219  16.004  106.751 1.00 35.73  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1  158  ? 28.451  17.737  108.413 1.00 35.75  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1  158  ? 27.315  18.676  108.821 1.00 33.00  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1  158  ? 29.658  17.956  109.310 1.00 32.45  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1  158  ? 26.813  18.434  110.220 1.00 33.15  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1  159  ? 31.142  18.000  106.256 1.00 33.50  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1  159  ? 32.460  17.460  105.960 1.00 43.20  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1  159  ? 33.520  18.322  106.629 1.00 45.63  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1  159  ? 33.610  19.522  106.364 1.00 34.25  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1  159  ? 32.700  17.420  104.446 1.00 36.38  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1  159  ? 31.659  16.633  103.663 1.00 39.93  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1  159  ? 31.892  16.710  102.159 1.00 37.97  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1  159  ? 33.171  15.995  101.755 1.00 37.45  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1  159  ? 33.319  15.894  100.277 1.00 34.48  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1  160  ? 34.319  17.710  107.499 1.00 46.68  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1  160  ? 35.422  18.417  108.143 1.00 48.74  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1  160  ? 36.556  18.635  107.140 1.00 44.22  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1  160  ? 36.838  19.769  106.752 1.00 47.50  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1  160  ? 35.911  17.656  109.381 1.00 53.20  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1  160  ? 35.112  17.997  110.635 1.00 50.56  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1  160  ? 34.126  18.758  110.528 1.00 46.74  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1  160  ? 35.468  17.501  111.727 1.00 36.38  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1  161  ? 37.193  17.551  106.708 1.00 40.49  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1  161  ? 38.202  17.644  105.658 1.00 44.07  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1  161  ? 37.650  17.178  104.307 1.00 44.29  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1  161  ? 36.488  16.786  104.207 1.00 43.18  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1  161  ? 39.465  16.866  106.035 1.00 48.88  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1  161  ? 39.264  15.374  106.212 1.00 50.25  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1  161  ? 40.595  14.683  106.461 1.00 57.95  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1  161  ? 41.108  14.925  107.807 1.00 55.75  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1  161  ? 42.349  14.644  108.195 1.00 61.48  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1  161  ? 43.213  14.117  107.335 1.00 51.06  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1  161  ? 42.729  14.896  109.440 1.00 67.68  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1  162  ? 38.491  17.222  103.276 1.00 43.67  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1  162  ? 38.060  16.958  101.902 1.00 41.22  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1  162  ? 37.449  15.570  101.692 1.00 40.38  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1  162  ? 36.415  15.432  101.038 1.00 46.91  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1  162  ? 39.222  17.163  100.901 1.00 40.04  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1  162  ? 39.677  18.626  100.898 1.00 45.47  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1  162  ? 38.811  16.740  99.497  1.00 35.04  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1  162  ? 38.660  19.590  100.315 1.00 43.97  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1  163  ? 38.079  14.548  102.257 1.00 37.76  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1  163  ? 37.642  13.173  102.035 1.00 34.69  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1  163  ? 36.609  12.668  103.040 1.00 30.16  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1  163  ? 36.247  11.492  103.024 1.00 27.48  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1  163  ? 38.842  12.223  101.990 1.00 44.69  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1  163  ? 39.636  12.350  100.707 1.00 49.38  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1  163  ? 39.085  12.665  99.650  1.00 49.13  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1  163  ? 40.940  12.106  100.790 1.00 52.57  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1  164  ? 36.150  13.552  103.919 1.00 32.93  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1  164  ? 35.165  13.181  104.932 1.00 30.96  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1  164  ? 33.834  12.768  104.303 1.00 32.16  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1  164  ? 33.463  13.250  103.235 1.00 31.84  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1  164  ? 34.960  14.320  105.919 1.00 36.11  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1  165  ? 33.125  11.866  104.974 1.00 27.75  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1  165  ? 31.854  11.354  104.478 1.00 23.38  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1  165  ? 30.694  11.743  105.389 1.00 25.60  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1  165  ? 30.649  11.326  106.547 1.00 27.63  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1  165  ? 31.884  9.828   104.392 1.00 21.85  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1  165  ? 33.086  9.369   103.566 1.00 19.48  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1  165  ? 30.576  9.304   103.823 1.00 19.98  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1  165  ? 33.369  7.890   103.687 1.00 21.53  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1  166  ? 29.752  12.547  104.871 1.00 25.90  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1  166  ? 28.550  12.895  105.636 1.00 25.64  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1  166  ? 27.754  11.651  106.034 1.00 26.57  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1  166  ? 27.630  10.712  105.245 1.00 26.09  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1  166  ? 27.747  13.751  104.653 1.00 25.19  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1  166  ? 28.771  14.332  103.743 1.00 27.04  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1  166  ? 29.812  13.260  103.584 1.00 26.70  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1  167  ? 27.229  11.651  107.255 1.00 22.13  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1  167  ? 26.520  10.495  107.789 1.00 21.48  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1  167  ? 25.090  10.859  108.174 1.00 22.73  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1  167  ? 24.846  11.931  108.731 1.00 22.66  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1  167  ? 27.258  9.925   109.021 1.00 23.46  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1  167  ? 26.455  8.805   109.680 1.00 18.73  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1  167  ? 28.638  9.434   108.622 1.00 20.96  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1  168  ? 24.148  9.972   107.859 1.00 24.13  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1  168  ? 22.762  10.145  108.275 1.00 25.32  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1  168  ? 22.691  10.229  109.792 1.00 18.69  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1  168  ? 23.181  9.344   110.492 1.00 15.13  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1  168  ? 21.899  8.984   107.776 1.00 25.51  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1  168  ? 21.722  8.993   106.273 1.00 30.52  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1  168  ? 21.486  10.082  105.705 1.00 30.18  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1  168  ? 21.820  7.912   105.656 1.00 42.85  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1  169  ? 22.073  11.292  110.295 1.00 20.82  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1  169  ? 22.059  11.554  111.729 1.00 24.48  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1  169  ? 20.673  11.439  112.346 1.00 23.41  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1  169  ? 19.783  12.233  112.046 1.00 26.07  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1  169  ? 22.650  12.929  112.019 1.00 25.29  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1  170  ? 20.499  10.452  113.219 1.00 23.40  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1  170  ? 19.287  10.370  114.018 1.00 27.25  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1  170  ? 19.630  10.893  115.402 1.00 26.14  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1  170  ? 20.299  10.220  116.186 1.00 35.28  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1  170  ? 18.783  8.923   114.142 1.00 23.99  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1  170  ? 17.439  8.890   114.851 1.00 24.77  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1  170  ? 18.689  8.278   112.771 1.00 24.18  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1  171  ? 19.155  12.095  115.701 1.00 23.85  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1  171  ? 19.543  12.776  116.927 1.00 24.79  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1  171  ? 18.765  12.313  118.147 1.00 27.52  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1  171  ? 19.278  12.356  119.263 1.00 31.56  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1  171  ? 19.430  14.289  116.757 1.00 24.64  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1  171  ? 20.473  14.870  115.849 1.00 30.88  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1  171  ? 21.815  14.816  116.195 1.00 31.37  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1  171  ? 20.118  15.467  114.650 1.00 27.00  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1  171  ? 22.783  15.346  115.361 1.00 32.50  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1  171  ? 21.082  16.002  113.814 1.00 25.11  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1  171  ? 22.415  15.940  114.170 1.00 30.81  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1  172  ? 17.533  11.867  117.929 1.00 27.51  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1  172  ? 16.643  11.510  119.027 1.00 26.36  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1  172  ? 17.245  10.447  119.941 1.00 28.77  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1  172  ? 17.562  9.342   119.498 1.00 29.98  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1  172  ? 15.290  11.038  118.492 1.00 26.56  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1  172  ? 14.465  10.559  119.540 1.00 25.18  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1  173  ? 17.431  10.803  121.221 1.00 32.11  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1  173  ? 17.873  9.909   122.295 1.00 28.56  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1  173  ? 16.784  8.916   122.683 1.00 24.40  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1  173  ? 17.064  7.937   123.372 1.00 25.79  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1  173  ? 18.151  10.870  123.452 1.00 28.67  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1  173  ? 17.230  12.011  123.207 1.00 25.24  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1  173  ? 17.182  12.169  121.717 1.00 29.98  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1  174  ? 15.552  9.182   122.260 1.00 24.94  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1  174  ? 14.410  8.371   122.668 1.00 24.32  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1  174  ? 14.180  7.188   121.732 1.00 25.25  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1  174  ? 13.892  7.367   120.550 1.00 29.33  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1  174  ? 13.124  9.215   122.737 1.00 18.35  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1  174  ? 11.957  8.354   123.150 1.00 22.28  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1  174  ? 13.300  10.368  123.709 1.00 22.42  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1  175  ? 14.320  5.980   122.270 1.00 26.14  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1  175  ? 14.102  4.767   121.492 1.00 24.12  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1  175  ? 12.628  4.399   121.360 1.00 24.20  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1  175  ? 12.176  4.038   120.275 1.00 33.19  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1  175  ? 14.863  3.587   122.097 1.00 23.12  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1  175  ? 16.371  3.679   121.995 1.00 29.99  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1  175  ? 17.007  2.371   122.442 1.00 53.52  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1  175  ? 18.454  2.478   122.611 1.00 74.31  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1  175  ? 19.227  1.490   123.053 1.00 75.50  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1  175  ? 18.689  0.319   123.369 1.00 77.80  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1  175  ? 20.536  1.672   123.180 1.00 67.23  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1  176  ? 11.884  4.474   122.461 1.00 23.12  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1  176  ? 10.472  4.076   122.433 1.00 22.59  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1  176  ? 9.622   4.798   123.477 1.00 22.74  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1  176  ? 10.097  5.096   124.569 1.00 25.91  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1  176  ? 10.348  2.560   122.616 1.00 15.34  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1  176  ? 8.917   2.050   122.653 1.00 20.94  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1  176  ? 8.856   0.566   122.963 1.00 21.08  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1  176  ? 9.347   -0.237  121.850 1.00 32.01  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1  176  ? 9.313   -1.564  121.818 1.00 39.31  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1  176  ? 8.809   -2.236  122.846 1.00 41.92  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1  176  ? 9.781   -2.218  120.761 1.00 25.87  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1  177  ? 8.365   5.079   123.143 1.00 22.38  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1  177  ? 7.430   5.655   124.110 1.00 20.51  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1  177  ? 6.063   4.994   124.029 1.00 17.53  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1  177  ? 5.457   4.942   122.963 1.00 19.64  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1  177  ? 7.229   7.167   123.904 1.00 16.91  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1  177  ? 6.256   7.707   124.933 1.00 16.54  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1  177  ? 8.546   7.899   123.995 1.00 19.01  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1  178  ? 5.577   4.493   125.159 1.00 24.28  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1  178  ? 4.219   3.963   125.230 1.00 24.61  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1  178  ? 3.504   4.601   126.412 1.00 25.16  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1  178  ? 4.150   5.118   127.314 1.00 23.73  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1  178  ? 4.244   2.454   125.377 1.00 18.86  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1  179  ? 2.176   4.599   126.406 1.00 28.91  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1  179  ? 1.455   5.026   127.602 1.00 23.71  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1  179  ? 0.192   4.216   127.886 1.00 27.32  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1  179  ? -0.630  3.974   127.001 1.00 26.56  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1  179  ? 1.195   6.542   127.625 1.00 19.70  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1  179  ? 0.128   7.000   126.679 1.00 22.63  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1  179  ? -1.188  7.102   127.096 1.00 25.21  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1  179  ? 0.441   7.354   125.380 1.00 25.55  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1  179  ? -2.174  7.532   126.231 1.00 24.25  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1  179  ? -0.540  7.785   124.509 1.00 27.46  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1  179  ? -1.849  7.876   124.936 1.00 25.33  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1  180  ? 0.066   3.800   129.140 1.00 30.74  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1  180  ? -1.044  2.983   129.596 1.00 29.02  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1  180  ? -2.083  3.852   130.289 1.00 24.36  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1  180  ? -1.743  4.729   131.086 1.00 22.72  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1  180  ? -0.533  1.926   130.577 1.00 30.30  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1  180  ? -1.205  0.574   130.454 1.00 33.66  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1  180  ? -0.641  -0.247  129.313 1.00 40.62  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1  180  ? 0.263   0.197   128.599 1.00 43.85  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1  180  ? -1.167  -1.454  129.137 1.00 42.63  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1  181  ? -3.351  3.611   129.979 1.00 22.28  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1  181  ? -4.439  4.251   130.702 1.00 25.36  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1  181  ? -5.261  3.189   131.416 1.00 29.63  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1  181  ? -5.934  2.375   130.781 1.00 27.51  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1  181  ? -5.353  5.061   129.775 1.00 19.75  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1  181  ? -6.526  5.624   130.561 1.00 23.82  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1  181  ? -4.569  6.177   129.107 1.00 21.05  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1  182  ? -5.201  3.200   132.743 1.00 34.07  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1  182  ? -5.876  2.180   133.535 1.00 31.20  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1  182  ? -7.037  2.777   134.315 1.00 30.28  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1  182  ? -7.031  3.963   134.637 1.00 30.01  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1  182  ? -4.882  1.485   134.468 1.00 26.04  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1  182  ? -3.804  0.708   133.723 1.00 36.89  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1  182  ? -2.693  0.214   134.627 1.00 44.38  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1  182  ? -2.639  -1.006  134.888 1.00 50.69  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1  182  ? -1.866  1.043   135.067 1.00 43.36  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1  183  ? -8.043  1.957   134.595 1.00 32.91  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1  183  ? -9.220  2.415   135.323 1.00 34.78  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1  183  ? -8.905  2.632   136.803 1.00 28.18  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1  183  ? -8.275  1.787   137.439 1.00 28.07  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1  183  ? -10.360 1.408   135.167 1.00 34.31  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1  183  ? -11.708 2.004   135.498 1.00 35.79  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1  183  ? -11.857 3.239   135.374 1.00 37.03  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1  183  ? -12.620 1.238   135.877 1.00 36.68  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1  184  ? -9.338  3.768   137.344 1.00 28.63  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1  184  ? -9.101  4.078   138.754 1.00 34.91  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1  184  ? -10.240 4.890   139.374 1.00 36.08  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1  184  ? -11.084 5.450   138.668 1.00 37.13  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1  184  ? -7.756  4.810   138.969 1.00 31.82  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1  184  ? -7.446  4.856   140.367 1.00 28.30  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1  184  ? -7.821  6.224   138.423 1.00 35.15  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1  185  ? -10.259 4.935   140.703 1.00 42.80  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1  185  ? -11.319 5.613   141.442 1.00 46.85  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1  185  ? -10.761 6.430   142.605 1.00 41.32  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1  185  ? -9.746  6.066   143.202 1.00 35.69  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1  185  ? -12.327 4.587   141.971 1.00 50.29  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1  185  ? -11.700 3.495   142.834 1.00 48.48  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1  185  ? -12.732 2.506   143.361 1.00 54.89  ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1  185  ? -13.704 3.136   144.253 1.00 68.51  ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1  185  ? -14.980 3.344   143.941 1.00 69.75  ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1  185  ? -15.445 2.966   142.758 1.00 70.32  ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1  185  ? -15.793 3.925   144.814 1.00 58.23  ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1  186  ? -11.420 7.544   142.912 1.00 46.38  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1  186  ? -11.117 8.316   144.114 1.00 45.96  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1  186  ? -12.400 8.587   144.882 1.00 48.54  ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1  186  ? -13.281 9.293   144.394 1.00 50.76  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1  186  ? -10.443 9.643   143.769 1.00 49.57  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1  186  ? -10.262 10.592  144.960 1.00 47.24  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1  186  ? -9.258  10.024  145.954 1.00 49.06  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1  186  ? -9.839  11.981  144.502 1.00 41.03  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1  187  ? -12.498 8.034   146.086 1.00 49.91  ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1  187  ? -13.709 8.167   146.872 1.00 53.24  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1  187  ? -14.892 7.546   146.155 1.00 54.42  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1  187  ? -14.860 6.372   145.784 1.00 46.62  ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1  188  ? -15.937 8.342   145.951 1.00 57.47  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1  188  ? -17.153 7.864   145.303 1.00 62.61  ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1  188  ? -17.130 8.069   143.791 1.00 63.44  ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1  188  ? -18.104 7.761   143.105 1.00 68.26  ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1  188  ? -18.386 8.546   145.905 1.00 72.62  ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1  188  ? -18.741 8.069   147.308 1.00 75.79  ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1  188  ? -19.277 6.648   147.324 1.00 79.57  ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1  188  ? -20.466 6.419   147.099 1.00 80.54  ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1  188  ? -18.401 5.685   147.592 1.00 72.97  ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1  189  ? -16.018 8.588   143.277 1.00 58.40  ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1  189  ? -15.894 8.856   141.847 1.00 49.91  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1  189  ? -15.329 7.652   141.106 1.00 54.26  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1  189  ? -14.338 7.058   141.536 1.00 51.73  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1  189  ? -14.998 10.071  141.604 1.00 48.94  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1  189  ? -15.201 11.198  142.594 1.00 52.36  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1  189  ? -14.403 12.425  142.203 1.00 47.45  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1  189  ? -14.356 13.403  143.285 1.00 59.79  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1  189  ? -14.130 14.700  143.109 1.00 63.30  ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1  189  ? -14.102 15.519  144.152 1.00 65.02  ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1  189  ? -13.938 15.180  141.887 1.00 65.20  ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1  190  ? -15.960 7.298   139.990 1.00 54.10  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1  190  ? -15.497 6.184   139.170 1.00 54.19  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1  190  ? -15.079 6.649   137.777 1.00 47.70  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1  190  ? -15.202 7.828   137.441 1.00 46.77  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1  190  ? -16.585 5.106   139.020 1.00 52.32  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1  190  ? -17.693 5.643   138.286 1.00 49.57  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1  190  ? -17.063 4.635   140.384 1.00 41.67  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1  191  ? -14.592 5.706   136.976 1.00 40.46  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  191  ? -14.167 5.971   135.601 1.00 44.89  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  191  ? -13.045 7.011   135.501 1.00 42.06  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  191  ? -12.917 7.699   134.488 1.00 43.14  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  191  ? -15.367 6.370   134.729 1.00 44.09  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  191  ? -15.144 6.075   133.252 1.00 48.17  ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  191  ? -14.170 5.365   132.919 1.00 43.20  ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  191  ? -15.955 6.544   132.425 1.00 46.87  ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1  192  ? -12.239 7.130   136.553 1.00 36.33  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1  192  ? -11.082 8.020   136.518 1.00 30.89  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1  192  ? -9.900  7.370   135.797 1.00 27.57  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1  192  ? -9.799  6.144   135.732 1.00 26.44  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1  192  ? -10.679 8.455   137.928 1.00 36.28  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1  192  ? -11.660 9.341   138.695 1.00 35.57  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1  192  ? -11.128 9.623   140.089 1.00 40.08  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1  192  ? -11.913 10.638  137.947 1.00 28.28  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1  193  ? -9.010  8.196   135.257 1.00 26.84  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1  193  ? -7.860  7.703   134.504 1.00 27.02  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1  193  ? -6.580  7.642   135.333 1.00 23.16  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1  193  ? -6.245  8.577   136.056 1.00 24.57  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1  193  ? -7.606  8.569   133.264 1.00 33.92  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1  193  ? -8.661  8.388   132.189 1.00 32.48  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1  193  ? -8.790  9.292   131.334 1.00 31.17  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1  193  ? -9.355  7.349   132.195 1.00 27.32  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1  194  ? -5.864  6.532   135.204 1.00 26.82  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1  194  ? -4.533  6.384   135.776 1.00 29.64  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1  194  ? -3.536  6.313   134.625 1.00 29.22  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1  194  ? -3.530  5.339   133.865 1.00 32.58  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1  194  ? -4.460  5.109   136.615 1.00 28.41  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1  194  ? -3.076  4.773   137.139 1.00 26.30  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1  194  ? -3.062  3.386   137.760 1.00 30.38  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1  194  ? -1.664  2.982   138.197 1.00 45.00  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1  194  ? -1.635  1.592   138.737 1.00 45.42  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1  195  ? -2.701  7.342   134.492 1.00 21.89  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1  195  ? -1.818  7.444   133.330 1.00 20.84  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1  195  ? -0.391  7.000   133.624 1.00 26.17  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1  195  ? 0.216   7.445   134.587 1.00 27.72  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1  195  ? -1.802  8.876   132.792 1.00 23.62  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1  195  ? -0.735  9.157   131.730 1.00 23.02  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1  195  ? -0.980  8.323   130.481 1.00 21.48  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1  195  ? -0.676  10.636  131.390 1.00 22.00  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1  196  ? 0.154   6.128   132.786 1.00 29.54  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1  196  ? 1.541   5.716   132.964 1.00 30.50  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1  196  ? 2.344   5.859   131.676 1.00 28.95  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1  196  ? 2.056   5.199   130.685 1.00 27.19  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1  196  ? 1.645   4.266   133.464 1.00 30.83  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1  196  ? 0.610   4.011   134.423 1.00 30.20  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1  196  ? 3.004   4.029   134.101 1.00 26.48  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1  197  ? 3.352   6.723   131.698 1.00 30.03  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1  197  ? 4.235   6.908   130.554 1.00 23.43  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1  197  ? 5.474   6.034   130.676 1.00 26.77  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1  197  ? 6.280   6.212   131.587 1.00 35.24  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1  197  ? 4.654   8.372   130.436 1.00 22.45  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1  197  ? 3.635   9.319   129.807 1.00 31.23  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1  197  ? 3.946   10.745  130.203 1.00 28.14  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1  197  ? 3.646   9.171   128.292 1.00 24.64  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1  198  ? 5.614   5.083   129.760 1.00 24.69  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1  198  ? 6.796   4.237   129.696 1.00 23.34  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1  198  ? 7.744   4.764   128.628 1.00 23.38  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1  198  ? 7.380   4.865   127.453 1.00 26.84  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1  198  ? 6.408   2.791   129.395 1.00 23.93  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1  198  ? 5.356   2.231   130.330 1.00 21.51  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1  198  ? 5.523   0.733   130.497 1.00 32.58  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1  198  ? 5.245   0.001   129.267 1.00 41.55  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1  198  ? 5.541   -1.281  129.081 1.00 46.94  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1  198  ? 5.249   -1.870  127.929 1.00 50.22  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1  198  ? 6.136   -1.971  130.045 1.00 40.48  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1  199  ? 8.961   5.095   129.049 1.00 27.74  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1  199  ? 9.945   5.732   128.181 1.00 23.89  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1  199  ? 11.267  4.964   128.127 1.00 25.93  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1  199  ? 11.931  4.775   129.148 1.00 31.77  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1  199  ? 10.229  7.171   128.644 1.00 20.58  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1  199  ? 8.933   7.982   128.690 1.00 16.74  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1  199  ? 11.250  7.832   127.737 1.00 26.57  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1  199  ? 9.129   9.403   129.145 1.00 20.23  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1  200  ? 11.633  4.522   126.928 1.00 24.77  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1  200  ? 12.913  3.870   126.676 1.00 22.29  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1  200  ? 13.822  4.824   125.913 1.00 26.60  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1  200  ? 13.462  5.288   124.825 1.00 30.05  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1  200  ? 12.725  2.628   125.805 1.00 19.13  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1  200  ? 11.979  1.490   126.422 1.00 21.20  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1  200  ? 12.516  0.363   126.973 1.00 24.53  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1  200  ? 10.556  1.342   126.512 1.00 20.78  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1  200  ? 11.517  -0.470  127.416 1.00 29.28  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1  200  ? 10.305  0.108   127.143 1.00 22.70  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1  200  ? 9.473   2.137   126.131 1.00 21.14  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1  200  ? 9.015   -0.348  127.402 1.00 24.81  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1  200  ? 8.193   1.682   126.388 1.00 24.65  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1  200  ? 7.975   0.451   127.017 1.00 28.67  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1  201  ? 15.001  5.100   126.463 1.00 27.04  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1  201  ? 15.988  5.927   125.773 1.00 27.00  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1  201  ? 17.293  5.171   125.526 1.00 30.09  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1  201  ? 17.406  3.985   125.842 1.00 32.76  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1  201  ? 16.290  7.222   126.542 1.00 29.83  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1  201  ? 17.030  6.917   127.730 1.00 27.54  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1  201  ? 14.995  7.939   126.909 1.00 24.61  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1  202  ? 18.273  5.866   124.955 1.00 33.05  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1  202  ? 19.549  5.251   124.590 1.00 38.61  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1  202  ? 20.621  5.425   125.663 1.00 40.39  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1  202  ? 21.740  4.930   125.521 1.00 36.84  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1  202  ? 20.052  5.815   123.255 1.00 41.74  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1  202  ? 20.357  7.305   123.322 1.00 38.43  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1  202  ? 19.975  7.956   124.319 1.00 36.25  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1  202  ? 20.970  7.828   122.366 1.00 34.97  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1  203  ? 20.276  6.137   126.730 1.00 37.42  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1  203  ? 21.213  6.390   127.807 1.00 33.76  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1  203  ? 21.859  7.757   127.706 1.00 33.38  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1  203  ? 22.356  8.284   128.698 1.00 31.60  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1  204  ? 21.852  8.331   126.505 1.00 40.40  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1  204  ? 22.392  9.670   126.288 1.00 35.71  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1  204  ? 21.673  10.677  127.178 1.00 38.81  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1  204  ? 22.306  11.503  127.836 1.00 35.79  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1  204  ? 22.258  10.073  124.819 1.00 34.80  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1  204  ? 22.664  11.416  124.620 1.00 41.75  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1  205  ? 20.344  10.609  127.179 1.00 39.53  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1  205  ? 19.535  11.318  128.163 1.00 35.88  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1  205  ? 18.583  10.322  128.827 1.00 33.12  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1  205  ? 18.168  9.338   128.214 1.00 32.83  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1  205  ? 18.746  12.513  127.556 1.00 28.65  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1  205  ? 19.615  13.292  126.579 1.00 26.42  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1  205  ? 17.467  12.043  126.882 1.00 28.74  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1  206  ? 18.260  10.564  130.091 1.00 30.55  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1  206  ? 17.400  9.656   130.834 1.00 30.53  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1  206  ? 15.944  9.895   130.451 1.00 29.69  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1  206  ? 15.608  10.964  129.942 1.00 29.64  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1  206  ? 17.585  9.840   132.351 1.00 28.11  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1  206  ? 17.080  11.120  132.746 1.00 31.36  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1  206  ? 19.058  9.738   132.719 1.00 26.89  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1  207  ? 15.077  8.892   130.674 1.00 29.57  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1  207  ? 13.647  9.062   130.402 1.00 24.98  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1  207  ? 13.056  10.257  131.141 1.00 27.95  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1  207  ? 12.209  10.949  130.583 1.00 32.66  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1  207  ? 13.042  7.763   130.936 1.00 26.25  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1  207  ? 14.122  6.765   130.765 1.00 24.58  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1  207  ? 15.394  7.505   131.060 1.00 32.03  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1  208  ? 13.505  10.495  132.370 1.00 30.56  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1  208  ? 12.986  11.594  133.180 1.00 27.86  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1  208  ? 13.308  12.961  132.570 1.00 27.92  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1  208  ? 12.447  13.845  132.521 1.00 26.51  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1  208  ? 13.511  11.498  134.616 1.00 30.06  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1  208  ? 13.003  12.521  135.638 1.00 29.97  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1  208  ? 11.490  12.637  135.593 1.00 23.59  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1  208  ? 13.465  12.141  137.036 1.00 26.42  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1  209  ? 14.544  13.126  132.107 1.00 26.75  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1  209  ? 14.945  14.351  131.424 1.00 29.36  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1  209  ? 14.058  14.568  130.208 1.00 28.12  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1  209  ? 13.543  15.668  129.980 1.00 26.55  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1  209  ? 16.401  14.264  130.967 1.00 31.67  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1  209  ? 17.426  14.203  132.082 1.00 28.58  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1  209  ? 18.845  14.141  131.549 1.00 35.73  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1  209  ? 19.672  13.408  132.132 1.00 36.65  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1  209  ? 19.133  14.826  130.542 1.00 37.39  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1  210  ? 13.885  13.497  129.439 1.00 28.28  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1  210  ? 13.079  13.522  128.228 1.00 28.20  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1  210  ? 11.667  13.989  128.533 1.00 24.44  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1  210  ? 11.143  14.877  127.864 1.00 24.72  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1  210  ? 13.053  12.145  127.588 1.00 30.77  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1  211  ? 11.066  13.388  129.555 1.00 21.04  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1  211  ? 9.721   13.742  129.983 1.00 21.05  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1  211  ? 9.652   15.213  130.364 1.00 24.14  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1  211  ? 8.721   15.923  129.972 1.00 26.60  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1  211  ? 9.292   12.873  131.164 1.00 25.56  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1  211  ? 7.937   13.191  131.802 1.00 30.02  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1  211  ? 6.819   13.081  130.775 1.00 24.25  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1  211  ? 7.674   12.274  132.994 1.00 24.58  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1  212  ? 10.651  15.667  131.117 1.00 27.08  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1  212  ? 10.705  17.060  131.551 1.00 27.11  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1  212  ? 10.726  18.042  130.381 1.00 24.07  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1  212  ? 9.884   18.938  130.304 1.00 25.17  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1  212  ? 11.898  17.307  132.484 1.00 26.81  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1  212  ? 11.776  16.561  133.808 1.00 30.04  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1  212  ? 10.675  16.268  134.276 1.00 22.45  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1  212  ? 12.915  16.254  134.418 1.00 35.57  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1  213  ? 11.673  17.874  129.462 1.00 26.64  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1  213  ? 11.764  18.807  128.341 1.00 24.00  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1  213  ? 10.627  18.651  127.335 1.00 26.67  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1  213  ? 10.317  19.587  126.601 1.00 29.33  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1  213  ? 13.131  18.748  127.653 1.00 22.49  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1  213  ? 13.678  17.360  127.422 1.00 24.23  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1  213  ? 15.177  17.377  127.187 1.00 27.88  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1  213  ? 15.703  18.286  126.545 1.00 33.25  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1  213  ? 15.873  16.380  127.719 1.00 24.19  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1  214  ? 10.002  17.479  127.307 1.00 20.34  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1  214  ? 8.812   17.282  126.488 1.00 20.81  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1  214  ? 7.670   18.123  127.048 1.00 26.19  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1  214  ? 6.981   18.842  126.310 1.00 23.69  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1  214  ? 8.427   15.819  126.458 1.00 25.67  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1  215  ? 7.480   18.030  128.363 1.00 26.92  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1  215  ? 6.504   18.859  129.061 1.00 26.67  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1  215  ? 6.795   20.341  128.831 1.00 23.02  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1  215  ? 5.883   21.139  128.612 1.00 26.84  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1  215  ? 6.490   18.560  130.573 1.00 26.07  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1  215  ? 5.668   19.600  131.324 1.00 27.97  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1  215  ? 5.952   17.162  130.830 1.00 24.15  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1  216  ? 8.073   20.700  128.862 1.00 25.62  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1  216  ? 8.475   22.084  128.634 1.00 29.99  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1  216  ? 8.136   22.547  127.217 1.00 29.13  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1  216  ? 7.683   23.673  127.018 1.00 32.89  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1  216  ? 9.967   22.275  128.929 1.00 22.19  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1  216  ? 10.485  23.678  128.653 1.00 23.04  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1  216  ? 9.696   24.752  129.381 1.00 38.60  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1  216  ? 9.205   24.483  130.498 1.00 41.40  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1  216  ? 9.565   25.869  128.832 1.00 37.62  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1  217  ? 8.353   21.670  126.240 1.00 24.65  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1  217  ? 8.029   21.964  124.847 1.00 23.75  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1  217  ? 6.524   22.164  124.659 1.00 28.50  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1  217  ? 6.094   23.103  123.982 1.00 26.34  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1  217  ? 8.541   20.850  123.905 1.00 26.21  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1  217  ? 10.063  20.919  123.782 1.00 20.99  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1  217  ? 7.900   20.959  122.528 1.00 23.38  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1  217  ? 10.682  19.698  123.144 1.00 15.87  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1  218  ? 5.723   21.294  125.272 1.00 24.35  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1  218  ? 4.272   21.438  125.186 1.00 24.12  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1  218  ? 3.789   22.723  125.864 1.00 25.42  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1  218  ? 2.907   23.415  125.348 1.00 26.79  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1  218  ? 3.562   20.221  125.779 1.00 19.35  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1  218  ? 2.046   20.212  125.573 1.00 15.39  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1  218  ? 1.709   20.469  124.117 1.00 11.94  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1  218  ? 1.451   18.895  126.029 1.00 15.93  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1  219  ? 4.381   23.032  127.015 1.00 26.47  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1  219  ? 4.071   24.245  127.769 1.00 28.12  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1  219  ? 4.345   25.480  126.913 1.00 32.71  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1  219  ? 3.463   26.325  126.692 1.00 31.54  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1  219  ? 4.938   24.286  129.029 1.00 27.35  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1  219  ? 4.293   24.918  130.259 1.00 35.16  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1  219  ? 4.231   26.439  130.175 1.00 47.76  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1  219  ? 5.388   27.016  129.492 1.00 47.97  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1  219  ? 6.606   27.105  130.015 1.00 37.56  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1  219  ? 7.592   27.648  129.312 1.00 29.39  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1  219  ? 6.842   26.642  131.235 1.00 39.06  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1  220  ? 5.581   25.566  126.432 1.00 32.30  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1  220  ? 6.014   26.655  125.571 1.00 31.39  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1  220  ? 5.109   26.783  124.353 1.00 33.75  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1  220  ? 4.800   27.889  123.915 1.00 38.05  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1  220  ? 7.463   26.437  125.133 1.00 32.57  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1  220  ? 8.000   27.511  124.205 1.00 46.76  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1  220  ? 9.392   27.196  123.700 1.00 62.20  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1  220  ? 10.136  26.485  124.409 1.00 67.44  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1  220  ? 9.740   27.653  122.590 1.00 70.00  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1  221  ? 4.677   25.651  123.808 1.00 35.61  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1  221  ? 3.757   25.682  122.676 1.00 35.52  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1  221  ? 2.410   26.273  123.073 1.00 34.15  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1  221  ? 1.783   26.991  122.293 1.00 30.51  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1  221  ? 3.581   24.292  122.063 1.00 30.52  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1  221  ? 4.541   24.000  120.953 1.00 28.49  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1  221  ? 5.596   23.124  121.090 1.00 26.29  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1  221  ? 4.611   24.477  119.688 1.00 28.62  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1  221  ? 6.271   23.071  119.957 1.00 23.99  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1  221  ? 5.694   23.882  119.089 1.00 29.36  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1  222  ? 1.971   25.975  124.292 1.00 35.01  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1  222  ? 0.731   26.547  124.804 1.00 33.26  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1  222  ? 0.875   28.051  125.006 1.00 32.86  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1  222  ? -0.113  28.787  124.983 1.00 31.08  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1  222  ? 0.312   25.865  126.106 1.00 26.25  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1  222  ? -0.239  24.446  125.973 1.00 21.76  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1  222  ? -0.452  23.832  127.340 1.00 27.04  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1  222  ? -1.536  24.458  125.185 1.00 26.69  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1  223  ? 2.111   28.506  125.193 1.00 36.47  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1  223  ? 2.380   29.939  125.321 1.00 35.57  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1  223  ? 2.067   30.700  124.028 1.00 39.82  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1  223  ? 1.918   31.922  124.039 1.00 43.91  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1  223  ? 3.849   30.204  125.726 1.00 40.95  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1  223  ? 4.242   29.276  126.746 1.00 43.52  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1  223  ? 4.032   31.628  126.241 1.00 53.65  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1  224  ? 1.955   29.976  122.919 1.00 42.54  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1  224  ? 1.738   30.601  121.614 1.00 40.46  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1  224  ? 0.310   31.112  121.419 1.00 45.57  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1  224  ? 0.043   31.894  120.505 1.00 52.74  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1  224  ? 2.118   29.640  120.484 1.00 37.35  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1  224  ? 3.583   29.266  120.476 1.00 44.53  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1  224  ? 4.545   30.152  120.942 1.00 45.42  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1  224  ? 4.004   28.026  120.012 1.00 45.95  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1  224  ? 5.887   29.818  120.941 1.00 47.55  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1  224  ? 5.346   27.683  120.007 1.00 45.78  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1  224  ? 6.283   28.584  120.474 1.00 47.04  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1  224  ? 7.619   28.253  120.475 1.00 50.73  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1  225  ? -0.601  30.672  122.279 1.00 43.66  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1  225  ? -1.992  31.108  122.211 1.00 47.14  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1  225  ? -2.197  32.419  122.971 1.00 51.61  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1  225  ? -3.302  32.960  123.007 1.00 51.71  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1  225  ? -2.919  30.036  122.792 1.00 46.35  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1  225  ? -3.006  28.779  121.965 1.00 43.18  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1  225  ? -2.022  27.805  122.047 1.00 43.16  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1  225  ? -4.087  28.560  121.126 1.00 40.97  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1  225  ? -2.107  26.645  121.292 1.00 33.82  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1  225  ? -4.177  27.400  120.373 1.00 34.63  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1  225  ? -3.186  26.443  120.457 1.00 25.40  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1  226  ? -1.125  32.927  123.572 1.00 61.00  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1  226  ? -1.216  34.071  124.479 1.00 66.90  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1  226  ? -1.304  35.425  123.773 1.00 70.18  ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1  226  ? -1.590  36.442  124.407 1.00 78.59  ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1  226  ? -0.042  34.070  125.465 1.00 65.52  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1  226  ? 1.201   34.155  124.787 1.00 60.75  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1  227  ? -1.058  35.443  122.467 1.00 63.18  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1  227  ? -1.134  36.688  121.710 1.00 65.54  ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1  227  ? -2.140  36.621  120.567 1.00 67.23  ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1  227  ? -1.763  36.389  119.417 1.00 71.21  ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1  227  ? 0.246   37.083  121.175 1.00 74.71  ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1  227  ? 0.222   38.394  120.408 1.00 72.83  ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1  227  ? -0.630  39.251  120.645 1.00 77.17  ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1  227  ? 1.156   38.553  119.478 1.00 64.25  ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1  228  ? -3.429  36.817  120.881 1.00 64.65  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1  228  ? -4.466  36.838  119.844 1.00 63.71  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1  228  ? -4.240  37.965  118.840 1.00 62.70  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1  228  ? -3.713  39.019  119.197 1.00 62.55  ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1  228  ? -5.751  37.082  120.642 1.00 55.74  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1  228  ? -5.445  36.570  122.009 1.00 59.69  ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1  228  ? -4.003  36.911  122.234 1.00 60.60  ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1  229  ? -4.626  37.728  117.592 1.00 61.85  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1  229  ? -4.495  38.722  116.536 1.00 61.69  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1  229  ? -5.745  38.693  115.666 1.00 60.67  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1  229  ? -6.198  37.627  115.255 1.00 59.73  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1  229  ? -3.259  38.436  115.681 1.00 59.55  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1  229  ? -2.897  39.538  114.699 1.00 68.09  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1  229  ? -2.021  40.609  115.322 1.00 80.28  ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1  229  ? -1.467  40.422  116.407 1.00 73.33  ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1  229  ? -1.889  41.739  114.635 1.00 75.68  ? 229  GLN A NE2   1 
ATOM   1783  N  N     . ALA A 1  230  ? -6.305  39.866  115.394 1.00 70.61  ? 230  ALA A N     1 
ATOM   1784  C  CA    . ALA A 1  230  ? -7.503  39.955  114.570 1.00 68.90  ? 230  ALA A CA    1 
ATOM   1785  C  C     . ALA A 1  230  ? -7.207  39.559  113.126 1.00 69.21  ? 230  ALA A C     1 
ATOM   1786  O  O     . ALA A 1  230  ? -6.215  39.996  112.543 1.00 72.04  ? 230  ALA A O     1 
ATOM   1787  C  CB    . ALA A 1  230  ? -8.086  41.359  114.631 1.00 76.83  ? 230  ALA A CB    1 
ATOM   1788  N  N     . ALA A 1  231  ? -8.070  38.720  112.561 1.00 71.32  ? 231  ALA A N     1 
ATOM   1789  C  CA    . ALA A 1  231  ? -7.942  38.304  111.170 1.00 73.76  ? 231  ALA A CA    1 
ATOM   1790  C  C     . ALA A 1  231  ? -8.928  39.077  110.311 1.00 88.43  ? 231  ALA A C     1 
ATOM   1791  O  O     . ALA A 1  231  ? -10.138 38.875  110.415 1.00 94.55  ? 231  ALA A O     1 
ATOM   1792  C  CB    . ALA A 1  231  ? -8.198  36.818  111.039 1.00 72.80  ? 231  ALA A CB    1 
ATOM   1793  N  N     . ALA A 1  232  ? -8.416  39.953  109.455 1.00 88.31  ? 232  ALA A N     1 
ATOM   1794  C  CA    . ALA A 1  232  ? -9.291  40.760  108.619 1.00 91.71  ? 232  ALA A CA    1 
ATOM   1795  C  C     . ALA A 1  232  ? -9.356  40.199  107.206 1.00 95.35  ? 232  ALA A C     1 
ATOM   1796  O  O     . ALA A 1  232  ? -8.402  40.307  106.437 1.00 97.93  ? 232  ALA A O     1 
ATOM   1797  C  CB    . ALA A 1  232  ? -8.816  42.206  108.597 1.00 85.75  ? 232  ALA A CB    1 
ATOM   1798  N  N     . VAL A 1  233  ? -10.493 39.595  106.875 1.00 102.39 ? 233  VAL A N     1 
ATOM   1799  C  CA    . VAL A 1  233  ? -10.748 39.119  105.523 1.00 110.22 ? 233  VAL A CA    1 
ATOM   1800  C  C     . VAL A 1  233  ? -11.588 40.162  104.788 1.00 110.11 ? 233  VAL A C     1 
ATOM   1801  O  O     . VAL A 1  233  ? -11.906 40.012  103.608 1.00 101.20 ? 233  VAL A O     1 
ATOM   1802  C  CB    . VAL A 1  233  ? -11.469 37.753  105.531 1.00 106.56 ? 233  VAL A CB    1 
ATOM   1803  C  CG1   . VAL A 1  233  ? -11.225 37.012  104.223 1.00 88.34  ? 233  VAL A CG1   1 
ATOM   1804  C  CG2   . VAL A 1  233  ? -10.992 36.912  106.707 1.00 96.23  ? 233  VAL A CG2   1 
ATOM   1805  N  N     . ALA A 1  234  ? -11.940 41.226  105.505 1.00 114.07 ? 234  ALA A N     1 
ATOM   1806  C  CA    . ALA A 1  234  ? -12.748 42.305  104.949 1.00 107.23 ? 234  ALA A CA    1 
ATOM   1807  C  C     . ALA A 1  234  ? -11.984 43.625  104.971 1.00 97.68  ? 234  ALA A C     1 
ATOM   1808  O  O     . ALA A 1  234  ? -11.556 44.088  106.028 1.00 89.64  ? 234  ALA A O     1 
ATOM   1809  C  CB    . ALA A 1  234  ? -14.055 42.437  105.716 1.00 92.49  ? 234  ALA A CB    1 
ATOM   1810  N  N     . LEU B 1  2    ? 21.632  20.727  109.552 1.00 79.32  ? 2    LEU B N     1 
ATOM   1811  C  CA    . LEU B 1  2    ? 21.560  20.425  110.977 1.00 85.45  ? 2    LEU B CA    1 
ATOM   1812  C  C     . LEU B 1  2    ? 21.023  21.625  111.753 1.00 103.04 ? 2    LEU B C     1 
ATOM   1813  O  O     . LEU B 1  2    ? 20.120  21.485  112.579 1.00 108.05 ? 2    LEU B O     1 
ATOM   1814  C  CB    . LEU B 1  2    ? 22.942  20.025  111.511 1.00 72.04  ? 2    LEU B CB    1 
ATOM   1815  C  CG    . LEU B 1  2    ? 23.043  19.120  112.747 1.00 66.86  ? 2    LEU B CG    1 
ATOM   1816  C  CD1   . LEU B 1  2    ? 24.477  18.651  112.937 1.00 50.46  ? 2    LEU B CD1   1 
ATOM   1817  C  CD2   . LEU B 1  2    ? 22.542  19.793  114.021 1.00 62.41  ? 2    LEU B CD2   1 
ATOM   1818  N  N     . ASP B 1  3    ? 21.586  22.799  111.482 1.00 99.52  ? 3    ASP B N     1 
ATOM   1819  C  CA    . ASP B 1  3    ? 21.245  24.009  112.223 1.00 103.02 ? 3    ASP B CA    1 
ATOM   1820  C  C     . ASP B 1  3    ? 19.779  24.390  112.042 1.00 110.43 ? 3    ASP B C     1 
ATOM   1821  O  O     . ASP B 1  3    ? 19.303  24.549  110.918 1.00 109.67 ? 3    ASP B O     1 
ATOM   1822  C  CB    . ASP B 1  3    ? 22.138  25.170  111.781 1.00 105.74 ? 3    ASP B CB    1 
ATOM   1823  C  CG    . ASP B 1  3    ? 23.614  24.836  111.870 1.00 98.89  ? 3    ASP B CG    1 
ATOM   1824  O  OD1   . ASP B 1  3    ? 24.014  24.142  112.829 1.00 97.16  ? 3    ASP B OD1   1 
ATOM   1825  O  OD2   . ASP B 1  3    ? 24.375  25.264  110.977 1.00 94.50  ? 3    ASP B OD2   1 
ATOM   1826  N  N     . SER B 1  4    ? 19.070  24.537  113.157 1.00 112.18 ? 4    SER B N     1 
ATOM   1827  C  CA    . SER B 1  4    ? 17.662  24.911  113.118 1.00 109.51 ? 4    SER B CA    1 
ATOM   1828  C  C     . SER B 1  4    ? 17.332  26.027  114.102 1.00 108.72 ? 4    SER B C     1 
ATOM   1829  O  O     . SER B 1  4    ? 17.416  25.844  115.316 1.00 106.34 ? 4    SER B O     1 
ATOM   1830  C  CB    . SER B 1  4    ? 16.782  23.694  113.410 1.00 106.58 ? 4    SER B CB    1 
ATOM   1831  O  OG    . SER B 1  4    ? 15.427  24.074  113.580 1.00 102.82 ? 4    SER B OG    1 
ATOM   1832  N  N     . LYS B 1  5    ? 16.959  27.184  113.566 1.00 110.95 ? 5    LYS B N     1 
ATOM   1833  C  CA    . LYS B 1  5    ? 16.423  28.271  114.374 1.00 115.19 ? 5    LYS B CA    1 
ATOM   1834  C  C     . LYS B 1  5    ? 15.307  28.959  113.594 1.00 119.39 ? 5    LYS B C     1 
ATOM   1835  O  O     . LYS B 1  5    ? 15.520  29.387  112.458 1.00 118.70 ? 5    LYS B O     1 
ATOM   1836  C  CB    . LYS B 1  5    ? 17.525  29.274  114.725 1.00 109.92 ? 5    LYS B CB    1 
ATOM   1837  C  CG    . LYS B 1  5    ? 17.153  30.259  115.826 1.00 104.71 ? 5    LYS B CG    1 
ATOM   1838  C  CD    . LYS B 1  5    ? 17.060  29.569  117.180 1.00 94.73  ? 5    LYS B CD    1 
ATOM   1839  C  CE    . LYS B 1  5    ? 18.397  28.965  117.583 1.00 78.63  ? 5    LYS B CE    1 
ATOM   1840  N  NZ    . LYS B 1  5    ? 18.311  28.222  118.870 1.00 57.47  ? 5    LYS B NZ    1 
ATOM   1841  N  N     . LEU B 1  6    ? 14.126  29.075  114.197 1.00 115.79 ? 6    LEU B N     1 
ATOM   1842  C  CA    . LEU B 1  6    ? 13.000  29.732  113.531 1.00 111.13 ? 6    LEU B CA    1 
ATOM   1843  C  C     . LEU B 1  6    ? 12.028  30.430  114.484 1.00 103.23 ? 6    LEU B C     1 
ATOM   1844  O  O     . LEU B 1  6    ? 12.001  30.157  115.684 1.00 97.70  ? 6    LEU B O     1 
ATOM   1845  C  CB    . LEU B 1  6    ? 12.249  28.762  112.610 1.00 112.22 ? 6    LEU B CB    1 
ATOM   1846  C  CG    . LEU B 1  6    ? 12.683  28.773  111.138 1.00 108.05 ? 6    LEU B CG    1 
ATOM   1847  C  CD1   . LEU B 1  6    ? 11.779  27.888  110.292 1.00 100.01 ? 6    LEU B CD1   1 
ATOM   1848  C  CD2   . LEU B 1  6    ? 12.715  30.196  110.589 1.00 85.71  ? 6    LEU B CD2   1 
ATOM   1849  N  N     . LYS B 1  7    ? 11.226  31.326  113.917 1.00 105.10 ? 7    LYS B N     1 
ATOM   1850  C  CA    . LYS B 1  7    ? 10.359  32.219  114.678 1.00 92.74  ? 7    LYS B CA    1 
ATOM   1851  C  C     . LYS B 1  7    ? 9.129   31.549  115.291 1.00 83.27  ? 7    LYS B C     1 
ATOM   1852  O  O     . LYS B 1  7    ? 8.618   30.555  114.770 1.00 72.78  ? 7    LYS B O     1 
ATOM   1853  C  CB    . LYS B 1  7    ? 9.934   33.396  113.794 1.00 84.29  ? 7    LYS B CB    1 
ATOM   1854  C  CG    . LYS B 1  7    ? 9.793   33.037  112.317 1.00 84.07  ? 7    LYS B CG    1 
ATOM   1855  C  CD    . LYS B 1  7    ? 8.401   32.522  111.980 1.00 72.93  ? 7    LYS B CD    1 
ATOM   1856  C  CE    . LYS B 1  7    ? 7.405   33.668  111.875 1.00 66.69  ? 7    LYS B CE    1 
ATOM   1857  N  NZ    . LYS B 1  7    ? 6.034   33.198  111.533 1.00 56.85  ? 7    LYS B NZ    1 
ATOM   1858  N  N     . ALA B 1  8    ? 8.665   32.111  116.404 1.00 79.62  ? 8    ALA B N     1 
ATOM   1859  C  CA    . ALA B 1  8    ? 7.456   31.643  117.073 1.00 68.53  ? 8    ALA B CA    1 
ATOM   1860  C  C     . ALA B 1  8    ? 6.234   31.956  116.219 1.00 62.83  ? 8    ALA B C     1 
ATOM   1861  O  O     . ALA B 1  8    ? 6.186   32.991  115.555 1.00 60.32  ? 8    ALA B O     1 
ATOM   1862  C  CB    . ALA B 1  8    ? 7.328   32.290  118.444 1.00 61.65  ? 8    ALA B CB    1 
ATOM   1863  N  N     . PRO B 1  9    ? 5.237   31.060  116.236 1.00 57.39  ? 9    PRO B N     1 
ATOM   1864  C  CA    . PRO B 1  9    ? 4.068   31.213  115.365 1.00 51.45  ? 9    PRO B CA    1 
ATOM   1865  C  C     . PRO B 1  9    ? 3.164   32.367  115.781 1.00 44.80  ? 9    PRO B C     1 
ATOM   1866  O  O     . PRO B 1  9    ? 3.126   32.742  116.952 1.00 46.65  ? 9    PRO B O     1 
ATOM   1867  C  CB    . PRO B 1  9    ? 3.331   29.883  115.538 1.00 44.74  ? 9    PRO B CB    1 
ATOM   1868  C  CG    . PRO B 1  9    ? 3.728   29.412  116.887 1.00 46.28  ? 9    PRO B CG    1 
ATOM   1869  C  CD    . PRO B 1  9    ? 5.149   29.852  117.074 1.00 51.11  ? 9    PRO B CD    1 
ATOM   1870  N  N     . VAL B 1  10   ? 2.444   32.920  114.811 1.00 42.85  ? 10   VAL B N     1 
ATOM   1871  C  CA    . VAL B 1  10   ? 1.483   33.980  115.070 1.00 45.75  ? 10   VAL B CA    1 
ATOM   1872  C  C     . VAL B 1  10   ? 0.087   33.386  115.261 1.00 43.93  ? 10   VAL B C     1 
ATOM   1873  O  O     . VAL B 1  10   ? -0.360  32.555  114.468 1.00 42.35  ? 10   VAL B O     1 
ATOM   1874  C  CB    . VAL B 1  10   ? 1.483   35.029  113.929 1.00 42.23  ? 10   VAL B CB    1 
ATOM   1875  C  CG1   . VAL B 1  10   ? 1.504   34.345  112.569 1.00 42.77  ? 10   VAL B CG1   1 
ATOM   1876  C  CG2   . VAL B 1  10   ? 0.292   35.972  114.053 1.00 36.14  ? 10   VAL B CG2   1 
ATOM   1877  N  N     . PHE B 1  11   ? -0.585  33.803  116.330 1.00 44.24  ? 11   PHE B N     1 
ATOM   1878  C  CA    . PHE B 1  11   ? -1.919  33.308  116.657 1.00 46.20  ? 11   PHE B CA    1 
ATOM   1879  C  C     . PHE B 1  11   ? -2.990  34.210  116.048 1.00 43.64  ? 11   PHE B C     1 
ATOM   1880  O  O     . PHE B 1  11   ? -3.086  35.387  116.384 1.00 46.48  ? 11   PHE B O     1 
ATOM   1881  C  CB    . PHE B 1  11   ? -2.080  33.217  118.178 1.00 50.04  ? 11   PHE B CB    1 
ATOM   1882  C  CG    . PHE B 1  11   ? -3.411  32.681  118.625 1.00 49.32  ? 11   PHE B CG    1 
ATOM   1883  C  CD1   . PHE B 1  11   ? -3.922  31.512  118.086 1.00 51.75  ? 11   PHE B CD1   1 
ATOM   1884  C  CD2   . PHE B 1  11   ? -4.140  33.335  119.606 1.00 51.97  ? 11   PHE B CD2   1 
ATOM   1885  C  CE1   . PHE B 1  11   ? -5.146  31.014  118.505 1.00 51.47  ? 11   PHE B CE1   1 
ATOM   1886  C  CE2   . PHE B 1  11   ? -5.362  32.843  120.030 1.00 53.70  ? 11   PHE B CE2   1 
ATOM   1887  C  CZ    . PHE B 1  11   ? -5.865  31.680  119.479 1.00 51.06  ? 11   PHE B CZ    1 
ATOM   1888  N  N     . THR B 1  12   ? -3.793  33.651  115.149 1.00 42.64  ? 12   THR B N     1 
ATOM   1889  C  CA    . THR B 1  12   ? -4.775  34.430  114.403 1.00 44.58  ? 12   THR B CA    1 
ATOM   1890  C  C     . THR B 1  12   ? -6.204  34.110  114.841 1.00 47.69  ? 12   THR B C     1 
ATOM   1891  O  O     . THR B 1  12   ? -6.565  32.944  115.006 1.00 43.78  ? 12   THR B O     1 
ATOM   1892  C  CB    . THR B 1  12   ? -4.641  34.176  112.895 1.00 49.25  ? 12   THR B CB    1 
ATOM   1893  O  OG1   . THR B 1  12   ? -3.257  34.006  112.559 1.00 48.81  ? 12   THR B OG1   1 
ATOM   1894  C  CG2   . THR B 1  12   ? -5.210  35.337  112.111 1.00 45.89  ? 12   THR B CG2   1 
ATOM   1895  N  N     . VAL B 1  13   ? -7.016  35.149  115.019 1.00 53.66  ? 13   VAL B N     1 
ATOM   1896  C  CA    . VAL B 1  13   ? -8.359  34.989  115.574 1.00 50.95  ? 13   VAL B CA    1 
ATOM   1897  C  C     . VAL B 1  13   ? -9.452  35.562  114.671 1.00 46.45  ? 13   VAL B C     1 
ATOM   1898  O  O     . VAL B 1  13   ? -9.353  36.689  114.191 1.00 49.19  ? 13   VAL B O     1 
ATOM   1899  C  CB    . VAL B 1  13   ? -8.473  35.647  116.971 1.00 53.17  ? 13   VAL B CB    1 
ATOM   1900  C  CG1   . VAL B 1  13   ? -9.842  35.385  117.577 1.00 43.92  ? 13   VAL B CG1   1 
ATOM   1901  C  CG2   . VAL B 1  13   ? -7.374  35.141  117.897 1.00 48.26  ? 13   VAL B CG2   1 
ATOM   1902  N  N     . ARG B 1  14   ? -10.493 34.768  114.445 1.00 48.93  ? 14   ARG B N     1 
ATOM   1903  C  CA    . ARG B 1  14   ? -11.654 35.200  113.679 1.00 47.27  ? 14   ARG B CA    1 
ATOM   1904  C  C     . ARG B 1  14   ? -12.905 34.877  114.488 1.00 51.51  ? 14   ARG B C     1 
ATOM   1905  O  O     . ARG B 1  14   ? -13.214 33.707  114.704 1.00 52.65  ? 14   ARG B O     1 
ATOM   1906  C  CB    . ARG B 1  14   ? -11.689 34.450  112.350 1.00 49.67  ? 14   ARG B CB    1 
ATOM   1907  C  CG    . ARG B 1  14   ? -12.164 35.264  111.160 1.00 70.48  ? 14   ARG B CG    1 
ATOM   1908  C  CD    . ARG B 1  14   ? -11.281 35.015  109.934 1.00 82.80  ? 14   ARG B CD    1 
ATOM   1909  N  NE    . ARG B 1  14   ? -11.081 33.592  109.656 1.00 84.04  ? 14   ARG B NE    1 
ATOM   1910  C  CZ    . ARG B 1  14   ? -9.978  32.910  109.962 1.00 75.12  ? 14   ARG B CZ    1 
ATOM   1911  N  NH1   . ARG B 1  14   ? -8.962  33.517  110.562 1.00 69.82  ? 14   ARG B NH1   1 
ATOM   1912  N  NH2   . ARG B 1  14   ? -9.891  31.619  109.671 1.00 67.87  ? 14   ARG B NH2   1 
ATOM   1913  N  N     . THR B 1  15   ? -13.629 35.902  114.930 1.00 59.93  ? 15   THR B N     1 
ATOM   1914  C  CA    . THR B 1  15   ? -14.779 35.688  115.812 1.00 59.35  ? 15   THR B CA    1 
ATOM   1915  C  C     . THR B 1  15   ? -16.074 36.337  115.329 1.00 54.16  ? 15   THR B C     1 
ATOM   1916  O  O     . THR B 1  15   ? -16.106 37.526  115.012 1.00 60.53  ? 15   THR B O     1 
ATOM   1917  C  CB    . THR B 1  15   ? -14.499 36.180  117.251 1.00 55.51  ? 15   THR B CB    1 
ATOM   1918  O  OG1   . THR B 1  15   ? -14.033 37.535  117.215 1.00 58.62  ? 15   THR B OG1   1 
ATOM   1919  C  CG2   . THR B 1  15   ? -13.455 35.309  117.925 1.00 50.94  ? 15   THR B CG2   1 
ATOM   1920  N  N     . GLN B 1  16   ? -17.139 35.543  115.280 1.00 52.68  ? 16   GLN B N     1 
ATOM   1921  C  CA    . GLN B 1  16   ? -18.470 36.059  114.986 1.00 57.78  ? 16   GLN B CA    1 
ATOM   1922  C  C     . GLN B 1  16   ? -19.369 35.881  116.204 1.00 65.20  ? 16   GLN B C     1 
ATOM   1923  O  O     . GLN B 1  16   ? -19.767 34.761  116.529 1.00 62.42  ? 16   GLN B O     1 
ATOM   1924  C  CB    . GLN B 1  16   ? -19.077 35.322  113.791 1.00 55.83  ? 16   GLN B CB    1 
ATOM   1925  C  CG    . GLN B 1  16   ? -18.217 35.349  112.540 1.00 68.87  ? 16   GLN B CG    1 
ATOM   1926  C  CD    . GLN B 1  16   ? -18.725 34.405  111.467 1.00 75.87  ? 16   GLN B CD    1 
ATOM   1927  O  OE1   . GLN B 1  16   ? -19.766 33.767  111.627 1.00 78.55  ? 16   GLN B OE1   1 
ATOM   1928  N  NE2   . GLN B 1  16   ? -17.988 34.307  110.365 1.00 74.32  ? 16   GLN B NE2   1 
ATOM   1929  N  N     . GLY B 1  17   ? -19.698 36.989  116.863 1.00 65.71  ? 17   GLY B N     1 
ATOM   1930  C  CA    . GLY B 1  17   ? -20.545 36.961  118.044 1.00 57.23  ? 17   GLY B CA    1 
ATOM   1931  C  C     . GLY B 1  17   ? -19.965 36.155  119.192 1.00 49.72  ? 17   GLY B C     1 
ATOM   1932  O  O     . GLY B 1  17   ? -18.755 35.932  119.260 1.00 58.39  ? 17   GLY B O     1 
ATOM   1933  N  N     . ARG B 1  18   ? -20.832 35.723  120.102 1.00 43.44  ? 18   ARG B N     1 
ATOM   1934  C  CA    . ARG B 1  18   ? -20.418 34.893  121.228 1.00 46.83  ? 18   ARG B CA    1 
ATOM   1935  C  C     . ARG B 1  18   ? -20.585 33.414  120.898 1.00 45.54  ? 18   ARG B C     1 
ATOM   1936  O  O     . ARG B 1  18   ? -20.219 32.543  121.688 1.00 38.65  ? 18   ARG B O     1 
ATOM   1937  C  CB    . ARG B 1  18   ? -21.245 35.234  122.469 1.00 49.31  ? 18   ARG B CB    1 
ATOM   1938  C  CG    . ARG B 1  18   ? -21.231 36.704  122.846 1.00 45.83  ? 18   ARG B CG    1 
ATOM   1939  C  CD    . ARG B 1  18   ? -22.118 36.968  124.049 1.00 32.52  ? 18   ARG B CD    1 
ATOM   1940  N  NE    . ARG B 1  18   ? -21.787 36.095  125.169 1.00 33.28  ? 18   ARG B NE    1 
ATOM   1941  C  CZ    . ARG B 1  18   ? -20.760 36.291  125.990 1.00 42.00  ? 18   ARG B CZ    1 
ATOM   1942  N  NH1   . ARG B 1  18   ? -20.534 35.443  126.986 1.00 35.90  ? 18   ARG B NH1   1 
ATOM   1943  N  NH2   . ARG B 1  18   ? -19.955 37.333  125.815 1.00 35.80  ? 18   ARG B NH2   1 
ATOM   1944  N  N     . GLU B 1  19   ? -21.161 33.145  119.731 1.00 48.03  ? 19   GLU B N     1 
ATOM   1945  C  CA    . GLU B 1  19   ? -21.485 31.786  119.304 1.00 47.79  ? 19   GLU B CA    1 
ATOM   1946  C  C     . GLU B 1  19   ? -20.330 30.995  118.683 1.00 43.22  ? 19   GLU B C     1 
ATOM   1947  O  O     . GLU B 1  19   ? -20.179 29.801  118.940 1.00 34.92  ? 19   GLU B O     1 
ATOM   1948  C  CB    . GLU B 1  19   ? -22.670 31.817  118.337 1.00 56.56  ? 19   GLU B CB    1 
ATOM   1949  C  CG    . GLU B 1  19   ? -23.949 32.332  118.965 1.00 48.19  ? 19   GLU B CG    1 
ATOM   1950  C  CD    . GLU B 1  19   ? -24.441 31.432  120.073 1.00 41.43  ? 19   GLU B CD    1 
ATOM   1951  O  OE1   . GLU B 1  19   ? -24.795 31.951  121.151 1.00 49.17  ? 19   GLU B OE1   1 
ATOM   1952  O  OE2   . GLU B 1  19   ? -24.476 30.202  119.865 1.00 49.12  ? 19   GLU B OE2   1 
ATOM   1953  N  N     . TYR B 1  20   ? -19.526 31.657  117.857 1.00 45.16  ? 20   TYR B N     1 
ATOM   1954  C  CA    . TYR B 1  20   ? -18.575 30.949  117.008 1.00 37.93  ? 20   TYR B CA    1 
ATOM   1955  C  C     . TYR B 1  20   ? -17.239 31.672  116.844 1.00 42.07  ? 20   TYR B C     1 
ATOM   1956  O  O     . TYR B 1  20   ? -17.177 32.901  116.885 1.00 46.84  ? 20   TYR B O     1 
ATOM   1957  C  CB    . TYR B 1  20   ? -19.208 30.713  115.636 1.00 38.42  ? 20   TYR B CB    1 
ATOM   1958  C  CG    . TYR B 1  20   ? -18.302 30.026  114.647 1.00 38.45  ? 20   TYR B CG    1 
ATOM   1959  C  CD1   . TYR B 1  20   ? -17.673 30.742  113.637 1.00 36.83  ? 20   TYR B CD1   1 
ATOM   1960  C  CD2   . TYR B 1  20   ? -18.070 28.660  114.726 1.00 41.84  ? 20   TYR B CD2   1 
ATOM   1961  C  CE1   . TYR B 1  20   ? -16.842 30.113  112.729 1.00 44.80  ? 20   TYR B CE1   1 
ATOM   1962  C  CE2   . TYR B 1  20   ? -17.239 28.025  113.826 1.00 44.09  ? 20   TYR B CE2   1 
ATOM   1963  C  CZ    . TYR B 1  20   ? -16.628 28.752  112.829 1.00 48.07  ? 20   TYR B CZ    1 
ATOM   1964  O  OH    . TYR B 1  20   ? -15.803 28.108  111.934 1.00 45.82  ? 20   TYR B OH    1 
ATOM   1965  N  N     . GLY B 1  21   ? -16.173 30.897  116.656 1.00 34.32  ? 21   GLY B N     1 
ATOM   1966  C  CA    . GLY B 1  21   ? -14.862 31.456  116.375 1.00 38.88  ? 21   GLY B CA    1 
ATOM   1967  C  C     . GLY B 1  21   ? -13.924 30.498  115.657 1.00 43.28  ? 21   GLY B C     1 
ATOM   1968  O  O     . GLY B 1  21   ? -14.067 29.279  115.755 1.00 36.75  ? 21   GLY B O     1 
ATOM   1969  N  N     . GLU B 1  22   ? -12.956 31.058  114.934 1.00 39.92  ? 22   GLU B N     1 
ATOM   1970  C  CA    . GLU B 1  22   ? -11.944 30.267  114.241 1.00 30.30  ? 22   GLU B CA    1 
ATOM   1971  C  C     . GLU B 1  22   ? -10.557 30.688  114.691 1.00 33.30  ? 22   GLU B C     1 
ATOM   1972  O  O     . GLU B 1  22   ? -10.264 31.878  114.799 1.00 40.03  ? 22   GLU B O     1 
ATOM   1973  C  CB    . GLU B 1  22   ? -12.060 30.438  112.730 1.00 43.69  ? 22   GLU B CB    1 
ATOM   1974  C  CG    . GLU B 1  22   ? -13.430 30.126  112.182 1.00 48.45  ? 22   GLU B CG    1 
ATOM   1975  C  CD    . GLU B 1  22   ? -13.434 29.986  110.676 1.00 52.16  ? 22   GLU B CD    1 
ATOM   1976  O  OE1   . GLU B 1  22   ? -12.335 29.951  110.082 1.00 56.50  ? 22   GLU B OE1   1 
ATOM   1977  O  OE2   . GLU B 1  22   ? -14.535 29.908  110.089 1.00 46.52  ? 22   GLU B OE2   1 
ATOM   1978  N  N     . PHE B 1  23   ? -9.696  29.711  114.942 1.00 27.93  ? 23   PHE B N     1 
ATOM   1979  C  CA    . PHE B 1  23   ? -8.392  29.996  115.522 1.00 33.02  ? 23   PHE B CA    1 
ATOM   1980  C  C     . PHE B 1  23   ? -7.258  29.359  114.730 1.00 30.18  ? 23   PHE B C     1 
ATOM   1981  O  O     . PHE B 1  23   ? -7.159  28.139  114.641 1.00 29.59  ? 23   PHE B O     1 
ATOM   1982  C  CB    . PHE B 1  23   ? -8.366  29.542  116.979 1.00 33.73  ? 23   PHE B CB    1 
ATOM   1983  C  CG    . PHE B 1  23   ? -9.444  30.163  117.819 1.00 32.20  ? 23   PHE B CG    1 
ATOM   1984  C  CD1   . PHE B 1  23   ? -9.182  31.288  118.581 1.00 38.10  ? 23   PHE B CD1   1 
ATOM   1985  C  CD2   . PHE B 1  23   ? -10.722 29.629  117.837 1.00 32.60  ? 23   PHE B CD2   1 
ATOM   1986  C  CE1   . PHE B 1  23   ? -10.172 31.863  119.351 1.00 43.71  ? 23   PHE B CE1   1 
ATOM   1987  C  CE2   . PHE B 1  23   ? -11.718 30.202  118.602 1.00 35.93  ? 23   PHE B CE2   1 
ATOM   1988  C  CZ    . PHE B 1  23   ? -11.443 31.319  119.361 1.00 41.20  ? 23   PHE B CZ    1 
ATOM   1989  N  N     . VAL B 1  24   ? -6.399  30.198  114.162 1.00 34.56  ? 24   VAL B N     1 
ATOM   1990  C  CA    . VAL B 1  24   ? -5.330  29.725  113.293 1.00 33.03  ? 24   VAL B CA    1 
ATOM   1991  C  C     . VAL B 1  24   ? -3.948  29.910  113.917 1.00 37.47  ? 24   VAL B C     1 
ATOM   1992  O  O     . VAL B 1  24   ? -3.582  31.013  114.320 1.00 40.94  ? 24   VAL B O     1 
ATOM   1993  C  CB    . VAL B 1  24   ? -5.369  30.433  111.927 1.00 40.00  ? 24   VAL B CB    1 
ATOM   1994  C  CG1   . VAL B 1  24   ? -4.255  29.915  111.028 1.00 44.26  ? 24   VAL B CG1   1 
ATOM   1995  C  CG2   . VAL B 1  24   ? -6.731  30.241  111.271 1.00 36.60  ? 24   VAL B CG2   1 
ATOM   1996  N  N     . LEU B 1  25   ? -3.183  28.826  113.995 1.00 29.87  ? 25   LEU B N     1 
ATOM   1997  C  CA    . LEU B 1  25   ? -1.829  28.902  114.520 1.00 30.24  ? 25   LEU B CA    1 
ATOM   1998  C  C     . LEU B 1  25   ? -0.840  28.333  113.510 1.00 37.10  ? 25   LEU B C     1 
ATOM   1999  O  O     . LEU B 1  25   ? -0.813  27.127  113.270 1.00 39.66  ? 25   LEU B O     1 
ATOM   2000  C  CB    . LEU B 1  25   ? -1.742  28.123  115.832 1.00 32.71  ? 25   LEU B CB    1 
ATOM   2001  C  CG    . LEU B 1  25   ? -0.447  28.211  116.640 1.00 30.52  ? 25   LEU B CG    1 
ATOM   2002  C  CD1   . LEU B 1  25   ? -0.164  29.649  117.032 1.00 40.26  ? 25   LEU B CD1   1 
ATOM   2003  C  CD2   . LEU B 1  25   ? -0.540  27.330  117.874 1.00 23.33  ? 25   LEU B CD2   1 
ATOM   2004  N  N     . GLU B 1  26   ? -0.030  29.211  112.922 1.00 46.88  ? 26   GLU B N     1 
ATOM   2005  C  CA    . GLU B 1  26   ? 1.003   28.813  111.965 1.00 39.95  ? 26   GLU B CA    1 
ATOM   2006  C  C     . GLU B 1  26   ? 2.193   29.769  112.023 1.00 37.80  ? 26   GLU B C     1 
ATOM   2007  O  O     . GLU B 1  26   ? 2.030   30.932  112.391 1.00 38.92  ? 26   GLU B O     1 
ATOM   2008  C  CB    . GLU B 1  26   ? 0.433   28.762  110.545 1.00 30.62  ? 26   GLU B CB    1 
ATOM   2009  C  CG    . GLU B 1  26   ? -0.177  30.068  110.065 1.00 33.75  ? 26   GLU B CG    1 
ATOM   2010  C  CD    . GLU B 1  26   ? -0.645  29.996  108.621 1.00 44.25  ? 26   GLU B CD    1 
ATOM   2011  O  OE1   . GLU B 1  26   ? -0.011  29.268  107.825 1.00 35.10  ? 26   GLU B OE1   1 
ATOM   2012  O  OE2   . GLU B 1  26   ? -1.649  30.664  108.284 1.00 41.28  ? 26   GLU B OE2   1 
ATOM   2013  N  N     . PRO B 1  27   ? 3.395   29.292  111.653 1.00 35.77  ? 27   PRO B N     1 
ATOM   2014  C  CA    . PRO B 1  27   ? 3.772   27.909  111.344 1.00 32.55  ? 27   PRO B CA    1 
ATOM   2015  C  C     . PRO B 1  27   ? 4.067   27.087  112.597 1.00 35.18  ? 27   PRO B C     1 
ATOM   2016  O  O     . PRO B 1  27   ? 4.500   27.637  113.610 1.00 37.37  ? 27   PRO B O     1 
ATOM   2017  C  CB    . PRO B 1  27   ? 5.051   28.084  110.530 1.00 34.08  ? 27   PRO B CB    1 
ATOM   2018  C  CG    . PRO B 1  27   ? 5.679   29.294  111.119 1.00 34.69  ? 27   PRO B CG    1 
ATOM   2019  C  CD    . PRO B 1  27   ? 4.538   30.209  111.499 1.00 41.89  ? 27   PRO B CD    1 
ATOM   2020  N  N     . LEU B 1  28   ? 3.858   25.778  112.516 1.00 31.40  ? 28   LEU B N     1 
ATOM   2021  C  CA    . LEU B 1  28   ? 4.225   24.875  113.599 1.00 27.37  ? 28   LEU B CA    1 
ATOM   2022  C  C     . LEU B 1  28   ? 5.185   23.824  113.069 1.00 26.37  ? 28   LEU B C     1 
ATOM   2023  O  O     . LEU B 1  28   ? 5.196   23.536  111.875 1.00 31.17  ? 28   LEU B O     1 
ATOM   2024  C  CB    . LEU B 1  28   ? 2.986   24.201  114.188 1.00 30.94  ? 28   LEU B CB    1 
ATOM   2025  C  CG    . LEU B 1  28   ? 2.065   25.065  115.051 1.00 28.92  ? 28   LEU B CG    1 
ATOM   2026  C  CD1   . LEU B 1  28   ? 0.754   24.342  115.320 1.00 26.91  ? 28   LEU B CD1   1 
ATOM   2027  C  CD2   . LEU B 1  28   ? 2.751   25.437  116.358 1.00 29.97  ? 28   LEU B CD2   1 
ATOM   2028  N  N     . GLU B 1  29   ? 5.993   23.252  113.954 1.00 32.84  ? 29   GLU B N     1 
ATOM   2029  C  CA    . GLU B 1  29   ? 6.919   22.203  113.552 1.00 33.25  ? 29   GLU B CA    1 
ATOM   2030  C  C     . GLU B 1  29   ? 6.105   20.981  113.141 1.00 33.03  ? 29   GLU B C     1 
ATOM   2031  O  O     . GLU B 1  29   ? 4.936   20.866  113.511 1.00 35.41  ? 29   GLU B O     1 
ATOM   2032  C  CB    . GLU B 1  29   ? 7.887   21.869  114.691 1.00 27.26  ? 29   GLU B CB    1 
ATOM   2033  C  CG    . GLU B 1  29   ? 9.126   21.098  114.254 1.00 41.03  ? 29   GLU B CG    1 
ATOM   2034  C  CD    . GLU B 1  29   ? 9.914   21.809  113.163 1.00 48.81  ? 29   GLU B CD    1 
ATOM   2035  O  OE1   . GLU B 1  29   ? 10.041  21.244  112.055 1.00 39.23  ? 29   GLU B OE1   1 
ATOM   2036  O  OE2   . GLU B 1  29   ? 10.412  22.926  113.415 1.00 47.45  ? 29   GLU B OE2   1 
ATOM   2037  N  N     . ARG B 1  30   ? 6.711   20.085  112.365 1.00 29.19  ? 30   ARG B N     1 
ATOM   2038  C  CA    . ARG B 1  30   ? 5.992   18.948  111.800 1.00 26.91  ? 30   ARG B CA    1 
ATOM   2039  C  C     . ARG B 1  30   ? 5.278   18.115  112.862 1.00 30.80  ? 30   ARG B C     1 
ATOM   2040  O  O     . ARG B 1  30   ? 5.885   17.682  113.842 1.00 36.03  ? 30   ARG B O     1 
ATOM   2041  C  CB    . ARG B 1  30   ? 6.940   18.058  110.992 1.00 28.49  ? 30   ARG B CB    1 
ATOM   2042  C  CG    . ARG B 1  30   ? 6.270   16.824  110.407 1.00 30.36  ? 30   ARG B CG    1 
ATOM   2043  C  CD    . ARG B 1  30   ? 7.232   15.982  109.581 1.00 27.58  ? 30   ARG B CD    1 
ATOM   2044  N  NE    . ARG B 1  30   ? 8.210   15.270  110.398 1.00 26.58  ? 30   ARG B NE    1 
ATOM   2045  C  CZ    . ARG B 1  30   ? 9.131   14.442  109.910 1.00 28.72  ? 30   ARG B CZ    1 
ATOM   2046  N  NH1   . ARG B 1  30   ? 9.204   14.219  108.606 1.00 32.41  ? 30   ARG B NH1   1 
ATOM   2047  N  NH2   . ARG B 1  30   ? 9.982   13.837  110.725 1.00 34.06  ? 30   ARG B NH2   1 
ATOM   2048  N  N     . GLY B 1  31   ? 3.981   17.907  112.662 1.00 26.33  ? 31   GLY B N     1 
ATOM   2049  C  CA    . GLY B 1  31   ? 3.192   17.068  113.545 1.00 27.53  ? 31   GLY B CA    1 
ATOM   2050  C  C     . GLY B 1  31   ? 2.497   17.799  114.681 1.00 29.20  ? 31   GLY B C     1 
ATOM   2051  O  O     . GLY B 1  31   ? 1.528   17.293  115.254 1.00 27.48  ? 31   GLY B O     1 
ATOM   2052  N  N     . PHE B 1  32   ? 2.982   18.993  115.005 1.00 28.80  ? 32   PHE B N     1 
ATOM   2053  C  CA    . PHE B 1  32   ? 2.473   19.730  116.160 1.00 28.09  ? 32   PHE B CA    1 
ATOM   2054  C  C     . PHE B 1  32   ? 1.063   20.277  115.967 1.00 26.54  ? 32   PHE B C     1 
ATOM   2055  O  O     . PHE B 1  32   ? 0.413   20.686  116.928 1.00 27.53  ? 32   PHE B O     1 
ATOM   2056  C  CB    . PHE B 1  32   ? 3.439   20.845  116.567 1.00 27.51  ? 32   PHE B CB    1 
ATOM   2057  C  CG    . PHE B 1  32   ? 4.566   20.370  117.432 1.00 26.55  ? 32   PHE B CG    1 
ATOM   2058  C  CD1   . PHE B 1  32   ? 5.761   19.956  116.872 1.00 28.56  ? 32   PHE B CD1   1 
ATOM   2059  C  CD2   . PHE B 1  32   ? 4.423   20.318  118.808 1.00 24.77  ? 32   PHE B CD2   1 
ATOM   2060  C  CE1   . PHE B 1  32   ? 6.796   19.510  117.668 1.00 25.14  ? 32   PHE B CE1   1 
ATOM   2061  C  CE2   . PHE B 1  32   ? 5.454   19.874  119.608 1.00 25.42  ? 32   PHE B CE2   1 
ATOM   2062  C  CZ    . PHE B 1  32   ? 6.642   19.470  119.037 1.00 23.36  ? 32   PHE B CZ    1 
ATOM   2063  N  N     . GLY B 1  33   ? 0.595   20.284  114.725 1.00 27.65  ? 33   GLY B N     1 
ATOM   2064  C  CA    . GLY B 1  33   ? -0.772  20.673  114.445 1.00 24.81  ? 33   GLY B CA    1 
ATOM   2065  C  C     . GLY B 1  33   ? -1.751  19.778  115.180 1.00 23.77  ? 33   GLY B C     1 
ATOM   2066  O  O     . GLY B 1  33   ? -2.687  20.262  115.811 1.00 24.46  ? 33   GLY B O     1 
ATOM   2067  N  N     . VAL B 1  34   ? -1.537  18.468  115.099 1.00 21.77  ? 34   VAL B N     1 
ATOM   2068  C  CA    . VAL B 1  34   ? -2.417  17.521  115.772 1.00 24.15  ? 34   VAL B CA    1 
ATOM   2069  C  C     . VAL B 1  34   ? -1.996  17.283  117.217 1.00 25.50  ? 34   VAL B C     1 
ATOM   2070  O  O     . VAL B 1  34   ? -2.766  16.744  118.012 1.00 30.59  ? 34   VAL B O     1 
ATOM   2071  C  CB    . VAL B 1  34   ? -2.487  16.168  115.034 1.00 25.57  ? 34   VAL B CB    1 
ATOM   2072  C  CG1   . VAL B 1  34   ? -2.629  16.388  113.536 1.00 28.76  ? 34   VAL B CG1   1 
ATOM   2073  C  CG2   . VAL B 1  34   ? -1.262  15.337  115.335 1.00 21.83  ? 34   VAL B CG2   1 
ATOM   2074  N  N     . THR B 1  35   ? -0.776  17.685  117.556 1.00 24.06  ? 35   THR B N     1 
ATOM   2075  C  CA    . THR B 1  35   ? -0.289  17.547  118.923 1.00 18.48  ? 35   THR B CA    1 
ATOM   2076  C  C     . THR B 1  35   ? -1.012  18.530  119.837 1.00 20.42  ? 35   THR B C     1 
ATOM   2077  O  O     . THR B 1  35   ? -1.370  18.194  120.962 1.00 22.50  ? 35   THR B O     1 
ATOM   2078  C  CB    . THR B 1  35   ? 1.236   17.755  119.007 1.00 22.15  ? 35   THR B CB    1 
ATOM   2079  O  OG1   . THR B 1  35   ? 1.901   16.643  118.395 1.00 23.06  ? 35   THR B OG1   1 
ATOM   2080  C  CG2   . THR B 1  35   ? 1.692   17.866  120.454 1.00 21.03  ? 35   THR B CG2   1 
ATOM   2081  N  N     . LEU B 1  36   ? -1.228  19.746  119.350 1.00 25.63  ? 36   LEU B N     1 
ATOM   2082  C  CA    . LEU B 1  36   ? -2.002  20.733  120.093 1.00 23.89  ? 36   LEU B CA    1 
ATOM   2083  C  C     . LEU B 1  36   ? -3.503  20.516  119.931 1.00 21.19  ? 36   LEU B C     1 
ATOM   2084  O  O     . LEU B 1  36   ? -4.259  20.600  120.896 1.00 24.81  ? 36   LEU B O     1 
ATOM   2085  C  CB    . LEU B 1  36   ? -1.630  22.151  119.653 1.00 24.09  ? 36   LEU B CB    1 
ATOM   2086  C  CG    . LEU B 1  36   ? -0.189  22.586  119.923 1.00 24.77  ? 36   LEU B CG    1 
ATOM   2087  C  CD1   . LEU B 1  36   ? 0.055   23.992  119.401 1.00 24.91  ? 36   LEU B CD1   1 
ATOM   2088  C  CD2   . LEU B 1  36   ? 0.123   22.506  121.407 1.00 25.80  ? 36   LEU B CD2   1 
ATOM   2089  N  N     . GLY B 1  37   ? -3.924  20.223  118.705 1.00 24.40  ? 37   GLY B N     1 
ATOM   2090  C  CA    . GLY B 1  37   ? -5.335  20.180  118.355 1.00 23.41  ? 37   GLY B CA    1 
ATOM   2091  C  C     . GLY B 1  37   ? -6.190  19.163  119.086 1.00 20.69  ? 37   GLY B C     1 
ATOM   2092  O  O     . GLY B 1  37   ? -7.281  19.486  119.554 1.00 20.99  ? 37   GLY B O     1 
ATOM   2093  N  N     . ASN B 1  38   ? -5.708  17.929  119.177 1.00 20.09  ? 38   ASN B N     1 
ATOM   2094  C  CA    . ASN B 1  38   ? -6.478  16.869  119.826 1.00 22.27  ? 38   ASN B CA    1 
ATOM   2095  C  C     . ASN B 1  38   ? -6.741  17.036  121.325 1.00 22.58  ? 38   ASN B C     1 
ATOM   2096  O  O     . ASN B 1  38   ? -7.884  16.900  121.758 1.00 25.11  ? 38   ASN B O     1 
ATOM   2097  C  CB    . ASN B 1  38   ? -5.904  15.485  119.511 1.00 18.31  ? 38   ASN B CB    1 
ATOM   2098  C  CG    . ASN B 1  38   ? -6.412  14.941  118.197 1.00 25.32  ? 38   ASN B CG    1 
ATOM   2099  O  OD1   . ASN B 1  38   ? -7.616  14.958  117.932 1.00 23.08  ? 38   ASN B OD1   1 
ATOM   2100  N  ND2   . ASN B 1  38   ? -5.498  14.471  117.356 1.00 27.14  ? 38   ASN B ND2   1 
ATOM   2101  N  N     . PRO B 1  39   ? -5.696  17.327  122.123 1.00 20.34  ? 39   PRO B N     1 
ATOM   2102  C  CA    . PRO B 1  39   ? -5.940  17.523  123.556 1.00 21.71  ? 39   PRO B CA    1 
ATOM   2103  C  C     . PRO B 1  39   ? -6.907  18.671  123.795 1.00 24.11  ? 39   PRO B C     1 
ATOM   2104  O  O     . PRO B 1  39   ? -7.826  18.540  124.604 1.00 24.69  ? 39   PRO B O     1 
ATOM   2105  C  CB    . PRO B 1  39   ? -4.563  17.909  124.098 1.00 20.19  ? 39   PRO B CB    1 
ATOM   2106  C  CG    . PRO B 1  39   ? -3.614  17.418  123.109 1.00 15.67  ? 39   PRO B CG    1 
ATOM   2107  C  CD    . PRO B 1  39   ? -4.273  17.494  121.789 1.00 19.30  ? 39   PRO B CD    1 
ATOM   2108  N  N     . LEU B 1  40   ? -6.695  19.780  123.091 1.00 21.98  ? 40   LEU B N     1 
ATOM   2109  C  CA    . LEU B 1  40   ? -7.572  20.936  123.206 1.00 25.15  ? 40   LEU B CA    1 
ATOM   2110  C  C     . LEU B 1  40   ? -9.014  20.567  122.880 1.00 23.71  ? 40   LEU B C     1 
ATOM   2111  O  O     . LEU B 1  40   ? -9.935  20.972  123.585 1.00 26.27  ? 40   LEU B O     1 
ATOM   2112  C  CB    . LEU B 1  40   ? -7.093  22.079  122.309 1.00 22.82  ? 40   LEU B CB    1 
ATOM   2113  C  CG    . LEU B 1  40   ? -5.771  22.730  122.714 1.00 23.00  ? 40   LEU B CG    1 
ATOM   2114  C  CD1   . LEU B 1  40   ? -5.517  23.990  121.901 1.00 23.31  ? 40   LEU B CD1   1 
ATOM   2115  C  CD2   . LEU B 1  40   ? -5.754  23.030  124.205 1.00 29.76  ? 40   LEU B CD2   1 
ATOM   2116  N  N     . ARG B 1  41   ? -9.206  19.784  121.822 1.00 21.98  ? 41   ARG B N     1 
ATOM   2117  C  CA    . ARG B 1  41   ? -10.545 19.343  121.453 1.00 25.49  ? 41   ARG B CA    1 
ATOM   2118  C  C     . ARG B 1  41   ? -11.164 18.482  122.551 1.00 23.94  ? 41   ARG B C     1 
ATOM   2119  O  O     . ARG B 1  41   ? -12.350 18.612  122.859 1.00 24.88  ? 41   ARG B O     1 
ATOM   2120  C  CB    . ARG B 1  41   ? -10.532 18.577  120.129 1.00 23.44  ? 41   ARG B CB    1 
ATOM   2121  C  CG    . ARG B 1  41   ? -11.912 18.103  119.705 1.00 20.87  ? 41   ARG B CG    1 
ATOM   2122  C  CD    . ARG B 1  41   ? -11.853 17.145  118.537 1.00 21.59  ? 41   ARG B CD    1 
ATOM   2123  N  NE    . ARG B 1  41   ? -13.137 16.483  118.330 1.00 28.95  ? 41   ARG B NE    1 
ATOM   2124  C  CZ    . ARG B 1  41   ? -13.508 15.364  118.946 1.00 27.43  ? 41   ARG B CZ    1 
ATOM   2125  N  NH1   . ARG B 1  41   ? -12.690 14.779  119.812 1.00 30.38  ? 41   ARG B NH1   1 
ATOM   2126  N  NH2   . ARG B 1  41   ? -14.696 14.832  118.697 1.00 21.53  ? 41   ARG B NH2   1 
ATOM   2127  N  N     . ARG B 1  42   ? -10.357 17.606  123.142 1.00 19.55  ? 42   ARG B N     1 
ATOM   2128  C  CA    . ARG B 1  42   ? -10.830 16.752  124.224 1.00 23.70  ? 42   ARG B CA    1 
ATOM   2129  C  C     . ARG B 1  42   ? -11.216 17.588  125.438 1.00 27.43  ? 42   ARG B C     1 
ATOM   2130  O  O     . ARG B 1  42   ? -12.287 17.401  126.019 1.00 27.11  ? 42   ARG B O     1 
ATOM   2131  C  CB    . ARG B 1  42   ? -9.765  15.724  124.605 1.00 19.94  ? 42   ARG B CB    1 
ATOM   2132  C  CG    . ARG B 1  42   ? -9.433  14.754  123.493 1.00 20.25  ? 42   ARG B CG    1 
ATOM   2133  C  CD    . ARG B 1  42   ? -8.264  13.861  123.863 1.00 20.44  ? 42   ARG B CD    1 
ATOM   2134  N  NE    . ARG B 1  42   ? -8.618  12.897  124.897 1.00 18.50  ? 42   ARG B NE    1 
ATOM   2135  C  CZ    . ARG B 1  42   ? -9.222  11.740  124.652 1.00 23.09  ? 42   ARG B CZ    1 
ATOM   2136  N  NH1   . ARG B 1  42   ? -9.541  11.412  123.409 1.00 26.98  ? 42   ARG B NH1   1 
ATOM   2137  N  NH2   . ARG B 1  42   ? -9.512  10.913  125.647 1.00 28.52  ? 42   ARG B NH2   1 
ATOM   2138  N  N     . ILE B 1  43   ? -10.337 18.514  125.811 1.00 26.00  ? 43   ILE B N     1 
ATOM   2139  C  CA    . ILE B 1  43   ? -10.585 19.403  126.940 1.00 25.63  ? 43   ILE B CA    1 
ATOM   2140  C  C     . ILE B 1  43   ? -11.800 20.296  126.688 1.00 26.63  ? 43   ILE B C     1 
ATOM   2141  O  O     . ILE B 1  43   ? -12.683 20.406  127.538 1.00 28.39  ? 43   ILE B O     1 
ATOM   2142  C  CB    . ILE B 1  43   ? -9.352  20.273  127.249 1.00 22.32  ? 43   ILE B CB    1 
ATOM   2143  C  CG1   . ILE B 1  43   ? -8.177  19.393  127.678 1.00 23.12  ? 43   ILE B CG1   1 
ATOM   2144  C  CG2   . ILE B 1  43   ? -9.669  21.291  128.330 1.00 24.60  ? 43   ILE B CG2   1 
ATOM   2145  C  CD1   . ILE B 1  43   ? -6.898  20.161  127.936 1.00 20.68  ? 43   ILE B CD1   1 
ATOM   2146  N  N     . LEU B 1  44   ? -11.845 20.916  125.511 1.00 21.78  ? 44   LEU B N     1 
ATOM   2147  C  CA    . LEU B 1  44   ? -12.938 21.814  125.146 1.00 25.54  ? 44   LEU B CA    1 
ATOM   2148  C  C     . LEU B 1  44   ? -14.313 21.154  125.222 1.00 28.82  ? 44   LEU B C     1 
ATOM   2149  O  O     . LEU B 1  44   ? -15.304 21.807  125.548 1.00 35.05  ? 44   LEU B O     1 
ATOM   2150  C  CB    . LEU B 1  44   ? -12.718 22.389  123.746 1.00 23.62  ? 44   LEU B CB    1 
ATOM   2151  C  CG    . LEU B 1  44   ? -11.744 23.561  123.632 1.00 23.70  ? 44   LEU B CG    1 
ATOM   2152  C  CD1   . LEU B 1  44   ? -11.252 23.702  122.205 1.00 26.97  ? 44   LEU B CD1   1 
ATOM   2153  C  CD2   . LEU B 1  44   ? -12.409 24.845  124.094 1.00 28.09  ? 44   LEU B CD2   1 
ATOM   2154  N  N     . LEU B 1  45   ? -14.379 19.871  124.889 1.00 25.24  ? 45   LEU B N     1 
ATOM   2155  C  CA    . LEU B 1  45   ? -15.642 19.148  124.951 1.00 27.15  ? 45   LEU B CA    1 
ATOM   2156  C  C     . LEU B 1  45   ? -15.995 18.634  126.346 1.00 33.22  ? 45   LEU B C     1 
ATOM   2157  O  O     . LEU B 1  45   ? -17.141 18.744  126.780 1.00 36.07  ? 45   LEU B O     1 
ATOM   2158  C  CB    . LEU B 1  45   ? -15.645 17.995  123.949 1.00 29.31  ? 45   LEU B CB    1 
ATOM   2159  C  CG    . LEU B 1  45   ? -15.646 18.429  122.484 1.00 24.44  ? 45   LEU B CG    1 
ATOM   2160  C  CD1   . LEU B 1  45   ? -15.699 17.221  121.565 1.00 21.64  ? 45   LEU B CD1   1 
ATOM   2161  C  CD2   . LEU B 1  45   ? -16.814 19.363  122.226 1.00 27.44  ? 45   LEU B CD2   1 
ATOM   2162  N  N     . SER B 1  46   ? -15.020 18.041  127.028 1.00 30.60  ? 46   SER B N     1 
ATOM   2163  C  CA    . SER B 1  46   ? -15.262 17.434  128.338 1.00 27.94  ? 46   SER B CA    1 
ATOM   2164  C  C     . SER B 1  46   ? -15.200 18.356  129.564 1.00 28.14  ? 46   SER B C     1 
ATOM   2165  O  O     . SER B 1  46   ? -16.052 18.282  130.446 1.00 27.36  ? 46   SER B O     1 
ATOM   2166  C  CB    . SER B 1  46   ? -14.322 16.241  128.543 1.00 32.48  ? 46   SER B CB    1 
ATOM   2167  O  OG    . SER B 1  46   ? -12.966 16.636  128.437 1.00 34.00  ? 46   SER B OG    1 
ATOM   2168  N  N     . SER B 1  47   ? -14.176 19.200  129.627 1.00 29.82  ? 47   SER B N     1 
ATOM   2169  C  CA    . SER B 1  47   ? -13.830 19.883  130.877 1.00 26.90  ? 47   SER B CA    1 
ATOM   2170  C  C     . SER B 1  47   ? -14.264 21.341  131.076 1.00 32.52  ? 47   SER B C     1 
ATOM   2171  O  O     . SER B 1  47   ? -13.988 21.921  132.126 1.00 37.45  ? 47   SER B O     1 
ATOM   2172  C  CB    . SER B 1  47   ? -12.332 19.743  131.146 1.00 31.25  ? 47   SER B CB    1 
ATOM   2173  O  OG    . SER B 1  47   ? -11.969 18.376  131.196 1.00 32.02  ? 47   SER B OG    1 
ATOM   2174  N  N     . ILE B 1  48   ? -14.918 21.943  130.089 1.00 32.61  ? 48   ILE B N     1 
ATOM   2175  C  CA    . ILE B 1  48   ? -15.273 23.359  130.203 1.00 38.15  ? 48   ILE B CA    1 
ATOM   2176  C  C     . ILE B 1  48   ? -16.529 23.574  131.051 1.00 33.42  ? 48   ILE B C     1 
ATOM   2177  O  O     . ILE B 1  48   ? -17.598 23.060  130.724 1.00 32.66  ? 48   ILE B O     1 
ATOM   2178  C  CB    . ILE B 1  48   ? -15.449 24.029  128.823 1.00 38.11  ? 48   ILE B CB    1 
ATOM   2179  C  CG1   . ILE B 1  48   ? -14.214 23.794  127.953 1.00 24.61  ? 48   ILE B CG1   1 
ATOM   2180  C  CG2   . ILE B 1  48   ? -15.695 25.520  128.985 1.00 34.50  ? 48   ILE B CG2   1 
ATOM   2181  C  CD1   . ILE B 1  48   ? -12.946 24.375  128.521 1.00 26.33  ? 48   ILE B CD1   1 
ATOM   2182  N  N     . PRO B 1  49   ? -16.394 24.340  132.146 1.00 37.75  ? 49   PRO B N     1 
ATOM   2183  C  CA    . PRO B 1  49   ? -17.467 24.595  133.118 1.00 36.69  ? 49   PRO B CA    1 
ATOM   2184  C  C     . PRO B 1  49   ? -18.703 25.242  132.493 1.00 37.48  ? 49   PRO B C     1 
ATOM   2185  O  O     . PRO B 1  49   ? -18.582 26.189  131.715 1.00 41.04  ? 49   PRO B O     1 
ATOM   2186  C  CB    . PRO B 1  49   ? -16.814 25.565  134.109 1.00 35.25  ? 49   PRO B CB    1 
ATOM   2187  C  CG    . PRO B 1  49   ? -15.353 25.313  133.981 1.00 29.31  ? 49   PRO B CG    1 
ATOM   2188  C  CD    . PRO B 1  49   ? -15.136 25.002  132.534 1.00 32.69  ? 49   PRO B CD    1 
ATOM   2189  N  N     . GLY B 1  50   ? -19.879 24.737  132.851 1.00 37.92  ? 50   GLY B N     1 
ATOM   2190  C  CA    . GLY B 1  50   ? -21.129 25.216  132.287 1.00 39.50  ? 50   GLY B CA    1 
ATOM   2191  C  C     . GLY B 1  50   ? -22.320 24.901  133.174 1.00 44.59  ? 50   GLY B C     1 
ATOM   2192  O  O     . GLY B 1  50   ? -22.155 24.476  134.318 1.00 44.94  ? 50   GLY B O     1 
ATOM   2193  N  N     . THR B 1  51   ? -23.523 25.129  132.654 1.00 42.05  ? 51   THR B N     1 
ATOM   2194  C  CA    . THR B 1  51   ? -24.749 24.845  133.395 1.00 41.52  ? 51   THR B CA    1 
ATOM   2195  C  C     . THR B 1  51   ? -25.689 23.952  132.589 1.00 43.03  ? 51   THR B C     1 
ATOM   2196  O  O     . THR B 1  51   ? -25.618 23.919  131.360 1.00 53.69  ? 51   THR B O     1 
ATOM   2197  C  CB    . THR B 1  51   ? -25.497 26.137  133.743 1.00 44.59  ? 51   THR B CB    1 
ATOM   2198  O  OG1   . THR B 1  51   ? -25.973 26.749  132.537 1.00 49.87  ? 51   THR B OG1   1 
ATOM   2199  C  CG2   . THR B 1  51   ? -24.580 27.105  134.476 1.00 50.31  ? 51   THR B CG2   1 
ATOM   2200  N  N     . ALA B 1  52   ? -26.575 23.241  133.281 1.00 37.30  ? 52   ALA B N     1 
ATOM   2201  C  CA    . ALA B 1  52   ? -27.519 22.341  132.621 1.00 33.50  ? 52   ALA B CA    1 
ATOM   2202  C  C     . ALA B 1  52   ? -28.764 22.070  133.465 1.00 36.44  ? 52   ALA B C     1 
ATOM   2203  O  O     . ALA B 1  52   ? -28.750 22.251  134.681 1.00 35.26  ? 52   ALA B O     1 
ATOM   2204  C  CB    . ALA B 1  52   ? -26.836 21.032  132.279 1.00 30.17  ? 52   ALA B CB    1 
ATOM   2205  N  N     . VAL B 1  53   ? -29.829 21.607  132.816 1.00 29.00  ? 53   VAL B N     1 
ATOM   2206  C  CA    . VAL B 1  53   ? -31.041 21.222  133.525 1.00 29.36  ? 53   VAL B CA    1 
ATOM   2207  C  C     . VAL B 1  53   ? -30.955 19.741  133.851 1.00 41.08  ? 53   VAL B C     1 
ATOM   2208  O  O     . VAL B 1  53   ? -31.029 18.891  132.960 1.00 41.54  ? 53   VAL B O     1 
ATOM   2209  C  CB    . VAL B 1  53   ? -32.294 21.458  132.661 1.00 29.98  ? 53   VAL B CB    1 
ATOM   2210  C  CG1   . VAL B 1  53   ? -33.515 20.801  133.292 1.00 27.80  ? 53   VAL B CG1   1 
ATOM   2211  C  CG2   . VAL B 1  53   ? -32.525 22.945  132.454 1.00 40.87  ? 53   VAL B CG2   1 
ATOM   2212  N  N     . THR B 1  54   ? -30.775 19.432  135.131 1.00 41.01  ? 54   THR B N     1 
ATOM   2213  C  CA    . THR B 1  54   ? -30.619 18.046  135.550 1.00 37.40  ? 54   THR B CA    1 
ATOM   2214  C  C     . THR B 1  54   ? -31.895 17.352  136.038 1.00 35.92  ? 54   THR B C     1 
ATOM   2215  O  O     . THR B 1  54   ? -31.924 16.128  136.159 1.00 39.66  ? 54   THR B O     1 
ATOM   2216  C  CB    . THR B 1  54   ? -29.542 17.938  136.637 1.00 39.69  ? 54   THR B CB    1 
ATOM   2217  O  OG1   . THR B 1  54   ? -29.835 18.870  137.682 1.00 42.34  ? 54   THR B OG1   1 
ATOM   2218  C  CG2   . THR B 1  54   ? -28.177 18.271  136.061 1.00 38.43  ? 54   THR B CG2   1 
ATOM   2219  N  N     . SER B 1  55   ? -32.949 18.116  136.308 1.00 39.67  ? 55   SER B N     1 
ATOM   2220  C  CA    . SER B 1  55   ? -34.196 17.514  136.790 1.00 43.85  ? 55   SER B CA    1 
ATOM   2221  C  C     . SER B 1  55   ? -35.435 18.362  136.501 1.00 35.69  ? 55   SER B C     1 
ATOM   2222  O  O     . SER B 1  55   ? -35.369 19.591  136.483 1.00 34.94  ? 55   SER B O     1 
ATOM   2223  C  CB    . SER B 1  55   ? -34.102 17.190  138.284 1.00 41.99  ? 55   SER B CB    1 
ATOM   2224  O  OG    . SER B 1  55   ? -34.953 16.108  138.620 1.00 42.79  ? 55   SER B OG    1 
ATOM   2225  N  N     . VAL B 1  56   ? -36.569 17.698  136.294 1.00 37.84  ? 56   VAL B N     1 
ATOM   2226  C  CA    . VAL B 1  56   ? -37.817 18.389  135.978 1.00 45.35  ? 56   VAL B CA    1 
ATOM   2227  C  C     . VAL B 1  56   ? -39.013 17.784  136.711 1.00 41.94  ? 56   VAL B C     1 
ATOM   2228  O  O     . VAL B 1  56   ? -39.185 16.565  136.730 1.00 39.75  ? 56   VAL B O     1 
ATOM   2229  C  CB    . VAL B 1  56   ? -38.090 18.374  134.455 1.00 41.39  ? 56   VAL B CB    1 
ATOM   2230  C  CG1   . VAL B 1  56   ? -39.525 18.778  134.152 1.00 33.03  ? 56   VAL B CG1   1 
ATOM   2231  C  CG2   . VAL B 1  56   ? -37.115 19.286  133.735 1.00 44.34  ? 56   VAL B CG2   1 
ATOM   2232  N  N     . TYR B 1  57   ? -39.829 18.641  137.321 1.00 42.27  ? 57   TYR B N     1 
ATOM   2233  C  CA    . TYR B 1  57   ? -41.094 18.211  137.913 1.00 48.49  ? 57   TYR B CA    1 
ATOM   2234  C  C     . TYR B 1  57   ? -42.262 18.992  137.323 1.00 48.45  ? 57   TYR B C     1 
ATOM   2235  O  O     . TYR B 1  57   ? -42.224 20.219  137.260 1.00 47.94  ? 57   TYR B O     1 
ATOM   2236  C  CB    . TYR B 1  57   ? -41.077 18.376  139.435 1.00 54.77  ? 57   TYR B CB    1 
ATOM   2237  C  CG    . TYR B 1  57   ? -42.446 18.254  140.078 1.00 55.62  ? 57   TYR B CG    1 
ATOM   2238  C  CD1   . TYR B 1  57   ? -43.037 17.010  140.273 1.00 53.32  ? 57   TYR B CD1   1 
ATOM   2239  C  CD2   . TYR B 1  57   ? -43.145 19.383  140.493 1.00 57.85  ? 57   TYR B CD2   1 
ATOM   2240  C  CE1   . TYR B 1  57   ? -44.288 16.894  140.860 1.00 55.20  ? 57   TYR B CE1   1 
ATOM   2241  C  CE2   . TYR B 1  57   ? -44.395 19.277  141.080 1.00 56.34  ? 57   TYR B CE2   1 
ATOM   2242  C  CZ    . TYR B 1  57   ? -44.962 18.032  141.262 1.00 62.23  ? 57   TYR B CZ    1 
ATOM   2243  O  OH    . TYR B 1  57   ? -46.205 17.926  141.846 1.00 65.10  ? 57   TYR B OH    1 
ATOM   2244  N  N     . ILE B 1  58   ? -43.296 18.274  136.894 1.00 49.04  ? 58   ILE B N     1 
ATOM   2245  C  CA    . ILE B 1  58   ? -44.503 18.895  136.359 1.00 55.08  ? 58   ILE B CA    1 
ATOM   2246  C  C     . ILE B 1  58   ? -45.728 18.376  137.104 1.00 60.27  ? 58   ILE B C     1 
ATOM   2247  O  O     . ILE B 1  58   ? -45.856 17.170  137.330 1.00 56.72  ? 58   ILE B O     1 
ATOM   2248  C  CB    . ILE B 1  58   ? -44.687 18.586  134.860 1.00 53.20  ? 58   ILE B CB    1 
ATOM   2249  C  CG1   . ILE B 1  58   ? -43.403 18.872  134.082 1.00 48.86  ? 58   ILE B CG1   1 
ATOM   2250  C  CG2   . ILE B 1  58   ? -45.844 19.388  134.287 1.00 60.10  ? 58   ILE B CG2   1 
ATOM   2251  C  CD1   . ILE B 1  58   ? -43.476 18.465  132.626 1.00 42.82  ? 58   ILE B CD1   1 
ATOM   2252  N  N     . GLU B 1  59   ? -46.625 19.286  137.481 1.00 59.80  ? 59   GLU B N     1 
ATOM   2253  C  CA    . GLU B 1  59   ? -47.855 18.913  138.176 1.00 63.00  ? 59   GLU B CA    1 
ATOM   2254  C  C     . GLU B 1  59   ? -48.676 17.908  137.375 1.00 55.00  ? 59   GLU B C     1 
ATOM   2255  O  O     . GLU B 1  59   ? -48.809 18.034  136.158 1.00 59.58  ? 59   GLU B O     1 
ATOM   2256  C  CB    . GLU B 1  59   ? -48.713 20.145  138.483 1.00 67.67  ? 59   GLU B CB    1 
ATOM   2257  C  CG    . GLU B 1  59   ? -48.300 20.921  139.725 1.00 71.02  ? 59   GLU B CG    1 
ATOM   2258  C  CD    . GLU B 1  59   ? -49.442 21.743  140.303 1.00 68.38  ? 59   GLU B CD    1 
ATOM   2259  O  OE1   . GLU B 1  59   ? -49.196 22.883  140.749 1.00 71.09  ? 59   GLU B OE1   1 
ATOM   2260  O  OE2   . GLU B 1  59   ? -50.587 21.243  140.319 1.00 66.75  ? 59   GLU B OE2   1 
ATOM   2261  N  N     . ASP B 1  60   ? -49.212 16.911  138.075 1.00 61.41  ? 60   ASP B N     1 
ATOM   2262  C  CA    . ASP B 1  60   ? -50.077 15.888  137.484 1.00 69.78  ? 60   ASP B CA    1 
ATOM   2263  C  C     . ASP B 1  60   ? -49.389 15.058  136.395 1.00 68.47  ? 60   ASP B C     1 
ATOM   2264  O  O     . ASP B 1  60   ? -50.051 14.501  135.518 1.00 68.66  ? 60   ASP B O     1 
ATOM   2265  C  CB    . ASP B 1  60   ? -51.371 16.513  136.947 1.00 66.50  ? 60   ASP B CB    1 
ATOM   2266  C  CG    . ASP B 1  60   ? -52.084 17.363  137.984 1.00 59.97  ? 60   ASP B CG    1 
ATOM   2267  O  OD1   . ASP B 1  60   ? -52.116 16.961  139.166 1.00 58.90  ? 60   ASP B OD1   1 
ATOM   2268  O  OD2   . ASP B 1  60   ? -52.609 18.437  137.617 1.00 56.92  ? 60   ASP B OD2   1 
ATOM   2269  N  N     . VAL B 1  61   ? -48.063 14.971  136.460 1.00 65.86  ? 61   VAL B N     1 
ATOM   2270  C  CA    . VAL B 1  61   ? -47.301 14.176  135.501 1.00 58.28  ? 61   VAL B CA    1 
ATOM   2271  C  C     . VAL B 1  61   ? -46.474 13.104  136.206 1.00 57.39  ? 61   VAL B C     1 
ATOM   2272  O  O     . VAL B 1  61   ? -45.620 13.413  137.040 1.00 48.62  ? 61   VAL B O     1 
ATOM   2273  C  CB    . VAL B 1  61   ? -46.369 15.056  134.646 1.00 61.92  ? 61   VAL B CB    1 
ATOM   2274  C  CG1   . VAL B 1  61   ? -45.493 14.188  133.755 1.00 60.95  ? 61   VAL B CG1   1 
ATOM   2275  C  CG2   . VAL B 1  61   ? -47.181 16.036  133.813 1.00 55.51  ? 61   VAL B CG2   1 
ATOM   2276  N  N     . LEU B 1  62   ? -46.733 11.845  135.868 1.00 63.39  ? 62   LEU B N     1 
ATOM   2277  C  CA    . LEU B 1  62   ? -46.039 10.725  136.498 1.00 68.97  ? 62   LEU B CA    1 
ATOM   2278  C  C     . LEU B 1  62   ? -44.678 10.459  135.860 1.00 67.90  ? 62   LEU B C     1 
ATOM   2279  O  O     . LEU B 1  62   ? -43.639 10.690  136.482 1.00 57.56  ? 62   LEU B O     1 
ATOM   2280  C  CB    . LEU B 1  62   ? -46.900 9.457   136.466 1.00 67.81  ? 62   LEU B CB    1 
ATOM   2281  C  CG    . LEU B 1  62   ? -48.163 9.460   137.333 1.00 77.87  ? 62   LEU B CG    1 
ATOM   2282  C  CD1   . LEU B 1  62   ? -48.837 8.093   137.325 1.00 74.85  ? 62   LEU B CD1   1 
ATOM   2283  C  CD2   . LEU B 1  62   ? -47.844 9.897   138.757 1.00 63.21  ? 62   LEU B CD2   1 
ATOM   2284  N  N     . HIS B 1  63   ? -44.683 9.971   134.622 1.00 65.37  ? 63   HIS B N     1 
ATOM   2285  C  CA    . HIS B 1  63   ? -43.431 9.664   133.937 1.00 64.30  ? 63   HIS B CA    1 
ATOM   2286  C  C     . HIS B 1  63   ? -43.158 10.527  132.706 1.00 55.36  ? 63   HIS B C     1 
ATOM   2287  O  O     . HIS B 1  63   ? -43.963 11.377  132.327 1.00 54.37  ? 63   HIS B O     1 
ATOM   2288  C  CB    . HIS B 1  63   ? -43.338 8.174   133.592 1.00 69.82  ? 63   HIS B CB    1 
ATOM   2289  C  CG    . HIS B 1  63   ? -44.600 7.596   133.032 1.00 72.02  ? 63   HIS B CG    1 
ATOM   2290  N  ND1   . HIS B 1  63   ? -44.915 7.652   131.691 1.00 72.79  ? 63   HIS B ND1   1 
ATOM   2291  C  CD2   . HIS B 1  63   ? -45.622 6.939   133.631 1.00 77.36  ? 63   HIS B CD2   1 
ATOM   2292  C  CE1   . HIS B 1  63   ? -46.077 7.058   131.489 1.00 77.91  ? 63   HIS B CE1   1 
ATOM   2293  N  NE2   . HIS B 1  63   ? -46.528 6.618   132.650 1.00 81.66  ? 63   HIS B NE2   1 
ATOM   2294  N  N     . GLU B 1  64   ? -42.007 10.286  132.090 1.00 55.69  ? 64   GLU B N     1 
ATOM   2295  C  CA    . GLU B 1  64   ? -41.498 11.114  131.005 1.00 51.98  ? 64   GLU B CA    1 
ATOM   2296  C  C     . GLU B 1  64   ? -42.325 10.972  129.734 1.00 51.03  ? 64   GLU B C     1 
ATOM   2297  O  O     . GLU B 1  64   ? -42.452 11.912  128.950 1.00 46.38  ? 64   GLU B O     1 
ATOM   2298  C  CB    . GLU B 1  64   ? -40.040 10.738  130.725 1.00 49.98  ? 64   GLU B CB    1 
ATOM   2299  C  CG    . GLU B 1  64   ? -39.339 11.604  129.697 1.00 50.96  ? 64   GLU B CG    1 
ATOM   2300  C  CD    . GLU B 1  64   ? -37.893 11.197  129.488 1.00 52.45  ? 64   GLU B CD    1 
ATOM   2301  O  OE1   . GLU B 1  64   ? -37.163 11.929  128.785 1.00 46.45  ? 64   GLU B OE1   1 
ATOM   2302  O  OE2   . GLU B 1  64   ? -37.488 10.144  130.027 1.00 53.77  ? 64   GLU B OE2   1 
ATOM   2303  N  N     . PHE B 1  65   ? -42.889 9.789   129.536 1.00 57.05  ? 65   PHE B N     1 
ATOM   2304  C  CA    . PHE B 1  65   ? -43.581 9.475   128.294 1.00 57.34  ? 65   PHE B CA    1 
ATOM   2305  C  C     . PHE B 1  65   ? -45.080 9.743   128.364 1.00 61.79  ? 65   PHE B C     1 
ATOM   2306  O  O     . PHE B 1  65   ? -45.819 9.428   127.431 1.00 68.30  ? 65   PHE B O     1 
ATOM   2307  C  CB    . PHE B 1  65   ? -43.283 8.036   127.876 1.00 58.58  ? 65   PHE B CB    1 
ATOM   2308  C  CG    . PHE B 1  65   ? -41.816 7.729   127.821 1.00 56.55  ? 65   PHE B CG    1 
ATOM   2309  C  CD1   . PHE B 1  65   ? -41.037 8.204   126.781 1.00 52.02  ? 65   PHE B CD1   1 
ATOM   2310  C  CD2   . PHE B 1  65   ? -41.211 6.987   128.821 1.00 65.78  ? 65   PHE B CD2   1 
ATOM   2311  C  CE1   . PHE B 1  65   ? -39.684 7.935   126.731 1.00 50.26  ? 65   PHE B CE1   1 
ATOM   2312  C  CE2   . PHE B 1  65   ? -39.857 6.715   128.776 1.00 63.93  ? 65   PHE B CE2   1 
ATOM   2313  C  CZ    . PHE B 1  65   ? -39.094 7.189   127.729 1.00 54.54  ? 65   PHE B CZ    1 
ATOM   2314  N  N     . SER B 1  66   ? -45.526 10.321  129.475 1.00 67.54  ? 66   SER B N     1 
ATOM   2315  C  CA    . SER B 1  66   ? -46.923 10.709  129.615 1.00 69.55  ? 66   SER B CA    1 
ATOM   2316  C  C     . SER B 1  66   ? -47.190 11.937  128.758 1.00 67.31  ? 66   SER B C     1 
ATOM   2317  O  O     . SER B 1  66   ? -46.275 12.481  128.138 1.00 60.81  ? 66   SER B O     1 
ATOM   2318  C  CB    . SER B 1  66   ? -47.248 11.030  131.076 1.00 67.52  ? 66   SER B CB    1 
ATOM   2319  O  OG    . SER B 1  66   ? -46.996 9.921   131.920 1.00 79.15  ? 66   SER B OG    1 
ATOM   2320  N  N     . THR B 1  67   ? -48.441 12.381  128.728 1.00 74.68  ? 67   THR B N     1 
ATOM   2321  C  CA    . THR B 1  67   ? -48.773 13.604  128.014 1.00 67.83  ? 67   THR B CA    1 
ATOM   2322  C  C     . THR B 1  67   ? -49.362 14.635  128.963 1.00 60.18  ? 67   THR B C     1 
ATOM   2323  O  O     . THR B 1  67   ? -49.610 14.350  130.134 1.00 60.68  ? 67   THR B O     1 
ATOM   2324  C  CB    . THR B 1  67   ? -49.779 13.338  126.882 1.00 62.81  ? 67   THR B CB    1 
ATOM   2325  O  OG1   . THR B 1  67   ? -50.148 14.580  126.270 1.00 68.40  ? 67   THR B OG1   1 
ATOM   2326  C  CG2   . THR B 1  67   ? -51.025 12.657  127.429 1.00 57.02  ? 67   THR B CG2   1 
ATOM   2327  N  N     . ILE B 1  68   ? -49.586 15.836  128.448 1.00 54.87  ? 68   ILE B N     1 
ATOM   2328  C  CA    . ILE B 1  68   ? -50.187 16.903  129.233 1.00 55.74  ? 68   ILE B CA    1 
ATOM   2329  C  C     . ILE B 1  68   ? -51.497 17.378  128.616 1.00 71.47  ? 68   ILE B C     1 
ATOM   2330  O  O     . ILE B 1  68   ? -51.496 17.968  127.535 1.00 72.53  ? 68   ILE B O     1 
ATOM   2331  C  CB    . ILE B 1  68   ? -49.226 18.089  129.394 1.00 54.71  ? 68   ILE B CB    1 
ATOM   2332  C  CG1   . ILE B 1  68   ? -47.922 17.619  130.042 1.00 53.85  ? 68   ILE B CG1   1 
ATOM   2333  C  CG2   . ILE B 1  68   ? -49.874 19.185  130.220 1.00 65.04  ? 68   ILE B CG2   1 
ATOM   2334  C  CD1   . ILE B 1  68   ? -46.919 18.722  130.270 1.00 60.58  ? 68   ILE B CD1   1 
ATOM   2335  N  N     . PRO B 1  69   ? -52.622 17.109  129.294 1.00 74.67  ? 69   PRO B N     1 
ATOM   2336  C  CA    . PRO B 1  69   ? -53.914 17.619  128.825 1.00 70.84  ? 69   PRO B CA    1 
ATOM   2337  C  C     . PRO B 1  69   ? -53.917 19.146  128.810 1.00 71.10  ? 69   PRO B C     1 
ATOM   2338  O  O     . PRO B 1  69   ? -53.555 19.770  129.809 1.00 67.17  ? 69   PRO B O     1 
ATOM   2339  C  CB    . PRO B 1  69   ? -54.895 17.101  129.880 1.00 75.29  ? 69   PRO B CB    1 
ATOM   2340  C  CG    . PRO B 1  69   ? -54.219 15.912  130.481 1.00 70.77  ? 69   PRO B CG    1 
ATOM   2341  C  CD    . PRO B 1  69   ? -52.762 16.250  130.481 1.00 70.35  ? 69   PRO B CD    1 
ATOM   2342  N  N     . GLY B 1  70   ? -54.319 19.734  127.688 1.00 67.67  ? 70   GLY B N     1 
ATOM   2343  C  CA    . GLY B 1  70   ? -54.340 21.179  127.553 1.00 71.16  ? 70   GLY B CA    1 
ATOM   2344  C  C     . GLY B 1  70   ? -53.087 21.730  126.901 1.00 75.00  ? 70   GLY B C     1 
ATOM   2345  O  O     . GLY B 1  70   ? -52.999 22.925  126.613 1.00 71.52  ? 70   GLY B O     1 
ATOM   2346  N  N     . VAL B 1  71   ? -52.109 20.856  126.677 1.00 74.95  ? 71   VAL B N     1 
ATOM   2347  C  CA    . VAL B 1  71   ? -50.869 21.231  126.004 1.00 72.96  ? 71   VAL B CA    1 
ATOM   2348  C  C     . VAL B 1  71   ? -50.589 20.253  124.863 1.00 71.61  ? 71   VAL B C     1 
ATOM   2349  O  O     . VAL B 1  71   ? -50.772 19.044  125.019 1.00 71.53  ? 71   VAL B O     1 
ATOM   2350  C  CB    . VAL B 1  71   ? -49.671 21.251  126.982 1.00 68.43  ? 71   VAL B CB    1 
ATOM   2351  C  CG1   . VAL B 1  71   ? -48.398 21.674  126.264 1.00 58.98  ? 71   VAL B CG1   1 
ATOM   2352  C  CG2   . VAL B 1  71   ? -49.950 22.183  128.153 1.00 72.43  ? 71   VAL B CG2   1 
ATOM   2353  N  N     . LYS B 1  72   ? -50.157 20.773  123.717 1.00 67.73  ? 72   LYS B N     1 
ATOM   2354  C  CA    . LYS B 1  72   ? -49.928 19.930  122.546 1.00 56.39  ? 72   LYS B CA    1 
ATOM   2355  C  C     . LYS B 1  72   ? -48.623 19.139  122.627 1.00 53.53  ? 72   LYS B C     1 
ATOM   2356  O  O     . LYS B 1  72   ? -48.592 17.954  122.291 1.00 55.30  ? 72   LYS B O     1 
ATOM   2357  C  CB    . LYS B 1  72   ? -49.988 20.750  121.252 1.00 63.89  ? 72   LYS B CB    1 
ATOM   2358  C  CG    . LYS B 1  72   ? -49.020 21.919  121.188 1.00 61.12  ? 72   LYS B CG    1 
ATOM   2359  C  CD    . LYS B 1  72   ? -49.140 22.650  119.861 1.00 54.61  ? 72   LYS B CD    1 
ATOM   2360  C  CE    . LYS B 1  72   ? -50.562 23.138  119.636 1.00 62.50  ? 72   LYS B CE    1 
ATOM   2361  N  NZ    . LYS B 1  72   ? -50.712 23.827  118.328 1.00 78.94  ? 72   LYS B NZ    1 
ATOM   2362  N  N     . GLU B 1  73   ? -47.554 19.790  123.077 1.00 50.34  ? 73   GLU B N     1 
ATOM   2363  C  CA    . GLU B 1  73   ? -46.271 19.116  123.240 1.00 44.37  ? 73   GLU B CA    1 
ATOM   2364  C  C     . GLU B 1  73   ? -46.367 18.072  124.343 1.00 43.92  ? 73   GLU B C     1 
ATOM   2365  O  O     . GLU B 1  73   ? -47.056 18.281  125.341 1.00 51.67  ? 73   GLU B O     1 
ATOM   2366  C  CB    . GLU B 1  73   ? -45.171 20.121  123.586 1.00 38.75  ? 73   GLU B CB    1 
ATOM   2367  C  CG    . GLU B 1  73   ? -44.944 21.193  122.539 1.00 46.05  ? 73   GLU B CG    1 
ATOM   2368  C  CD    . GLU B 1  73   ? -45.449 22.549  122.979 1.00 42.14  ? 73   GLU B CD    1 
ATOM   2369  O  OE1   . GLU B 1  73   ? -46.300 22.595  123.890 1.00 52.47  ? 73   GLU B OE1   1 
ATOM   2370  O  OE2   . GLU B 1  73   ? -44.990 23.569  122.420 1.00 38.36  ? 73   GLU B OE2   1 
ATOM   2371  N  N     . ASP B 1  74   ? -45.686 16.945  124.164 1.00 39.77  ? 74   ASP B N     1 
ATOM   2372  C  CA    . ASP B 1  74   ? -45.625 15.945  125.223 1.00 42.27  ? 74   ASP B CA    1 
ATOM   2373  C  C     . ASP B 1  74   ? -44.503 16.282  126.203 1.00 41.41  ? 74   ASP B C     1 
ATOM   2374  O  O     . ASP B 1  74   ? -43.753 17.237  125.997 1.00 36.57  ? 74   ASP B O     1 
ATOM   2375  C  CB    . ASP B 1  74   ? -45.459 14.530  124.650 1.00 41.13  ? 74   ASP B CB    1 
ATOM   2376  C  CG    . ASP B 1  74   ? -44.333 14.429  123.629 1.00 43.12  ? 74   ASP B CG    1 
ATOM   2377  O  OD1   . ASP B 1  74   ? -43.323 15.153  123.760 1.00 46.34  ? 74   ASP B OD1   1 
ATOM   2378  O  OD2   . ASP B 1  74   ? -44.457 13.613  122.692 1.00 36.97  ? 74   ASP B OD2   1 
ATOM   2379  N  N     . VAL B 1  75   ? -44.383 15.489  127.261 1.00 40.30  ? 75   VAL B N     1 
ATOM   2380  C  CA    . VAL B 1  75   ? -43.390 15.759  128.289 1.00 42.79  ? 75   VAL B CA    1 
ATOM   2381  C  C     . VAL B 1  75   ? -41.987 15.611  127.709 1.00 41.42  ? 75   VAL B C     1 
ATOM   2382  O  O     . VAL B 1  75   ? -41.065 16.329  128.097 1.00 41.01  ? 75   VAL B O     1 
ATOM   2383  C  CB    . VAL B 1  75   ? -43.573 14.834  129.507 1.00 48.34  ? 75   VAL B CB    1 
ATOM   2384  C  CG1   . VAL B 1  75   ? -42.671 15.271  130.648 1.00 39.90  ? 75   VAL B CG1   1 
ATOM   2385  C  CG2   . VAL B 1  75   ? -45.026 14.833  129.954 1.00 50.99  ? 75   VAL B CG2   1 
ATOM   2386  N  N     . VAL B 1  76   ? -41.844 14.687  126.763 1.00 40.09  ? 76   VAL B N     1 
ATOM   2387  C  CA    . VAL B 1  76   ? -40.578 14.474  126.072 1.00 35.80  ? 76   VAL B CA    1 
ATOM   2388  C  C     . VAL B 1  76   ? -40.102 15.751  125.392 1.00 36.77  ? 76   VAL B C     1 
ATOM   2389  O  O     . VAL B 1  76   ? -38.960 16.175  125.577 1.00 32.11  ? 76   VAL B O     1 
ATOM   2390  C  CB    . VAL B 1  76   ? -40.705 13.377  124.999 1.00 38.40  ? 76   VAL B CB    1 
ATOM   2391  C  CG1   . VAL B 1  76   ? -39.383 13.192  124.271 1.00 40.88  ? 76   VAL B CG1   1 
ATOM   2392  C  CG2   . VAL B 1  76   ? -41.166 12.071  125.623 1.00 44.72  ? 76   VAL B CG2   1 
ATOM   2393  N  N     . GLU B 1  77   ? -40.992 16.362  124.614 1.00 39.11  ? 77   GLU B N     1 
ATOM   2394  C  CA    . GLU B 1  77   ? -40.659 17.545  123.824 1.00 39.21  ? 77   GLU B CA    1 
ATOM   2395  C  C     . GLU B 1  77   ? -40.304 18.747  124.697 1.00 36.29  ? 77   GLU B C     1 
ATOM   2396  O  O     . GLU B 1  77   ? -39.466 19.570  124.324 1.00 30.33  ? 77   GLU B O     1 
ATOM   2397  C  CB    . GLU B 1  77   ? -41.814 17.900  122.879 1.00 37.78  ? 77   GLU B CB    1 
ATOM   2398  C  CG    . GLU B 1  77   ? -41.454 18.913  121.800 1.00 38.06  ? 77   GLU B CG    1 
ATOM   2399  C  CD    . GLU B 1  77   ? -40.403 18.394  120.832 1.00 44.07  ? 77   GLU B CD    1 
ATOM   2400  O  OE1   . GLU B 1  77   ? -39.590 19.210  120.347 1.00 45.16  ? 77   GLU B OE1   1 
ATOM   2401  O  OE2   . GLU B 1  77   ? -40.390 17.176  120.550 1.00 38.74  ? 77   GLU B OE2   1 
ATOM   2402  N  N     . ILE B 1  78   ? -40.942 18.845  125.859 1.00 37.27  ? 78   ILE B N     1 
ATOM   2403  C  CA    . ILE B 1  78   ? -40.667 19.941  126.781 1.00 38.70  ? 78   ILE B CA    1 
ATOM   2404  C  C     . ILE B 1  78   ? -39.273 19.793  127.383 1.00 36.14  ? 78   ILE B C     1 
ATOM   2405  O  O     . ILE B 1  78   ? -38.527 20.767  127.495 1.00 27.98  ? 78   ILE B O     1 
ATOM   2406  C  CB    . ILE B 1  78   ? -41.719 20.016  127.902 1.00 40.58  ? 78   ILE B CB    1 
ATOM   2407  C  CG1   . ILE B 1  78   ? -43.121 20.133  127.301 1.00 40.37  ? 78   ILE B CG1   1 
ATOM   2408  C  CG2   . ILE B 1  78   ? -41.434 21.192  128.827 1.00 38.02  ? 78   ILE B CG2   1 
ATOM   2409  C  CD1   . ILE B 1  78   ? -44.220 20.257  128.327 1.00 36.48  ? 78   ILE B CD1   1 
ATOM   2410  N  N     . ILE B 1  79   ? -38.929 18.565  127.758 1.00 36.10  ? 79   ILE B N     1 
ATOM   2411  C  CA    . ILE B 1  79   ? -37.609 18.259  128.301 1.00 38.32  ? 79   ILE B CA    1 
ATOM   2412  C  C     . ILE B 1  79   ? -36.506 18.577  127.286 1.00 41.42  ? 79   ILE B C     1 
ATOM   2413  O  O     . ILE B 1  79   ? -35.435 19.071  127.650 1.00 40.31  ? 79   ILE B O     1 
ATOM   2414  C  CB    . ILE B 1  79   ? -37.522 16.783  128.745 1.00 33.12  ? 79   ILE B CB    1 
ATOM   2415  C  CG1   . ILE B 1  79   ? -38.439 16.540  129.944 1.00 28.31  ? 79   ILE B CG1   1 
ATOM   2416  C  CG2   . ILE B 1  79   ? -36.098 16.404  129.102 1.00 32.41  ? 79   ILE B CG2   1 
ATOM   2417  C  CD1   . ILE B 1  79   ? -38.540 15.091  130.341 1.00 30.47  ? 79   ILE B CD1   1 
ATOM   2418  N  N     . LEU B 1  80   ? -36.783 18.307  126.013 1.00 36.44  ? 80   LEU B N     1 
ATOM   2419  C  CA    . LEU B 1  80   ? -35.853 18.638  124.940 1.00 28.38  ? 80   LEU B CA    1 
ATOM   2420  C  C     . LEU B 1  80   ? -35.564 20.134  124.913 1.00 29.85  ? 80   LEU B C     1 
ATOM   2421  O  O     . LEU B 1  80   ? -34.406 20.549  124.879 1.00 29.53  ? 80   LEU B O     1 
ATOM   2422  C  CB    . LEU B 1  80   ? -36.410 18.190  123.589 1.00 28.14  ? 80   LEU B CB    1 
ATOM   2423  C  CG    . LEU B 1  80   ? -36.562 16.684  123.398 1.00 23.86  ? 80   LEU B CG    1 
ATOM   2424  C  CD1   . LEU B 1  80   ? -37.082 16.378  122.007 1.00 31.20  ? 80   LEU B CD1   1 
ATOM   2425  C  CD2   . LEU B 1  80   ? -35.238 15.991  123.647 1.00 24.04  ? 80   LEU B CD2   1 
ATOM   2426  N  N     . ASN B 1  81   ? -36.624 20.938  124.931 1.00 31.00  ? 81   ASN B N     1 
ATOM   2427  C  CA    . ASN B 1  81   ? -36.488 22.390  124.951 1.00 25.95  ? 81   ASN B CA    1 
ATOM   2428  C  C     . ASN B 1  81   ? -35.737 22.850  126.188 1.00 31.17  ? 81   ASN B C     1 
ATOM   2429  O  O     . ASN B 1  81   ? -34.985 23.826  126.148 1.00 30.65  ? 81   ASN B O     1 
ATOM   2430  C  CB    . ASN B 1  81   ? -37.861 23.059  124.896 1.00 23.90  ? 81   ASN B CB    1 
ATOM   2431  C  CG    . ASN B 1  81   ? -38.515 22.933  123.536 1.00 31.11  ? 81   ASN B CG    1 
ATOM   2432  O  OD1   . ASN B 1  81   ? -37.906 23.240  122.512 1.00 31.73  ? 81   ASN B OD1   1 
ATOM   2433  N  ND2   . ASN B 1  81   ? -39.760 22.472  123.519 1.00 34.02  ? 81   ASN B ND2   1 
ATOM   2434  N  N     . LEU B 1  82   ? -35.941 22.132  127.286 1.00 30.98  ? 82   LEU B N     1 
ATOM   2435  C  CA    . LEU B 1  82   ? -35.272 22.444  128.540 1.00 30.60  ? 82   LEU B CA    1 
ATOM   2436  C  C     . LEU B 1  82   ? -33.778 22.154  128.460 1.00 32.08  ? 82   LEU B C     1 
ATOM   2437  O  O     . LEU B 1  82   ? -32.993 22.706  129.230 1.00 36.95  ? 82   LEU B O     1 
ATOM   2438  C  CB    . LEU B 1  82   ? -35.918 21.678  129.695 1.00 36.52  ? 82   LEU B CB    1 
ATOM   2439  C  CG    . LEU B 1  82   ? -37.317 22.174  130.069 1.00 39.30  ? 82   LEU B CG    1 
ATOM   2440  C  CD1   . LEU B 1  82   ? -38.080 21.131  130.866 1.00 35.19  ? 82   LEU B CD1   1 
ATOM   2441  C  CD2   . LEU B 1  82   ? -37.228 23.480  130.841 1.00 37.24  ? 82   LEU B CD2   1 
ATOM   2442  N  N     . LYS B 1  83   ? -33.387 21.295  127.523 1.00 28.37  ? 83   LYS B N     1 
ATOM   2443  C  CA    . LYS B 1  83   ? -31.975 21.016  127.292 1.00 23.33  ? 83   LYS B CA    1 
ATOM   2444  C  C     . LYS B 1  83   ? -31.320 22.149  126.507 1.00 28.59  ? 83   LYS B C     1 
ATOM   2445  O  O     . LYS B 1  83   ? -30.125 22.411  126.655 1.00 29.05  ? 83   LYS B O     1 
ATOM   2446  C  CB    . LYS B 1  83   ? -31.793 19.702  126.538 1.00 24.47  ? 83   LYS B CB    1 
ATOM   2447  C  CG    . LYS B 1  83   ? -32.127 18.449  127.325 1.00 20.86  ? 83   LYS B CG    1 
ATOM   2448  C  CD    . LYS B 1  83   ? -31.815 17.223  126.483 1.00 23.79  ? 83   LYS B CD    1 
ATOM   2449  C  CE    . LYS B 1  83   ? -32.198 15.933  127.174 1.00 27.54  ? 83   LYS B CE    1 
ATOM   2450  N  NZ    . LYS B 1  83   ? -31.905 14.756  126.306 1.00 23.60  ? 83   LYS B NZ    1 
ATOM   2451  N  N     . GLU B 1  84   ? -32.109 22.819  125.672 1.00 31.37  ? 84   GLU B N     1 
ATOM   2452  C  CA    . GLU B 1  84   ? -31.597 23.913  124.854 1.00 30.20  ? 84   GLU B CA    1 
ATOM   2453  C  C     . GLU B 1  84   ? -31.576 25.236  125.618 1.00 31.93  ? 84   GLU B C     1 
ATOM   2454  O  O     . GLU B 1  84   ? -31.118 26.255  125.104 1.00 36.07  ? 84   GLU B O     1 
ATOM   2455  C  CB    . GLU B 1  84   ? -32.415 24.054  123.569 1.00 29.54  ? 84   GLU B CB    1 
ATOM   2456  C  CG    . GLU B 1  84   ? -32.372 22.832  122.666 1.00 32.82  ? 84   GLU B CG    1 
ATOM   2457  C  CD    . GLU B 1  84   ? -33.052 23.074  121.332 1.00 35.95  ? 84   GLU B CD    1 
ATOM   2458  O  OE1   . GLU B 1  84   ? -33.347 24.248  121.023 1.00 36.07  ? 84   GLU B OE1   1 
ATOM   2459  O  OE2   . GLU B 1  84   ? -33.290 22.094  120.593 1.00 31.04  ? 84   GLU B OE2   1 
ATOM   2460  N  N     . LEU B 1  85   ? -32.071 25.211  126.850 1.00 33.99  ? 85   LEU B N     1 
ATOM   2461  C  CA    . LEU B 1  85   ? -32.057 26.391  127.705 1.00 38.31  ? 85   LEU B CA    1 
ATOM   2462  C  C     . LEU B 1  85   ? -30.632 26.720  128.138 1.00 36.12  ? 85   LEU B C     1 
ATOM   2463  O  O     . LEU B 1  85   ? -29.940 25.880  128.713 1.00 41.46  ? 85   LEU B O     1 
ATOM   2464  C  CB    . LEU B 1  85   ? -32.942 26.158  128.931 1.00 39.40  ? 85   LEU B CB    1 
ATOM   2465  C  CG    . LEU B 1  85   ? -32.991 27.256  129.994 1.00 41.74  ? 85   LEU B CG    1 
ATOM   2466  C  CD1   . LEU B 1  85   ? -33.653 28.508  129.447 1.00 46.80  ? 85   LEU B CD1   1 
ATOM   2467  C  CD2   . LEU B 1  85   ? -33.712 26.763  131.239 1.00 43.83  ? 85   LEU B CD2   1 
ATOM   2468  N  N     . VAL B 1  86   ? -30.194 27.944  127.863 1.00 38.07  ? 86   VAL B N     1 
ATOM   2469  C  CA    . VAL B 1  86   ? -28.846 28.366  128.228 1.00 41.28  ? 86   VAL B CA    1 
ATOM   2470  C  C     . VAL B 1  86   ? -28.879 29.296  129.433 1.00 43.29  ? 86   VAL B C     1 
ATOM   2471  O  O     . VAL B 1  86   ? -29.305 30.446  129.334 1.00 46.00  ? 86   VAL B O     1 
ATOM   2472  C  CB    . VAL B 1  86   ? -28.137 29.071  127.057 1.00 36.59  ? 86   VAL B CB    1 
ATOM   2473  C  CG1   . VAL B 1  86   ? -26.724 29.461  127.449 1.00 32.24  ? 86   VAL B CG1   1 
ATOM   2474  C  CG2   . VAL B 1  86   ? -28.122 28.172  125.835 1.00 42.52  ? 86   VAL B CG2   1 
ATOM   2475  N  N     . VAL B 1  87   ? -28.411 28.791  130.569 1.00 48.64  ? 87   VAL B N     1 
ATOM   2476  C  CA    . VAL B 1  87   ? -28.441 29.539  131.818 1.00 45.97  ? 87   VAL B CA    1 
ATOM   2477  C  C     . VAL B 1  87   ? -27.027 29.898  132.258 1.00 46.96  ? 87   VAL B C     1 
ATOM   2478  O  O     . VAL B 1  87   ? -26.140 29.047  132.294 1.00 47.35  ? 87   VAL B O     1 
ATOM   2479  C  CB    . VAL B 1  87   ? -29.147 28.734  132.932 1.00 40.93  ? 87   VAL B CB    1 
ATOM   2480  C  CG1   . VAL B 1  87   ? -29.004 29.429  134.272 1.00 50.24  ? 87   VAL B CG1   1 
ATOM   2481  C  CG2   . VAL B 1  87   ? -30.618 28.523  132.589 1.00 39.42  ? 87   VAL B CG2   1 
ATOM   2482  N  N     . ARG B 1  88   ? -26.823 31.167  132.590 1.00 54.16  ? 88   ARG B N     1 
ATOM   2483  C  CA    . ARG B 1  88   ? -25.513 31.655  132.991 1.00 55.55  ? 88   ARG B CA    1 
ATOM   2484  C  C     . ARG B 1  88   ? -25.539 32.112  134.446 1.00 62.83  ? 88   ARG B C     1 
ATOM   2485  O  O     . ARG B 1  88   ? -26.375 32.931  134.829 1.00 64.26  ? 88   ARG B O     1 
ATOM   2486  C  CB    . ARG B 1  88   ? -25.103 32.810  132.080 1.00 45.52  ? 88   ARG B CB    1 
ATOM   2487  C  CG    . ARG B 1  88   ? -23.682 33.288  132.260 1.00 50.50  ? 88   ARG B CG    1 
ATOM   2488  C  CD    . ARG B 1  88   ? -23.419 34.497  131.382 1.00 53.05  ? 88   ARG B CD    1 
ATOM   2489  N  NE    . ARG B 1  88   ? -22.020 34.906  131.421 1.00 53.96  ? 88   ARG B NE    1 
ATOM   2490  C  CZ    . ARG B 1  88   ? -21.548 35.992  130.821 1.00 59.57  ? 88   ARG B CZ    1 
ATOM   2491  N  NH1   . ARG B 1  88   ? -22.371 36.777  130.138 1.00 55.86  ? 88   ARG B NH1   1 
ATOM   2492  N  NH2   . ARG B 1  88   ? -20.259 36.296  130.903 1.00 67.01  ? 88   ARG B NH2   1 
ATOM   2493  N  N     . PHE B 1  89   ? -24.632 31.577  135.257 1.00 64.99  ? 89   PHE B N     1 
ATOM   2494  C  CA    . PHE B 1  89   ? -24.559 31.961  136.665 1.00 63.00  ? 89   PHE B CA    1 
ATOM   2495  C  C     . PHE B 1  89   ? -23.667 33.186  136.829 1.00 67.37  ? 89   PHE B C     1 
ATOM   2496  O  O     . PHE B 1  89   ? -22.529 33.196  136.365 1.00 62.10  ? 89   PHE B O     1 
ATOM   2497  C  CB    . PHE B 1  89   ? -24.043 30.805  137.530 1.00 51.87  ? 89   PHE B CB    1 
ATOM   2498  C  CG    . PHE B 1  89   ? -25.009 29.661  137.659 1.00 52.53  ? 89   PHE B CG    1 
ATOM   2499  C  CD1   . PHE B 1  89   ? -26.280 29.739  137.110 1.00 53.74  ? 89   PHE B CD1   1 
ATOM   2500  C  CD2   . PHE B 1  89   ? -24.647 28.507  138.335 1.00 53.21  ? 89   PHE B CD2   1 
ATOM   2501  C  CE1   . PHE B 1  89   ? -27.170 28.685  137.227 1.00 49.10  ? 89   PHE B CE1   1 
ATOM   2502  C  CE2   . PHE B 1  89   ? -25.534 27.451  138.457 1.00 51.08  ? 89   PHE B CE2   1 
ATOM   2503  C  CZ    . PHE B 1  89   ? -26.796 27.540  137.903 1.00 45.02  ? 89   PHE B CZ    1 
ATOM   2504  N  N     . LEU B 1  90   ? -24.186 34.221  137.482 1.00 67.82  ? 90   LEU B N     1 
ATOM   2505  C  CA    . LEU B 1  90   ? -23.438 35.469  137.619 1.00 67.26  ? 90   LEU B CA    1 
ATOM   2506  C  C     . LEU B 1  90   ? -22.371 35.402  138.708 1.00 68.87  ? 90   LEU B C     1 
ATOM   2507  O  O     . LEU B 1  90   ? -21.416 36.180  138.703 1.00 68.84  ? 90   LEU B O     1 
ATOM   2508  C  CB    . LEU B 1  90   ? -24.374 36.659  137.850 1.00 69.11  ? 90   LEU B CB    1 
ATOM   2509  C  CG    . LEU B 1  90   ? -25.068 37.261  136.624 1.00 65.19  ? 90   LEU B CG    1 
ATOM   2510  C  CD1   . LEU B 1  90   ? -24.078 37.546  135.492 1.00 50.51  ? 90   LEU B CD1   1 
ATOM   2511  C  CD2   . LEU B 1  90   ? -26.189 36.358  136.139 1.00 64.61  ? 90   LEU B CD2   1 
ATOM   2512  N  N     . ASN B 1  91   ? -22.529 34.459  139.629 1.00 64.15  ? 91   ASN B N     1 
ATOM   2513  C  CA    . ASN B 1  91   ? -21.622 34.339  140.760 1.00 63.47  ? 91   ASN B CA    1 
ATOM   2514  C  C     . ASN B 1  91   ? -21.017 32.934  140.829 1.00 70.16  ? 91   ASN B C     1 
ATOM   2515  O  O     . ASN B 1  91   ? -21.702 31.949  140.557 1.00 63.71  ? 91   ASN B O     1 
ATOM   2516  C  CB    . ASN B 1  91   ? -22.372 34.730  142.043 1.00 65.67  ? 91   ASN B CB    1 
ATOM   2517  C  CG    . ASN B 1  91   ? -22.074 33.818  143.212 1.00 70.67  ? 91   ASN B CG    1 
ATOM   2518  O  OD1   . ASN B 1  91   ? -21.016 33.907  143.832 1.00 75.52  ? 91   ASN B OD1   1 
ATOM   2519  N  ND2   . ASN B 1  91   ? -23.026 32.957  143.543 1.00 70.70  ? 91   ASN B ND2   1 
ATOM   2520  N  N     . PRO B 1  92   ? -19.716 32.847  141.155 1.00 76.12  ? 92   PRO B N     1 
ATOM   2521  C  CA    . PRO B 1  92   ? -18.949 31.592  141.189 1.00 68.75  ? 92   PRO B CA    1 
ATOM   2522  C  C     . PRO B 1  92   ? -19.323 30.672  142.339 1.00 68.15  ? 92   PRO B C     1 
ATOM   2523  O  O     . PRO B 1  92   ? -19.114 29.458  142.266 1.00 68.89  ? 92   PRO B O     1 
ATOM   2524  C  CB    . PRO B 1  92   ? -17.502 32.068  141.349 1.00 70.55  ? 92   PRO B CB    1 
ATOM   2525  C  CG    . PRO B 1  92   ? -17.597 33.449  141.898 1.00 69.42  ? 92   PRO B CG    1 
ATOM   2526  C  CD    . PRO B 1  92   ? -18.851 34.028  141.317 1.00 72.44  ? 92   PRO B CD    1 
ATOM   2527  N  N     . SER B 1  93   ? -19.852 31.260  143.402 1.00 70.65  ? 93   SER B N     1 
ATOM   2528  C  CA    . SER B 1  93   ? -20.224 30.506  144.587 1.00 78.39  ? 93   SER B CA    1 
ATOM   2529  C  C     . SER B 1  93   ? -21.409 29.589  144.311 1.00 78.58  ? 93   SER B C     1 
ATOM   2530  O  O     . SER B 1  93   ? -21.458 28.459  144.797 1.00 72.52  ? 93   SER B O     1 
ATOM   2531  C  CB    . SER B 1  93   ? -20.574 31.471  145.720 1.00 78.04  ? 93   SER B CB    1 
ATOM   2532  O  OG    . SER B 1  93   ? -19.521 32.402  145.929 1.00 84.81  ? 93   SER B OG    1 
ATOM   2533  N  N     . LEU B 1  94   ? -22.357 30.090  143.522 1.00 73.29  ? 94   LEU B N     1 
ATOM   2534  C  CA    . LEU B 1  94   ? -23.597 29.376  143.232 1.00 60.51  ? 94   LEU B CA    1 
ATOM   2535  C  C     . LEU B 1  94   ? -23.361 28.068  142.487 1.00 54.29  ? 94   LEU B C     1 
ATOM   2536  O  O     . LEU B 1  94   ? -22.712 28.040  141.443 1.00 63.53  ? 94   LEU B O     1 
ATOM   2537  C  CB    . LEU B 1  94   ? -24.541 30.272  142.429 1.00 61.24  ? 94   LEU B CB    1 
ATOM   2538  C  CG    . LEU B 1  94   ? -25.802 29.658  141.821 1.00 64.73  ? 94   LEU B CG    1 
ATOM   2539  C  CD1   . LEU B 1  94   ? -26.631 28.915  142.861 1.00 63.93  ? 94   LEU B CD1   1 
ATOM   2540  C  CD2   . LEU B 1  94   ? -26.627 30.745  141.149 1.00 65.39  ? 94   LEU B CD2   1 
ATOM   2541  N  N     . GLN B 1  95   ? -23.908 26.988  143.033 1.00 51.34  ? 95   GLN B N     1 
ATOM   2542  C  CA    . GLN B 1  95   ? -23.810 25.672  142.419 1.00 50.19  ? 95   GLN B CA    1 
ATOM   2543  C  C     . GLN B 1  95   ? -25.110 25.298  141.710 1.00 50.80  ? 95   GLN B C     1 
ATOM   2544  O  O     . GLN B 1  95   ? -25.133 25.121  140.494 1.00 52.95  ? 95   GLN B O     1 
ATOM   2545  C  CB    . GLN B 1  95   ? -23.447 24.611  143.464 1.00 55.06  ? 95   GLN B CB    1 
ATOM   2546  C  CG    . GLN B 1  95   ? -21.956 24.282  143.556 1.00 60.37  ? 95   GLN B CG    1 
ATOM   2547  C  CD    . GLN B 1  95   ? -21.121 25.413  144.139 1.00 67.09  ? 95   GLN B CD    1 
ATOM   2548  O  OE1   . GLN B 1  95   ? -19.993 25.652  143.706 1.00 72.41  ? 95   GLN B OE1   1 
ATOM   2549  N  NE2   . GLN B 1  95   ? -21.666 26.105  145.134 1.00 60.28  ? 95   GLN B NE2   1 
ATOM   2550  N  N     . THR B 1  96   ? -26.191 25.176  142.476 1.00 58.81  ? 96   THR B N     1 
ATOM   2551  C  CA    . THR B 1  96   ? -27.472 24.734  141.927 1.00 49.24  ? 96   THR B CA    1 
ATOM   2552  C  C     . THR B 1  96   ? -28.629 25.704  142.187 1.00 46.28  ? 96   THR B C     1 
ATOM   2553  O  O     . THR B 1  96   ? -28.672 26.377  143.216 1.00 51.27  ? 96   THR B O     1 
ATOM   2554  C  CB    . THR B 1  96   ? -27.853 23.338  142.459 1.00 46.47  ? 96   THR B CB    1 
ATOM   2555  O  OG1   . THR B 1  96   ? -29.200 23.028  142.081 1.00 43.77  ? 96   THR B OG1   1 
ATOM   2556  C  CG2   . THR B 1  96   ? -27.737 23.291  143.974 1.00 51.58  ? 96   THR B CG2   1 
ATOM   2557  N  N     . VAL B 1  97   ? -29.561 25.767  141.236 1.00 47.36  ? 97   VAL B N     1 
ATOM   2558  C  CA    . VAL B 1  97   ? -30.756 26.603  141.343 1.00 44.48  ? 97   VAL B CA    1 
ATOM   2559  C  C     . VAL B 1  97   ? -31.996 25.790  140.970 1.00 48.89  ? 97   VAL B C     1 
ATOM   2560  O  O     . VAL B 1  97   ? -31.893 24.768  140.292 1.00 49.31  ? 97   VAL B O     1 
ATOM   2561  C  CB    . VAL B 1  97   ? -30.690 27.820  140.391 1.00 41.19  ? 97   VAL B CB    1 
ATOM   2562  C  CG1   . VAL B 1  97   ? -31.647 28.912  140.845 1.00 49.92  ? 97   VAL B CG1   1 
ATOM   2563  C  CG2   . VAL B 1  97   ? -29.281 28.369  140.311 1.00 55.52  ? 97   VAL B CG2   1 
ATOM   2564  N  N     . THR B 1  98   ? -33.165 26.239  141.420 1.00 55.30  ? 98   THR B N     1 
ATOM   2565  C  CA    . THR B 1  98   ? -34.434 25.665  140.977 1.00 53.04  ? 98   THR B CA    1 
ATOM   2566  C  C     . THR B 1  98   ? -35.340 26.759  140.420 1.00 48.76  ? 98   THR B C     1 
ATOM   2567  O  O     . THR B 1  98   ? -35.742 27.669  141.142 1.00 51.60  ? 98   THR B O     1 
ATOM   2568  C  CB    . THR B 1  98   ? -35.163 24.914  142.109 1.00 48.72  ? 98   THR B CB    1 
ATOM   2569  O  OG1   . THR B 1  98   ? -34.371 23.799  142.535 1.00 51.41  ? 98   THR B OG1   1 
ATOM   2570  C  CG2   . THR B 1  98   ? -36.514 24.404  141.625 1.00 48.50  ? 98   THR B CG2   1 
ATOM   2571  N  N     . LEU B 1  99   ? -35.651 26.667  139.131 1.00 54.64  ? 99   LEU B N     1 
ATOM   2572  C  CA    . LEU B 1  99   ? -36.455 27.683  138.458 1.00 55.06  ? 99   LEU B CA    1 
ATOM   2573  C  C     . LEU B 1  99   ? -37.911 27.251  138.328 1.00 55.47  ? 99   LEU B C     1 
ATOM   2574  O  O     . LEU B 1  99   ? -38.206 26.166  137.827 1.00 52.03  ? 99   LEU B O     1 
ATOM   2575  C  CB    . LEU B 1  99   ? -35.871 28.015  137.081 1.00 50.29  ? 99   LEU B CB    1 
ATOM   2576  C  CG    . LEU B 1  99   ? -34.687 28.988  137.039 1.00 54.01  ? 99   LEU B CG    1 
ATOM   2577  C  CD1   . LEU B 1  99   ? -33.425 28.377  137.636 1.00 48.49  ? 99   LEU B CD1   1 
ATOM   2578  C  CD2   . LEU B 1  99   ? -34.433 29.464  135.616 1.00 61.27  ? 99   LEU B CD2   1 
ATOM   2579  N  N     . LEU B 1  100  ? -38.818 28.109  138.782 1.00 59.83  ? 100  LEU B N     1 
ATOM   2580  C  CA    . LEU B 1  100  ? -40.240 27.788  138.779 1.00 59.91  ? 100  LEU B CA    1 
ATOM   2581  C  C     . LEU B 1  100  ? -40.975 28.484  137.639 1.00 53.33  ? 100  LEU B C     1 
ATOM   2582  O  O     . LEU B 1  100  ? -40.712 29.647  137.331 1.00 52.93  ? 100  LEU B O     1 
ATOM   2583  C  CB    . LEU B 1  100  ? -40.887 28.152  140.122 1.00 68.23  ? 100  LEU B CB    1 
ATOM   2584  C  CG    . LEU B 1  100  ? -40.574 27.284  141.347 1.00 68.40  ? 100  LEU B CG    1 
ATOM   2585  C  CD1   . LEU B 1  100  ? -39.234 27.651  141.975 1.00 60.93  ? 100  LEU B CD1   1 
ATOM   2586  C  CD2   . LEU B 1  100  ? -41.697 27.369  142.377 1.00 73.27  ? 100  LEU B CD2   1 
ATOM   2587  N  N     . LEU B 1  101  ? -41.893 27.758  137.010 1.00 48.57  ? 101  LEU B N     1 
ATOM   2588  C  CA    . LEU B 1  101  ? -42.721 28.327  135.956 1.00 56.52  ? 101  LEU B CA    1 
ATOM   2589  C  C     . LEU B 1  101  ? -44.180 27.914  136.118 1.00 63.89  ? 101  LEU B C     1 
ATOM   2590  O  O     . LEU B 1  101  ? -44.507 26.727  136.111 1.00 61.40  ? 101  LEU B O     1 
ATOM   2591  C  CB    . LEU B 1  101  ? -42.203 27.918  134.576 1.00 58.76  ? 101  LEU B CB    1 
ATOM   2592  C  CG    . LEU B 1  101  ? -42.902 28.574  133.384 1.00 60.09  ? 101  LEU B CG    1 
ATOM   2593  C  CD1   . LEU B 1  101  ? -41.875 29.119  132.403 1.00 57.06  ? 101  LEU B CD1   1 
ATOM   2594  C  CD2   . LEU B 1  101  ? -43.840 27.592  132.697 1.00 51.97  ? 101  LEU B CD2   1 
ATOM   2595  N  N     . LYS B 1  102  ? -45.049 28.908  136.269 1.00 67.86  ? 102  LYS B N     1 
ATOM   2596  C  CA    . LYS B 1  102  ? -46.480 28.673  136.401 1.00 61.77  ? 102  LYS B CA    1 
ATOM   2597  C  C     . LYS B 1  102  ? -47.223 29.581  135.434 1.00 61.39  ? 102  LYS B C     1 
ATOM   2598  O  O     . LYS B 1  102  ? -47.122 30.805  135.522 1.00 64.90  ? 102  LYS B O     1 
ATOM   2599  C  CB    . LYS B 1  102  ? -46.940 28.950  137.835 1.00 65.15  ? 102  LYS B CB    1 
ATOM   2600  C  CG    . LYS B 1  102  ? -46.161 28.189  138.900 1.00 78.18  ? 102  LYS B CG    1 
ATOM   2601  C  CD    . LYS B 1  102  ? -46.542 28.634  140.306 1.00 86.19  ? 102  LYS B CD    1 
ATOM   2602  C  CE    . LYS B 1  102  ? -45.705 27.917  141.358 1.00 87.21  ? 102  LYS B CE    1 
ATOM   2603  N  NZ    . LYS B 1  102  ? -46.027 28.369  142.741 1.00 84.40  ? 102  LYS B NZ    1 
ATOM   2604  N  N     . ALA B 1  103  ? -47.960 28.981  134.506 1.00 58.42  ? 103  ALA B N     1 
ATOM   2605  C  CA    . ALA B 1  103  ? -48.726 29.746  133.529 1.00 57.98  ? 103  ALA B CA    1 
ATOM   2606  C  C     . ALA B 1  103  ? -49.935 28.958  133.044 1.00 61.28  ? 103  ALA B C     1 
ATOM   2607  O  O     . ALA B 1  103  ? -49.966 27.731  133.143 1.00 63.50  ? 103  ALA B O     1 
ATOM   2608  C  CB    . ALA B 1  103  ? -47.844 30.145  132.357 1.00 59.34  ? 103  ALA B CB    1 
ATOM   2609  N  N     . GLU B 1  104  ? -50.931 29.668  132.523 1.00 63.83  ? 104  GLU B N     1 
ATOM   2610  C  CA    . GLU B 1  104  ? -52.136 29.029  132.005 1.00 72.09  ? 104  GLU B CA    1 
ATOM   2611  C  C     . GLU B 1  104  ? -52.831 29.893  130.958 1.00 76.19  ? 104  GLU B C     1 
ATOM   2612  O  O     . GLU B 1  104  ? -52.295 30.915  130.524 1.00 68.13  ? 104  GLU B O     1 
ATOM   2613  C  CB    . GLU B 1  104  ? -53.103 28.687  133.142 1.00 76.92  ? 104  GLU B CB    1 
ATOM   2614  C  CG    . GLU B 1  104  ? -53.588 29.888  133.936 1.00 74.15  ? 104  GLU B CG    1 
ATOM   2615  C  CD    . GLU B 1  104  ? -54.637 29.516  134.965 1.00 75.56  ? 104  GLU B CD    1 
ATOM   2616  O  OE1   . GLU B 1  104  ? -55.094 30.414  135.703 1.00 75.82  ? 104  GLU B OE1   1 
ATOM   2617  O  OE2   . GLU B 1  104  ? -55.005 28.324  135.034 1.00 70.44  ? 104  GLU B OE2   1 
ATOM   2618  N  N     . GLY B 1  105  ? -54.026 29.472  130.550 1.00 78.83  ? 105  GLY B N     1 
ATOM   2619  C  CA    . GLY B 1  105  ? -54.768 30.157  129.507 1.00 76.14  ? 105  GLY B CA    1 
ATOM   2620  C  C     . GLY B 1  105  ? -54.076 29.962  128.175 1.00 75.83  ? 105  GLY B C     1 
ATOM   2621  O  O     . GLY B 1  105  ? -53.033 29.309  128.115 1.00 79.40  ? 105  GLY B O     1 
ATOM   2622  N  N     . PRO B 1  106  ? -54.656 30.496  127.090 1.00 76.70  ? 106  PRO B N     1 
ATOM   2623  C  CA    . PRO B 1  106  ? -53.900 30.413  125.837 1.00 74.74  ? 106  PRO B CA    1 
ATOM   2624  C  C     . PRO B 1  106  ? -52.616 31.227  125.947 1.00 71.55  ? 106  PRO B C     1 
ATOM   2625  O  O     . PRO B 1  106  ? -52.666 32.421  126.245 1.00 67.19  ? 106  PRO B O     1 
ATOM   2626  C  CB    . PRO B 1  106  ? -54.847 31.046  124.814 1.00 80.18  ? 106  PRO B CB    1 
ATOM   2627  C  CG    . PRO B 1  106  ? -55.760 31.919  125.622 1.00 92.84  ? 106  PRO B CG    1 
ATOM   2628  C  CD    . PRO B 1  106  ? -55.930 31.219  126.937 1.00 82.12  ? 106  PRO B CD    1 
ATOM   2629  N  N     . LYS B 1  107  ? -51.480 30.585  125.700 1.00 70.80  ? 107  LYS B N     1 
ATOM   2630  C  CA    . LYS B 1  107  ? -50.194 31.263  125.766 1.00 64.83  ? 107  LYS B CA    1 
ATOM   2631  C  C     . LYS B 1  107  ? -49.131 30.453  125.034 1.00 63.09  ? 107  LYS B C     1 
ATOM   2632  O  O     . LYS B 1  107  ? -49.277 29.242  124.859 1.00 55.23  ? 107  LYS B O     1 
ATOM   2633  C  CB    . LYS B 1  107  ? -49.788 31.460  127.229 1.00 65.32  ? 107  LYS B CB    1 
ATOM   2634  C  CG    . LYS B 1  107  ? -48.669 32.465  127.458 1.00 64.11  ? 107  LYS B CG    1 
ATOM   2635  C  CD    . LYS B 1  107  ? -48.340 32.573  128.939 1.00 65.93  ? 107  LYS B CD    1 
ATOM   2636  C  CE    . LYS B 1  107  ? -47.239 33.588  129.193 1.00 64.87  ? 107  LYS B CE    1 
ATOM   2637  N  NZ    . LYS B 1  107  ? -46.945 33.717  130.648 1.00 74.41  ? 107  LYS B NZ    1 
ATOM   2638  N  N     . GLU B 1  108  ? -48.059 31.118  124.619 1.00 65.26  ? 108  GLU B N     1 
ATOM   2639  C  CA    . GLU B 1  108  ? -46.863 30.419  124.176 1.00 57.45  ? 108  GLU B CA    1 
ATOM   2640  C  C     . GLU B 1  108  ? -45.746 30.738  125.159 1.00 57.84  ? 108  GLU B C     1 
ATOM   2641  O  O     . GLU B 1  108  ? -45.223 31.853  125.181 1.00 54.22  ? 108  GLU B O     1 
ATOM   2642  C  CB    . GLU B 1  108  ? -46.471 30.837  122.759 1.00 52.67  ? 108  GLU B CB    1 
ATOM   2643  C  CG    . GLU B 1  108  ? -47.566 30.624  121.730 1.00 61.68  ? 108  GLU B CG    1 
ATOM   2644  C  CD    . GLU B 1  108  ? -47.018 30.297  120.356 1.00 71.66  ? 108  GLU B CD    1 
ATOM   2645  O  OE1   . GLU B 1  108  ? -45.801 30.030  120.248 1.00 67.84  ? 108  GLU B OE1   1 
ATOM   2646  O  OE2   . GLU B 1  108  ? -47.804 30.301  119.385 1.00 69.72  ? 108  GLU B OE2   1 
ATOM   2647  N  N     . VAL B 1  109  ? -45.379 29.749  125.966 1.00 51.69  ? 109  VAL B N     1 
ATOM   2648  C  CA    . VAL B 1  109  ? -44.416 29.962  127.038 1.00 52.69  ? 109  VAL B CA    1 
ATOM   2649  C  C     . VAL B 1  109  ? -42.988 29.995  126.511 1.00 52.64  ? 109  VAL B C     1 
ATOM   2650  O  O     . VAL B 1  109  ? -42.564 29.107  125.772 1.00 52.07  ? 109  VAL B O     1 
ATOM   2651  C  CB    . VAL B 1  109  ? -44.549 28.885  128.136 1.00 56.60  ? 109  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B 1  109  ? -43.375 28.951  129.100 1.00 52.58  ? 109  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B 1  109  ? -45.862 29.051  128.880 1.00 50.49  ? 109  VAL B CG2   1 
ATOM   2654  N  N     . LYS B 1  110  ? -42.253 31.031  126.896 1.00 49.48  ? 110  LYS B N     1 
ATOM   2655  C  CA    . LYS B 1  110  ? -40.860 31.165  126.504 1.00 51.61  ? 110  LYS B CA    1 
ATOM   2656  C  C     . LYS B 1  110  ? -39.963 31.021  127.729 1.00 49.09  ? 110  LYS B C     1 
ATOM   2657  O  O     . LYS B 1  110  ? -40.454 30.847  128.843 1.00 51.11  ? 110  LYS B O     1 
ATOM   2658  C  CB    . LYS B 1  110  ? -40.634 32.515  125.820 1.00 60.17  ? 110  LYS B CB    1 
ATOM   2659  C  CG    . LYS B 1  110  ? -41.374 32.661  124.493 1.00 61.79  ? 110  LYS B CG    1 
ATOM   2660  C  CD    . LYS B 1  110  ? -40.708 31.833  123.401 1.00 62.34  ? 110  LYS B CD    1 
ATOM   2661  C  CE    . LYS B 1  110  ? -41.522 31.810  122.115 1.00 51.98  ? 110  LYS B CE    1 
ATOM   2662  N  NZ    . LYS B 1  110  ? -42.708 30.918  122.222 1.00 52.70  ? 110  LYS B NZ    1 
ATOM   2663  N  N     . ALA B 1  111  ? -38.653 31.092  127.526 1.00 48.84  ? 111  ALA B N     1 
ATOM   2664  C  CA    . ALA B 1  111  ? -37.707 30.917  128.622 1.00 55.08  ? 111  ALA B CA    1 
ATOM   2665  C  C     . ALA B 1  111  ? -37.693 32.133  129.536 1.00 58.30  ? 111  ALA B C     1 
ATOM   2666  O  O     . ALA B 1  111  ? -37.297 32.051  130.699 1.00 54.94  ? 111  ALA B O     1 
ATOM   2667  C  CB    . ALA B 1  111  ? -36.319 30.641  128.083 1.00 53.47  ? 111  ALA B CB    1 
ATOM   2668  N  N     . ARG B 1  112  ? -38.136 33.260  128.994 1.00 59.16  ? 112  ARG B N     1 
ATOM   2669  C  CA    . ARG B 1  112  ? -38.180 34.515  129.727 1.00 65.70  ? 112  ARG B CA    1 
ATOM   2670  C  C     . ARG B 1  112  ? -39.243 34.468  130.826 1.00 63.14  ? 112  ARG B C     1 
ATOM   2671  O  O     . ARG B 1  112  ? -39.145 35.172  131.832 1.00 59.35  ? 112  ARG B O     1 
ATOM   2672  C  CB    . ARG B 1  112  ? -38.466 35.649  128.744 1.00 64.45  ? 112  ARG B CB    1 
ATOM   2673  C  CG    . ARG B 1  112  ? -38.495 37.048  129.326 1.00 67.65  ? 112  ARG B CG    1 
ATOM   2674  C  CD    . ARG B 1  112  ? -38.890 38.051  128.248 1.00 69.00  ? 112  ARG B CD    1 
ATOM   2675  N  NE    . ARG B 1  112  ? -40.066 37.604  127.500 1.00 81.99  ? 112  ARG B NE    1 
ATOM   2676  C  CZ    . ARG B 1  112  ? -40.029 37.096  126.271 1.00 70.42  ? 112  ARG B CZ    1 
ATOM   2677  N  NH1   . ARG B 1  112  ? -38.871 36.970  125.637 1.00 59.64  ? 112  ARG B NH1   1 
ATOM   2678  N  NH2   . ARG B 1  112  ? -41.151 36.711  125.677 1.00 69.04  ? 112  ARG B NH2   1 
ATOM   2679  N  N     . ASP B 1  113  ? -40.245 33.615  130.631 1.00 64.62  ? 113  ASP B N     1 
ATOM   2680  C  CA    . ASP B 1  113  ? -41.364 33.492  131.563 1.00 58.05  ? 113  ASP B CA    1 
ATOM   2681  C  C     . ASP B 1  113  ? -40.958 32.919  132.917 1.00 57.58  ? 113  ASP B C     1 
ATOM   2682  O  O     . ASP B 1  113  ? -41.685 33.068  133.898 1.00 66.88  ? 113  ASP B O     1 
ATOM   2683  C  CB    . ASP B 1  113  ? -42.471 32.632  130.952 1.00 52.68  ? 113  ASP B CB    1 
ATOM   2684  C  CG    . ASP B 1  113  ? -43.003 33.207  129.656 1.00 64.39  ? 113  ASP B CG    1 
ATOM   2685  O  OD1   . ASP B 1  113  ? -44.098 32.791  129.225 1.00 69.18  ? 113  ASP B OD1   1 
ATOM   2686  O  OD2   . ASP B 1  113  ? -42.326 34.079  129.069 1.00 65.76  ? 113  ASP B OD2   1 
ATOM   2687  N  N     . PHE B 1  114  ? -39.806 32.258  132.966 1.00 56.46  ? 114  PHE B N     1 
ATOM   2688  C  CA    . PHE B 1  114  ? -39.287 31.722  134.221 1.00 63.18  ? 114  PHE B CA    1 
ATOM   2689  C  C     . PHE B 1  114  ? -39.030 32.839  135.228 1.00 64.37  ? 114  PHE B C     1 
ATOM   2690  O  O     . PHE B 1  114  ? -38.433 33.863  134.890 1.00 59.18  ? 114  PHE B O     1 
ATOM   2691  C  CB    . PHE B 1  114  ? -38.000 30.925  133.985 1.00 61.64  ? 114  PHE B CB    1 
ATOM   2692  C  CG    . PHE B 1  114  ? -38.232 29.527  133.481 1.00 56.68  ? 114  PHE B CG    1 
ATOM   2693  C  CD1   . PHE B 1  114  ? -38.550 28.506  134.359 1.00 54.20  ? 114  PHE B CD1   1 
ATOM   2694  C  CD2   . PHE B 1  114  ? -38.124 29.234  132.132 1.00 59.92  ? 114  PHE B CD2   1 
ATOM   2695  C  CE1   . PHE B 1  114  ? -38.762 27.219  133.900 1.00 57.05  ? 114  PHE B CE1   1 
ATOM   2696  C  CE2   . PHE B 1  114  ? -38.334 27.948  131.668 1.00 50.60  ? 114  PHE B CE2   1 
ATOM   2697  C  CZ    . PHE B 1  114  ? -38.654 26.941  132.553 1.00 50.55  ? 114  PHE B CZ    1 
ATOM   2698  N  N     . LEU B 1  115  ? -39.490 32.636  136.460 1.00 59.93  ? 115  LEU B N     1 
ATOM   2699  C  CA    . LEU B 1  115  ? -39.305 33.621  137.521 1.00 63.17  ? 115  LEU B CA    1 
ATOM   2700  C  C     . LEU B 1  115  ? -37.825 33.851  137.801 1.00 61.37  ? 115  LEU B C     1 
ATOM   2701  O  O     . LEU B 1  115  ? -37.097 32.908  138.111 1.00 56.77  ? 115  LEU B O     1 
ATOM   2702  C  CB    . LEU B 1  115  ? -40.026 33.187  138.799 1.00 60.13  ? 115  LEU B CB    1 
ATOM   2703  C  CG    . LEU B 1  115  ? -41.555 33.174  138.748 1.00 56.14  ? 115  LEU B CG    1 
ATOM   2704  C  CD1   . LEU B 1  115  ? -42.123 32.711  140.077 1.00 60.35  ? 115  LEU B CD1   1 
ATOM   2705  C  CD2   . LEU B 1  115  ? -42.097 34.546  138.381 1.00 40.76  ? 115  LEU B CD2   1 
ATOM   2706  N  N     . PRO B 1  116  ? -37.380 35.113  137.684 1.00 65.48  ? 116  PRO B N     1 
ATOM   2707  C  CA    . PRO B 1  116  ? -35.976 35.508  137.847 1.00 62.86  ? 116  PRO B CA    1 
ATOM   2708  C  C     . PRO B 1  116  ? -35.400 35.101  139.200 1.00 60.00  ? 116  PRO B C     1 
ATOM   2709  O  O     . PRO B 1  116  ? -36.110 35.109  140.205 1.00 70.08  ? 116  PRO B O     1 
ATOM   2710  C  CB    . PRO B 1  116  ? -36.029 37.035  137.739 1.00 53.66  ? 116  PRO B CB    1 
ATOM   2711  C  CG    . PRO B 1  116  ? -37.244 37.312  136.928 1.00 60.20  ? 116  PRO B CG    1 
ATOM   2712  C  CD    . PRO B 1  116  ? -38.236 36.263  137.342 1.00 64.57  ? 116  PRO B CD    1 
ATOM   2713  N  N     . VAL B 1  117  ? -34.122 34.738  139.209 1.00 47.79  ? 117  VAL B N     1 
ATOM   2714  C  CA    . VAL B 1  117  ? -33.424 34.399  140.441 1.00 49.53  ? 117  VAL B CA    1 
ATOM   2715  C  C     . VAL B 1  117  ? -32.168 35.264  140.547 1.00 58.81  ? 117  VAL B C     1 
ATOM   2716  O  O     . VAL B 1  117  ? -31.605 35.681  139.533 1.00 54.61  ? 117  VAL B O     1 
ATOM   2717  C  CB    . VAL B 1  117  ? -33.066 32.895  140.486 1.00 47.69  ? 117  VAL B CB    1 
ATOM   2718  C  CG1   . VAL B 1  117  ? -32.429 32.519  141.817 1.00 42.50  ? 117  VAL B CG1   1 
ATOM   2719  C  CG2   . VAL B 1  117  ? -34.308 32.053  140.247 1.00 50.36  ? 117  VAL B CG2   1 
ATOM   2720  N  N     . ALA B 1  118  ? -31.751 35.556  141.776 1.00 64.22  ? 118  ALA B N     1 
ATOM   2721  C  CA    . ALA B 1  118  ? -30.571 36.376  142.019 1.00 67.98  ? 118  ALA B CA    1 
ATOM   2722  C  C     . ALA B 1  118  ? -29.326 35.752  141.402 1.00 67.84  ? 118  ALA B C     1 
ATOM   2723  O  O     . ALA B 1  118  ? -29.022 34.584  141.651 1.00 71.02  ? 118  ALA B O     1 
ATOM   2724  C  CB    . ALA B 1  118  ? -30.375 36.585  143.515 1.00 66.84  ? 118  ALA B CB    1 
ATOM   2725  N  N     . ASP B 1  119  ? -28.617 36.541  140.598 1.00 63.63  ? 119  ASP B N     1 
ATOM   2726  C  CA    . ASP B 1  119  ? -27.385 36.105  139.937 1.00 76.94  ? 119  ASP B CA    1 
ATOM   2727  C  C     . ASP B 1  119  ? -27.595 34.913  138.996 1.00 77.55  ? 119  ASP B C     1 
ATOM   2728  O  O     . ASP B 1  119  ? -26.729 34.044  138.875 1.00 72.64  ? 119  ASP B O     1 
ATOM   2729  C  CB    . ASP B 1  119  ? -26.280 35.800  140.961 1.00 81.38  ? 119  ASP B CB    1 
ATOM   2730  C  CG    . ASP B 1  119  ? -25.787 37.045  141.682 1.00 77.43  ? 119  ASP B CG    1 
ATOM   2731  O  OD1   . ASP B 1  119  ? -25.879 38.148  141.100 1.00 77.31  ? 119  ASP B OD1   1 
ATOM   2732  O  OD2   . ASP B 1  119  ? -25.302 36.919  142.828 1.00 65.50  ? 119  ASP B OD2   1 
ATOM   2733  N  N     . VAL B 1  120  ? -28.751 34.874  138.340 1.00 73.41  ? 120  VAL B N     1 
ATOM   2734  C  CA    . VAL B 1  120  ? -29.019 33.873  137.311 1.00 60.08  ? 120  VAL B CA    1 
ATOM   2735  C  C     . VAL B 1  120  ? -29.530 34.538  136.035 1.00 61.81  ? 120  VAL B C     1 
ATOM   2736  O  O     . VAL B 1  120  ? -30.609 35.130  136.023 1.00 61.04  ? 120  VAL B O     1 
ATOM   2737  C  CB    . VAL B 1  120  ? -30.036 32.816  137.787 1.00 55.69  ? 120  VAL B CB    1 
ATOM   2738  C  CG1   . VAL B 1  120  ? -30.489 31.950  136.622 1.00 51.65  ? 120  VAL B CG1   1 
ATOM   2739  C  CG2   . VAL B 1  120  ? -29.436 31.956  138.892 1.00 58.31  ? 120  VAL B CG2   1 
ATOM   2740  N  N     . GLU B 1  121  ? -28.749 34.435  134.963 1.00 64.01  ? 121  GLU B N     1 
ATOM   2741  C  CA    . GLU B 1  121  ? -29.107 35.048  133.687 1.00 59.87  ? 121  GLU B CA    1 
ATOM   2742  C  C     . GLU B 1  121  ? -29.552 34.005  132.673 1.00 62.84  ? 121  GLU B C     1 
ATOM   2743  O  O     . GLU B 1  121  ? -28.937 32.945  132.544 1.00 59.69  ? 121  GLU B O     1 
ATOM   2744  C  CB    . GLU B 1  121  ? -27.930 35.845  133.119 1.00 57.75  ? 121  GLU B CB    1 
ATOM   2745  C  CG    . GLU B 1  121  ? -28.188 36.454  131.749 1.00 59.91  ? 121  GLU B CG    1 
ATOM   2746  C  CD    . GLU B 1  121  ? -27.022 37.287  131.250 1.00 66.21  ? 121  GLU B CD    1 
ATOM   2747  O  OE1   . GLU B 1  121  ? -27.104 37.811  130.117 1.00 59.49  ? 121  GLU B OE1   1 
ATOM   2748  O  OE2   . GLU B 1  121  ? -26.025 37.418  131.992 1.00 66.26  ? 121  GLU B OE2   1 
ATOM   2749  N  N     . ILE B 1  122  ? -30.624 34.313  131.954 1.00 55.59  ? 122  ILE B N     1 
ATOM   2750  C  CA    . ILE B 1  122  ? -31.096 33.444  130.890 1.00 47.73  ? 122  ILE B CA    1 
ATOM   2751  C  C     . ILE B 1  122  ? -30.697 34.025  129.539 1.00 52.06  ? 122  ILE B C     1 
ATOM   2752  O  O     . ILE B 1  122  ? -31.212 35.062  129.121 1.00 50.32  ? 122  ILE B O     1 
ATOM   2753  C  CB    . ILE B 1  122  ? -32.613 33.243  130.966 1.00 48.62  ? 122  ILE B CB    1 
ATOM   2754  C  CG1   . ILE B 1  122  ? -32.984 32.616  132.312 1.00 48.19  ? 122  ILE B CG1   1 
ATOM   2755  C  CG2   . ILE B 1  122  ? -33.092 32.375  129.815 1.00 56.47  ? 122  ILE B CG2   1 
ATOM   2756  C  CD1   . ILE B 1  122  ? -34.454 32.306  132.464 1.00 60.71  ? 122  ILE B CD1   1 
ATOM   2757  N  N     . MET B 1  123  ? -29.773 33.344  128.866 1.00 58.04  ? 123  MET B N     1 
ATOM   2758  C  CA    . MET B 1  123  ? -29.183 33.836  127.624 1.00 52.77  ? 123  MET B CA    1 
ATOM   2759  C  C     . MET B 1  123  ? -30.148 33.774  126.444 1.00 54.00  ? 123  MET B C     1 
ATOM   2760  O  O     . MET B 1  123  ? -30.078 34.600  125.534 1.00 54.14  ? 123  MET B O     1 
ATOM   2761  C  CB    . MET B 1  123  ? -27.915 33.048  127.297 1.00 49.45  ? 123  MET B CB    1 
ATOM   2762  C  CG    . MET B 1  123  ? -26.880 33.041  128.412 1.00 54.13  ? 123  MET B CG    1 
ATOM   2763  S  SD    . MET B 1  123  ? -26.061 34.632  128.635 1.00 60.18  ? 123  MET B SD    1 
ATOM   2764  C  CE    . MET B 1  123  ? -25.269 34.825  127.040 1.00 52.45  ? 123  MET B CE    1 
ATOM   2765  N  N     . ASN B 1  124  ? -31.046 32.794  126.460 1.00 52.07  ? 124  ASN B N     1 
ATOM   2766  C  CA    . ASN B 1  124  ? -32.013 32.628  125.379 1.00 52.54  ? 124  ASN B CA    1 
ATOM   2767  C  C     . ASN B 1  124  ? -33.462 32.729  125.850 1.00 54.59  ? 124  ASN B C     1 
ATOM   2768  O  O     . ASN B 1  124  ? -34.146 31.716  125.982 1.00 52.37  ? 124  ASN B O     1 
ATOM   2769  C  CB    . ASN B 1  124  ? -31.778 31.303  124.643 1.00 49.85  ? 124  ASN B CB    1 
ATOM   2770  C  CG    . ASN B 1  124  ? -31.630 30.124  125.591 1.00 48.02  ? 124  ASN B CG    1 
ATOM   2771  O  OD1   . ASN B 1  124  ? -31.184 30.279  126.727 1.00 51.84  ? 124  ASN B OD1   1 
ATOM   2772  N  ND2   . ASN B 1  124  ? -32.006 28.937  125.124 1.00 37.85  ? 124  ASN B ND2   1 
ATOM   2773  N  N     . PRO B 1  125  ? -33.937 33.961  126.095 1.00 61.12  ? 125  PRO B N     1 
ATOM   2774  C  CA    . PRO B 1  125  ? -35.296 34.197  126.598 1.00 60.91  ? 125  PRO B CA    1 
ATOM   2775  C  C     . PRO B 1  125  ? -36.375 33.875  125.567 1.00 64.83  ? 125  PRO B C     1 
ATOM   2776  O  O     . PRO B 1  125  ? -37.499 33.537  125.944 1.00 65.19  ? 125  PRO B O     1 
ATOM   2777  C  CB    . PRO B 1  125  ? -35.295 35.697  126.901 1.00 61.19  ? 125  PRO B CB    1 
ATOM   2778  C  CG    . PRO B 1  125  ? -34.296 36.262  125.955 1.00 60.64  ? 125  PRO B CG    1 
ATOM   2779  C  CD    . PRO B 1  125  ? -33.217 35.222  125.847 1.00 57.98  ? 125  PRO B CD    1 
ATOM   2780  N  N     . ASP B 1  126  ? -36.035 33.974  124.285 1.00 60.53  ? 126  ASP B N     1 
ATOM   2781  C  CA    . ASP B 1  126  ? -37.003 33.749  123.217 1.00 58.88  ? 126  ASP B CA    1 
ATOM   2782  C  C     . ASP B 1  126  ? -37.133 32.270  122.858 1.00 60.52  ? 126  ASP B C     1 
ATOM   2783  O  O     . ASP B 1  126  ? -37.861 31.910  121.933 1.00 59.79  ? 126  ASP B O     1 
ATOM   2784  C  CB    . ASP B 1  126  ? -36.653 34.577  121.978 1.00 69.90  ? 126  ASP B CB    1 
ATOM   2785  C  CG    . ASP B 1  126  ? -36.878 36.065  122.188 1.00 78.76  ? 126  ASP B CG    1 
ATOM   2786  O  OD1   . ASP B 1  126  ? -36.111 36.874  121.622 1.00 71.74  ? 126  ASP B OD1   1 
ATOM   2787  O  OD2   . ASP B 1  126  ? -37.824 36.425  122.922 1.00 78.85  ? 126  ASP B OD2   1 
ATOM   2788  N  N     . LEU B 1  127  ? -36.409 31.423  123.585 1.00 58.19  ? 127  LEU B N     1 
ATOM   2789  C  CA    . LEU B 1  127  ? -36.530 29.976  123.429 1.00 55.60  ? 127  LEU B CA    1 
ATOM   2790  C  C     . LEU B 1  127  ? -37.930 29.512  123.810 1.00 49.71  ? 127  LEU B C     1 
ATOM   2791  O  O     . LEU B 1  127  ? -38.440 29.864  124.872 1.00 56.40  ? 127  LEU B O     1 
ATOM   2792  C  CB    . LEU B 1  127  ? -35.497 29.254  124.295 1.00 47.47  ? 127  LEU B CB    1 
ATOM   2793  C  CG    . LEU B 1  127  ? -35.692 27.742  124.422 1.00 41.30  ? 127  LEU B CG    1 
ATOM   2794  C  CD1   . LEU B 1  127  ? -35.397 27.042  123.105 1.00 38.80  ? 127  LEU B CD1   1 
ATOM   2795  C  CD2   . LEU B 1  127  ? -34.833 27.179  125.539 1.00 45.35  ? 127  LEU B CD2   1 
ATOM   2796  N  N     . HIS B 1  128  ? -38.542 28.707  122.951 1.00 42.60  ? 128  HIS B N     1 
ATOM   2797  C  CA    . HIS B 1  128  ? -39.919 28.282  123.158 1.00 44.56  ? 128  HIS B CA    1 
ATOM   2798  C  C     . HIS B 1  128  ? -40.003 26.978  123.954 1.00 42.80  ? 128  HIS B C     1 
ATOM   2799  O  O     . HIS B 1  128  ? -39.568 25.929  123.480 1.00 42.07  ? 128  HIS B O     1 
ATOM   2800  C  CB    . HIS B 1  128  ? -40.613 28.132  121.800 1.00 42.17  ? 128  HIS B CB    1 
ATOM   2801  C  CG    . HIS B 1  128  ? -41.796 27.217  121.821 1.00 48.04  ? 128  HIS B CG    1 
ATOM   2802  N  ND1   . HIS B 1  128  ? -43.010 27.581  122.362 1.00 50.84  ? 128  HIS B ND1   1 
ATOM   2803  C  CD2   . HIS B 1  128  ? -41.949 25.949  121.371 1.00 50.70  ? 128  HIS B CD2   1 
ATOM   2804  C  CE1   . HIS B 1  128  ? -43.860 26.577  122.244 1.00 48.28  ? 128  HIS B CE1   1 
ATOM   2805  N  NE2   . HIS B 1  128  ? -43.242 25.574  121.648 1.00 46.25  ? 128  HIS B NE2   1 
ATOM   2806  N  N     . ILE B 1  129  ? -40.535 27.057  125.176 1.00 44.78  ? 129  ILE B N     1 
ATOM   2807  C  CA    . ILE B 1  129  ? -40.759 25.867  126.003 1.00 44.27  ? 129  ILE B CA    1 
ATOM   2808  C  C     . ILE B 1  129  ? -42.034 25.092  125.658 1.00 42.57  ? 129  ILE B C     1 
ATOM   2809  O  O     . ILE B 1  129  ? -41.992 23.881  125.431 1.00 43.01  ? 129  ILE B O     1 
ATOM   2810  C  CB    . ILE B 1  129  ? -40.787 26.209  127.520 1.00 40.82  ? 129  ILE B CB    1 
ATOM   2811  C  CG1   . ILE B 1  129  ? -39.371 26.362  128.075 1.00 37.22  ? 129  ILE B CG1   1 
ATOM   2812  C  CG2   . ILE B 1  129  ? -41.503 25.123  128.310 1.00 42.05  ? 129  ILE B CG2   1 
ATOM   2813  C  CD1   . ILE B 1  129  ? -38.705 27.662  127.723 1.00 42.46  ? 129  ILE B CD1   1 
ATOM   2814  N  N     . ALA B 1  130  ? -43.164 25.793  125.609 1.00 41.87  ? 130  ALA B N     1 
ATOM   2815  C  CA    . ALA B 1  130  ? -44.450 25.136  125.391 1.00 50.37  ? 130  ALA B CA    1 
ATOM   2816  C  C     . ALA B 1  130  ? -45.540 26.091  124.913 1.00 51.94  ? 130  ALA B C     1 
ATOM   2817  O  O     . ALA B 1  130  ? -45.447 27.303  125.106 1.00 54.82  ? 130  ALA B O     1 
ATOM   2818  C  CB    . ALA B 1  130  ? -44.899 24.423  126.664 1.00 47.03  ? 130  ALA B CB    1 
ATOM   2819  N  N     . THR B 1  131  ? -46.577 25.530  124.297 1.00 49.29  ? 131  THR B N     1 
ATOM   2820  C  CA    . THR B 1  131  ? -47.778 26.288  123.962 1.00 54.48  ? 131  THR B CA    1 
ATOM   2821  C  C     . THR B 1  131  ? -48.957 25.743  124.759 1.00 61.98  ? 131  THR B C     1 
ATOM   2822  O  O     . THR B 1  131  ? -49.167 24.531  124.829 1.00 57.00  ? 131  THR B O     1 
ATOM   2823  C  CB    . THR B 1  131  ? -48.116 26.231  122.455 1.00 51.70  ? 131  THR B CB    1 
ATOM   2824  O  OG1   . THR B 1  131  ? -48.106 24.871  122.008 1.00 65.03  ? 131  THR B OG1   1 
ATOM   2825  C  CG2   . THR B 1  131  ? -47.113 27.029  121.644 1.00 55.61  ? 131  THR B CG2   1 
ATOM   2826  N  N     . LEU B 1  132  ? -49.722 26.645  125.363 1.00 62.70  ? 132  LEU B N     1 
ATOM   2827  C  CA    . LEU B 1  132  ? -50.862 26.246  126.174 1.00 59.90  ? 132  LEU B CA    1 
ATOM   2828  C  C     . LEU B 1  132  ? -52.173 26.625  125.501 1.00 65.76  ? 132  LEU B C     1 
ATOM   2829  O  O     . LEU B 1  132  ? -52.296 27.701  124.915 1.00 63.47  ? 132  LEU B O     1 
ATOM   2830  C  CB    . LEU B 1  132  ? -50.779 26.866  127.571 1.00 64.25  ? 132  LEU B CB    1 
ATOM   2831  C  CG    . LEU B 1  132  ? -49.815 26.219  128.571 1.00 66.90  ? 132  LEU B CG    1 
ATOM   2832  C  CD1   . LEU B 1  132  ? -48.360 26.519  128.236 1.00 60.14  ? 132  LEU B CD1   1 
ATOM   2833  C  CD2   . LEU B 1  132  ? -50.141 26.663  129.987 1.00 71.06  ? 132  LEU B CD2   1 
ATOM   2834  N  N     . GLU B 1  133  ? -53.148 25.727  125.585 1.00 64.55  ? 133  GLU B N     1 
ATOM   2835  C  CA    . GLU B 1  133  ? -54.460 25.949  124.995 1.00 71.40  ? 133  GLU B CA    1 
ATOM   2836  C  C     . GLU B 1  133  ? -55.432 26.488  126.041 1.00 76.29  ? 133  GLU B C     1 
ATOM   2837  O  O     . GLU B 1  133  ? -55.037 26.800  127.165 1.00 71.19  ? 133  GLU B O     1 
ATOM   2838  C  CB    . GLU B 1  133  ? -54.988 24.641  124.407 1.00 73.90  ? 133  GLU B CB    1 
ATOM   2839  C  CG    . GLU B 1  133  ? -54.038 23.994  123.410 1.00 70.71  ? 133  GLU B CG    1 
ATOM   2840  C  CD    . GLU B 1  133  ? -54.218 22.490  123.315 1.00 69.64  ? 133  GLU B CD    1 
ATOM   2841  O  OE1   . GLU B 1  133  ? -54.813 21.895  124.239 1.00 63.83  ? 133  GLU B OE1   1 
ATOM   2842  O  OE2   . GLU B 1  133  ? -53.759 21.902  122.313 1.00 70.48  ? 133  GLU B OE2   1 
ATOM   2843  N  N     . GLU B 1  134  ? -56.703 26.602  125.669 1.00 74.84  ? 134  GLU B N     1 
ATOM   2844  C  CA    . GLU B 1  134  ? -57.727 27.017  126.616 1.00 70.46  ? 134  GLU B CA    1 
ATOM   2845  C  C     . GLU B 1  134  ? -57.953 25.906  127.630 1.00 71.13  ? 134  GLU B C     1 
ATOM   2846  O  O     . GLU B 1  134  ? -58.272 24.774  127.266 1.00 70.51  ? 134  GLU B O     1 
ATOM   2847  C  CB    . GLU B 1  134  ? -59.034 27.338  125.891 1.00 85.22  ? 134  GLU B CB    1 
ATOM   2848  C  CG    . GLU B 1  134  ? -58.995 28.613  125.061 1.00 90.38  ? 134  GLU B CG    1 
ATOM   2849  C  CD    . GLU B 1  134  ? -59.095 29.869  125.908 1.00 93.58  ? 134  GLU B CD    1 
ATOM   2850  O  OE1   . GLU B 1  134  ? -58.903 30.974  125.357 1.00 89.71  ? 134  GLU B OE1   1 
ATOM   2851  O  OE2   . GLU B 1  134  ? -59.371 29.753  127.121 1.00 90.09  ? 134  GLU B OE2   1 
ATOM   2852  N  N     . GLY B 1  135  ? -57.792 26.236  128.907 1.00 78.27  ? 135  GLY B N     1 
ATOM   2853  C  CA    . GLY B 1  135  ? -57.884 25.246  129.964 1.00 81.88  ? 135  GLY B CA    1 
ATOM   2854  C  C     . GLY B 1  135  ? -56.548 24.569  130.201 1.00 81.41  ? 135  GLY B C     1 
ATOM   2855  O  O     . GLY B 1  135  ? -56.402 23.764  131.122 1.00 82.49  ? 135  GLY B O     1 
ATOM   2856  N  N     . GLY B 1  136  ? -55.573 24.891  129.356 1.00 78.56  ? 136  GLY B N     1 
ATOM   2857  C  CA    . GLY B 1  136  ? -54.230 24.358  129.494 1.00 76.94  ? 136  GLY B CA    1 
ATOM   2858  C  C     . GLY B 1  136  ? -53.523 24.922  130.710 1.00 80.98  ? 136  GLY B C     1 
ATOM   2859  O  O     . GLY B 1  136  ? -53.445 26.140  130.886 1.00 70.13  ? 136  GLY B O     1 
ATOM   2860  N  N     . ARG B 1  137  ? -53.003 24.033  131.550 1.00 81.99  ? 137  ARG B N     1 
ATOM   2861  C  CA    . ARG B 1  137  ? -52.331 24.441  132.778 1.00 79.04  ? 137  ARG B CA    1 
ATOM   2862  C  C     . ARG B 1  137  ? -50.937 23.827  132.875 1.00 71.57  ? 137  ARG B C     1 
ATOM   2863  O  O     . ARG B 1  137  ? -50.780 22.607  132.814 1.00 69.83  ? 137  ARG B O     1 
ATOM   2864  C  CB    . ARG B 1  137  ? -53.164 24.046  134.001 1.00 76.30  ? 137  ARG B CB    1 
ATOM   2865  C  CG    . ARG B 1  137  ? -54.604 24.538  133.959 1.00 81.76  ? 137  ARG B CG    1 
ATOM   2866  C  CD    . ARG B 1  137  ? -55.382 24.105  135.192 1.00 88.09  ? 137  ARG B CD    1 
ATOM   2867  N  NE    . ARG B 1  137  ? -54.971 24.832  136.391 1.00 100.95 ? 137  ARG B NE    1 
ATOM   2868  C  CZ    . ARG B 1  137  ? -55.561 25.938  136.832 1.00 93.13  ? 137  ARG B CZ    1 
ATOM   2869  N  NH1   . ARG B 1  137  ? -56.592 26.450  136.173 1.00 79.84  ? 137  ARG B NH1   1 
ATOM   2870  N  NH2   . ARG B 1  137  ? -55.121 26.535  137.932 1.00 80.24  ? 137  ARG B NH2   1 
ATOM   2871  N  N     . LEU B 1  138  ? -49.929 24.679  133.022 1.00 64.93  ? 138  LEU B N     1 
ATOM   2872  C  CA    . LEU B 1  138  ? -48.559 24.211  133.189 1.00 62.80  ? 138  LEU B CA    1 
ATOM   2873  C  C     . LEU B 1  138  ? -47.911 24.795  134.441 1.00 60.46  ? 138  LEU B C     1 
ATOM   2874  O  O     . LEU B 1  138  ? -47.710 26.005  134.546 1.00 57.64  ? 138  LEU B O     1 
ATOM   2875  C  CB    . LEU B 1  138  ? -47.714 24.548  131.960 1.00 66.78  ? 138  LEU B CB    1 
ATOM   2876  C  CG    . LEU B 1  138  ? -46.263 24.063  132.012 1.00 58.98  ? 138  LEU B CG    1 
ATOM   2877  C  CD1   . LEU B 1  138  ? -46.208 22.545  132.109 1.00 55.81  ? 138  LEU B CD1   1 
ATOM   2878  C  CD2   . LEU B 1  138  ? -45.485 24.555  130.804 1.00 57.22  ? 138  LEU B CD2   1 
ATOM   2879  N  N     . ASN B 1  139  ? -47.591 23.920  135.387 1.00 58.88  ? 139  ASN B N     1 
ATOM   2880  C  CA    . ASN B 1  139  ? -46.874 24.309  136.592 1.00 65.73  ? 139  ASN B CA    1 
ATOM   2881  C  C     . ASN B 1  139  ? -45.663 23.398  136.755 1.00 69.65  ? 139  ASN B C     1 
ATOM   2882  O  O     . ASN B 1  139  ? -45.811 22.199  137.004 1.00 63.72  ? 139  ASN B O     1 
ATOM   2883  C  CB    . ASN B 1  139  ? -47.800 24.194  137.806 1.00 67.43  ? 139  ASN B CB    1 
ATOM   2884  C  CG    . ASN B 1  139  ? -47.251 24.894  139.037 1.00 73.21  ? 139  ASN B CG    1 
ATOM   2885  O  OD1   . ASN B 1  139  ? -46.057 24.828  139.331 1.00 74.19  ? 139  ASN B OD1   1 
ATOM   2886  N  ND2   . ASN B 1  139  ? -48.130 25.571  139.767 1.00 83.24  ? 139  ASN B ND2   1 
ATOM   2887  N  N     . MET B 1  140  ? -44.465 23.962  136.621 1.00 64.33  ? 140  MET B N     1 
ATOM   2888  C  CA    . MET B 1  140  ? -43.253 23.147  136.664 1.00 61.93  ? 140  MET B CA    1 
ATOM   2889  C  C     . MET B 1  140  ? -42.062 23.824  137.334 1.00 51.17  ? 140  MET B C     1 
ATOM   2890  O  O     . MET B 1  140  ? -41.940 25.049  137.335 1.00 48.79  ? 140  MET B O     1 
ATOM   2891  C  CB    . MET B 1  140  ? -42.858 22.675  135.257 1.00 64.21  ? 140  MET B CB    1 
ATOM   2892  C  CG    . MET B 1  140  ? -42.383 23.784  134.326 1.00 68.68  ? 140  MET B CG    1 
ATOM   2893  S  SD    . MET B 1  140  ? -41.415 23.164  132.932 1.00 58.00  ? 140  MET B SD    1 
ATOM   2894  C  CE    . MET B 1  140  ? -42.540 21.950  132.255 1.00 50.23  ? 140  MET B CE    1 
ATOM   2895  N  N     . GLU B 1  141  ? -41.186 22.999  137.899 1.00 52.04  ? 141  GLU B N     1 
ATOM   2896  C  CA    . GLU B 1  141  ? -39.951 23.459  138.515 1.00 53.63  ? 141  GLU B CA    1 
ATOM   2897  C  C     . GLU B 1  141  ? -38.788 22.715  137.871 1.00 52.57  ? 141  GLU B C     1 
ATOM   2898  O  O     . GLU B 1  141  ? -38.835 21.492  137.724 1.00 54.03  ? 141  GLU B O     1 
ATOM   2899  C  CB    . GLU B 1  141  ? -39.972 23.180  140.020 1.00 60.41  ? 141  GLU B CB    1 
ATOM   2900  C  CG    . GLU B 1  141  ? -41.219 23.685  140.736 1.00 65.40  ? 141  GLU B CG    1 
ATOM   2901  C  CD    . GLU B 1  141  ? -41.356 23.132  142.146 1.00 71.87  ? 141  GLU B CD    1 
ATOM   2902  O  OE1   . GLU B 1  141  ? -40.395 22.501  142.638 1.00 71.77  ? 141  GLU B OE1   1 
ATOM   2903  O  OE2   . GLU B 1  141  ? -42.430 23.323  142.758 1.00 59.60  ? 141  GLU B OE2   1 
ATOM   2904  N  N     . VAL B 1  142  ? -37.748 23.445  137.479 1.00 48.93  ? 142  VAL B N     1 
ATOM   2905  C  CA    . VAL B 1  142  ? -36.591 22.822  136.840 1.00 46.58  ? 142  VAL B CA    1 
ATOM   2906  C  C     . VAL B 1  142  ? -35.308 22.995  137.653 1.00 39.13  ? 142  VAL B C     1 
ATOM   2907  O  O     . VAL B 1  142  ? -35.010 24.078  138.155 1.00 38.18  ? 142  VAL B O     1 
ATOM   2908  C  CB    . VAL B 1  142  ? -36.383 23.322  135.386 1.00 45.59  ? 142  VAL B CB    1 
ATOM   2909  C  CG1   . VAL B 1  142  ? -37.564 22.925  134.516 1.00 43.40  ? 142  VAL B CG1   1 
ATOM   2910  C  CG2   . VAL B 1  142  ? -36.177 24.828  135.350 1.00 47.60  ? 142  VAL B CG2   1 
ATOM   2911  N  N     . ARG B 1  143  ? -34.557 21.907  137.778 1.00 39.50  ? 143  ARG B N     1 
ATOM   2912  C  CA    . ARG B 1  143  ? -33.314 21.896  138.540 1.00 41.82  ? 143  ARG B CA    1 
ATOM   2913  C  C     . ARG B 1  143  ? -32.113 22.195  137.636 1.00 45.36  ? 143  ARG B C     1 
ATOM   2914  O  O     . ARG B 1  143  ? -31.822 21.445  136.702 1.00 39.07  ? 143  ARG B O     1 
ATOM   2915  C  CB    . ARG B 1  143  ? -33.158 20.538  139.232 1.00 38.82  ? 143  ARG B CB    1 
ATOM   2916  C  CG    . ARG B 1  143  ? -31.767 20.220  139.756 1.00 43.29  ? 143  ARG B CG    1 
ATOM   2917  C  CD    . ARG B 1  143  ? -31.499 20.839  141.111 1.00 48.48  ? 143  ARG B CD    1 
ATOM   2918  N  NE    . ARG B 1  143  ? -30.217 20.400  141.659 1.00 49.17  ? 143  ARG B NE    1 
ATOM   2919  C  CZ    . ARG B 1  143  ? -30.048 19.286  142.364 1.00 45.45  ? 143  ARG B CZ    1 
ATOM   2920  N  NH1   . ARG B 1  143  ? -31.082 18.492  142.609 1.00 42.94  ? 143  ARG B NH1   1 
ATOM   2921  N  NH2   . ARG B 1  143  ? -28.846 18.965  142.826 1.00 34.18  ? 143  ARG B NH2   1 
ATOM   2922  N  N     . VAL B 1  144  ? -31.424 23.299  137.911 1.00 39.08  ? 144  VAL B N     1 
ATOM   2923  C  CA    . VAL B 1  144  ? -30.271 23.702  137.111 1.00 33.28  ? 144  VAL B CA    1 
ATOM   2924  C  C     . VAL B 1  144  ? -28.975 23.643  137.915 1.00 39.06  ? 144  VAL B C     1 
ATOM   2925  O  O     . VAL B 1  144  ? -28.847 24.291  138.950 1.00 44.33  ? 144  VAL B O     1 
ATOM   2926  C  CB    . VAL B 1  144  ? -30.452 25.117  136.529 1.00 29.88  ? 144  VAL B CB    1 
ATOM   2927  C  CG1   . VAL B 1  144  ? -29.154 25.613  135.920 1.00 34.41  ? 144  VAL B CG1   1 
ATOM   2928  C  CG2   . VAL B 1  144  ? -31.564 25.125  135.496 1.00 31.74  ? 144  VAL B CG2   1 
ATOM   2929  N  N     . ASP B 1  145  ? -28.012 22.868  137.427 1.00 43.51  ? 145  ASP B N     1 
ATOM   2930  C  CA    . ASP B 1  145  ? -26.750 22.682  138.133 1.00 41.41  ? 145  ASP B CA    1 
ATOM   2931  C  C     . ASP B 1  145  ? -25.555 23.112  137.299 1.00 43.72  ? 145  ASP B C     1 
ATOM   2932  O  O     . ASP B 1  145  ? -25.638 23.216  136.075 1.00 44.66  ? 145  ASP B O     1 
ATOM   2933  C  CB    . ASP B 1  145  ? -26.570 21.219  138.532 1.00 39.45  ? 145  ASP B CB    1 
ATOM   2934  C  CG    . ASP B 1  145  ? -27.652 20.736  139.464 1.00 48.27  ? 145  ASP B CG    1 
ATOM   2935  O  OD1   . ASP B 1  145  ? -28.744 20.391  138.969 1.00 44.97  ? 145  ASP B OD1   1 
ATOM   2936  O  OD2   . ASP B 1  145  ? -27.409 20.697  140.689 1.00 50.68  ? 145  ASP B OD2   1 
ATOM   2937  N  N     . ARG B 1  146  ? -24.441 23.361  137.977 1.00 44.76  ? 146  ARG B N     1 
ATOM   2938  C  CA    . ARG B 1  146  ? -23.185 23.629  137.299 1.00 44.66  ? 146  ARG B CA    1 
ATOM   2939  C  C     . ARG B 1  146  ? -22.345 22.361  137.261 1.00 42.27  ? 146  ARG B C     1 
ATOM   2940  O  O     . ARG B 1  146  ? -22.206 21.664  138.264 1.00 37.51  ? 146  ARG B O     1 
ATOM   2941  C  CB    . ARG B 1  146  ? -22.421 24.762  137.984 1.00 45.76  ? 146  ARG B CB    1 
ATOM   2942  C  CG    . ARG B 1  146  ? -21.008 24.954  137.458 1.00 53.56  ? 146  ARG B CG    1 
ATOM   2943  C  CD    . ARG B 1  146  ? -20.594 26.412  137.505 1.00 61.43  ? 146  ARG B CD    1 
ATOM   2944  N  NE    . ARG B 1  146  ? -20.789 26.997  138.827 1.00 53.21  ? 146  ARG B NE    1 
ATOM   2945  C  CZ    . ARG B 1  146  ? -20.512 28.260  139.130 1.00 58.55  ? 146  ARG B CZ    1 
ATOM   2946  N  NH1   . ARG B 1  146  ? -20.024 29.074  138.204 1.00 59.05  ? 146  ARG B NH1   1 
ATOM   2947  N  NH2   . ARG B 1  146  ? -20.721 28.709  140.358 1.00 69.72  ? 146  ARG B NH2   1 
ATOM   2948  N  N     . GLY B 1  147  ? -21.796 22.063  136.091 1.00 43.68  ? 147  GLY B N     1 
ATOM   2949  C  CA    . GLY B 1  147  ? -20.991 20.873  135.909 1.00 40.27  ? 147  GLY B CA    1 
ATOM   2950  C  C     . GLY B 1  147  ? -20.220 20.950  134.610 1.00 38.75  ? 147  GLY B C     1 
ATOM   2951  O  O     . GLY B 1  147  ? -20.130 22.013  133.994 1.00 35.27  ? 147  GLY B O     1 
ATOM   2952  N  N     . VAL B 1  148  ? -19.661 19.822  134.192 1.00 38.37  ? 148  VAL B N     1 
ATOM   2953  C  CA    . VAL B 1  148  ? -18.853 19.781  132.983 1.00 31.99  ? 148  VAL B CA    1 
ATOM   2954  C  C     . VAL B 1  148  ? -19.246 18.609  132.091 1.00 33.87  ? 148  VAL B C     1 
ATOM   2955  O  O     . VAL B 1  148  ? -19.660 17.556  132.578 1.00 34.94  ? 148  VAL B O     1 
ATOM   2956  C  CB    . VAL B 1  148  ? -17.353 19.683  133.319 1.00 25.16  ? 148  VAL B CB    1 
ATOM   2957  C  CG1   . VAL B 1  148  ? -16.841 21.004  133.873 1.00 23.42  ? 148  VAL B CG1   1 
ATOM   2958  C  CG2   . VAL B 1  148  ? -17.106 18.552  134.301 1.00 18.51  ? 148  VAL B CG2   1 
ATOM   2959  N  N     . GLY B 1  149  ? -19.127 18.806  130.782 1.00 28.44  ? 149  GLY B N     1 
ATOM   2960  C  CA    . GLY B 1  149  ? -19.331 17.732  129.829 1.00 28.08  ? 149  GLY B CA    1 
ATOM   2961  C  C     . GLY B 1  149  ? -20.771 17.293  129.662 1.00 27.66  ? 149  GLY B C     1 
ATOM   2962  O  O     . GLY B 1  149  ? -21.677 18.120  129.567 1.00 32.32  ? 149  GLY B O     1 
ATOM   2963  N  N     . TYR B 1  150  ? -20.978 15.982  129.615 1.00 22.97  ? 150  TYR B N     1 
ATOM   2964  C  CA    . TYR B 1  150  ? -22.297 15.425  129.347 1.00 26.56  ? 150  TYR B CA    1 
ATOM   2965  C  C     . TYR B 1  150  ? -22.621 14.258  130.282 1.00 29.35  ? 150  TYR B C     1 
ATOM   2966  O  O     . TYR B 1  150  ? -21.904 13.256  130.313 1.00 22.63  ? 150  TYR B O     1 
ATOM   2967  C  CB    . TYR B 1  150  ? -22.382 14.982  127.885 1.00 22.73  ? 150  TYR B CB    1 
ATOM   2968  C  CG    . TYR B 1  150  ? -23.756 14.544  127.433 1.00 22.50  ? 150  TYR B CG    1 
ATOM   2969  C  CD1   . TYR B 1  150  ? -24.682 15.468  126.969 1.00 21.78  ? 150  TYR B CD1   1 
ATOM   2970  C  CD2   . TYR B 1  150  ? -24.120 13.204  127.451 1.00 23.21  ? 150  TYR B CD2   1 
ATOM   2971  C  CE1   . TYR B 1  150  ? -25.936 15.071  126.545 1.00 20.05  ? 150  TYR B CE1   1 
ATOM   2972  C  CE2   . TYR B 1  150  ? -25.372 12.798  127.030 1.00 22.25  ? 150  TYR B CE2   1 
ATOM   2973  C  CZ    . TYR B 1  150  ? -26.274 13.736  126.578 1.00 19.27  ? 150  TYR B CZ    1 
ATOM   2974  O  OH    . TYR B 1  150  ? -27.519 13.336  126.158 1.00 28.05  ? 150  TYR B OH    1 
ATOM   2975  N  N     . VAL B 1  151  ? -23.693 14.411  131.058 1.00 29.21  ? 151  VAL B N     1 
ATOM   2976  C  CA    . VAL B 1  151  ? -24.178 13.355  131.942 1.00 25.85  ? 151  VAL B CA    1 
ATOM   2977  C  C     . VAL B 1  151  ? -25.596 12.912  131.577 1.00 27.95  ? 151  VAL B C     1 
ATOM   2978  O  O     . VAL B 1  151  ? -26.542 13.696  131.685 1.00 26.99  ? 151  VAL B O     1 
ATOM   2979  C  CB    . VAL B 1  151  ? -24.161 13.802  133.418 1.00 26.83  ? 151  VAL B CB    1 
ATOM   2980  C  CG1   . VAL B 1  151  ? -24.549 12.644  134.325 1.00 29.17  ? 151  VAL B CG1   1 
ATOM   2981  C  CG2   . VAL B 1  151  ? -22.789 14.342  133.796 1.00 22.53  ? 151  VAL B CG2   1 
ATOM   2982  N  N     . PRO B 1  152  ? -25.752 11.650  131.145 1.00 31.91  ? 152  PRO B N     1 
ATOM   2983  C  CA    . PRO B 1  152  ? -27.086 11.109  130.857 1.00 30.75  ? 152  PRO B CA    1 
ATOM   2984  C  C     . PRO B 1  152  ? -27.956 11.099  132.112 1.00 34.78  ? 152  PRO B C     1 
ATOM   2985  O  O     . PRO B 1  152  ? -27.423 11.134  133.222 1.00 35.52  ? 152  PRO B O     1 
ATOM   2986  C  CB    . PRO B 1  152  ? -26.792 9.674   130.407 1.00 29.98  ? 152  PRO B CB    1 
ATOM   2987  C  CG    . PRO B 1  152  ? -25.376 9.695   129.953 1.00 23.76  ? 152  PRO B CG    1 
ATOM   2988  C  CD    . PRO B 1  152  ? -24.684 10.686  130.835 1.00 25.44  ? 152  PRO B CD    1 
ATOM   2989  N  N     . ALA B 1  153  ? -29.273 11.045  131.935 1.00 39.53  ? 153  ALA B N     1 
ATOM   2990  C  CA    . ALA B 1  153  ? -30.213 11.129  133.055 1.00 38.28  ? 153  ALA B CA    1 
ATOM   2991  C  C     . ALA B 1  153  ? -30.036 10.013  134.083 1.00 41.04  ? 153  ALA B C     1 
ATOM   2992  O  O     . ALA B 1  153  ? -30.145 10.246  135.286 1.00 44.04  ? 153  ALA B O     1 
ATOM   2993  C  CB    . ALA B 1  153  ? -31.647 11.154  132.545 1.00 33.10  ? 153  ALA B CB    1 
ATOM   2994  N  N     . GLU B 1  154  ? -29.761 8.804   133.606 1.00 36.72  ? 154  GLU B N     1 
ATOM   2995  C  CA    . GLU B 1  154  ? -29.623 7.653   134.492 1.00 36.72  ? 154  GLU B CA    1 
ATOM   2996  C  C     . GLU B 1  154  ? -28.348 7.696   135.331 1.00 41.10  ? 154  GLU B C     1 
ATOM   2997  O  O     . GLU B 1  154  ? -28.246 6.998   136.338 1.00 46.85  ? 154  GLU B O     1 
ATOM   2998  C  CB    . GLU B 1  154  ? -29.677 6.347   133.696 1.00 36.76  ? 154  GLU B CB    1 
ATOM   2999  C  CG    . GLU B 1  154  ? -29.467 6.519   132.200 1.00 45.42  ? 154  GLU B CG    1 
ATOM   3000  C  CD    . GLU B 1  154  ? -30.769 6.747   131.448 1.00 48.66  ? 154  GLU B CD    1 
ATOM   3001  O  OE1   . GLU B 1  154  ? -30.754 7.491   130.444 1.00 44.28  ? 154  GLU B OE1   1 
ATOM   3002  O  OE2   . GLU B 1  154  ? -31.805 6.177   131.857 1.00 46.03  ? 154  GLU B OE2   1 
ATOM   3003  N  N     . LYS B 1  155  ? -27.376 8.502   134.916 1.00 40.02  ? 155  LYS B N     1 
ATOM   3004  C  CA    . LYS B 1  155  ? -26.099 8.563   135.625 1.00 45.35  ? 155  LYS B CA    1 
ATOM   3005  C  C     . LYS B 1  155  ? -26.120 9.438   136.882 1.00 43.11  ? 155  LYS B C     1 
ATOM   3006  O  O     . LYS B 1  155  ? -25.596 9.039   137.922 1.00 47.41  ? 155  LYS B O     1 
ATOM   3007  C  CB    . LYS B 1  155  ? -24.970 8.992   134.683 1.00 47.30  ? 155  LYS B CB    1 
ATOM   3008  C  CG    . LYS B 1  155  ? -24.724 8.018   133.539 1.00 52.07  ? 155  LYS B CG    1 
ATOM   3009  C  CD    . LYS B 1  155  ? -24.524 6.599   134.053 1.00 56.14  ? 155  LYS B CD    1 
ATOM   3010  C  CE    . LYS B 1  155  ? -24.385 5.609   132.905 1.00 66.73  ? 155  LYS B CE    1 
ATOM   3011  N  NZ    . LYS B 1  155  ? -24.224 4.210   133.390 1.00 58.31  ? 155  LYS B NZ    1 
ATOM   3012  N  N     . HIS B 1  156  ? -26.707 10.627  136.793 1.00 36.26  ? 156  HIS B N     1 
ATOM   3013  C  CA    . HIS B 1  156  ? -26.879 11.454  137.985 1.00 42.09  ? 156  HIS B CA    1 
ATOM   3014  C  C     . HIS B 1  156  ? -28.111 11.023  138.784 1.00 46.71  ? 156  HIS B C     1 
ATOM   3015  O  O     . HIS B 1  156  ? -28.080 10.993  140.015 1.00 48.84  ? 156  HIS B O     1 
ATOM   3016  C  CB    . HIS B 1  156  ? -26.918 12.951  137.644 1.00 37.97  ? 156  HIS B CB    1 
ATOM   3017  C  CG    . HIS B 1  156  ? -28.023 13.337  136.712 1.00 39.21  ? 156  HIS B CG    1 
ATOM   3018  N  ND1   . HIS B 1  156  ? -29.345 13.373  137.097 1.00 40.89  ? 156  HIS B ND1   1 
ATOM   3019  C  CD2   . HIS B 1  156  ? -28.000 13.716  135.412 1.00 35.69  ? 156  HIS B CD2   1 
ATOM   3020  C  CE1   . HIS B 1  156  ? -30.091 13.747  136.073 1.00 37.13  ? 156  HIS B CE1   1 
ATOM   3021  N  NE2   . HIS B 1  156  ? -29.298 13.964  135.039 1.00 36.41  ? 156  HIS B NE2   1 
ATOM   3022  N  N     . GLY B 1  157  ? -29.183 10.689  138.066 1.00 45.40  ? 157  GLY B N     1 
ATOM   3023  C  CA    . GLY B 1  157  ? -30.415 10.182  138.649 1.00 42.43  ? 157  GLY B CA    1 
ATOM   3024  C  C     . GLY B 1  157  ? -30.976 10.963  139.824 1.00 50.59  ? 157  GLY B C     1 
ATOM   3025  O  O     . GLY B 1  157  ? -31.466 10.371  140.786 1.00 57.65  ? 157  GLY B O     1 
ATOM   3026  N  N     . ILE B 1  158  ? -30.923 12.289  139.750 1.00 46.78  ? 158  ILE B N     1 
ATOM   3027  C  CA    . ILE B 1  158  ? -31.326 13.112  140.888 1.00 49.10  ? 158  ILE B CA    1 
ATOM   3028  C  C     . ILE B 1  158  ? -32.827 13.407  140.923 1.00 54.64  ? 158  ILE B C     1 
ATOM   3029  O  O     . ILE B 1  158  ? -33.437 13.734  139.903 1.00 54.46  ? 158  ILE B O     1 
ATOM   3030  C  CB    . ILE B 1  158  ? -30.506 14.422  140.986 1.00 40.87  ? 158  ILE B CB    1 
ATOM   3031  C  CG1   . ILE B 1  158  ? -30.868 15.391  139.864 1.00 37.73  ? 158  ILE B CG1   1 
ATOM   3032  C  CG2   . ILE B 1  158  ? -29.013 14.123  140.959 1.00 41.65  ? 158  ILE B CG2   1 
ATOM   3033  C  CD1   . ILE B 1  158  ? -30.152 16.707  139.978 1.00 44.84  ? 158  ILE B CD1   1 
ATOM   3034  N  N     . LYS B 1  159  ? -33.415 13.262  142.108 1.00 55.44  ? 159  LYS B N     1 
ATOM   3035  C  CA    . LYS B 1  159  ? -34.837 13.514  142.312 1.00 48.20  ? 159  LYS B CA    1 
ATOM   3036  C  C     . LYS B 1  159  ? -35.076 14.283  143.606 1.00 55.41  ? 159  LYS B C     1 
ATOM   3037  O  O     . LYS B 1  159  ? -34.660 13.844  144.679 1.00 61.03  ? 159  LYS B O     1 
ATOM   3038  C  CB    . LYS B 1  159  ? -35.617 12.198  142.362 1.00 48.84  ? 159  LYS B CB    1 
ATOM   3039  C  CG    . LYS B 1  159  ? -35.840 11.522  141.020 1.00 42.23  ? 159  LYS B CG    1 
ATOM   3040  C  CD    . LYS B 1  159  ? -36.885 10.423  141.150 1.00 40.25  ? 159  LYS B CD    1 
ATOM   3041  C  CE    . LYS B 1  159  ? -37.158 9.738   139.822 1.00 45.07  ? 159  LYS B CE    1 
ATOM   3042  N  NZ    . LYS B 1  159  ? -35.991 8.951   139.340 1.00 48.64  ? 159  LYS B NZ    1 
ATOM   3043  N  N     . ASP B 1  160  ? -35.739 15.431  143.503 1.00 59.74  ? 160  ASP B N     1 
ATOM   3044  C  CA    . ASP B 1  160  ? -36.151 16.183  144.686 1.00 55.12  ? 160  ASP B CA    1 
ATOM   3045  C  C     . ASP B 1  160  ? -37.457 15.646  145.264 1.00 51.21  ? 160  ASP B C     1 
ATOM   3046  O  O     . ASP B 1  160  ? -37.762 15.861  146.437 1.00 53.03  ? 160  ASP B O     1 
ATOM   3047  C  CB    . ASP B 1  160  ? -36.285 17.672  144.367 1.00 55.73  ? 160  ASP B CB    1 
ATOM   3048  C  CG    . ASP B 1  160  ? -34.966 18.407  144.466 1.00 65.49  ? 160  ASP B CG    1 
ATOM   3049  O  OD1   . ASP B 1  160  ? -33.910 17.763  144.286 1.00 67.04  ? 160  ASP B OD1   1 
ATOM   3050  O  OD2   . ASP B 1  160  ? -34.985 19.628  144.728 1.00 74.64  ? 160  ASP B OD2   1 
ATOM   3051  N  N     . ARG B 1  161  ? -38.222 14.947  144.433 1.00 43.98  ? 161  ARG B N     1 
ATOM   3052  C  CA    . ARG B 1  161  ? -39.465 14.327  144.873 1.00 45.72  ? 161  ARG B CA    1 
ATOM   3053  C  C     . ARG B 1  161  ? -39.798 13.116  144.005 1.00 51.67  ? 161  ARG B C     1 
ATOM   3054  O  O     . ARG B 1  161  ? -39.041 12.770  143.100 1.00 57.18  ? 161  ARG B O     1 
ATOM   3055  C  CB    . ARG B 1  161  ? -40.611 15.339  144.875 1.00 48.12  ? 161  ARG B CB    1 
ATOM   3056  C  CG    . ARG B 1  161  ? -41.037 15.816  143.506 1.00 45.05  ? 161  ARG B CG    1 
ATOM   3057  C  CD    . ARG B 1  161  ? -42.028 16.959  143.630 1.00 51.84  ? 161  ARG B CD    1 
ATOM   3058  N  NE    . ARG B 1  161  ? -41.364 18.252  143.765 1.00 49.53  ? 161  ARG B NE    1 
ATOM   3059  C  CZ    . ARG B 1  161  ? -41.997 19.393  144.016 1.00 48.17  ? 161  ARG B CZ    1 
ATOM   3060  N  NH1   . ARG B 1  161  ? -43.314 19.399  144.173 1.00 46.89  ? 161  ARG B NH1   1 
ATOM   3061  N  NH2   . ARG B 1  161  ? -41.315 20.526  144.116 1.00 45.85  ? 161  ARG B NH2   1 
ATOM   3062  N  N     . ILE B 1  162  ? -40.928 12.473  144.279 1.00 52.02  ? 162  ILE B N     1 
ATOM   3063  C  CA    . ILE B 1  162  ? -41.246 11.196  143.646 1.00 49.63  ? 162  ILE B CA    1 
ATOM   3064  C  C     . ILE B 1  162  ? -41.578 11.314  142.155 1.00 50.57  ? 162  ILE B C     1 
ATOM   3065  O  O     . ILE B 1  162  ? -41.311 10.397  141.379 1.00 52.81  ? 162  ILE B O     1 
ATOM   3066  C  CB    . ILE B 1  162  ? -42.381 10.455  144.395 1.00 51.16  ? 162  ILE B CB    1 
ATOM   3067  C  CG1   . ILE B 1  162  ? -42.483 9.003   143.921 1.00 60.74  ? 162  ILE B CG1   1 
ATOM   3068  C  CG2   . ILE B 1  162  ? -43.707 11.184  144.233 1.00 53.56  ? 162  ILE B CG2   1 
ATOM   3069  C  CD1   . ILE B 1  162  ? -41.202 8.211   144.094 1.00 54.48  ? 162  ILE B CD1   1 
ATOM   3070  N  N     . ASN B 1  163  ? -42.153 12.444  141.755 1.00 54.50  ? 163  ASN B N     1 
ATOM   3071  C  CA    . ASN B 1  163  ? -42.543 12.643  140.361 1.00 53.16  ? 163  ASN B CA    1 
ATOM   3072  C  C     . ASN B 1  163  ? -41.532 13.412  139.512 1.00 44.66  ? 163  ASN B C     1 
ATOM   3073  O  O     . ASN B 1  163  ? -41.790 13.695  138.343 1.00 46.22  ? 163  ASN B O     1 
ATOM   3074  C  CB    . ASN B 1  163  ? -43.925 13.295  140.274 1.00 56.48  ? 163  ASN B CB    1 
ATOM   3075  C  CG    . ASN B 1  163  ? -45.042 12.327  140.603 1.00 56.74  ? 163  ASN B CG    1 
ATOM   3076  O  OD1   . ASN B 1  163  ? -44.953 11.135  140.300 1.00 52.11  ? 163  ASN B OD1   1 
ATOM   3077  N  ND2   . ASN B 1  163  ? -46.100 12.831  141.229 1.00 55.41  ? 163  ASN B ND2   1 
ATOM   3078  N  N     . ALA B 1  164  ? -40.392 13.757  140.103 1.00 43.63  ? 164  ALA B N     1 
ATOM   3079  C  CA    . ALA B 1  164  ? -39.353 14.485  139.380 1.00 45.27  ? 164  ALA B CA    1 
ATOM   3080  C  C     . ALA B 1  164  ? -38.714 13.610  138.305 1.00 47.34  ? 164  ALA B C     1 
ATOM   3081  O  O     . ALA B 1  164  ? -38.301 12.482  138.576 1.00 47.28  ? 164  ALA B O     1 
ATOM   3082  C  CB    . ALA B 1  164  ? -38.294 15.007  140.345 1.00 36.85  ? 164  ALA B CB    1 
ATOM   3083  N  N     . ILE B 1  165  ? -38.642 14.135  137.084 1.00 42.10  ? 165  ILE B N     1 
ATOM   3084  C  CA    . ILE B 1  165  ? -38.031 13.414  135.973 1.00 40.67  ? 165  ILE B CA    1 
ATOM   3085  C  C     . ILE B 1  165  ? -36.602 13.894  135.741 1.00 40.52  ? 165  ILE B C     1 
ATOM   3086  O  O     . ILE B 1  165  ? -36.376 15.076  135.475 1.00 38.63  ? 165  ILE B O     1 
ATOM   3087  C  CB    . ILE B 1  165  ? -38.831 13.601  134.670 1.00 44.93  ? 165  ILE B CB    1 
ATOM   3088  C  CG1   . ILE B 1  165  ? -40.321 13.363  134.915 1.00 40.59  ? 165  ILE B CG1   1 
ATOM   3089  C  CG2   . ILE B 1  165  ? -38.308 12.670  133.585 1.00 41.03  ? 165  ILE B CG2   1 
ATOM   3090  C  CD1   . ILE B 1  165  ? -41.183 13.626  133.703 1.00 36.02  ? 165  ILE B CD1   1 
ATOM   3091  N  N     . PRO B 1  166  ? -35.629 12.974  135.847 1.00 40.84  ? 166  PRO B N     1 
ATOM   3092  C  CA    . PRO B 1  166  ? -34.214 13.291  135.622 1.00 40.67  ? 166  PRO B CA    1 
ATOM   3093  C  C     . PRO B 1  166  ? -33.934 13.584  134.150 1.00 37.97  ? 166  PRO B C     1 
ATOM   3094  O  O     . PRO B 1  166  ? -34.414 12.862  133.275 1.00 34.12  ? 166  PRO B O     1 
ATOM   3095  C  CB    . PRO B 1  166  ? -33.500 12.009  136.056 1.00 37.30  ? 166  PRO B CB    1 
ATOM   3096  C  CG    . PRO B 1  166  ? -34.503 10.933  135.828 1.00 42.83  ? 166  PRO B CG    1 
ATOM   3097  C  CD    . PRO B 1  166  ? -35.836 11.547  136.148 1.00 39.10  ? 166  PRO B CD    1 
ATOM   3098  N  N     . VAL B 1  167  ? -33.160 14.632  133.886 1.00 31.67  ? 167  VAL B N     1 
ATOM   3099  C  CA    . VAL B 1  167  ? -32.892 15.068  132.519 1.00 36.21  ? 167  VAL B CA    1 
ATOM   3100  C  C     . VAL B 1  167  ? -31.414 14.896  132.172 1.00 29.91  ? 167  VAL B C     1 
ATOM   3101  O  O     . VAL B 1  167  ? -30.551 15.139  133.014 1.00 28.61  ? 167  VAL B O     1 
ATOM   3102  C  CB    . VAL B 1  167  ? -33.312 16.548  132.326 1.00 33.85  ? 167  VAL B CB    1 
ATOM   3103  C  CG1   . VAL B 1  167  ? -32.978 17.039  130.926 1.00 26.94  ? 167  VAL B CG1   1 
ATOM   3104  C  CG2   . VAL B 1  167  ? -34.795 16.713  132.607 1.00 29.28  ? 167  VAL B CG2   1 
ATOM   3105  N  N     . ASP B 1  168  ? -31.129 14.464  130.943 1.00 29.67  ? 168  ASP B N     1 
ATOM   3106  C  CA    . ASP B 1  168  ? -29.752 14.373  130.465 1.00 27.22  ? 168  ASP B CA    1 
ATOM   3107  C  C     . ASP B 1  168  ? -29.109 15.741  130.610 1.00 23.45  ? 168  ASP B C     1 
ATOM   3108  O  O     . ASP B 1  168  ? -29.603 16.730  130.072 1.00 22.22  ? 168  ASP B O     1 
ATOM   3109  C  CB    . ASP B 1  168  ? -29.709 13.958  128.993 1.00 24.01  ? 168  ASP B CB    1 
ATOM   3110  C  CG    . ASP B 1  168  ? -30.330 12.600  128.746 1.00 27.77  ? 168  ASP B CG    1 
ATOM   3111  O  OD1   . ASP B 1  168  ? -30.230 11.724  129.629 1.00 30.24  ? 168  ASP B OD1   1 
ATOM   3112  O  OD2   . ASP B 1  168  ? -30.916 12.406  127.659 1.00 27.04  ? 168  ASP B OD2   1 
ATOM   3113  N  N     . ALA B 1  169  ? -27.994 15.797  131.323 1.00 20.44  ? 169  ALA B N     1 
ATOM   3114  C  CA    . ALA B 1  169  ? -27.401 17.077  131.660 1.00 23.50  ? 169  ALA B CA    1 
ATOM   3115  C  C     . ALA B 1  169  ? -26.380 17.474  130.614 1.00 26.64  ? 169  ALA B C     1 
ATOM   3116  O  O     . ALA B 1  169  ? -25.325 16.852  130.507 1.00 31.01  ? 169  ALA B O     1 
ATOM   3117  C  CB    . ALA B 1  169  ? -26.749 17.003  133.024 1.00 22.51  ? 169  ALA B CB    1 
ATOM   3118  N  N     . VAL B 1  170  ? -26.673 18.521  129.850 1.00 23.03  ? 170  VAL B N     1 
ATOM   3119  C  CA    . VAL B 1  170  ? -25.696 18.986  128.889 1.00 22.58  ? 170  VAL B CA    1 
ATOM   3120  C  C     . VAL B 1  170  ? -25.021 20.194  129.508 1.00 26.40  ? 170  VAL B C     1 
ATOM   3121  O  O     . VAL B 1  170  ? -25.519 21.317  129.424 1.00 30.12  ? 170  VAL B O     1 
ATOM   3122  C  CB    . VAL B 1  170  ? -26.390 19.421  127.585 1.00 21.57  ? 170  VAL B CB    1 
ATOM   3123  C  CG1   . VAL B 1  170  ? -25.363 19.728  126.509 1.00 32.60  ? 170  VAL B CG1   1 
ATOM   3124  C  CG2   . VAL B 1  170  ? -27.357 18.345  127.114 1.00 21.18  ? 170  VAL B CG2   1 
ATOM   3125  N  N     . PHE B 1  171  ? -23.845 19.960  130.073 1.00 23.91  ? 171  PHE B N     1 
ATOM   3126  C  CA    . PHE B 1  171  ? -23.134 21.000  130.796 1.00 28.33  ? 171  PHE B CA    1 
ATOM   3127  C  C     . PHE B 1  171  ? -22.336 21.863  129.847 1.00 36.32  ? 171  PHE B C     1 
ATOM   3128  O  O     . PHE B 1  171  ? -22.305 23.088  129.980 1.00 38.85  ? 171  PHE B O     1 
ATOM   3129  C  CB    . PHE B 1  171  ? -22.216 20.394  131.856 1.00 30.19  ? 171  PHE B CB    1 
ATOM   3130  C  CG    . PHE B 1  171  ? -22.948 19.752  132.996 1.00 33.54  ? 171  PHE B CG    1 
ATOM   3131  C  CD1   . PHE B 1  171  ? -23.725 20.515  133.852 1.00 36.66  ? 171  PHE B CD1   1 
ATOM   3132  C  CD2   . PHE B 1  171  ? -22.853 18.390  133.219 1.00 32.53  ? 171  PHE B CD2   1 
ATOM   3133  C  CE1   . PHE B 1  171  ? -24.399 19.930  134.905 1.00 32.40  ? 171  PHE B CE1   1 
ATOM   3134  C  CE2   . PHE B 1  171  ? -23.528 17.798  134.272 1.00 31.68  ? 171  PHE B CE2   1 
ATOM   3135  C  CZ    . PHE B 1  171  ? -24.301 18.569  135.115 1.00 29.36  ? 171  PHE B CZ    1 
ATOM   3136  N  N     . SER B 1  172  ? -21.703 21.202  128.882 1.00 34.67  ? 172  SER B N     1 
ATOM   3137  C  CA    . SER B 1  172  ? -20.720 21.840  128.023 1.00 34.38  ? 172  SER B CA    1 
ATOM   3138  C  C     . SER B 1  172  ? -21.305 23.052  127.315 1.00 32.02  ? 172  SER B C     1 
ATOM   3139  O  O     . SER B 1  172  ? -22.258 22.933  126.545 1.00 28.43  ? 172  SER B O     1 
ATOM   3140  C  CB    . SER B 1  172  ? -20.178 20.838  126.998 1.00 33.28  ? 172  SER B CB    1 
ATOM   3141  O  OG    . SER B 1  172  ? -19.053 21.359  126.308 1.00 29.59  ? 172  SER B OG    1 
ATOM   3142  N  N     . PRO B 1  173  ? -20.736 24.231  127.593 1.00 30.60  ? 173  PRO B N     1 
ATOM   3143  C  CA    . PRO B 1  173  ? -21.115 25.446  126.872 1.00 31.04  ? 173  PRO B CA    1 
ATOM   3144  C  C     . PRO B 1  173  ? -20.652 25.333  125.430 1.00 35.88  ? 173  PRO B C     1 
ATOM   3145  O  O     . PRO B 1  173  ? -21.183 26.018  124.561 1.00 38.90  ? 173  PRO B O     1 
ATOM   3146  C  CB    . PRO B 1  173  ? -20.331 26.542  127.598 1.00 37.04  ? 173  PRO B CB    1 
ATOM   3147  C  CG    . PRO B 1  173  ? -19.168 25.835  128.206 1.00 33.30  ? 173  PRO B CG    1 
ATOM   3148  C  CD    . PRO B 1  173  ? -19.678 24.480  128.587 1.00 31.31  ? 173  PRO B CD    1 
ATOM   3149  N  N     . VAL B 1  174  ? -19.675 24.461  125.189 1.00 36.37  ? 174  VAL B N     1 
ATOM   3150  C  CA    . VAL B 1  174  ? -19.155 24.218  123.850 1.00 35.01  ? 174  VAL B CA    1 
ATOM   3151  C  C     . VAL B 1  174  ? -19.993 23.159  123.142 1.00 27.34  ? 174  VAL B C     1 
ATOM   3152  O  O     . VAL B 1  174  ? -20.057 22.015  123.588 1.00 27.61  ? 174  VAL B O     1 
ATOM   3153  C  CB    . VAL B 1  174  ? -17.697 23.726  123.912 1.00 31.97  ? 174  VAL B CB    1 
ATOM   3154  C  CG1   . VAL B 1  174  ? -17.162 23.483  122.514 1.00 31.30  ? 174  VAL B CG1   1 
ATOM   3155  C  CG2   . VAL B 1  174  ? -16.830 24.728  124.656 1.00 28.38  ? 174  VAL B CG2   1 
ATOM   3156  N  N     . ARG B 1  175  ? -20.640 23.546  122.045 1.00 28.38  ? 175  ARG B N     1 
ATOM   3157  C  CA    . ARG B 1  175  ? -21.489 22.625  121.289 1.00 27.76  ? 175  ARG B CA    1 
ATOM   3158  C  C     . ARG B 1  175  ? -20.713 21.737  120.318 1.00 26.34  ? 175  ARG B C     1 
ATOM   3159  O  O     . ARG B 1  175  ? -21.074 20.581  120.103 1.00 24.82  ? 175  ARG B O     1 
ATOM   3160  C  CB    . ARG B 1  175  ? -22.596 23.381  120.551 1.00 28.73  ? 175  ARG B CB    1 
ATOM   3161  C  CG    . ARG B 1  175  ? -23.478 24.210  121.465 1.00 37.28  ? 175  ARG B CG    1 
ATOM   3162  C  CD    . ARG B 1  175  ? -24.895 24.334  120.926 1.00 44.05  ? 175  ARG B CD    1 
ATOM   3163  N  NE    . ARG B 1  175  ? -25.771 25.017  121.875 1.00 55.22  ? 175  ARG B NE    1 
ATOM   3164  C  CZ    . ARG B 1  175  ? -26.323 24.435  122.937 1.00 54.90  ? 175  ARG B CZ    1 
ATOM   3165  N  NH1   . ARG B 1  175  ? -26.091 23.154  123.193 1.00 47.68  ? 175  ARG B NH1   1 
ATOM   3166  N  NH2   . ARG B 1  175  ? -27.106 25.136  123.748 1.00 48.41  ? 175  ARG B NH2   1 
ATOM   3167  N  N     . ARG B 1  176  ? -19.662 22.289  119.718 1.00 27.80  ? 176  ARG B N     1 
ATOM   3168  C  CA    . ARG B 1  176  ? -18.857 21.541  118.757 1.00 24.29  ? 176  ARG B CA    1 
ATOM   3169  C  C     . ARG B 1  176  ? -17.416 22.046  118.678 1.00 25.13  ? 176  ARG B C     1 
ATOM   3170  O  O     . ARG B 1  176  ? -17.154 23.236  118.841 1.00 22.18  ? 176  ARG B O     1 
ATOM   3171  C  CB    . ARG B 1  176  ? -19.516 21.582  117.372 1.00 26.20  ? 176  ARG B CB    1 
ATOM   3172  C  CG    . ARG B 1  176  ? -18.722 20.891  116.271 1.00 31.97  ? 176  ARG B CG    1 
ATOM   3173  C  CD    . ARG B 1  176  ? -19.622 20.380  115.160 1.00 32.89  ? 176  ARG B CD    1 
ATOM   3174  N  NE    . ARG B 1  176  ? -20.134 21.446  114.304 1.00 36.89  ? 176  ARG B NE    1 
ATOM   3175  C  CZ    . ARG B 1  176  ? -19.872 21.549  113.004 1.00 35.42  ? 176  ARG B CZ    1 
ATOM   3176  N  NH1   . ARG B 1  176  ? -19.105 20.649  112.402 1.00 31.87  ? 176  ARG B NH1   1 
ATOM   3177  N  NH2   . ARG B 1  176  ? -20.381 22.552  112.304 1.00 29.63  ? 176  ARG B NH2   1 
ATOM   3178  N  N     . VAL B 1  177  ? -16.486 21.129  118.428 1.00 24.43  ? 177  VAL B N     1 
ATOM   3179  C  CA    . VAL B 1  177  ? -15.101 21.489  118.153 1.00 25.65  ? 177  VAL B CA    1 
ATOM   3180  C  C     . VAL B 1  177  ? -14.602 20.749  116.918 1.00 28.12  ? 177  VAL B C     1 
ATOM   3181  O  O     . VAL B 1  177  ? -14.674 19.521  116.843 1.00 31.05  ? 177  VAL B O     1 
ATOM   3182  C  CB    . VAL B 1  177  ? -14.162 21.157  119.335 1.00 28.08  ? 177  VAL B CB    1 
ATOM   3183  C  CG1   . VAL B 1  177  ? -12.720 21.493  118.976 1.00 22.45  ? 177  VAL B CG1   1 
ATOM   3184  C  CG2   . VAL B 1  177  ? -14.583 21.906  120.584 1.00 24.45  ? 177  VAL B CG2   1 
ATOM   3185  N  N     . ALA B 1  178  ? -14.099 21.504  115.949 1.00 32.16  ? 178  ALA B N     1 
ATOM   3186  C  CA    . ALA B 1  178  ? -13.487 20.923  114.762 1.00 25.35  ? 178  ALA B CA    1 
ATOM   3187  C  C     . ALA B 1  178  ? -12.096 21.504  114.578 1.00 25.32  ? 178  ALA B C     1 
ATOM   3188  O  O     . ALA B 1  178  ? -11.878 22.695  114.802 1.00 29.42  ? 178  ALA B O     1 
ATOM   3189  C  CB    . ALA B 1  178  ? -14.340 21.198  113.533 1.00 23.28  ? 178  ALA B CB    1 
ATOM   3190  N  N     . PHE B 1  179  ? -11.148 20.666  114.181 1.00 23.12  ? 179  PHE B N     1 
ATOM   3191  C  CA    . PHE B 1  179  ? -9.821  21.167  113.855 1.00 25.00  ? 179  PHE B CA    1 
ATOM   3192  C  C     . PHE B 1  179  ? -9.211  20.438  112.667 1.00 26.97  ? 179  PHE B C     1 
ATOM   3193  O  O     . PHE B 1  179  ? -9.452  19.248  112.455 1.00 29.86  ? 179  PHE B O     1 
ATOM   3194  C  CB    . PHE B 1  179  ? -8.890  21.145  115.076 1.00 27.51  ? 179  PHE B CB    1 
ATOM   3195  C  CG    . PHE B 1  179  ? -8.243  19.814  115.336 1.00 24.31  ? 179  PHE B CG    1 
ATOM   3196  C  CD1   . PHE B 1  179  ? -6.980  19.533  114.835 1.00 19.47  ? 179  PHE B CD1   1 
ATOM   3197  C  CD2   . PHE B 1  179  ? -8.887  18.852  116.098 1.00 19.27  ? 179  PHE B CD2   1 
ATOM   3198  C  CE1   . PHE B 1  179  ? -6.380  18.316  115.077 1.00 20.40  ? 179  PHE B CE1   1 
ATOM   3199  C  CE2   . PHE B 1  179  ? -8.292  17.632  116.344 1.00 19.15  ? 179  PHE B CE2   1 
ATOM   3200  C  CZ    . PHE B 1  179  ? -7.037  17.363  115.834 1.00 23.27  ? 179  PHE B CZ    1 
ATOM   3201  N  N     . GLN B 1  180  ? -8.422  21.172  111.893 1.00 26.09  ? 180  GLN B N     1 
ATOM   3202  C  CA    . GLN B 1  180  ? -7.820  20.640  110.684 1.00 27.43  ? 180  GLN B CA    1 
ATOM   3203  C  C     . GLN B 1  180  ? -6.397  21.159  110.549 1.00 26.48  ? 180  GLN B C     1 
ATOM   3204  O  O     . GLN B 1  180  ? -6.135  22.338  110.786 1.00 31.52  ? 180  GLN B O     1 
ATOM   3205  C  CB    . GLN B 1  180  ? -8.655  21.045  109.467 1.00 33.73  ? 180  GLN B CB    1 
ATOM   3206  C  CG    . GLN B 1  180  ? -8.038  20.683  108.129 1.00 45.53  ? 180  GLN B CG    1 
ATOM   3207  C  CD    . GLN B 1  180  ? -8.961  20.980  106.964 1.00 59.88  ? 180  GLN B CD    1 
ATOM   3208  O  OE1   . GLN B 1  180  ? -10.179 21.074  107.130 1.00 61.22  ? 180  GLN B OE1   1 
ATOM   3209  N  NE2   . GLN B 1  180  ? -8.386  21.130  105.776 1.00 66.24  ? 180  GLN B NE2   1 
ATOM   3210  N  N     . VAL B 1  181  ? -5.477  20.275  110.180 1.00 22.97  ? 181  VAL B N     1 
ATOM   3211  C  CA    . VAL B 1  181  ? -4.091  20.669  109.969 1.00 25.98  ? 181  VAL B CA    1 
ATOM   3212  C  C     . VAL B 1  181  ? -3.737  20.638  108.488 1.00 24.50  ? 181  VAL B C     1 
ATOM   3213  O  O     . VAL B 1  181  ? -3.907  19.621  107.820 1.00 29.64  ? 181  VAL B O     1 
ATOM   3214  C  CB    . VAL B 1  181  ? -3.117  19.763  110.740 1.00 20.51  ? 181  VAL B CB    1 
ATOM   3215  C  CG1   . VAL B 1  181  ? -1.702  20.311  110.647 1.00 20.00  ? 181  VAL B CG1   1 
ATOM   3216  C  CG2   . VAL B 1  181  ? -3.548  19.646  112.185 1.00 22.78  ? 181  VAL B CG2   1 
ATOM   3217  N  N     . GLU B 1  182  ? -3.247  21.761  107.978 1.00 29.20  ? 182  GLU B N     1 
ATOM   3218  C  CA    . GLU B 1  182  ? -2.839  21.850  106.584 1.00 34.73  ? 182  GLU B CA    1 
ATOM   3219  C  C     . GLU B 1  182  ? -1.347  22.117  106.504 1.00 32.04  ? 182  GLU B C     1 
ATOM   3220  O  O     . GLU B 1  182  ? -0.798  22.857  107.320 1.00 31.80  ? 182  GLU B O     1 
ATOM   3221  C  CB    . GLU B 1  182  ? -3.606  22.963  105.871 1.00 32.03  ? 182  GLU B CB    1 
ATOM   3222  C  CG    . GLU B 1  182  ? -5.110  22.774  105.876 1.00 37.54  ? 182  GLU B CG    1 
ATOM   3223  C  CD    . GLU B 1  182  ? -5.851  24.066  105.614 1.00 56.23  ? 182  GLU B CD    1 
ATOM   3224  O  OE1   . GLU B 1  182  ? -7.084  24.100  105.821 1.00 60.79  ? 182  GLU B OE1   1 
ATOM   3225  O  OE2   . GLU B 1  182  ? -5.196  25.050  105.207 1.00 60.65  ? 182  GLU B OE2   1 
ATOM   3226  N  N     . ASP B 1  183  ? -0.691  21.505  105.525 1.00 35.98  ? 183  ASP B N     1 
ATOM   3227  C  CA    . ASP B 1  183  ? 0.732   21.730  105.318 1.00 36.47  ? 183  ASP B CA    1 
ATOM   3228  C  C     . ASP B 1  183  ? 0.971   23.176  104.903 1.00 28.02  ? 183  ASP B C     1 
ATOM   3229  O  O     . ASP B 1  183  ? 0.248   23.722  104.072 1.00 29.23  ? 183  ASP B O     1 
ATOM   3230  C  CB    . ASP B 1  183  ? 1.290   20.768  104.266 1.00 38.07  ? 183  ASP B CB    1 
ATOM   3231  C  CG    . ASP B 1  183  ? 1.141   19.309  104.667 1.00 49.36  ? 183  ASP B CG    1 
ATOM   3232  O  OD1   . ASP B 1  183  ? 0.912   19.035  105.865 1.00 46.18  ? 183  ASP B OD1   1 
ATOM   3233  O  OD2   . ASP B 1  183  ? 1.261   18.434  103.783 1.00 52.14  ? 183  ASP B OD2   1 
ATOM   3234  N  N     . THR B 1  184  ? 1.976   23.798  105.503 1.00 32.62  ? 184  THR B N     1 
ATOM   3235  C  CA    . THR B 1  184  ? 2.330   25.171  105.173 1.00 37.09  ? 184  THR B CA    1 
ATOM   3236  C  C     . THR B 1  184  ? 3.843   25.271  105.070 1.00 38.82  ? 184  THR B C     1 
ATOM   3237  O  O     . THR B 1  184  ? 4.563   24.420  105.595 1.00 39.67  ? 184  THR B O     1 
ATOM   3238  C  CB    . THR B 1  184  ? 1.804   26.165  106.229 1.00 33.15  ? 184  THR B CB    1 
ATOM   3239  O  OG1   . THR B 1  184  ? 1.817   27.493  105.693 1.00 37.35  ? 184  THR B OG1   1 
ATOM   3240  C  CG2   . THR B 1  184  ? 2.655   26.115  107.491 1.00 30.85  ? 184  THR B CG2   1 
ATOM   3241  N  N     . ARG B 1  185  ? 4.331   26.299  104.386 1.00 46.57  ? 185  ARG B N     1 
ATOM   3242  C  CA    . ARG B 1  185  ? 5.770   26.445  104.207 1.00 56.53  ? 185  ARG B CA    1 
ATOM   3243  C  C     . ARG B 1  185  ? 6.281   27.826  104.603 1.00 59.48  ? 185  ARG B C     1 
ATOM   3244  O  O     . ARG B 1  185  ? 5.667   28.848  104.293 1.00 53.85  ? 185  ARG B O     1 
ATOM   3245  C  CB    . ARG B 1  185  ? 6.185   26.106  102.769 1.00 64.33  ? 185  ARG B CB    1 
ATOM   3246  C  CG    . ARG B 1  185  ? 5.723   27.108  101.722 1.00 60.47  ? 185  ARG B CG    1 
ATOM   3247  C  CD    . ARG B 1  185  ? 6.254   26.759  100.341 1.00 60.61  ? 185  ARG B CD    1 
ATOM   3248  N  NE    . ARG B 1  185  ? 6.246   27.919  99.456  1.00 54.28  ? 185  ARG B NE    1 
ATOM   3249  C  CZ    . ARG B 1  185  ? 7.289   28.721  99.271  1.00 61.64  ? 185  ARG B CZ    1 
ATOM   3250  N  NH1   . ARG B 1  185  ? 8.432   28.483  99.904  1.00 61.41  ? 185  ARG B NH1   1 
ATOM   3251  N  NH2   . ARG B 1  185  ? 7.193   29.759  98.451  1.00 52.06  ? 185  ARG B NH2   1 
ATOM   3252  N  N     . LEU B 1  186  ? 7.401   27.836  105.318 1.00 69.94  ? 186  LEU B N     1 
ATOM   3253  C  CA    . LEU B 1  186  ? 8.118   29.064  105.624 1.00 68.59  ? 186  LEU B CA    1 
ATOM   3254  C  C     . LEU B 1  186  ? 9.517   28.940  105.041 1.00 72.95  ? 186  LEU B C     1 
ATOM   3255  O  O     . LEU B 1  186  ? 10.329  28.147  105.524 1.00 75.11  ? 186  LEU B O     1 
ATOM   3256  C  CB    . LEU B 1  186  ? 8.196   29.277  107.137 1.00 60.57  ? 186  LEU B CB    1 
ATOM   3257  C  CG    . LEU B 1  186  ? 8.985   30.495  107.624 1.00 60.92  ? 186  LEU B CG    1 
ATOM   3258  C  CD1   . LEU B 1  186  ? 8.251   31.787  107.294 1.00 67.60  ? 186  LEU B CD1   1 
ATOM   3259  C  CD2   . LEU B 1  186  ? 9.272   30.398  109.114 1.00 60.40  ? 186  LEU B CD2   1 
ATOM   3260  N  N     . GLY B 1  187  ? 9.801   29.727  104.008 1.00 66.23  ? 187  GLY B N     1 
ATOM   3261  C  CA    . GLY B 1  187  ? 11.067  29.619  103.311 1.00 62.59  ? 187  GLY B CA    1 
ATOM   3262  C  C     . GLY B 1  187  ? 11.229  28.245  102.689 1.00 73.23  ? 187  GLY B C     1 
ATOM   3263  O  O     . GLY B 1  187  ? 10.393  27.807  101.895 1.00 60.56  ? 187  GLY B O     1 
ATOM   3264  N  N     . GLN B 1  188  ? 12.312  27.565  103.053 1.00 80.56  ? 188  GLN B N     1 
ATOM   3265  C  CA    . GLN B 1  188  ? 12.602  26.239  102.517 1.00 81.97  ? 188  GLN B CA    1 
ATOM   3266  C  C     . GLN B 1  188  ? 12.107  25.084  103.396 1.00 91.35  ? 188  GLN B C     1 
ATOM   3267  O  O     . GLN B 1  188  ? 12.384  23.919  103.104 1.00 91.27  ? 188  GLN B O     1 
ATOM   3268  C  CB    . GLN B 1  188  ? 14.095  26.085  102.216 1.00 74.20  ? 188  GLN B CB    1 
ATOM   3269  C  CG    . GLN B 1  188  ? 14.365  25.283  100.957 1.00 83.67  ? 188  GLN B CG    1 
ATOM   3270  C  CD    . GLN B 1  188  ? 13.541  25.773  99.779  1.00 75.71  ? 188  GLN B CD    1 
ATOM   3271  O  OE1   . GLN B 1  188  ? 13.783  26.854  99.243  1.00 71.81  ? 188  GLN B OE1   1 
ATOM   3272  N  NE2   . GLN B 1  188  ? 12.552  24.981  99.378  1.00 64.68  ? 188  GLN B NE2   1 
ATOM   3273  N  N     . ARG B 1  189  ? 11.382  25.401  104.468 1.00 87.31  ? 189  ARG B N     1 
ATOM   3274  C  CA    . ARG B 1  189  ? 10.810  24.365  105.321 1.00 67.19  ? 189  ARG B CA    1 
ATOM   3275  C  C     . ARG B 1  189  ? 9.412   24.048  104.805 1.00 71.74  ? 189  ARG B C     1 
ATOM   3276  O  O     . ARG B 1  189  ? 8.498   24.862  104.929 1.00 71.09  ? 189  ARG B O     1 
ATOM   3277  C  CB    . ARG B 1  189  ? 10.708  24.861  106.764 1.00 69.09  ? 189  ARG B CB    1 
ATOM   3278  C  CG    . ARG B 1  189  ? 11.993  25.421  107.354 1.00 73.38  ? 189  ARG B CG    1 
ATOM   3279  C  CD    . ARG B 1  189  ? 12.839  24.333  107.997 1.00 81.10  ? 189  ARG B CD    1 
ATOM   3280  N  NE    . ARG B 1  189  ? 13.767  24.882  108.983 1.00 84.46  ? 189  ARG B NE    1 
ATOM   3281  C  CZ    . ARG B 1  189  ? 13.534  24.920  110.292 1.00 84.52  ? 189  ARG B CZ    1 
ATOM   3282  N  NH1   . ARG B 1  189  ? 14.435  25.442  111.114 1.00 85.44  ? 189  ARG B NH1   1 
ATOM   3283  N  NH2   . ARG B 1  189  ? 12.400  24.435  110.781 1.00 79.65  ? 189  ARG B NH2   1 
ATOM   3284  N  N     . THR B 1  190  ? 9.252   22.868  104.215 1.00 69.75  ? 190  THR B N     1 
ATOM   3285  C  CA    . THR B 1  190  ? 7.996   22.510  103.558 1.00 75.47  ? 190  THR B CA    1 
ATOM   3286  C  C     . THR B 1  190  ? 7.037   21.606  104.343 1.00 71.56  ? 190  THR B C     1 
ATOM   3287  O  O     . THR B 1  190  ? 5.914   21.355  103.895 1.00 63.62  ? 190  THR B O     1 
ATOM   3288  C  CB    . THR B 1  190  ? 8.282   21.848  102.206 1.00 82.07  ? 190  THR B CB    1 
ATOM   3289  O  OG1   . THR B 1  190  ? 9.242   20.799  102.391 1.00 73.68  ? 190  THR B OG1   1 
ATOM   3290  C  CG2   . THR B 1  190  ? 8.842   22.872  101.229 1.00 77.64  ? 190  THR B CG2   1 
ATOM   3291  N  N     . ASP B 1  191  ? 7.467   21.114  105.499 1.00 54.89  ? 191  ASP B N     1 
ATOM   3292  C  CA    . ASP B 1  191  ? 6.646   20.167  106.253 1.00 57.52  ? 191  ASP B CA    1 
ATOM   3293  C  C     . ASP B 1  191  ? 5.850   20.801  107.394 1.00 54.56  ? 191  ASP B C     1 
ATOM   3294  O  O     . ASP B 1  191  ? 5.161   20.102  108.140 1.00 47.38  ? 191  ASP B O     1 
ATOM   3295  C  CB    . ASP B 1  191  ? 7.486   18.993  106.763 1.00 61.64  ? 191  ASP B CB    1 
ATOM   3296  C  CG    . ASP B 1  191  ? 6.760   17.662  106.640 1.00 67.96  ? 191  ASP B CG    1 
ATOM   3297  O  OD1   . ASP B 1  191  ? 5.522   17.630  106.826 1.00 57.64  ? 191  ASP B OD1   1 
ATOM   3298  O  OD2   . ASP B 1  191  ? 7.429   16.646  106.349 1.00 66.15  ? 191  ASP B OD2   1 
ATOM   3299  N  N     . LEU B 1  192  ? 5.947   22.121  107.524 1.00 45.44  ? 192  LEU B N     1 
ATOM   3300  C  CA    . LEU B 1  192  ? 5.359   22.830  108.657 1.00 31.36  ? 192  LEU B CA    1 
ATOM   3301  C  C     . LEU B 1  192  ? 3.833   22.729  108.704 1.00 32.71  ? 192  LEU B C     1 
ATOM   3302  O  O     . LEU B 1  192  ? 3.178   22.512  107.684 1.00 35.12  ? 192  LEU B O     1 
ATOM   3303  C  CB    . LEU B 1  192  ? 5.804   24.292  108.656 1.00 33.95  ? 192  LEU B CB    1 
ATOM   3304  C  CG    . LEU B 1  192  ? 7.321   24.497  108.670 1.00 38.44  ? 192  LEU B CG    1 
ATOM   3305  C  CD1   . LEU B 1  192  ? 7.670   25.977  108.680 1.00 47.29  ? 192  LEU B CD1   1 
ATOM   3306  C  CD2   . LEU B 1  192  ? 7.959   23.783  109.854 1.00 30.36  ? 192  LEU B CD2   1 
ATOM   3307  N  N     . ASP B 1  193  ? 3.280   22.881  109.903 1.00 28.14  ? 193  ASP B N     1 
ATOM   3308  C  CA    . ASP B 1  193  ? 1.854   22.685  110.135 1.00 27.19  ? 193  ASP B CA    1 
ATOM   3309  C  C     . ASP B 1  193  ? 1.102   23.997  110.319 1.00 29.73  ? 193  ASP B C     1 
ATOM   3310  O  O     . ASP B 1  193  ? 1.620   24.946  110.905 1.00 30.27  ? 193  ASP B O     1 
ATOM   3311  C  CB    . ASP B 1  193  ? 1.635   21.804  111.368 1.00 30.19  ? 193  ASP B CB    1 
ATOM   3312  C  CG    . ASP B 1  193  ? 1.936   20.339  111.104 1.00 37.27  ? 193  ASP B CG    1 
ATOM   3313  O  OD1   . ASP B 1  193  ? 2.535   20.029  110.052 1.00 41.33  ? 193  ASP B OD1   1 
ATOM   3314  O  OD2   . ASP B 1  193  ? 1.574   19.498  111.956 1.00 28.37  ? 193  ASP B OD2   1 
ATOM   3315  N  N     . LYS B 1  194  ? -0.127  24.037  109.815 1.00 29.79  ? 194  LYS B N     1 
ATOM   3316  C  CA    . LYS B 1  194  ? -1.017  25.165  110.047 1.00 28.98  ? 194  LYS B CA    1 
ATOM   3317  C  C     . LYS B 1  194  ? -2.252  24.673  110.792 1.00 30.45  ? 194  LYS B C     1 
ATOM   3318  O  O     . LYS B 1  194  ? -3.076  23.948  110.234 1.00 32.89  ? 194  LYS B O     1 
ATOM   3319  C  CB    . LYS B 1  194  ? -1.426  25.808  108.720 1.00 29.67  ? 194  LYS B CB    1 
ATOM   3320  C  CG    . LYS B 1  194  ? -2.459  26.918  108.856 1.00 28.45  ? 194  LYS B CG    1 
ATOM   3321  C  CD    . LYS B 1  194  ? -3.089  27.258  107.514 1.00 30.02  ? 194  LYS B CD    1 
ATOM   3322  C  CE    . LYS B 1  194  ? -4.198  28.290  107.666 1.00 36.12  ? 194  LYS B CE    1 
ATOM   3323  N  NZ    . LYS B 1  194  ? -4.952  28.496  106.396 1.00 28.76  ? 194  LYS B NZ    1 
ATOM   3324  N  N     . LEU B 1  195  ? -2.380  25.079  112.051 1.00 30.08  ? 195  LEU B N     1 
ATOM   3325  C  CA    . LEU B 1  195  ? -3.472  24.616  112.899 1.00 30.76  ? 195  LEU B CA    1 
ATOM   3326  C  C     . LEU B 1  195  ? -4.672  25.544  112.818 1.00 31.37  ? 195  LEU B C     1 
ATOM   3327  O  O     . LEU B 1  195  ? -4.541  26.750  113.002 1.00 33.85  ? 195  LEU B O     1 
ATOM   3328  C  CB    . LEU B 1  195  ? -3.014  24.503  114.355 1.00 30.76  ? 195  LEU B CB    1 
ATOM   3329  C  CG    . LEU B 1  195  ? -4.115  24.206  115.378 1.00 26.77  ? 195  LEU B CG    1 
ATOM   3330  C  CD1   . LEU B 1  195  ? -4.724  22.825  115.151 1.00 21.61  ? 195  LEU B CD1   1 
ATOM   3331  C  CD2   . LEU B 1  195  ? -3.583  24.338  116.796 1.00 26.45  ? 195  LEU B CD2   1 
ATOM   3332  N  N     . THR B 1  196  ? -5.840  24.973  112.546 1.00 29.11  ? 196  THR B N     1 
ATOM   3333  C  CA    . THR B 1  196  ? -7.077  25.737  112.522 1.00 24.73  ? 196  THR B CA    1 
ATOM   3334  C  C     . THR B 1  196  ? -8.098  25.097  113.451 1.00 31.46  ? 196  THR B C     1 
ATOM   3335  O  O     . THR B 1  196  ? -8.401  23.914  113.324 1.00 30.82  ? 196  THR B O     1 
ATOM   3336  C  CB    . THR B 1  196  ? -7.662  25.821  111.104 1.00 24.36  ? 196  THR B CB    1 
ATOM   3337  O  OG1   . THR B 1  196  ? -6.728  26.479  110.240 1.00 36.11  ? 196  THR B OG1   1 
ATOM   3338  C  CG2   . THR B 1  196  ? -8.968  26.599  111.112 1.00 27.03  ? 196  THR B CG2   1 
ATOM   3339  N  N     . LEU B 1  197  ? -8.617  25.882  114.391 1.00 31.69  ? 197  LEU B N     1 
ATOM   3340  C  CA    . LEU B 1  197  ? -9.618  25.399  115.334 1.00 24.19  ? 197  LEU B CA    1 
ATOM   3341  C  C     . LEU B 1  197  ? -10.946 26.096  115.105 1.00 26.03  ? 197  LEU B C     1 
ATOM   3342  O  O     . LEU B 1  197  ? -10.983 27.291  114.829 1.00 35.47  ? 197  LEU B O     1 
ATOM   3343  C  CB    . LEU B 1  197  ? -9.153  25.631  116.771 1.00 26.27  ? 197  LEU B CB    1 
ATOM   3344  C  CG    . LEU B 1  197  ? -8.668  24.395  117.527 1.00 30.70  ? 197  LEU B CG    1 
ATOM   3345  C  CD1   . LEU B 1  197  ? -7.914  24.795  118.783 1.00 33.37  ? 197  LEU B CD1   1 
ATOM   3346  C  CD2   . LEU B 1  197  ? -9.847  23.505  117.875 1.00 30.43  ? 197  LEU B CD2   1 
ATOM   3347  N  N     . ARG B 1  198  ? -12.034 25.342  115.216 1.00 27.86  ? 198  ARG B N     1 
ATOM   3348  C  CA    . ARG B 1  198  ? -13.373 25.892  115.038 1.00 30.42  ? 198  ARG B CA    1 
ATOM   3349  C  C     . ARG B 1  198  ? -14.267 25.489  116.208 1.00 32.63  ? 198  ARG B C     1 
ATOM   3350  O  O     . ARG B 1  198  ? -14.513 24.304  116.435 1.00 31.39  ? 198  ARG B O     1 
ATOM   3351  C  CB    . ARG B 1  198  ? -13.970 25.423  113.709 1.00 31.22  ? 198  ARG B CB    1 
ATOM   3352  C  CG    . ARG B 1  198  ? -13.210 25.920  112.485 1.00 31.76  ? 198  ARG B CG    1 
ATOM   3353  C  CD    . ARG B 1  198  ? -13.509 25.075  111.259 1.00 27.61  ? 198  ARG B CD    1 
ATOM   3354  N  NE    . ARG B 1  198  ? -14.888 25.223  110.808 1.00 34.79  ? 198  ARG B NE    1 
ATOM   3355  C  CZ    . ARG B 1  198  ? -15.572 24.276  110.173 1.00 36.19  ? 198  ARG B CZ    1 
ATOM   3356  N  NH1   . ARG B 1  198  ? -16.825 24.498  109.796 1.00 31.61  ? 198  ARG B NH1   1 
ATOM   3357  N  NH2   . ARG B 1  198  ? -15.003 23.103  109.923 1.00 25.49  ? 198  ARG B NH2   1 
ATOM   3358  N  N     . ILE B 1  199  ? -14.747 26.481  116.951 1.00 34.25  ? 199  ILE B N     1 
ATOM   3359  C  CA    . ILE B 1  199  ? -15.475 26.227  118.190 1.00 27.17  ? 199  ILE B CA    1 
ATOM   3360  C  C     . ILE B 1  199  ? -16.863 26.863  118.201 1.00 25.23  ? 199  ILE B C     1 
ATOM   3361  O  O     . ILE B 1  199  ? -17.011 28.061  117.966 1.00 33.41  ? 199  ILE B O     1 
ATOM   3362  C  CB    . ILE B 1  199  ? -14.685 26.741  119.408 1.00 23.68  ? 199  ILE B CB    1 
ATOM   3363  C  CG1   . ILE B 1  199  ? -13.236 26.253  119.347 1.00 21.60  ? 199  ILE B CG1   1 
ATOM   3364  C  CG2   . ILE B 1  199  ? -15.353 26.303  120.699 1.00 26.31  ? 199  ILE B CG2   1 
ATOM   3365  C  CD1   . ILE B 1  199  ? -12.377 26.733  120.491 1.00 27.84  ? 199  ILE B CD1   1 
ATOM   3366  N  N     . TRP B 1  200  ? -17.875 26.047  118.476 1.00 22.24  ? 200  TRP B N     1 
ATOM   3367  C  CA    . TRP B 1  200  ? -19.248 26.518  118.598 1.00 26.55  ? 200  TRP B CA    1 
ATOM   3368  C  C     . TRP B 1  200  ? -19.661 26.463  120.061 1.00 30.25  ? 200  TRP B C     1 
ATOM   3369  O  O     . TRP B 1  200  ? -19.547 25.417  120.701 1.00 28.86  ? 200  TRP B O     1 
ATOM   3370  C  CB    . TRP B 1  200  ? -20.201 25.628  117.794 1.00 29.85  ? 200  TRP B CB    1 
ATOM   3371  C  CG    . TRP B 1  200  ? -20.069 25.704  116.296 1.00 33.75  ? 200  TRP B CG    1 
ATOM   3372  C  CD1   . TRP B 1  200  ? -20.927 26.316  115.432 1.00 33.19  ? 200  TRP B CD1   1 
ATOM   3373  C  CD2   . TRP B 1  200  ? -19.035 25.123  115.489 1.00 32.38  ? 200  TRP B CD2   1 
ATOM   3374  N  NE1   . TRP B 1  200  ? -20.489 26.163  114.139 1.00 31.82  ? 200  TRP B NE1   1 
ATOM   3375  C  CE2   . TRP B 1  200  ? -19.329 25.435  114.148 1.00 30.74  ? 200  TRP B CE2   1 
ATOM   3376  C  CE3   . TRP B 1  200  ? -17.887 24.376  115.770 1.00 30.80  ? 200  TRP B CE3   1 
ATOM   3377  C  CZ2   . TRP B 1  200  ? -18.517 25.027  113.092 1.00 35.86  ? 200  TRP B CZ2   1 
ATOM   3378  C  CZ3   . TRP B 1  200  ? -17.083 23.973  114.721 1.00 29.38  ? 200  TRP B CZ3   1 
ATOM   3379  C  CH2   . TRP B 1  200  ? -17.401 24.299  113.399 1.00 32.80  ? 200  TRP B CH2   1 
ATOM   3380  N  N     . THR B 1  201  ? -20.145 27.580  120.594 1.00 34.69  ? 201  THR B N     1 
ATOM   3381  C  CA    . THR B 1  201  ? -20.659 27.588  121.961 1.00 36.33  ? 201  THR B CA    1 
ATOM   3382  C  C     . THR B 1  201  ? -22.112 28.053  122.008 1.00 36.67  ? 201  THR B C     1 
ATOM   3383  O  O     . THR B 1  201  ? -22.700 28.377  120.976 1.00 37.00  ? 201  THR B O     1 
ATOM   3384  C  CB    . THR B 1  201  ? -19.812 28.467  122.901 1.00 33.24  ? 201  THR B CB    1 
ATOM   3385  O  OG1   . THR B 1  201  ? -20.098 29.850  122.661 1.00 41.15  ? 201  THR B OG1   1 
ATOM   3386  C  CG2   . THR B 1  201  ? -18.324 28.208  122.698 1.00 32.54  ? 201  THR B CG2   1 
ATOM   3387  N  N     . ASP B 1  202  ? -22.687 28.081  123.207 1.00 36.09  ? 202  ASP B N     1 
ATOM   3388  C  CA    . ASP B 1  202  ? -24.074 28.506  123.374 1.00 38.79  ? 202  ASP B CA    1 
ATOM   3389  C  C     . ASP B 1  202  ? -24.177 29.991  123.706 1.00 37.41  ? 202  ASP B C     1 
ATOM   3390  O  O     . ASP B 1  202  ? -25.274 30.537  123.822 1.00 40.41  ? 202  ASP B O     1 
ATOM   3391  C  CB    . ASP B 1  202  ? -24.791 27.663  124.437 1.00 35.96  ? 202  ASP B CB    1 
ATOM   3392  C  CG    . ASP B 1  202  ? -24.052 27.630  125.766 1.00 41.30  ? 202  ASP B CG    1 
ATOM   3393  O  OD1   . ASP B 1  202  ? -23.121 28.440  125.965 1.00 40.41  ? 202  ASP B OD1   1 
ATOM   3394  O  OD2   . ASP B 1  202  ? -24.412 26.792  126.621 1.00 36.68  ? 202  ASP B OD2   1 
ATOM   3395  N  N     . GLY B 1  203  ? -23.026 30.638  123.853 1.00 36.04  ? 203  GLY B N     1 
ATOM   3396  C  CA    . GLY B 1  203  ? -22.981 32.059  124.142 1.00 40.86  ? 203  GLY B CA    1 
ATOM   3397  C  C     . GLY B 1  203  ? -22.721 32.358  125.605 1.00 45.83  ? 203  GLY B C     1 
ATOM   3398  O  O     . GLY B 1  203  ? -22.278 33.455  125.950 1.00 48.72  ? 203  GLY B O     1 
ATOM   3399  N  N     . SER B 1  204  ? -23.000 31.384  126.467 1.00 40.02  ? 204  SER B N     1 
ATOM   3400  C  CA    . SER B 1  204  ? -22.738 31.530  127.894 1.00 39.00  ? 204  SER B CA    1 
ATOM   3401  C  C     . SER B 1  204  ? -21.245 31.734  128.125 1.00 41.33  ? 204  SER B C     1 
ATOM   3402  O  O     . SER B 1  204  ? -20.834 32.539  128.961 1.00 48.73  ? 204  SER B O     1 
ATOM   3403  C  CB    . SER B 1  204  ? -23.237 30.304  128.663 1.00 36.93  ? 204  SER B CB    1 
ATOM   3404  O  OG    . SER B 1  204  ? -22.645 29.114  128.172 1.00 37.83  ? 204  SER B OG    1 
ATOM   3405  N  N     . VAL B 1  205  ? -20.440 30.990  127.375 1.00 38.83  ? 205  VAL B N     1 
ATOM   3406  C  CA    . VAL B 1  205  ? -18.996 31.167  127.366 1.00 35.06  ? 205  VAL B CA    1 
ATOM   3407  C  C     . VAL B 1  205  ? -18.572 31.289  125.910 1.00 35.79  ? 205  VAL B C     1 
ATOM   3408  O  O     . VAL B 1  205  ? -18.915 30.437  125.097 1.00 44.03  ? 205  VAL B O     1 
ATOM   3409  C  CB    . VAL B 1  205  ? -18.276 29.962  127.996 1.00 32.64  ? 205  VAL B CB    1 
ATOM   3410  C  CG1   . VAL B 1  205  ? -16.801 30.267  128.186 1.00 32.81  ? 205  VAL B CG1   1 
ATOM   3411  C  CG2   . VAL B 1  205  ? -18.917 29.585  129.324 1.00 36.94  ? 205  VAL B CG2   1 
ATOM   3412  N  N     . THR B 1  206  ? -17.840 32.346  125.572 1.00 32.20  ? 206  THR B N     1 
ATOM   3413  C  CA    . THR B 1  206  ? -17.436 32.571  124.186 1.00 33.90  ? 206  THR B CA    1 
ATOM   3414  C  C     . THR B 1  206  ? -16.392 31.541  123.750 1.00 36.63  ? 206  THR B C     1 
ATOM   3415  O  O     . THR B 1  206  ? -15.734 30.930  124.594 1.00 38.69  ? 206  THR B O     1 
ATOM   3416  C  CB    . THR B 1  206  ? -16.881 33.996  123.978 1.00 32.08  ? 206  THR B CB    1 
ATOM   3417  O  OG1   . THR B 1  206  ? -15.491 34.029  124.316 1.00 39.46  ? 206  THR B OG1   1 
ATOM   3418  C  CG2   . THR B 1  206  ? -17.642 34.998  124.826 1.00 36.00  ? 206  THR B CG2   1 
ATOM   3419  N  N     . PRO B 1  207  ? -16.252 31.325  122.430 1.00 36.59  ? 207  PRO B N     1 
ATOM   3420  C  CA    . PRO B 1  207  ? -15.229 30.397  121.936 1.00 42.59  ? 207  PRO B CA    1 
ATOM   3421  C  C     . PRO B 1  207  ? -13.818 30.765  122.399 1.00 38.07  ? 207  PRO B C     1 
ATOM   3422  O  O     . PRO B 1  207  ? -13.067 29.880  122.811 1.00 31.83  ? 207  PRO B O     1 
ATOM   3423  C  CB    . PRO B 1  207  ? -15.343 30.540  120.416 1.00 38.33  ? 207  PRO B CB    1 
ATOM   3424  C  CG    . PRO B 1  207  ? -16.763 30.903  120.192 1.00 34.18  ? 207  PRO B CG    1 
ATOM   3425  C  CD    . PRO B 1  207  ? -17.138 31.787  121.345 1.00 35.28  ? 207  PRO B CD    1 
ATOM   3426  N  N     . LEU B 1  208  ? -13.467 32.047  122.336 1.00 35.59  ? 208  LEU B N     1 
ATOM   3427  C  CA    . LEU B 1  208  ? -12.144 32.485  122.768 1.00 38.01  ? 208  LEU B CA    1 
ATOM   3428  C  C     . LEU B 1  208  ? -11.954 32.219  124.258 1.00 38.88  ? 208  LEU B C     1 
ATOM   3429  O  O     . LEU B 1  208  ? -10.889 31.769  124.689 1.00 35.57  ? 208  LEU B O     1 
ATOM   3430  C  CB    . LEU B 1  208  ? -11.919 33.966  122.454 1.00 32.27  ? 208  LEU B CB    1 
ATOM   3431  C  CG    . LEU B 1  208  ? -10.589 34.540  122.954 1.00 34.63  ? 208  LEU B CG    1 
ATOM   3432  C  CD1   . LEU B 1  208  ? -9.412  33.724  122.436 1.00 34.38  ? 208  LEU B CD1   1 
ATOM   3433  C  CD2   . LEU B 1  208  ? -10.443 36.001  122.560 1.00 39.79  ? 208  LEU B CD2   1 
ATOM   3434  N  N     . GLU B 1  209  ? -12.993 32.496  125.038 1.00 34.60  ? 209  GLU B N     1 
ATOM   3435  C  CA    . GLU B 1  209  ? -12.977 32.186  126.459 1.00 35.54  ? 209  GLU B CA    1 
ATOM   3436  C  C     . GLU B 1  209  ? -12.823 30.684  126.652 1.00 34.57  ? 209  GLU B C     1 
ATOM   3437  O  O     . GLU B 1  209  ? -12.050 30.234  127.497 1.00 34.79  ? 209  GLU B O     1 
ATOM   3438  C  CB    . GLU B 1  209  ? -14.258 32.680  127.133 1.00 35.08  ? 209  GLU B CB    1 
ATOM   3439  C  CG    . GLU B 1  209  ? -14.352 34.193  127.247 1.00 42.30  ? 209  GLU B CG    1 
ATOM   3440  C  CD    . GLU B 1  209  ? -15.706 34.658  127.746 1.00 41.64  ? 209  GLU B CD    1 
ATOM   3441  O  OE1   . GLU B 1  209  ? -15.972 35.877  127.689 1.00 48.11  ? 209  GLU B OE1   1 
ATOM   3442  O  OE2   . GLU B 1  209  ? -16.504 33.807  128.194 1.00 42.86  ? 209  GLU B OE2   1 
ATOM   3443  N  N     . ALA B 1  210  ? -13.553 29.915  125.851 1.00 33.58  ? 210  ALA B N     1 
ATOM   3444  C  CA    . ALA B 1  210  ? -13.486 28.461  125.913 1.00 33.80  ? 210  ALA B CA    1 
ATOM   3445  C  C     . ALA B 1  210  ? -12.068 27.958  125.648 1.00 36.19  ? 210  ALA B C     1 
ATOM   3446  O  O     . ALA B 1  210  ? -11.534 27.160  126.422 1.00 34.08  ? 210  ALA B O     1 
ATOM   3447  C  CB    . ALA B 1  210  ? -14.469 27.840  124.931 1.00 29.63  ? 210  ALA B CB    1 
ATOM   3448  N  N     . LEU B 1  211  ? -11.461 28.432  124.562 1.00 33.14  ? 211  LEU B N     1 
ATOM   3449  C  CA    . LEU B 1  211  ? -10.102 28.029  124.209 1.00 35.52  ? 211  LEU B CA    1 
ATOM   3450  C  C     . LEU B 1  211  ? -9.105  28.424  125.298 1.00 37.35  ? 211  LEU B C     1 
ATOM   3451  O  O     . LEU B 1  211  ? -8.219  27.642  125.655 1.00 33.33  ? 211  LEU B O     1 
ATOM   3452  C  CB    . LEU B 1  211  ? -9.681  28.630  122.864 1.00 36.15  ? 211  LEU B CB    1 
ATOM   3453  C  CG    . LEU B 1  211  ? -8.276  28.257  122.375 1.00 31.03  ? 211  LEU B CG    1 
ATOM   3454  C  CD1   . LEU B 1  211  ? -8.213  26.792  121.962 1.00 23.38  ? 211  LEU B CD1   1 
ATOM   3455  C  CD2   . LEU B 1  211  ? -7.821  29.165  121.237 1.00 34.31  ? 211  LEU B CD2   1 
ATOM   3456  N  N     . ASN B 1  212  ? -9.256  29.637  125.823 1.00 36.22  ? 212  ASN B N     1 
ATOM   3457  C  CA    . ASN B 1  212  ? -8.397  30.117  126.899 1.00 30.48  ? 212  ASN B CA    1 
ATOM   3458  C  C     . ASN B 1  212  ? -8.508  29.253  128.149 1.00 31.69  ? 212  ASN B C     1 
ATOM   3459  O  O     . ASN B 1  212  ? -7.499  28.903  128.763 1.00 29.69  ? 212  ASN B O     1 
ATOM   3460  C  CB    . ASN B 1  212  ? -8.710  31.576  127.228 1.00 30.51  ? 212  ASN B CB    1 
ATOM   3461  C  CG    . ASN B 1  212  ? -8.233  32.529  126.151 1.00 36.29  ? 212  ASN B CG    1 
ATOM   3462  O  OD1   . ASN B 1  212  ? -7.169  32.336  125.563 1.00 36.90  ? 212  ASN B OD1   1 
ATOM   3463  N  ND2   . ASN B 1  212  ? -9.022  33.563  125.882 1.00 40.43  ? 212  ASN B ND2   1 
ATOM   3464  N  N     . GLN B 1  213  ? -9.737  28.905  128.518 1.00 30.59  ? 213  GLN B N     1 
ATOM   3465  C  CA    . GLN B 1  213  ? -9.965  28.023  129.653 1.00 28.12  ? 213  GLN B CA    1 
ATOM   3466  C  C     . GLN B 1  213  ? -9.382  26.646  129.368 1.00 28.94  ? 213  GLN B C     1 
ATOM   3467  O  O     . GLN B 1  213  ? -8.851  25.987  130.263 1.00 28.49  ? 213  GLN B O     1 
ATOM   3468  C  CB    . GLN B 1  213  ? -11.460 27.911  129.968 1.00 33.78  ? 213  GLN B CB    1 
ATOM   3469  C  CG    . GLN B 1  213  ? -12.091 29.195  130.504 1.00 35.52  ? 213  GLN B CG    1 
ATOM   3470  C  CD    . GLN B 1  213  ? -13.557 29.028  130.874 1.00 31.47  ? 213  GLN B CD    1 
ATOM   3471  O  OE1   . GLN B 1  213  ? -13.999 27.942  131.251 1.00 34.06  ? 213  GLN B OE1   1 
ATOM   3472  N  NE2   . GLN B 1  213  ? -14.318 30.111  130.767 1.00 38.14  ? 213  GLN B NE2   1 
ATOM   3473  N  N     . ALA B 1  214  ? -9.469  26.225  128.110 1.00 35.80  ? 214  ALA B N     1 
ATOM   3474  C  CA    . ALA B 1  214  ? -8.984  24.910  127.702 1.00 31.20  ? 214  ALA B CA    1 
ATOM   3475  C  C     . ALA B 1  214  ? -7.465  24.787  127.800 1.00 26.66  ? 214  ALA B C     1 
ATOM   3476  O  O     . ALA B 1  214  ? -6.953  23.801  128.328 1.00 27.02  ? 214  ALA B O     1 
ATOM   3477  C  CB    . ALA B 1  214  ? -9.456  24.584  126.294 1.00 26.48  ? 214  ALA B CB    1 
ATOM   3478  N  N     . VAL B 1  215  ? -6.747  25.786  127.295 1.00 23.45  ? 215  VAL B N     1 
ATOM   3479  C  CA    . VAL B 1  215  ? -5.287  25.750  127.320 1.00 28.50  ? 215  VAL B CA    1 
ATOM   3480  C  C     . VAL B 1  215  ? -4.743  25.890  128.742 1.00 34.92  ? 215  VAL B C     1 
ATOM   3481  O  O     . VAL B 1  215  ? -3.666  25.379  129.058 1.00 33.86  ? 215  VAL B O     1 
ATOM   3482  C  CB    . VAL B 1  215  ? -4.656  26.825  126.402 1.00 28.75  ? 215  VAL B CB    1 
ATOM   3483  C  CG1   . VAL B 1  215  ? -5.106  26.627  124.965 1.00 32.24  ? 215  VAL B CG1   1 
ATOM   3484  C  CG2   . VAL B 1  215  ? -5.011  28.217  126.878 1.00 39.79  ? 215  VAL B CG2   1 
ATOM   3485  N  N     . GLU B 1  216  ? -5.496  26.577  129.598 1.00 33.45  ? 216  GLU B N     1 
ATOM   3486  C  CA    . GLU B 1  216  ? -5.104  26.747  130.992 1.00 31.21  ? 216  GLU B CA    1 
ATOM   3487  C  C     . GLU B 1  216  ? -5.192  25.422  131.742 1.00 29.81  ? 216  GLU B C     1 
ATOM   3488  O  O     . GLU B 1  216  ? -4.291  25.071  132.506 1.00 31.97  ? 216  GLU B O     1 
ATOM   3489  C  CB    . GLU B 1  216  ? -5.972  27.809  131.671 1.00 30.59  ? 216  GLU B CB    1 
ATOM   3490  C  CG    . GLU B 1  216  ? -5.787  27.905  133.180 1.00 31.09  ? 216  GLU B CG    1 
ATOM   3491  C  CD    . GLU B 1  216  ? -4.361  28.233  133.585 1.00 37.86  ? 216  GLU B CD    1 
ATOM   3492  O  OE1   . GLU B 1  216  ? -3.943  27.802  134.681 1.00 41.05  ? 216  GLU B OE1   1 
ATOM   3493  O  OE2   . GLU B 1  216  ? -3.659  28.924  132.816 1.00 33.29  ? 216  GLU B OE2   1 
ATOM   3494  N  N     . ILE B 1  217  ? -6.283  24.695  131.517 1.00 23.78  ? 217  ILE B N     1 
ATOM   3495  C  CA    . ILE B 1  217  ? -6.467  23.375  132.104 1.00 23.48  ? 217  ILE B CA    1 
ATOM   3496  C  C     . ILE B 1  217  ? -5.300  22.465  131.740 1.00 27.89  ? 217  ILE B C     1 
ATOM   3497  O  O     . ILE B 1  217  ? -4.773  21.742  132.587 1.00 27.92  ? 217  ILE B O     1 
ATOM   3498  C  CB    . ILE B 1  217  ? -7.787  22.731  131.625 1.00 25.47  ? 217  ILE B CB    1 
ATOM   3499  C  CG1   . ILE B 1  217  ? -8.985  23.482  132.203 1.00 22.78  ? 217  ILE B CG1   1 
ATOM   3500  C  CG2   . ILE B 1  217  ? -7.853  21.261  132.017 1.00 20.32  ? 217  ILE B CG2   1 
ATOM   3501  C  CD1   . ILE B 1  217  ? -10.318 22.933  131.757 1.00 23.27  ? 217  ILE B CD1   1 
ATOM   3502  N  N     . LEU B 1  218  ? -4.888  22.524  130.478 1.00 26.76  ? 218  LEU B N     1 
ATOM   3503  C  CA    . LEU B 1  218  ? -3.806  21.684  129.981 1.00 28.27  ? 218  LEU B CA    1 
ATOM   3504  C  C     . LEU B 1  218  ? -2.478  22.027  130.648 1.00 30.63  ? 218  LEU B C     1 
ATOM   3505  O  O     . LEU B 1  218  ? -1.773  21.139  131.131 1.00 27.84  ? 218  LEU B O     1 
ATOM   3506  C  CB    . LEU B 1  218  ? -3.683  21.812  128.461 1.00 30.15  ? 218  LEU B CB    1 
ATOM   3507  C  CG    . LEU B 1  218  ? -2.636  20.930  127.777 1.00 23.26  ? 218  LEU B CG    1 
ATOM   3508  C  CD1   . LEU B 1  218  ? -2.849  19.468  128.128 1.00 22.06  ? 218  LEU B CD1   1 
ATOM   3509  C  CD2   . LEU B 1  218  ? -2.688  21.130  126.275 1.00 23.99  ? 218  LEU B CD2   1 
ATOM   3510  N  N     . ARG B 1  219  ? -2.148  23.316  130.670 1.00 31.04  ? 219  ARG B N     1 
ATOM   3511  C  CA    . ARG B 1  219  ? -0.908  23.785  131.277 1.00 30.07  ? 219  ARG B CA    1 
ATOM   3512  C  C     . ARG B 1  219  ? -0.830  23.361  132.736 1.00 32.63  ? 219  ARG B C     1 
ATOM   3513  O  O     . ARG B 1  219  ? 0.218   22.921  133.213 1.00 32.17  ? 219  ARG B O     1 
ATOM   3514  C  CB    . ARG B 1  219  ? -0.802  25.307  131.182 1.00 27.03  ? 219  ARG B CB    1 
ATOM   3515  C  CG    . ARG B 1  219  ? 0.509   25.858  131.721 1.00 37.61  ? 219  ARG B CG    1 
ATOM   3516  C  CD    . ARG B 1  219  ? 0.391   27.328  132.082 1.00 39.19  ? 219  ARG B CD    1 
ATOM   3517  N  NE    . ARG B 1  219  ? -0.703  27.567  133.022 1.00 40.77  ? 219  ARG B NE    1 
ATOM   3518  C  CZ    . ARG B 1  219  ? -0.625  27.351  134.332 1.00 46.21  ? 219  ARG B CZ    1 
ATOM   3519  N  NH1   . ARG B 1  219  ? 0.496   26.885  134.868 1.00 42.37  ? 219  ARG B NH1   1 
ATOM   3520  N  NH2   . ARG B 1  219  ? -1.672  27.597  135.109 1.00 41.99  ? 219  ARG B NH2   1 
ATOM   3521  N  N     . GLU B 1  220  ? -1.953  23.494  133.433 1.00 31.26  ? 220  GLU B N     1 
ATOM   3522  C  CA    . GLU B 1  220  ? -2.044  23.126  134.839 1.00 35.53  ? 220  GLU B CA    1 
ATOM   3523  C  C     . GLU B 1  220  ? -1.807  21.631  135.033 1.00 33.77  ? 220  GLU B C     1 
ATOM   3524  O  O     . GLU B 1  220  ? -1.233  21.209  136.037 1.00 34.06  ? 220  GLU B O     1 
ATOM   3525  C  CB    . GLU B 1  220  ? -3.409  23.527  135.402 1.00 39.75  ? 220  GLU B CB    1 
ATOM   3526  C  CG    . GLU B 1  220  ? -3.600  23.218  136.877 1.00 41.46  ? 220  GLU B CG    1 
ATOM   3527  C  CD    . GLU B 1  220  ? -4.934  23.710  137.400 1.00 49.69  ? 220  GLU B CD    1 
ATOM   3528  O  OE1   . GLU B 1  220  ? -5.673  24.356  136.625 1.00 29.35  ? 220  GLU B OE1   1 
ATOM   3529  O  OE2   . GLU B 1  220  ? -5.243  23.452  138.584 1.00 59.90  ? 220  GLU B OE2   1 
ATOM   3530  N  N     . HIS B 1  221  ? -2.251  20.834  134.066 1.00 34.50  ? 221  HIS B N     1 
ATOM   3531  C  CA    . HIS B 1  221  ? -2.043  19.391  134.118 1.00 33.97  ? 221  HIS B CA    1 
ATOM   3532  C  C     . HIS B 1  221  ? -0.581  19.038  133.881 1.00 36.49  ? 221  HIS B C     1 
ATOM   3533  O  O     . HIS B 1  221  ? -0.111  17.988  134.319 1.00 40.88  ? 221  HIS B O     1 
ATOM   3534  C  CB    . HIS B 1  221  ? -2.934  18.665  133.105 1.00 30.96  ? 221  HIS B CB    1 
ATOM   3535  C  CG    . HIS B 1  221  ? -4.246  18.214  133.668 1.00 27.07  ? 221  HIS B CG    1 
ATOM   3536  N  ND1   . HIS B 1  221  ? -5.340  19.047  133.767 1.00 25.77  ? 221  HIS B ND1   1 
ATOM   3537  C  CD2   . HIS B 1  221  ? -4.638  17.018  134.167 1.00 27.56  ? 221  HIS B CD2   1 
ATOM   3538  C  CE1   . HIS B 1  221  ? -6.349  18.383  134.301 1.00 26.82  ? 221  HIS B CE1   1 
ATOM   3539  N  NE2   . HIS B 1  221  ? -5.949  17.149  134.553 1.00 26.86  ? 221  HIS B NE2   1 
ATOM   3540  N  N     . LEU B 1  222  ? 0.133   19.919  133.187 1.00 35.25  ? 222  LEU B N     1 
ATOM   3541  C  CA    . LEU B 1  222  ? 1.550   19.708  132.909 1.00 34.97  ? 222  LEU B CA    1 
ATOM   3542  C  C     . LEU B 1  222  ? 2.397   19.923  134.158 1.00 34.21  ? 222  LEU B C     1 
ATOM   3543  O  O     . LEU B 1  222  ? 3.503   19.394  134.269 1.00 37.95  ? 222  LEU B O     1 
ATOM   3544  C  CB    . LEU B 1  222  ? 2.020   20.626  131.779 1.00 31.80  ? 222  LEU B CB    1 
ATOM   3545  C  CG    . LEU B 1  222  ? 1.474   20.273  130.395 1.00 32.11  ? 222  LEU B CG    1 
ATOM   3546  C  CD1   . LEU B 1  222  ? 1.940   21.278  129.355 1.00 30.01  ? 222  LEU B CD1   1 
ATOM   3547  C  CD2   . LEU B 1  222  ? 1.893   18.862  130.006 1.00 29.08  ? 222  LEU B CD2   1 
ATOM   3548  N  N     . THR B 1  223  ? 1.864   20.694  135.100 1.00 35.33  ? 223  THR B N     1 
ATOM   3549  C  CA    . THR B 1  223  ? 2.558   20.977  136.351 1.00 35.02  ? 223  THR B CA    1 
ATOM   3550  C  C     . THR B 1  223  ? 2.490   19.788  137.306 1.00 37.90  ? 223  THR B C     1 
ATOM   3551  O  O     . THR B 1  223  ? 3.107   19.801  138.370 1.00 44.74  ? 223  THR B O     1 
ATOM   3552  C  CB    . THR B 1  223  ? 1.964   22.208  137.056 1.00 29.17  ? 223  THR B CB    1 
ATOM   3553  O  OG1   . THR B 1  223  ? 0.660   21.892  137.557 1.00 30.58  ? 223  THR B OG1   1 
ATOM   3554  C  CG2   . THR B 1  223  ? 1.864   23.377  136.090 1.00 28.30  ? 223  THR B CG2   1 
ATOM   3555  N  N     . TYR B 1  224  ? 1.735   18.764  136.921 1.00 34.75  ? 224  TYR B N     1 
ATOM   3556  C  CA    . TYR B 1  224  ? 1.530   17.597  137.772 1.00 35.27  ? 224  TYR B CA    1 
ATOM   3557  C  C     . TYR B 1  224  ? 2.697   16.614  137.705 1.00 35.41  ? 224  TYR B C     1 
ATOM   3558  O  O     . TYR B 1  224  ? 2.735   15.633  138.446 1.00 35.60  ? 224  TYR B O     1 
ATOM   3559  C  CB    . TYR B 1  224  ? 0.220   16.897  137.406 1.00 30.41  ? 224  TYR B CB    1 
ATOM   3560  C  CG    . TYR B 1  224  ? -1.011  17.728  137.695 1.00 37.38  ? 224  TYR B CG    1 
ATOM   3561  C  CD1   . TYR B 1  224  ? -0.966  18.776  138.606 1.00 38.25  ? 224  TYR B CD1   1 
ATOM   3562  C  CD2   . TYR B 1  224  ? -2.218  17.463  137.061 1.00 42.07  ? 224  TYR B CD2   1 
ATOM   3563  C  CE1   . TYR B 1  224  ? -2.088  19.539  138.876 1.00 39.32  ? 224  TYR B CE1   1 
ATOM   3564  C  CE2   . TYR B 1  224  ? -3.348  18.219  137.327 1.00 39.03  ? 224  TYR B CE2   1 
ATOM   3565  C  CZ    . TYR B 1  224  ? -3.276  19.257  138.235 1.00 41.71  ? 224  TYR B CZ    1 
ATOM   3566  O  OH    . TYR B 1  224  ? -4.395  20.016  138.503 1.00 44.71  ? 224  TYR B OH    1 
ATOM   3567  N  N     . PHE B 1  225  ? 3.646   16.888  136.816 1.00 38.04  ? 225  PHE B N     1 
ATOM   3568  C  CA    . PHE B 1  225  ? 4.842   16.062  136.676 1.00 43.94  ? 225  PHE B CA    1 
ATOM   3569  C  C     . PHE B 1  225  ? 5.985   16.613  137.527 1.00 54.88  ? 225  PHE B C     1 
ATOM   3570  O  O     . PHE B 1  225  ? 7.113   16.120  137.467 1.00 50.00  ? 225  PHE B O     1 
ATOM   3571  C  CB    . PHE B 1  225  ? 5.268   15.982  135.208 1.00 35.70  ? 225  PHE B CB    1 
ATOM   3572  C  CG    . PHE B 1  225  ? 4.225   15.388  134.307 1.00 32.95  ? 225  PHE B CG    1 
ATOM   3573  C  CD1   . PHE B 1  225  ? 3.270   16.191  133.706 1.00 34.22  ? 225  PHE B CD1   1 
ATOM   3574  C  CD2   . PHE B 1  225  ? 4.198   14.026  134.062 1.00 28.39  ? 225  PHE B CD2   1 
ATOM   3575  C  CE1   . PHE B 1  225  ? 2.306   15.646  132.879 1.00 27.53  ? 225  PHE B CE1   1 
ATOM   3576  C  CE2   . PHE B 1  225  ? 3.238   13.477  133.235 1.00 26.49  ? 225  PHE B CE2   1 
ATOM   3577  C  CZ    . PHE B 1  225  ? 2.291   14.288  132.644 1.00 23.23  ? 225  PHE B CZ    1 
ATOM   3578  N  N     . SER B 1  226  ? 5.679   17.640  138.315 1.00 63.34  ? 226  SER B N     1 
ATOM   3579  C  CA    . SER B 1  226  ? 6.689   18.395  139.053 1.00 58.94  ? 226  SER B CA    1 
ATOM   3580  C  C     . SER B 1  226  ? 7.256   17.673  140.278 1.00 64.36  ? 226  SER B C     1 
ATOM   3581  O  O     . SER B 1  226  ? 8.432   17.310  140.302 1.00 62.57  ? 226  SER B O     1 
ATOM   3582  C  CB    . SER B 1  226  ? 6.121   19.753  139.474 1.00 56.82  ? 226  SER B CB    1 
ATOM   3583  O  OG    . SER B 1  226  ? 5.644   20.477  138.352 1.00 54.31  ? 226  SER B OG    1 
ATOM   3584  N  N     . ASN B 1  227  ? 6.427   17.477  141.297 1.00 63.02  ? 227  ASN B N     1 
ATOM   3585  C  CA    . ASN B 1  227  ? 6.913   16.947  142.567 1.00 58.53  ? 227  ASN B CA    1 
ATOM   3586  C  C     . ASN B 1  227  ? 6.437   15.528  142.878 1.00 57.74  ? 227  ASN B C     1 
ATOM   3587  O  O     . ASN B 1  227  ? 5.262   15.312  143.176 1.00 58.58  ? 227  ASN B O     1 
ATOM   3588  C  CB    . ASN B 1  227  ? 6.538   17.894  143.708 1.00 56.96  ? 227  ASN B CB    1 
ATOM   3589  C  CG    . ASN B 1  227  ? 7.055   17.420  145.048 1.00 71.45  ? 227  ASN B CG    1 
ATOM   3590  O  OD1   . ASN B 1  227  ? 6.333   16.783  145.815 1.00 75.81  ? 227  ASN B OD1   1 
ATOM   3591  N  ND2   . ASN B 1  227  ? 8.316   17.725  145.337 1.00 69.95  ? 227  ASN B ND2   1 
ATOM   3592  N  N     . PRO B 1  228  ? 7.360   14.554  142.811 1.00 53.87  ? 228  PRO B N     1 
ATOM   3593  C  CA    . PRO B 1  228  ? 7.074   13.143  143.104 1.00 51.38  ? 228  PRO B CA    1 
ATOM   3594  C  C     . PRO B 1  228  ? 6.857   12.887  144.594 1.00 46.31  ? 228  PRO B C     1 
ATOM   3595  O  O     . PRO B 1  228  ? 6.823   11.725  145.009 1.00 35.05  ? 228  PRO B O     1 
ATOM   3596  C  CB    . PRO B 1  228  ? 8.343   12.423  142.628 1.00 42.10  ? 228  PRO B CB    1 
ATOM   3597  C  CG    . PRO B 1  228  ? 9.029   13.394  141.710 1.00 35.44  ? 228  PRO B CG    1 
ATOM   3598  C  CD    . PRO B 1  228  ? 8.720   14.737  142.280 1.00 48.67  ? 228  PRO B CD    1 
ATOM   3599  N  N     . MET C 2  1    ? 18.868  -17.287 114.422 1.00 72.76  ? 1    MET C N     1 
ATOM   3600  C  CA    . MET C 2  1    ? 17.474  -17.556 114.756 1.00 67.63  ? 1    MET C CA    1 
ATOM   3601  C  C     . MET C 2  1    ? 17.025  -18.912 114.220 1.00 69.60  ? 1    MET C C     1 
ATOM   3602  O  O     . MET C 2  1    ? 17.630  -19.461 113.299 1.00 74.22  ? 1    MET C O     1 
ATOM   3603  C  CB    . MET C 2  1    ? 16.570  -16.453 114.209 1.00 60.03  ? 1    MET C CB    1 
ATOM   3604  C  CG    . MET C 2  1    ? 16.590  -16.338 112.696 1.00 64.43  ? 1    MET C CG    1 
ATOM   3605  S  SD    . MET C 2  1    ? 15.694  -14.887 112.117 1.00 89.82  ? 1    MET C SD    1 
ATOM   3606  C  CE    . MET C 2  1    ? 16.570  -13.581 112.977 1.00 65.48  ? 1    MET C CE    1 
ATOM   3607  N  N     . GLU C 2  2    ? 15.953  -19.440 114.802 1.00 61.90  ? 2    GLU C N     1 
ATOM   3608  C  CA    . GLU C 2  2    ? 15.445  -20.758 114.438 1.00 62.39  ? 2    GLU C CA    1 
ATOM   3609  C  C     . GLU C 2  2    ? 14.611  -20.728 113.158 1.00 54.60  ? 2    GLU C C     1 
ATOM   3610  O  O     . GLU C 2  2    ? 13.758  -19.857 112.977 1.00 44.48  ? 2    GLU C O     1 
ATOM   3611  C  CB    . GLU C 2  2    ? 14.617  -21.339 115.588 1.00 54.87  ? 2    GLU C CB    1 
ATOM   3612  C  CG    . GLU C 2  2    ? 13.971  -22.681 115.280 1.00 55.56  ? 2    GLU C CG    1 
ATOM   3613  C  CD    . GLU C 2  2    ? 13.036  -23.138 116.381 1.00 58.82  ? 2    GLU C CD    1 
ATOM   3614  O  OE1   . GLU C 2  2    ? 13.071  -22.537 117.475 1.00 57.63  ? 2    GLU C OE1   1 
ATOM   3615  O  OE2   . GLU C 2  2    ? 12.263  -24.092 116.151 1.00 66.68  ? 2    GLU C OE2   1 
ATOM   3616  N  N     . ILE C 2  3    ? 14.864  -21.688 112.274 1.00 47.28  ? 3    ILE C N     1 
ATOM   3617  C  CA    . ILE C 2  3    ? 14.069  -21.842 111.065 1.00 42.22  ? 3    ILE C CA    1 
ATOM   3618  C  C     . ILE C 2  3    ? 13.197  -23.090 111.189 1.00 44.37  ? 3    ILE C C     1 
ATOM   3619  O  O     . ILE C 2  3    ? 13.701  -24.213 111.153 1.00 49.15  ? 3    ILE C O     1 
ATOM   3620  C  CB    . ILE C 2  3    ? 14.965  -21.978 109.814 1.00 34.77  ? 3    ILE C CB    1 
ATOM   3621  C  CG1   . ILE C 2  3    ? 16.039  -20.887 109.790 1.00 36.74  ? 3    ILE C CG1   1 
ATOM   3622  C  CG2   . ILE C 2  3    ? 14.127  -21.946 108.545 1.00 26.83  ? 3    ILE C CG2   1 
ATOM   3623  C  CD1   . ILE C 2  3    ? 15.498  -19.490 109.601 1.00 36.67  ? 3    ILE C CD1   1 
ATOM   3624  N  N     . LYS C 2  4    ? 11.890  -22.888 111.334 1.00 31.33  ? 4    LYS C N     1 
ATOM   3625  C  CA    . LYS C 2  4    ? 10.946  -23.996 111.439 1.00 30.81  ? 4    LYS C CA    1 
ATOM   3626  C  C     . LYS C 2  4    ? 10.280  -24.254 110.093 1.00 29.83  ? 4    LYS C C     1 
ATOM   3627  O  O     . LYS C 2  4    ? 9.753   -23.331 109.475 1.00 32.98  ? 4    LYS C O     1 
ATOM   3628  C  CB    . LYS C 2  4    ? 9.879   -23.685 112.489 1.00 39.22  ? 4    LYS C CB    1 
ATOM   3629  C  CG    . LYS C 2  4    ? 8.804   -24.756 112.619 1.00 44.39  ? 4    LYS C CG    1 
ATOM   3630  C  CD    . LYS C 2  4    ? 7.668   -24.299 113.524 1.00 38.82  ? 4    LYS C CD    1 
ATOM   3631  C  CE    . LYS C 2  4    ? 6.739   -25.456 113.881 1.00 49.68  ? 4    LYS C CE    1 
ATOM   3632  N  NZ    . LYS C 2  4    ? 6.166   -26.128 112.679 1.00 32.66  ? 4    LYS C NZ    1 
ATOM   3633  N  N     . ARG C 2  5    ? 10.295  -25.502 109.635 1.00 24.82  ? 5    ARG C N     1 
ATOM   3634  C  CA    . ARG C 2  5    ? 9.709   -25.815 108.334 1.00 24.14  ? 5    ARG C CA    1 
ATOM   3635  C  C     . ARG C 2  5    ? 8.513   -26.752 108.413 1.00 25.18  ? 5    ARG C C     1 
ATOM   3636  O  O     . ARG C 2  5    ? 8.475   -27.664 109.237 1.00 33.03  ? 5    ARG C O     1 
ATOM   3637  C  CB    . ARG C 2  5    ? 10.759  -26.366 107.364 1.00 31.49  ? 5    ARG C CB    1 
ATOM   3638  C  CG    . ARG C 2  5    ? 11.369  -27.697 107.752 1.00 28.29  ? 5    ARG C CG    1 
ATOM   3639  C  CD    . ARG C 2  5    ? 12.394  -28.121 106.710 1.00 30.28  ? 5    ARG C CD    1 
ATOM   3640  N  NE    . ARG C 2  5    ? 11.798  -28.222 105.380 1.00 37.17  ? 5    ARG C NE    1 
ATOM   3641  C  CZ    . ARG C 2  5    ? 12.428  -27.917 104.250 1.00 39.05  ? 5    ARG C CZ    1 
ATOM   3642  N  NH1   . ARG C 2  5    ? 13.682  -27.482 104.280 1.00 29.61  ? 5    ARG C NH1   1 
ATOM   3643  N  NH2   . ARG C 2  5    ? 11.802  -28.042 103.086 1.00 33.86  ? 5    ARG C NH2   1 
ATOM   3644  N  N     . PHE C 2  6    ? 7.535   -26.509 107.546 1.00 25.04  ? 6    PHE C N     1 
ATOM   3645  C  CA    . PHE C 2  6    ? 6.306   -27.286 107.528 1.00 22.01  ? 6    PHE C CA    1 
ATOM   3646  C  C     . PHE C 2  6    ? 6.290   -28.257 106.355 1.00 30.17  ? 6    PHE C C     1 
ATOM   3647  O  O     . PHE C 2  6    ? 7.206   -28.279 105.530 1.00 36.39  ? 6    PHE C O     1 
ATOM   3648  C  CB    . PHE C 2  6    ? 5.087   -26.362 107.423 1.00 22.13  ? 6    PHE C CB    1 
ATOM   3649  C  CG    . PHE C 2  6    ? 5.009   -25.315 108.502 1.00 18.96  ? 6    PHE C CG    1 
ATOM   3650  C  CD1   . PHE C 2  6    ? 4.143   -25.467 109.569 1.00 18.98  ? 6    PHE C CD1   1 
ATOM   3651  C  CD2   . PHE C 2  6    ? 5.786   -24.168 108.438 1.00 20.02  ? 6    PHE C CD2   1 
ATOM   3652  C  CE1   . PHE C 2  6    ? 4.063   -24.505 110.557 1.00 20.70  ? 6    PHE C CE1   1 
ATOM   3653  C  CE2   . PHE C 2  6    ? 5.711   -23.204 109.425 1.00 20.23  ? 6    PHE C CE2   1 
ATOM   3654  C  CZ    . PHE C 2  6    ? 4.848   -23.372 110.484 1.00 21.22  ? 6    PHE C CZ    1 
ATOM   3655  N  N     . GLY C 2  7    ? 5.228   -29.051 106.292 1.00 40.48  ? 7    GLY C N     1 
ATOM   3656  C  CA    . GLY C 2  7    ? 4.970   -29.954 105.186 1.00 47.50  ? 7    GLY C CA    1 
ATOM   3657  C  C     . GLY C 2  7    ? 5.491   -31.363 105.394 1.00 46.47  ? 7    GLY C C     1 
ATOM   3658  O  O     . GLY C 2  7    ? 6.562   -31.563 105.965 1.00 41.75  ? 7    GLY C O     1 
ATOM   3659  N  N     . ARG C 2  8    ? 4.729   -32.344 104.916 1.00 55.85  ? 8    ARG C N     1 
ATOM   3660  C  CA    . ARG C 2  8    ? 5.110   -33.749 105.039 1.00 55.50  ? 8    ARG C CA    1 
ATOM   3661  C  C     . ARG C 2  8    ? 5.799   -34.342 103.809 1.00 54.25  ? 8    ARG C C     1 
ATOM   3662  O  O     . ARG C 2  8    ? 6.340   -35.445 103.875 1.00 71.14  ? 8    ARG C O     1 
ATOM   3663  C  CB    . ARG C 2  8    ? 3.893   -34.600 105.414 1.00 70.09  ? 8    ARG C CB    1 
ATOM   3664  C  CG    . ARG C 2  8    ? 3.215   -34.173 106.705 1.00 83.20  ? 8    ARG C CG    1 
ATOM   3665  C  CD    . ARG C 2  8    ? 2.076   -35.111 107.069 1.00 97.28  ? 8    ARG C CD    1 
ATOM   3666  N  NE    . ARG C 2  8    ? 1.315   -34.622 108.215 1.00 109.87 ? 8    ARG C NE    1 
ATOM   3667  C  CZ    . ARG C 2  8    ? 0.280   -35.260 108.753 1.00 110.26 ? 8    ARG C CZ    1 
ATOM   3668  N  NH1   . ARG C 2  8    ? -0.120  -36.421 108.252 1.00 110.14 ? 8    ARG C NH1   1 
ATOM   3669  N  NH2   . ARG C 2  8    ? -0.354  -34.738 109.795 1.00 105.48 ? 8    ARG C NH2   1 
ATOM   3670  N  N     . ILE C 2  9    ? 5.789   -33.617 102.694 1.00 61.13  ? 9    ILE C N     1 
ATOM   3671  C  CA    . ILE C 2  9    ? 6.297   -34.171 101.439 1.00 61.63  ? 9    ILE C CA    1 
ATOM   3672  C  C     . ILE C 2  9    ? 7.818   -34.117 101.368 1.00 62.01  ? 9    ILE C C     1 
ATOM   3673  O  O     . ILE C 2  9    ? 8.417   -33.045 101.443 1.00 57.05  ? 9    ILE C O     1 
ATOM   3674  C  CB    . ILE C 2  9    ? 5.694   -33.470 100.199 1.00 57.09  ? 9    ILE C CB    1 
ATOM   3675  C  CG1   . ILE C 2  9    ? 4.167   -33.588 100.208 1.00 57.69  ? 9    ILE C CG1   1 
ATOM   3676  C  CG2   . ILE C 2  9    ? 6.266   -34.069 98.917  1.00 45.82  ? 9    ILE C CG2   1 
ATOM   3677  C  CD1   . ILE C 2  9    ? 3.485   -32.875 99.055  1.00 42.45  ? 9    ILE C CD1   1 
ATOM   3678  N  N     . ARG C 2  10   ? 8.432   -35.288 101.222 1.00 66.10  ? 10   ARG C N     1 
ATOM   3679  C  CA    . ARG C 2  10   ? 9.883   -35.397 101.130 1.00 69.00  ? 10   ARG C CA    1 
ATOM   3680  C  C     . ARG C 2  10   ? 10.309  -35.514 99.668  1.00 63.26  ? 10   ARG C C     1 
ATOM   3681  O  O     . ARG C 2  10   ? 9.984   -36.492 98.993  1.00 56.94  ? 10   ARG C O     1 
ATOM   3682  C  CB    . ARG C 2  10   ? 10.375  -36.601 101.941 1.00 63.38  ? 10   ARG C CB    1 
ATOM   3683  C  CG    . ARG C 2  10   ? 11.878  -36.847 101.881 1.00 65.15  ? 10   ARG C CG    1 
ATOM   3684  C  CD    . ARG C 2  10   ? 12.204  -38.123 101.111 1.00 66.71  ? 10   ARG C CD    1 
ATOM   3685  N  NE    . ARG C 2  10   ? 11.490  -39.285 101.640 1.00 74.60  ? 10   ARG C NE    1 
ATOM   3686  C  CZ    . ARG C 2  10   ? 11.574  -40.513 101.134 1.00 71.42  ? 10   ARG C CZ    1 
ATOM   3687  N  NH1   . ARG C 2  10   ? 10.886  -41.507 101.681 1.00 63.12  ? 10   ARG C NH1   1 
ATOM   3688  N  NH2   . ARG C 2  10   ? 12.345  -40.749 100.081 1.00 72.92  ? 10   ARG C NH2   1 
ATOM   3689  N  N     . GLU C 2  11   ? 11.032  -34.508 99.180  1.00 61.57  ? 11   GLU C N     1 
ATOM   3690  C  CA    . GLU C 2  11   ? 11.462  -34.490 97.787  1.00 49.45  ? 11   GLU C CA    1 
ATOM   3691  C  C     . GLU C 2  11   ? 12.604  -35.469 97.556  1.00 41.92  ? 11   GLU C C     1 
ATOM   3692  O  O     . GLU C 2  11   ? 13.661  -35.367 98.177  1.00 40.49  ? 11   GLU C O     1 
ATOM   3693  C  CB    . GLU C 2  11   ? 11.876  -33.080 97.361  1.00 41.01  ? 11   GLU C CB    1 
ATOM   3694  C  CG    . GLU C 2  11   ? 10.750  -32.265 96.741  1.00 34.87  ? 11   GLU C CG    1 
ATOM   3695  C  CD    . GLU C 2  11   ? 10.130  -31.274 97.706  1.00 40.53  ? 11   GLU C CD    1 
ATOM   3696  O  OE1   . GLU C 2  11   ? 10.877  -30.685 98.517  1.00 43.62  ? 11   GLU C OE1   1 
ATOM   3697  O  OE2   . GLU C 2  11   ? 8.897   -31.082 97.650  1.00 37.17  ? 11   GLU C OE2   1 
ATOM   3698  N  N     . VAL C 2  12   ? 12.382  -36.408 96.645  1.00 39.02  ? 12   VAL C N     1 
ATOM   3699  C  CA    . VAL C 2  12   ? 13.332  -37.485 96.395  1.00 47.32  ? 12   VAL C CA    1 
ATOM   3700  C  C     . VAL C 2  12   ? 14.622  -36.984 95.753  1.00 44.57  ? 12   VAL C C     1 
ATOM   3701  O  O     . VAL C 2  12   ? 15.721  -37.366 96.158  1.00 49.17  ? 12   VAL C O     1 
ATOM   3702  C  CB    . VAL C 2  12   ? 12.696  -38.584 95.524  1.00 44.49  ? 12   VAL C CB    1 
ATOM   3703  C  CG1   . VAL C 2  12   ? 13.746  -39.581 95.052  1.00 47.76  ? 12   VAL C CG1   1 
ATOM   3704  C  CG2   . VAL C 2  12   ? 11.598  -39.281 96.304  1.00 48.75  ? 12   VAL C CG2   1 
ATOM   3705  N  N     . ILE C 2  13   ? 14.483  -36.120 94.755  1.00 38.61  ? 13   ILE C N     1 
ATOM   3706  C  CA    . ILE C 2  13   ? 15.641  -35.551 94.084  1.00 29.22  ? 13   ILE C CA    1 
ATOM   3707  C  C     . ILE C 2  13   ? 15.677  -34.039 94.270  1.00 23.99  ? 13   ILE C C     1 
ATOM   3708  O  O     . ILE C 2  13   ? 14.633  -33.400 94.390  1.00 21.77  ? 13   ILE C O     1 
ATOM   3709  C  CB    . ILE C 2  13   ? 15.637  -35.889 92.584  1.00 25.57  ? 13   ILE C CB    1 
ATOM   3710  C  CG1   . ILE C 2  13   ? 14.332  -35.426 91.936  1.00 18.54  ? 13   ILE C CG1   1 
ATOM   3711  C  CG2   . ILE C 2  13   ? 15.828  -37.382 92.380  1.00 29.17  ? 13   ILE C CG2   1 
ATOM   3712  C  CD1   . ILE C 2  13   ? 14.335  -35.534 90.430  1.00 18.46  ? 13   ILE C CD1   1 
ATOM   3713  N  N     . PRO C 2  14   ? 16.886  -33.459 94.304  1.00 28.55  ? 14   PRO C N     1 
ATOM   3714  C  CA    . PRO C 2  14   ? 16.987  -32.002 94.402  1.00 24.38  ? 14   PRO C CA    1 
ATOM   3715  C  C     . PRO C 2  14   ? 16.702  -31.378 93.048  1.00 21.34  ? 14   PRO C C     1 
ATOM   3716  O  O     . PRO C 2  14   ? 16.482  -32.096 92.072  1.00 20.54  ? 14   PRO C O     1 
ATOM   3717  C  CB    . PRO C 2  14   ? 18.456  -31.789 94.757  1.00 18.84  ? 14   PRO C CB    1 
ATOM   3718  C  CG    . PRO C 2  14   ? 19.148  -32.917 94.084  1.00 12.91  ? 14   PRO C CG    1 
ATOM   3719  C  CD    . PRO C 2  14   ? 18.214  -34.094 94.221  1.00 23.74  ? 14   PRO C CD    1 
ATOM   3720  N  N     . LEU C 2  15   ? 16.715  -30.055 92.983  1.00 21.09  ? 15   LEU C N     1 
ATOM   3721  C  CA    . LEU C 2  15   ? 16.569  -29.386 91.702  1.00 21.62  ? 15   LEU C CA    1 
ATOM   3722  C  C     . LEU C 2  15   ? 17.822  -29.622 90.872  1.00 17.79  ? 15   LEU C C     1 
ATOM   3723  O  O     . LEU C 2  15   ? 18.936  -29.564 91.394  1.00 18.83  ? 15   LEU C O     1 
ATOM   3724  C  CB    . LEU C 2  15   ? 16.334  -27.888 91.897  1.00 20.81  ? 15   LEU C CB    1 
ATOM   3725  C  CG    . LEU C 2  15   ? 14.991  -27.499 92.514  1.00 17.27  ? 15   LEU C CG    1 
ATOM   3726  C  CD1   . LEU C 2  15   ? 14.898  -25.993 92.655  1.00 16.19  ? 15   LEU C CD1   1 
ATOM   3727  C  CD2   . LEU C 2  15   ? 13.848  -28.030 91.667  1.00 17.08  ? 15   LEU C CD2   1 
ATOM   3728  N  N     . PRO C 2  16   ? 17.643  -29.893 89.572  1.00 15.39  ? 16   PRO C N     1 
ATOM   3729  C  CA    . PRO C 2  16   ? 18.770  -30.050 88.649  1.00 18.26  ? 16   PRO C CA    1 
ATOM   3730  C  C     . PRO C 2  16   ? 19.499  -28.717 88.523  1.00 20.34  ? 16   PRO C C     1 
ATOM   3731  O  O     . PRO C 2  16   ? 18.947  -27.706 88.955  1.00 18.53  ? 16   PRO C O     1 
ATOM   3732  C  CB    . PRO C 2  16   ? 18.086  -30.421 87.330  1.00 16.99  ? 16   PRO C CB    1 
ATOM   3733  C  CG    . PRO C 2  16   ? 16.717  -29.847 87.441  1.00 14.85  ? 16   PRO C CG    1 
ATOM   3734  C  CD    . PRO C 2  16   ? 16.344  -29.986 88.884  1.00 15.36  ? 16   PRO C CD    1 
ATOM   3735  N  N     . PRO C 2  17   ? 20.728  -28.711 87.976  1.00 22.83  ? 17   PRO C N     1 
ATOM   3736  C  CA    . PRO C 2  17   ? 21.394  -27.417 87.795  1.00 20.94  ? 17   PRO C CA    1 
ATOM   3737  C  C     . PRO C 2  17   ? 20.513  -26.515 86.940  1.00 18.01  ? 17   PRO C C     1 
ATOM   3738  O  O     . PRO C 2  17   ? 20.093  -26.915 85.854  1.00 17.67  ? 17   PRO C O     1 
ATOM   3739  C  CB    . PRO C 2  17   ? 22.667  -27.785 87.032  1.00 22.98  ? 17   PRO C CB    1 
ATOM   3740  C  CG    . PRO C 2  17   ? 22.898  -29.226 87.348  1.00 18.85  ? 17   PRO C CG    1 
ATOM   3741  C  CD    . PRO C 2  17   ? 21.536  -29.829 87.461  1.00 17.84  ? 17   PRO C CD    1 
ATOM   3742  N  N     . LEU C 2  18   ? 20.239  -25.311 87.427  1.00 15.56  ? 18   LEU C N     1 
ATOM   3743  C  CA    . LEU C 2  18   ? 19.202  -24.477 86.827  1.00 15.10  ? 18   LEU C CA    1 
ATOM   3744  C  C     . LEU C 2  18   ? 19.668  -23.750 85.567  1.00 14.93  ? 18   LEU C C     1 
ATOM   3745  O  O     . LEU C 2  18   ? 18.851  -23.324 84.758  1.00 20.62  ? 18   LEU C O     1 
ATOM   3746  C  CB    . LEU C 2  18   ? 18.631  -23.502 87.863  1.00 15.63  ? 18   LEU C CB    1 
ATOM   3747  C  CG    . LEU C 2  18   ? 17.912  -24.170 89.043  1.00 15.87  ? 18   LEU C CG    1 
ATOM   3748  C  CD1   . LEU C 2  18   ? 17.584  -23.179 90.151  1.00 13.20  ? 18   LEU C CD1   1 
ATOM   3749  C  CD2   . LEU C 2  18   ? 16.648  -24.876 88.568  1.00 16.11  ? 18   LEU C CD2   1 
ATOM   3750  N  N     . THR C 2  19   ? 20.979  -23.610 85.410  1.00 14.37  ? 19   THR C N     1 
ATOM   3751  C  CA    . THR C 2  19   ? 21.555  -23.010 84.211  1.00 9.73   ? 19   THR C CA    1 
ATOM   3752  C  C     . THR C 2  19   ? 21.999  -24.050 83.190  1.00 13.45  ? 19   THR C C     1 
ATOM   3753  O  O     . THR C 2  19   ? 22.628  -23.705 82.191  1.00 14.65  ? 19   THR C O     1 
ATOM   3754  C  CB    . THR C 2  19   ? 22.750  -22.106 84.543  1.00 13.90  ? 19   THR C CB    1 
ATOM   3755  O  OG1   . THR C 2  19   ? 23.715  -22.846 85.298  1.00 20.68  ? 19   THR C OG1   1 
ATOM   3756  C  CG2   . THR C 2  19   ? 22.295  -20.908 85.356  1.00 20.16  ? 19   THR C CG2   1 
ATOM   3757  N  N     . GLU C 2  20   ? 21.705  -25.321 83.457  1.00 16.50  ? 20   GLU C N     1 
ATOM   3758  C  CA    . GLU C 2  20   ? 22.185  -26.411 82.604  1.00 16.33  ? 20   GLU C CA    1 
ATOM   3759  C  C     . GLU C 2  20   ? 21.682  -26.302 81.166  1.00 16.74  ? 20   GLU C C     1 
ATOM   3760  O  O     . GLU C 2  20   ? 22.366  -26.732 80.228  1.00 16.38  ? 20   GLU C O     1 
ATOM   3761  C  CB    . GLU C 2  20   ? 21.825  -27.784 83.188  1.00 17.96  ? 20   GLU C CB    1 
ATOM   3762  C  CG    . GLU C 2  20   ? 20.377  -28.215 82.980  1.00 25.32  ? 20   GLU C CG    1 
ATOM   3763  C  CD    . GLU C 2  20   ? 20.135  -29.671 83.351  1.00 29.33  ? 20   GLU C CD    1 
ATOM   3764  O  OE1   . GLU C 2  20   ? 21.100  -30.463 83.331  1.00 31.33  ? 20   GLU C OE1   1 
ATOM   3765  O  OE2   . GLU C 2  20   ? 18.978  -30.023 83.664  1.00 28.40  ? 20   GLU C OE2   1 
ATOM   3766  N  N     . ILE C 2  21   ? 20.496  -25.719 81.002  1.00 10.57  ? 21   ILE C N     1 
ATOM   3767  C  CA    . ILE C 2  21   ? 19.879  -25.573 79.693  1.00 8.86   ? 21   ILE C CA    1 
ATOM   3768  C  C     . ILE C 2  21   ? 20.758  -24.745 78.761  1.00 12.70  ? 21   ILE C C     1 
ATOM   3769  O  O     . ILE C 2  21   ? 20.792  -24.983 77.554  1.00 13.38  ? 21   ILE C O     1 
ATOM   3770  C  CB    . ILE C 2  21   ? 18.466  -24.952 79.798  1.00 12.78  ? 21   ILE C CB    1 
ATOM   3771  C  CG1   . ILE C 2  21   ? 17.787  -24.913 78.429  1.00 8.87   ? 21   ILE C CG1   1 
ATOM   3772  C  CG2   . ILE C 2  21   ? 18.517  -23.559 80.416  1.00 10.34  ? 21   ILE C CG2   1 
ATOM   3773  C  CD1   . ILE C 2  21   ? 16.364  -24.423 78.483  1.00 8.64   ? 21   ILE C CD1   1 
ATOM   3774  N  N     . GLN C 2  22   ? 21.450  -23.757 79.319  1.00 12.51  ? 22   GLN C N     1 
ATOM   3775  C  CA    . GLN C 2  22   ? 22.434  -22.992 78.566  1.00 13.00  ? 22   GLN C CA    1 
ATOM   3776  C  C     . GLN C 2  22   ? 23.773  -23.725 78.472  1.00 13.71  ? 22   GLN C C     1 
ATOM   3777  O  O     . GLN C 2  22   ? 24.317  -23.947 77.376  1.00 12.39  ? 22   GLN C O     1 
ATOM   3778  C  CB    . GLN C 2  22   ? 22.644  -21.632 79.239  1.00 13.54  ? 22   GLN C CB    1 
ATOM   3779  C  CG    . GLN C 2  22   ? 21.382  -20.795 79.370  1.00 10.71  ? 22   GLN C CG    1 
ATOM   3780  C  CD    . GLN C 2  22   ? 21.132  -19.934 78.150  1.00 12.96  ? 22   GLN C CD    1 
ATOM   3781  O  OE1   . GLN C 2  22   ? 22.071  -19.472 77.504  1.00 11.03  ? 22   GLN C OE1   1 
ATOM   3782  N  NE2   . GLN C 2  22   ? 19.863  -19.710 77.829  1.00 16.96  ? 22   GLN C NE2   1 
ATOM   3783  N  N     . VAL C 2  23   ? 24.268  -24.147 79.634  1.00 13.07  ? 23   VAL C N     1 
ATOM   3784  C  CA    . VAL C 2  23   ? 25.646  -24.610 79.765  1.00 13.04  ? 23   VAL C CA    1 
ATOM   3785  C  C     . VAL C 2  23   ? 25.912  -25.877 78.971  1.00 11.87  ? 23   VAL C C     1 
ATOM   3786  O  O     . VAL C 2  23   ? 26.822  -25.916 78.144  1.00 11.76  ? 23   VAL C O     1 
ATOM   3787  C  CB    . VAL C 2  23   ? 26.030  -24.838 81.242  1.00 11.98  ? 23   VAL C CB    1 
ATOM   3788  C  CG1   . VAL C 2  23   ? 27.391  -25.503 81.343  1.00 9.69   ? 23   VAL C CG1   1 
ATOM   3789  C  CG2   . VAL C 2  23   ? 26.026  -23.524 81.997  1.00 13.53  ? 23   VAL C CG2   1 
ATOM   3790  N  N     . GLU C 2  24   ? 25.110  -26.907 79.216  1.00 13.92  ? 24   GLU C N     1 
ATOM   3791  C  CA    . GLU C 2  24   ? 25.318  -28.185 78.552  1.00 16.28  ? 24   GLU C CA    1 
ATOM   3792  C  C     . GLU C 2  24   ? 25.046  -28.080 77.060  1.00 14.78  ? 24   GLU C C     1 
ATOM   3793  O  O     . GLU C 2  24   ? 25.663  -28.775 76.261  1.00 16.10  ? 24   GLU C O     1 
ATOM   3794  C  CB    . GLU C 2  24   ? 24.459  -29.280 79.188  1.00 24.63  ? 24   GLU C CB    1 
ATOM   3795  C  CG    . GLU C 2  24   ? 24.984  -29.748 80.536  1.00 27.76  ? 24   GLU C CG    1 
ATOM   3796  C  CD    . GLU C 2  24   ? 26.426  -30.224 80.462  1.00 39.38  ? 24   GLU C CD    1 
ATOM   3797  O  OE1   . GLU C 2  24   ? 27.202  -29.915 81.394  1.00 41.98  ? 24   GLU C OE1   1 
ATOM   3798  O  OE2   . GLU C 2  24   ? 26.782  -30.909 79.476  1.00 33.26  ? 24   GLU C OE2   1 
ATOM   3799  N  N     . SER C 2  25   ? 24.125  -27.199 76.693  1.00 14.78  ? 25   SER C N     1 
ATOM   3800  C  CA    . SER C 2  25   ? 23.828  -26.950 75.292  1.00 11.67  ? 25   SER C CA    1 
ATOM   3801  C  C     . SER C 2  25   ? 25.057  -26.418 74.569  1.00 13.89  ? 25   SER C C     1 
ATOM   3802  O  O     . SER C 2  25   ? 25.507  -26.992 73.566  1.00 13.04  ? 25   SER C O     1 
ATOM   3803  C  CB    . SER C 2  25   ? 22.682  -25.948 75.164  1.00 10.03  ? 25   SER C CB    1 
ATOM   3804  O  OG    . SER C 2  25   ? 22.473  -25.597 73.810  1.00 12.54  ? 25   SER C OG    1 
ATOM   3805  N  N     . TYR C 2  26   ? 25.607  -25.320 75.080  1.00 11.39  ? 26   TYR C N     1 
ATOM   3806  C  CA    . TYR C 2  26   ? 26.748  -24.709 74.415  1.00 8.94   ? 26   TYR C CA    1 
ATOM   3807  C  C     . TYR C 2  26   ? 27.977  -25.613 74.457  1.00 13.22  ? 26   TYR C C     1 
ATOM   3808  O  O     . TYR C 2  26   ? 28.699  -25.729 73.465  1.00 15.64  ? 26   TYR C O     1 
ATOM   3809  C  CB    . TYR C 2  26   ? 27.062  -23.334 74.997  1.00 9.51   ? 26   TYR C CB    1 
ATOM   3810  C  CG    . TYR C 2  26   ? 27.701  -22.413 73.987  1.00 8.90   ? 26   TYR C CG    1 
ATOM   3811  C  CD1   . TYR C 2  26   ? 27.033  -22.070 72.821  1.00 7.98   ? 26   TYR C CD1   1 
ATOM   3812  C  CD2   . TYR C 2  26   ? 28.972  -21.891 74.193  1.00 10.71  ? 26   TYR C CD2   1 
ATOM   3813  C  CE1   . TYR C 2  26   ? 27.608  -21.233 71.890  1.00 9.69   ? 26   TYR C CE1   1 
ATOM   3814  C  CE2   . TYR C 2  26   ? 29.556  -21.051 73.266  1.00 9.09   ? 26   TYR C CE2   1 
ATOM   3815  C  CZ    . TYR C 2  26   ? 28.868  -20.727 72.116  1.00 8.69   ? 26   TYR C CZ    1 
ATOM   3816  O  OH    . TYR C 2  26   ? 29.438  -19.893 71.188  1.00 8.49   ? 26   TYR C OH    1 
ATOM   3817  N  N     . ARG C 2  27   ? 28.207  -26.253 75.601  1.00 15.19  ? 27   ARG C N     1 
ATOM   3818  C  CA    . ARG C 2  27   ? 29.304  -27.209 75.736  1.00 13.75  ? 27   ARG C CA    1 
ATOM   3819  C  C     . ARG C 2  27   ? 29.188  -28.321 74.698  1.00 13.61  ? 27   ARG C C     1 
ATOM   3820  O  O     . ARG C 2  27   ? 30.175  -28.701 74.070  1.00 15.86  ? 27   ARG C O     1 
ATOM   3821  C  CB    . ARG C 2  27   ? 29.327  -27.807 77.142  1.00 19.87  ? 27   ARG C CB    1 
ATOM   3822  C  CG    . ARG C 2  27   ? 30.250  -29.002 77.285  1.00 22.21  ? 27   ARG C CG    1 
ATOM   3823  C  CD    . ARG C 2  27   ? 29.937  -29.793 78.542  1.00 26.37  ? 27   ARG C CD    1 
ATOM   3824  N  NE    . ARG C 2  27   ? 30.262  -31.206 78.370  1.00 45.67  ? 27   ARG C NE    1 
ATOM   3825  C  CZ    . ARG C 2  27   ? 29.419  -32.114 77.884  1.00 51.35  ? 27   ARG C CZ    1 
ATOM   3826  N  NH1   . ARG C 2  27   ? 29.803  -33.378 77.761  1.00 50.86  ? 27   ARG C NH1   1 
ATOM   3827  N  NH2   . ARG C 2  27   ? 28.190  -31.760 77.523  1.00 39.14  ? 27   ARG C NH2   1 
ATOM   3828  N  N     . ARG C 2  28   ? 27.974  -28.828 74.516  1.00 12.22  ? 28   ARG C N     1 
ATOM   3829  C  CA    . ARG C 2  28   ? 27.702  -29.848 73.509  1.00 15.64  ? 28   ARG C CA    1 
ATOM   3830  C  C     . ARG C 2  28   ? 27.995  -29.325 72.105  1.00 17.96  ? 28   ARG C C     1 
ATOM   3831  O  O     . ARG C 2  28   ? 28.491  -30.058 71.248  1.00 18.09  ? 28   ARG C O     1 
ATOM   3832  C  CB    . ARG C 2  28   ? 26.244  -30.303 73.601  1.00 16.05  ? 28   ARG C CB    1 
ATOM   3833  C  CG    . ARG C 2  28   ? 25.881  -31.477 72.712  1.00 30.84  ? 28   ARG C CG    1 
ATOM   3834  C  CD    . ARG C 2  28   ? 25.629  -32.727 73.544  1.00 56.89  ? 28   ARG C CD    1 
ATOM   3835  N  NE    . ARG C 2  28   ? 25.032  -33.806 72.759  1.00 73.27  ? 28   ARG C NE    1 
ATOM   3836  C  CZ    . ARG C 2  28   ? 25.728  -34.746 72.127  1.00 67.56  ? 28   ARG C CZ    1 
ATOM   3837  N  NH1   . ARG C 2  28   ? 27.054  -34.745 72.184  1.00 58.89  ? 28   ARG C NH1   1 
ATOM   3838  N  NH2   . ARG C 2  28   ? 25.099  -35.690 71.438  1.00 64.74  ? 28   ARG C NH2   1 
ATOM   3839  N  N     . ALA C 2  29   ? 27.685  -28.053 71.873  1.00 18.59  ? 29   ALA C N     1 
ATOM   3840  C  CA    . ALA C 2  29   ? 27.903  -27.449 70.560  1.00 15.67  ? 29   ALA C CA    1 
ATOM   3841  C  C     . ALA C 2  29   ? 29.383  -27.261 70.224  1.00 16.21  ? 29   ALA C C     1 
ATOM   3842  O  O     . ALA C 2  29   ? 29.797  -27.473 69.085  1.00 18.15  ? 29   ALA C O     1 
ATOM   3843  C  CB    . ALA C 2  29   ? 27.169  -26.124 70.458  1.00 12.72  ? 29   ALA C CB    1 
ATOM   3844  N  N     . LEU C 2  30   ? 30.172  -26.844 71.210  1.00 15.38  ? 30   LEU C N     1 
ATOM   3845  C  CA    . LEU C 2  30   ? 31.592  -26.571 70.987  1.00 15.39  ? 30   LEU C CA    1 
ATOM   3846  C  C     . LEU C 2  30   ? 32.482  -27.818 70.992  1.00 15.39  ? 30   LEU C C     1 
ATOM   3847  O  O     . LEU C 2  30   ? 33.381  -27.946 70.156  1.00 11.73  ? 30   LEU C O     1 
ATOM   3848  C  CB    . LEU C 2  30   ? 32.112  -25.546 71.999  1.00 15.21  ? 30   LEU C CB    1 
ATOM   3849  C  CG    . LEU C 2  30   ? 31.573  -24.121 71.863  1.00 11.80  ? 30   LEU C CG    1 
ATOM   3850  C  CD1   . LEU C 2  30   ? 32.408  -23.160 72.693  1.00 16.64  ? 30   LEU C CD1   1 
ATOM   3851  C  CD2   . LEU C 2  30   ? 31.547  -23.686 70.410  1.00 10.68  ? 30   LEU C CD2   1 
ATOM   3852  N  N     . GLN C 2  31   ? 32.228  -28.724 71.934  1.00 18.03  ? 31   GLN C N     1 
ATOM   3853  C  CA    . GLN C 2  31   ? 33.041  -29.930 72.105  1.00 18.44  ? 31   GLN C CA    1 
ATOM   3854  C  C     . GLN C 2  31   ? 34.516  -29.587 72.292  1.00 15.31  ? 31   GLN C C     1 
ATOM   3855  O  O     . GLN C 2  31   ? 35.388  -30.256 71.740  1.00 14.91  ? 31   GLN C O     1 
ATOM   3856  C  CB    . GLN C 2  31   ? 32.871  -30.888 70.918  1.00 14.81  ? 31   GLN C CB    1 
ATOM   3857  C  CG    . GLN C 2  31   ? 31.577  -31.682 70.918  1.00 16.52  ? 31   GLN C CG    1 
ATOM   3858  C  CD    . GLN C 2  31   ? 31.449  -32.587 69.703  1.00 22.61  ? 31   GLN C CD    1 
ATOM   3859  O  OE1   . GLN C 2  31   ? 31.667  -33.797 69.786  1.00 22.69  ? 31   GLN C OE1   1 
ATOM   3860  N  NE2   . GLN C 2  31   ? 31.091  -32.001 68.568  1.00 23.49  ? 31   GLN C NE2   1 
ATOM   3861  N  N     . ALA C 2  32   ? 34.790  -28.543 73.067  1.00 13.59  ? 32   ALA C N     1 
ATOM   3862  C  CA    . ALA C 2  32   ? 36.159  -28.072 73.255  1.00 13.55  ? 32   ALA C CA    1 
ATOM   3863  C  C     . ALA C 2  32   ? 37.016  -29.042 74.068  1.00 16.90  ? 32   ALA C C     1 
ATOM   3864  O  O     . ALA C 2  32   ? 38.226  -29.131 73.861  1.00 18.32  ? 32   ALA C O     1 
ATOM   3865  C  CB    . ALA C 2  32   ? 36.164  -26.692 73.893  1.00 10.27  ? 32   ALA C CB    1 
ATOM   3866  N  N     . ASP C 2  33   ? 36.388  -29.762 74.992  1.00 19.51  ? 33   ASP C N     1 
ATOM   3867  C  CA    . ASP C 2  33   ? 37.106  -30.693 75.859  1.00 21.55  ? 33   ASP C CA    1 
ATOM   3868  C  C     . ASP C 2  33   ? 37.337  -32.036 75.175  1.00 23.46  ? 33   ASP C C     1 
ATOM   3869  O  O     . ASP C 2  33   ? 38.166  -32.833 75.613  1.00 27.71  ? 33   ASP C O     1 
ATOM   3870  C  CB    . ASP C 2  33   ? 36.335  -30.910 77.161  1.00 28.69  ? 33   ASP C CB    1 
ATOM   3871  C  CG    . ASP C 2  33   ? 35.894  -29.609 77.799  1.00 39.60  ? 33   ASP C CG    1 
ATOM   3872  O  OD1   . ASP C 2  33   ? 36.701  -28.653 77.821  1.00 35.94  ? 33   ASP C OD1   1 
ATOM   3873  O  OD2   . ASP C 2  33   ? 34.737  -29.543 78.272  1.00 40.91  ? 33   ASP C OD2   1 
ATOM   3874  N  N     . VAL C 2  34   ? 36.595  -32.284 74.102  1.00 19.23  ? 34   VAL C N     1 
ATOM   3875  C  CA    . VAL C 2  34   ? 36.714  -33.531 73.365  1.00 14.42  ? 34   VAL C CA    1 
ATOM   3876  C  C     . VAL C 2  34   ? 37.846  -33.443 72.355  1.00 17.35  ? 34   VAL C C     1 
ATOM   3877  O  O     . VAL C 2  34   ? 37.850  -32.553 71.504  1.00 18.83  ? 34   VAL C O     1 
ATOM   3878  C  CB    . VAL C 2  34   ? 35.415  -33.854 72.610  1.00 14.72  ? 34   VAL C CB    1 
ATOM   3879  C  CG1   . VAL C 2  34   ? 35.573  -35.131 71.797  1.00 13.71  ? 34   VAL C CG1   1 
ATOM   3880  C  CG2   . VAL C 2  34   ? 34.254  -33.970 73.579  1.00 16.01  ? 34   VAL C CG2   1 
ATOM   3881  N  N     . PRO C 2  35   ? 38.821  -34.361 72.452  1.00 16.10  ? 35   PRO C N     1 
ATOM   3882  C  CA    . PRO C 2  35   ? 39.871  -34.456 71.435  1.00 15.85  ? 35   PRO C CA    1 
ATOM   3883  C  C     . PRO C 2  35   ? 39.258  -34.708 70.060  1.00 17.49  ? 35   PRO C C     1 
ATOM   3884  O  O     . PRO C 2  35   ? 38.369  -35.548 69.941  1.00 18.39  ? 35   PRO C O     1 
ATOM   3885  C  CB    . PRO C 2  35   ? 40.709  -35.652 71.899  1.00 14.45  ? 35   PRO C CB    1 
ATOM   3886  C  CG    . PRO C 2  35   ? 39.874  -36.365 72.902  1.00 13.88  ? 35   PRO C CG    1 
ATOM   3887  C  CD    . PRO C 2  35   ? 39.026  -35.324 73.544  1.00 17.59  ? 35   PRO C CD    1 
ATOM   3888  N  N     . PRO C 2  36   ? 39.742  -33.989 69.035  1.00 16.95  ? 36   PRO C N     1 
ATOM   3889  C  CA    . PRO C 2  36   ? 39.116  -33.854 67.715  1.00 19.85  ? 36   PRO C CA    1 
ATOM   3890  C  C     . PRO C 2  36   ? 38.636  -35.164 67.091  1.00 23.78  ? 36   PRO C C     1 
ATOM   3891  O  O     . PRO C 2  36   ? 37.546  -35.201 66.519  1.00 24.39  ? 36   PRO C O     1 
ATOM   3892  C  CB    . PRO C 2  36   ? 40.242  -33.256 66.870  1.00 14.81  ? 36   PRO C CB    1 
ATOM   3893  C  CG    . PRO C 2  36   ? 41.018  -32.448 67.835  1.00 14.67  ? 36   PRO C CG    1 
ATOM   3894  C  CD    . PRO C 2  36   ? 40.991  -33.212 69.127  1.00 15.25  ? 36   PRO C CD    1 
ATOM   3895  N  N     . GLU C 2  37   ? 39.430  -36.221 67.208  1.00 25.59  ? 37   GLU C N     1 
ATOM   3896  C  CA    . GLU C 2  37   ? 39.087  -37.496 66.591  1.00 25.68  ? 37   GLU C CA    1 
ATOM   3897  C  C     . GLU C 2  37   ? 37.907  -38.169 67.295  1.00 28.38  ? 37   GLU C C     1 
ATOM   3898  O  O     . GLU C 2  37   ? 37.247  -39.038 66.725  1.00 32.41  ? 37   GLU C O     1 
ATOM   3899  C  CB    . GLU C 2  37   ? 40.300  -38.429 66.577  1.00 21.25  ? 37   GLU C CB    1 
ATOM   3900  C  CG    . GLU C 2  37   ? 40.717  -38.935 67.953  1.00 22.05  ? 37   GLU C CG    1 
ATOM   3901  C  CD    . GLU C 2  37   ? 41.518  -37.925 68.749  1.00 25.47  ? 37   GLU C CD    1 
ATOM   3902  O  OE1   . GLU C 2  37   ? 42.087  -36.990 68.144  1.00 22.86  ? 37   GLU C OE1   1 
ATOM   3903  O  OE2   . GLU C 2  37   ? 41.579  -38.074 69.987  1.00 25.50  ? 37   GLU C OE2   1 
ATOM   3904  N  N     . LYS C 2  38   ? 37.644  -37.764 68.534  1.00 25.24  ? 38   LYS C N     1 
ATOM   3905  C  CA    . LYS C 2  38   ? 36.561  -38.345 69.323  1.00 24.01  ? 38   LYS C CA    1 
ATOM   3906  C  C     . LYS C 2  38   ? 35.271  -37.529 69.236  1.00 24.75  ? 38   LYS C C     1 
ATOM   3907  O  O     . LYS C 2  38   ? 34.255  -37.894 69.829  1.00 22.10  ? 38   LYS C O     1 
ATOM   3908  C  CB    . LYS C 2  38   ? 36.983  -38.481 70.789  1.00 21.03  ? 38   LYS C CB    1 
ATOM   3909  C  CG    . LYS C 2  38   ? 38.137  -39.435 71.025  1.00 21.09  ? 38   LYS C CG    1 
ATOM   3910  C  CD    . LYS C 2  38   ? 38.412  -39.604 72.509  1.00 16.29  ? 38   LYS C CD    1 
ATOM   3911  C  CE    . LYS C 2  38   ? 39.508  -40.625 72.755  1.00 21.05  ? 38   LYS C CE    1 
ATOM   3912  N  NZ    . LYS C 2  38   ? 39.942  -40.666 74.181  1.00 18.27  ? 38   LYS C NZ    1 
ATOM   3913  N  N     . ARG C 2  39   ? 35.313  -36.422 68.504  1.00 23.70  ? 39   ARG C N     1 
ATOM   3914  C  CA    . ARG C 2  39   ? 34.149  -35.551 68.407  1.00 23.28  ? 39   ARG C CA    1 
ATOM   3915  C  C     . ARG C 2  39   ? 33.020  -36.247 67.669  1.00 27.98  ? 39   ARG C C     1 
ATOM   3916  O  O     . ARG C 2  39   ? 33.257  -37.156 66.873  1.00 32.90  ? 39   ARG C O     1 
ATOM   3917  C  CB    . ARG C 2  39   ? 34.506  -34.231 67.719  1.00 20.97  ? 39   ARG C CB    1 
ATOM   3918  C  CG    . ARG C 2  39   ? 35.443  -33.357 68.531  1.00 17.68  ? 39   ARG C CG    1 
ATOM   3919  C  CD    . ARG C 2  39   ? 35.424  -31.910 68.066  1.00 17.15  ? 39   ARG C CD    1 
ATOM   3920  N  NE    . ARG C 2  39   ? 36.092  -31.042 69.034  1.00 19.29  ? 39   ARG C NE    1 
ATOM   3921  C  CZ    . ARG C 2  39   ? 37.228  -30.391 68.805  1.00 14.83  ? 39   ARG C CZ    1 
ATOM   3922  N  NH1   . ARG C 2  39   ? 37.829  -30.488 67.627  1.00 12.57  ? 39   ARG C NH1   1 
ATOM   3923  N  NH2   . ARG C 2  39   ? 37.756  -29.632 69.755  1.00 14.00  ? 39   ARG C NH2   1 
ATOM   3924  N  N     . GLU C 2  40   ? 31.789  -35.829 67.942  1.00 26.32  ? 40   GLU C N     1 
ATOM   3925  C  CA    . GLU C 2  40   ? 30.638  -36.394 67.253  1.00 21.09  ? 40   GLU C CA    1 
ATOM   3926  C  C     . GLU C 2  40   ? 30.227  -35.547 66.056  1.00 25.30  ? 40   GLU C C     1 
ATOM   3927  O  O     . GLU C 2  40   ? 30.812  -34.501 65.785  1.00 32.02  ? 40   GLU C O     1 
ATOM   3928  C  CB    . GLU C 2  40   ? 29.465  -36.567 68.214  1.00 26.33  ? 40   GLU C CB    1 
ATOM   3929  C  CG    . GLU C 2  40   ? 29.790  -37.445 69.404  1.00 40.71  ? 40   GLU C CG    1 
ATOM   3930  C  CD    . GLU C 2  40   ? 28.557  -37.881 70.163  1.00 50.10  ? 40   GLU C CD    1 
ATOM   3931  O  OE1   . GLU C 2  40   ? 27.454  -37.840 69.577  1.00 47.18  ? 40   GLU C OE1   1 
ATOM   3932  O  OE2   . GLU C 2  40   ? 28.693  -38.264 71.344  1.00 55.62  ? 40   GLU C OE2   1 
ATOM   3933  N  N     . ASN C 2  41   ? 29.191  -35.996 65.364  1.00 33.76  ? 41   ASN C N     1 
ATOM   3934  C  CA    . ASN C 2  41   ? 28.737  -35.367 64.131  1.00 30.35  ? 41   ASN C CA    1 
ATOM   3935  C  C     . ASN C 2  41   ? 27.742  -34.254 64.426  1.00 32.92  ? 41   ASN C C     1 
ATOM   3936  O  O     . ASN C 2  41   ? 27.036  -33.790 63.541  1.00 36.03  ? 41   ASN C O     1 
ATOM   3937  C  CB    . ASN C 2  41   ? 28.147  -36.397 63.168  1.00 34.43  ? 41   ASN C CB    1 
ATOM   3938  C  CG    . ASN C 2  41   ? 28.107  -35.899 61.735  1.00 32.38  ? 41   ASN C CG    1 
ATOM   3939  O  OD1   . ASN C 2  41   ? 28.588  -34.808 61.431  1.00 24.99  ? 41   ASN C OD1   1 
ATOM   3940  N  ND2   . ASN C 2  41   ? 27.538  -36.704 60.846  1.00 51.81  ? 41   ASN C ND2   1 
ATOM   3941  N  N     . VAL C 2  42   ? 27.642  -33.896 65.700  1.00 30.09  ? 42   VAL C N     1 
ATOM   3942  C  CA    . VAL C 2  42   ? 26.769  -32.825 66.166  1.00 28.85  ? 42   VAL C CA    1 
ATOM   3943  C  C     . VAL C 2  42   ? 27.570  -31.560 66.496  1.00 23.49  ? 42   VAL C C     1 
ATOM   3944  O  O     . VAL C 2  42   ? 28.762  -31.632 66.787  1.00 26.76  ? 42   VAL C O     1 
ATOM   3945  C  CB    . VAL C 2  42   ? 25.977  -33.265 67.404  1.00 25.71  ? 42   VAL C CB    1 
ATOM   3946  C  CG1   . VAL C 2  42   ? 25.220  -34.546 67.107  1.00 26.62  ? 42   VAL C CG1   1 
ATOM   3947  C  CG2   . VAL C 2  42   ? 26.910  -33.464 68.588  1.00 25.19  ? 42   VAL C CG2   1 
ATOM   3948  N  N     . GLY C 2  43   ? 26.930  -30.399 66.392  1.00 22.86  ? 43   GLY C N     1 
ATOM   3949  C  CA    . GLY C 2  43   ? 27.555  -29.149 66.796  1.00 20.28  ? 43   GLY C CA    1 
ATOM   3950  C  C     . GLY C 2  43   ? 28.214  -28.413 65.651  1.00 20.32  ? 43   GLY C C     1 
ATOM   3951  O  O     . GLY C 2  43   ? 27.805  -28.563 64.505  1.00 24.28  ? 43   GLY C O     1 
ATOM   3952  N  N     . ILE C 2  44   ? 29.220  -27.595 65.949  1.00 17.90  ? 44   ILE C N     1 
ATOM   3953  C  CA    . ILE C 2  44   ? 29.930  -26.885 64.887  1.00 20.56  ? 44   ILE C CA    1 
ATOM   3954  C  C     . ILE C 2  44   ? 30.707  -27.869 64.014  1.00 21.40  ? 44   ILE C C     1 
ATOM   3955  O  O     . ILE C 2  44   ? 30.982  -27.597 62.838  1.00 25.70  ? 44   ILE C O     1 
ATOM   3956  C  CB    . ILE C 2  44   ? 30.856  -25.767 65.428  1.00 19.50  ? 44   ILE C CB    1 
ATOM   3957  C  CG1   . ILE C 2  44   ? 32.075  -26.350 66.142  1.00 17.38  ? 44   ILE C CG1   1 
ATOM   3958  C  CG2   . ILE C 2  44   ? 30.084  -24.840 66.355  1.00 18.20  ? 44   ILE C CG2   1 
ATOM   3959  C  CD1   . ILE C 2  44   ? 33.026  -25.297 66.667  1.00 10.14  ? 44   ILE C CD1   1 
ATOM   3960  N  N     . GLN C 2  45   ? 31.042  -29.019 64.596  1.00 22.34  ? 45   GLN C N     1 
ATOM   3961  C  CA    . GLN C 2  45   ? 31.666  -30.104 63.852  1.00 22.60  ? 45   GLN C CA    1 
ATOM   3962  C  C     . GLN C 2  45   ? 30.724  -30.538 62.738  1.00 24.84  ? 45   GLN C C     1 
ATOM   3963  O  O     . GLN C 2  45   ? 31.154  -30.768 61.609  1.00 26.72  ? 45   GLN C O     1 
ATOM   3964  C  CB    . GLN C 2  45   ? 31.984  -31.283 64.776  1.00 21.33  ? 45   GLN C CB    1 
ATOM   3965  C  CG    . GLN C 2  45   ? 32.578  -32.500 64.074  1.00 23.60  ? 45   GLN C CG    1 
ATOM   3966  C  CD    . GLN C 2  45   ? 34.074  -32.388 63.832  1.00 21.87  ? 45   GLN C CD    1 
ATOM   3967  O  OE1   . GLN C 2  45   ? 34.689  -31.366 64.122  1.00 19.89  ? 45   GLN C OE1   1 
ATOM   3968  N  NE2   . GLN C 2  45   ? 34.667  -33.451 63.300  1.00 21.32  ? 45   GLN C NE2   1 
ATOM   3969  N  N     . ALA C 2  46   ? 29.435  -30.630 63.063  1.00 28.03  ? 46   ALA C N     1 
ATOM   3970  C  CA    . ALA C 2  46   ? 28.402  -30.963 62.083  1.00 25.52  ? 46   ALA C CA    1 
ATOM   3971  C  C     . ALA C 2  46   ? 28.405  -29.981 60.923  1.00 27.27  ? 46   ALA C C     1 
ATOM   3972  O  O     . ALA C 2  46   ? 28.289  -30.377 59.768  1.00 24.69  ? 46   ALA C O     1 
ATOM   3973  C  CB    . ALA C 2  46   ? 27.041  -30.962 62.735  1.00 29.56  ? 46   ALA C CB    1 
ATOM   3974  N  N     . ALA C 2  47   ? 28.524  -28.697 61.246  1.00 27.60  ? 47   ALA C N     1 
ATOM   3975  C  CA    . ALA C 2  47   ? 28.524  -27.648 60.237  1.00 25.93  ? 47   ALA C CA    1 
ATOM   3976  C  C     . ALA C 2  47   ? 29.740  -27.779 59.330  1.00 23.91  ? 47   ALA C C     1 
ATOM   3977  O  O     . ALA C 2  47   ? 29.636  -27.618 58.110  1.00 26.72  ? 47   ALA C O     1 
ATOM   3978  C  CB    . ALA C 2  47   ? 28.487  -26.278 60.894  1.00 20.97  ? 47   ALA C CB    1 
ATOM   3979  N  N     . PHE C 2  48   ? 30.892  -28.073 59.929  1.00 22.12  ? 48   PHE C N     1 
ATOM   3980  C  CA    . PHE C 2  48   ? 32.100  -28.324 59.147  1.00 25.03  ? 48   PHE C CA    1 
ATOM   3981  C  C     . PHE C 2  48   ? 31.898  -29.507 58.204  1.00 24.41  ? 48   PHE C C     1 
ATOM   3982  O  O     . PHE C 2  48   ? 32.293  -29.462 57.040  1.00 23.26  ? 48   PHE C O     1 
ATOM   3983  C  CB    . PHE C 2  48   ? 33.300  -28.594 60.057  1.00 19.82  ? 48   PHE C CB    1 
ATOM   3984  C  CG    . PHE C 2  48   ? 34.015  -27.355 60.512  1.00 15.86  ? 48   PHE C CG    1 
ATOM   3985  C  CD1   . PHE C 2  48   ? 34.151  -27.074 61.862  1.00 16.53  ? 48   PHE C CD1   1 
ATOM   3986  C  CD2   . PHE C 2  48   ? 34.563  -26.477 59.591  1.00 17.40  ? 48   PHE C CD2   1 
ATOM   3987  C  CE1   . PHE C 2  48   ? 34.819  -25.938 62.284  1.00 17.25  ? 48   PHE C CE1   1 
ATOM   3988  C  CE2   . PHE C 2  48   ? 35.229  -25.336 60.006  1.00 14.34  ? 48   PHE C CE2   1 
ATOM   3989  C  CZ    . PHE C 2  48   ? 35.357  -25.067 61.353  1.00 16.66  ? 48   PHE C CZ    1 
ATOM   3990  N  N     . ARG C 2  49   ? 31.272  -30.560 58.718  1.00 21.77  ? 49   ARG C N     1 
ATOM   3991  C  CA    . ARG C 2  49   ? 31.075  -31.787 57.959  1.00 27.05  ? 49   ARG C CA    1 
ATOM   3992  C  C     . ARG C 2  49   ? 30.048  -31.622 56.844  1.00 29.97  ? 49   ARG C C     1 
ATOM   3993  O  O     . ARG C 2  49   ? 30.086  -32.337 55.843  1.00 39.52  ? 49   ARG C O     1 
ATOM   3994  C  CB    . ARG C 2  49   ? 30.665  -32.924 58.894  1.00 25.86  ? 49   ARG C CB    1 
ATOM   3995  C  CG    . ARG C 2  49   ? 31.754  -33.330 59.868  1.00 26.84  ? 49   ARG C CG    1 
ATOM   3996  C  CD    . ARG C 2  49   ? 32.840  -34.149 59.189  1.00 34.66  ? 49   ARG C CD    1 
ATOM   3997  N  NE    . ARG C 2  49   ? 32.418  -35.533 58.993  1.00 46.08  ? 49   ARG C NE    1 
ATOM   3998  C  CZ    . ARG C 2  49   ? 31.921  -36.010 57.857  1.00 48.19  ? 49   ARG C CZ    1 
ATOM   3999  N  NH1   . ARG C 2  49   ? 31.790  -35.217 56.800  1.00 41.58  ? 49   ARG C NH1   1 
ATOM   4000  N  NH2   . ARG C 2  49   ? 31.560  -37.283 57.777  1.00 52.23  ? 49   ARG C NH2   1 
ATOM   4001  N  N     . GLU C 2  50   ? 29.122  -30.691 57.027  1.00 30.99  ? 50   GLU C N     1 
ATOM   4002  C  CA    . GLU C 2  50   ? 28.123  -30.403 56.007  1.00 33.96  ? 50   GLU C CA    1 
ATOM   4003  C  C     . GLU C 2  50   ? 28.694  -29.502 54.922  1.00 37.52  ? 50   GLU C C     1 
ATOM   4004  O  O     . GLU C 2  50   ? 28.421  -29.697 53.739  1.00 47.16  ? 50   GLU C O     1 
ATOM   4005  C  CB    . GLU C 2  50   ? 26.875  -29.772 56.626  1.00 28.33  ? 50   GLU C CB    1 
ATOM   4006  C  CG    . GLU C 2  50   ? 26.024  -30.752 57.415  1.00 43.17  ? 50   GLU C CG    1 
ATOM   4007  C  CD    . GLU C 2  50   ? 25.025  -30.058 58.317  1.00 49.47  ? 50   GLU C CD    1 
ATOM   4008  O  OE1   . GLU C 2  50   ? 24.261  -30.758 59.018  1.00 54.65  ? 50   GLU C OE1   1 
ATOM   4009  O  OE2   . GLU C 2  50   ? 25.012  -28.810 58.329  1.00 35.55  ? 50   GLU C OE2   1 
ATOM   4010  N  N     . THR C 2  51   ? 29.486  -28.514 55.327  1.00 30.11  ? 51   THR C N     1 
ATOM   4011  C  CA    . THR C 2  51   ? 30.071  -27.583 54.369  1.00 27.68  ? 51   THR C CA    1 
ATOM   4012  C  C     . THR C 2  51   ? 31.107  -28.279 53.486  1.00 35.73  ? 51   THR C C     1 
ATOM   4013  O  O     . THR C 2  51   ? 31.043  -28.206 52.256  1.00 38.92  ? 51   THR C O     1 
ATOM   4014  C  CB    . THR C 2  51   ? 30.710  -26.372 55.073  1.00 25.14  ? 51   THR C CB    1 
ATOM   4015  O  OG1   . THR C 2  51   ? 29.713  -25.678 55.832  1.00 28.64  ? 51   THR C OG1   1 
ATOM   4016  C  CG2   . THR C 2  51   ? 31.310  -25.419 54.055  1.00 22.16  ? 51   THR C CG2   1 
ATOM   4017  N  N     . PHE C 2  52   ? 32.053  -28.960 54.127  1.00 40.74  ? 52   PHE C N     1 
ATOM   4018  C  CA    . PHE C 2  52   ? 33.124  -29.668 53.430  1.00 37.03  ? 52   PHE C CA    1 
ATOM   4019  C  C     . PHE C 2  52   ? 32.711  -31.104 53.090  1.00 38.67  ? 52   PHE C C     1 
ATOM   4020  O  O     . PHE C 2  52   ? 31.862  -31.679 53.770  1.00 33.21  ? 52   PHE C O     1 
ATOM   4021  C  CB    . PHE C 2  52   ? 34.396  -29.658 54.285  1.00 30.28  ? 52   PHE C CB    1 
ATOM   4022  C  CG    . PHE C 2  52   ? 35.013  -28.295 54.438  1.00 25.51  ? 52   PHE C CG    1 
ATOM   4023  C  CD1   . PHE C 2  52   ? 36.015  -27.875 53.582  1.00 29.80  ? 52   PHE C CD1   1 
ATOM   4024  C  CD2   . PHE C 2  52   ? 34.591  -27.436 55.436  1.00 24.35  ? 52   PHE C CD2   1 
ATOM   4025  C  CE1   . PHE C 2  52   ? 36.586  -26.623 53.719  1.00 27.52  ? 52   PHE C CE1   1 
ATOM   4026  C  CE2   . PHE C 2  52   ? 35.159  -26.182 55.577  1.00 25.82  ? 52   PHE C CE2   1 
ATOM   4027  C  CZ    . PHE C 2  52   ? 36.156  -25.776 54.716  1.00 21.41  ? 52   PHE C CZ    1 
ATOM   4028  N  N     . PRO C 2  53   ? 33.316  -31.696 52.041  1.00 46.74  ? 53   PRO C N     1 
ATOM   4029  C  CA    . PRO C 2  53   ? 34.372  -31.147 51.178  1.00 43.53  ? 53   PRO C CA    1 
ATOM   4030  C  C     . PRO C 2  53   ? 33.863  -30.147 50.141  1.00 39.27  ? 53   PRO C C     1 
ATOM   4031  O  O     . PRO C 2  53   ? 32.718  -30.235 49.699  1.00 40.73  ? 53   PRO C O     1 
ATOM   4032  C  CB    . PRO C 2  53   ? 34.922  -32.392 50.481  1.00 38.52  ? 53   PRO C CB    1 
ATOM   4033  C  CG    . PRO C 2  53   ? 33.756  -33.302 50.404  1.00 33.68  ? 53   PRO C CG    1 
ATOM   4034  C  CD    . PRO C 2  53   ? 32.973  -33.079 51.666  1.00 37.03  ? 53   PRO C CD    1 
ATOM   4035  N  N     . ILE C 2  54   ? 34.725  -29.209 49.764  1.00 32.04  ? 54   ILE C N     1 
ATOM   4036  C  CA    . ILE C 2  54   ? 34.397  -28.205 48.761  1.00 39.80  ? 54   ILE C CA    1 
ATOM   4037  C  C     . ILE C 2  54   ? 35.060  -28.558 47.433  1.00 56.58  ? 54   ILE C C     1 
ATOM   4038  O  O     . ILE C 2  54   ? 36.288  -28.575 47.333  1.00 56.15  ? 54   ILE C O     1 
ATOM   4039  C  CB    . ILE C 2  54   ? 34.874  -26.810 49.199  1.00 38.19  ? 54   ILE C CB    1 
ATOM   4040  C  CG1   . ILE C 2  54   ? 34.239  -26.425 50.536  1.00 35.87  ? 54   ILE C CG1   1 
ATOM   4041  C  CG2   . ILE C 2  54   ? 34.557  -25.778 48.131  1.00 43.17  ? 54   ILE C CG2   1 
ATOM   4042  C  CD1   . ILE C 2  54   ? 34.693  -25.082 51.064  1.00 28.45  ? 54   ILE C CD1   1 
ATOM   4043  N  N     . GLU C 2  55   ? 34.252  -28.830 46.411  1.00 62.26  ? 55   GLU C N     1 
ATOM   4044  C  CA    . GLU C 2  55   ? 34.785  -29.287 45.131  1.00 58.48  ? 55   GLU C CA    1 
ATOM   4045  C  C     . GLU C 2  55   ? 34.571  -28.274 44.012  1.00 66.71  ? 55   GLU C C     1 
ATOM   4046  O  O     . GLU C 2  55   ? 33.949  -27.229 44.215  1.00 63.60  ? 55   GLU C O     1 
ATOM   4047  C  CB    . GLU C 2  55   ? 34.141  -30.616 44.734  1.00 59.48  ? 55   GLU C CB    1 
ATOM   4048  C  CG    . GLU C 2  55   ? 34.086  -31.644 45.851  1.00 62.05  ? 55   GLU C CG    1 
ATOM   4049  C  CD    . GLU C 2  55   ? 33.547  -32.983 45.382  1.00 79.87  ? 55   GLU C CD    1 
ATOM   4050  O  OE1   . GLU C 2  55   ? 32.907  -33.686 46.193  1.00 73.35  ? 55   GLU C OE1   1 
ATOM   4051  O  OE2   . GLU C 2  55   ? 33.770  -33.334 44.203  1.00 79.68  ? 55   GLU C OE2   1 
ATOM   4052  N  N     . GLU C 2  56   ? 35.087  -28.607 42.830  1.00 75.35  ? 56   GLU C N     1 
ATOM   4053  C  CA    . GLU C 2  56   ? 34.903  -27.802 41.624  1.00 76.73  ? 56   GLU C CA    1 
ATOM   4054  C  C     . GLU C 2  56   ? 35.319  -26.343 41.804  1.00 70.18  ? 56   GLU C C     1 
ATOM   4055  O  O     . GLU C 2  56   ? 36.348  -25.912 41.282  1.00 73.99  ? 56   GLU C O     1 
ATOM   4056  C  CB    . GLU C 2  56   ? 33.451  -27.891 41.147  1.00 78.57  ? 56   GLU C CB    1 
ATOM   4057  C  CG    . GLU C 2  56   ? 33.001  -29.309 40.833  1.00 79.13  ? 56   GLU C CG    1 
ATOM   4058  C  CD    . GLU C 2  56   ? 31.493  -29.450 40.803  1.00 86.57  ? 56   GLU C CD    1 
ATOM   4059  O  OE1   . GLU C 2  56   ? 30.992  -30.335 40.078  1.00 98.80  ? 56   GLU C OE1   1 
ATOM   4060  O  OE2   . GLU C 2  56   ? 30.810  -28.680 41.512  1.00 79.70  ? 56   GLU C OE2   1 
ATOM   4061  N  N     . GLY C 2  63   ? 40.830  -30.074 38.760  1.00 79.28  ? 63   GLY C N     1 
ATOM   4062  C  CA    . GLY C 2  63   ? 39.737  -29.956 39.708  1.00 70.84  ? 63   GLY C CA    1 
ATOM   4063  C  C     . GLY C 2  63   ? 40.214  -29.982 41.147  1.00 71.04  ? 63   GLY C C     1 
ATOM   4064  O  O     . GLY C 2  63   ? 40.578  -31.035 41.672  1.00 72.90  ? 63   GLY C O     1 
ATOM   4065  N  N     . LEU C 2  64   ? 40.208  -28.817 41.786  1.00 64.08  ? 64   LEU C N     1 
ATOM   4066  C  CA    . LEU C 2  64   ? 40.661  -28.697 43.168  1.00 62.72  ? 64   LEU C CA    1 
ATOM   4067  C  C     . LEU C 2  64   ? 39.589  -29.139 44.161  1.00 64.89  ? 64   LEU C C     1 
ATOM   4068  O  O     . LEU C 2  64   ? 38.394  -28.954 43.925  1.00 68.06  ? 64   LEU C O     1 
ATOM   4069  C  CB    . LEU C 2  64   ? 41.089  -27.258 43.467  1.00 59.60  ? 64   LEU C CB    1 
ATOM   4070  C  CG    . LEU C 2  64   ? 42.389  -26.778 42.820  1.00 68.92  ? 64   LEU C CG    1 
ATOM   4071  C  CD1   . LEU C 2  64   ? 42.599  -25.291 43.066  1.00 58.96  ? 64   LEU C CD1   1 
ATOM   4072  C  CD2   . LEU C 2  64   ? 43.570  -27.586 43.338  1.00 69.82  ? 64   LEU C CD2   1 
ATOM   4073  N  N     . VAL C 2  65   ? 40.027  -29.729 45.270  1.00 56.33  ? 65   VAL C N     1 
ATOM   4074  C  CA    . VAL C 2  65   ? 39.122  -30.156 46.332  1.00 50.79  ? 65   VAL C CA    1 
ATOM   4075  C  C     . VAL C 2  65   ? 39.653  -29.744 47.703  1.00 53.66  ? 65   VAL C C     1 
ATOM   4076  O  O     . VAL C 2  65   ? 40.738  -30.166 48.107  1.00 54.95  ? 65   VAL C O     1 
ATOM   4077  C  CB    . VAL C 2  65   ? 38.905  -31.685 46.315  1.00 43.37  ? 65   VAL C CB    1 
ATOM   4078  C  CG1   . VAL C 2  65   ? 38.147  -32.132 47.555  1.00 42.97  ? 65   VAL C CG1   1 
ATOM   4079  C  CG2   . VAL C 2  65   ? 38.166  -32.106 45.058  1.00 55.07  ? 65   VAL C CG2   1 
ATOM   4080  N  N     . LEU C 2  66   ? 38.887  -28.920 48.413  1.00 48.34  ? 66   LEU C N     1 
ATOM   4081  C  CA    . LEU C 2  66   ? 39.252  -28.507 49.766  1.00 40.71  ? 66   LEU C CA    1 
ATOM   4082  C  C     . LEU C 2  66   ? 38.496  -29.337 50.796  1.00 38.05  ? 66   LEU C C     1 
ATOM   4083  O  O     . LEU C 2  66   ? 37.266  -29.373 50.793  1.00 43.68  ? 66   LEU C O     1 
ATOM   4084  C  CB    . LEU C 2  66   ? 38.968  -27.020 49.978  1.00 40.51  ? 66   LEU C CB    1 
ATOM   4085  C  CG    . LEU C 2  66   ? 39.570  -26.417 51.248  1.00 36.32  ? 66   LEU C CG    1 
ATOM   4086  C  CD1   . LEU C 2  66   ? 41.067  -26.674 51.292  1.00 35.61  ? 66   LEU C CD1   1 
ATOM   4087  C  CD2   . LEU C 2  66   ? 39.285  -24.927 51.328  1.00 33.78  ? 66   LEU C CD2   1 
ATOM   4088  N  N     . ASP C 2  67   ? 39.235  -30.000 51.679  1.00 35.53  ? 67   ASP C N     1 
ATOM   4089  C  CA    . ASP C 2  67   ? 38.632  -30.931 52.626  1.00 33.13  ? 67   ASP C CA    1 
ATOM   4090  C  C     . ASP C 2  67   ? 38.880  -30.516 54.075  1.00 35.05  ? 67   ASP C C     1 
ATOM   4091  O  O     . ASP C 2  67   ? 39.816  -29.772 54.370  1.00 36.54  ? 67   ASP C O     1 
ATOM   4092  C  CB    . ASP C 2  67   ? 39.157  -32.347 52.378  1.00 38.23  ? 67   ASP C CB    1 
ATOM   4093  C  CG    . ASP C 2  67   ? 38.300  -33.410 53.037  1.00 52.39  ? 67   ASP C CG    1 
ATOM   4094  O  OD1   . ASP C 2  67   ? 37.085  -33.170 53.210  1.00 45.52  ? 67   ASP C OD1   1 
ATOM   4095  O  OD2   . ASP C 2  67   ? 38.841  -34.485 53.380  1.00 51.90  ? 67   ASP C OD2   1 
ATOM   4096  N  N     . PHE C 2  68   ? 38.032  -31.004 54.975  1.00 30.92  ? 68   PHE C N     1 
ATOM   4097  C  CA    . PHE C 2  68   ? 38.125  -30.662 56.389  1.00 28.32  ? 68   PHE C CA    1 
ATOM   4098  C  C     . PHE C 2  68   ? 38.639  -31.833 57.221  1.00 30.26  ? 68   PHE C C     1 
ATOM   4099  O  O     . PHE C 2  68   ? 38.045  -32.911 57.224  1.00 29.70  ? 68   PHE C O     1 
ATOM   4100  C  CB    . PHE C 2  68   ? 36.760  -30.198 56.910  1.00 24.03  ? 68   PHE C CB    1 
ATOM   4101  C  CG    . PHE C 2  68   ? 36.647  -30.183 58.410  1.00 20.52  ? 68   PHE C CG    1 
ATOM   4102  C  CD1   . PHE C 2  68   ? 37.151  -29.125 59.146  1.00 17.08  ? 68   PHE C CD1   1 
ATOM   4103  C  CD2   . PHE C 2  68   ? 36.018  -31.221 59.082  1.00 19.88  ? 68   PHE C CD2   1 
ATOM   4104  C  CE1   . PHE C 2  68   ? 37.044  -29.109 60.519  1.00 15.71  ? 68   PHE C CE1   1 
ATOM   4105  C  CE2   . PHE C 2  68   ? 35.908  -31.211 60.456  1.00 15.98  ? 68   PHE C CE2   1 
ATOM   4106  C  CZ    . PHE C 2  68   ? 36.420  -30.154 61.176  1.00 17.54  ? 68   PHE C CZ    1 
ATOM   4107  N  N     . LEU C 2  69   ? 39.740  -31.609 57.932  1.00 24.39  ? 69   LEU C N     1 
ATOM   4108  C  CA    . LEU C 2  69   ? 40.302  -32.627 58.812  1.00 20.94  ? 69   LEU C CA    1 
ATOM   4109  C  C     . LEU C 2  69   ? 39.714  -32.522 60.215  1.00 22.29  ? 69   LEU C C     1 
ATOM   4110  O  O     . LEU C 2  69   ? 39.001  -33.417 60.671  1.00 25.34  ? 69   LEU C O     1 
ATOM   4111  C  CB    . LEU C 2  69   ? 41.824  -32.496 58.877  1.00 24.85  ? 69   LEU C CB    1 
ATOM   4112  C  CG    . LEU C 2  69   ? 42.579  -32.677 57.562  1.00 28.21  ? 69   LEU C CG    1 
ATOM   4113  C  CD1   . LEU C 2  69   ? 44.075  -32.545 57.791  1.00 25.95  ? 69   LEU C CD1   1 
ATOM   4114  C  CD2   . LEU C 2  69   ? 42.238  -34.018 56.936  1.00 29.25  ? 69   LEU C CD2   1 
ATOM   4115  N  N     . GLU C 2  70   ? 40.022  -31.422 60.894  1.00 21.04  ? 70   GLU C N     1 
ATOM   4116  C  CA    . GLU C 2  70   ? 39.535  -31.190 62.248  1.00 22.02  ? 70   GLU C CA    1 
ATOM   4117  C  C     . GLU C 2  70   ? 39.603  -29.704 62.580  1.00 19.84  ? 70   GLU C C     1 
ATOM   4118  O  O     . GLU C 2  70   ? 40.063  -28.906 61.765  1.00 19.36  ? 70   GLU C O     1 
ATOM   4119  C  CB    . GLU C 2  70   ? 40.373  -31.987 63.246  1.00 23.70  ? 70   GLU C CB    1 
ATOM   4120  C  CG    . GLU C 2  70   ? 41.862  -31.693 63.168  1.00 23.13  ? 70   GLU C CG    1 
ATOM   4121  C  CD    . GLU C 2  70   ? 42.694  -32.734 63.885  1.00 33.37  ? 70   GLU C CD    1 
ATOM   4122  O  OE1   . GLU C 2  70   ? 43.924  -32.544 63.997  1.00 29.41  ? 70   GLU C OE1   1 
ATOM   4123  O  OE2   . GLU C 2  70   ? 42.115  -33.747 64.333  1.00 35.25  ? 70   GLU C OE2   1 
ATOM   4124  N  N     . TYR C 2  71   ? 39.142  -29.329 63.770  1.00 15.00  ? 71   TYR C N     1 
ATOM   4125  C  CA    . TYR C 2  71   ? 39.316  -27.956 64.235  1.00 16.25  ? 71   TYR C CA    1 
ATOM   4126  C  C     . TYR C 2  71   ? 39.902  -27.932 65.642  1.00 14.69  ? 71   TYR C C     1 
ATOM   4127  O  O     . TYR C 2  71   ? 40.103  -28.976 66.261  1.00 11.34  ? 71   TYR C O     1 
ATOM   4128  C  CB    . TYR C 2  71   ? 37.996  -27.165 64.184  1.00 11.68  ? 71   TYR C CB    1 
ATOM   4129  C  CG    . TYR C 2  71   ? 36.944  -27.607 65.185  1.00 14.59  ? 71   TYR C CG    1 
ATOM   4130  C  CD1   . TYR C 2  71   ? 36.947  -27.126 66.492  1.00 12.58  ? 71   TYR C CD1   1 
ATOM   4131  C  CD2   . TYR C 2  71   ? 35.939  -28.496 64.821  1.00 17.71  ? 71   TYR C CD2   1 
ATOM   4132  C  CE1   . TYR C 2  71   ? 35.991  -27.531 67.408  1.00 13.62  ? 71   TYR C CE1   1 
ATOM   4133  C  CE2   . TYR C 2  71   ? 34.975  -28.902 65.733  1.00 14.57  ? 71   TYR C CE2   1 
ATOM   4134  C  CZ    . TYR C 2  71   ? 35.006  -28.419 67.020  1.00 14.30  ? 71   TYR C CZ    1 
ATOM   4135  O  OH    . TYR C 2  71   ? 34.048  -28.825 67.921  1.00 14.18  ? 71   TYR C OH    1 
ATOM   4136  N  N     . ARG C 2  72   ? 40.175  -26.733 66.140  1.00 13.69  ? 72   ARG C N     1 
ATOM   4137  C  CA    . ARG C 2  72   ? 40.569  -26.559 67.530  1.00 15.59  ? 72   ARG C CA    1 
ATOM   4138  C  C     . ARG C 2  72   ? 40.207  -25.164 68.029  1.00 15.98  ? 72   ARG C C     1 
ATOM   4139  O  O     . ARG C 2  72   ? 40.178  -24.200 67.257  1.00 15.81  ? 72   ARG C O     1 
ATOM   4140  C  CB    . ARG C 2  72   ? 42.063  -26.830 67.726  1.00 12.82  ? 72   ARG C CB    1 
ATOM   4141  C  CG    . ARG C 2  72   ? 42.970  -25.814 67.071  1.00 15.20  ? 72   ARG C CG    1 
ATOM   4142  C  CD    . ARG C 2  72   ? 44.423  -26.047 67.433  1.00 14.00  ? 72   ARG C CD    1 
ATOM   4143  N  NE    . ARG C 2  72   ? 45.284  -25.052 66.803  1.00 17.95  ? 72   ARG C NE    1 
ATOM   4144  C  CZ    . ARG C 2  72   ? 45.694  -23.936 67.396  1.00 20.42  ? 72   ARG C CZ    1 
ATOM   4145  N  NH1   . ARG C 2  72   ? 45.331  -23.671 68.645  1.00 13.61  ? 72   ARG C NH1   1 
ATOM   4146  N  NH2   . ARG C 2  72   ? 46.472  -23.086 66.739  1.00 25.71  ? 72   ARG C NH2   1 
ATOM   4147  N  N     . LEU C 2  73   ? 39.919  -25.069 69.322  1.00 13.27  ? 73   LEU C N     1 
ATOM   4148  C  CA    . LEU C 2  73   ? 39.660  -23.787 69.954  1.00 13.49  ? 73   LEU C CA    1 
ATOM   4149  C  C     . LEU C 2  73   ? 40.793  -23.470 70.915  1.00 14.99  ? 73   LEU C C     1 
ATOM   4150  O  O     . LEU C 2  73   ? 41.082  -24.252 71.820  1.00 17.22  ? 73   LEU C O     1 
ATOM   4151  C  CB    . LEU C 2  73   ? 38.318  -23.805 70.691  1.00 13.39  ? 73   LEU C CB    1 
ATOM   4152  C  CG    . LEU C 2  73   ? 37.073  -23.909 69.807  1.00 15.46  ? 73   LEU C CG    1 
ATOM   4153  C  CD1   . LEU C 2  73   ? 35.813  -24.059 70.645  1.00 10.41  ? 73   LEU C CD1   1 
ATOM   4154  C  CD2   . LEU C 2  73   ? 36.965  -22.700 68.890  1.00 17.62  ? 73   LEU C CD2   1 
ATOM   4155  N  N     . GLY C 2  74   ? 41.439  -22.327 70.706  1.00 13.28  ? 74   GLY C N     1 
ATOM   4156  C  CA    . GLY C 2  74   ? 42.529  -21.901 71.561  1.00 13.37  ? 74   GLY C CA    1 
ATOM   4157  C  C     . GLY C 2  74   ? 42.019  -21.326 72.865  1.00 18.39  ? 74   GLY C C     1 
ATOM   4158  O  O     . GLY C 2  74   ? 40.814  -21.296 73.109  1.00 17.67  ? 74   GLY C O     1 
ATOM   4159  N  N     . GLU C 2  75   ? 42.940  -20.878 73.711  1.00 24.13  ? 75   GLU C N     1 
ATOM   4160  C  CA    . GLU C 2  75   ? 42.578  -20.213 74.956  1.00 17.80  ? 75   GLU C CA    1 
ATOM   4161  C  C     . GLU C 2  75   ? 42.140  -18.778 74.669  1.00 22.66  ? 75   GLU C C     1 
ATOM   4162  O  O     . GLU C 2  75   ? 42.563  -18.183 73.676  1.00 21.55  ? 75   GLU C O     1 
ATOM   4163  C  CB    . GLU C 2  75   ? 43.763  -20.225 75.922  1.00 19.20  ? 75   GLU C CB    1 
ATOM   4164  C  CG    . GLU C 2  75   ? 44.211  -21.620 76.331  1.00 37.97  ? 75   GLU C CG    1 
ATOM   4165  C  CD    . GLU C 2  75   ? 43.158  -22.363 77.139  1.00 50.40  ? 75   GLU C CD    1 
ATOM   4166  O  OE1   . GLU C 2  75   ? 43.096  -23.607 77.035  1.00 48.65  ? 75   GLU C OE1   1 
ATOM   4167  O  OE2   . GLU C 2  75   ? 42.396  -21.706 77.882  1.00 55.29  ? 75   GLU C OE2   1 
ATOM   4168  N  N     . PRO C 2  76   ? 41.278  -18.218 75.529  1.00 23.44  ? 76   PRO C N     1 
ATOM   4169  C  CA    . PRO C 2  76   ? 40.859  -16.830 75.319  1.00 20.00  ? 76   PRO C CA    1 
ATOM   4170  C  C     . PRO C 2  76   ? 42.036  -15.875 75.492  1.00 27.14  ? 76   PRO C C     1 
ATOM   4171  O  O     . PRO C 2  76   ? 42.770  -15.992 76.474  1.00 23.46  ? 76   PRO C O     1 
ATOM   4172  C  CB    . PRO C 2  76   ? 39.837  -16.597 76.439  1.00 24.33  ? 76   PRO C CB    1 
ATOM   4173  C  CG    . PRO C 2  76   ? 39.437  -17.957 76.906  1.00 20.59  ? 76   PRO C CG    1 
ATOM   4174  C  CD    . PRO C 2  76   ? 40.633  -18.822 76.707  1.00 21.64  ? 76   PRO C CD    1 
ATOM   4175  N  N     . PRO C 2  77   ? 42.214  -14.937 74.547  1.00 29.35  ? 77   PRO C N     1 
ATOM   4176  C  CA    . PRO C 2  77   ? 43.289  -13.942 74.630  1.00 24.36  ? 77   PRO C CA    1 
ATOM   4177  C  C     . PRO C 2  77   ? 43.158  -13.043 75.857  1.00 30.99  ? 77   PRO C C     1 
ATOM   4178  O  O     . PRO C 2  77   ? 44.161  -12.507 76.332  1.00 31.96  ? 77   PRO C O     1 
ATOM   4179  C  CB    . PRO C 2  77   ? 43.113  -13.121 73.346  1.00 21.70  ? 77   PRO C CB    1 
ATOM   4180  C  CG    . PRO C 2  77   ? 41.712  -13.382 72.901  1.00 23.60  ? 77   PRO C CG    1 
ATOM   4181  C  CD    . PRO C 2  77   ? 41.417  -14.787 73.317  1.00 24.34  ? 77   PRO C CD    1 
ATOM   4182  N  N     . PHE C 2  78   ? 41.937  -12.885 76.362  1.00 35.35  ? 78   PHE C N     1 
ATOM   4183  C  CA    . PHE C 2  78   ? 41.695  -12.060 77.543  1.00 31.86  ? 78   PHE C CA    1 
ATOM   4184  C  C     . PHE C 2  78   ? 40.647  -12.689 78.453  1.00 31.71  ? 78   PHE C C     1 
ATOM   4185  O  O     . PHE C 2  78   ? 39.703  -13.317 77.973  1.00 29.63  ? 78   PHE C O     1 
ATOM   4186  C  CB    . PHE C 2  78   ? 41.248  -10.657 77.131  1.00 31.61  ? 78   PHE C CB    1 
ATOM   4187  C  CG    . PHE C 2  78   ? 42.190  -9.980  76.184  1.00 34.59  ? 78   PHE C CG    1 
ATOM   4188  C  CD1   . PHE C 2  78   ? 41.941  -9.979  74.822  1.00 27.28  ? 78   PHE C CD1   1 
ATOM   4189  C  CD2   . PHE C 2  78   ? 43.333  -9.356  76.653  1.00 35.31  ? 78   PHE C CD2   1 
ATOM   4190  C  CE1   . PHE C 2  78   ? 42.808  -9.360  73.951  1.00 25.93  ? 78   PHE C CE1   1 
ATOM   4191  C  CE2   . PHE C 2  78   ? 44.204  -8.736  75.786  1.00 26.27  ? 78   PHE C CE2   1 
ATOM   4192  C  CZ    . PHE C 2  78   ? 43.941  -8.738  74.434  1.00 31.75  ? 78   PHE C CZ    1 
ATOM   4193  N  N     . PRO C 2  79   ? 40.817  -12.523 79.774  1.00 33.43  ? 79   PRO C N     1 
ATOM   4194  C  CA    . PRO C 2  79   ? 39.852  -13.008 80.766  1.00 32.74  ? 79   PRO C CA    1 
ATOM   4195  C  C     . PRO C 2  79   ? 38.560  -12.191 80.744  1.00 36.79  ? 79   PRO C C     1 
ATOM   4196  O  O     . PRO C 2  79   ? 38.540  -11.089 80.194  1.00 32.89  ? 79   PRO C O     1 
ATOM   4197  C  CB    . PRO C 2  79   ? 40.591  -12.819 82.092  1.00 36.89  ? 79   PRO C CB    1 
ATOM   4198  C  CG    . PRO C 2  79   ? 41.559  -11.722 81.828  1.00 40.17  ? 79   PRO C CG    1 
ATOM   4199  C  CD    . PRO C 2  79   ? 41.993  -11.903 80.408  1.00 34.91  ? 79   PRO C CD    1 
ATOM   4200  N  N     . GLN C 2  80   ? 37.502  -12.737 81.339  1.00 37.09  ? 80   GLN C N     1 
ATOM   4201  C  CA    . GLN C 2  80   ? 36.161  -12.153 81.270  1.00 35.38  ? 80   GLN C CA    1 
ATOM   4202  C  C     . GLN C 2  80   ? 36.083  -10.707 81.768  1.00 41.97  ? 80   GLN C C     1 
ATOM   4203  O  O     . GLN C 2  80   ? 35.474  -9.846  81.125  1.00 40.39  ? 80   GLN C O     1 
ATOM   4204  C  CB    . GLN C 2  80   ? 35.174  -13.028 82.047  1.00 27.91  ? 80   GLN C CB    1 
ATOM   4205  C  CG    . GLN C 2  80   ? 35.074  -14.450 81.527  1.00 26.41  ? 80   GLN C CG    1 
ATOM   4206  C  CD    . GLN C 2  80   ? 34.142  -15.317 82.356  1.00 33.13  ? 80   GLN C CD    1 
ATOM   4207  O  OE1   . GLN C 2  80   ? 33.501  -14.843 83.297  1.00 31.94  ? 80   GLN C OE1   1 
ATOM   4208  N  NE2   . GLN C 2  80   ? 34.062  -16.596 82.007  1.00 30.90  ? 80   GLN C NE2   1 
ATOM   4209  N  N     . ASP C 2  81   ? 36.698  -10.455 82.918  1.00 44.03  ? 81   ASP C N     1 
ATOM   4210  C  CA    . ASP C 2  81   ? 36.720  -9.125  83.519  1.00 46.23  ? 81   ASP C CA    1 
ATOM   4211  C  C     . ASP C 2  81   ? 37.355  -8.095  82.585  1.00 44.94  ? 81   ASP C C     1 
ATOM   4212  O  O     . ASP C 2  81   ? 36.773  -7.038  82.306  1.00 44.98  ? 81   ASP C O     1 
ATOM   4213  C  CB    . ASP C 2  81   ? 37.482  -9.181  84.843  1.00 47.75  ? 81   ASP C CB    1 
ATOM   4214  C  CG    . ASP C 2  81   ? 38.644  -10.162 84.802  1.00 60.25  ? 81   ASP C CG    1 
ATOM   4215  O  OD1   . ASP C 2  81   ? 39.786  -9.728  84.534  1.00 60.93  ? 81   ASP C OD1   1 
ATOM   4216  O  OD2   . ASP C 2  81   ? 38.412  -11.371 85.027  1.00 56.67  ? 81   ASP C OD2   1 
ATOM   4217  N  N     . GLU C 2  82   ? 38.548  -8.420  82.099  1.00 38.92  ? 82   GLU C N     1 
ATOM   4218  C  CA    . GLU C 2  82   ? 39.279  -7.549  81.190  1.00 42.16  ? 82   GLU C CA    1 
ATOM   4219  C  C     . GLU C 2  82   ? 38.462  -7.274  79.928  1.00 40.86  ? 82   GLU C C     1 
ATOM   4220  O  O     . GLU C 2  82   ? 38.522  -6.183  79.362  1.00 41.27  ? 82   GLU C O     1 
ATOM   4221  C  CB    . GLU C 2  82   ? 40.631  -8.176  80.841  1.00 42.80  ? 82   GLU C CB    1 
ATOM   4222  C  CG    . GLU C 2  82   ? 41.560  -7.283  80.038  1.00 40.36  ? 82   GLU C CG    1 
ATOM   4223  C  CD    . GLU C 2  82   ? 42.985  -7.807  80.008  1.00 49.14  ? 82   GLU C CD    1 
ATOM   4224  O  OE1   . GLU C 2  82   ? 43.346  -8.606  80.901  1.00 44.28  ? 82   GLU C OE1   1 
ATOM   4225  O  OE2   . GLU C 2  82   ? 43.743  -7.421  79.093  1.00 48.11  ? 82   GLU C OE2   1 
ATOM   4226  N  N     . CYS C 2  83   ? 37.686  -8.266  79.503  1.00 38.70  ? 83   CYS C N     1 
ATOM   4227  C  CA    . CYS C 2  83   ? 36.809  -8.103  78.352  1.00 39.16  ? 83   CYS C CA    1 
ATOM   4228  C  C     . CYS C 2  83   ? 35.679  -7.139  78.678  1.00 38.48  ? 83   CYS C C     1 
ATOM   4229  O  O     . CYS C 2  83   ? 35.269  -6.344  77.833  1.00 39.45  ? 83   CYS C O     1 
ATOM   4230  C  CB    . CYS C 2  83   ? 36.236  -9.449  77.907  1.00 35.75  ? 83   CYS C CB    1 
ATOM   4231  S  SG    . CYS C 2  83   ? 37.453  -10.580 77.200  1.00 33.57  ? 83   CYS C SG    1 
ATOM   4232  N  N     . ARG C 2  84   ? 35.175  -7.213  79.907  1.00 38.65  ? 84   ARG C N     1 
ATOM   4233  C  CA    . ARG C 2  84   ? 34.113  -6.310  80.340  1.00 42.70  ? 84   ARG C CA    1 
ATOM   4234  C  C     . ARG C 2  84   ? 34.592  -4.862  80.382  1.00 50.82  ? 84   ARG C C     1 
ATOM   4235  O  O     . ARG C 2  84   ? 33.871  -3.952  79.966  1.00 47.13  ? 84   ARG C O     1 
ATOM   4236  C  CB    . ARG C 2  84   ? 33.562  -6.720  81.710  1.00 38.03  ? 84   ARG C CB    1 
ATOM   4237  C  CG    . ARG C 2  84   ? 32.748  -8.001  81.694  1.00 36.67  ? 84   ARG C CG    1 
ATOM   4238  C  CD    . ARG C 2  84   ? 32.018  -8.222  83.010  1.00 26.70  ? 84   ARG C CD    1 
ATOM   4239  N  NE    . ARG C 2  84   ? 31.158  -9.400  82.950  1.00 23.84  ? 84   ARG C NE    1 
ATOM   4240  C  CZ    . ARG C 2  84   ? 31.481  -10.591 83.443  1.00 26.05  ? 84   ARG C CZ    1 
ATOM   4241  N  NH1   . ARG C 2  84   ? 32.645  -10.766 84.054  1.00 33.27  ? 84   ARG C NH1   1 
ATOM   4242  N  NH2   . ARG C 2  84   ? 30.634  -11.606 83.334  1.00 25.13  ? 84   ARG C NH2   1 
ATOM   4243  N  N     . GLU C 2  85   ? 35.809  -4.652  80.880  1.00 53.63  ? 85   GLU C N     1 
ATOM   4244  C  CA    . GLU C 2  85   ? 36.343  -3.296  81.012  1.00 51.96  ? 85   GLU C CA    1 
ATOM   4245  C  C     . GLU C 2  85   ? 36.737  -2.675  79.674  1.00 49.97  ? 85   GLU C C     1 
ATOM   4246  O  O     . GLU C 2  85   ? 36.432  -1.513  79.405  1.00 51.28  ? 85   GLU C O     1 
ATOM   4247  C  CB    . GLU C 2  85   ? 37.534  -3.263  81.971  1.00 48.83  ? 85   GLU C CB    1 
ATOM   4248  C  CG    . GLU C 2  85   ? 38.190  -1.894  82.069  1.00 58.96  ? 85   GLU C CG    1 
ATOM   4249  C  CD    . GLU C 2  85   ? 39.240  -1.818  83.161  1.00 80.02  ? 85   GLU C CD    1 
ATOM   4250  O  OE1   . GLU C 2  85   ? 38.957  -2.269  84.292  1.00 73.46  ? 85   GLU C OE1   1 
ATOM   4251  O  OE2   . GLU C 2  85   ? 40.348  -1.307  82.887  1.00 77.31  ? 85   GLU C OE2   1 
ATOM   4252  N  N     . LYS C 2  86   ? 37.409  -3.459  78.837  1.00 47.47  ? 86   LYS C N     1 
ATOM   4253  C  CA    . LYS C 2  86   ? 37.927  -2.964  77.563  1.00 47.62  ? 86   LYS C CA    1 
ATOM   4254  C  C     . LYS C 2  86   ? 36.889  -3.024  76.442  1.00 47.18  ? 86   LYS C C     1 
ATOM   4255  O  O     . LYS C 2  86   ? 37.206  -2.746  75.284  1.00 42.62  ? 86   LYS C O     1 
ATOM   4256  C  CB    . LYS C 2  86   ? 39.193  -3.725  77.160  1.00 41.58  ? 86   LYS C CB    1 
ATOM   4257  C  CG    . LYS C 2  86   ? 40.370  -3.528  78.106  1.00 50.61  ? 86   LYS C CG    1 
ATOM   4258  C  CD    . LYS C 2  86   ? 41.611  -4.261  77.612  1.00 50.30  ? 86   LYS C CD    1 
ATOM   4259  C  CE    . LYS C 2  86   ? 42.812  -3.988  78.506  1.00 52.22  ? 86   LYS C CE    1 
ATOM   4260  N  NZ    . LYS C 2  86   ? 44.048  -4.658  78.006  1.00 51.18  ? 86   LYS C NZ    1 
ATOM   4261  N  N     . ASP C 2  87   ? 35.664  -3.412  76.793  1.00 43.19  ? 87   ASP C N     1 
ATOM   4262  C  CA    . ASP C 2  87   ? 34.569  -3.558  75.831  1.00 41.79  ? 87   ASP C CA    1 
ATOM   4263  C  C     . ASP C 2  87   ? 34.900  -4.600  74.767  1.00 40.49  ? 87   ASP C C     1 
ATOM   4264  O  O     . ASP C 2  87   ? 34.570  -4.438  73.590  1.00 33.50  ? 87   ASP C O     1 
ATOM   4265  C  CB    . ASP C 2  87   ? 34.200  -2.217  75.184  1.00 44.48  ? 87   ASP C CB    1 
ATOM   4266  C  CG    . ASP C 2  87   ? 33.569  -1.246  76.168  1.00 61.14  ? 87   ASP C CG    1 
ATOM   4267  O  OD1   . ASP C 2  87   ? 33.859  -1.348  77.380  1.00 58.12  ? 87   ASP C OD1   1 
ATOM   4268  O  OD2   . ASP C 2  87   ? 32.782  -0.379  75.726  1.00 66.48  ? 87   ASP C OD2   1 
ATOM   4269  N  N     . LEU C 2  88   ? 35.553  -5.674  75.198  1.00 40.91  ? 88   LEU C N     1 
ATOM   4270  C  CA    . LEU C 2  88   ? 35.923  -6.758  74.303  1.00 36.75  ? 88   LEU C CA    1 
ATOM   4271  C  C     . LEU C 2  88   ? 34.894  -7.874  74.366  1.00 30.63  ? 88   LEU C C     1 
ATOM   4272  O  O     . LEU C 2  88   ? 33.923  -7.797  75.116  1.00 35.05  ? 88   LEU C O     1 
ATOM   4273  C  CB    . LEU C 2  88   ? 37.297  -7.312  74.677  1.00 32.88  ? 88   LEU C CB    1 
ATOM   4274  C  CG    . LEU C 2  88   ? 38.443  -6.302  74.683  1.00 38.15  ? 88   LEU C CG    1 
ATOM   4275  C  CD1   . LEU C 2  88   ? 39.774  -7.008  74.899  1.00 39.73  ? 88   LEU C CD1   1 
ATOM   4276  C  CD2   . LEU C 2  88   ? 38.455  -5.492  73.393  1.00 38.21  ? 88   LEU C CD2   1 
ATOM   4277  N  N     . THR C 2  89   ? 35.119  -8.913  73.574  1.00 23.55  ? 89   THR C N     1 
ATOM   4278  C  CA    . THR C 2  89   ? 34.258  -10.083 73.585  1.00 22.45  ? 89   THR C CA    1 
ATOM   4279  C  C     . THR C 2  89   ? 35.026  -11.290 74.108  1.00 22.15  ? 89   THR C C     1 
ATOM   4280  O  O     . THR C 2  89   ? 36.113  -11.597 73.619  1.00 23.31  ? 89   THR C O     1 
ATOM   4281  C  CB    . THR C 2  89   ? 33.726  -10.381 72.179  1.00 18.47  ? 89   THR C CB    1 
ATOM   4282  O  OG1   . THR C 2  89   ? 32.754  -9.390  71.824  1.00 23.37  ? 89   THR C OG1   1 
ATOM   4283  C  CG2   . THR C 2  89   ? 33.082  -11.755 72.127  1.00 20.68  ? 89   THR C CG2   1 
ATOM   4284  N  N     . TYR C 2  90   ? 34.474  -11.964 75.114  1.00 18.82  ? 90   TYR C N     1 
ATOM   4285  C  CA    . TYR C 2  90   ? 35.111  -13.166 75.632  1.00 18.75  ? 90   TYR C CA    1 
ATOM   4286  C  C     . TYR C 2  90   ? 34.953  -14.238 74.567  1.00 19.48  ? 90   TYR C C     1 
ATOM   4287  O  O     . TYR C 2  90   ? 33.837  -14.606 74.198  1.00 20.44  ? 90   TYR C O     1 
ATOM   4288  C  CB    . TYR C 2  90   ? 34.449  -13.595 76.941  1.00 20.31  ? 90   TYR C CB    1 
ATOM   4289  C  CG    . TYR C 2  90   ? 35.192  -14.673 77.699  1.00 22.41  ? 90   TYR C CG    1 
ATOM   4290  C  CD1   . TYR C 2  90   ? 36.555  -14.561 77.945  1.00 22.14  ? 90   TYR C CD1   1 
ATOM   4291  C  CD2   . TYR C 2  90   ? 34.525  -15.790 78.192  1.00 19.28  ? 90   TYR C CD2   1 
ATOM   4292  C  CE1   . TYR C 2  90   ? 37.239  -15.538 78.644  1.00 22.40  ? 90   TYR C CE1   1 
ATOM   4293  C  CE2   . TYR C 2  90   ? 35.199  -16.772 78.893  1.00 23.63  ? 90   TYR C CE2   1 
ATOM   4294  C  CZ    . TYR C 2  90   ? 36.557  -16.641 79.117  1.00 29.80  ? 90   TYR C CZ    1 
ATOM   4295  O  OH    . TYR C 2  90   ? 37.236  -17.616 79.815  1.00 28.05  ? 90   TYR C OH    1 
ATOM   4296  N  N     . GLN C 2  91   ? 36.080  -14.740 74.077  1.00 20.24  ? 91   GLN C N     1 
ATOM   4297  C  CA    . GLN C 2  91   ? 36.074  -15.585 72.894  1.00 18.79  ? 91   GLN C CA    1 
ATOM   4298  C  C     . GLN C 2  91   ? 37.341  -16.416 72.784  1.00 20.45  ? 91   GLN C C     1 
ATOM   4299  O  O     . GLN C 2  91   ? 38.352  -16.112 73.417  1.00 28.25  ? 91   GLN C O     1 
ATOM   4300  C  CB    . GLN C 2  91   ? 35.918  -14.723 71.644  1.00 17.64  ? 91   GLN C CB    1 
ATOM   4301  C  CG    . GLN C 2  91   ? 37.053  -13.740 71.451  1.00 20.13  ? 91   GLN C CG    1 
ATOM   4302  C  CD    . GLN C 2  91   ? 36.713  -12.650 70.462  1.00 23.25  ? 91   GLN C CD    1 
ATOM   4303  O  OE1   . GLN C 2  91   ? 35.637  -12.655 69.863  1.00 22.53  ? 91   GLN C OE1   1 
ATOM   4304  N  NE2   . GLN C 2  91   ? 37.630  -11.705 70.284  1.00 24.78  ? 91   GLN C NE2   1 
ATOM   4305  N  N     . ALA C 2  92   ? 37.284  -17.459 71.965  1.00 17.47  ? 92   ALA C N     1 
ATOM   4306  C  CA    . ALA C 2  92   ? 38.447  -18.294 71.710  1.00 15.36  ? 92   ALA C CA    1 
ATOM   4307  C  C     . ALA C 2  92   ? 38.724  -18.343 70.216  1.00 15.00  ? 92   ALA C C     1 
ATOM   4308  O  O     . ALA C 2  92   ? 37.793  -18.383 69.410  1.00 14.82  ? 92   ALA C O     1 
ATOM   4309  C  CB    . ALA C 2  92   ? 38.219  -19.692 72.248  1.00 16.31  ? 92   ALA C CB    1 
ATOM   4310  N  N     . PRO C 2  93   ? 40.010  -18.336 69.842  1.00 15.96  ? 93   PRO C N     1 
ATOM   4311  C  CA    . PRO C 2  93   ? 40.393  -18.424 68.432  1.00 14.38  ? 93   PRO C CA    1 
ATOM   4312  C  C     . PRO C 2  93   ? 40.030  -19.790 67.863  1.00 13.38  ? 93   PRO C C     1 
ATOM   4313  O  O     . PRO C 2  93   ? 40.284  -20.805 68.508  1.00 11.86  ? 93   PRO C O     1 
ATOM   4314  C  CB    . PRO C 2  93   ? 41.913  -18.240 68.474  1.00 17.60  ? 93   PRO C CB    1 
ATOM   4315  C  CG    . PRO C 2  93   ? 42.311  -18.667 69.842  1.00 16.45  ? 93   PRO C CG    1 
ATOM   4316  C  CD    . PRO C 2  93   ? 41.181  -18.256 70.732  1.00 16.75  ? 93   PRO C CD    1 
ATOM   4317  N  N     . LEU C 2  94   ? 39.432  -19.806 66.677  1.00 14.44  ? 94   LEU C N     1 
ATOM   4318  C  CA    . LEU C 2  94   ? 39.005  -21.048 66.043  1.00 14.56  ? 94   LEU C CA    1 
ATOM   4319  C  C     . LEU C 2  94   ? 39.883  -21.375 64.847  1.00 17.39  ? 94   LEU C C     1 
ATOM   4320  O  O     . LEU C 2  94   ? 39.848  -20.677 63.834  1.00 21.61  ? 94   LEU C O     1 
ATOM   4321  C  CB    . LEU C 2  94   ? 37.546  -20.945 65.595  1.00 20.93  ? 94   LEU C CB    1 
ATOM   4322  C  CG    . LEU C 2  94   ? 37.018  -22.040 64.659  1.00 21.68  ? 94   LEU C CG    1 
ATOM   4323  C  CD1   . LEU C 2  94   ? 36.989  -23.395 65.349  1.00 14.90  ? 94   LEU C CD1   1 
ATOM   4324  C  CD2   . LEU C 2  94   ? 35.638  -21.674 64.127  1.00 17.06  ? 94   LEU C CD2   1 
ATOM   4325  N  N     . TYR C 2  95   ? 40.670  -22.439 64.964  1.00 18.56  ? 95   TYR C N     1 
ATOM   4326  C  CA    . TYR C 2  95   ? 41.530  -22.864 63.866  1.00 16.00  ? 95   TYR C CA    1 
ATOM   4327  C  C     . TYR C 2  95   ? 40.944  -24.102 63.206  1.00 19.25  ? 95   TYR C C     1 
ATOM   4328  O  O     . TYR C 2  95   ? 40.353  -24.952 63.873  1.00 18.11  ? 95   TYR C O     1 
ATOM   4329  C  CB    . TYR C 2  95   ? 42.945  -23.153 64.366  1.00 14.88  ? 95   TYR C CB    1 
ATOM   4330  C  CG    . TYR C 2  95   ? 43.611  -21.977 65.042  1.00 16.67  ? 95   TYR C CG    1 
ATOM   4331  C  CD1   . TYR C 2  95   ? 43.396  -21.713 66.387  1.00 16.47  ? 95   TYR C CD1   1 
ATOM   4332  C  CD2   . TYR C 2  95   ? 44.459  -21.132 64.337  1.00 15.65  ? 95   TYR C CD2   1 
ATOM   4333  C  CE1   . TYR C 2  95   ? 44.003  -20.641 67.012  1.00 17.38  ? 95   TYR C CE1   1 
ATOM   4334  C  CE2   . TYR C 2  95   ? 45.072  -20.056 64.953  1.00 14.90  ? 95   TYR C CE2   1 
ATOM   4335  C  CZ    . TYR C 2  95   ? 44.840  -19.816 66.291  1.00 21.23  ? 95   TYR C CZ    1 
ATOM   4336  O  OH    . TYR C 2  95   ? 45.444  -18.747 66.915  1.00 28.82  ? 95   TYR C OH    1 
ATOM   4337  N  N     . ALA C 2  96   ? 41.093  -24.199 61.891  1.00 15.93  ? 96   ALA C N     1 
ATOM   4338  C  CA    . ALA C 2  96   ? 40.598  -25.362 61.169  1.00 16.15  ? 96   ALA C CA    1 
ATOM   4339  C  C     . ALA C 2  96   ? 41.687  -25.927 60.269  1.00 22.95  ? 96   ALA C C     1 
ATOM   4340  O  O     . ALA C 2  96   ? 42.257  -25.214 59.441  1.00 23.60  ? 96   ALA C O     1 
ATOM   4341  C  CB    . ALA C 2  96   ? 39.361  -25.003 60.361  1.00 13.10  ? 96   ALA C CB    1 
ATOM   4342  N  N     . ARG C 2  97   ? 41.984  -27.211 60.437  1.00 20.79  ? 97   ARG C N     1 
ATOM   4343  C  CA    . ARG C 2  97   ? 42.993  -27.850 59.610  1.00 21.05  ? 97   ARG C CA    1 
ATOM   4344  C  C     . ARG C 2  97   ? 42.366  -28.324 58.314  1.00 21.22  ? 97   ARG C C     1 
ATOM   4345  O  O     . ARG C 2  97   ? 41.480  -29.179 58.307  1.00 19.15  ? 97   ARG C O     1 
ATOM   4346  C  CB    . ARG C 2  97   ? 43.660  -29.005 60.354  1.00 22.08  ? 97   ARG C CB    1 
ATOM   4347  C  CG    . ARG C 2  97   ? 44.609  -28.544 61.454  1.00 34.13  ? 97   ARG C CG    1 
ATOM   4348  C  CD    . ARG C 2  97   ? 45.378  -29.706 62.047  1.00 37.16  ? 97   ARG C CD    1 
ATOM   4349  N  NE    . ARG C 2  97   ? 45.882  -30.597 61.008  1.00 40.03  ? 97   ARG C NE    1 
ATOM   4350  C  CZ    . ARG C 2  97   ? 46.553  -31.718 61.248  1.00 42.72  ? 97   ARG C CZ    1 
ATOM   4351  N  NH1   . ARG C 2  97   ? 46.969  -32.473 60.239  1.00 44.39  ? 97   ARG C NH1   1 
ATOM   4352  N  NH2   . ARG C 2  97   ? 46.810  -32.083 62.498  1.00 42.66  ? 97   ARG C NH2   1 
ATOM   4353  N  N     . LEU C 2  98   ? 42.840  -27.755 57.214  1.00 23.25  ? 98   LEU C N     1 
ATOM   4354  C  CA    . LEU C 2  98   ? 42.283  -28.042 55.905  1.00 30.03  ? 98   LEU C CA    1 
ATOM   4355  C  C     . LEU C 2  98   ? 43.376  -28.539 54.975  1.00 37.37  ? 98   LEU C C     1 
ATOM   4356  O  O     . LEU C 2  98   ? 44.560  -28.262 55.187  1.00 43.27  ? 98   LEU C O     1 
ATOM   4357  C  CB    . LEU C 2  98   ? 41.649  -26.778 55.325  1.00 32.40  ? 98   LEU C CB    1 
ATOM   4358  C  CG    . LEU C 2  98   ? 40.665  -26.039 56.232  1.00 21.38  ? 98   LEU C CG    1 
ATOM   4359  C  CD1   . LEU C 2  98   ? 40.228  -24.738 55.588  1.00 23.30  ? 98   LEU C CD1   1 
ATOM   4360  C  CD2   . LEU C 2  98   ? 39.470  -26.920 56.540  1.00 18.61  ? 98   LEU C CD2   1 
ATOM   4361  N  N     . GLN C 2  99   ? 42.979  -29.276 53.943  1.00 38.84  ? 99   GLN C N     1 
ATOM   4362  C  CA    . GLN C 2  99   ? 43.927  -29.703 52.922  1.00 49.77  ? 99   GLN C CA    1 
ATOM   4363  C  C     . GLN C 2  99   ? 43.352  -29.569 51.515  1.00 44.30  ? 99   GLN C C     1 
ATOM   4364  O  O     . GLN C 2  99   ? 42.264  -30.061 51.221  1.00 48.93  ? 99   GLN C O     1 
ATOM   4365  C  CB    . GLN C 2  99   ? 44.412  -31.134 53.179  1.00 48.59  ? 99   GLN C CB    1 
ATOM   4366  C  CG    . GLN C 2  99   ? 43.321  -32.187 53.167  1.00 43.31  ? 99   GLN C CG    1 
ATOM   4367  C  CD    . GLN C 2  99   ? 43.879  -33.594 53.159  1.00 58.71  ? 99   GLN C CD    1 
ATOM   4368  O  OE1   . GLN C 2  99   ? 43.193  -34.544 52.779  1.00 68.07  ? 99   GLN C OE1   1 
ATOM   4369  N  NE2   . GLN C 2  99   ? 45.133  -33.736 53.581  1.00 52.50  ? 99   GLN C NE2   1 
ATOM   4370  N  N     . LEU C 2  100  ? 44.089  -28.881 50.652  1.00 47.85  ? 100  LEU C N     1 
ATOM   4371  C  CA    . LEU C 2  100  ? 43.722  -28.782 49.251  1.00 50.92  ? 100  LEU C CA    1 
ATOM   4372  C  C     . LEU C 2  100  ? 44.320  -29.953 48.491  1.00 51.33  ? 100  LEU C C     1 
ATOM   4373  O  O     . LEU C 2  100  ? 45.515  -30.226 48.596  1.00 54.26  ? 100  LEU C O     1 
ATOM   4374  C  CB    . LEU C 2  100  ? 44.215  -27.468 48.652  1.00 44.56  ? 100  LEU C CB    1 
ATOM   4375  C  CG    . LEU C 2  100  ? 43.823  -27.291 47.186  1.00 50.70  ? 100  LEU C CG    1 
ATOM   4376  C  CD1   . LEU C 2  100  ? 42.314  -27.417 47.029  1.00 47.80  ? 100  LEU C CD1   1 
ATOM   4377  C  CD2   . LEU C 2  100  ? 44.313  -25.959 46.651  1.00 55.64  ? 100  LEU C CD2   1 
ATOM   4378  N  N     . ILE C 2  101  ? 43.482  -30.650 47.732  1.00 52.00  ? 101  ILE C N     1 
ATOM   4379  C  CA    . ILE C 2  101  ? 43.941  -31.780 46.940  1.00 56.65  ? 101  ILE C CA    1 
ATOM   4380  C  C     . ILE C 2  101  ? 43.576  -31.592 45.475  1.00 68.13  ? 101  ILE C C     1 
ATOM   4381  O  O     . ILE C 2  101  ? 42.397  -31.574 45.123  1.00 73.68  ? 101  ILE C O     1 
ATOM   4382  C  CB    . ILE C 2  101  ? 43.322  -33.103 47.432  1.00 51.74  ? 101  ILE C CB    1 
ATOM   4383  C  CG1   . ILE C 2  101  ? 43.650  -33.336 48.908  1.00 60.32  ? 101  ILE C CG1   1 
ATOM   4384  C  CG2   . ILE C 2  101  ? 43.811  -34.266 46.587  1.00 60.53  ? 101  ILE C CG2   1 
ATOM   4385  C  CD1   . ILE C 2  101  ? 43.091  -34.631 49.464  1.00 49.10  ? 101  ILE C CD1   1 
ATOM   4386  N  N     . HIS C 2  102  ? 44.585  -31.448 44.621  1.00 78.61  ? 102  HIS C N     1 
ATOM   4387  C  CA    . HIS C 2  102  ? 44.344  -31.414 43.186  1.00 81.59  ? 102  HIS C CA    1 
ATOM   4388  C  C     . HIS C 2  102  ? 44.189  -32.854 42.715  1.00 89.96  ? 102  HIS C C     1 
ATOM   4389  O  O     . HIS C 2  102  ? 45.104  -33.663 42.868  1.00 93.61  ? 102  HIS C O     1 
ATOM   4390  C  CB    . HIS C 2  102  ? 45.498  -30.728 42.451  1.00 75.75  ? 102  HIS C CB    1 
ATOM   4391  C  CG    . HIS C 2  102  ? 45.155  -30.294 41.059  1.00 86.31  ? 102  HIS C CG    1 
ATOM   4392  N  ND1   . HIS C 2  102  ? 44.931  -31.188 40.034  1.00 92.71  ? 102  HIS C ND1   1 
ATOM   4393  C  CD2   . HIS C 2  102  ? 44.996  -29.061 40.523  1.00 84.73  ? 102  HIS C CD2   1 
ATOM   4394  C  CE1   . HIS C 2  102  ? 44.648  -30.524 38.927  1.00 90.14  ? 102  HIS C CE1   1 
ATOM   4395  N  NE2   . HIS C 2  102  ? 44.681  -29.231 39.197  1.00 82.21  ? 102  HIS C NE2   1 
ATOM   4396  N  N     . LYS C 2  103  ? 43.026  -33.170 42.152  1.00 87.18  ? 103  LYS C N     1 
ATOM   4397  C  CA    . LYS C 2  103  ? 42.700  -34.543 41.776  1.00 87.99  ? 103  LYS C CA    1 
ATOM   4398  C  C     . LYS C 2  103  ? 43.661  -35.118 40.738  1.00 101.05 ? 103  LYS C C     1 
ATOM   4399  O  O     . LYS C 2  103  ? 44.194  -36.216 40.913  1.00 95.93  ? 103  LYS C O     1 
ATOM   4400  C  CB    . LYS C 2  103  ? 41.260  -34.631 41.263  1.00 88.30  ? 103  LYS C CB    1 
ATOM   4401  C  CG    . LYS C 2  103  ? 40.201  -34.516 42.347  1.00 79.26  ? 103  LYS C CG    1 
ATOM   4402  C  CD    . LYS C 2  103  ? 38.811  -34.735 41.773  1.00 86.91  ? 103  LYS C CD    1 
ATOM   4403  C  CE    . LYS C 2  103  ? 37.780  -34.921 42.875  1.00 88.37  ? 103  LYS C CE    1 
ATOM   4404  N  NZ    . LYS C 2  103  ? 36.410  -35.132 42.331  1.00 92.17  ? 103  LYS C NZ    1 
ATOM   4405  N  N     . ASP C 2  104  ? 43.878  -34.370 39.662  1.00 98.69  ? 104  ASP C N     1 
ATOM   4406  C  CA    . ASP C 2  104  ? 44.740  -34.815 38.574  1.00 90.50  ? 104  ASP C CA    1 
ATOM   4407  C  C     . ASP C 2  104  ? 46.191  -34.944 39.022  1.00 91.47  ? 104  ASP C C     1 
ATOM   4408  O  O     . ASP C 2  104  ? 46.810  -35.995 38.858  1.00 97.84  ? 104  ASP C O     1 
ATOM   4409  C  CB    . ASP C 2  104  ? 44.645  -33.845 37.398  1.00 95.93  ? 104  ASP C CB    1 
ATOM   4410  C  CG    . ASP C 2  104  ? 43.218  -33.621 36.946  1.00 103.59 ? 104  ASP C CG    1 
ATOM   4411  O  OD1   . ASP C 2  104  ? 42.425  -34.587 36.980  1.00 97.78  ? 104  ASP C OD1   1 
ATOM   4412  O  OD2   . ASP C 2  104  ? 42.889  -32.479 36.562  1.00 108.95 ? 104  ASP C OD2   1 
ATOM   4413  N  N     . THR C 2  105  ? 46.723  -33.868 39.592  1.00 91.94  ? 105  THR C N     1 
ATOM   4414  C  CA    . THR C 2  105  ? 48.114  -33.831 40.026  1.00 92.69  ? 105  THR C CA    1 
ATOM   4415  C  C     . THR C 2  105  ? 48.383  -34.813 41.163  1.00 90.98  ? 105  THR C C     1 
ATOM   4416  O  O     . THR C 2  105  ? 49.428  -35.462 41.202  1.00 90.34  ? 105  THR C O     1 
ATOM   4417  C  CB    . THR C 2  105  ? 48.512  -32.417 40.490  1.00 85.45  ? 105  THR C CB    1 
ATOM   4418  O  OG1   . THR C 2  105  ? 48.123  -31.459 39.499  1.00 94.30  ? 105  THR C OG1   1 
ATOM   4419  C  CG2   . THR C 2  105  ? 50.013  -32.330 40.714  1.00 77.60  ? 105  THR C CG2   1 
ATOM   4420  N  N     . GLY C 2  106  ? 47.430  -34.921 42.083  1.00 91.82  ? 106  GLY C N     1 
ATOM   4421  C  CA    . GLY C 2  106  ? 47.613  -35.729 43.273  1.00 90.73  ? 106  GLY C CA    1 
ATOM   4422  C  C     . GLY C 2  106  ? 48.279  -34.910 44.362  1.00 95.42  ? 106  GLY C C     1 
ATOM   4423  O  O     . GLY C 2  106  ? 48.525  -35.401 45.465  1.00 89.21  ? 106  GLY C O     1 
ATOM   4424  N  N     . LEU C 2  107  ? 48.568  -33.651 44.042  1.00 93.00  ? 107  LEU C N     1 
ATOM   4425  C  CA    . LEU C 2  107  ? 49.227  -32.740 44.971  1.00 83.81  ? 107  LEU C CA    1 
ATOM   4426  C  C     . LEU C 2  107  ? 48.330  -32.408 46.158  1.00 76.10  ? 107  LEU C C     1 
ATOM   4427  O  O     . LEU C 2  107  ? 47.173  -32.021 45.989  1.00 64.94  ? 107  LEU C O     1 
ATOM   4428  C  CB    . LEU C 2  107  ? 49.646  -31.454 44.252  1.00 78.73  ? 107  LEU C CB    1 
ATOM   4429  C  CG    . LEU C 2  107  ? 50.357  -30.392 45.095  1.00 80.72  ? 107  LEU C CG    1 
ATOM   4430  C  CD1   . LEU C 2  107  ? 51.660  -30.935 45.662  1.00 81.27  ? 107  LEU C CD1   1 
ATOM   4431  C  CD2   . LEU C 2  107  ? 50.606  -29.127 44.283  1.00 75.82  ? 107  LEU C CD2   1 
ATOM   4432  N  N     . ILE C 2  108  ? 48.875  -32.563 47.360  1.00 73.27  ? 108  ILE C N     1 
ATOM   4433  C  CA    . ILE C 2  108  ? 48.137  -32.276 48.582  1.00 65.96  ? 108  ILE C CA    1 
ATOM   4434  C  C     . ILE C 2  108  ? 48.864  -31.236 49.430  1.00 65.19  ? 108  ILE C C     1 
ATOM   4435  O  O     . ILE C 2  108  ? 49.968  -31.482 49.915  1.00 68.97  ? 108  ILE C O     1 
ATOM   4436  C  CB    . ILE C 2  108  ? 47.925  -33.551 49.420  1.00 55.18  ? 108  ILE C CB    1 
ATOM   4437  C  CG1   . ILE C 2  108  ? 47.153  -34.599 48.613  1.00 58.72  ? 108  ILE C CG1   1 
ATOM   4438  C  CG2   . ILE C 2  108  ? 47.198  -33.223 50.714  1.00 50.14  ? 108  ILE C CG2   1 
ATOM   4439  C  CD1   . ILE C 2  108  ? 46.949  -35.910 49.344  1.00 50.25  ? 108  ILE C CD1   1 
ATOM   4440  N  N     . LYS C 2  109  ? 48.241  -30.074 49.599  1.00 59.04  ? 109  LYS C N     1 
ATOM   4441  C  CA    . LYS C 2  109  ? 48.793  -29.023 50.448  1.00 55.48  ? 109  LYS C CA    1 
ATOM   4442  C  C     . LYS C 2  109  ? 47.951  -28.871 51.716  1.00 57.26  ? 109  LYS C C     1 
ATOM   4443  O  O     . LYS C 2  109  ? 46.768  -28.552 51.649  1.00 53.62  ? 109  LYS C O     1 
ATOM   4444  C  CB    . LYS C 2  109  ? 48.868  -27.698 49.686  1.00 45.29  ? 109  LYS C CB    1 
ATOM   4445  C  CG    . LYS C 2  109  ? 49.209  -26.494 50.554  1.00 59.36  ? 109  LYS C CG    1 
ATOM   4446  C  CD    . LYS C 2  109  ? 50.557  -26.653 51.244  1.00 60.54  ? 109  LYS C CD    1 
ATOM   4447  C  CE    . LYS C 2  109  ? 50.849  -25.470 52.156  1.00 48.76  ? 109  LYS C CE    1 
ATOM   4448  N  NZ    . LYS C 2  109  ? 52.168  -25.598 52.834  1.00 65.12  ? 109  LYS C NZ    1 
ATOM   4449  N  N     . GLU C 2  110  ? 48.571  -29.098 52.870  1.00 57.42  ? 110  GLU C N     1 
ATOM   4450  C  CA    . GLU C 2  110  ? 47.845  -29.133 54.136  1.00 46.22  ? 110  GLU C CA    1 
ATOM   4451  C  C     . GLU C 2  110  ? 48.257  -27.998 55.068  1.00 44.70  ? 110  GLU C C     1 
ATOM   4452  O  O     . GLU C 2  110  ? 49.445  -27.764 55.285  1.00 46.89  ? 110  GLU C O     1 
ATOM   4453  C  CB    . GLU C 2  110  ? 48.070  -30.482 54.816  1.00 45.42  ? 110  GLU C CB    1 
ATOM   4454  C  CG    . GLU C 2  110  ? 47.449  -30.615 56.186  1.00 42.73  ? 110  GLU C CG    1 
ATOM   4455  C  CD    . GLU C 2  110  ? 47.700  -31.980 56.788  1.00 47.56  ? 110  GLU C CD    1 
ATOM   4456  O  OE1   . GLU C 2  110  ? 48.108  -32.041 57.966  1.00 49.03  ? 110  GLU C OE1   1 
ATOM   4457  O  OE2   . GLU C 2  110  ? 47.492  -32.991 56.079  1.00 41.27  ? 110  GLU C OE2   1 
ATOM   4458  N  N     . ASP C 2  111  ? 47.272  -27.289 55.612  1.00 40.87  ? 111  ASP C N     1 
ATOM   4459  C  CA    . ASP C 2  111  ? 47.562  -26.163 56.494  1.00 42.73  ? 111  ASP C CA    1 
ATOM   4460  C  C     . ASP C 2  111  ? 46.435  -25.896 57.500  1.00 34.56  ? 111  ASP C C     1 
ATOM   4461  O  O     . ASP C 2  111  ? 45.263  -26.157 57.219  1.00 37.68  ? 111  ASP C O     1 
ATOM   4462  C  CB    . ASP C 2  111  ? 47.850  -24.912 55.657  1.00 43.57  ? 111  ASP C CB    1 
ATOM   4463  C  CG    . ASP C 2  111  ? 48.617  -23.849 56.427  1.00 55.40  ? 111  ASP C CG    1 
ATOM   4464  O  OD1   . ASP C 2  111  ? 48.534  -22.662 56.042  1.00 54.18  ? 111  ASP C OD1   1 
ATOM   4465  O  OD2   . ASP C 2  111  ? 49.307  -24.196 57.410  1.00 55.76  ? 111  ASP C OD2   1 
ATOM   4466  N  N     . GLU C 2  112  ? 46.799  -25.383 58.673  1.00 20.78  ? 112  GLU C N     1 
ATOM   4467  C  CA    . GLU C 2  112  ? 45.813  -24.978 59.671  1.00 25.78  ? 112  GLU C CA    1 
ATOM   4468  C  C     . GLU C 2  112  ? 45.503  -23.489 59.544  1.00 26.90  ? 112  GLU C C     1 
ATOM   4469  O  O     . GLU C 2  112  ? 46.358  -22.649 59.818  1.00 26.13  ? 112  GLU C O     1 
ATOM   4470  C  CB    . GLU C 2  112  ? 46.316  -25.282 61.085  1.00 20.65  ? 112  GLU C CB    1 
ATOM   4471  C  CG    . GLU C 2  112  ? 45.454  -24.672 62.183  1.00 21.73  ? 112  GLU C CG    1 
ATOM   4472  C  CD    . GLU C 2  112  ? 45.935  -25.012 63.584  1.00 25.54  ? 112  GLU C CD    1 
ATOM   4473  O  OE1   . GLU C 2  112  ? 46.964  -24.450 64.025  1.00 18.44  ? 112  GLU C OE1   1 
ATOM   4474  O  OE2   . GLU C 2  112  ? 45.274  -25.839 64.248  1.00 27.20  ? 112  GLU C OE2   1 
ATOM   4475  N  N     . VAL C 2  113  ? 44.277  -23.163 59.144  1.00 23.49  ? 113  VAL C N     1 
ATOM   4476  C  CA    . VAL C 2  113  ? 43.903  -21.770 58.898  1.00 26.40  ? 113  VAL C CA    1 
ATOM   4477  C  C     . VAL C 2  113  ? 43.106  -21.156 60.052  1.00 19.06  ? 113  VAL C C     1 
ATOM   4478  O  O     . VAL C 2  113  ? 42.331  -21.839 60.723  1.00 23.74  ? 113  VAL C O     1 
ATOM   4479  C  CB    . VAL C 2  113  ? 43.132  -21.609 57.565  1.00 25.47  ? 113  VAL C CB    1 
ATOM   4480  C  CG1   . VAL C 2  113  ? 43.867  -22.323 56.446  1.00 27.85  ? 113  VAL C CG1   1 
ATOM   4481  C  CG2   . VAL C 2  113  ? 41.727  -22.151 57.686  1.00 27.94  ? 113  VAL C CG2   1 
ATOM   4482  N  N     . PHE C 2  114  ? 43.318  -19.863 60.283  1.00 20.98  ? 114  PHE C N     1 
ATOM   4483  C  CA    . PHE C 2  114  ? 42.662  -19.143 61.373  1.00 20.31  ? 114  PHE C CA    1 
ATOM   4484  C  C     . PHE C 2  114  ? 41.324  -18.557 60.922  1.00 23.88  ? 114  PHE C C     1 
ATOM   4485  O  O     . PHE C 2  114  ? 41.275  -17.695 60.045  1.00 26.45  ? 114  PHE C O     1 
ATOM   4486  C  CB    . PHE C 2  114  ? 43.581  -18.035 61.888  1.00 20.11  ? 114  PHE C CB    1 
ATOM   4487  C  CG    . PHE C 2  114  ? 42.956  -17.156 62.932  1.00 24.92  ? 114  PHE C CG    1 
ATOM   4488  C  CD1   . PHE C 2  114  ? 42.720  -17.631 64.210  1.00 24.69  ? 114  PHE C CD1   1 
ATOM   4489  C  CD2   . PHE C 2  114  ? 42.624  -15.844 62.641  1.00 28.27  ? 114  PHE C CD2   1 
ATOM   4490  C  CE1   . PHE C 2  114  ? 42.152  -16.819 65.174  1.00 21.70  ? 114  PHE C CE1   1 
ATOM   4491  C  CE2   . PHE C 2  114  ? 42.056  -15.028 63.602  1.00 29.33  ? 114  PHE C CE2   1 
ATOM   4492  C  CZ    . PHE C 2  114  ? 41.822  -15.516 64.871  1.00 20.43  ? 114  PHE C CZ    1 
ATOM   4493  N  N     . LEU C 2  115  ? 40.243  -19.032 61.533  1.00 21.85  ? 115  LEU C N     1 
ATOM   4494  C  CA    . LEU C 2  115  ? 38.893  -18.656 61.126  1.00 20.55  ? 115  LEU C CA    1 
ATOM   4495  C  C     . LEU C 2  115  ? 38.316  -17.500 61.936  1.00 22.59  ? 115  LEU C C     1 
ATOM   4496  O  O     . LEU C 2  115  ? 37.154  -17.137 61.765  1.00 23.49  ? 115  LEU C O     1 
ATOM   4497  C  CB    . LEU C 2  115  ? 37.953  -19.861 61.200  1.00 17.09  ? 115  LEU C CB    1 
ATOM   4498  C  CG    . LEU C 2  115  ? 38.296  -21.026 60.275  1.00 14.18  ? 115  LEU C CG    1 
ATOM   4499  C  CD1   . LEU C 2  115  ? 37.197  -22.069 60.310  1.00 15.54  ? 115  LEU C CD1   1 
ATOM   4500  C  CD2   . LEU C 2  115  ? 38.524  -20.531 58.861  1.00 18.25  ? 115  LEU C CD2   1 
ATOM   4501  N  N     . GLY C 2  116  ? 39.126  -16.921 62.813  1.00 23.42  ? 116  GLY C N     1 
ATOM   4502  C  CA    . GLY C 2  116  ? 38.630  -15.900 63.716  1.00 25.28  ? 116  GLY C CA    1 
ATOM   4503  C  C     . GLY C 2  116  ? 38.249  -16.465 65.072  1.00 23.57  ? 116  GLY C C     1 
ATOM   4504  O  O     . GLY C 2  116  ? 38.776  -17.495 65.495  1.00 23.77  ? 116  GLY C O     1 
ATOM   4505  N  N     . HIS C 2  117  ? 37.337  -15.789 65.761  1.00 17.28  ? 117  HIS C N     1 
ATOM   4506  C  CA    . HIS C 2  117  ? 36.989  -16.170 67.123  1.00 16.87  ? 117  HIS C CA    1 
ATOM   4507  C  C     . HIS C 2  117  ? 35.536  -16.618 67.282  1.00 19.45  ? 117  HIS C C     1 
ATOM   4508  O  O     . HIS C 2  117  ? 34.671  -16.275 66.475  1.00 16.31  ? 117  HIS C O     1 
ATOM   4509  C  CB    . HIS C 2  117  ? 37.272  -15.010 68.076  1.00 18.03  ? 117  HIS C CB    1 
ATOM   4510  C  CG    . HIS C 2  117  ? 38.728  -14.717 68.258  1.00 18.51  ? 117  HIS C CG    1 
ATOM   4511  N  ND1   . HIS C 2  117  ? 39.395  -14.966 69.439  1.00 21.91  ? 117  HIS C ND1   1 
ATOM   4512  C  CD2   . HIS C 2  117  ? 39.645  -14.191 67.413  1.00 22.19  ? 117  HIS C CD2   1 
ATOM   4513  C  CE1   . HIS C 2  117  ? 40.660  -14.608 69.313  1.00 21.30  ? 117  HIS C CE1   1 
ATOM   4514  N  NE2   . HIS C 2  117  ? 40.838  -14.135 68.092  1.00 25.21  ? 117  HIS C NE2   1 
ATOM   4515  N  N     . ILE C 2  118  ? 35.282  -17.401 68.327  1.00 17.16  ? 118  ILE C N     1 
ATOM   4516  C  CA    . ILE C 2  118  ? 33.921  -17.753 68.705  1.00 14.32  ? 118  ILE C CA    1 
ATOM   4517  C  C     . ILE C 2  118  ? 33.704  -17.352 70.158  1.00 13.98  ? 118  ILE C C     1 
ATOM   4518  O  O     . ILE C 2  118  ? 34.566  -17.592 71.002  1.00 13.72  ? 118  ILE C O     1 
ATOM   4519  C  CB    . ILE C 2  118  ? 33.684  -19.272 68.556  1.00 14.63  ? 118  ILE C CB    1 
ATOM   4520  C  CG1   . ILE C 2  118  ? 33.411  -19.631 67.099  1.00 18.16  ? 118  ILE C CG1   1 
ATOM   4521  C  CG2   . ILE C 2  118  ? 32.519  -19.741 69.412  1.00 12.03  ? 118  ILE C CG2   1 
ATOM   4522  C  CD1   . ILE C 2  118  ? 32.954  -21.061 66.919  1.00 20.69  ? 118  ILE C CD1   1 
ATOM   4523  N  N     . PRO C 2  119  ? 32.538  -16.761 70.460  1.00 12.78  ? 119  PRO C N     1 
ATOM   4524  C  CA    . PRO C 2  119  ? 32.207  -16.357 71.831  1.00 13.81  ? 119  PRO C CA    1 
ATOM   4525  C  C     . PRO C 2  119  ? 32.147  -17.544 72.790  1.00 12.15  ? 119  PRO C C     1 
ATOM   4526  O  O     . PRO C 2  119  ? 31.503  -18.549 72.490  1.00 10.65  ? 119  PRO C O     1 
ATOM   4527  C  CB    . PRO C 2  119  ? 30.819  -15.733 71.678  1.00 11.87  ? 119  PRO C CB    1 
ATOM   4528  C  CG    . PRO C 2  119  ? 30.784  -15.248 70.275  1.00 11.39  ? 119  PRO C CG    1 
ATOM   4529  C  CD    . PRO C 2  119  ? 31.556  -16.258 69.486  1.00 11.03  ? 119  PRO C CD    1 
ATOM   4530  N  N     . LEU C 2  120  ? 32.816  -17.424 73.932  1.00 11.51  ? 120  LEU C N     1 
ATOM   4531  C  CA    . LEU C 2  120  ? 32.758  -18.456 74.959  1.00 12.57  ? 120  LEU C CA    1 
ATOM   4532  C  C     . LEU C 2  120  ? 31.666  -18.140 75.969  1.00 14.41  ? 120  LEU C C     1 
ATOM   4533  O  O     . LEU C 2  120  ? 31.486  -16.988 76.362  1.00 14.96  ? 120  LEU C O     1 
ATOM   4534  C  CB    . LEU C 2  120  ? 34.103  -18.596 75.675  1.00 12.65  ? 120  LEU C CB    1 
ATOM   4535  C  CG    . LEU C 2  120  ? 35.251  -19.214 74.877  1.00 11.38  ? 120  LEU C CG    1 
ATOM   4536  C  CD1   . LEU C 2  120  ? 36.430  -19.494 75.785  1.00 10.66  ? 120  LEU C CD1   1 
ATOM   4537  C  CD2   . LEU C 2  120  ? 34.803  -20.481 74.174  1.00 8.78   ? 120  LEU C CD2   1 
ATOM   4538  N  N     . MET C 2  121  ? 30.930  -19.166 76.380  1.00 14.93  ? 121  MET C N     1 
ATOM   4539  C  CA    . MET C 2  121  ? 29.918  -18.999 77.408  1.00 12.53  ? 121  MET C CA    1 
ATOM   4540  C  C     . MET C 2  121  ? 30.617  -18.978 78.756  1.00 11.70  ? 121  MET C C     1 
ATOM   4541  O  O     . MET C 2  121  ? 31.556  -19.736 78.978  1.00 11.50  ? 121  MET C O     1 
ATOM   4542  C  CB    . MET C 2  121  ? 28.894  -20.132 77.343  1.00 10.44  ? 121  MET C CB    1 
ATOM   4543  C  CG    . MET C 2  121  ? 27.877  -20.118 78.467  1.00 13.92  ? 121  MET C CG    1 
ATOM   4544  S  SD    . MET C 2  121  ? 26.620  -21.403 78.299  1.00 15.32  ? 121  MET C SD    1 
ATOM   4545  C  CE    . MET C 2  121  ? 25.589  -20.716 77.007  1.00 12.85  ? 121  MET C CE    1 
ATOM   4546  N  N     . THR C 2  122  ? 30.178  -18.096 79.647  1.00 15.51  ? 122  THR C N     1 
ATOM   4547  C  CA    . THR C 2  122  ? 30.777  -18.003 80.973  1.00 15.07  ? 122  THR C CA    1 
ATOM   4548  C  C     . THR C 2  122  ? 30.320  -19.160 81.852  1.00 16.73  ? 122  THR C C     1 
ATOM   4549  O  O     . THR C 2  122  ? 29.544  -20.013 81.421  1.00 19.05  ? 122  THR C O     1 
ATOM   4550  C  CB    . THR C 2  122  ? 30.442  -16.670 81.667  1.00 16.17  ? 122  THR C CB    1 
ATOM   4551  O  OG1   . THR C 2  122  ? 29.034  -16.595 81.924  1.00 14.81  ? 122  THR C OG1   1 
ATOM   4552  C  CG2   . THR C 2  122  ? 30.865  -15.497 80.798  1.00 15.92  ? 122  THR C CG2   1 
ATOM   4553  N  N     . GLU C 2  123  ? 30.806  -19.185 83.087  1.00 16.81  ? 123  GLU C N     1 
ATOM   4554  C  CA    . GLU C 2  123  ? 30.497  -20.273 84.002  1.00 25.03  ? 123  GLU C CA    1 
ATOM   4555  C  C     . GLU C 2  123  ? 29.011  -20.292 84.362  1.00 22.94  ? 123  GLU C C     1 
ATOM   4556  O  O     . GLU C 2  123  ? 28.437  -21.350 84.622  1.00 20.02  ? 123  GLU C O     1 
ATOM   4557  C  CB    . GLU C 2  123  ? 31.358  -20.161 85.262  1.00 25.94  ? 123  GLU C CB    1 
ATOM   4558  C  CG    . GLU C 2  123  ? 31.280  -21.361 86.189  1.00 36.90  ? 123  GLU C CG    1 
ATOM   4559  C  CD    . GLU C 2  123  ? 32.220  -21.239 87.377  1.00 62.61  ? 123  GLU C CD    1 
ATOM   4560  O  OE1   . GLU C 2  123  ? 32.220  -22.149 88.235  1.00 65.14  ? 123  GLU C OE1   1 
ATOM   4561  O  OE2   . GLU C 2  123  ? 32.961  -20.234 87.452  1.00 59.38  ? 123  GLU C OE2   1 
ATOM   4562  N  N     . ASP C 2  124  ? 28.388  -19.119 84.353  1.00 23.45  ? 124  ASP C N     1 
ATOM   4563  C  CA    . ASP C 2  124  ? 26.994  -18.994 84.763  1.00 21.85  ? 124  ASP C CA    1 
ATOM   4564  C  C     . ASP C 2  124  ? 26.018  -19.108 83.593  1.00 18.85  ? 124  ASP C C     1 
ATOM   4565  O  O     . ASP C 2  124  ? 24.811  -18.973 83.774  1.00 22.33  ? 124  ASP C O     1 
ATOM   4566  C  CB    . ASP C 2  124  ? 26.772  -17.680 85.512  1.00 17.40  ? 124  ASP C CB    1 
ATOM   4567  C  CG    . ASP C 2  124  ? 26.931  -16.469 84.619  1.00 24.69  ? 124  ASP C CG    1 
ATOM   4568  O  OD1   . ASP C 2  124  ? 28.081  -16.155 84.246  1.00 30.02  ? 124  ASP C OD1   1 
ATOM   4569  O  OD2   . ASP C 2  124  ? 25.907  -15.829 84.294  1.00 23.32  ? 124  ASP C OD2   1 
ATOM   4570  N  N     . GLY C 2  125  ? 26.538  -19.364 82.397  1.00 15.14  ? 125  GLY C N     1 
ATOM   4571  C  CA    . GLY C 2  125  ? 25.685  -19.549 81.236  1.00 17.47  ? 125  GLY C CA    1 
ATOM   4572  C  C     . GLY C 2  125  ? 25.296  -18.279 80.498  1.00 20.33  ? 125  GLY C C     1 
ATOM   4573  O  O     . GLY C 2  125  ? 24.214  -18.195 79.915  1.00 15.37  ? 125  GLY C O     1 
ATOM   4574  N  N     . SER C 2  126  ? 26.173  -17.282 80.528  1.00 19.78  ? 126  SER C N     1 
ATOM   4575  C  CA    . SER C 2  126  ? 25.944  -16.051 79.782  1.00 17.06  ? 126  SER C CA    1 
ATOM   4576  C  C     . SER C 2  126  ? 27.116  -15.768 78.852  1.00 15.24  ? 126  SER C C     1 
ATOM   4577  O  O     . SER C 2  126  ? 28.093  -16.513 78.833  1.00 17.93  ? 126  SER C O     1 
ATOM   4578  C  CB    . SER C 2  126  ? 25.718  -14.876 80.734  1.00 18.65  ? 126  SER C CB    1 
ATOM   4579  O  OG    . SER C 2  126  ? 26.752  -14.790 81.696  1.00 19.34  ? 126  SER C OG    1 
ATOM   4580  N  N     . PHE C 2  127  ? 27.017  -14.692 78.080  1.00 15.05  ? 127  PHE C N     1 
ATOM   4581  C  CA    . PHE C 2  127  ? 28.089  -14.323 77.163  1.00 17.60  ? 127  PHE C CA    1 
ATOM   4582  C  C     . PHE C 2  127  ? 28.570  -12.909 77.434  1.00 16.92  ? 127  PHE C C     1 
ATOM   4583  O  O     . PHE C 2  127  ? 27.856  -12.117 78.033  1.00 24.27  ? 127  PHE C O     1 
ATOM   4584  C  CB    . PHE C 2  127  ? 27.617  -14.433 75.717  1.00 12.03  ? 127  PHE C CB    1 
ATOM   4585  C  CG    . PHE C 2  127  ? 27.418  -15.842 75.253  1.00 15.14  ? 127  PHE C CG    1 
ATOM   4586  C  CD1   . PHE C 2  127  ? 26.232  -16.509 75.510  1.00 15.00  ? 127  PHE C CD1   1 
ATOM   4587  C  CD2   . PHE C 2  127  ? 28.416  -16.501 74.551  1.00 15.97  ? 127  PHE C CD2   1 
ATOM   4588  C  CE1   . PHE C 2  127  ? 26.044  -17.811 75.077  1.00 14.94  ? 127  PHE C CE1   1 
ATOM   4589  C  CE2   . PHE C 2  127  ? 28.235  -17.804 74.116  1.00 13.82  ? 127  PHE C CE2   1 
ATOM   4590  C  CZ    . PHE C 2  127  ? 27.046  -18.459 74.380  1.00 12.50  ? 127  PHE C CZ    1 
ATOM   4591  N  N     . ILE C 2  128  ? 29.791  -12.599 77.014  1.00 18.15  ? 128  ILE C N     1 
ATOM   4592  C  CA    . ILE C 2  128  ? 30.270  -11.223 77.045  1.00 18.82  ? 128  ILE C CA    1 
ATOM   4593  C  C     . ILE C 2  128  ? 30.519  -10.737 75.624  1.00 20.50  ? 128  ILE C C     1 
ATOM   4594  O  O     . ILE C 2  128  ? 31.477  -11.152 74.975  1.00 21.22  ? 128  ILE C O     1 
ATOM   4595  C  CB    . ILE C 2  128  ? 31.561  -11.090 77.865  1.00 14.32  ? 128  ILE C CB    1 
ATOM   4596  C  CG1   . ILE C 2  128  ? 31.346  -11.629 79.279  1.00 17.14  ? 128  ILE C CG1   1 
ATOM   4597  C  CG2   . ILE C 2  128  ? 32.013  -9.644  77.909  1.00 18.46  ? 128  ILE C CG2   1 
ATOM   4598  C  CD1   . ILE C 2  128  ? 32.572  -11.568 80.146  1.00 17.18  ? 128  ILE C CD1   1 
ATOM   4599  N  N     . ILE C 2  129  ? 29.656  -9.849  75.148  1.00 20.12  ? 129  ILE C N     1 
ATOM   4600  C  CA    . ILE C 2  129  ? 29.764  -9.336  73.790  1.00 19.48  ? 129  ILE C CA    1 
ATOM   4601  C  C     . ILE C 2  129  ? 30.008  -7.839  73.834  1.00 30.19  ? 129  ILE C C     1 
ATOM   4602  O  O     . ILE C 2  129  ? 29.142  -7.076  74.271  1.00 35.75  ? 129  ILE C O     1 
ATOM   4603  C  CB    . ILE C 2  129  ? 28.486  -9.606  72.982  1.00 22.29  ? 129  ILE C CB    1 
ATOM   4604  C  CG1   . ILE C 2  129  ? 28.123  -11.095 73.029  1.00 24.26  ? 129  ILE C CG1   1 
ATOM   4605  C  CG2   . ILE C 2  129  ? 28.651  -9.119  71.552  1.00 19.42  ? 129  ILE C CG2   1 
ATOM   4606  C  CD1   . ILE C 2  129  ? 29.224  -12.020 72.541  1.00 17.42  ? 129  ILE C CD1   1 
ATOM   4607  N  N     . ASN C 2  130  ? 31.191  -7.428  73.386  1.00 28.40  ? 130  ASN C N     1 
ATOM   4608  C  CA    . ASN C 2  130  ? 31.593  -6.026  73.415  1.00 26.92  ? 130  ASN C CA    1 
ATOM   4609  C  C     . ASN C 2  130  ? 31.512  -5.414  74.813  1.00 33.30  ? 130  ASN C C     1 
ATOM   4610  O  O     . ASN C 2  130  ? 31.190  -4.236  74.966  1.00 45.67  ? 130  ASN C O     1 
ATOM   4611  C  CB    . ASN C 2  130  ? 30.766  -5.207  72.422  1.00 26.60  ? 130  ASN C CB    1 
ATOM   4612  C  CG    . ASN C 2  130  ? 30.906  -5.707  70.999  1.00 33.30  ? 130  ASN C CG    1 
ATOM   4613  O  OD1   . ASN C 2  130  ? 32.014  -5.963  70.526  1.00 31.61  ? 130  ASN C OD1   1 
ATOM   4614  N  ND2   . ASN C 2  130  ? 29.778  -5.857  70.310  1.00 28.94  ? 130  ASN C ND2   1 
ATOM   4615  N  N     . GLY C 2  131  ? 31.799  -6.223  75.828  1.00 25.91  ? 131  GLY C N     1 
ATOM   4616  C  CA    . GLY C 2  131  ? 31.847  -5.740  77.197  1.00 34.53  ? 131  GLY C CA    1 
ATOM   4617  C  C     . GLY C 2  131  ? 30.545  -5.902  77.956  1.00 33.25  ? 131  GLY C C     1 
ATOM   4618  O  O     . GLY C 2  131  ? 30.527  -5.872  79.189  1.00 35.28  ? 131  GLY C O     1 
ATOM   4619  N  N     . ALA C 2  132  ? 29.452  -6.075  77.222  1.00 22.23  ? 132  ALA C N     1 
ATOM   4620  C  CA    . ALA C 2  132  ? 28.141  -6.228  77.839  1.00 21.68  ? 132  ALA C CA    1 
ATOM   4621  C  C     . ALA C 2  132  ? 27.728  -7.696  77.928  1.00 25.11  ? 132  ALA C C     1 
ATOM   4622  O  O     . ALA C 2  132  ? 27.902  -8.460  76.977  1.00 25.97  ? 132  ALA C O     1 
ATOM   4623  C  CB    . ALA C 2  132  ? 27.107  -5.433  77.068  1.00 28.01  ? 132  ALA C CB    1 
ATOM   4624  N  N     . ASP C 2  133  ? 27.178  -8.086  79.073  1.00 19.58  ? 133  ASP C N     1 
ATOM   4625  C  CA    . ASP C 2  133  ? 26.715  -9.456  79.257  1.00 18.97  ? 133  ASP C CA    1 
ATOM   4626  C  C     . ASP C 2  133  ? 25.396  -9.693  78.539  1.00 16.23  ? 133  ASP C C     1 
ATOM   4627  O  O     . ASP C 2  133  ? 24.450  -8.923  78.683  1.00 18.87  ? 133  ASP C O     1 
ATOM   4628  C  CB    . ASP C 2  133  ? 26.582  -9.801  80.744  1.00 23.36  ? 133  ASP C CB    1 
ATOM   4629  C  CG    . ASP C 2  133  ? 27.927  -9.948  81.431  1.00 24.60  ? 133  ASP C CG    1 
ATOM   4630  O  OD1   . ASP C 2  133  ? 28.841  -9.154  81.127  1.00 24.69  ? 133  ASP C OD1   1 
ATOM   4631  O  OD2   . ASP C 2  133  ? 28.073  -10.861 82.270  1.00 24.66  ? 133  ASP C OD2   1 
ATOM   4632  N  N     . ARG C 2  134  ? 25.343  -10.766 77.761  1.00 18.56  ? 134  ARG C N     1 
ATOM   4633  C  CA    . ARG C 2  134  ? 24.146  -11.115 77.013  1.00 17.08  ? 134  ARG C CA    1 
ATOM   4634  C  C     . ARG C 2  134  ? 23.687  -12.532 77.324  1.00 15.46  ? 134  ARG C C     1 
ATOM   4635  O  O     . ARG C 2  134  ? 24.451  -13.354 77.835  1.00 15.81  ? 134  ARG C O     1 
ATOM   4636  C  CB    . ARG C 2  134  ? 24.391  -10.967 75.511  1.00 17.85  ? 134  ARG C CB    1 
ATOM   4637  C  CG    . ARG C 2  134  ? 24.798  -9.566  75.096  1.00 22.84  ? 134  ARG C CG    1 
ATOM   4638  C  CD    . ARG C 2  134  ? 24.718  -9.385  73.590  1.00 23.63  ? 134  ARG C CD    1 
ATOM   4639  N  NE    . ARG C 2  134  ? 24.106  -8.105  73.248  1.00 25.23  ? 134  ARG C NE    1 
ATOM   4640  C  CZ    . ARG C 2  134  ? 22.823  -7.953  72.945  1.00 23.73  ? 134  ARG C CZ    1 
ATOM   4641  N  NH1   . ARG C 2  134  ? 22.018  -9.005  72.927  1.00 22.56  ? 134  ARG C NH1   1 
ATOM   4642  N  NH2   . ARG C 2  134  ? 22.344  -6.752  72.650  1.00 30.99  ? 134  ARG C NH2   1 
ATOM   4643  N  N     . VAL C 2  135  ? 22.426  -12.804 77.015  1.00 11.49  ? 135  VAL C N     1 
ATOM   4644  C  CA    . VAL C 2  135  ? 21.851  -14.123 77.192  1.00 9.92   ? 135  VAL C CA    1 
ATOM   4645  C  C     . VAL C 2  135  ? 21.169  -14.546 75.899  1.00 10.71  ? 135  VAL C C     1 
ATOM   4646  O  O     . VAL C 2  135  ? 20.379  -13.791 75.328  1.00 12.05  ? 135  VAL C O     1 
ATOM   4647  C  CB    . VAL C 2  135  ? 20.821  -14.141 78.341  1.00 11.17  ? 135  VAL C CB    1 
ATOM   4648  C  CG1   . VAL C 2  135  ? 19.991  -15.415 78.297  1.00 10.79  ? 135  VAL C CG1   1 
ATOM   4649  C  CG2   . VAL C 2  135  ? 21.518  -13.992 79.692  1.00 10.50  ? 135  VAL C CG2   1 
ATOM   4650  N  N     . ILE C 2  136  ? 21.494  -15.742 75.424  1.00 10.73  ? 136  ILE C N     1 
ATOM   4651  C  CA    . ILE C 2  136  ? 20.784  -16.307 74.289  1.00 12.22  ? 136  ILE C CA    1 
ATOM   4652  C  C     . ILE C 2  136  ? 19.592  -17.086 74.818  1.00 11.15  ? 136  ILE C C     1 
ATOM   4653  O  O     . ILE C 2  136  ? 19.749  -18.063 75.551  1.00 11.42  ? 136  ILE C O     1 
ATOM   4654  C  CB    . ILE C 2  136  ? 21.671  -17.242 73.462  1.00 12.02  ? 136  ILE C CB    1 
ATOM   4655  C  CG1   . ILE C 2  136  ? 22.940  -16.517 73.016  1.00 11.23  ? 136  ILE C CG1   1 
ATOM   4656  C  CG2   . ILE C 2  136  ? 20.900  -17.771 72.260  1.00 12.30  ? 136  ILE C CG2   1 
ATOM   4657  C  CD1   . ILE C 2  136  ? 22.690  -15.415 72.021  1.00 10.41  ? 136  ILE C CD1   1 
ATOM   4658  N  N     . VAL C 2  137  ? 18.399  -16.638 74.454  1.00 10.00  ? 137  VAL C N     1 
ATOM   4659  C  CA    . VAL C 2  137  ? 17.177  -17.228 74.972  1.00 8.52   ? 137  VAL C CA    1 
ATOM   4660  C  C     . VAL C 2  137  ? 16.746  -18.399 74.107  1.00 9.75   ? 137  VAL C C     1 
ATOM   4661  O  O     . VAL C 2  137  ? 16.738  -18.300 72.882  1.00 13.40  ? 137  VAL C O     1 
ATOM   4662  C  CB    . VAL C 2  137  ? 16.054  -16.181 75.048  1.00 8.03   ? 137  VAL C CB    1 
ATOM   4663  C  CG1   . VAL C 2  137  ? 14.739  -16.831 75.419  1.00 10.60  ? 137  VAL C CG1   1 
ATOM   4664  C  CG2   . VAL C 2  137  ? 16.419  -15.098 76.050  1.00 8.26   ? 137  VAL C CG2   1 
ATOM   4665  N  N     . SER C 2  138  ? 16.406  -19.511 74.750  1.00 9.52   ? 138  SER C N     1 
ATOM   4666  C  CA    . SER C 2  138  ? 15.933  -20.695 74.045  1.00 8.56   ? 138  SER C CA    1 
ATOM   4667  C  C     . SER C 2  138  ? 14.682  -20.375 73.243  1.00 8.16   ? 138  SER C C     1 
ATOM   4668  O  O     . SER C 2  138  ? 13.841  -19.592 73.676  1.00 10.39  ? 138  SER C O     1 
ATOM   4669  C  CB    . SER C 2  138  ? 15.626  -21.814 75.037  1.00 8.98   ? 138  SER C CB    1 
ATOM   4670  O  OG    . SER C 2  138  ? 16.718  -22.036 75.910  1.00 10.31  ? 138  SER C OG    1 
ATOM   4671  N  N     . GLN C 2  139  ? 14.558  -20.986 72.073  1.00 8.55   ? 139  GLN C N     1 
ATOM   4672  C  CA    . GLN C 2  139  ? 13.384  -20.774 71.242  1.00 11.65  ? 139  GLN C CA    1 
ATOM   4673  C  C     . GLN C 2  139  ? 12.483  -21.995 71.309  1.00 11.11  ? 139  GLN C C     1 
ATOM   4674  O  O     . GLN C 2  139  ? 12.962  -23.106 71.457  1.00 14.28  ? 139  GLN C O     1 
ATOM   4675  C  CB    . GLN C 2  139  ? 13.798  -20.511 69.794  1.00 14.73  ? 139  GLN C CB    1 
ATOM   4676  C  CG    . GLN C 2  139  ? 12.660  -20.046 68.901  1.00 16.83  ? 139  GLN C CG    1 
ATOM   4677  C  CD    . GLN C 2  139  ? 13.097  -19.821 67.469  1.00 21.75  ? 139  GLN C CD    1 
ATOM   4678  O  OE1   . GLN C 2  139  ? 13.908  -20.574 66.928  1.00 22.12  ? 139  GLN C OE1   1 
ATOM   4679  N  NE2   . GLN C 2  139  ? 12.563  -18.777 66.845  1.00 26.18  ? 139  GLN C NE2   1 
ATOM   4680  N  N     . ILE C 2  140  ? 11.175  -21.795 71.224  1.00 12.25  ? 140  ILE C N     1 
ATOM   4681  C  CA    . ILE C 2  140  ? 10.263  -22.926 71.101  1.00 12.26  ? 140  ILE C CA    1 
ATOM   4682  C  C     . ILE C 2  140  ? 9.639   -22.911 69.711  1.00 13.25  ? 140  ILE C C     1 
ATOM   4683  O  O     . ILE C 2  140  ? 9.293   -21.850 69.190  1.00 16.89  ? 140  ILE C O     1 
ATOM   4684  C  CB    . ILE C 2  140  ? 9.170   -22.925 72.204  1.00 14.81  ? 140  ILE C CB    1 
ATOM   4685  C  CG1   . ILE C 2  140  ? 8.367   -24.230 72.175  1.00 13.42  ? 140  ILE C CG1   1 
ATOM   4686  C  CG2   . ILE C 2  140  ? 8.256   -21.713 72.083  1.00 5.76   ? 140  ILE C CG2   1 
ATOM   4687  C  CD1   . ILE C 2  140  ? 7.424   -24.391 73.351  1.00 9.41   ? 140  ILE C CD1   1 
ATOM   4688  N  N     . HIS C 2  141  ? 9.526   -24.079 69.090  1.00 12.39  ? 141  HIS C N     1 
ATOM   4689  C  CA    . HIS C 2  141  ? 8.895   -24.141 67.776  1.00 13.30  ? 141  HIS C CA    1 
ATOM   4690  C  C     . HIS C 2  141  ? 8.267   -25.495 67.503  1.00 14.40  ? 141  HIS C C     1 
ATOM   4691  O  O     . HIS C 2  141  ? 8.367   -26.413 68.318  1.00 13.42  ? 141  HIS C O     1 
ATOM   4692  C  CB    . HIS C 2  141  ? 9.897   -23.798 66.670  1.00 11.58  ? 141  HIS C CB    1 
ATOM   4693  C  CG    . HIS C 2  141  ? 10.965  -24.827 66.477  1.00 14.69  ? 141  HIS C CG    1 
ATOM   4694  N  ND1   . HIS C 2  141  ? 11.384  -25.238 65.230  1.00 16.54  ? 141  HIS C ND1   1 
ATOM   4695  C  CD2   . HIS C 2  141  ? 11.709  -25.522 67.370  1.00 16.98  ? 141  HIS C CD2   1 
ATOM   4696  C  CE1   . HIS C 2  141  ? 12.334  -26.146 65.363  1.00 19.15  ? 141  HIS C CE1   1 
ATOM   4697  N  NE2   . HIS C 2  141  ? 12.551  -26.336 66.652  1.00 16.43  ? 141  HIS C NE2   1 
ATOM   4698  N  N     . ARG C 2  142  ? 7.621   -25.611 66.348  1.00 15.14  ? 142  ARG C N     1 
ATOM   4699  C  CA    . ARG C 2  142  ? 7.035   -26.875 65.941  1.00 20.99  ? 142  ARG C CA    1 
ATOM   4700  C  C     . ARG C 2  142  ? 8.144   -27.852 65.589  1.00 23.65  ? 142  ARG C C     1 
ATOM   4701  O  O     . ARG C 2  142  ? 8.982   -27.572 64.730  1.00 22.71  ? 142  ARG C O     1 
ATOM   4702  C  CB    . ARG C 2  142  ? 6.104   -26.684 64.743  1.00 19.65  ? 142  ARG C CB    1 
ATOM   4703  C  CG    . ARG C 2  142  ? 4.796   -25.993 65.078  1.00 32.11  ? 142  ARG C CG    1 
ATOM   4704  C  CD    . ARG C 2  142  ? 3.851   -25.994 63.886  1.00 35.34  ? 142  ARG C CD    1 
ATOM   4705  N  NE    . ARG C 2  142  ? 3.465   -27.345 63.492  1.00 32.43  ? 142  ARG C NE    1 
ATOM   4706  C  CZ    . ARG C 2  142  ? 2.697   -27.625 62.444  1.00 36.33  ? 142  ARG C CZ    1 
ATOM   4707  N  NH1   . ARG C 2  142  ? 2.233   -26.644 61.680  1.00 41.14  ? 142  ARG C NH1   1 
ATOM   4708  N  NH2   . ARG C 2  142  ? 2.393   -28.883 62.157  1.00 38.63  ? 142  ARG C NH2   1 
ATOM   4709  N  N     . SER C 2  143  ? 8.145   -28.999 66.258  1.00 23.99  ? 143  SER C N     1 
ATOM   4710  C  CA    . SER C 2  143  ? 9.135   -30.028 65.992  1.00 22.77  ? 143  SER C CA    1 
ATOM   4711  C  C     . SER C 2  143  ? 8.954   -30.540 64.579  1.00 28.66  ? 143  SER C C     1 
ATOM   4712  O  O     . SER C 2  143  ? 7.828   -30.766 64.139  1.00 26.60  ? 143  SER C O     1 
ATOM   4713  C  CB    . SER C 2  143  ? 8.989   -31.183 66.980  1.00 27.40  ? 143  SER C CB    1 
ATOM   4714  O  OG    . SER C 2  143  ? 9.730   -32.312 66.549  1.00 33.67  ? 143  SER C OG    1 
ATOM   4715  N  N     . PRO C 2  144  ? 10.066  -30.699 63.851  1.00 30.81  ? 144  PRO C N     1 
ATOM   4716  C  CA    . PRO C 2  144  ? 10.032  -31.302 62.518  1.00 30.80  ? 144  PRO C CA    1 
ATOM   4717  C  C     . PRO C 2  144  ? 9.457   -32.716 62.560  1.00 28.98  ? 144  PRO C C     1 
ATOM   4718  O  O     . PRO C 2  144  ? 9.546   -33.388 63.589  1.00 30.80  ? 144  PRO C O     1 
ATOM   4719  C  CB    . PRO C 2  144  ? 11.508  -31.336 62.122  1.00 32.63  ? 144  PRO C CB    1 
ATOM   4720  C  CG    . PRO C 2  144  ? 12.102  -30.186 62.854  1.00 29.36  ? 144  PRO C CG    1 
ATOM   4721  C  CD    . PRO C 2  144  ? 11.398  -30.165 64.180  1.00 24.06  ? 144  PRO C CD    1 
ATOM   4722  N  N     . GLY C 2  145  ? 8.862   -33.150 61.455  1.00 22.83  ? 145  GLY C N     1 
ATOM   4723  C  CA    . GLY C 2  145  ? 8.267   -34.469 61.371  1.00 28.74  ? 145  GLY C CA    1 
ATOM   4724  C  C     . GLY C 2  145  ? 7.099   -34.500 60.407  1.00 29.31  ? 145  GLY C C     1 
ATOM   4725  O  O     . GLY C 2  145  ? 6.928   -33.593 59.589  1.00 29.03  ? 145  GLY C O     1 
ATOM   4726  N  N     . VAL C 2  146  ? 6.292   -35.550 60.501  1.00 27.71  ? 146  VAL C N     1 
ATOM   4727  C  CA    . VAL C 2  146  ? 5.126   -35.691 59.641  1.00 33.61  ? 146  VAL C CA    1 
ATOM   4728  C  C     . VAL C 2  146  ? 3.846   -35.535 60.457  1.00 33.07  ? 146  VAL C C     1 
ATOM   4729  O  O     . VAL C 2  146  ? 3.584   -36.309 61.377  1.00 38.27  ? 146  VAL C O     1 
ATOM   4730  C  CB    . VAL C 2  146  ? 5.124   -37.045 58.905  1.00 26.69  ? 146  VAL C CB    1 
ATOM   4731  C  CG1   . VAL C 2  146  ? 3.955   -37.121 57.939  1.00 26.17  ? 146  VAL C CG1   1 
ATOM   4732  C  CG2   . VAL C 2  146  ? 6.435   -37.241 58.165  1.00 28.37  ? 146  VAL C CG2   1 
ATOM   4733  N  N     . TYR C 2  147  ? 3.056   -34.525 60.114  1.00 22.54  ? 147  TYR C N     1 
ATOM   4734  C  CA    . TYR C 2  147  ? 1.849   -34.207 60.862  1.00 33.89  ? 147  TYR C CA    1 
ATOM   4735  C  C     . TYR C 2  147  ? 0.598   -34.415 60.024  1.00 31.86  ? 147  TYR C C     1 
ATOM   4736  O  O     . TYR C 2  147  ? 0.636   -34.342 58.797  1.00 28.83  ? 147  TYR C O     1 
ATOM   4737  C  CB    . TYR C 2  147  ? 1.898   -32.762 61.369  1.00 35.27  ? 147  TYR C CB    1 
ATOM   4738  C  CG    . TYR C 2  147  ? 2.969   -32.515 62.403  1.00 32.85  ? 147  TYR C CG    1 
ATOM   4739  C  CD1   . TYR C 2  147  ? 4.248   -32.133 62.028  1.00 33.10  ? 147  TYR C CD1   1 
ATOM   4740  C  CD2   . TYR C 2  147  ? 2.701   -32.666 63.756  1.00 32.50  ? 147  TYR C CD2   1 
ATOM   4741  C  CE1   . TYR C 2  147  ? 5.231   -31.908 62.970  1.00 31.05  ? 147  TYR C CE1   1 
ATOM   4742  C  CE2   . TYR C 2  147  ? 3.677   -32.443 64.707  1.00 33.74  ? 147  TYR C CE2   1 
ATOM   4743  C  CZ    . TYR C 2  147  ? 4.941   -32.065 64.309  1.00 33.23  ? 147  TYR C CZ    1 
ATOM   4744  O  OH    . TYR C 2  147  ? 5.917   -31.841 65.253  1.00 36.61  ? 147  TYR C OH    1 
ATOM   4745  N  N     . PHE C 2  148  ? -0.513  -34.680 60.700  1.00 28.82  ? 148  PHE C N     1 
ATOM   4746  C  CA    . PHE C 2  148  ? -1.792  -34.837 60.031  1.00 33.08  ? 148  PHE C CA    1 
ATOM   4747  C  C     . PHE C 2  148  ? -2.829  -33.982 60.741  1.00 36.30  ? 148  PHE C C     1 
ATOM   4748  O  O     . PHE C 2  148  ? -3.137  -34.197 61.913  1.00 29.83  ? 148  PHE C O     1 
ATOM   4749  C  CB    . PHE C 2  148  ? -2.203  -36.309 59.999  1.00 28.98  ? 148  PHE C CB    1 
ATOM   4750  C  CG    . PHE C 2  148  ? -1.226  -37.185 59.271  1.00 29.42  ? 148  PHE C CG    1 
ATOM   4751  C  CD1   . PHE C 2  148  ? -0.134  -37.726 59.932  1.00 31.38  ? 148  PHE C CD1   1 
ATOM   4752  C  CD2   . PHE C 2  148  ? -1.386  -37.452 57.921  1.00 32.12  ? 148  PHE C CD2   1 
ATOM   4753  C  CE1   . PHE C 2  148  ? 0.775   -38.524 59.263  1.00 29.40  ? 148  PHE C CE1   1 
ATOM   4754  C  CE2   . PHE C 2  148  ? -0.482  -38.252 57.247  1.00 33.60  ? 148  PHE C CE2   1 
ATOM   4755  C  CZ    . PHE C 2  148  ? 0.600   -38.787 57.918  1.00 31.65  ? 148  PHE C CZ    1 
ATOM   4756  N  N     . THR C 2  149  ? -3.354  -32.998 60.023  1.00 39.53  ? 149  THR C N     1 
ATOM   4757  C  CA    . THR C 2  149  ? -4.233  -32.013 60.632  1.00 41.75  ? 149  THR C CA    1 
ATOM   4758  C  C     . THR C 2  149  ? -5.566  -31.951 59.894  1.00 49.89  ? 149  THR C C     1 
ATOM   4759  O  O     . THR C 2  149  ? -5.617  -32.141 58.681  1.00 51.28  ? 149  THR C O     1 
ATOM   4760  C  CB    . THR C 2  149  ? -3.561  -30.617 60.666  1.00 36.38  ? 149  THR C CB    1 
ATOM   4761  O  OG1   . THR C 2  149  ? -4.386  -29.697 61.389  1.00 57.75  ? 149  THR C OG1   1 
ATOM   4762  C  CG2   . THR C 2  149  ? -3.327  -30.088 59.258  1.00 36.03  ? 149  THR C CG2   1 
ATOM   4763  N  N     . PRO C 2  150  ? -6.659  -31.711 60.630  1.00 47.74  ? 150  PRO C N     1 
ATOM   4764  C  CA    . PRO C 2  150  ? -7.975  -31.589 59.993  1.00 52.33  ? 150  PRO C CA    1 
ATOM   4765  C  C     . PRO C 2  150  ? -8.037  -30.419 59.011  1.00 54.97  ? 150  PRO C C     1 
ATOM   4766  O  O     . PRO C 2  150  ? -7.599  -29.316 59.342  1.00 55.48  ? 150  PRO C O     1 
ATOM   4767  C  CB    . PRO C 2  150  ? -8.910  -31.326 61.176  1.00 51.14  ? 150  PRO C CB    1 
ATOM   4768  C  CG    . PRO C 2  150  ? -8.207  -31.916 62.351  1.00 54.14  ? 150  PRO C CG    1 
ATOM   4769  C  CD    . PRO C 2  150  ? -6.749  -31.688 62.100  1.00 43.88  ? 150  PRO C CD    1 
ATOM   4770  N  N     . ASP C 2  151  ? -8.564  -30.666 57.815  1.00 58.14  ? 151  ASP C N     1 
ATOM   4771  C  CA    . ASP C 2  151  ? -8.804  -29.599 56.850  1.00 60.35  ? 151  ASP C CA    1 
ATOM   4772  C  C     . ASP C 2  151  ? -9.971  -28.755 57.360  1.00 64.46  ? 151  ASP C C     1 
ATOM   4773  O  O     . ASP C 2  151  ? -11.083 -29.261 57.525  1.00 62.79  ? 151  ASP C O     1 
ATOM   4774  C  CB    . ASP C 2  151  ? -9.114  -30.184 55.467  1.00 58.37  ? 151  ASP C CB    1 
ATOM   4775  C  CG    . ASP C 2  151  ? -9.012  -29.152 54.348  1.00 63.85  ? 151  ASP C CG    1 
ATOM   4776  O  OD1   . ASP C 2  151  ? -9.451  -28.000 54.542  1.00 69.11  ? 151  ASP C OD1   1 
ATOM   4777  O  OD2   . ASP C 2  151  ? -8.493  -29.499 53.264  1.00 57.71  ? 151  ASP C OD2   1 
ATOM   4778  N  N     . PRO C 2  152  ? -9.715  -27.463 57.622  1.00 61.30  ? 152  PRO C N     1 
ATOM   4779  C  CA    . PRO C 2  152  ? -10.700 -26.547 58.213  1.00 64.09  ? 152  PRO C CA    1 
ATOM   4780  C  C     . PRO C 2  152  ? -11.931 -26.329 57.333  1.00 65.03  ? 152  PRO C C     1 
ATOM   4781  O  O     . PRO C 2  152  ? -13.028 -26.120 57.851  1.00 59.65  ? 152  PRO C O     1 
ATOM   4782  C  CB    . PRO C 2  152  ? -9.914  -25.238 58.361  1.00 64.51  ? 152  PRO C CB    1 
ATOM   4783  C  CG    . PRO C 2  152  ? -8.802  -25.344 57.368  1.00 58.41  ? 152  PRO C CG    1 
ATOM   4784  C  CD    . PRO C 2  152  ? -8.433  -26.791 57.347  1.00 54.55  ? 152  PRO C CD    1 
ATOM   4785  N  N     . ALA C 2  153  ? -11.746 -26.378 56.018  1.00 64.64  ? 153  ALA C N     1 
ATOM   4786  C  CA    . ALA C 2  153  ? -12.845 -26.167 55.083  1.00 68.40  ? 153  ALA C CA    1 
ATOM   4787  C  C     . ALA C 2  153  ? -13.715 -27.414 54.949  1.00 72.70  ? 153  ALA C C     1 
ATOM   4788  O  O     . ALA C 2  153  ? -14.892 -27.403 55.308  1.00 74.18  ? 153  ALA C O     1 
ATOM   4789  C  CB    . ALA C 2  153  ? -12.308 -25.743 53.723  1.00 70.74  ? 153  ALA C CB    1 
ATOM   4790  N  N     . ARG C 2  154  ? -13.122 -28.484 54.428  1.00 72.24  ? 154  ARG C N     1 
ATOM   4791  C  CA    . ARG C 2  154  ? -13.842 -29.725 54.155  1.00 69.40  ? 154  ARG C CA    1 
ATOM   4792  C  C     . ARG C 2  154  ? -13.612 -30.792 55.230  1.00 66.17  ? 154  ARG C C     1 
ATOM   4793  O  O     . ARG C 2  154  ? -12.517 -31.343 55.340  1.00 65.87  ? 154  ARG C O     1 
ATOM   4794  C  CB    . ARG C 2  154  ? -13.440 -30.259 52.775  1.00 68.54  ? 154  ARG C CB    1 
ATOM   4795  C  CG    . ARG C 2  154  ? -11.949 -30.128 52.480  1.00 73.00  ? 154  ARG C CG    1 
ATOM   4796  C  CD    . ARG C 2  154  ? -11.658 -30.002 50.989  1.00 68.08  ? 154  ARG C CD    1 
ATOM   4797  N  NE    . ARG C 2  154  ? -11.729 -31.283 50.292  1.00 70.03  ? 154  ARG C NE    1 
ATOM   4798  C  CZ    . ARG C 2  154  ? -12.797 -31.717 49.630  1.00 81.48  ? 154  ARG C CZ    1 
ATOM   4799  N  NH1   . ARG C 2  154  ? -13.894 -30.973 49.572  1.00 79.18  ? 154  ARG C NH1   1 
ATOM   4800  N  NH2   . ARG C 2  154  ? -12.768 -32.896 49.023  1.00 82.45  ? 154  ARG C NH2   1 
ATOM   4801  N  N     . PRO C 2  155  ? -14.649 -31.079 56.034  1.00 57.56  ? 155  PRO C N     1 
ATOM   4802  C  CA    . PRO C 2  155  ? -14.583 -32.145 57.039  1.00 56.08  ? 155  PRO C CA    1 
ATOM   4803  C  C     . PRO C 2  155  ? -14.528 -33.516 56.377  1.00 57.39  ? 155  PRO C C     1 
ATOM   4804  O  O     . PRO C 2  155  ? -15.153 -33.717 55.337  1.00 61.19  ? 155  PRO C O     1 
ATOM   4805  C  CB    . PRO C 2  155  ? -15.901 -31.989 57.805  1.00 56.14  ? 155  PRO C CB    1 
ATOM   4806  C  CG    . PRO C 2  155  ? -16.348 -30.592 57.529  1.00 62.69  ? 155  PRO C CG    1 
ATOM   4807  C  CD    . PRO C 2  155  ? -15.905 -30.319 56.128  1.00 64.86  ? 155  PRO C CD    1 
ATOM   4808  N  N     . GLY C 2  156  ? -13.791 -34.445 56.977  1.00 56.04  ? 156  GLY C N     1 
ATOM   4809  C  CA    . GLY C 2  156  ? -13.611 -35.764 56.401  1.00 49.62  ? 156  GLY C CA    1 
ATOM   4810  C  C     . GLY C 2  156  ? -12.315 -35.852 55.617  1.00 63.85  ? 156  GLY C C     1 
ATOM   4811  O  O     . GLY C 2  156  ? -11.819 -36.944 55.334  1.00 68.72  ? 156  GLY C O     1 
ATOM   4812  N  N     . ARG C 2  157  ? -11.766 -34.692 55.267  1.00 56.70  ? 157  ARG C N     1 
ATOM   4813  C  CA    . ARG C 2  157  ? -10.498 -34.621 54.549  1.00 54.38  ? 157  ARG C CA    1 
ATOM   4814  C  C     . ARG C 2  157  ? -9.409  -34.069 55.463  1.00 55.36  ? 157  ARG C C     1 
ATOM   4815  O  O     . ARG C 2  157  ? -9.685  -33.276 56.364  1.00 53.32  ? 157  ARG C O     1 
ATOM   4816  C  CB    . ARG C 2  157  ? -10.632 -33.757 53.292  1.00 58.35  ? 157  ARG C CB    1 
ATOM   4817  C  CG    . ARG C 2  157  ? -11.748 -34.195 52.357  1.00 65.82  ? 157  ARG C CG    1 
ATOM   4818  C  CD    . ARG C 2  157  ? -11.605 -35.660 51.974  1.00 71.81  ? 157  ARG C CD    1 
ATOM   4819  N  NE    . ARG C 2  157  ? -12.760 -36.147 51.224  1.00 80.61  ? 157  ARG C NE    1 
ATOM   4820  C  CZ    . ARG C 2  157  ? -12.830 -36.182 49.896  1.00 100.91 ? 157  ARG C CZ    1 
ATOM   4821  N  NH1   . ARG C 2  157  ? -11.807 -35.760 49.163  1.00 89.14  ? 157  ARG C NH1   1 
ATOM   4822  N  NH2   . ARG C 2  157  ? -13.922 -36.643 49.300  1.00 102.32 ? 157  ARG C NH2   1 
ATOM   4823  N  N     . TYR C 2  158  ? -8.172  -34.498 55.235  1.00 56.07  ? 158  TYR C N     1 
ATOM   4824  C  CA    . TYR C 2  158  ? -7.062  -34.111 56.099  1.00 50.07  ? 158  TYR C CA    1 
ATOM   4825  C  C     . TYR C 2  158  ? -5.845  -33.630 55.309  1.00 50.40  ? 158  TYR C C     1 
ATOM   4826  O  O     . TYR C 2  158  ? -5.716  -33.898 54.113  1.00 52.73  ? 158  TYR C O     1 
ATOM   4827  C  CB    . TYR C 2  158  ? -6.667  -35.278 57.011  1.00 51.26  ? 158  TYR C CB    1 
ATOM   4828  C  CG    . TYR C 2  158  ? -7.792  -35.795 57.885  1.00 55.65  ? 158  TYR C CG    1 
ATOM   4829  C  CD1   . TYR C 2  158  ? -8.019  -35.261 59.147  1.00 51.31  ? 158  TYR C CD1   1 
ATOM   4830  C  CD2   . TYR C 2  158  ? -8.624  -36.819 57.448  1.00 50.78  ? 158  TYR C CD2   1 
ATOM   4831  C  CE1   . TYR C 2  158  ? -9.044  -35.731 59.947  1.00 47.74  ? 158  TYR C CE1   1 
ATOM   4832  C  CE2   . TYR C 2  158  ? -9.651  -37.294 58.241  1.00 45.76  ? 158  TYR C CE2   1 
ATOM   4833  C  CZ    . TYR C 2  158  ? -9.856  -36.746 59.489  1.00 48.29  ? 158  TYR C CZ    1 
ATOM   4834  O  OH    . TYR C 2  158  ? -10.878 -37.215 60.284  1.00 48.36  ? 158  TYR C OH    1 
ATOM   4835  N  N     . ILE C 2  159  ? -4.957  -32.916 55.993  1.00 45.63  ? 159  ILE C N     1 
ATOM   4836  C  CA    . ILE C 2  159  ? -3.717  -32.431 55.403  1.00 46.82  ? 159  ILE C CA    1 
ATOM   4837  C  C     . ILE C 2  159  ? -2.526  -33.147 56.026  1.00 41.40  ? 159  ILE C C     1 
ATOM   4838  O  O     . ILE C 2  159  ? -2.415  -33.234 57.253  1.00 46.92  ? 159  ILE C O     1 
ATOM   4839  C  CB    . ILE C 2  159  ? -3.535  -30.916 55.630  1.00 45.34  ? 159  ILE C CB    1 
ATOM   4840  C  CG1   . ILE C 2  159  ? -4.762  -30.142 55.145  1.00 43.84  ? 159  ILE C CG1   1 
ATOM   4841  C  CG2   . ILE C 2  159  ? -2.273  -30.421 54.935  1.00 42.98  ? 159  ILE C CG2   1 
ATOM   4842  C  CD1   . ILE C 2  159  ? -4.912  -30.121 53.646  1.00 46.51  ? 159  ILE C CD1   1 
ATOM   4843  N  N     . ALA C 2  160  ? -1.638  -33.660 55.180  1.00 34.05  ? 160  ALA C N     1 
ATOM   4844  C  CA    . ALA C 2  160  ? -0.406  -34.273 55.655  1.00 36.30  ? 160  ALA C CA    1 
ATOM   4845  C  C     . ALA C 2  160  ? 0.768   -33.336 55.403  1.00 37.76  ? 160  ALA C C     1 
ATOM   4846  O  O     . ALA C 2  160  ? 1.177   -33.133 54.264  1.00 36.71  ? 160  ALA C O     1 
ATOM   4847  C  CB    . ALA C 2  160  ? -0.177  -35.605 54.966  1.00 38.09  ? 160  ALA C CB    1 
ATOM   4848  N  N     . SER C 2  161  ? 1.318   -32.772 56.471  1.00 37.15  ? 161  SER C N     1 
ATOM   4849  C  CA    . SER C 2  161  ? 2.407   -31.816 56.337  1.00 28.11  ? 161  SER C CA    1 
ATOM   4850  C  C     . SER C 2  161  ? 3.738   -32.431 56.738  1.00 26.32  ? 161  SER C C     1 
ATOM   4851  O  O     . SER C 2  161  ? 3.866   -33.016 57.807  1.00 26.40  ? 161  SER C O     1 
ATOM   4852  C  CB    . SER C 2  161  ? 2.128   -30.572 57.175  1.00 26.04  ? 161  SER C CB    1 
ATOM   4853  O  OG    . SER C 2  161  ? 0.822   -30.086 56.924  1.00 40.27  ? 161  SER C OG    1 
ATOM   4854  N  N     . ILE C 2  162  ? 4.727   -32.299 55.864  1.00 29.52  ? 162  ILE C N     1 
ATOM   4855  C  CA    . ILE C 2  162  ? 6.066   -32.784 56.148  1.00 26.11  ? 162  ILE C CA    1 
ATOM   4856  C  C     . ILE C 2  162  ? 6.954   -31.584 56.430  1.00 32.05  ? 162  ILE C C     1 
ATOM   4857  O  O     . ILE C 2  162  ? 7.257   -30.800 55.531  1.00 32.88  ? 162  ILE C O     1 
ATOM   4858  C  CB    . ILE C 2  162  ? 6.625   -33.568 54.957  1.00 31.28  ? 162  ILE C CB    1 
ATOM   4859  C  CG1   . ILE C 2  162  ? 5.612   -34.623 54.502  1.00 25.52  ? 162  ILE C CG1   1 
ATOM   4860  C  CG2   . ILE C 2  162  ? 7.966   -34.194 55.313  1.00 29.91  ? 162  ILE C CG2   1 
ATOM   4861  C  CD1   . ILE C 2  162  ? 5.932   -35.238 53.159  1.00 30.99  ? 162  ILE C CD1   1 
ATOM   4862  N  N     . ILE C 2  163  ? 7.362   -31.441 57.686  1.00 30.28  ? 163  ILE C N     1 
ATOM   4863  C  CA    . ILE C 2  163  ? 8.089   -30.256 58.124  1.00 29.68  ? 163  ILE C CA    1 
ATOM   4864  C  C     . ILE C 2  163  ? 9.528   -30.556 58.530  1.00 29.05  ? 163  ILE C C     1 
ATOM   4865  O  O     . ILE C 2  163  ? 9.763   -31.363 59.416  1.00 30.07  ? 163  ILE C O     1 
ATOM   4866  C  CB    . ILE C 2  163  ? 7.366   -29.576 59.297  1.00 35.36  ? 163  ILE C CB    1 
ATOM   4867  C  CG1   . ILE C 2  163  ? 5.939   -29.206 58.887  1.00 30.97  ? 163  ILE C CG1   1 
ATOM   4868  C  CG2   . ILE C 2  163  ? 8.140   -28.351 59.763  1.00 33.29  ? 163  ILE C CG2   1 
ATOM   4869  C  CD1   . ILE C 2  163  ? 5.125   -28.592 59.998  1.00 40.35  ? 163  ILE C CD1   1 
ATOM   4870  N  N     . PRO C 2  164  ? 10.500  -29.919 57.863  1.00 28.68  ? 164  PRO C N     1 
ATOM   4871  C  CA    . PRO C 2  164  ? 11.905  -30.033 58.263  1.00 32.41  ? 164  PRO C CA    1 
ATOM   4872  C  C     . PRO C 2  164  ? 12.292  -28.949 59.269  1.00 32.67  ? 164  PRO C C     1 
ATOM   4873  O  O     . PRO C 2  164  ? 11.431  -28.171 59.678  1.00 34.57  ? 164  PRO C O     1 
ATOM   4874  C  CB    . PRO C 2  164  ? 12.645  -29.816 56.947  1.00 33.99  ? 164  PRO C CB    1 
ATOM   4875  C  CG    . PRO C 2  164  ? 11.771  -28.872 56.202  1.00 31.52  ? 164  PRO C CG    1 
ATOM   4876  C  CD    . PRO C 2  164  ? 10.347  -29.176 56.601  1.00 32.22  ? 164  PRO C CD    1 
ATOM   4877  N  N     . LEU C 2  165  ? 13.562  -28.908 59.666  1.00 30.13  ? 165  LEU C N     1 
ATOM   4878  C  CA    . LEU C 2  165  ? 14.067  -27.843 60.530  1.00 34.28  ? 165  LEU C CA    1 
ATOM   4879  C  C     . LEU C 2  165  ? 13.998  -26.494 59.811  1.00 37.15  ? 165  LEU C C     1 
ATOM   4880  O  O     . LEU C 2  165  ? 13.965  -26.447 58.581  1.00 38.23  ? 165  LEU C O     1 
ATOM   4881  C  CB    . LEU C 2  165  ? 15.516  -28.121 60.934  1.00 33.69  ? 165  LEU C CB    1 
ATOM   4882  C  CG    . LEU C 2  165  ? 15.881  -29.287 61.848  1.00 37.83  ? 165  LEU C CG    1 
ATOM   4883  C  CD1   . LEU C 2  165  ? 17.381  -29.518 61.783  1.00 32.64  ? 165  LEU C CD1   1 
ATOM   4884  C  CD2   . LEU C 2  165  ? 15.452  -29.003 63.276  1.00 35.05  ? 165  LEU C CD2   1 
ATOM   4885  N  N     . PRO C 2  166  ? 13.971  -25.390 60.575  1.00 34.99  ? 166  PRO C N     1 
ATOM   4886  C  CA    . PRO C 2  166  ? 13.951  -24.057 59.961  1.00 46.16  ? 166  PRO C CA    1 
ATOM   4887  C  C     . PRO C 2  166  ? 15.173  -23.802 59.078  1.00 50.89  ? 166  PRO C C     1 
ATOM   4888  O  O     . PRO C 2  166  ? 16.281  -24.214 59.425  1.00 52.37  ? 166  PRO C O     1 
ATOM   4889  C  CB    . PRO C 2  166  ? 13.956  -23.119 61.170  1.00 42.54  ? 166  PRO C CB    1 
ATOM   4890  C  CG    . PRO C 2  166  ? 13.319  -23.914 62.255  1.00 38.15  ? 166  PRO C CG    1 
ATOM   4891  C  CD    . PRO C 2  166  ? 13.790  -25.324 62.036  1.00 35.24  ? 166  PRO C CD    1 
ATOM   4892  N  N     . LYS C 2  167  ? 14.946  -23.151 57.939  1.00 54.24  ? 167  LYS C N     1 
ATOM   4893  C  CA    . LYS C 2  167  ? 15.981  -22.856 56.945  1.00 58.49  ? 167  LYS C CA    1 
ATOM   4894  C  C     . LYS C 2  167  ? 16.648  -24.129 56.427  1.00 53.37  ? 167  LYS C C     1 
ATOM   4895  O  O     . LYS C 2  167  ? 17.744  -24.088 55.866  1.00 59.41  ? 167  LYS C O     1 
ATOM   4896  C  CB    . LYS C 2  167  ? 17.043  -21.914 57.530  1.00 62.55  ? 167  LYS C CB    1 
ATOM   4897  C  CG    . LYS C 2  167  ? 16.575  -20.487 57.790  1.00 57.20  ? 167  LYS C CG    1 
ATOM   4898  C  CD    . LYS C 2  167  ? 16.462  -19.700 56.496  1.00 73.32  ? 167  LYS C CD    1 
ATOM   4899  C  CE    . LYS C 2  167  ? 16.331  -18.205 56.754  1.00 76.60  ? 167  LYS C CE    1 
ATOM   4900  N  NZ    . LYS C 2  167  ? 16.309  -17.428 55.481  1.00 61.44  ? 167  LYS C NZ    1 
ATOM   4901  N  N     . ARG C 2  168  ? 15.978  -25.257 56.627  1.00 47.39  ? 168  ARG C N     1 
ATOM   4902  C  CA    . ARG C 2  168  ? 16.432  -26.553 56.124  1.00 49.13  ? 168  ARG C CA    1 
ATOM   4903  C  C     . ARG C 2  168  ? 15.724  -27.062 54.863  1.00 55.42  ? 168  ARG C C     1 
ATOM   4904  O  O     . ARG C 2  168  ? 15.839  -28.233 54.511  1.00 48.75  ? 168  ARG C O     1 
ATOM   4905  C  CB    . ARG C 2  168  ? 16.553  -27.595 57.235  1.00 46.50  ? 168  ARG C CB    1 
ATOM   4906  C  CG    . ARG C 2  168  ? 17.503  -27.147 58.353  1.00 51.63  ? 168  ARG C CG    1 
ATOM   4907  C  CD    . ARG C 2  168  ? 18.979  -27.405 58.057  1.00 54.69  ? 168  ARG C CD    1 
ATOM   4908  N  NE    . ARG C 2  168  ? 19.484  -26.625 56.933  1.00 59.30  ? 168  ARG C NE    1 
ATOM   4909  C  CZ    . ARG C 2  168  ? 20.670  -26.818 56.366  1.00 65.11  ? 168  ARG C CZ    1 
ATOM   4910  N  NH1   . ARG C 2  168  ? 21.478  -27.766 56.822  1.00 63.43  ? 168  ARG C NH1   1 
ATOM   4911  N  NH2   . ARG C 2  168  ? 21.045  -26.064 55.342  1.00 69.01  ? 168  ARG C NH2   1 
ATOM   4912  N  N     . GLY C 2  169  ? 14.954  -26.192 54.219  1.00 60.33  ? 169  GLY C N     1 
ATOM   4913  C  CA    . GLY C 2  169  ? 14.177  -26.583 53.058  1.00 48.91  ? 169  GLY C CA    1 
ATOM   4914  C  C     . GLY C 2  169  ? 12.683  -26.542 53.296  1.00 47.38  ? 169  GLY C C     1 
ATOM   4915  O  O     . GLY C 2  169  ? 12.235  -26.374 54.427  1.00 47.56  ? 169  GLY C O     1 
ATOM   4916  N  N     . PRO C 2  170  ? 11.904  -26.683 52.215  1.00 48.29  ? 170  PRO C N     1 
ATOM   4917  C  CA    . PRO C 2  170  ? 10.482  -26.331 52.126  1.00 46.85  ? 170  PRO C CA    1 
ATOM   4918  C  C     . PRO C 2  170  ? 9.532   -27.248 52.884  1.00 47.56  ? 170  PRO C C     1 
ATOM   4919  O  O     . PRO C 2  170  ? 9.772   -28.451 52.990  1.00 48.52  ? 170  PRO C O     1 
ATOM   4920  C  CB    . PRO C 2  170  ? 10.201  -26.457 50.630  1.00 48.43  ? 170  PRO C CB    1 
ATOM   4921  C  CG    . PRO C 2  170  ? 11.112  -27.548 50.192  1.00 43.58  ? 170  PRO C CG    1 
ATOM   4922  C  CD    . PRO C 2  170  ? 12.372  -27.367 50.995  1.00 44.93  ? 170  PRO C CD    1 
ATOM   4923  N  N     . TRP C 2  171  ? 8.453   -26.669 53.400  1.00 42.96  ? 171  TRP C N     1 
ATOM   4924  C  CA    . TRP C 2  171  ? 7.347   -27.452 53.926  1.00 39.48  ? 171  TRP C CA    1 
ATOM   4925  C  C     . TRP C 2  171  ? 6.635   -28.106 52.751  1.00 43.38  ? 171  TRP C C     1 
ATOM   4926  O  O     . TRP C 2  171  ? 6.477   -27.492 51.695  1.00 49.65  ? 171  TRP C O     1 
ATOM   4927  C  CB    . TRP C 2  171  ? 6.363   -26.568 54.698  1.00 43.39  ? 171  TRP C CB    1 
ATOM   4928  C  CG    . TRP C 2  171  ? 6.865   -26.095 56.030  1.00 50.26  ? 171  TRP C CG    1 
ATOM   4929  C  CD1   . TRP C 2  171  ? 8.165   -25.903 56.398  1.00 51.20  ? 171  TRP C CD1   1 
ATOM   4930  C  CD2   . TRP C 2  171  ? 6.071   -25.767 57.177  1.00 47.07  ? 171  TRP C CD2   1 
ATOM   4931  N  NE1   . TRP C 2  171  ? 8.229   -25.468 57.700  1.00 45.53  ? 171  TRP C NE1   1 
ATOM   4932  C  CE2   . TRP C 2  171  ? 6.958   -25.377 58.201  1.00 46.53  ? 171  TRP C CE2   1 
ATOM   4933  C  CE3   . TRP C 2  171  ? 4.697   -25.763 57.436  1.00 47.49  ? 171  TRP C CE3   1 
ATOM   4934  C  CZ2   . TRP C 2  171  ? 6.515   -24.988 59.465  1.00 47.21  ? 171  TRP C CZ2   1 
ATOM   4935  C  CZ3   . TRP C 2  171  ? 4.260   -25.375 58.691  1.00 58.66  ? 171  TRP C CZ3   1 
ATOM   4936  C  CH2   . TRP C 2  171  ? 5.167   -24.993 59.689  1.00 52.06  ? 171  TRP C CH2   1 
ATOM   4937  N  N     . ILE C 2  172  ? 6.212   -29.352 52.929  1.00 41.90  ? 172  ILE C N     1 
ATOM   4938  C  CA    . ILE C 2  172  ? 5.514   -30.072 51.873  1.00 37.47  ? 172  ILE C CA    1 
ATOM   4939  C  C     . ILE C 2  172  ? 4.132   -30.491 52.338  1.00 34.81  ? 172  ILE C C     1 
ATOM   4940  O  O     . ILE C 2  172  ? 3.996   -31.177 53.348  1.00 31.17  ? 172  ILE C O     1 
ATOM   4941  C  CB    . ILE C 2  172  ? 6.293   -31.320 51.426  1.00 32.52  ? 172  ILE C CB    1 
ATOM   4942  C  CG1   . ILE C 2  172  ? 7.630   -30.915 50.801  1.00 37.13  ? 172  ILE C CG1   1 
ATOM   4943  C  CG2   . ILE C 2  172  ? 5.471   -32.136 50.446  1.00 34.23  ? 172  ILE C CG2   1 
ATOM   4944  C  CD1   . ILE C 2  172  ? 8.422   -32.070 50.236  1.00 33.68  ? 172  ILE C CD1   1 
ATOM   4945  N  N     . ASP C 2  173  ? 3.104   -30.078 51.603  1.00 44.54  ? 173  ASP C N     1 
ATOM   4946  C  CA    . ASP C 2  173  ? 1.741   -30.460 51.961  1.00 43.65  ? 173  ASP C CA    1 
ATOM   4947  C  C     . ASP C 2  173  ? 1.171   -31.531 51.035  1.00 54.78  ? 173  ASP C C     1 
ATOM   4948  O  O     . ASP C 2  173  ? 1.458   -31.556 49.843  1.00 49.59  ? 173  ASP C O     1 
ATOM   4949  C  CB    . ASP C 2  173  ? 0.818   -29.239 52.000  1.00 46.27  ? 173  ASP C CB    1 
ATOM   4950  C  CG    . ASP C 2  173  ? 0.822   -28.549 53.350  1.00 46.85  ? 173  ASP C CG    1 
ATOM   4951  O  OD1   . ASP C 2  173  ? 1.857   -28.612 54.045  1.00 50.46  ? 173  ASP C OD1   1 
ATOM   4952  O  OD2   . ASP C 2  173  ? -0.210  -27.947 53.718  1.00 46.26  ? 173  ASP C OD2   1 
ATOM   4953  N  N     . LEU C 2  174  ? 0.368   -32.422 51.606  1.00 56.48  ? 174  LEU C N     1 
ATOM   4954  C  CA    . LEU C 2  174  ? -0.309  -33.472 50.859  1.00 44.96  ? 174  LEU C CA    1 
ATOM   4955  C  C     . LEU C 2  174  ? -1.795  -33.388 51.174  1.00 51.47  ? 174  LEU C C     1 
ATOM   4956  O  O     . LEU C 2  174  ? -2.188  -33.406 52.341  1.00 49.42  ? 174  LEU C O     1 
ATOM   4957  C  CB    . LEU C 2  174  ? 0.230   -34.846 51.257  1.00 35.45  ? 174  LEU C CB    1 
ATOM   4958  C  CG    . LEU C 2  174  ? 1.289   -35.501 50.369  1.00 39.74  ? 174  LEU C CG    1 
ATOM   4959  C  CD1   . LEU C 2  174  ? 2.462   -34.578 50.107  1.00 35.70  ? 174  LEU C CD1   1 
ATOM   4960  C  CD2   . LEU C 2  174  ? 1.762   -36.802 50.998  1.00 46.44  ? 174  LEU C CD2   1 
ATOM   4961  N  N     . GLU C 2  175  ? -2.621  -33.286 50.139  1.00 60.84  ? 175  GLU C N     1 
ATOM   4962  C  CA    . GLU C 2  175  ? -4.054  -33.103 50.352  1.00 58.92  ? 175  GLU C CA    1 
ATOM   4963  C  C     . GLU C 2  175  ? -4.876  -33.836 49.301  1.00 65.56  ? 175  GLU C C     1 
ATOM   4964  O  O     . GLU C 2  175  ? -4.529  -33.828 48.128  1.00 65.30  ? 175  GLU C O     1 
ATOM   4965  C  CB    . GLU C 2  175  ? -4.391  -31.609 50.327  1.00 62.09  ? 175  GLU C CB    1 
ATOM   4966  C  CG    . GLU C 2  175  ? -5.876  -31.289 50.366  1.00 66.62  ? 175  GLU C CG    1 
ATOM   4967  C  CD    . GLU C 2  175  ? -6.155  -29.807 50.203  1.00 61.86  ? 175  GLU C CD    1 
ATOM   4968  O  OE1   . GLU C 2  175  ? -5.188  -29.035 50.022  1.00 45.30  ? 175  GLU C OE1   1 
ATOM   4969  O  OE2   . GLU C 2  175  ? -7.341  -29.417 50.255  1.00 64.56  ? 175  GLU C OE2   1 
ATOM   4970  N  N     . VAL C 2  176  ? -5.974  -34.460 49.713  1.00 69.75  ? 176  VAL C N     1 
ATOM   4971  C  CA    . VAL C 2  176  ? -6.870  -35.078 48.742  1.00 69.69  ? 176  VAL C CA    1 
ATOM   4972  C  C     . VAL C 2  176  ? -7.840  -34.028 48.212  1.00 72.16  ? 176  VAL C C     1 
ATOM   4973  O  O     . VAL C 2  176  ? -8.657  -33.486 48.959  1.00 75.61  ? 176  VAL C O     1 
ATOM   4974  C  CB    . VAL C 2  176  ? -7.656  -36.251 49.351  1.00 66.73  ? 176  VAL C CB    1 
ATOM   4975  C  CG1   . VAL C 2  176  ? -8.686  -36.769 48.360  1.00 67.88  ? 176  VAL C CG1   1 
ATOM   4976  C  CG2   . VAL C 2  176  ? -6.705  -37.361 49.770  1.00 63.85  ? 176  VAL C CG2   1 
ATOM   4977  N  N     . GLU C 2  177  ? -7.749  -33.757 46.914  1.00 67.95  ? 177  GLU C N     1 
ATOM   4978  C  CA    . GLU C 2  177  ? -8.521  -32.692 46.284  1.00 68.98  ? 177  GLU C CA    1 
ATOM   4979  C  C     . GLU C 2  177  ? -9.966  -33.134 46.053  1.00 75.51  ? 177  GLU C C     1 
ATOM   4980  O  O     . GLU C 2  177  ? -10.235 -34.331 45.936  1.00 75.13  ? 177  GLU C O     1 
ATOM   4981  C  CB    . GLU C 2  177  ? -7.864  -32.298 44.957  1.00 65.14  ? 177  GLU C CB    1 
ATOM   4982  C  CG    . GLU C 2  177  ? -7.729  -30.799 44.730  1.00 68.86  ? 177  GLU C CG    1 
ATOM   4983  C  CD    . GLU C 2  177  ? -6.897  -30.116 45.797  1.00 66.48  ? 177  GLU C CD    1 
ATOM   4984  O  OE1   . GLU C 2  177  ? -7.438  -29.244 46.511  1.00 72.36  ? 177  GLU C OE1   1 
ATOM   4985  O  OE2   . GLU C 2  177  ? -5.699  -30.445 45.917  1.00 55.42  ? 177  GLU C OE2   1 
ATOM   4986  N  N     . PRO C 2  178  ? -10.904 -32.169 46.004  1.00 71.52  ? 178  PRO C N     1 
ATOM   4987  C  CA    . PRO C 2  178  ? -12.305 -32.462 45.677  1.00 74.78  ? 178  PRO C CA    1 
ATOM   4988  C  C     . PRO C 2  178  ? -12.469 -33.194 44.345  1.00 70.33  ? 178  PRO C C     1 
ATOM   4989  O  O     . PRO C 2  178  ? -13.465 -33.891 44.156  1.00 60.53  ? 178  PRO C O     1 
ATOM   4990  C  CB    . PRO C 2  178  ? -12.935 -31.071 45.590  1.00 70.82  ? 178  PRO C CB    1 
ATOM   4991  C  CG    . PRO C 2  178  ? -12.138 -30.253 46.529  1.00 69.95  ? 178  PRO C CG    1 
ATOM   4992  C  CD    . PRO C 2  178  ? -10.728 -30.768 46.431  1.00 68.58  ? 178  PRO C CD    1 
ATOM   4993  N  N     . ASN C 2  179  ? -11.506 -33.042 43.440  1.00 68.69  ? 179  ASN C N     1 
ATOM   4994  C  CA    . ASN C 2  179  ? -11.568 -33.726 42.154  1.00 69.62  ? 179  ASN C CA    1 
ATOM   4995  C  C     . ASN C 2  179  ? -11.021 -35.152 42.233  1.00 74.72  ? 179  ASN C C     1 
ATOM   4996  O  O     . ASN C 2  179  ? -10.988 -35.872 41.234  1.00 75.30  ? 179  ASN C O     1 
ATOM   4997  C  CB    . ASN C 2  179  ? -10.855 -32.922 41.059  1.00 75.88  ? 179  ASN C CB    1 
ATOM   4998  C  CG    . ASN C 2  179  ? -9.352  -33.132 41.057  1.00 76.86  ? 179  ASN C CG    1 
ATOM   4999  O  OD1   . ASN C 2  179  ? -8.847  -34.076 40.451  1.00 72.75  ? 179  ASN C OD1   1 
ATOM   5000  N  ND2   . ASN C 2  179  ? -8.628  -32.239 41.722  1.00 74.66  ? 179  ASN C ND2   1 
ATOM   5001  N  N     . GLY C 2  180  ? -10.587 -35.550 43.425  1.00 72.62  ? 180  GLY C N     1 
ATOM   5002  C  CA    . GLY C 2  180  ? -10.221 -36.931 43.679  1.00 73.02  ? 180  GLY C CA    1 
ATOM   5003  C  C     . GLY C 2  180  ? -8.738  -37.249 43.636  1.00 74.89  ? 180  GLY C C     1 
ATOM   5004  O  O     . GLY C 2  180  ? -8.319  -38.300 44.118  1.00 70.24  ? 180  GLY C O     1 
ATOM   5005  N  N     . VAL C 2  181  ? -7.941  -36.351 43.064  1.00 76.66  ? 181  VAL C N     1 
ATOM   5006  C  CA    . VAL C 2  181  ? -6.506  -36.595 42.927  1.00 76.78  ? 181  VAL C CA    1 
ATOM   5007  C  C     . VAL C 2  181  ? -5.711  -35.999 44.096  1.00 73.92  ? 181  VAL C C     1 
ATOM   5008  O  O     . VAL C 2  181  ? -6.056  -34.938 44.621  1.00 68.56  ? 181  VAL C O     1 
ATOM   5009  C  CB    . VAL C 2  181  ? -5.961  -36.085 41.564  1.00 68.08  ? 181  VAL C CB    1 
ATOM   5010  C  CG1   . VAL C 2  181  ? -5.932  -34.564 41.522  1.00 65.43  ? 181  VAL C CG1   1 
ATOM   5011  C  CG2   . VAL C 2  181  ? -4.577  -36.659 41.286  1.00 63.94  ? 181  VAL C CG2   1 
ATOM   5012  N  N     . VAL C 2  182  ? -4.662  -36.703 44.515  1.00 71.55  ? 182  VAL C N     1 
ATOM   5013  C  CA    . VAL C 2  182  ? -3.819  -36.242 45.615  1.00 66.63  ? 182  VAL C CA    1 
ATOM   5014  C  C     . VAL C 2  182  ? -2.822  -35.175 45.159  1.00 65.01  ? 182  VAL C C     1 
ATOM   5015  O  O     . VAL C 2  182  ? -2.054  -35.378 44.216  1.00 66.92  ? 182  VAL C O     1 
ATOM   5016  C  CB    . VAL C 2  182  ? -3.077  -37.414 46.300  1.00 57.25  ? 182  VAL C CB    1 
ATOM   5017  C  CG1   . VAL C 2  182  ? -2.386  -38.288 45.269  1.00 67.13  ? 182  VAL C CG1   1 
ATOM   5018  C  CG2   . VAL C 2  182  ? -2.082  -36.892 47.325  1.00 54.85  ? 182  VAL C CG2   1 
ATOM   5019  N  N     . SER C 2  183  ? -2.851  -34.034 45.838  1.00 65.64  ? 183  SER C N     1 
ATOM   5020  C  CA    . SER C 2  183  ? -2.011  -32.898 45.493  1.00 62.84  ? 183  SER C CA    1 
ATOM   5021  C  C     . SER C 2  183  ? -0.873  -32.690 46.481  1.00 57.63  ? 183  SER C C     1 
ATOM   5022  O  O     . SER C 2  183  ? -1.019  -32.913 47.690  1.00 62.66  ? 183  SER C O     1 
ATOM   5023  C  CB    . SER C 2  183  ? -2.846  -31.620 45.401  1.00 60.52  ? 183  SER C CB    1 
ATOM   5024  O  OG    . SER C 2  183  ? -3.442  -31.309 46.649  1.00 51.59  ? 183  SER C OG    1 
ATOM   5025  N  N     . MET C 2  184  ? 0.256   -32.252 45.938  1.00 56.62  ? 184  MET C N     1 
ATOM   5026  C  CA    . MET C 2  184  ? 1.437   -31.912 46.709  1.00 59.13  ? 184  MET C CA    1 
ATOM   5027  C  C     . MET C 2  184  ? 1.747   -30.428 46.545  1.00 65.02  ? 184  MET C C     1 
ATOM   5028  O  O     . MET C 2  184  ? 1.756   -29.901 45.426  1.00 67.49  ? 184  MET C O     1 
ATOM   5029  C  CB    . MET C 2  184  ? 2.626   -32.755 46.252  1.00 50.80  ? 184  MET C CB    1 
ATOM   5030  C  CG    . MET C 2  184  ? 3.949   -32.390 46.897  1.00 42.06  ? 184  MET C CG    1 
ATOM   5031  S  SD    . MET C 2  184  ? 5.180   -33.655 46.547  1.00 58.62  ? 184  MET C SD    1 
ATOM   5032  C  CE    . MET C 2  184  ? 6.682   -32.881 47.127  1.00 39.79  ? 184  MET C CE    1 
ATOM   5033  N  N     . LYS C 2  185  ? 1.987   -29.765 47.672  1.00 67.19  ? 185  LYS C N     1 
ATOM   5034  C  CA    . LYS C 2  185  ? 2.304   -28.345 47.705  1.00 62.69  ? 185  LYS C CA    1 
ATOM   5035  C  C     . LYS C 2  185  ? 3.741   -28.132 48.177  1.00 60.32  ? 185  LYS C C     1 
ATOM   5036  O  O     . LYS C 2  185  ? 4.113   -28.545 49.283  1.00 51.79  ? 185  LYS C O     1 
ATOM   5037  C  CB    . LYS C 2  185  ? 1.335   -27.608 48.632  1.00 51.40  ? 185  LYS C CB    1 
ATOM   5038  C  CG    . LYS C 2  185  ? 1.554   -26.106 48.698  1.00 58.91  ? 185  LYS C CG    1 
ATOM   5039  C  CD    . LYS C 2  185  ? 0.868   -25.503 49.916  1.00 65.51  ? 185  LYS C CD    1 
ATOM   5040  C  CE    . LYS C 2  185  ? -0.616  -25.834 49.945  1.00 61.38  ? 185  LYS C CE    1 
ATOM   5041  N  NZ    . LYS C 2  185  ? -1.338  -25.260 48.779  1.00 60.75  ? 185  LYS C NZ    1 
ATOM   5042  N  N     . VAL C 2  186  ? 4.540   -27.504 47.316  1.00 59.39  ? 186  VAL C N     1 
ATOM   5043  C  CA    . VAL C 2  186  ? 5.918   -27.134 47.625  1.00 56.44  ? 186  VAL C CA    1 
ATOM   5044  C  C     . VAL C 2  186  ? 6.201   -25.741 47.082  1.00 66.38  ? 186  VAL C C     1 
ATOM   5045  O  O     . VAL C 2  186  ? 5.992   -25.486 45.895  1.00 67.18  ? 186  VAL C O     1 
ATOM   5046  C  CB    . VAL C 2  186  ? 6.917   -28.110 46.985  1.00 51.45  ? 186  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C 2  186  ? 8.331   -27.562 47.073  1.00 54.02  ? 186  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C 2  186  ? 6.839   -29.448 47.663  1.00 59.85  ? 186  VAL C CG2   1 
ATOM   5049  N  N     . ASN C 2  187  ? 6.687   -24.851 47.947  1.00 66.81  ? 187  ASN C N     1 
ATOM   5050  C  CA    . ASN C 2  187  ? 6.948   -23.461 47.575  1.00 61.76  ? 187  ASN C CA    1 
ATOM   5051  C  C     . ASN C 2  187  ? 5.726   -22.817 46.926  1.00 63.06  ? 187  ASN C C     1 
ATOM   5052  O  O     . ASN C 2  187  ? 5.845   -22.081 45.946  1.00 59.27  ? 187  ASN C O     1 
ATOM   5053  C  CB    . ASN C 2  187  ? 8.167   -23.358 46.651  1.00 58.81  ? 187  ASN C CB    1 
ATOM   5054  C  CG    . ASN C 2  187  ? 9.457   -23.782 47.333  1.00 62.34  ? 187  ASN C CG    1 
ATOM   5055  O  OD1   . ASN C 2  187  ? 10.068  -24.785 46.963  1.00 56.80  ? 187  ASN C OD1   1 
ATOM   5056  N  ND2   . ASN C 2  187  ? 9.881   -23.013 48.330  1.00 68.96  ? 187  ASN C ND2   1 
ATOM   5057  N  N     . LYS C 2  188  ? 4.557   -23.115 47.486  1.00 66.64  ? 188  LYS C N     1 
ATOM   5058  C  CA    . LYS C 2  188  ? 3.273   -22.683 46.935  1.00 74.55  ? 188  LYS C CA    1 
ATOM   5059  C  C     . LYS C 2  188  ? 3.045   -23.156 45.497  1.00 79.13  ? 188  LYS C C     1 
ATOM   5060  O  O     . LYS C 2  188  ? 2.665   -22.371 44.628  1.00 85.68  ? 188  LYS C O     1 
ATOM   5061  C  CB    . LYS C 2  188  ? 3.097   -21.165 47.050  1.00 73.98  ? 188  LYS C CB    1 
ATOM   5062  C  CG    . LYS C 2  188  ? 2.750   -20.693 48.454  1.00 76.70  ? 188  LYS C CG    1 
ATOM   5063  C  CD    . LYS C 2  188  ? 2.635   -19.179 48.518  1.00 84.50  ? 188  LYS C CD    1 
ATOM   5064  C  CE    . LYS C 2  188  ? 3.976   -18.514 48.253  1.00 82.35  ? 188  LYS C CE    1 
ATOM   5065  N  NZ    . LYS C 2  188  ? 5.005   -18.931 49.247  1.00 73.67  ? 188  LYS C NZ    1 
ATOM   5066  N  N     . ARG C 2  189  ? 3.280   -24.445 45.260  1.00 73.54  ? 189  ARG C N     1 
ATOM   5067  C  CA    . ARG C 2  189  ? 2.985   -25.057 43.968  1.00 69.81  ? 189  ARG C CA    1 
ATOM   5068  C  C     . ARG C 2  189  ? 2.207   -26.355 44.143  1.00 66.75  ? 189  ARG C C     1 
ATOM   5069  O  O     . ARG C 2  189  ? 2.724   -27.326 44.692  1.00 64.72  ? 189  ARG C O     1 
ATOM   5070  C  CB    . ARG C 2  189  ? 4.272   -25.336 43.191  1.00 70.05  ? 189  ARG C CB    1 
ATOM   5071  C  CG    . ARG C 2  189  ? 4.955   -24.096 42.655  1.00 73.38  ? 189  ARG C CG    1 
ATOM   5072  C  CD    . ARG C 2  189  ? 6.142   -24.458 41.784  1.00 76.43  ? 189  ARG C CD    1 
ATOM   5073  N  NE    . ARG C 2  189  ? 6.677   -23.289 41.095  1.00 89.72  ? 189  ARG C NE    1 
ATOM   5074  C  CZ    . ARG C 2  189  ? 6.244   -22.858 39.915  1.00 91.53  ? 189  ARG C CZ    1 
ATOM   5075  N  NH1   . ARG C 2  189  ? 5.268   -23.505 39.290  1.00 94.16  ? 189  ARG C NH1   1 
ATOM   5076  N  NH2   . ARG C 2  189  ? 6.784   -21.783 39.359  1.00 86.96  ? 189  ARG C NH2   1 
ATOM   5077  N  N     . LYS C 2  190  ? 0.969   -26.368 43.658  1.00 67.15  ? 190  LYS C N     1 
ATOM   5078  C  CA    . LYS C 2  190  ? 0.126   -27.557 43.723  1.00 66.28  ? 190  LYS C CA    1 
ATOM   5079  C  C     . LYS C 2  190  ? 0.304   -28.416 42.477  1.00 64.61  ? 190  LYS C C     1 
ATOM   5080  O  O     . LYS C 2  190  ? 0.029   -27.969 41.364  1.00 66.71  ? 190  LYS C O     1 
ATOM   5081  C  CB    . LYS C 2  190  ? -1.346  -27.163 43.858  1.00 66.06  ? 190  LYS C CB    1 
ATOM   5082  C  CG    . LYS C 2  190  ? -1.769  -26.714 45.246  1.00 60.89  ? 190  LYS C CG    1 
ATOM   5083  C  CD    . LYS C 2  190  ? -2.635  -27.772 45.913  1.00 65.16  ? 190  LYS C CD    1 
ATOM   5084  C  CE    . LYS C 2  190  ? -3.477  -27.182 47.037  1.00 70.97  ? 190  LYS C CE    1 
ATOM   5085  N  NZ    . LYS C 2  190  ? -4.482  -26.203 46.532  1.00 65.18  ? 190  LYS C NZ    1 
ATOM   5086  N  N     . PHE C 2  191  ? 0.762   -29.650 42.662  1.00 60.44  ? 191  PHE C N     1 
ATOM   5087  C  CA    . PHE C 2  191  ? 0.903   -30.568 41.536  1.00 60.41  ? 191  PHE C CA    1 
ATOM   5088  C  C     . PHE C 2  191  ? 0.572   -31.994 41.966  1.00 68.15  ? 191  PHE C C     1 
ATOM   5089  O  O     . PHE C 2  191  ? 0.770   -32.346 43.123  1.00 70.66  ? 191  PHE C O     1 
ATOM   5090  C  CB    . PHE C 2  191  ? 2.319   -30.494 40.960  1.00 59.07  ? 191  PHE C CB    1 
ATOM   5091  C  CG    . PHE C 2  191  ? 3.351   -31.204 41.788  1.00 62.05  ? 191  PHE C CG    1 
ATOM   5092  C  CD1   . PHE C 2  191  ? 3.770   -32.481 41.450  1.00 68.04  ? 191  PHE C CD1   1 
ATOM   5093  C  CD2   . PHE C 2  191  ? 3.907   -30.595 42.900  1.00 60.33  ? 191  PHE C CD2   1 
ATOM   5094  C  CE1   . PHE C 2  191  ? 4.717   -33.139 42.209  1.00 69.16  ? 191  PHE C CE1   1 
ATOM   5095  C  CE2   . PHE C 2  191  ? 4.857   -31.246 43.661  1.00 61.15  ? 191  PHE C CE2   1 
ATOM   5096  C  CZ    . PHE C 2  191  ? 5.264   -32.519 43.314  1.00 64.63  ? 191  PHE C CZ    1 
ATOM   5097  N  N     . PRO C 2  192  ? 0.065   -32.821 41.036  1.00 70.67  ? 192  PRO C N     1 
ATOM   5098  C  CA    . PRO C 2  192  ? -0.271  -34.211 41.373  1.00 72.64  ? 192  PRO C CA    1 
ATOM   5099  C  C     . PRO C 2  192  ? 0.924   -34.986 41.930  1.00 73.16  ? 192  PRO C C     1 
ATOM   5100  O  O     . PRO C 2  192  ? 2.000   -34.985 41.331  1.00 69.86  ? 192  PRO C O     1 
ATOM   5101  C  CB    . PRO C 2  192  ? -0.712  -34.804 40.029  1.00 70.83  ? 192  PRO C CB    1 
ATOM   5102  C  CG    . PRO C 2  192  ? -0.169  -33.871 38.989  1.00 69.67  ? 192  PRO C CG    1 
ATOM   5103  C  CD    . PRO C 2  192  ? -0.209  -32.520 39.622  1.00 68.73  ? 192  PRO C CD    1 
ATOM   5104  N  N     . LEU C 2  193  ? 0.716   -35.645 43.066  1.00 70.14  ? 193  LEU C N     1 
ATOM   5105  C  CA    . LEU C 2  193  ? 1.777   -36.361 43.770  1.00 66.44  ? 193  LEU C CA    1 
ATOM   5106  C  C     . LEU C 2  193  ? 2.305   -37.544 42.961  1.00 67.08  ? 193  LEU C C     1 
ATOM   5107  O  O     . LEU C 2  193  ? 3.484   -37.903 43.056  1.00 59.18  ? 193  LEU C O     1 
ATOM   5108  C  CB    . LEU C 2  193  ? 1.264   -36.833 45.136  1.00 60.08  ? 193  LEU C CB    1 
ATOM   5109  C  CG    . LEU C 2  193  ? 2.136   -37.761 45.984  1.00 52.84  ? 193  LEU C CG    1 
ATOM   5110  C  CD1   . LEU C 2  193  ? 3.484   -37.127 46.294  1.00 55.13  ? 193  LEU C CD1   1 
ATOM   5111  C  CD2   . LEU C 2  193  ? 1.409   -38.131 47.266  1.00 42.22  ? 193  LEU C CD2   1 
ATOM   5112  N  N     . VAL C 2  194  ? 1.424   -38.132 42.157  1.00 73.07  ? 194  VAL C N     1 
ATOM   5113  C  CA    . VAL C 2  194  ? 1.746   -39.316 41.367  1.00 72.73  ? 194  VAL C CA    1 
ATOM   5114  C  C     . VAL C 2  194  ? 2.967   -39.100 40.477  1.00 67.01  ? 194  VAL C C     1 
ATOM   5115  O  O     . VAL C 2  194  ? 3.697   -40.040 40.168  1.00 65.93  ? 194  VAL C O     1 
ATOM   5116  C  CB    . VAL C 2  194  ? 0.558   -39.727 40.482  1.00 70.33  ? 194  VAL C CB    1 
ATOM   5117  C  CG1   . VAL C 2  194  ? 0.540   -41.235 40.290  1.00 67.07  ? 194  VAL C CG1   1 
ATOM   5118  C  CG2   . VAL C 2  194  ? -0.748  -39.248 41.099  1.00 76.10  ? 194  VAL C CG2   1 
ATOM   5119  N  N     . LEU C 2  195  ? 3.179   -37.853 40.072  1.00 64.17  ? 195  LEU C N     1 
ATOM   5120  C  CA    . LEU C 2  195  ? 4.314   -37.499 39.232  1.00 64.31  ? 195  LEU C CA    1 
ATOM   5121  C  C     . LEU C 2  195  ? 5.623   -37.724 39.980  1.00 63.60  ? 195  LEU C C     1 
ATOM   5122  O  O     . LEU C 2  195  ? 6.530   -38.401 39.485  1.00 65.25  ? 195  LEU C O     1 
ATOM   5123  C  CB    . LEU C 2  195  ? 4.200   -36.043 38.784  1.00 61.98  ? 195  LEU C CB    1 
ATOM   5124  C  CG    . LEU C 2  195  ? 5.125   -35.609 37.650  1.00 74.66  ? 195  LEU C CG    1 
ATOM   5125  C  CD1   . LEU C 2  195  ? 4.941   -36.503 36.433  1.00 75.51  ? 195  LEU C CD1   1 
ATOM   5126  C  CD2   . LEU C 2  195  ? 4.862   -34.159 37.294  1.00 78.50  ? 195  LEU C CD2   1 
ATOM   5127  N  N     . LEU C 2  196  ? 5.713   -37.159 41.180  1.00 61.55  ? 196  LEU C N     1 
ATOM   5128  C  CA    . LEU C 2  196  ? 6.886   -37.353 42.020  1.00 61.36  ? 196  LEU C CA    1 
ATOM   5129  C  C     . LEU C 2  196  ? 7.028   -38.821 42.391  1.00 62.33  ? 196  LEU C C     1 
ATOM   5130  O  O     . LEU C 2  196  ? 8.138   -39.344 42.470  1.00 60.54  ? 196  LEU C O     1 
ATOM   5131  C  CB    . LEU C 2  196  ? 6.804   -36.502 43.286  1.00 64.92  ? 196  LEU C CB    1 
ATOM   5132  C  CG    . LEU C 2  196  ? 7.982   -36.696 44.243  1.00 58.05  ? 196  LEU C CG    1 
ATOM   5133  C  CD1   . LEU C 2  196  ? 9.282   -36.268 43.585  1.00 60.04  ? 196  LEU C CD1   1 
ATOM   5134  C  CD2   . LEU C 2  196  ? 7.762   -35.942 45.532  1.00 53.65  ? 196  LEU C CD2   1 
ATOM   5135  N  N     . LEU C 2  197  ? 5.895   -39.482 42.613  1.00 66.74  ? 197  LEU C N     1 
ATOM   5136  C  CA    . LEU C 2  197  ? 5.895   -40.915 42.882  1.00 70.29  ? 197  LEU C CA    1 
ATOM   5137  C  C     . LEU C 2  197  ? 6.571   -41.666 41.740  1.00 68.33  ? 197  LEU C C     1 
ATOM   5138  O  O     . LEU C 2  197  ? 7.312   -42.623 41.963  1.00 63.70  ? 197  LEU C O     1 
ATOM   5139  C  CB    . LEU C 2  197  ? 4.467   -41.428 43.084  1.00 66.79  ? 197  LEU C CB    1 
ATOM   5140  C  CG    . LEU C 2  197  ? 3.758   -40.986 44.366  1.00 62.17  ? 197  LEU C CG    1 
ATOM   5141  C  CD1   . LEU C 2  197  ? 2.332   -41.511 44.401  1.00 64.41  ? 197  LEU C CD1   1 
ATOM   5142  C  CD2   . LEU C 2  197  ? 4.531   -41.448 45.593  1.00 56.28  ? 197  LEU C CD2   1 
ATOM   5143  N  N     . ARG C 2  198  ? 6.322   -41.209 40.516  1.00 66.94  ? 198  ARG C N     1 
ATOM   5144  C  CA    . ARG C 2  198  ? 6.929   -41.807 39.335  1.00 74.03  ? 198  ARG C CA    1 
ATOM   5145  C  C     . ARG C 2  198  ? 8.420   -41.482 39.270  1.00 76.84  ? 198  ARG C C     1 
ATOM   5146  O  O     . ARG C 2  198  ? 9.222   -42.313 38.842  1.00 81.41  ? 198  ARG C O     1 
ATOM   5147  C  CB    . ARG C 2  198  ? 6.222   -41.327 38.066  1.00 74.40  ? 198  ARG C CB    1 
ATOM   5148  C  CG    . ARG C 2  198  ? 6.435   -42.220 36.850  1.00 85.80  ? 198  ARG C CG    1 
ATOM   5149  C  CD    . ARG C 2  198  ? 5.780   -43.583 37.038  1.00 88.33  ? 198  ARG C CD    1 
ATOM   5150  N  NE    . ARG C 2  198  ? 5.867   -44.407 35.835  1.00 95.45  ? 198  ARG C NE    1 
ATOM   5151  C  CZ    . ARG C 2  198  ? 6.835   -45.287 35.597  1.00 100.12 ? 198  ARG C CZ    1 
ATOM   5152  N  NH1   . ARG C 2  198  ? 6.832   -45.993 34.473  1.00 98.26  ? 198  ARG C NH1   1 
ATOM   5153  N  NH2   . ARG C 2  198  ? 7.806   -45.464 36.483  1.00 93.45  ? 198  ARG C NH2   1 
ATOM   5154  N  N     . VAL C 2  199  ? 8.786   -40.274 39.695  1.00 72.59  ? 199  VAL C N     1 
ATOM   5155  C  CA    . VAL C 2  199  ? 10.194  -39.877 39.741  1.00 64.48  ? 199  VAL C CA    1 
ATOM   5156  C  C     . VAL C 2  199  ? 10.996  -40.783 40.677  1.00 66.49  ? 199  VAL C C     1 
ATOM   5157  O  O     . VAL C 2  199  ? 12.148  -41.120 40.402  1.00 68.97  ? 199  VAL C O     1 
ATOM   5158  C  CB    . VAL C 2  199  ? 10.356  -38.408 40.181  1.00 65.33  ? 199  VAL C CB    1 
ATOM   5159  C  CG1   . VAL C 2  199  ? 11.827  -38.022 40.227  1.00 65.62  ? 199  VAL C CG1   1 
ATOM   5160  C  CG2   . VAL C 2  199  ? 9.593   -37.487 39.244  1.00 68.19  ? 199  VAL C CG2   1 
ATOM   5161  N  N     . LEU C 2  200  ? 10.369  -41.188 41.778  1.00 74.92  ? 200  LEU C N     1 
ATOM   5162  C  CA    . LEU C 2  200  ? 10.983  -42.114 42.727  1.00 73.81  ? 200  LEU C CA    1 
ATOM   5163  C  C     . LEU C 2  200  ? 11.046  -43.541 42.176  1.00 73.66  ? 200  LEU C C     1 
ATOM   5164  O  O     . LEU C 2  200  ? 11.608  -44.435 42.811  1.00 68.92  ? 200  LEU C O     1 
ATOM   5165  C  CB    . LEU C 2  200  ? 10.245  -42.094 44.071  1.00 76.69  ? 200  LEU C CB    1 
ATOM   5166  C  CG    . LEU C 2  200  ? 10.688  -41.073 45.126  1.00 64.86  ? 200  LEU C CG    1 
ATOM   5167  C  CD1   . LEU C 2  200  ? 12.195  -41.120 45.320  1.00 73.09  ? 200  LEU C CD1   1 
ATOM   5168  C  CD2   . LEU C 2  200  ? 10.232  -39.661 44.790  1.00 49.68  ? 200  LEU C CD2   1 
ATOM   5169  N  N     . GLY C 2  201  ? 10.466  -43.745 40.996  1.00 74.30  ? 201  GLY C N     1 
ATOM   5170  C  CA    . GLY C 2  201  ? 10.457  -45.050 40.358  1.00 77.67  ? 201  GLY C CA    1 
ATOM   5171  C  C     . GLY C 2  201  ? 9.442   -46.026 40.923  1.00 81.40  ? 201  GLY C C     1 
ATOM   5172  O  O     . GLY C 2  201  ? 9.768   -47.177 41.215  1.00 81.41  ? 201  GLY C O     1 
ATOM   5173  N  N     . TYR C 2  202  ? 8.207   -45.563 41.085  1.00 79.81  ? 202  TYR C N     1 
ATOM   5174  C  CA    . TYR C 2  202  ? 7.122   -46.425 41.543  1.00 80.45  ? 202  TYR C CA    1 
ATOM   5175  C  C     . TYR C 2  202  ? 6.273   -46.931 40.382  1.00 86.27  ? 202  TYR C C     1 
ATOM   5176  O  O     . TYR C 2  202  ? 5.735   -46.145 39.600  1.00 78.67  ? 202  TYR C O     1 
ATOM   5177  C  CB    . TYR C 2  202  ? 6.236   -45.694 42.555  1.00 78.26  ? 202  TYR C CB    1 
ATOM   5178  C  CG    . TYR C 2  202  ? 6.766   -45.725 43.969  1.00 74.82  ? 202  TYR C CG    1 
ATOM   5179  C  CD1   . TYR C 2  202  ? 7.726   -46.653 44.352  1.00 78.44  ? 202  TYR C CD1   1 
ATOM   5180  C  CD2   . TYR C 2  202  ? 6.302   -44.831 44.924  1.00 66.26  ? 202  TYR C CD2   1 
ATOM   5181  C  CE1   . TYR C 2  202  ? 8.211   -46.687 45.644  1.00 75.83  ? 202  TYR C CE1   1 
ATOM   5182  C  CE2   . TYR C 2  202  ? 6.780   -44.857 46.218  1.00 64.46  ? 202  TYR C CE2   1 
ATOM   5183  C  CZ    . TYR C 2  202  ? 7.735   -45.787 46.573  1.00 68.91  ? 202  TYR C CZ    1 
ATOM   5184  O  OH    . TYR C 2  202  ? 8.213   -45.817 47.862  1.00 67.07  ? 202  TYR C OH    1 
ATOM   5185  N  N     . ASP C 2  203  ? 6.163   -48.251 40.274  1.00 92.57  ? 203  ASP C N     1 
ATOM   5186  C  CA    . ASP C 2  203  ? 5.310   -48.872 39.271  1.00 94.33  ? 203  ASP C CA    1 
ATOM   5187  C  C     . ASP C 2  203  ? 3.871   -48.884 39.772  1.00 98.68  ? 203  ASP C C     1 
ATOM   5188  O  O     . ASP C 2  203  ? 3.633   -48.996 40.975  1.00 97.62  ? 203  ASP C O     1 
ATOM   5189  C  CB    . ASP C 2  203  ? 5.781   -50.298 38.978  1.00 95.31  ? 203  ASP C CB    1 
ATOM   5190  C  CG    . ASP C 2  203  ? 5.085   -50.907 37.776  1.00 107.67 ? 203  ASP C CG    1 
ATOM   5191  O  OD1   . ASP C 2  203  ? 5.623   -50.787 36.654  1.00 117.27 ? 203  ASP C OD1   1 
ATOM   5192  O  OD2   . ASP C 2  203  ? 4.002   -51.503 37.950  1.00 106.10 ? 203  ASP C OD2   1 
ATOM   5193  N  N     . GLN C 2  204  ? 2.917   -48.765 38.850  1.00 99.96  ? 204  GLN C N     1 
ATOM   5194  C  CA    . GLN C 2  204  ? 1.498   -48.726 39.201  1.00 93.00  ? 204  GLN C CA    1 
ATOM   5195  C  C     . GLN C 2  204  ? 1.061   -49.954 39.995  1.00 93.21  ? 204  GLN C C     1 
ATOM   5196  O  O     . GLN C 2  204  ? 0.152   -49.879 40.817  1.00 93.13  ? 204  GLN C O     1 
ATOM   5197  C  CB    . GLN C 2  204  ? 0.635   -48.580 37.945  1.00 94.82  ? 204  GLN C CB    1 
ATOM   5198  C  CG    . GLN C 2  204  ? -0.855  -48.458 38.227  1.00 93.26  ? 204  GLN C CG    1 
ATOM   5199  C  CD    . GLN C 2  204  ? -1.690  -48.416 36.963  1.00 99.88  ? 204  GLN C CD    1 
ATOM   5200  O  OE1   . GLN C 2  204  ? -1.159  -48.430 35.853  1.00 107.57 ? 204  GLN C OE1   1 
ATOM   5201  N  NE2   . GLN C 2  204  ? -3.008  -48.366 37.127  1.00 88.94  ? 204  GLN C NE2   1 
ATOM   5202  N  N     . GLU C 2  205  ? 1.724   -51.078 39.749  1.00 99.67  ? 205  GLU C N     1 
ATOM   5203  C  CA    . GLU C 2  205  ? 1.413   -52.324 40.438  1.00 99.58  ? 205  GLU C CA    1 
ATOM   5204  C  C     . GLU C 2  205  ? 1.752   -52.230 41.925  1.00 90.54  ? 205  GLU C C     1 
ATOM   5205  O  O     . GLU C 2  205  ? 0.981   -52.678 42.776  1.00 90.72  ? 205  GLU C O     1 
ATOM   5206  C  CB    . GLU C 2  205  ? 2.168   -53.484 39.787  1.00 109.96 ? 205  GLU C CB    1 
ATOM   5207  C  CG    . GLU C 2  205  ? 1.711   -54.866 40.221  1.00 121.36 ? 205  GLU C CG    1 
ATOM   5208  C  CD    . GLU C 2  205  ? 2.259   -55.963 39.327  1.00 131.33 ? 205  GLU C CD    1 
ATOM   5209  O  OE1   . GLU C 2  205  ? 2.799   -55.637 38.247  1.00 123.64 ? 205  GLU C OE1   1 
ATOM   5210  O  OE2   . GLU C 2  205  ? 2.151   -57.150 39.701  1.00 136.79 ? 205  GLU C OE2   1 
ATOM   5211  N  N     . THR C 2  206  ? 2.903   -51.635 42.230  1.00 91.54  ? 206  THR C N     1 
ATOM   5212  C  CA    . THR C 2  206  ? 3.351   -51.476 43.611  1.00 87.34  ? 206  THR C CA    1 
ATOM   5213  C  C     . THR C 2  206  ? 2.461   -50.503 44.384  1.00 80.81  ? 206  THR C C     1 
ATOM   5214  O  O     . THR C 2  206  ? 2.099   -50.757 45.535  1.00 78.01  ? 206  THR C O     1 
ATOM   5215  C  CB    . THR C 2  206  ? 4.812   -50.991 43.683  1.00 80.49  ? 206  THR C CB    1 
ATOM   5216  O  OG1   . THR C 2  206  ? 5.629   -51.794 42.823  1.00 81.86  ? 206  THR C OG1   1 
ATOM   5217  C  CG2   . THR C 2  206  ? 5.337   -51.085 45.108  1.00 68.07  ? 206  THR C CG2   1 
ATOM   5218  N  N     . LEU C 2  207  ? 2.110   -49.389 43.746  1.00 76.12  ? 207  LEU C N     1 
ATOM   5219  C  CA    . LEU C 2  207  ? 1.224   -48.405 44.362  1.00 80.30  ? 207  LEU C CA    1 
ATOM   5220  C  C     . LEU C 2  207  ? -0.184  -48.968 44.533  1.00 81.02  ? 207  LEU C C     1 
ATOM   5221  O  O     . LEU C 2  207  ? -0.895  -48.611 45.474  1.00 78.64  ? 207  LEU C O     1 
ATOM   5222  C  CB    . LEU C 2  207  ? 1.181   -47.112 43.540  1.00 84.31  ? 207  LEU C CB    1 
ATOM   5223  C  CG    . LEU C 2  207  ? 2.441   -46.241 43.524  1.00 80.03  ? 207  LEU C CG    1 
ATOM   5224  C  CD1   . LEU C 2  207  ? 2.207   -44.965 42.728  1.00 65.67  ? 207  LEU C CD1   1 
ATOM   5225  C  CD2   . LEU C 2  207  ? 2.893   -45.913 44.938  1.00 76.17  ? 207  LEU C CD2   1 
ATOM   5226  N  N     . ALA C 2  208  ? -0.577  -49.852 43.621  1.00 85.85  ? 208  ALA C N     1 
ATOM   5227  C  CA    . ALA C 2  208  ? -1.884  -50.495 43.691  1.00 87.64  ? 208  ALA C CA    1 
ATOM   5228  C  C     . ALA C 2  208  ? -1.948  -51.495 44.841  1.00 76.06  ? 208  ALA C C     1 
ATOM   5229  O  O     . ALA C 2  208  ? -2.911  -51.506 45.604  1.00 68.67  ? 208  ALA C O     1 
ATOM   5230  C  CB    . ALA C 2  208  ? -2.221  -51.178 42.373  1.00 91.19  ? 208  ALA C CB    1 
ATOM   5231  N  N     . ARG C 2  209  ? -0.926  -52.335 44.964  1.00 72.24  ? 209  ARG C N     1 
ATOM   5232  C  CA    . ARG C 2  209  ? -0.905  -53.322 46.039  1.00 75.32  ? 209  ARG C CA    1 
ATOM   5233  C  C     . ARG C 2  209  ? -0.692  -52.667 47.403  1.00 73.02  ? 209  ARG C C     1 
ATOM   5234  O  O     . ARG C 2  209  ? -1.145  -53.185 48.425  1.00 68.51  ? 209  ARG C O     1 
ATOM   5235  C  CB    . ARG C 2  209  ? 0.151   -54.404 45.785  1.00 78.19  ? 209  ARG C CB    1 
ATOM   5236  C  CG    . ARG C 2  209  ? 1.576   -53.888 45.699  1.00 81.80  ? 209  ARG C CG    1 
ATOM   5237  C  CD    . ARG C 2  209  ? 2.572   -55.028 45.589  1.00 82.52  ? 209  ARG C CD    1 
ATOM   5238  N  NE    . ARG C 2  209  ? 2.557   -55.874 46.779  1.00 84.02  ? 209  ARG C NE    1 
ATOM   5239  C  CZ    . ARG C 2  209  ? 3.266   -55.629 47.876  1.00 82.65  ? 209  ARG C CZ    1 
ATOM   5240  N  NH1   . ARG C 2  209  ? 4.048   -54.559 47.937  1.00 87.89  ? 209  ARG C NH1   1 
ATOM   5241  N  NH2   . ARG C 2  209  ? 3.192   -56.451 48.914  1.00 75.29  ? 209  ARG C NH2   1 
ATOM   5242  N  N     . GLU C 2  210  ? -0.003  -51.529 47.418  1.00 73.94  ? 210  GLU C N     1 
ATOM   5243  C  CA    . GLU C 2  210  ? 0.243   -50.813 48.667  1.00 68.53  ? 210  GLU C CA    1 
ATOM   5244  C  C     . GLU C 2  210  ? -0.973  -50.020 49.140  1.00 64.06  ? 210  GLU C C     1 
ATOM   5245  O  O     . GLU C 2  210  ? -1.346  -50.078 50.311  1.00 62.63  ? 210  GLU C O     1 
ATOM   5246  C  CB    . GLU C 2  210  ? 1.446   -49.879 48.525  1.00 65.57  ? 210  GLU C CB    1 
ATOM   5247  C  CG    . GLU C 2  210  ? 2.495   -50.071 49.602  1.00 66.89  ? 210  GLU C CG    1 
ATOM   5248  C  CD    . GLU C 2  210  ? 3.077   -51.470 49.592  1.00 71.52  ? 210  GLU C CD    1 
ATOM   5249  O  OE1   . GLU C 2  210  ? 3.890   -51.769 48.691  1.00 75.82  ? 210  GLU C OE1   1 
ATOM   5250  O  OE2   . GLU C 2  210  ? 2.717   -52.272 50.479  1.00 67.45  ? 210  GLU C OE2   1 
ATOM   5251  N  N     . LEU C 2  211  ? -1.577  -49.269 48.225  1.00 65.77  ? 211  LEU C N     1 
ATOM   5252  C  CA    . LEU C 2  211  ? -2.700  -48.397 48.564  1.00 66.35  ? 211  LEU C CA    1 
ATOM   5253  C  C     . LEU C 2  211  ? -4.077  -48.990 48.262  1.00 67.63  ? 211  LEU C C     1 
ATOM   5254  O  O     . LEU C 2  211  ? -5.095  -48.316 48.419  1.00 66.93  ? 211  LEU C O     1 
ATOM   5255  C  CB    . LEU C 2  211  ? -2.542  -47.032 47.892  1.00 66.04  ? 211  LEU C CB    1 
ATOM   5256  C  CG    . LEU C 2  211  ? -1.774  -45.967 48.680  1.00 63.68  ? 211  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C 2  211  ? -0.405  -46.458 49.143  1.00 59.53  ? 211  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C 2  211  ? -1.627  -44.724 47.838  1.00 58.97  ? 211  LEU C CD2   1 
ATOM   5259  N  N     . GLY C 2  212  ? -4.103  -50.242 47.815  1.00 74.73  ? 212  GLY C N     1 
ATOM   5260  C  CA    . GLY C 2  212  ? -5.342  -50.898 47.434  1.00 79.29  ? 212  GLY C CA    1 
ATOM   5261  C  C     . GLY C 2  212  ? -6.358  -51.085 48.547  1.00 82.19  ? 212  GLY C C     1 
ATOM   5262  O  O     . GLY C 2  212  ? -7.563  -51.121 48.289  1.00 80.10  ? 212  GLY C O     1 
ATOM   5263  N  N     . ALA C 2  213  ? -5.876  -51.197 49.783  1.00 76.16  ? 213  ALA C N     1 
ATOM   5264  C  CA    . ALA C 2  213  ? -6.742  -51.421 50.942  1.00 70.13  ? 213  ALA C CA    1 
ATOM   5265  C  C     . ALA C 2  213  ? -7.780  -50.314 51.127  1.00 76.37  ? 213  ALA C C     1 
ATOM   5266  O  O     . ALA C 2  213  ? -8.813  -50.516 51.767  1.00 79.56  ? 213  ALA C O     1 
ATOM   5267  C  CB    . ALA C 2  213  ? -5.905  -51.579 52.205  1.00 62.73  ? 213  ALA C CB    1 
ATOM   5268  N  N     . TYR C 2  214  ? -7.495  -49.145 50.564  1.00 83.92  ? 214  TYR C N     1 
ATOM   5269  C  CA    . TYR C 2  214  ? -8.405  -48.010 50.631  1.00 83.38  ? 214  TYR C CA    1 
ATOM   5270  C  C     . TYR C 2  214  ? -8.982  -47.789 49.235  1.00 86.78  ? 214  TYR C C     1 
ATOM   5271  O  O     . TYR C 2  214  ? -8.285  -47.342 48.326  1.00 84.11  ? 214  TYR C O     1 
ATOM   5272  C  CB    . TYR C 2  214  ? -7.647  -46.778 51.130  1.00 64.05  ? 214  TYR C CB    1 
ATOM   5273  C  CG    . TYR C 2  214  ? -6.557  -47.133 52.124  1.00 60.16  ? 214  TYR C CG    1 
ATOM   5274  C  CD1   . TYR C 2  214  ? -6.843  -47.290 53.474  1.00 52.55  ? 214  TYR C CD1   1 
ATOM   5275  C  CD2   . TYR C 2  214  ? -5.246  -47.333 51.705  1.00 60.44  ? 214  TYR C CD2   1 
ATOM   5276  C  CE1   . TYR C 2  214  ? -5.852  -47.626 54.381  1.00 46.95  ? 214  TYR C CE1   1 
ATOM   5277  C  CE2   . TYR C 2  214  ? -4.250  -47.670 52.604  1.00 55.70  ? 214  TYR C CE2   1 
ATOM   5278  C  CZ    . TYR C 2  214  ? -4.558  -47.815 53.940  1.00 48.98  ? 214  TYR C CZ    1 
ATOM   5279  O  OH    . TYR C 2  214  ? -3.566  -48.148 54.835  1.00 52.27  ? 214  TYR C OH    1 
ATOM   5280  N  N     . GLY C 2  215  ? -10.264 -48.107 49.080  1.00 87.93  ? 215  GLY C N     1 
ATOM   5281  C  CA    . GLY C 2  215  ? -10.871 -48.251 47.768  1.00 90.80  ? 215  GLY C CA    1 
ATOM   5282  C  C     . GLY C 2  215  ? -11.009 -47.011 46.906  1.00 93.65  ? 215  GLY C C     1 
ATOM   5283  O  O     . GLY C 2  215  ? -10.529 -46.980 45.772  1.00 92.09  ? 215  GLY C O     1 
ATOM   5284  N  N     . GLU C 2  216  ? -11.668 -45.989 47.439  1.00 93.34  ? 216  GLU C N     1 
ATOM   5285  C  CA    . GLU C 2  216  ? -12.013 -44.805 46.658  1.00 99.99  ? 216  GLU C CA    1 
ATOM   5286  C  C     . GLU C 2  216  ? -10.796 -43.946 46.311  1.00 103.37 ? 216  GLU C C     1 
ATOM   5287  O  O     . GLU C 2  216  ? -10.709 -43.377 45.221  1.00 103.09 ? 216  GLU C O     1 
ATOM   5288  C  CB    . GLU C 2  216  ? -13.054 -43.970 47.415  1.00 95.59  ? 216  GLU C CB    1 
ATOM   5289  C  CG    . GLU C 2  216  ? -13.396 -42.625 46.781  1.00 100.42 ? 216  GLU C CG    1 
ATOM   5290  C  CD    . GLU C 2  216  ? -14.410 -42.731 45.653  1.00 97.79  ? 216  GLU C CD    1 
ATOM   5291  O  OE1   . GLU C 2  216  ? -15.086 -41.720 45.372  1.00 86.91  ? 216  GLU C OE1   1 
ATOM   5292  O  OE2   . GLU C 2  216  ? -14.531 -43.816 45.045  1.00 100.84 ? 216  GLU C OE2   1 
ATOM   5293  N  N     . LEU C 2  217  ? -9.852  -43.880 47.241  1.00 98.44  ? 217  LEU C N     1 
ATOM   5294  C  CA    . LEU C 2  217  ? -8.742  -42.935 47.172  1.00 90.60  ? 217  LEU C CA    1 
ATOM   5295  C  C     . LEU C 2  217  ? -7.681  -43.306 46.128  1.00 86.55  ? 217  LEU C C     1 
ATOM   5296  O  O     . LEU C 2  217  ? -7.276  -42.471 45.304  1.00 82.09  ? 217  LEU C O     1 
ATOM   5297  C  CB    . LEU C 2  217  ? -8.102  -42.792 48.560  1.00 85.03  ? 217  LEU C CB    1 
ATOM   5298  C  CG    . LEU C 2  217  ? -9.052  -42.562 49.747  1.00 79.92  ? 217  LEU C CG    1 
ATOM   5299  C  CD1   . LEU C 2  217  ? -9.577  -43.871 50.335  1.00 70.83  ? 217  LEU C CD1   1 
ATOM   5300  C  CD2   . LEU C 2  217  ? -8.369  -41.751 50.833  1.00 67.76  ? 217  LEU C CD2   1 
ATOM   5301  N  N     . VAL C 2  218  ? -7.239  -44.560 46.162  1.00 87.30  ? 218  VAL C N     1 
ATOM   5302  C  CA    . VAL C 2  218  ? -6.189  -45.028 45.261  1.00 84.73  ? 218  VAL C CA    1 
ATOM   5303  C  C     . VAL C 2  218  ? -6.621  -44.916 43.798  1.00 89.85  ? 218  VAL C C     1 
ATOM   5304  O  O     . VAL C 2  218  ? -5.785  -44.760 42.909  1.00 86.68  ? 218  VAL C O     1 
ATOM   5305  C  CB    . VAL C 2  218  ? -5.741  -46.476 45.598  1.00 81.09  ? 218  VAL C CB    1 
ATOM   5306  C  CG1   . VAL C 2  218  ? -6.856  -47.471 45.311  1.00 87.76  ? 218  VAL C CG1   1 
ATOM   5307  C  CG2   . VAL C 2  218  ? -4.477  -46.843 44.832  1.00 77.37  ? 218  VAL C CG2   1 
ATOM   5308  N  N     . GLN C 2  219  ? -7.929  -44.974 43.557  1.00 96.57  ? 219  GLN C N     1 
ATOM   5309  C  CA    . GLN C 2  219  ? -8.466  -44.775 42.216  1.00 99.35  ? 219  GLN C CA    1 
ATOM   5310  C  C     . GLN C 2  219  ? -8.213  -43.340 41.770  1.00 95.83  ? 219  GLN C C     1 
ATOM   5311  O  O     . GLN C 2  219  ? -7.923  -43.083 40.601  1.00 92.99  ? 219  GLN C O     1 
ATOM   5312  C  CB    . GLN C 2  219  ? -9.964  -45.087 42.175  1.00 97.21  ? 219  GLN C CB    1 
ATOM   5313  C  CG    . GLN C 2  219  ? -10.350 -46.133 41.138  1.00 95.95  ? 219  GLN C CG    1 
ATOM   5314  C  CD    . GLN C 2  219  ? -9.870  -45.779 39.742  1.00 100.06 ? 219  GLN C CD    1 
ATOM   5315  O  OE1   . GLN C 2  219  ? -8.858  -46.298 39.269  1.00 103.57 ? 219  GLN C OE1   1 
ATOM   5316  N  NE2   . GLN C 2  219  ? -10.599 -44.893 39.073  1.00 84.50  ? 219  GLN C NE2   1 
ATOM   5317  N  N     . GLY C 2  220  ? -8.323  -42.411 42.715  1.00 96.32  ? 220  GLY C N     1 
ATOM   5318  C  CA    . GLY C 2  220  ? -8.006  -41.018 42.462  1.00 93.19  ? 220  GLY C CA    1 
ATOM   5319  C  C     . GLY C 2  220  ? -6.511  -40.812 42.313  1.00 89.18  ? 220  GLY C C     1 
ATOM   5320  O  O     . GLY C 2  220  ? -6.064  -39.836 41.708  1.00 76.71  ? 220  GLY C O     1 
ATOM   5321  N  N     . LEU C 2  221  ? -5.732  -41.732 42.876  1.00 90.15  ? 221  LEU C N     1 
ATOM   5322  C  CA    . LEU C 2  221  ? -4.281  -41.702 42.700  1.00 79.02  ? 221  LEU C CA    1 
ATOM   5323  C  C     . LEU C 2  221  ? -3.860  -42.130 41.289  1.00 86.12  ? 221  LEU C C     1 
ATOM   5324  O  O     . LEU C 2  221  ? -2.807  -41.721 40.799  1.00 82.73  ? 221  LEU C O     1 
ATOM   5325  C  CB    . LEU C 2  221  ? -3.592  -42.590 43.743  1.00 83.64  ? 221  LEU C CB    1 
ATOM   5326  C  CG    . LEU C 2  221  ? -2.070  -42.745 43.639  1.00 79.39  ? 221  LEU C CG    1 
ATOM   5327  C  CD1   . LEU C 2  221  ? -1.353  -41.505 44.142  1.00 74.35  ? 221  LEU C CD1   1 
ATOM   5328  C  CD2   . LEU C 2  221  ? -1.585  -43.985 44.370  1.00 72.29  ? 221  LEU C CD2   1 
ATOM   5329  N  N     . MET C 2  222  ? -4.693  -42.931 40.627  1.00 94.63  ? 222  MET C N     1 
ATOM   5330  C  CA    . MET C 2  222  ? -4.310  -43.544 39.354  1.00 90.15  ? 222  MET C CA    1 
ATOM   5331  C  C     . MET C 2  222  ? -4.389  -42.588 38.166  1.00 92.78  ? 222  MET C C     1 
ATOM   5332  O  O     . MET C 2  222  ? -5.454  -42.058 37.849  1.00 93.74  ? 222  MET C O     1 
ATOM   5333  C  CB    . MET C 2  222  ? -5.176  -44.776 39.066  1.00 86.47  ? 222  MET C CB    1 
ATOM   5334  C  CG    . MET C 2  222  ? -5.018  -45.913 40.064  1.00 93.34  ? 222  MET C CG    1 
ATOM   5335  S  SD    . MET C 2  222  ? -3.343  -46.574 40.131  1.00 90.82  ? 222  MET C SD    1 
ATOM   5336  C  CE    . MET C 2  222  ? -3.518  -47.821 41.403  1.00 85.63  ? 222  MET C CE    1 
ATOM   5337  N  N     . ASP C 2  223  ? -3.250  -42.377 37.514  1.00 94.28  ? 223  ASP C N     1 
ATOM   5338  C  CA    . ASP C 2  223  ? -3.195  -41.620 36.269  1.00 97.15  ? 223  ASP C CA    1 
ATOM   5339  C  C     . ASP C 2  223  ? -2.270  -42.333 35.287  1.00 101.80 ? 223  ASP C C     1 
ATOM   5340  O  O     . ASP C 2  223  ? -1.080  -42.499 35.556  1.00 98.32  ? 223  ASP C O     1 
ATOM   5341  C  CB    . ASP C 2  223  ? -2.711  -40.193 36.528  1.00 98.85  ? 223  ASP C CB    1 
ATOM   5342  C  CG    . ASP C 2  223  ? -2.925  -39.279 35.337  1.00 103.31 ? 223  ASP C CG    1 
ATOM   5343  O  OD1   . ASP C 2  223  ? -1.960  -39.049 34.580  1.00 100.08 ? 223  ASP C OD1   1 
ATOM   5344  O  OD2   . ASP C 2  223  ? -4.061  -38.790 35.160  1.00 104.23 ? 223  ASP C OD2   1 
ATOM   5345  N  N     . GLU C 2  224  ? -2.814  -42.746 34.146  1.00 106.87 ? 224  GLU C N     1 
ATOM   5346  C  CA    . GLU C 2  224  ? -2.059  -43.548 33.185  1.00 110.75 ? 224  GLU C CA    1 
ATOM   5347  C  C     . GLU C 2  224  ? -1.073  -42.727 32.355  1.00 106.22 ? 224  GLU C C     1 
ATOM   5348  O  O     . GLU C 2  224  ? -0.083  -43.261 31.853  1.00 100.87 ? 224  GLU C O     1 
ATOM   5349  C  CB    . GLU C 2  224  ? -2.998  -44.341 32.266  1.00 105.96 ? 224  GLU C CB    1 
ATOM   5350  C  CG    . GLU C 2  224  ? -4.030  -43.498 31.534  1.00 114.20 ? 224  GLU C CG    1 
ATOM   5351  C  CD    . GLU C 2  224  ? -5.243  -43.188 32.390  1.00 125.32 ? 224  GLU C CD    1 
ATOM   5352  O  OE1   . GLU C 2  224  ? -5.837  -44.137 32.945  1.00 117.62 ? 224  GLU C OE1   1 
ATOM   5353  O  OE2   . GLU C 2  224  ? -5.597  -41.996 32.515  1.00 127.58 ? 224  GLU C OE2   1 
ATOM   5354  N  N     . SER C 2  225  ? -1.343  -41.433 32.213  1.00 105.26 ? 225  SER C N     1 
ATOM   5355  C  CA    . SER C 2  225  ? -0.454  -40.554 31.460  1.00 100.12 ? 225  SER C CA    1 
ATOM   5356  C  C     . SER C 2  225  ? 0.898   -40.432 32.156  1.00 100.75 ? 225  SER C C     1 
ATOM   5357  O  O     . SER C 2  225  ? 1.918   -40.178 31.514  1.00 99.89  ? 225  SER C O     1 
ATOM   5358  C  CB    . SER C 2  225  ? -1.086  -39.172 31.264  1.00 89.84  ? 225  SER C CB    1 
ATOM   5359  O  OG    . SER C 2  225  ? -1.317  -38.527 32.503  1.00 89.54  ? 225  SER C OG    1 
ATOM   5360  N  N     . VAL C 2  226  ? 0.896   -40.615 33.473  1.00 104.16 ? 226  VAL C N     1 
ATOM   5361  C  CA    . VAL C 2  226  ? 2.122   -40.573 34.261  1.00 100.94 ? 226  VAL C CA    1 
ATOM   5362  C  C     . VAL C 2  226  ? 2.899   -41.886 34.171  1.00 98.53  ? 226  VAL C C     1 
ATOM   5363  O  O     . VAL C 2  226  ? 4.121   -41.882 34.021  1.00 96.50  ? 226  VAL C O     1 
ATOM   5364  C  CB    . VAL C 2  226  ? 1.827   -40.260 35.740  1.00 97.88  ? 226  VAL C CB    1 
ATOM   5365  C  CG1   . VAL C 2  226  ? 3.122   -40.156 36.531  1.00 84.16  ? 226  VAL C CG1   1 
ATOM   5366  C  CG2   . VAL C 2  226  ? 1.022   -38.975 35.856  1.00 93.44  ? 226  VAL C CG2   1 
ATOM   5367  N  N     . PHE C 2  227  ? 2.185   -43.005 34.256  1.00 98.71  ? 227  PHE C N     1 
ATOM   5368  C  CA    . PHE C 2  227  ? 2.819   -44.321 34.207  1.00 100.26 ? 227  PHE C CA    1 
ATOM   5369  C  C     . PHE C 2  227  ? 3.294   -44.676 32.802  1.00 98.23  ? 227  PHE C C     1 
ATOM   5370  O  O     . PHE C 2  227  ? 4.113   -45.579 32.623  1.00 90.63  ? 227  PHE C O     1 
ATOM   5371  C  CB    . PHE C 2  227  ? 1.878   -45.404 34.738  1.00 100.85 ? 227  PHE C CB    1 
ATOM   5372  C  CG    . PHE C 2  227  ? 1.625   -45.313 36.214  1.00 105.87 ? 227  PHE C CG    1 
ATOM   5373  C  CD1   . PHE C 2  227  ? 2.644   -45.558 37.119  1.00 97.47  ? 227  PHE C CD1   1 
ATOM   5374  C  CD2   . PHE C 2  227  ? 0.368   -44.989 36.696  1.00 106.11 ? 227  PHE C CD2   1 
ATOM   5375  C  CE1   . PHE C 2  227  ? 2.418   -45.473 38.478  1.00 91.09  ? 227  PHE C CE1   1 
ATOM   5376  C  CE2   . PHE C 2  227  ? 0.133   -44.904 38.055  1.00 99.90  ? 227  PHE C CE2   1 
ATOM   5377  C  CZ    . PHE C 2  227  ? 1.159   -45.148 38.947  1.00 97.20  ? 227  PHE C CZ    1 
ATOM   5378  N  N     . ALA C 2  228  ? 2.776   -43.960 31.809  1.00 95.66  ? 228  ALA C N     1 
ATOM   5379  C  CA    . ALA C 2  228  ? 3.211   -44.142 30.431  1.00 97.62  ? 228  ALA C CA    1 
ATOM   5380  C  C     . ALA C 2  228  ? 4.580   -43.505 30.225  1.00 97.38  ? 228  ALA C C     1 
ATOM   5381  O  O     . ALA C 2  228  ? 5.207   -43.679 29.180  1.00 96.78  ? 228  ALA C O     1 
ATOM   5382  C  CB    . ALA C 2  228  ? 2.195   -43.545 29.471  1.00 92.54  ? 228  ALA C CB    1 
ATOM   5383  N  N     . MET C 2  229  ? 5.038   -42.767 31.232  1.00 99.01  ? 229  MET C N     1 
ATOM   5384  C  CA    . MET C 2  229  ? 6.334   -42.104 31.179  1.00 98.73  ? 229  MET C CA    1 
ATOM   5385  C  C     . MET C 2  229  ? 7.426   -42.953 31.823  1.00 92.64  ? 229  MET C C     1 
ATOM   5386  O  O     . MET C 2  229  ? 7.178   -44.061 32.299  1.00 92.31  ? 229  MET C O     1 
ATOM   5387  C  CB    . MET C 2  229  ? 6.271   -40.745 31.882  1.00 96.75  ? 229  MET C CB    1 
ATOM   5388  C  CG    . MET C 2  229  ? 5.185   -39.812 31.375  1.00 93.87  ? 229  MET C CG    1 
ATOM   5389  S  SD    . MET C 2  229  ? 5.155   -38.258 32.291  1.00 85.78  ? 229  MET C SD    1 
ATOM   5390  C  CE    . MET C 2  229  ? 3.775   -37.422 31.514  1.00 80.13  ? 229  MET C CE    1 
ATOM   5391  N  N     . ARG C 2  230  ? 8.637   -42.408 31.834  1.00 93.50  ? 230  ARG C N     1 
ATOM   5392  C  CA    . ARG C 2  230  ? 9.780   -43.032 32.482  1.00 99.29  ? 230  ARG C CA    1 
ATOM   5393  C  C     . ARG C 2  230  ? 10.236  -42.110 33.607  1.00 98.19  ? 230  ARG C C     1 
ATOM   5394  O  O     . ARG C 2  230  ? 9.925   -40.919 33.586  1.00 97.37  ? 230  ARG C O     1 
ATOM   5395  C  CB    . ARG C 2  230  ? 10.911  -43.233 31.469  1.00 102.20 ? 230  ARG C CB    1 
ATOM   5396  C  CG    . ARG C 2  230  ? 10.984  -44.631 30.869  1.00 104.82 ? 230  ARG C CG    1 
ATOM   5397  C  CD    . ARG C 2  230  ? 11.816  -45.557 31.745  1.00 112.08 ? 230  ARG C CD    1 
ATOM   5398  N  NE    . ARG C 2  230  ? 11.927  -46.903 31.192  1.00 117.77 ? 230  ARG C NE    1 
ATOM   5399  C  CZ    . ARG C 2  230  ? 11.234  -47.950 31.627  1.00 116.67 ? 230  ARG C CZ    1 
ATOM   5400  N  NH1   . ARG C 2  230  ? 10.376  -47.810 32.629  1.00 111.08 ? 230  ARG C NH1   1 
ATOM   5401  N  NH2   . ARG C 2  230  ? 11.401  -49.139 31.064  1.00 116.29 ? 230  ARG C NH2   1 
ATOM   5402  N  N     . PRO C 2  231  ? 10.949  -42.660 34.606  1.00 92.22  ? 231  PRO C N     1 
ATOM   5403  C  CA    . PRO C 2  231  ? 11.505  -41.855 35.700  1.00 90.40  ? 231  PRO C CA    1 
ATOM   5404  C  C     . PRO C 2  231  ? 12.232  -40.602 35.207  1.00 98.17  ? 231  PRO C C     1 
ATOM   5405  O  O     . PRO C 2  231  ? 12.121  -39.553 35.839  1.00 94.78  ? 231  PRO C O     1 
ATOM   5406  C  CB    . PRO C 2  231  ? 12.501  -42.813 36.373  1.00 93.04  ? 231  PRO C CB    1 
ATOM   5407  C  CG    . PRO C 2  231  ? 12.319  -44.168 35.690  1.00 91.70  ? 231  PRO C CG    1 
ATOM   5408  C  CD    . PRO C 2  231  ? 11.058  -44.096 34.897  1.00 88.66  ? 231  PRO C CD    1 
ATOM   5409  N  N     . GLU C 2  232  ? 12.948  -40.710 34.091  1.00 102.71 ? 232  GLU C N     1 
ATOM   5410  C  CA    . GLU C 2  232  ? 13.598  -39.552 33.482  1.00 100.43 ? 232  GLU C CA    1 
ATOM   5411  C  C     . GLU C 2  232  ? 12.572  -38.547 32.964  1.00 95.83  ? 232  GLU C C     1 
ATOM   5412  O  O     . GLU C 2  232  ? 12.625  -37.362 33.299  1.00 96.49  ? 232  GLU C O     1 
ATOM   5413  C  CB    . GLU C 2  232  ? 14.522  -39.984 32.338  1.00 103.53 ? 232  GLU C CB    1 
ATOM   5414  C  CG    . GLU C 2  232  ? 15.970  -40.228 32.745  1.00 108.64 ? 232  GLU C CG    1 
ATOM   5415  C  CD    . GLU C 2  232  ? 16.160  -41.515 33.527  1.00 113.63 ? 232  GLU C CD    1 
ATOM   5416  O  OE1   . GLU C 2  232  ? 15.206  -42.318 33.606  1.00 114.83 ? 232  GLU C OE1   1 
ATOM   5417  O  OE2   . GLU C 2  232  ? 17.270  -41.723 34.063  1.00 104.41 ? 232  GLU C OE2   1 
ATOM   5418  N  N     . GLU C 2  233  ? 11.642  -39.030 32.145  1.00 96.07  ? 233  GLU C N     1 
ATOM   5419  C  CA    . GLU C 2  233  ? 10.620  -38.178 31.545  1.00 96.82  ? 233  GLU C CA    1 
ATOM   5420  C  C     . GLU C 2  233  ? 9.729   -37.547 32.611  1.00 96.40  ? 233  GLU C C     1 
ATOM   5421  O  O     . GLU C 2  233  ? 9.348   -36.380 32.506  1.00 93.80  ? 233  GLU C O     1 
ATOM   5422  C  CB    . GLU C 2  233  ? 9.771   -38.978 30.553  1.00 103.77 ? 233  GLU C CB    1 
ATOM   5423  C  CG    . GLU C 2  233  ? 10.581  -39.698 29.482  1.00 104.24 ? 233  GLU C CG    1 
ATOM   5424  C  CD    . GLU C 2  233  ? 9.711   -40.466 28.503  1.00 97.92  ? 233  GLU C CD    1 
ATOM   5425  O  OE1   . GLU C 2  233  ? 8.572   -40.026 28.240  1.00 88.82  ? 233  GLU C OE1   1 
ATOM   5426  O  OE2   . GLU C 2  233  ? 10.168  -41.514 28.000  1.00 96.73  ? 233  GLU C OE2   1 
ATOM   5427  N  N     . ALA C 2  234  ? 9.404   -38.325 33.639  1.00 98.97  ? 234  ALA C N     1 
ATOM   5428  C  CA    . ALA C 2  234  ? 8.602   -37.828 34.749  1.00 92.99  ? 234  ALA C CA    1 
ATOM   5429  C  C     . ALA C 2  234  ? 9.376   -36.776 35.535  1.00 91.08  ? 234  ALA C C     1 
ATOM   5430  O  O     . ALA C 2  234  ? 8.815   -35.760 35.947  1.00 86.13  ? 234  ALA C O     1 
ATOM   5431  C  CB    . ALA C 2  234  ? 8.180   -38.972 35.658  1.00 85.93  ? 234  ALA C CB    1 
ATOM   5432  N  N     . LEU C 2  235  ? 10.669  -37.026 35.733  1.00 92.70  ? 235  LEU C N     1 
ATOM   5433  C  CA    . LEU C 2  235  ? 11.538  -36.086 36.434  1.00 87.04  ? 235  LEU C CA    1 
ATOM   5434  C  C     . LEU C 2  235  ? 11.585  -34.746 35.715  1.00 84.56  ? 235  LEU C C     1 
ATOM   5435  O  O     . LEU C 2  235  ? 11.431  -33.691 36.332  1.00 85.91  ? 235  LEU C O     1 
ATOM   5436  C  CB    . LEU C 2  235  ? 12.953  -36.653 36.558  1.00 82.43  ? 235  LEU C CB    1 
ATOM   5437  C  CG    . LEU C 2  235  ? 14.019  -35.723 37.138  1.00 86.67  ? 235  LEU C CG    1 
ATOM   5438  C  CD1   . LEU C 2  235  ? 13.637  -35.284 38.537  1.00 89.32  ? 235  LEU C CD1   1 
ATOM   5439  C  CD2   . LEU C 2  235  ? 15.375  -36.406 37.145  1.00 76.70  ? 235  LEU C CD2   1 
ATOM   5440  N  N     . ILE C 2  236  ? 11.795  -34.798 34.404  1.00 87.22  ? 236  ILE C N     1 
ATOM   5441  C  CA    . ILE C 2  236  ? 11.873  -33.594 33.586  1.00 88.95  ? 236  ILE C CA    1 
ATOM   5442  C  C     . ILE C 2  236  ? 10.517  -32.884 33.520  1.00 83.00  ? 236  ILE C C     1 
ATOM   5443  O  O     . ILE C 2  236  ? 10.449  -31.653 33.462  1.00 74.78  ? 236  ILE C O     1 
ATOM   5444  C  CB    . ILE C 2  236  ? 12.408  -33.920 32.171  1.00 87.97  ? 236  ILE C CB    1 
ATOM   5445  C  CG1   . ILE C 2  236  ? 13.809  -34.535 32.271  1.00 77.68  ? 236  ILE C CG1   1 
ATOM   5446  C  CG2   . ILE C 2  236  ? 12.440  -32.679 31.301  1.00 81.90  ? 236  ILE C CG2   1 
ATOM   5447  C  CD1   . ILE C 2  236  ? 14.414  -34.921 30.941  1.00 80.72  ? 236  ILE C CD1   1 
ATOM   5448  N  N     . ARG C 2  237  ? 9.440   -33.665 33.553  1.00 81.70  ? 237  ARG C N     1 
ATOM   5449  C  CA    . ARG C 2  237  ? 8.092   -33.108 33.593  1.00 76.52  ? 237  ARG C CA    1 
ATOM   5450  C  C     . ARG C 2  237  ? 7.881   -32.313 34.879  1.00 80.90  ? 237  ARG C C     1 
ATOM   5451  O  O     . ARG C 2  237  ? 7.402   -31.174 34.852  1.00 87.87  ? 237  ARG C O     1 
ATOM   5452  C  CB    . ARG C 2  237  ? 7.052   -34.223 33.484  1.00 79.66  ? 237  ARG C CB    1 
ATOM   5453  C  CG    . ARG C 2  237  ? 5.614   -33.760 33.664  1.00 87.82  ? 237  ARG C CG    1 
ATOM   5454  C  CD    . ARG C 2  237  ? 5.222   -32.719 32.627  1.00 82.77  ? 237  ARG C CD    1 
ATOM   5455  N  NE    . ARG C 2  237  ? 3.828   -32.309 32.774  1.00 78.64  ? 237  ARG C NE    1 
ATOM   5456  C  CZ    . ARG C 2  237  ? 3.240   -31.377 32.031  1.00 82.08  ? 237  ARG C CZ    1 
ATOM   5457  N  NH1   . ARG C 2  237  ? 1.966   -31.069 32.234  1.00 73.50  ? 237  ARG C NH1   1 
ATOM   5458  N  NH2   . ARG C 2  237  ? 3.927   -30.751 31.085  1.00 87.82  ? 237  ARG C NH2   1 
ATOM   5459  N  N     . LEU C 2  238  ? 8.249   -32.921 36.002  1.00 76.91  ? 238  LEU C N     1 
ATOM   5460  C  CA    . LEU C 2  238  ? 8.155   -32.263 37.299  1.00 78.48  ? 238  LEU C CA    1 
ATOM   5461  C  C     . LEU C 2  238  ? 9.021   -31.008 37.341  1.00 85.36  ? 238  LEU C C     1 
ATOM   5462  O  O     . LEU C 2  238  ? 8.618   -29.986 37.898  1.00 82.56  ? 238  LEU C O     1 
ATOM   5463  C  CB    . LEU C 2  238  ? 8.560   -33.224 38.420  1.00 77.02  ? 238  LEU C CB    1 
ATOM   5464  C  CG    . LEU C 2  238  ? 8.608   -32.637 39.833  1.00 77.35  ? 238  LEU C CG    1 
ATOM   5465  C  CD1   . LEU C 2  238  ? 7.286   -31.974 40.184  1.00 73.28  ? 238  LEU C CD1   1 
ATOM   5466  C  CD2   . LEU C 2  238  ? 8.961   -33.709 40.852  1.00 63.36  ? 238  LEU C CD2   1 
ATOM   5467  N  N     . PHE C 2  239  ? 10.209  -31.091 36.746  1.00 86.41  ? 239  PHE C N     1 
ATOM   5468  C  CA    . PHE C 2  239  ? 11.123  -29.954 36.690  1.00 78.22  ? 239  PHE C CA    1 
ATOM   5469  C  C     . PHE C 2  239  ? 10.518  -28.804 35.895  1.00 78.36  ? 239  PHE C C     1 
ATOM   5470  O  O     . PHE C 2  239  ? 10.664  -27.640 36.267  1.00 75.13  ? 239  PHE C O     1 
ATOM   5471  C  CB    . PHE C 2  239  ? 12.466  -30.367 36.083  1.00 72.64  ? 239  PHE C CB    1 
ATOM   5472  C  CG    . PHE C 2  239  ? 13.482  -29.260 36.047  1.00 73.02  ? 239  PHE C CG    1 
ATOM   5473  C  CD1   . PHE C 2  239  ? 13.707  -28.544 34.884  1.00 82.66  ? 239  PHE C CD1   1 
ATOM   5474  C  CD2   . PHE C 2  239  ? 14.209  -28.933 37.179  1.00 77.88  ? 239  PHE C CD2   1 
ATOM   5475  C  CE1   . PHE C 2  239  ? 14.641  -27.525 34.849  1.00 83.18  ? 239  PHE C CE1   1 
ATOM   5476  C  CE2   . PHE C 2  239  ? 15.146  -27.917 37.149  1.00 78.50  ? 239  PHE C CE2   1 
ATOM   5477  C  CZ    . PHE C 2  239  ? 15.361  -27.212 35.983  1.00 77.89  ? 239  PHE C CZ    1 
ATOM   5478  N  N     . THR C 2  240  ? 9.838   -29.136 34.801  1.00 83.13  ? 240  THR C N     1 
ATOM   5479  C  CA    . THR C 2  240  ? 9.151   -28.127 34.000  1.00 84.74  ? 240  THR C CA    1 
ATOM   5480  C  C     . THR C 2  240  ? 7.962   -27.546 34.758  1.00 83.28  ? 240  THR C C     1 
ATOM   5481  O  O     . THR C 2  240  ? 7.576   -26.398 34.534  1.00 79.78  ? 240  THR C O     1 
ATOM   5482  C  CB    . THR C 2  240  ? 8.665   -28.692 32.650  1.00 87.28  ? 240  THR C CB    1 
ATOM   5483  O  OG1   . THR C 2  240  ? 7.887   -29.875 32.873  1.00 93.46  ? 240  THR C OG1   1 
ATOM   5484  C  CG2   . THR C 2  240  ? 9.845   -29.028 31.752  1.00 80.67  ? 240  THR C CG2   1 
ATOM   5485  N  N     . LEU C 2  241  ? 7.383   -28.342 35.652  1.00 82.88  ? 241  LEU C N     1 
ATOM   5486  C  CA    . LEU C 2  241  ? 6.269   -27.870 36.470  1.00 79.37  ? 241  LEU C CA    1 
ATOM   5487  C  C     . LEU C 2  241  ? 6.717   -26.917 37.576  1.00 84.75  ? 241  LEU C C     1 
ATOM   5488  O  O     . LEU C 2  241  ? 6.028   -25.942 37.880  1.00 88.38  ? 241  LEU C O     1 
ATOM   5489  C  CB    . LEU C 2  241  ? 5.495   -29.044 37.071  1.00 75.26  ? 241  LEU C CB    1 
ATOM   5490  C  CG    . LEU C 2  241  ? 4.678   -29.879 36.086  1.00 73.97  ? 241  LEU C CG    1 
ATOM   5491  C  CD1   . LEU C 2  241  ? 3.715   -30.781 36.832  1.00 79.90  ? 241  LEU C CD1   1 
ATOM   5492  C  CD2   . LEU C 2  241  ? 3.933   -28.982 35.113  1.00 73.32  ? 241  LEU C CD2   1 
ATOM   5493  N  N     . LEU C 2  242  ? 7.862   -27.208 38.184  1.00 85.52  ? 242  LEU C N     1 
ATOM   5494  C  CA    . LEU C 2  242  ? 8.387   -26.373 39.262  1.00 91.30  ? 242  LEU C CA    1 
ATOM   5495  C  C     . LEU C 2  242  ? 9.233   -25.203 38.755  1.00 92.88  ? 242  LEU C C     1 
ATOM   5496  O  O     . LEU C 2  242  ? 9.487   -24.250 39.493  1.00 89.67  ? 242  LEU C O     1 
ATOM   5497  C  CB    . LEU C 2  242  ? 9.206   -27.217 40.244  1.00 82.15  ? 242  LEU C CB    1 
ATOM   5498  C  CG    . LEU C 2  242  ? 8.494   -28.394 40.914  1.00 81.84  ? 242  LEU C CG    1 
ATOM   5499  C  CD1   . LEU C 2  242  ? 9.458   -29.163 41.805  1.00 75.83  ? 242  LEU C CD1   1 
ATOM   5500  C  CD2   . LEU C 2  242  ? 7.286   -27.921 41.707  1.00 76.18  ? 242  LEU C CD2   1 
ATOM   5501  N  N     . ARG C 2  243  ? 9.663   -25.273 37.498  1.00 96.69  ? 243  ARG C N     1 
ATOM   5502  C  CA    . ARG C 2  243  ? 10.544  -24.251 36.934  1.00 94.53  ? 243  ARG C CA    1 
ATOM   5503  C  C     . ARG C 2  243  ? 10.116  -23.837 35.529  1.00 91.42  ? 243  ARG C C     1 
ATOM   5504  O  O     . ARG C 2  243  ? 10.685  -24.306 34.542  1.00 90.02  ? 243  ARG C O     1 
ATOM   5505  C  CB    . ARG C 2  243  ? 11.994  -24.750 36.896  1.00 90.79  ? 243  ARG C CB    1 
ATOM   5506  C  CG    . ARG C 2  243  ? 12.542  -25.233 38.233  1.00 89.17  ? 243  ARG C CG    1 
ATOM   5507  C  CD    . ARG C 2  243  ? 12.784  -24.082 39.195  1.00 90.48  ? 243  ARG C CD    1 
ATOM   5508  N  NE    . ARG C 2  243  ? 13.921  -23.261 38.791  1.00 95.45  ? 243  ARG C NE    1 
ATOM   5509  C  CZ    . ARG C 2  243  ? 14.423  -22.269 39.519  1.00 87.49  ? 243  ARG C CZ    1 
ATOM   5510  N  NH1   . ARG C 2  243  ? 15.461  -21.576 39.072  1.00 75.19  ? 243  ARG C NH1   1 
ATOM   5511  N  NH2   . ARG C 2  243  ? 13.887  -21.971 40.695  1.00 84.35  ? 243  ARG C NH2   1 
ATOM   5512  N  N     . PRO C 2  244  ? 9.107   -22.957 35.431  1.00 92.75  ? 244  PRO C N     1 
ATOM   5513  C  CA    . PRO C 2  244  ? 8.664   -22.452 34.128  1.00 88.72  ? 244  PRO C CA    1 
ATOM   5514  C  C     . PRO C 2  244  ? 9.742   -21.599 33.465  1.00 90.15  ? 244  PRO C C     1 
ATOM   5515  O  O     . PRO C 2  244  ? 10.314  -20.722 34.111  1.00 86.42  ? 244  PRO C O     1 
ATOM   5516  C  CB    . PRO C 2  244  ? 7.455   -21.576 34.484  1.00 75.40  ? 244  PRO C CB    1 
ATOM   5517  C  CG    . PRO C 2  244  ? 7.017   -22.042 35.833  1.00 74.31  ? 244  PRO C CG    1 
ATOM   5518  C  CD    . PRO C 2  244  ? 8.273   -22.447 36.532  1.00 87.43  ? 244  PRO C CD    1 
ATOM   5519  N  N     . GLY C 2  245  ? 10.019  -21.866 32.193  1.00 93.97  ? 245  GLY C N     1 
ATOM   5520  C  CA    . GLY C 2  245  ? 10.960  -21.065 31.430  1.00 102.74 ? 245  GLY C CA    1 
ATOM   5521  C  C     . GLY C 2  245  ? 12.396  -21.535 31.557  1.00 96.75  ? 245  GLY C C     1 
ATOM   5522  O  O     . GLY C 2  245  ? 13.233  -21.245 30.702  1.00 96.53  ? 245  GLY C O     1 
ATOM   5523  N  N     . ASP C 2  246  ? 12.681  -22.266 32.629  1.00 92.41  ? 246  ASP C N     1 
ATOM   5524  C  CA    . ASP C 2  246  ? 14.019  -22.790 32.871  1.00 96.70  ? 246  ASP C CA    1 
ATOM   5525  C  C     . ASP C 2  246  ? 14.225  -24.028 32.005  1.00 97.36  ? 246  ASP C C     1 
ATOM   5526  O  O     . ASP C 2  246  ? 13.407  -24.950 32.041  1.00 93.40  ? 246  ASP C O     1 
ATOM   5527  C  CB    . ASP C 2  246  ? 14.180  -23.137 34.355  1.00 99.10  ? 246  ASP C CB    1 
ATOM   5528  C  CG    . ASP C 2  246  ? 15.628  -23.121 34.811  1.00 95.78  ? 246  ASP C CG    1 
ATOM   5529  O  OD1   . ASP C 2  246  ? 16.497  -23.629 34.075  1.00 98.08  ? 246  ASP C OD1   1 
ATOM   5530  O  OD2   . ASP C 2  246  ? 15.898  -22.598 35.914  1.00 91.76  ? 246  ASP C OD2   1 
ATOM   5531  N  N     . PRO C 2  247  ? 15.311  -24.047 31.209  1.00 97.25  ? 247  PRO C N     1 
ATOM   5532  C  CA    . PRO C 2  247  ? 15.585  -25.175 30.309  1.00 95.49  ? 247  PRO C CA    1 
ATOM   5533  C  C     . PRO C 2  247  ? 15.620  -26.515 31.038  1.00 90.64  ? 247  PRO C C     1 
ATOM   5534  O  O     . PRO C 2  247  ? 16.342  -26.663 32.024  1.00 90.91  ? 247  PRO C O     1 
ATOM   5535  C  CB    . PRO C 2  247  ? 16.970  -24.841 29.731  1.00 94.04  ? 247  PRO C CB    1 
ATOM   5536  C  CG    . PRO C 2  247  ? 17.514  -23.732 30.594  1.00 91.33  ? 247  PRO C CG    1 
ATOM   5537  C  CD    . PRO C 2  247  ? 16.314  -22.981 31.064  1.00 93.01  ? 247  PRO C CD    1 
ATOM   5538  N  N     . PRO C 2  248  ? 14.845  -27.490 30.542  1.00 90.23  ? 248  PRO C N     1 
ATOM   5539  C  CA    . PRO C 2  248  ? 14.671  -28.804 31.167  1.00 87.86  ? 248  PRO C CA    1 
ATOM   5540  C  C     . PRO C 2  248  ? 15.813  -29.770 30.865  1.00 88.38  ? 248  PRO C C     1 
ATOM   5541  O  O     . PRO C 2  248  ? 15.563  -30.872 30.375  1.00 88.79  ? 248  PRO C O     1 
ATOM   5542  C  CB    . PRO C 2  248  ? 13.372  -29.325 30.532  1.00 83.71  ? 248  PRO C CB    1 
ATOM   5543  C  CG    . PRO C 2  248  ? 12.758  -28.145 29.824  1.00 81.32  ? 248  PRO C CG    1 
ATOM   5544  C  CD    . PRO C 2  248  ? 13.910  -27.297 29.423  1.00 93.20  ? 248  PRO C CD    1 
ATOM   5545  N  N     . LYS C 2  249  ? 17.046  -29.367 31.154  1.00 82.75  ? 249  LYS C N     1 
ATOM   5546  C  CA    . LYS C 2  249  ? 18.189  -30.253 30.979  1.00 84.66  ? 249  LYS C CA    1 
ATOM   5547  C  C     . LYS C 2  249  ? 18.111  -31.367 32.015  1.00 85.96  ? 249  LYS C C     1 
ATOM   5548  O  O     . LYS C 2  249  ? 17.589  -31.162 33.110  1.00 86.72  ? 249  LYS C O     1 
ATOM   5549  C  CB    . LYS C 2  249  ? 19.501  -29.479 31.117  1.00 91.86  ? 249  LYS C CB    1 
ATOM   5550  C  CG    . LYS C 2  249  ? 20.717  -30.202 30.556  1.00 85.46  ? 249  LYS C CG    1 
ATOM   5551  C  CD    . LYS C 2  249  ? 21.949  -29.309 30.591  1.00 92.45  ? 249  LYS C CD    1 
ATOM   5552  C  CE    . LYS C 2  249  ? 23.140  -29.971 29.913  1.00 88.22  ? 249  LYS C CE    1 
ATOM   5553  N  NZ    . LYS C 2  249  ? 22.895  -30.220 28.465  1.00 79.54  ? 249  LYS C NZ    1 
ATOM   5554  N  N     . ARG C 2  250  ? 18.622  -32.543 31.667  1.00 89.09  ? 250  ARG C N     1 
ATOM   5555  C  CA    . ARG C 2  250  ? 18.510  -33.715 32.532  1.00 88.12  ? 250  ARG C CA    1 
ATOM   5556  C  C     . ARG C 2  250  ? 19.283  -33.544 33.841  1.00 88.74  ? 250  ARG C C     1 
ATOM   5557  O  O     . ARG C 2  250  ? 18.722  -33.709 34.928  1.00 94.81  ? 250  ARG C O     1 
ATOM   5558  C  CB    . ARG C 2  250  ? 18.971  -34.974 31.789  1.00 91.44  ? 250  ARG C CB    1 
ATOM   5559  C  CG    . ARG C 2  250  ? 18.619  -36.290 32.473  1.00 85.22  ? 250  ARG C CG    1 
ATOM   5560  C  CD    . ARG C 2  250  ? 19.768  -36.808 33.325  1.00 86.04  ? 250  ARG C CD    1 
ATOM   5561  N  NE    . ARG C 2  250  ? 19.508  -38.145 33.849  1.00 83.38  ? 250  ARG C NE    1 
ATOM   5562  C  CZ    . ARG C 2  250  ? 20.355  -38.822 34.618  1.00 76.45  ? 250  ARG C CZ    1 
ATOM   5563  N  NH1   . ARG C 2  250  ? 21.519  -38.286 34.958  1.00 63.19  ? 250  ARG C NH1   1 
ATOM   5564  N  NH2   . ARG C 2  250  ? 20.037  -40.035 35.049  1.00 82.26  ? 250  ARG C NH2   1 
ATOM   5565  N  N     . ASP C 2  251  ? 20.567  -33.212 33.733  1.00 87.12  ? 251  ASP C N     1 
ATOM   5566  C  CA    . ASP C 2  251  ? 21.414  -33.042 34.911  1.00 89.52  ? 251  ASP C CA    1 
ATOM   5567  C  C     . ASP C 2  251  ? 20.958  -31.884 35.802  1.00 90.68  ? 251  ASP C C     1 
ATOM   5568  O  O     . ASP C 2  251  ? 21.154  -31.913 37.020  1.00 89.24  ? 251  ASP C O     1 
ATOM   5569  C  CB    . ASP C 2  251  ? 22.884  -32.874 34.509  1.00 88.87  ? 251  ASP C CB    1 
ATOM   5570  C  CG    . ASP C 2  251  ? 23.072  -31.871 33.388  1.00 90.02  ? 251  ASP C CG    1 
ATOM   5571  O  OD1   . ASP C 2  251  ? 23.042  -32.286 32.210  1.00 90.18  ? 251  ASP C OD1   1 
ATOM   5572  O  OD2   . ASP C 2  251  ? 23.252  -30.671 33.684  1.00 87.80  ? 251  ASP C OD2   1 
ATOM   5573  N  N     . LYS C 2  252  ? 20.342  -30.873 35.196  1.00 89.51  ? 252  LYS C N     1 
ATOM   5574  C  CA    . LYS C 2  252  ? 19.819  -29.742 35.955  1.00 86.69  ? 252  LYS C CA    1 
ATOM   5575  C  C     . LYS C 2  252  ? 18.561  -30.129 36.734  1.00 85.53  ? 252  LYS C C     1 
ATOM   5576  O  O     . LYS C 2  252  ? 18.355  -29.679 37.862  1.00 82.07  ? 252  LYS C O     1 
ATOM   5577  C  CB    . LYS C 2  252  ? 19.531  -28.551 35.038  1.00 79.05  ? 252  LYS C CB    1 
ATOM   5578  C  CG    . LYS C 2  252  ? 19.164  -27.286 35.796  1.00 93.06  ? 252  LYS C CG    1 
ATOM   5579  C  CD    . LYS C 2  252  ? 19.084  -26.075 34.883  1.00 95.34  ? 252  LYS C CD    1 
ATOM   5580  C  CE    . LYS C 2  252  ? 18.949  -24.797 35.697  1.00 89.16  ? 252  LYS C CE    1 
ATOM   5581  N  NZ    . LYS C 2  252  ? 18.833  -23.591 34.833  1.00 92.81  ? 252  LYS C NZ    1 
ATOM   5582  N  N     . ALA C 2  253  ? 17.726  -30.965 36.124  1.00 83.72  ? 253  ALA C N     1 
ATOM   5583  C  CA    . ALA C 2  253  ? 16.525  -31.468 36.782  1.00 75.39  ? 253  ALA C CA    1 
ATOM   5584  C  C     . ALA C 2  253  ? 16.901  -32.378 37.942  1.00 78.70  ? 253  ALA C C     1 
ATOM   5585  O  O     . ALA C 2  253  ? 16.336  -32.274 39.037  1.00 81.47  ? 253  ALA C O     1 
ATOM   5586  C  CB    . ALA C 2  253  ? 15.642  -32.205 35.792  1.00 74.08  ? 253  ALA C CB    1 
ATOM   5587  N  N     . VAL C 2  254  ? 17.857  -33.271 37.694  1.00 78.11  ? 254  VAL C N     1 
ATOM   5588  C  CA    . VAL C 2  254  ? 18.393  -34.129 38.745  1.00 84.39  ? 254  VAL C CA    1 
ATOM   5589  C  C     . VAL C 2  254  ? 18.938  -33.275 39.885  1.00 86.89  ? 254  VAL C C     1 
ATOM   5590  O  O     . VAL C 2  254  ? 18.658  -33.538 41.054  1.00 84.10  ? 254  VAL C O     1 
ATOM   5591  C  CB    . VAL C 2  254  ? 19.512  -35.054 38.220  1.00 83.18  ? 254  VAL C CB    1 
ATOM   5592  C  CG1   . VAL C 2  254  ? 20.164  -35.813 39.369  1.00 75.55  ? 254  VAL C CG1   1 
ATOM   5593  C  CG2   . VAL C 2  254  ? 18.964  -36.021 37.184  1.00 81.00  ? 254  VAL C CG2   1 
ATOM   5594  N  N     . ALA C 2  255  ? 19.700  -32.243 39.533  1.00 84.76  ? 255  ALA C N     1 
ATOM   5595  C  CA    . ALA C 2  255  ? 20.258  -31.323 40.520  1.00 77.53  ? 255  ALA C CA    1 
ATOM   5596  C  C     . ALA C 2  255  ? 19.171  -30.676 41.379  1.00 82.61  ? 255  ALA C C     1 
ATOM   5597  O  O     . ALA C 2  255  ? 19.254  -30.685 42.610  1.00 83.59  ? 255  ALA C O     1 
ATOM   5598  C  CB    . ALA C 2  255  ? 21.099  -30.256 39.835  1.00 71.33  ? 255  ALA C CB    1 
ATOM   5599  N  N     . TYR C 2  256  ? 18.151  -30.124 40.726  1.00 81.43  ? 256  TYR C N     1 
ATOM   5600  C  CA    . TYR C 2  256  ? 17.075  -29.432 41.433  1.00 75.68  ? 256  TYR C CA    1 
ATOM   5601  C  C     . TYR C 2  256  ? 16.287  -30.360 42.350  1.00 74.90  ? 256  TYR C C     1 
ATOM   5602  O  O     . TYR C 2  256  ? 16.078  -30.045 43.521  1.00 76.08  ? 256  TYR C O     1 
ATOM   5603  C  CB    . TYR C 2  256  ? 16.124  -28.738 40.455  1.00 73.43  ? 256  TYR C CB    1 
ATOM   5604  C  CG    . TYR C 2  256  ? 15.043  -27.924 41.136  1.00 68.73  ? 256  TYR C CG    1 
ATOM   5605  C  CD1   . TYR C 2  256  ? 15.271  -26.606 41.508  1.00 75.98  ? 256  TYR C CD1   1 
ATOM   5606  C  CD2   . TYR C 2  256  ? 13.796  -28.474 41.408  1.00 70.76  ? 256  TYR C CD2   1 
ATOM   5607  C  CE1   . TYR C 2  256  ? 14.289  -25.857 42.131  1.00 81.44  ? 256  TYR C CE1   1 
ATOM   5608  C  CE2   . TYR C 2  256  ? 12.808  -27.734 42.032  1.00 74.56  ? 256  TYR C CE2   1 
ATOM   5609  C  CZ    . TYR C 2  256  ? 13.060  -26.427 42.390  1.00 76.65  ? 256  TYR C CZ    1 
ATOM   5610  O  OH    . TYR C 2  256  ? 12.079  -25.686 43.011  1.00 67.46  ? 256  TYR C OH    1 
ATOM   5611  N  N     . VAL C 2  257  ? 15.840  -31.494 41.819  1.00 70.43  ? 257  VAL C N     1 
ATOM   5612  C  CA    . VAL C 2  257  ? 15.052  -32.427 42.621  1.00 68.89  ? 257  VAL C CA    1 
ATOM   5613  C  C     . VAL C 2  257  ? 15.866  -33.006 43.778  1.00 69.36  ? 257  VAL C C     1 
ATOM   5614  O  O     . VAL C 2  257  ? 15.353  -33.158 44.888  1.00 67.11  ? 257  VAL C O     1 
ATOM   5615  C  CB    . VAL C 2  257  ? 14.412  -33.541 41.758  1.00 68.13  ? 257  VAL C CB    1 
ATOM   5616  C  CG1   . VAL C 2  257  ? 14.423  -34.880 42.483  1.00 60.51  ? 257  VAL C CG1   1 
ATOM   5617  C  CG2   . VAL C 2  257  ? 12.992  -33.148 41.375  1.00 57.18  ? 257  VAL C CG2   1 
ATOM   5618  N  N     . TYR C 2  258  ? 17.137  -33.303 43.522  1.00 71.04  ? 258  TYR C N     1 
ATOM   5619  C  CA    . TYR C 2  258  ? 18.027  -33.789 44.572  1.00 66.28  ? 258  TYR C CA    1 
ATOM   5620  C  C     . TYR C 2  258  ? 18.164  -32.748 45.675  1.00 67.55  ? 258  TYR C C     1 
ATOM   5621  O  O     . TYR C 2  258  ? 18.047  -33.068 46.858  1.00 60.47  ? 258  TYR C O     1 
ATOM   5622  C  CB    . TYR C 2  258  ? 19.402  -34.133 43.998  1.00 65.40  ? 258  TYR C CB    1 
ATOM   5623  C  CG    . TYR C 2  258  ? 20.409  -34.604 45.023  1.00 59.92  ? 258  TYR C CG    1 
ATOM   5624  C  CD1   . TYR C 2  258  ? 21.421  -33.762 45.470  1.00 57.98  ? 258  TYR C CD1   1 
ATOM   5625  C  CD2   . TYR C 2  258  ? 20.352  -35.891 45.541  1.00 55.75  ? 258  TYR C CD2   1 
ATOM   5626  C  CE1   . TYR C 2  258  ? 22.348  -34.190 46.403  1.00 50.84  ? 258  TYR C CE1   1 
ATOM   5627  C  CE2   . TYR C 2  258  ? 21.272  -36.327 46.476  1.00 53.78  ? 258  TYR C CE2   1 
ATOM   5628  C  CZ    . TYR C 2  258  ? 22.267  -35.473 46.904  1.00 54.83  ? 258  TYR C CZ    1 
ATOM   5629  O  OH    . TYR C 2  258  ? 23.185  -35.906 47.835  1.00 50.99  ? 258  TYR C OH    1 
ATOM   5630  N  N     . GLY C 2  259  ? 18.399  -31.502 45.275  1.00 69.80  ? 259  GLY C N     1 
ATOM   5631  C  CA    . GLY C 2  259  ? 18.542  -30.409 46.221  1.00 68.33  ? 259  GLY C CA    1 
ATOM   5632  C  C     . GLY C 2  259  ? 17.271  -30.127 47.001  1.00 70.43  ? 259  GLY C C     1 
ATOM   5633  O  O     . GLY C 2  259  ? 17.317  -29.649 48.134  1.00 70.66  ? 259  GLY C O     1 
ATOM   5634  N  N     . LEU C 2  260  ? 16.130  -30.420 46.389  1.00 64.14  ? 260  LEU C N     1 
ATOM   5635  C  CA    . LEU C 2  260  ? 14.838  -30.170 47.013  1.00 57.43  ? 260  LEU C CA    1 
ATOM   5636  C  C     . LEU C 2  260  ? 14.452  -31.261 48.015  1.00 62.16  ? 260  LEU C C     1 
ATOM   5637  O  O     . LEU C 2  260  ? 13.832  -30.979 49.041  1.00 61.89  ? 260  LEU C O     1 
ATOM   5638  C  CB    . LEU C 2  260  ? 13.756  -30.028 45.940  1.00 55.44  ? 260  LEU C CB    1 
ATOM   5639  C  CG    . LEU C 2  260  ? 12.411  -29.441 46.366  1.00 53.13  ? 260  LEU C CG    1 
ATOM   5640  C  CD1   . LEU C 2  260  ? 12.575  -27.992 46.797  1.00 65.03  ? 260  LEU C CD1   1 
ATOM   5641  C  CD2   . LEU C 2  260  ? 11.395  -29.556 45.241  1.00 54.57  ? 260  LEU C CD2   1 
ATOM   5642  N  N     . ILE C 2  261  ? 14.824  -32.504 47.718  1.00 57.48  ? 261  ILE C N     1 
ATOM   5643  C  CA    . ILE C 2  261  ? 14.400  -33.644 48.533  1.00 50.23  ? 261  ILE C CA    1 
ATOM   5644  C  C     . ILE C 2  261  ? 15.547  -34.449 49.156  1.00 52.32  ? 261  ILE C C     1 
ATOM   5645  O  O     . ILE C 2  261  ? 15.635  -34.568 50.376  1.00 55.54  ? 261  ILE C O     1 
ATOM   5646  C  CB    . ILE C 2  261  ? 13.464  -34.602 47.759  1.00 50.04  ? 261  ILE C CB    1 
ATOM   5647  C  CG1   . ILE C 2  261  ? 12.119  -33.932 47.471  1.00 47.67  ? 261  ILE C CG1   1 
ATOM   5648  C  CG2   . ILE C 2  261  ? 13.220  -35.856 48.564  1.00 57.03  ? 261  ILE C CG2   1 
ATOM   5649  C  CD1   . ILE C 2  261  ? 12.054  -33.218 46.144  1.00 60.32  ? 261  ILE C CD1   1 
ATOM   5650  N  N     . ALA C 2  262  ? 16.401  -35.028 48.319  1.00 53.67  ? 262  ALA C N     1 
ATOM   5651  C  CA    . ALA C 2  262  ? 17.398  -35.985 48.797  1.00 59.27  ? 262  ALA C CA    1 
ATOM   5652  C  C     . ALA C 2  262  ? 18.720  -35.392 49.297  1.00 57.46  ? 262  ALA C C     1 
ATOM   5653  O  O     . ALA C 2  262  ? 19.497  -36.088 49.953  1.00 55.83  ? 262  ALA C O     1 
ATOM   5654  C  CB    . ALA C 2  262  ? 17.666  -37.037 47.727  1.00 68.71  ? 262  ALA C CB    1 
ATOM   5655  N  N     . ASP C 2  263  ? 18.981  -34.122 49.003  1.00 56.84  ? 263  ASP C N     1 
ATOM   5656  C  CA    . ASP C 2  263  ? 20.256  -33.517 49.391  1.00 58.60  ? 263  ASP C CA    1 
ATOM   5657  C  C     . ASP C 2  263  ? 20.301  -33.219 50.885  1.00 59.65  ? 263  ASP C C     1 
ATOM   5658  O  O     . ASP C 2  263  ? 19.562  -32.362 51.370  1.00 62.36  ? 263  ASP C O     1 
ATOM   5659  C  CB    . ASP C 2  263  ? 20.516  -32.234 48.599  1.00 60.68  ? 263  ASP C CB    1 
ATOM   5660  C  CG    . ASP C 2  263  ? 21.930  -31.712 48.782  1.00 62.82  ? 263  ASP C CG    1 
ATOM   5661  O  OD1   . ASP C 2  263  ? 22.843  -32.528 49.027  1.00 60.30  ? 263  ASP C OD1   1 
ATOM   5662  O  OD2   . ASP C 2  263  ? 22.130  -30.484 48.677  1.00 65.44  ? 263  ASP C OD2   1 
ATOM   5663  N  N     . PRO C 2  264  ? 21.187  -33.914 51.617  1.00 56.40  ? 264  PRO C N     1 
ATOM   5664  C  CA    . PRO C 2  264  ? 21.281  -33.762 53.074  1.00 58.36  ? 264  PRO C CA    1 
ATOM   5665  C  C     . PRO C 2  264  ? 21.729  -32.365 53.489  1.00 59.68  ? 264  PRO C C     1 
ATOM   5666  O  O     . PRO C 2  264  ? 21.369  -31.900 54.571  1.00 62.95  ? 264  PRO C O     1 
ATOM   5667  C  CB    . PRO C 2  264  ? 22.340  -34.797 53.468  1.00 44.47  ? 264  PRO C CB    1 
ATOM   5668  C  CG    . PRO C 2  264  ? 23.151  -34.992 52.239  1.00 57.23  ? 264  PRO C CG    1 
ATOM   5669  C  CD    . PRO C 2  264  ? 22.187  -34.863 51.099  1.00 56.66  ? 264  PRO C CD    1 
ATOM   5670  N  N     . ARG C 2  265  ? 22.500  -31.706 52.633  1.00 57.99  ? 265  ARG C N     1 
ATOM   5671  C  CA    . ARG C 2  265  ? 23.007  -30.373 52.934  1.00 57.60  ? 265  ARG C CA    1 
ATOM   5672  C  C     . ARG C 2  265  ? 21.936  -29.303 52.733  1.00 59.79  ? 265  ARG C C     1 
ATOM   5673  O  O     . ARG C 2  265  ? 21.863  -28.339 53.494  1.00 66.91  ? 265  ARG C O     1 
ATOM   5674  C  CB    . ARG C 2  265  ? 24.253  -30.075 52.095  1.00 57.44  ? 265  ARG C CB    1 
ATOM   5675  C  CG    . ARG C 2  265  ? 25.422  -31.003 52.410  1.00 59.97  ? 265  ARG C CG    1 
ATOM   5676  C  CD    . ARG C 2  265  ? 26.041  -31.592 51.149  1.00 66.76  ? 265  ARG C CD    1 
ATOM   5677  N  NE    . ARG C 2  265  ? 27.229  -30.861 50.714  1.00 69.07  ? 265  ARG C NE    1 
ATOM   5678  C  CZ    . ARG C 2  265  ? 28.471  -31.174 51.071  1.00 56.28  ? 265  ARG C CZ    1 
ATOM   5679  N  NH1   . ARG C 2  265  ? 28.693  -32.206 51.875  1.00 43.23  ? 265  ARG C NH1   1 
ATOM   5680  N  NH2   . ARG C 2  265  ? 29.494  -30.453 50.627  1.00 48.62  ? 265  ARG C NH2   1 
ATOM   5681  N  N     . ARG C 2  266  ? 21.120  -29.466 51.697  1.00 58.18  ? 266  ARG C N     1 
ATOM   5682  C  CA    . ARG C 2  266  ? 19.995  -28.562 51.468  1.00 66.73  ? 266  ARG C CA    1 
ATOM   5683  C  C     . ARG C 2  266  ? 18.741  -28.901 52.287  1.00 60.04  ? 266  ARG C C     1 
ATOM   5684  O  O     . ARG C 2  266  ? 18.048  -28.003 52.764  1.00 51.61  ? 266  ARG C O     1 
ATOM   5685  C  CB    . ARG C 2  266  ? 19.659  -28.470 49.977  1.00 69.38  ? 266  ARG C CB    1 
ATOM   5686  C  CG    . ARG C 2  266  ? 20.654  -27.654 49.168  1.00 61.76  ? 266  ARG C CG    1 
ATOM   5687  C  CD    . ARG C 2  266  ? 20.206  -27.526 47.721  1.00 70.72  ? 266  ARG C CD    1 
ATOM   5688  N  NE    . ARG C 2  266  ? 21.191  -26.826 46.901  1.00 85.84  ? 266  ARG C NE    1 
ATOM   5689  C  CZ    . ARG C 2  266  ? 22.147  -27.431 46.202  1.00 85.33  ? 266  ARG C CZ    1 
ATOM   5690  N  NH1   . ARG C 2  266  ? 22.248  -28.754 46.219  1.00 74.70  ? 266  ARG C NH1   1 
ATOM   5691  N  NH2   . ARG C 2  266  ? 23.001  -26.712 45.483  1.00 77.38  ? 266  ARG C NH2   1 
ATOM   5692  N  N     . TYR C 2  267  ? 18.446  -30.190 52.437  1.00 57.37  ? 267  TYR C N     1 
ATOM   5693  C  CA    . TYR C 2  267  ? 17.246  -30.613 53.163  1.00 56.91  ? 267  TYR C CA    1 
ATOM   5694  C  C     . TYR C 2  267  ? 17.573  -31.406 54.425  1.00 53.68  ? 267  TYR C C     1 
ATOM   5695  O  O     . TYR C 2  267  ? 18.176  -32.477 54.355  1.00 54.80  ? 267  TYR C O     1 
ATOM   5696  C  CB    . TYR C 2  267  ? 16.316  -31.432 52.264  1.00 52.69  ? 267  TYR C CB    1 
ATOM   5697  C  CG    . TYR C 2  267  ? 14.958  -31.702 52.879  1.00 48.96  ? 267  TYR C CG    1 
ATOM   5698  C  CD1   . TYR C 2  267  ? 13.864  -30.905 52.568  1.00 53.42  ? 267  TYR C CD1   1 
ATOM   5699  C  CD2   . TYR C 2  267  ? 14.770  -32.751 53.772  1.00 46.75  ? 267  TYR C CD2   1 
ATOM   5700  C  CE1   . TYR C 2  267  ? 12.622  -31.144 53.126  1.00 46.91  ? 267  TYR C CE1   1 
ATOM   5701  C  CE2   . TYR C 2  267  ? 13.535  -32.995 54.338  1.00 46.30  ? 267  TYR C CE2   1 
ATOM   5702  C  CZ    . TYR C 2  267  ? 12.463  -32.191 54.010  1.00 43.87  ? 267  TYR C CZ    1 
ATOM   5703  O  OH    . TYR C 2  267  ? 11.230  -32.431 54.569  1.00 37.60  ? 267  TYR C OH    1 
ATOM   5704  N  N     . ASP C 2  268  ? 17.163  -30.886 55.577  1.00 45.17  ? 268  ASP C N     1 
ATOM   5705  C  CA    . ASP C 2  268  ? 17.443  -31.561 56.836  1.00 44.47  ? 268  ASP C CA    1 
ATOM   5706  C  C     . ASP C 2  268  ? 16.232  -31.619 57.770  1.00 45.65  ? 268  ASP C C     1 
ATOM   5707  O  O     . ASP C 2  268  ? 15.752  -30.589 58.243  1.00 44.75  ? 268  ASP C O     1 
ATOM   5708  C  CB    . ASP C 2  268  ? 18.619  -30.869 57.535  1.00 46.56  ? 268  ASP C CB    1 
ATOM   5709  C  CG    . ASP C 2  268  ? 19.250  -31.725 58.617  1.00 49.76  ? 268  ASP C CG    1 
ATOM   5710  O  OD1   . ASP C 2  268  ? 19.085  -32.962 58.577  1.00 51.51  ? 268  ASP C OD1   1 
ATOM   5711  O  OD2   . ASP C 2  268  ? 19.928  -31.158 59.501  1.00 42.14  ? 268  ASP C OD2   1 
ATOM   5712  N  N     . LEU C 2  269  ? 15.743  -32.828 58.034  1.00 46.62  ? 269  LEU C N     1 
ATOM   5713  C  CA    . LEU C 2  269  ? 14.870  -33.052 59.177  1.00 37.43  ? 269  LEU C CA    1 
ATOM   5714  C  C     . LEU C 2  269  ? 15.831  -33.135 60.341  1.00 45.60  ? 269  LEU C C     1 
ATOM   5715  O  O     . LEU C 2  269  ? 16.964  -33.578 60.173  1.00 56.55  ? 269  LEU C O     1 
ATOM   5716  C  CB    . LEU C 2  269  ? 14.116  -34.381 59.064  1.00 34.31  ? 269  LEU C CB    1 
ATOM   5717  C  CG    . LEU C 2  269  ? 12.990  -34.565 58.045  1.00 38.81  ? 269  LEU C CG    1 
ATOM   5718  C  CD1   . LEU C 2  269  ? 12.492  -36.005 58.052  1.00 31.56  ? 269  LEU C CD1   1 
ATOM   5719  C  CD2   . LEU C 2  269  ? 11.849  -33.620 58.338  1.00 41.49  ? 269  LEU C CD2   1 
ATOM   5720  N  N     . GLY C 2  270  ? 15.406  -32.713 61.521  1.00 40.84  ? 270  GLY C N     1 
ATOM   5721  C  CA    . GLY C 2  270  ? 16.270  -32.842 62.677  1.00 45.74  ? 270  GLY C CA    1 
ATOM   5722  C  C     . GLY C 2  270  ? 16.421  -34.302 63.047  1.00 44.86  ? 270  GLY C C     1 
ATOM   5723  O  O     . GLY C 2  270  ? 15.782  -35.168 62.447  1.00 41.95  ? 270  GLY C O     1 
ATOM   5724  N  N     . GLU C 2  271  ? 17.273  -34.581 64.028  1.00 45.61  ? 271  GLU C N     1 
ATOM   5725  C  CA    . GLU C 2  271  ? 17.348  -35.921 64.585  1.00 42.95  ? 271  GLU C CA    1 
ATOM   5726  C  C     . GLU C 2  271  ? 15.994  -36.229 65.211  1.00 45.72  ? 271  GLU C C     1 
ATOM   5727  O  O     . GLU C 2  271  ? 15.492  -37.356 65.138  1.00 41.57  ? 271  GLU C O     1 
ATOM   5728  C  CB    . GLU C 2  271  ? 18.465  -36.007 65.625  1.00 40.80  ? 271  GLU C CB    1 
ATOM   5729  C  CG    . GLU C 2  271  ? 18.702  -37.409 66.165  1.00 58.83  ? 271  GLU C CG    1 
ATOM   5730  C  CD    . GLU C 2  271  ? 18.968  -38.425 65.066  1.00 71.65  ? 271  GLU C CD    1 
ATOM   5731  O  OE1   . GLU C 2  271  ? 19.642  -38.078 64.069  1.00 64.78  ? 271  GLU C OE1   1 
ATOM   5732  O  OE2   . GLU C 2  271  ? 18.496  -39.575 65.199  1.00 76.55  ? 271  GLU C OE2   1 
ATOM   5733  N  N     . ALA C 2  272  ? 15.402  -35.196 65.807  1.00 45.90  ? 272  ALA C N     1 
ATOM   5734  C  CA    . ALA C 2  272  ? 14.063  -35.274 66.378  1.00 39.85  ? 272  ALA C CA    1 
ATOM   5735  C  C     . ALA C 2  272  ? 13.002  -35.443 65.295  1.00 35.66  ? 272  ALA C C     1 
ATOM   5736  O  O     . ALA C 2  272  ? 12.029  -36.167 65.483  1.00 37.79  ? 272  ALA C O     1 
ATOM   5737  C  CB    . ALA C 2  272  ? 13.775  -34.036 67.214  1.00 40.12  ? 272  ALA C CB    1 
ATOM   5738  N  N     . GLY C 2  273  ? 13.185  -34.762 64.169  1.00 37.93  ? 273  GLY C N     1 
ATOM   5739  C  CA    . GLY C 2  273  ? 12.273  -34.898 63.047  1.00 38.11  ? 273  GLY C CA    1 
ATOM   5740  C  C     . GLY C 2  273  ? 12.333  -36.306 62.493  1.00 39.02  ? 273  GLY C C     1 
ATOM   5741  O  O     . GLY C 2  273  ? 11.315  -36.897 62.127  1.00 37.86  ? 273  GLY C O     1 
ATOM   5742  N  N     . ARG C 2  274  ? 13.549  -36.837 62.444  1.00 43.92  ? 274  ARG C N     1 
ATOM   5743  C  CA    . ARG C 2  274  ? 13.797  -38.210 62.036  1.00 41.71  ? 274  ARG C CA    1 
ATOM   5744  C  C     . ARG C 2  274  ? 13.038  -39.170 62.947  1.00 42.13  ? 274  ARG C C     1 
ATOM   5745  O  O     . ARG C 2  274  ? 12.226  -39.977 62.481  1.00 42.62  ? 274  ARG C O     1 
ATOM   5746  C  CB    . ARG C 2  274  ? 15.300  -38.485 62.105  1.00 48.75  ? 274  ARG C CB    1 
ATOM   5747  C  CG    . ARG C 2  274  ? 15.757  -39.799 61.505  1.00 53.26  ? 274  ARG C CG    1 
ATOM   5748  C  CD    . ARG C 2  274  ? 17.278  -39.866 61.503  1.00 55.54  ? 274  ARG C CD    1 
ATOM   5749  N  NE    . ARG C 2  274  ? 17.782  -41.112 60.939  1.00 63.16  ? 274  ARG C NE    1 
ATOM   5750  C  CZ    . ARG C 2  274  ? 18.020  -42.208 61.650  1.00 65.66  ? 274  ARG C CZ    1 
ATOM   5751  N  NH1   . ARG C 2  274  ? 17.796  -42.213 62.957  1.00 60.31  ? 274  ARG C NH1   1 
ATOM   5752  N  NH2   . ARG C 2  274  ? 18.480  -43.301 61.053  1.00 67.79  ? 274  ARG C NH2   1 
ATOM   5753  N  N     . TYR C 2  275  ? 13.293  -39.062 64.250  1.00 47.14  ? 275  TYR C N     1 
ATOM   5754  C  CA    . TYR C 2  275  ? 12.649  -39.928 65.237  1.00 53.31  ? 275  TYR C CA    1 
ATOM   5755  C  C     . TYR C 2  275  ? 11.121  -39.857 65.192  1.00 52.76  ? 275  TYR C C     1 
ATOM   5756  O  O     . TYR C 2  275  ? 10.445  -40.888 65.160  1.00 53.00  ? 275  TYR C O     1 
ATOM   5757  C  CB    . TYR C 2  275  ? 13.150  -39.613 66.650  1.00 47.53  ? 275  TYR C CB    1 
ATOM   5758  C  CG    . TYR C 2  275  ? 12.293  -40.214 67.747  1.00 64.74  ? 275  TYR C CG    1 
ATOM   5759  C  CD1   . TYR C 2  275  ? 12.349  -41.573 68.036  1.00 66.41  ? 275  TYR C CD1   1 
ATOM   5760  C  CD2   . TYR C 2  275  ? 11.426  -39.421 68.494  1.00 62.95  ? 275  TYR C CD2   1 
ATOM   5761  C  CE1   . TYR C 2  275  ? 11.564  -42.127 69.037  1.00 64.67  ? 275  TYR C CE1   1 
ATOM   5762  C  CE2   . TYR C 2  275  ? 10.638  -39.966 69.497  1.00 67.35  ? 275  TYR C CE2   1 
ATOM   5763  C  CZ    . TYR C 2  275  ? 10.712  -41.319 69.765  1.00 71.34  ? 275  TYR C CZ    1 
ATOM   5764  O  OH    . TYR C 2  275  ? 9.931   -41.865 70.762  1.00 62.17  ? 275  TYR C OH    1 
ATOM   5765  N  N     . LYS C 2  276  ? 10.583  -38.641 65.189  1.00 42.32  ? 276  LYS C N     1 
ATOM   5766  C  CA    . LYS C 2  276  ? 9.136   -38.447 65.181  1.00 46.47  ? 276  LYS C CA    1 
ATOM   5767  C  C     . LYS C 2  276  ? 8.485   -38.966 63.905  1.00 45.38  ? 276  LYS C C     1 
ATOM   5768  O  O     . LYS C 2  276  ? 7.401   -39.547 63.952  1.00 44.96  ? 276  LYS C O     1 
ATOM   5769  C  CB    . LYS C 2  276  ? 8.772   -36.978 65.403  1.00 44.06  ? 276  LYS C CB    1 
ATOM   5770  C  CG    . LYS C 2  276  ? 8.769   -36.558 66.865  1.00 46.94  ? 276  LYS C CG    1 
ATOM   5771  C  CD    . LYS C 2  276  ? 7.930   -35.308 67.093  1.00 41.82  ? 276  LYS C CD    1 
ATOM   5772  C  CE    . LYS C 2  276  ? 6.445   -35.576 66.869  1.00 39.51  ? 276  LYS C CE    1 
ATOM   5773  N  NZ    . LYS C 2  276  ? 6.015   -35.398 65.451  1.00 35.91  ? 276  LYS C NZ    1 
ATOM   5774  N  N     . ALA C 2  277  ? 9.141   -38.752 62.768  1.00 43.43  ? 277  ALA C N     1 
ATOM   5775  C  CA    . ALA C 2  277  ? 8.644   -39.288 61.508  1.00 38.10  ? 277  ALA C CA    1 
ATOM   5776  C  C     . ALA C 2  277  ? 8.601   -40.807 61.583  1.00 45.19  ? 277  ALA C C     1 
ATOM   5777  O  O     . ALA C 2  277  ? 7.612   -41.433 61.185  1.00 47.57  ? 277  ALA C O     1 
ATOM   5778  C  CB    . ALA C 2  277  ? 9.518   -38.840 60.353  1.00 36.27  ? 277  ALA C CB    1 
ATOM   5779  N  N     . GLU C 2  278  ? 9.675   -41.392 62.109  1.00 40.49  ? 278  GLU C N     1 
ATOM   5780  C  CA    . GLU C 2  278  ? 9.770   -42.842 62.236  1.00 47.11  ? 278  GLU C CA    1 
ATOM   5781  C  C     . GLU C 2  278  ? 8.668   -43.413 63.122  1.00 54.44  ? 278  GLU C C     1 
ATOM   5782  O  O     . GLU C 2  278  ? 8.038   -44.414 62.777  1.00 53.62  ? 278  GLU C O     1 
ATOM   5783  C  CB    . GLU C 2  278  ? 11.140  -43.247 62.784  1.00 46.46  ? 278  GLU C CB    1 
ATOM   5784  C  CG    . GLU C 2  278  ? 12.266  -43.146 61.772  1.00 52.62  ? 278  GLU C CG    1 
ATOM   5785  C  CD    . GLU C 2  278  ? 13.619  -43.453 62.379  1.00 57.27  ? 278  GLU C CD    1 
ATOM   5786  O  OE1   . GLU C 2  278  ? 13.676  -43.719 63.598  1.00 58.51  ? 278  GLU C OE1   1 
ATOM   5787  O  OE2   . GLU C 2  278  ? 14.624  -43.425 61.639  1.00 53.71  ? 278  GLU C OE2   1 
ATOM   5788  N  N     . GLU C 2  279  ? 8.438   -42.768 64.261  1.00 52.37  ? 279  GLU C N     1 
ATOM   5789  C  CA    . GLU C 2  279  ? 7.466   -43.253 65.232  1.00 47.60  ? 279  GLU C CA    1 
ATOM   5790  C  C     . GLU C 2  279  ? 6.035   -43.075 64.727  1.00 45.82  ? 279  GLU C C     1 
ATOM   5791  O  O     . GLU C 2  279  ? 5.182   -43.939 64.931  1.00 49.69  ? 279  GLU C O     1 
ATOM   5792  C  CB    . GLU C 2  279  ? 7.653   -42.535 66.571  1.00 52.94  ? 279  GLU C CB    1 
ATOM   5793  C  CG    . GLU C 2  279  ? 7.317   -43.383 67.789  1.00 71.33  ? 279  GLU C CG    1 
ATOM   5794  C  CD    . GLU C 2  279  ? 8.326   -44.496 68.031  1.00 76.07  ? 279  GLU C CD    1 
ATOM   5795  O  OE1   . GLU C 2  279  ? 8.006   -45.437 68.789  1.00 69.95  ? 279  GLU C OE1   1 
ATOM   5796  O  OE2   . GLU C 2  279  ? 9.442   -44.427 67.469  1.00 64.57  ? 279  GLU C OE2   1 
ATOM   5797  N  N     . LYS C 2  280  ? 5.781   -41.953 64.064  1.00 43.91  ? 280  LYS C N     1 
ATOM   5798  C  CA    . LYS C 2  280  ? 4.449   -41.654 63.550  1.00 42.70  ? 280  LYS C CA    1 
ATOM   5799  C  C     . LYS C 2  280  ? 4.068   -42.549 62.374  1.00 48.08  ? 280  LYS C C     1 
ATOM   5800  O  O     . LYS C 2  280  ? 3.008   -43.174 62.382  1.00 41.60  ? 280  LYS C O     1 
ATOM   5801  C  CB    . LYS C 2  280  ? 4.352   -40.186 63.133  1.00 37.29  ? 280  LYS C CB    1 
ATOM   5802  C  CG    . LYS C 2  280  ? 3.002   -39.787 62.560  1.00 31.93  ? 280  LYS C CG    1 
ATOM   5803  C  CD    . LYS C 2  280  ? 1.912   -39.846 63.614  1.00 28.21  ? 280  LYS C CD    1 
ATOM   5804  C  CE    . LYS C 2  280  ? 0.603   -39.281 63.084  1.00 32.36  ? 280  LYS C CE    1 
ATOM   5805  N  NZ    . LYS C 2  280  ? -0.495  -39.344 64.095  1.00 31.98  ? 280  LYS C NZ    1 
ATOM   5806  N  N     . LEU C 2  281  ? 4.937   -42.607 61.368  1.00 52.58  ? 281  LEU C N     1 
ATOM   5807  C  CA    . LEU C 2  281  ? 4.641   -43.349 60.143  1.00 45.97  ? 281  LEU C CA    1 
ATOM   5808  C  C     . LEU C 2  281  ? 4.908   -44.848 60.267  1.00 53.07  ? 281  LEU C C     1 
ATOM   5809  O  O     . LEU C 2  281  ? 4.611   -45.615 59.349  1.00 49.05  ? 281  LEU C O     1 
ATOM   5810  C  CB    . LEU C 2  281  ? 5.428   -42.774 58.964  1.00 46.85  ? 281  LEU C CB    1 
ATOM   5811  C  CG    . LEU C 2  281  ? 5.035   -41.362 58.531  1.00 46.07  ? 281  LEU C CG    1 
ATOM   5812  C  CD1   . LEU C 2  281  ? 5.884   -40.899 57.358  1.00 38.92  ? 281  LEU C CD1   1 
ATOM   5813  C  CD2   . LEU C 2  281  ? 3.556   -41.311 58.182  1.00 45.43  ? 281  LEU C CD2   1 
ATOM   5814  N  N     . GLY C 2  282  ? 5.472   -45.256 61.401  1.00 50.88  ? 282  GLY C N     1 
ATOM   5815  C  CA    . GLY C 2  282  ? 5.758   -46.657 61.656  1.00 52.17  ? 282  GLY C CA    1 
ATOM   5816  C  C     . GLY C 2  282  ? 6.756   -47.237 60.673  1.00 54.59  ? 282  GLY C C     1 
ATOM   5817  O  O     . GLY C 2  282  ? 6.555   -48.325 60.131  1.00 55.74  ? 282  GLY C O     1 
ATOM   5818  N  N     . ILE C 2  283  ? 7.835   -46.498 60.436  1.00 51.95  ? 283  ILE C N     1 
ATOM   5819  C  CA    . ILE C 2  283  ? 8.865   -46.912 59.493  1.00 49.05  ? 283  ILE C CA    1 
ATOM   5820  C  C     . ILE C 2  283  ? 10.247  -46.693 60.088  1.00 56.38  ? 283  ILE C C     1 
ATOM   5821  O  O     . ILE C 2  283  ? 10.381  -46.335 61.259  1.00 56.60  ? 283  ILE C O     1 
ATOM   5822  C  CB    . ILE C 2  283  ? 8.774   -46.119 58.178  1.00 48.55  ? 283  ILE C CB    1 
ATOM   5823  C  CG1   . ILE C 2  283  ? 9.046   -44.634 58.436  1.00 49.12  ? 283  ILE C CG1   1 
ATOM   5824  C  CG2   . ILE C 2  283  ? 7.414   -46.324 57.522  1.00 44.80  ? 283  ILE C CG2   1 
ATOM   5825  C  CD1   . ILE C 2  283  ? 9.058   -43.782 57.189  1.00 35.08  ? 283  ILE C CD1   1 
ATOM   5826  N  N     . ARG C 2  284  ? 11.275  -46.918 59.276  1.00 60.17  ? 284  ARG C N     1 
ATOM   5827  C  CA    . ARG C 2  284  ? 12.648  -46.655 59.685  1.00 63.85  ? 284  ARG C CA    1 
ATOM   5828  C  C     . ARG C 2  284  ? 13.339  -45.788 58.640  1.00 65.41  ? 284  ARG C C     1 
ATOM   5829  O  O     . ARG C 2  284  ? 13.377  -46.136 57.460  1.00 64.76  ? 284  ARG C O     1 
ATOM   5830  C  CB    . ARG C 2  284  ? 13.415  -47.963 59.873  1.00 63.73  ? 284  ARG C CB    1 
ATOM   5831  C  CG    . ARG C 2  284  ? 14.795  -47.796 60.491  1.00 62.48  ? 284  ARG C CG    1 
ATOM   5832  C  CD    . ARG C 2  284  ? 14.698  -47.379 61.949  1.00 67.28  ? 284  ARG C CD    1 
ATOM   5833  N  NE    . ARG C 2  284  ? 15.980  -47.493 62.641  1.00 76.19  ? 284  ARG C NE    1 
ATOM   5834  C  CZ    . ARG C 2  284  ? 16.815  -46.480 62.846  1.00 74.54  ? 284  ARG C CZ    1 
ATOM   5835  N  NH1   . ARG C 2  284  ? 17.960  -46.680 63.486  1.00 67.57  ? 284  ARG C NH1   1 
ATOM   5836  N  NH2   . ARG C 2  284  ? 16.505  -45.265 62.414  1.00 76.00  ? 284  ARG C NH2   1 
ATOM   5837  N  N     . LEU C 2  285  ? 13.880  -44.656 59.077  1.00 67.84  ? 285  LEU C N     1 
ATOM   5838  C  CA    . LEU C 2  285  ? 14.551  -43.736 58.168  1.00 64.15  ? 285  LEU C CA    1 
ATOM   5839  C  C     . LEU C 2  285  ? 16.045  -44.031 58.087  1.00 69.21  ? 285  LEU C C     1 
ATOM   5840  O  O     . LEU C 2  285  ? 16.704  -44.246 59.105  1.00 67.10  ? 285  LEU C O     1 
ATOM   5841  C  CB    . LEU C 2  285  ? 14.324  -42.285 58.604  1.00 60.67  ? 285  LEU C CB    1 
ATOM   5842  C  CG    . LEU C 2  285  ? 13.569  -41.375 57.631  1.00 56.26  ? 285  LEU C CG    1 
ATOM   5843  C  CD1   . LEU C 2  285  ? 14.219  -41.397 56.256  1.00 65.31  ? 285  LEU C CD1   1 
ATOM   5844  C  CD2   . LEU C 2  285  ? 12.104  -41.765 57.539  1.00 49.76  ? 285  LEU C CD2   1 
ATOM   5845  N  N     . SER C 2  286  ? 16.570  -44.047 56.867  1.00 70.35  ? 286  SER C N     1 
ATOM   5846  C  CA    . SER C 2  286  ? 17.999  -44.223 56.655  1.00 72.09  ? 286  SER C CA    1 
ATOM   5847  C  C     . SER C 2  286  ? 18.721  -42.926 56.982  1.00 72.71  ? 286  SER C C     1 
ATOM   5848  O  O     . SER C 2  286  ? 19.479  -42.847 57.950  1.00 65.81  ? 286  SER C O     1 
ATOM   5849  C  CB    . SER C 2  286  ? 18.277  -44.624 55.207  1.00 78.05  ? 286  SER C CB    1 
ATOM   5850  O  OG    . SER C 2  286  ? 19.667  -44.617 54.932  1.00 95.13  ? 286  SER C OG    1 
ATOM   5851  N  N     . GLY C 2  287  ? 18.474  -41.907 56.166  1.00 72.03  ? 287  GLY C N     1 
ATOM   5852  C  CA    . GLY C 2  287  ? 19.040  -40.592 56.393  1.00 71.66  ? 287  GLY C CA    1 
ATOM   5853  C  C     . GLY C 2  287  ? 18.014  -39.640 56.975  1.00 61.38  ? 287  GLY C C     1 
ATOM   5854  O  O     . GLY C 2  287  ? 16.928  -40.052 57.379  1.00 61.34  ? 287  GLY C O     1 
ATOM   5855  N  N     . ARG C 2  288  ? 18.366  -38.362 57.026  1.00 52.48  ? 288  ARG C N     1 
ATOM   5856  C  CA    . ARG C 2  288  ? 17.464  -37.338 57.537  1.00 47.29  ? 288  ARG C CA    1 
ATOM   5857  C  C     . ARG C 2  288  ? 16.669  -36.630 56.437  1.00 51.37  ? 288  ARG C C     1 
ATOM   5858  O  O     . ARG C 2  288  ? 15.989  -35.639 56.694  1.00 47.89  ? 288  ARG C O     1 
ATOM   5859  C  CB    . ARG C 2  288  ? 18.211  -36.349 58.432  1.00 45.86  ? 288  ARG C CB    1 
ATOM   5860  C  CG    . ARG C 2  288  ? 18.757  -37.004 59.692  1.00 45.57  ? 288  ARG C CG    1 
ATOM   5861  C  CD    . ARG C 2  288  ? 19.051  -35.992 60.776  1.00 43.54  ? 288  ARG C CD    1 
ATOM   5862  N  NE    . ARG C 2  288  ? 20.189  -35.140 60.447  1.00 54.26  ? 288  ARG C NE    1 
ATOM   5863  C  CZ    . ARG C 2  288  ? 21.234  -34.957 61.247  1.00 59.34  ? 288  ARG C CZ    1 
ATOM   5864  N  NH1   . ARG C 2  288  ? 21.282  -35.566 62.425  1.00 37.55  ? 288  ARG C NH1   1 
ATOM   5865  N  NH2   . ARG C 2  288  ? 22.229  -34.162 60.871  1.00 60.92  ? 288  ARG C NH2   1 
ATOM   5866  N  N     . THR C 2  289  ? 16.783  -37.126 55.208  1.00 60.16  ? 289  THR C N     1 
ATOM   5867  C  CA    . THR C 2  289  ? 16.035  -36.567 54.084  1.00 51.79  ? 289  THR C CA    1 
ATOM   5868  C  C     . THR C 2  289  ? 14.783  -37.383 53.768  1.00 51.64  ? 289  THR C C     1 
ATOM   5869  O  O     . THR C 2  289  ? 14.526  -38.410 54.397  1.00 55.37  ? 289  THR C O     1 
ATOM   5870  C  CB    . THR C 2  289  ? 16.901  -36.497 52.818  1.00 58.40  ? 289  THR C CB    1 
ATOM   5871  O  OG1   . THR C 2  289  ? 17.337  -37.816 52.466  1.00 66.43  ? 289  THR C OG1   1 
ATOM   5872  C  CG2   . THR C 2  289  ? 18.116  -35.615 53.054  1.00 58.07  ? 289  THR C CG2   1 
ATOM   5873  N  N     . LEU C 2  290  ? 14.013  -36.922 52.786  1.00 55.23  ? 290  LEU C N     1 
ATOM   5874  C  CA    . LEU C 2  290  ? 12.773  -37.590 52.398  1.00 51.63  ? 290  LEU C CA    1 
ATOM   5875  C  C     . LEU C 2  290  ? 13.006  -38.646 51.323  1.00 65.03  ? 290  LEU C C     1 
ATOM   5876  O  O     . LEU C 2  290  ? 12.119  -39.450 51.031  1.00 64.34  ? 290  LEU C O     1 
ATOM   5877  C  CB    . LEU C 2  290  ? 11.752  -36.572 51.889  1.00 49.93  ? 290  LEU C CB    1 
ATOM   5878  C  CG    . LEU C 2  290  ? 11.506  -35.328 52.743  1.00 47.60  ? 290  LEU C CG    1 
ATOM   5879  C  CD1   . LEU C 2  290  ? 10.396  -34.484 52.135  1.00 42.51  ? 290  LEU C CD1   1 
ATOM   5880  C  CD2   . LEU C 2  290  ? 11.184  -35.701 54.184  1.00 41.60  ? 290  LEU C CD2   1 
ATOM   5881  N  N     . ALA C 2  291  ? 14.199  -38.632 50.733  1.00 71.88  ? 291  ALA C N     1 
ATOM   5882  C  CA    . ALA C 2  291  ? 14.576  -39.615 49.721  1.00 69.85  ? 291  ALA C CA    1 
ATOM   5883  C  C     . ALA C 2  291  ? 16.090  -39.677 49.567  1.00 65.68  ? 291  ALA C C     1 
ATOM   5884  O  O     . ALA C 2  291  ? 16.821  -38.943 50.232  1.00 60.97  ? 291  ALA C O     1 
ATOM   5885  C  CB    . ALA C 2  291  ? 13.922  -39.296 48.384  1.00 61.43  ? 291  ALA C CB    1 
ATOM   5886  N  N     . ARG C 2  292  ? 16.556  -40.556 48.688  1.00 72.97  ? 292  ARG C N     1 
ATOM   5887  C  CA    . ARG C 2  292  ? 17.987  -40.711 48.457  1.00 68.78  ? 292  ARG C CA    1 
ATOM   5888  C  C     . ARG C 2  292  ? 18.308  -40.753 46.972  1.00 73.73  ? 292  ARG C C     1 
ATOM   5889  O  O     . ARG C 2  292  ? 17.439  -41.024 46.144  1.00 73.93  ? 292  ARG C O     1 
ATOM   5890  C  CB    . ARG C 2  292  ? 18.500  -41.995 49.110  1.00 61.00  ? 292  ARG C CB    1 
ATOM   5891  C  CG    . ARG C 2  292  ? 18.317  -42.062 50.612  1.00 68.10  ? 292  ARG C CG    1 
ATOM   5892  C  CD    . ARG C 2  292  ? 18.601  -43.463 51.113  1.00 72.12  ? 292  ARG C CD    1 
ATOM   5893  N  NE    . ARG C 2  292  ? 17.781  -44.449 50.416  1.00 75.12  ? 292  ARG C NE    1 
ATOM   5894  C  CZ    . ARG C 2  292  ? 17.848  -45.760 50.622  1.00 82.58  ? 292  ARG C CZ    1 
ATOM   5895  N  NH1   . ARG C 2  292  ? 18.701  -46.251 51.511  1.00 79.09  ? 292  ARG C NH1   1 
ATOM   5896  N  NH2   . ARG C 2  292  ? 17.060  -46.580 49.939  1.00 85.98  ? 292  ARG C NH2   1 
ATOM   5897  N  N     . PHE C 2  293  ? 19.566  -40.480 46.646  1.00 78.13  ? 293  PHE C N     1 
ATOM   5898  C  CA    . PHE C 2  293  ? 20.080  -40.724 45.308  1.00 81.71  ? 293  PHE C CA    1 
ATOM   5899  C  C     . PHE C 2  293  ? 21.054  -41.888 45.421  1.00 88.14  ? 293  PHE C C     1 
ATOM   5900  O  O     . PHE C 2  293  ? 22.148  -41.745 45.971  1.00 78.46  ? 293  PHE C O     1 
ATOM   5901  C  CB    . PHE C 2  293  ? 20.788  -39.481 44.764  1.00 75.22  ? 293  PHE C CB    1 
ATOM   5902  C  CG    . PHE C 2  293  ? 21.214  -39.602 43.325  1.00 84.97  ? 293  PHE C CG    1 
ATOM   5903  C  CD1   . PHE C 2  293  ? 20.358  -39.227 42.301  1.00 80.81  ? 293  PHE C CD1   1 
ATOM   5904  C  CD2   . PHE C 2  293  ? 22.473  -40.082 42.996  1.00 85.44  ? 293  PHE C CD2   1 
ATOM   5905  C  CE1   . PHE C 2  293  ? 20.747  -39.333 40.979  1.00 78.62  ? 293  PHE C CE1   1 
ATOM   5906  C  CE2   . PHE C 2  293  ? 22.867  -40.192 41.675  1.00 80.54  ? 293  PHE C CE2   1 
ATOM   5907  C  CZ    . PHE C 2  293  ? 22.003  -39.816 40.666  1.00 83.58  ? 293  PHE C CZ    1 
ATOM   5908  N  N     . GLU C 2  294  ? 20.651  -43.042 44.900  1.00 89.34  ? 294  GLU C N     1 
ATOM   5909  C  CA    . GLU C 2  294  ? 21.428  -44.263 45.065  1.00 85.42  ? 294  GLU C CA    1 
ATOM   5910  C  C     . GLU C 2  294  ? 21.570  -45.020 43.750  1.00 93.99  ? 294  GLU C C     1 
ATOM   5911  O  O     . GLU C 2  294  ? 20.576  -45.326 43.088  1.00 93.28  ? 294  GLU C O     1 
ATOM   5912  C  CB    . GLU C 2  294  ? 20.791  -45.157 46.131  1.00 81.29  ? 294  GLU C CB    1 
ATOM   5913  C  CG    . GLU C 2  294  ? 21.529  -46.461 46.380  1.00 88.08  ? 294  GLU C CG    1 
ATOM   5914  C  CD    . GLU C 2  294  ? 20.980  -47.224 47.571  1.00 88.04  ? 294  GLU C CD    1 
ATOM   5915  O  OE1   . GLU C 2  294  ? 21.015  -48.473 47.547  1.00 85.05  ? 294  GLU C OE1   1 
ATOM   5916  O  OE2   . GLU C 2  294  ? 20.519  -46.576 48.534  1.00 81.21  ? 294  GLU C OE2   1 
ATOM   5917  N  N     . ASP C 2  295  ? 22.818  -45.305 43.383  1.00 95.92  ? 295  ASP C N     1 
ATOM   5918  C  CA    . ASP C 2  295  ? 23.145  -46.051 42.169  1.00 93.94  ? 295  ASP C CA    1 
ATOM   5919  C  C     . ASP C 2  295  ? 22.610  -45.386 40.900  1.00 92.72  ? 295  ASP C C     1 
ATOM   5920  O  O     . ASP C 2  295  ? 22.292  -46.062 39.922  1.00 105.19 ? 295  ASP C O     1 
ATOM   5921  C  CB    . ASP C 2  295  ? 22.656  -47.501 42.268  1.00 94.98  ? 295  ASP C CB    1 
ATOM   5922  C  CG    . ASP C 2  295  ? 23.187  -48.214 43.499  1.00 89.00  ? 295  ASP C CG    1 
ATOM   5923  O  OD1   . ASP C 2  295  ? 22.428  -48.998 44.107  1.00 80.48  ? 295  ASP C OD1   1 
ATOM   5924  O  OD2   . ASP C 2  295  ? 24.361  -47.990 43.861  1.00 89.14  ? 295  ASP C OD2   1 
ATOM   5925  N  N     . GLY C 2  296  ? 22.511  -44.060 40.923  1.00 85.54  ? 296  GLY C N     1 
ATOM   5926  C  CA    . GLY C 2  296  ? 22.109  -43.309 39.748  1.00 90.37  ? 296  GLY C CA    1 
ATOM   5927  C  C     . GLY C 2  296  ? 20.666  -42.837 39.739  1.00 89.49  ? 296  GLY C C     1 
ATOM   5928  O  O     . GLY C 2  296  ? 20.321  -41.912 39.003  1.00 85.74  ? 296  GLY C O     1 
ATOM   5929  N  N     . GLU C 2  297  ? 19.819  -43.464 40.550  1.00 87.11  ? 297  GLU C N     1 
ATOM   5930  C  CA    . GLU C 2  297  ? 18.407  -43.092 40.592  1.00 92.29  ? 297  GLU C CA    1 
ATOM   5931  C  C     . GLU C 2  297  ? 17.948  -42.692 41.996  1.00 93.54  ? 297  GLU C C     1 
ATOM   5932  O  O     . GLU C 2  297  ? 18.724  -42.740 42.952  1.00 83.68  ? 297  GLU C O     1 
ATOM   5933  C  CB    . GLU C 2  297  ? 17.535  -44.228 40.048  1.00 94.49  ? 297  GLU C CB    1 
ATOM   5934  C  CG    . GLU C 2  297  ? 17.631  -45.527 40.835  1.00 98.72  ? 297  GLU C CG    1 
ATOM   5935  C  CD    . GLU C 2  297  ? 16.702  -46.603 40.301  1.00 98.34  ? 297  GLU C CD    1 
ATOM   5936  O  OE1   . GLU C 2  297  ? 16.335  -47.513 41.075  1.00 94.20  ? 297  GLU C OE1   1 
ATOM   5937  O  OE2   . GLU C 2  297  ? 16.341  -46.540 39.107  1.00 93.73  ? 297  GLU C OE2   1 
ATOM   5938  N  N     . PHE C 2  298  ? 16.680  -42.301 42.109  1.00 89.44  ? 298  PHE C N     1 
ATOM   5939  C  CA    . PHE C 2  298  ? 16.112  -41.863 43.382  1.00 79.99  ? 298  PHE C CA    1 
ATOM   5940  C  C     . PHE C 2  298  ? 15.346  -42.979 44.088  1.00 85.08  ? 298  PHE C C     1 
ATOM   5941  O  O     . PHE C 2  298  ? 14.671  -43.781 43.444  1.00 91.21  ? 298  PHE C O     1 
ATOM   5942  C  CB    . PHE C 2  298  ? 15.179  -40.667 43.177  1.00 73.02  ? 298  PHE C CB    1 
ATOM   5943  C  CG    . PHE C 2  298  ? 15.882  -39.410 42.754  1.00 74.26  ? 298  PHE C CG    1 
ATOM   5944  C  CD1   . PHE C 2  298  ? 15.637  -38.849 41.512  1.00 71.59  ? 298  PHE C CD1   1 
ATOM   5945  C  CD2   . PHE C 2  298  ? 16.786  -38.789 43.599  1.00 73.81  ? 298  PHE C CD2   1 
ATOM   5946  C  CE1   . PHE C 2  298  ? 16.280  -37.690 41.120  1.00 74.68  ? 298  PHE C CE1   1 
ATOM   5947  C  CE2   . PHE C 2  298  ? 17.434  -37.630 43.213  1.00 73.24  ? 298  PHE C CE2   1 
ATOM   5948  C  CZ    . PHE C 2  298  ? 17.181  -37.081 41.971  1.00 76.38  ? 298  PHE C CZ    1 
ATOM   5949  N  N     . LYS C 2  299  ? 15.450  -43.023 45.414  1.00 82.57  ? 299  LYS C N     1 
ATOM   5950  C  CA    . LYS C 2  299  ? 14.681  -43.982 46.205  1.00 80.91  ? 299  LYS C CA    1 
ATOM   5951  C  C     . LYS C 2  299  ? 13.914  -43.317 47.347  1.00 78.22  ? 299  LYS C C     1 
ATOM   5952  O  O     . LYS C 2  299  ? 14.460  -42.491 48.080  1.00 76.42  ? 299  LYS C O     1 
ATOM   5953  C  CB    . LYS C 2  299  ? 15.574  -45.114 46.726  1.00 81.65  ? 299  LYS C CB    1 
ATOM   5954  C  CG    . LYS C 2  299  ? 15.498  -46.405 45.906  1.00 87.87  ? 299  LYS C CG    1 
ATOM   5955  C  CD    . LYS C 2  299  ? 14.199  -47.179 46.160  1.00 87.97  ? 299  LYS C CD    1 
ATOM   5956  C  CE    . LYS C 2  299  ? 13.127  -46.889 45.109  1.00 82.38  ? 299  LYS C CE    1 
ATOM   5957  N  NZ    . LYS C 2  299  ? 11.843  -47.589 45.396  1.00 67.47  ? 299  LYS C NZ    1 
ATOM   5958  N  N     . ASP C 2  300  ? 12.646  -43.695 47.489  1.00 79.65  ? 300  ASP C N     1 
ATOM   5959  C  CA    . ASP C 2  300  ? 11.726  -43.040 48.419  1.00 77.92  ? 300  ASP C CA    1 
ATOM   5960  C  C     . ASP C 2  300  ? 11.925  -43.442 49.881  1.00 72.43  ? 300  ASP C C     1 
ATOM   5961  O  O     . ASP C 2  300  ? 12.295  -44.576 50.185  1.00 70.33  ? 300  ASP C O     1 
ATOM   5962  C  CB    . ASP C 2  300  ? 10.276  -43.309 48.000  1.00 77.61  ? 300  ASP C CB    1 
ATOM   5963  C  CG    . ASP C 2  300  ? 9.268   -42.606 48.892  1.00 69.62  ? 300  ASP C CG    1 
ATOM   5964  O  OD1   . ASP C 2  300  ? 9.596   -41.528 49.432  1.00 74.11  ? 300  ASP C OD1   1 
ATOM   5965  O  OD2   . ASP C 2  300  ? 8.146   -43.129 49.053  1.00 63.04  ? 300  ASP C OD2   1 
ATOM   5966  N  N     . GLU C 2  301  ? 11.670  -42.495 50.779  1.00 72.74  ? 301  GLU C N     1 
ATOM   5967  C  CA    . GLU C 2  301  ? 11.730  -42.745 52.214  1.00 71.12  ? 301  GLU C CA    1 
ATOM   5968  C  C     . GLU C 2  301  ? 10.407  -42.398 52.897  1.00 61.71  ? 301  GLU C C     1 
ATOM   5969  O  O     . GLU C 2  301  ? 9.663   -43.278 53.324  1.00 60.11  ? 301  GLU C O     1 
ATOM   5970  C  CB    . GLU C 2  301  ? 12.856  -41.926 52.849  1.00 64.68  ? 301  GLU C CB    1 
ATOM   5971  C  CG    . GLU C 2  301  ? 14.254  -42.313 52.403  1.00 63.07  ? 301  GLU C CG    1 
ATOM   5972  C  CD    . GLU C 2  301  ? 14.850  -43.408 53.259  1.00 61.87  ? 301  GLU C CD    1 
ATOM   5973  O  OE1   . GLU C 2  301  ? 16.077  -43.625 53.180  1.00 66.70  ? 301  GLU C OE1   1 
ATOM   5974  O  OE2   . GLU C 2  301  ? 14.091  -44.050 54.014  1.00 64.03  ? 301  GLU C OE2   1 
ATOM   5975  N  N     . VAL C 2  302  ? 10.139  -41.101 53.005  1.00 64.98  ? 302  VAL C N     1 
ATOM   5976  C  CA    . VAL C 2  302  ? 8.985   -40.582 53.739  1.00 55.84  ? 302  VAL C CA    1 
ATOM   5977  C  C     . VAL C 2  302  ? 7.660   -40.576 52.959  1.00 51.37  ? 302  VAL C C     1 
ATOM   5978  O  O     . VAL C 2  302  ? 6.599   -40.858 53.524  1.00 51.34  ? 302  VAL C O     1 
ATOM   5979  C  CB    . VAL C 2  302  ? 9.292   -39.168 54.293  1.00 44.31  ? 302  VAL C CB    1 
ATOM   5980  C  CG1   . VAL C 2  302  ? 8.105   -38.607 55.052  1.00 44.83  ? 302  VAL C CG1   1 
ATOM   5981  C  CG2   . VAL C 2  302  ? 10.518  -39.217 55.190  1.00 45.64  ? 302  VAL C CG2   1 
ATOM   5982  N  N     . PHE C 2  303  ? 7.727   -40.258 51.668  1.00 49.26  ? 303  PHE C N     1 
ATOM   5983  C  CA    . PHE C 2  303  ? 6.529   -40.004 50.860  1.00 46.63  ? 303  PHE C CA    1 
ATOM   5984  C  C     . PHE C 2  303  ? 5.460   -41.097 50.874  1.00 49.73  ? 303  PHE C C     1 
ATOM   5985  O  O     . PHE C 2  303  ? 4.296   -40.823 51.168  1.00 49.16  ? 303  PHE C O     1 
ATOM   5986  C  CB    . PHE C 2  303  ? 6.909   -39.652 49.419  1.00 44.62  ? 303  PHE C CB    1 
ATOM   5987  C  CG    . PHE C 2  303  ? 7.415   -38.251 49.260  1.00 45.69  ? 303  PHE C CG    1 
ATOM   5988  C  CD1   . PHE C 2  303  ? 8.772   -37.980 49.303  1.00 45.48  ? 303  PHE C CD1   1 
ATOM   5989  C  CD2   . PHE C 2  303  ? 6.530   -37.201 49.084  1.00 49.10  ? 303  PHE C CD2   1 
ATOM   5990  C  CE1   . PHE C 2  303  ? 9.237   -36.687 49.165  1.00 47.45  ? 303  PHE C CE1   1 
ATOM   5991  C  CE2   . PHE C 2  303  ? 6.988   -35.906 48.946  1.00 44.27  ? 303  PHE C CE2   1 
ATOM   5992  C  CZ    . PHE C 2  303  ? 8.344   -35.649 48.986  1.00 46.30  ? 303  PHE C CZ    1 
ATOM   5993  N  N     . LEU C 2  304  ? 5.846   -42.326 50.551  1.00 49.51  ? 304  LEU C N     1 
ATOM   5994  C  CA    . LEU C 2  304  ? 4.883   -43.427 50.534  1.00 51.15  ? 304  LEU C CA    1 
ATOM   5995  C  C     . LEU C 2  304  ? 4.266   -43.735 51.909  1.00 47.70  ? 304  LEU C C     1 
ATOM   5996  O  O     . LEU C 2  304  ? 3.051   -43.898 52.004  1.00 45.24  ? 304  LEU C O     1 
ATOM   5997  C  CB    . LEU C 2  304  ? 5.471   -44.688 49.885  1.00 56.19  ? 304  LEU C CB    1 
ATOM   5998  C  CG    . LEU C 2  304  ? 4.515   -45.873 49.735  1.00 48.93  ? 304  LEU C CG    1 
ATOM   5999  C  CD1   . LEU C 2  304  ? 3.358   -45.520 48.812  1.00 41.58  ? 304  LEU C CD1   1 
ATOM   6000  C  CD2   . LEU C 2  304  ? 5.260   -47.102 49.233  1.00 54.75  ? 304  LEU C CD2   1 
ATOM   6001  N  N     . PRO C 2  305  ? 5.091   -43.822 52.974  1.00 43.68  ? 305  PRO C N     1 
ATOM   6002  C  CA    . PRO C 2  305  ? 4.483   -43.998 54.299  1.00 45.43  ? 305  PRO C CA    1 
ATOM   6003  C  C     . PRO C 2  305  ? 3.540   -42.857 54.678  1.00 42.14  ? 305  PRO C C     1 
ATOM   6004  O  O     . PRO C 2  305  ? 2.505   -43.101 55.302  1.00 44.97  ? 305  PRO C O     1 
ATOM   6005  C  CB    . PRO C 2  305  ? 5.693   -44.006 55.235  1.00 45.38  ? 305  PRO C CB    1 
ATOM   6006  C  CG    . PRO C 2  305  ? 6.795   -44.533 54.398  1.00 41.98  ? 305  PRO C CG    1 
ATOM   6007  C  CD    . PRO C 2  305  ? 6.557   -43.976 53.028  1.00 40.39  ? 305  PRO C CD    1 
ATOM   6008  N  N     . THR C 2  306  ? 3.897   -41.631 54.302  1.00 45.01  ? 306  THR C N     1 
ATOM   6009  C  CA    . THR C 2  306  ? 3.054   -40.472 54.583  1.00 44.91  ? 306  THR C CA    1 
ATOM   6010  C  C     . THR C 2  306  ? 1.712   -40.588 53.868  1.00 44.79  ? 306  THR C C     1 
ATOM   6011  O  O     . THR C 2  306  ? 0.660   -40.366 54.468  1.00 36.50  ? 306  THR C O     1 
ATOM   6012  C  CB    . THR C 2  306  ? 3.738   -39.153 54.169  1.00 39.92  ? 306  THR C CB    1 
ATOM   6013  O  OG1   . THR C 2  306  ? 4.921   -38.961 54.952  1.00 34.18  ? 306  THR C OG1   1 
ATOM   6014  C  CG2   . THR C 2  306  ? 2.802   -37.973 54.388  1.00 36.18  ? 306  THR C CG2   1 
ATOM   6015  N  N     . LEU C 2  307  ? 1.762   -40.942 52.586  1.00 49.97  ? 307  LEU C N     1 
ATOM   6016  C  CA    . LEU C 2  307  ? 0.561   -41.106 51.768  1.00 50.50  ? 307  LEU C CA    1 
ATOM   6017  C  C     . LEU C 2  307  ? -0.327  -42.224 52.312  1.00 48.70  ? 307  LEU C C     1 
ATOM   6018  O  O     . LEU C 2  307  ? -1.554  -42.088 52.387  1.00 45.01  ? 307  LEU C O     1 
ATOM   6019  C  CB    . LEU C 2  307  ? 0.955   -41.398 50.318  1.00 45.77  ? 307  LEU C CB    1 
ATOM   6020  C  CG    . LEU C 2  307  ? -0.150  -41.610 49.283  1.00 47.79  ? 307  LEU C CG    1 
ATOM   6021  C  CD1   . LEU C 2  307  ? -1.129  -40.449 49.295  1.00 50.24  ? 307  LEU C CD1   1 
ATOM   6022  C  CD2   . LEU C 2  307  ? 0.455   -41.788 47.896  1.00 45.83  ? 307  LEU C CD2   1 
ATOM   6023  N  N     . ARG C 2  308  ? 0.313   -43.324 52.697  1.00 45.79  ? 308  ARG C N     1 
ATOM   6024  C  CA    . ARG C 2  308  ? -0.370  -44.473 53.277  1.00 48.56  ? 308  ARG C CA    1 
ATOM   6025  C  C     . ARG C 2  308  ? -1.113  -44.063 54.546  1.00 48.79  ? 308  ARG C C     1 
ATOM   6026  O  O     . ARG C 2  308  ? -2.302  -44.357 54.703  1.00 45.90  ? 308  ARG C O     1 
ATOM   6027  C  CB    . ARG C 2  308  ? 0.646   -45.585 53.569  1.00 46.05  ? 308  ARG C CB    1 
ATOM   6028  C  CG    . ARG C 2  308  ? 0.055   -46.943 53.934  1.00 48.68  ? 308  ARG C CG    1 
ATOM   6029  C  CD    . ARG C 2  308  ? -0.125  -47.082 55.435  1.00 50.14  ? 308  ARG C CD    1 
ATOM   6030  N  NE    . ARG C 2  308  ? 1.039   -46.581 56.158  1.00 56.40  ? 308  ARG C NE    1 
ATOM   6031  C  CZ    . ARG C 2  308  ? 0.996   -46.095 57.395  1.00 57.93  ? 308  ARG C CZ    1 
ATOM   6032  N  NH1   . ARG C 2  308  ? -0.159  -46.044 58.046  1.00 52.13  ? 308  ARG C NH1   1 
ATOM   6033  N  NH2   . ARG C 2  308  ? 2.106   -45.655 57.978  1.00 49.37  ? 308  ARG C NH2   1 
ATOM   6034  N  N     . TYR C 2  309  ? -0.408  -43.376 55.444  1.00 46.39  ? 309  TYR C N     1 
ATOM   6035  C  CA    . TYR C 2  309  ? -1.005  -42.927 56.698  1.00 39.38  ? 309  TYR C CA    1 
ATOM   6036  C  C     . TYR C 2  309  ? -2.152  -41.957 56.439  1.00 35.22  ? 309  TYR C C     1 
ATOM   6037  O  O     . TYR C 2  309  ? -3.199  -42.051 57.072  1.00 34.76  ? 309  TYR C O     1 
ATOM   6038  C  CB    . TYR C 2  309  ? 0.045   -42.271 57.604  1.00 39.41  ? 309  TYR C CB    1 
ATOM   6039  C  CG    . TYR C 2  309  ? -0.387  -42.120 59.051  1.00 36.62  ? 309  TYR C CG    1 
ATOM   6040  C  CD1   . TYR C 2  309  ? 0.180   -42.900 60.051  1.00 37.51  ? 309  TYR C CD1   1 
ATOM   6041  C  CD2   . TYR C 2  309  ? -1.365  -41.199 59.418  1.00 35.67  ? 309  TYR C CD2   1 
ATOM   6042  C  CE1   . TYR C 2  309  ? -0.213  -42.764 61.374  1.00 36.26  ? 309  TYR C CE1   1 
ATOM   6043  C  CE2   . TYR C 2  309  ? -1.765  -41.060 60.734  1.00 31.32  ? 309  TYR C CE2   1 
ATOM   6044  C  CZ    . TYR C 2  309  ? -1.187  -41.844 61.707  1.00 32.96  ? 309  TYR C CZ    1 
ATOM   6045  O  OH    . TYR C 2  309  ? -1.585  -41.702 63.016  1.00 35.78  ? 309  TYR C OH    1 
ATOM   6046  N  N     . LEU C 2  310  ? -1.947  -41.026 55.513  1.00 42.13  ? 310  LEU C N     1 
ATOM   6047  C  CA    . LEU C 2  310  ? -2.965  -40.032 55.180  1.00 45.78  ? 310  LEU C CA    1 
ATOM   6048  C  C     . LEU C 2  310  ? -4.249  -40.694 54.693  1.00 45.43  ? 310  LEU C C     1 
ATOM   6049  O  O     . LEU C 2  310  ? -5.347  -40.372 55.163  1.00 40.12  ? 310  LEU C O     1 
ATOM   6050  C  CB    . LEU C 2  310  ? -2.443  -39.058 54.120  1.00 38.84  ? 310  LEU C CB    1 
ATOM   6051  C  CG    . LEU C 2  310  ? -3.471  -38.075 53.552  1.00 47.38  ? 310  LEU C CG    1 
ATOM   6052  C  CD1   . LEU C 2  310  ? -4.029  -37.174 54.646  1.00 44.58  ? 310  LEU C CD1   1 
ATOM   6053  C  CD2   . LEU C 2  310  ? -2.872  -37.249 52.421  1.00 48.07  ? 310  LEU C CD2   1 
ATOM   6054  N  N     . PHE C 2  311  ? -4.105  -41.625 53.753  1.00 49.86  ? 311  PHE C N     1 
ATOM   6055  C  CA    . PHE C 2  311  ? -5.254  -42.365 53.244  1.00 54.26  ? 311  PHE C CA    1 
ATOM   6056  C  C     . PHE C 2  311  ? -5.922  -43.185 54.348  1.00 49.92  ? 311  PHE C C     1 
ATOM   6057  O  O     . PHE C 2  311  ? -7.149  -43.278 54.405  1.00 47.59  ? 311  PHE C O     1 
ATOM   6058  C  CB    . PHE C 2  311  ? -4.855  -43.259 52.065  1.00 53.72  ? 311  PHE C CB    1 
ATOM   6059  C  CG    . PHE C 2  311  ? -4.712  -42.519 50.761  1.00 62.56  ? 311  PHE C CG    1 
ATOM   6060  C  CD1   . PHE C 2  311  ? -4.959  -41.156 50.689  1.00 64.78  ? 311  PHE C CD1   1 
ATOM   6061  C  CD2   . PHE C 2  311  ? -4.344  -43.188 49.605  1.00 60.60  ? 311  PHE C CD2   1 
ATOM   6062  C  CE1   . PHE C 2  311  ? -4.836  -40.474 49.492  1.00 64.19  ? 311  PHE C CE1   1 
ATOM   6063  C  CE2   . PHE C 2  311  ? -4.220  -42.510 48.404  1.00 65.34  ? 311  PHE C CE2   1 
ATOM   6064  C  CZ    . PHE C 2  311  ? -4.465  -41.152 48.349  1.00 70.96  ? 311  PHE C CZ    1 
ATOM   6065  N  N     . ALA C 2  312  ? -5.110  -43.764 55.230  1.00 44.17  ? 312  ALA C N     1 
ATOM   6066  C  CA    . ALA C 2  312  ? -5.630  -44.572 56.331  1.00 46.28  ? 312  ALA C CA    1 
ATOM   6067  C  C     . ALA C 2  312  ? -6.453  -43.735 57.310  1.00 45.97  ? 312  ALA C C     1 
ATOM   6068  O  O     . ALA C 2  312  ? -7.474  -44.189 57.826  1.00 44.30  ? 312  ALA C O     1 
ATOM   6069  C  CB    . ALA C 2  312  ? -4.495  -45.285 57.055  1.00 43.57  ? 312  ALA C CB    1 
ATOM   6070  N  N     . LEU C 2  313  ? -6.000  -42.511 57.560  1.00 46.88  ? 313  LEU C N     1 
ATOM   6071  C  CA    . LEU C 2  313  ? -6.707  -41.597 58.447  1.00 45.48  ? 313  LEU C CA    1 
ATOM   6072  C  C     . LEU C 2  313  ? -7.993  -41.118 57.786  1.00 48.17  ? 313  LEU C C     1 
ATOM   6073  O  O     . LEU C 2  313  ? -9.028  -40.979 58.443  1.00 39.51  ? 313  LEU C O     1 
ATOM   6074  C  CB    . LEU C 2  313  ? -5.819  -40.401 58.799  1.00 43.37  ? 313  LEU C CB    1 
ATOM   6075  C  CG    . LEU C 2  313  ? -6.455  -39.299 59.650  1.00 44.46  ? 313  LEU C CG    1 
ATOM   6076  C  CD1   . LEU C 2  313  ? -6.852  -39.833 61.018  1.00 42.65  ? 313  LEU C CD1   1 
ATOM   6077  C  CD2   . LEU C 2  313  ? -5.517  -38.110 59.783  1.00 46.01  ? 313  LEU C CD2   1 
ATOM   6078  N  N     . THR C 2  314  ? -7.921  -40.868 56.482  1.00 49.21  ? 314  THR C N     1 
ATOM   6079  C  CA    . THR C 2  314  ? -9.084  -40.407 55.733  1.00 45.21  ? 314  THR C CA    1 
ATOM   6080  C  C     . THR C 2  314  ? -10.170 -41.478 55.709  1.00 47.04  ? 314  THR C C     1 
ATOM   6081  O  O     . THR C 2  314  ? -11.360 -41.174 55.821  1.00 44.95  ? 314  THR C O     1 
ATOM   6082  C  CB    . THR C 2  314  ? -8.714  -40.037 54.287  1.00 45.40  ? 314  THR C CB    1 
ATOM   6083  O  OG1   . THR C 2  314  ? -7.494  -39.285 54.280  1.00 46.10  ? 314  THR C OG1   1 
ATOM   6084  C  CG2   . THR C 2  314  ? -9.823  -39.213 53.649  1.00 47.61  ? 314  THR C CG2   1 
ATOM   6085  N  N     . ALA C 2  315  ? -9.748  -42.732 55.574  1.00 50.16  ? 315  ALA C N     1 
ATOM   6086  C  CA    . ALA C 2  315  ? -10.671 -43.863 55.512  1.00 47.75  ? 315  ALA C CA    1 
ATOM   6087  C  C     . ALA C 2  315  ? -11.332 -44.158 56.860  1.00 42.04  ? 315  ALA C C     1 
ATOM   6088  O  O     . ALA C 2  315  ? -12.474 -44.615 56.913  1.00 39.27  ? 315  ALA C O     1 
ATOM   6089  C  CB    . ALA C 2  315  ? -9.954  -45.102 54.987  1.00 40.24  ? 315  ALA C CB    1 
ATOM   6090  N  N     . GLY C 2  316  ? -10.617 -43.885 57.946  1.00 44.49  ? 316  GLY C N     1 
ATOM   6091  C  CA    . GLY C 2  316  ? -11.129 -44.161 59.275  1.00 44.53  ? 316  GLY C CA    1 
ATOM   6092  C  C     . GLY C 2  316  ? -10.470 -45.362 59.925  1.00 44.86  ? 316  GLY C C     1 
ATOM   6093  O  O     . GLY C 2  316  ? -10.866 -45.779 61.015  1.00 49.44  ? 316  GLY C O     1 
ATOM   6094  N  N     . VAL C 2  317  ? -9.476  -45.925 59.243  1.00 39.60  ? 317  VAL C N     1 
ATOM   6095  C  CA    . VAL C 2  317  ? -8.718  -47.067 59.750  1.00 41.78  ? 317  VAL C CA    1 
ATOM   6096  C  C     . VAL C 2  317  ? -8.170  -46.792 61.153  1.00 43.43  ? 317  VAL C C     1 
ATOM   6097  O  O     . VAL C 2  317  ? -7.554  -45.753 61.388  1.00 46.38  ? 317  VAL C O     1 
ATOM   6098  C  CB    . VAL C 2  317  ? -7.550  -47.417 58.800  1.00 43.72  ? 317  VAL C CB    1 
ATOM   6099  C  CG1   . VAL C 2  317  ? -6.816  -48.662 59.276  1.00 41.49  ? 317  VAL C CG1   1 
ATOM   6100  C  CG2   . VAL C 2  317  ? -8.057  -47.597 57.374  1.00 38.87  ? 317  VAL C CG2   1 
ATOM   6101  N  N     . PRO C 2  318  ? -8.412  -47.721 62.094  1.00 45.68  ? 318  PRO C N     1 
ATOM   6102  C  CA    . PRO C 2  318  ? -7.990  -47.572 63.492  1.00 42.20  ? 318  PRO C CA    1 
ATOM   6103  C  C     . PRO C 2  318  ? -6.484  -47.396 63.632  1.00 45.31  ? 318  PRO C C     1 
ATOM   6104  O  O     . PRO C 2  318  ? -5.729  -47.838 62.766  1.00 49.16  ? 318  PRO C O     1 
ATOM   6105  C  CB    . PRO C 2  318  ? -8.421  -48.895 64.128  1.00 40.10  ? 318  PRO C CB    1 
ATOM   6106  C  CG    . PRO C 2  318  ? -9.550  -49.360 63.288  1.00 46.81  ? 318  PRO C CG    1 
ATOM   6107  C  CD    . PRO C 2  318  ? -9.205  -48.946 61.891  1.00 45.18  ? 318  PRO C CD    1 
ATOM   6108  N  N     . GLY C 2  319  ? -6.059  -46.754 64.716  1.00 42.10  ? 319  GLY C N     1 
ATOM   6109  C  CA    . GLY C 2  319  ? -4.647  -46.525 64.960  1.00 50.34  ? 319  GLY C CA    1 
ATOM   6110  C  C     . GLY C 2  319  ? -4.093  -45.387 64.125  1.00 55.08  ? 319  GLY C C     1 
ATOM   6111  O  O     . GLY C 2  319  ? -2.887  -45.303 63.893  1.00 56.96  ? 319  GLY C O     1 
ATOM   6112  N  N     . HIS C 2  320  ? -4.986  -44.517 63.663  1.00 56.33  ? 320  HIS C N     1 
ATOM   6113  C  CA    . HIS C 2  320  ? -4.594  -43.322 62.925  1.00 46.29  ? 320  HIS C CA    1 
ATOM   6114  C  C     . HIS C 2  320  ? -5.357  -42.114 63.460  1.00 48.19  ? 320  HIS C C     1 
ATOM   6115  O  O     . HIS C 2  320  ? -6.588  -42.077 63.423  1.00 44.33  ? 320  HIS C O     1 
ATOM   6116  C  CB    . HIS C 2  320  ? -4.848  -43.500 61.426  1.00 42.76  ? 320  HIS C CB    1 
ATOM   6117  C  CG    . HIS C 2  320  ? -4.092  -44.639 60.815  1.00 45.42  ? 320  HIS C CG    1 
ATOM   6118  N  ND1   . HIS C 2  320  ? -4.564  -45.934 60.819  1.00 49.26  ? 320  HIS C ND1   1 
ATOM   6119  C  CD2   . HIS C 2  320  ? -2.894  -44.678 60.185  1.00 45.73  ? 320  HIS C CD2   1 
ATOM   6120  C  CE1   . HIS C 2  320  ? -3.692  -46.721 60.215  1.00 46.48  ? 320  HIS C CE1   1 
ATOM   6121  N  NE2   . HIS C 2  320  ? -2.669  -45.983 59.821  1.00 42.85  ? 320  HIS C NE2   1 
ATOM   6122  N  N     . GLU C 2  321  ? -4.620  -41.132 63.969  1.00 47.74  ? 321  GLU C N     1 
ATOM   6123  C  CA    . GLU C 2  321  ? -5.222  -39.949 64.570  1.00 44.11  ? 321  GLU C CA    1 
ATOM   6124  C  C     . GLU C 2  321  ? -4.580  -38.692 64.007  1.00 43.11  ? 321  GLU C C     1 
ATOM   6125  O  O     . GLU C 2  321  ? -3.476  -38.739 63.464  1.00 36.68  ? 321  GLU C O     1 
ATOM   6126  C  CB    . GLU C 2  321  ? -5.017  -39.960 66.085  1.00 44.62  ? 321  GLU C CB    1 
ATOM   6127  C  CG    . GLU C 2  321  ? -5.212  -41.310 66.746  1.00 56.50  ? 321  GLU C CG    1 
ATOM   6128  C  CD    . GLU C 2  321  ? -4.257  -41.518 67.904  1.00 72.12  ? 321  GLU C CD    1 
ATOM   6129  O  OE1   . GLU C 2  321  ? -3.290  -40.734 68.021  1.00 60.80  ? 321  GLU C OE1   1 
ATOM   6130  O  OE2   . GLU C 2  321  ? -4.470  -42.463 68.693  1.00 77.55  ? 321  GLU C OE2   1 
ATOM   6131  N  N     . VAL C 2  322  ? -5.267  -37.564 64.151  1.00 41.26  ? 322  VAL C N     1 
ATOM   6132  C  CA    . VAL C 2  322  ? -4.677  -36.280 63.804  1.00 34.14  ? 322  VAL C CA    1 
ATOM   6133  C  C     . VAL C 2  322  ? -3.669  -35.902 64.879  1.00 32.26  ? 322  VAL C C     1 
ATOM   6134  O  O     . VAL C 2  322  ? -3.518  -36.614 65.871  1.00 39.02  ? 322  VAL C O     1 
ATOM   6135  C  CB    . VAL C 2  322  ? -5.739  -35.177 63.691  1.00 32.53  ? 322  VAL C CB    1 
ATOM   6136  C  CG1   . VAL C 2  322  ? -6.614  -35.413 62.476  1.00 43.49  ? 322  VAL C CG1   1 
ATOM   6137  C  CG2   . VAL C 2  322  ? -6.581  -35.127 64.951  1.00 32.31  ? 322  VAL C CG2   1 
ATOM   6138  N  N     . ASP C 2  323  ? -2.986  -34.779 64.697  1.00 29.35  ? 323  ASP C N     1 
ATOM   6139  C  CA    . ASP C 2  323  ? -1.975  -34.373 65.664  1.00 26.54  ? 323  ASP C CA    1 
ATOM   6140  C  C     . ASP C 2  323  ? -2.311  -33.062 66.353  1.00 26.33  ? 323  ASP C C     1 
ATOM   6141  O  O     . ASP C 2  323  ? -2.846  -32.139 65.736  1.00 27.33  ? 323  ASP C O     1 
ATOM   6142  C  CB    . ASP C 2  323  ? -0.599  -34.281 65.006  1.00 27.28  ? 323  ASP C CB    1 
ATOM   6143  C  CG    . ASP C 2  323  ? -0.113  -35.618 64.493  1.00 31.26  ? 323  ASP C CG    1 
ATOM   6144  O  OD1   . ASP C 2  323  ? 0.085   -36.532 65.321  1.00 29.42  ? 323  ASP C OD1   1 
ATOM   6145  O  OD2   . ASP C 2  323  ? 0.077   -35.754 63.265  1.00 31.56  ? 323  ASP C OD2   1 
ATOM   6146  N  N     . ASP C 2  324  ? -1.982  -32.987 67.637  1.00 25.90  ? 324  ASP C N     1 
ATOM   6147  C  CA    . ASP C 2  324  ? -2.138  -31.757 68.390  1.00 22.50  ? 324  ASP C CA    1 
ATOM   6148  C  C     . ASP C 2  324  ? -0.809  -31.035 68.256  1.00 23.55  ? 324  ASP C C     1 
ATOM   6149  O  O     . ASP C 2  324  ? 0.191   -31.458 68.829  1.00 27.47  ? 324  ASP C O     1 
ATOM   6150  C  CB    . ASP C 2  324  ? -2.416  -32.087 69.857  1.00 16.94  ? 324  ASP C CB    1 
ATOM   6151  C  CG    . ASP C 2  324  ? -2.839  -30.874 70.669  1.00 23.35  ? 324  ASP C CG    1 
ATOM   6152  O  OD1   . ASP C 2  324  ? -2.422  -29.744 70.337  1.00 27.59  ? 324  ASP C OD1   1 
ATOM   6153  O  OD2   . ASP C 2  324  ? -3.589  -31.055 71.653  1.00 17.56  ? 324  ASP C OD2   1 
ATOM   6154  N  N     . ILE C 2  325  ? -0.799  -29.938 67.508  1.00 19.95  ? 325  ILE C N     1 
ATOM   6155  C  CA    . ILE C 2  325  ? 0.452   -29.258 67.199  1.00 20.83  ? 325  ILE C CA    1 
ATOM   6156  C  C     . ILE C 2  325  ? 0.938   -28.419 68.377  1.00 21.89  ? 325  ILE C C     1 
ATOM   6157  O  O     . ILE C 2  325  ? 2.087   -27.978 68.400  1.00 19.48  ? 325  ILE C O     1 
ATOM   6158  C  CB    . ILE C 2  325  ? 0.343   -28.387 65.925  1.00 23.75  ? 325  ILE C CB    1 
ATOM   6159  C  CG1   . ILE C 2  325  ? -0.518  -27.151 66.178  1.00 23.18  ? 325  ILE C CG1   1 
ATOM   6160  C  CG2   . ILE C 2  325  ? -0.220  -29.198 64.771  1.00 15.29  ? 325  ILE C CG2   1 
ATOM   6161  C  CD1   . ILE C 2  325  ? -0.506  -26.166 65.029  1.00 18.21  ? 325  ILE C CD1   1 
ATOM   6162  N  N     . ASP C 2  326  ? 0.056   -28.205 69.350  1.00 20.15  ? 326  ASP C N     1 
ATOM   6163  C  CA    . ASP C 2  326  ? 0.406   -27.478 70.567  1.00 20.65  ? 326  ASP C CA    1 
ATOM   6164  C  C     . ASP C 2  326  ? 0.874   -28.420 71.669  1.00 20.33  ? 326  ASP C C     1 
ATOM   6165  O  O     . ASP C 2  326  ? 1.341   -27.975 72.721  1.00 18.13  ? 326  ASP C O     1 
ATOM   6166  C  CB    . ASP C 2  326  ? -0.781  -26.657 71.062  1.00 24.10  ? 326  ASP C CB    1 
ATOM   6167  C  CG    . ASP C 2  326  ? -1.131  -25.525 70.127  1.00 25.86  ? 326  ASP C CG    1 
ATOM   6168  O  OD1   . ASP C 2  326  ? -0.198  -24.881 69.600  1.00 24.94  ? 326  ASP C OD1   1 
ATOM   6169  O  OD2   . ASP C 2  326  ? -2.338  -25.286 69.917  1.00 29.61  ? 326  ASP C OD2   1 
ATOM   6170  N  N     . HIS C 2  327  ? 0.727   -29.719 71.424  1.00 18.93  ? 327  HIS C N     1 
ATOM   6171  C  CA    . HIS C 2  327  ? 1.194   -30.745 72.348  1.00 18.56  ? 327  HIS C CA    1 
ATOM   6172  C  C     . HIS C 2  327  ? 2.694   -30.565 72.506  1.00 14.45  ? 327  HIS C C     1 
ATOM   6173  O  O     . HIS C 2  327  ? 3.387   -30.273 71.535  1.00 14.67  ? 327  HIS C O     1 
ATOM   6174  C  CB    . HIS C 2  327  ? 0.880   -32.133 71.782  1.00 19.53  ? 327  HIS C CB    1 
ATOM   6175  C  CG    . HIS C 2  327  ? 0.889   -33.234 72.799  1.00 15.11  ? 327  HIS C CG    1 
ATOM   6176  N  ND1   . HIS C 2  327  ? 2.049   -33.838 73.237  1.00 14.75  ? 327  HIS C ND1   1 
ATOM   6177  C  CD2   . HIS C 2  327  ? -0.125  -33.864 73.439  1.00 15.92  ? 327  HIS C CD2   1 
ATOM   6178  C  CE1   . HIS C 2  327  ? 1.749   -34.780 74.114  1.00 14.71  ? 327  HIS C CE1   1 
ATOM   6179  N  NE2   . HIS C 2  327  ? 0.437   -34.815 74.255  1.00 12.88  ? 327  HIS C NE2   1 
ATOM   6180  N  N     . LEU C 2  328  ? 3.203   -30.752 73.718  1.00 13.64  ? 328  LEU C N     1 
ATOM   6181  C  CA    . LEU C 2  328  ? 4.618   -30.512 73.976  1.00 14.86  ? 328  LEU C CA    1 
ATOM   6182  C  C     . LEU C 2  328  ? 5.465   -31.703 73.551  1.00 15.41  ? 328  LEU C C     1 
ATOM   6183  O  O     . LEU C 2  328  ? 6.675   -31.736 73.780  1.00 15.37  ? 328  LEU C O     1 
ATOM   6184  C  CB    . LEU C 2  328  ? 4.877   -30.140 75.436  1.00 11.18  ? 328  LEU C CB    1 
ATOM   6185  C  CG    . LEU C 2  328  ? 4.637   -28.669 75.785  1.00 12.36  ? 328  LEU C CG    1 
ATOM   6186  C  CD1   . LEU C 2  328  ? 5.324   -28.312 77.090  1.00 14.53  ? 328  LEU C CD1   1 
ATOM   6187  C  CD2   . LEU C 2  328  ? 5.108   -27.751 74.666  1.00 11.46  ? 328  LEU C CD2   1 
ATOM   6188  N  N     . GLY C 2  329  ? 4.809   -32.694 72.958  1.00 14.36  ? 329  GLY C N     1 
ATOM   6189  C  CA    . GLY C 2  329  ? 5.505   -33.751 72.254  1.00 17.10  ? 329  GLY C CA    1 
ATOM   6190  C  C     . GLY C 2  329  ? 5.811   -33.301 70.838  1.00 19.42  ? 329  GLY C C     1 
ATOM   6191  O  O     . GLY C 2  329  ? 6.760   -33.769 70.216  1.00 24.14  ? 329  GLY C O     1 
ATOM   6192  N  N     . ASN C 2  330  ? 4.983   -32.400 70.320  1.00 23.48  ? 330  ASN C N     1 
ATOM   6193  C  CA    . ASN C 2  330  ? 5.173   -31.860 68.974  1.00 25.00  ? 330  ASN C CA    1 
ATOM   6194  C  C     . ASN C 2  330  ? 5.848   -30.481 68.908  1.00 18.49  ? 330  ASN C C     1 
ATOM   6195  O  O     . ASN C 2  330  ? 6.065   -29.942 67.823  1.00 19.29  ? 330  ASN C O     1 
ATOM   6196  C  CB    . ASN C 2  330  ? 3.845   -31.861 68.210  1.00 23.39  ? 330  ASN C CB    1 
ATOM   6197  C  CG    . ASN C 2  330  ? 3.221   -33.242 68.138  1.00 25.64  ? 330  ASN C CG    1 
ATOM   6198  O  OD1   . ASN C 2  330  ? 3.920   -34.254 68.201  1.00 31.70  ? 330  ASN C OD1   1 
ATOM   6199  N  ND2   . ASN C 2  330  ? 1.901   -33.292 68.010  1.00 26.36  ? 330  ASN C ND2   1 
ATOM   6200  N  N     . ARG C 2  331  ? 6.164   -29.912 70.069  1.00 15.47  ? 331  ARG C N     1 
ATOM   6201  C  CA    . ARG C 2  331  ? 6.867   -28.633 70.133  1.00 16.94  ? 331  ARG C CA    1 
ATOM   6202  C  C     . ARG C 2  331  ? 8.200   -28.802 70.845  1.00 14.76  ? 331  ARG C C     1 
ATOM   6203  O  O     . ARG C 2  331  ? 8.241   -29.234 71.996  1.00 12.78  ? 331  ARG C O     1 
ATOM   6204  C  CB    . ARG C 2  331  ? 6.041   -27.585 70.885  1.00 16.84  ? 331  ARG C CB    1 
ATOM   6205  C  CG    . ARG C 2  331  ? 4.668   -27.300 70.309  1.00 16.98  ? 331  ARG C CG    1 
ATOM   6206  C  CD    . ARG C 2  331  ? 4.009   -26.146 71.058  1.00 18.53  ? 331  ARG C CD    1 
ATOM   6207  N  NE    . ARG C 2  331  ? 4.593   -24.858 70.694  1.00 13.53  ? 331  ARG C NE    1 
ATOM   6208  C  CZ    . ARG C 2  331  ? 4.550   -23.770 71.457  1.00 11.87  ? 331  ARG C CZ    1 
ATOM   6209  N  NH1   . ARG C 2  331  ? 3.961   -23.804 72.643  1.00 9.45   ? 331  ARG C NH1   1 
ATOM   6210  N  NH2   . ARG C 2  331  ? 5.109   -22.647 71.035  1.00 16.96  ? 331  ARG C NH2   1 
ATOM   6211  N  N     . ARG C 2  332  ? 9.292   -28.451 70.174  1.00 15.46  ? 332  ARG C N     1 
ATOM   6212  C  CA    . ARG C 2  332  ? 10.608  -28.616 70.777  1.00 15.78  ? 332  ARG C CA    1 
ATOM   6213  C  C     . ARG C 2  332  ? 11.323  -27.291 71.012  1.00 13.34  ? 332  ARG C C     1 
ATOM   6214  O  O     . ARG C 2  332  ? 10.835  -26.225 70.623  1.00 14.19  ? 332  ARG C O     1 
ATOM   6215  C  CB    . ARG C 2  332  ? 11.482  -29.549 69.930  1.00 17.69  ? 332  ARG C CB    1 
ATOM   6216  C  CG    . ARG C 2  332  ? 11.704  -29.081 68.498  1.00 18.23  ? 332  ARG C CG    1 
ATOM   6217  C  CD    . ARG C 2  332  ? 12.643  -30.019 67.752  1.00 21.19  ? 332  ARG C CD    1 
ATOM   6218  N  NE    . ARG C 2  332  ? 13.965  -30.056 68.368  1.00 17.35  ? 332  ARG C NE    1 
ATOM   6219  C  CZ    . ARG C 2  332  ? 15.004  -29.346 67.945  1.00 17.89  ? 332  ARG C CZ    1 
ATOM   6220  N  NH1   . ARG C 2  332  ? 14.876  -28.552 66.892  1.00 17.18  ? 332  ARG C NH1   1 
ATOM   6221  N  NH2   . ARG C 2  332  ? 16.170  -29.433 68.570  1.00 16.35  ? 332  ARG C NH2   1 
ATOM   6222  N  N     . ILE C 2  333  ? 12.498  -27.384 71.629  1.00 15.63  ? 333  ILE C N     1 
ATOM   6223  C  CA    . ILE C 2  333  ? 13.281  -26.220 72.018  1.00 11.87  ? 333  ILE C CA    1 
ATOM   6224  C  C     . ILE C 2  333  ? 14.629  -26.170 71.301  1.00 16.14  ? 333  ILE C C     1 
ATOM   6225  O  O     . ILE C 2  333  ? 15.363  -27.156 71.270  1.00 20.84  ? 333  ILE C O     1 
ATOM   6226  C  CB    . ILE C 2  333  ? 13.563  -26.229 73.528  1.00 10.74  ? 333  ILE C CB    1 
ATOM   6227  C  CG1   . ILE C 2  333  ? 12.265  -26.363 74.320  1.00 10.91  ? 333  ILE C CG1   1 
ATOM   6228  C  CG2   . ILE C 2  333  ? 14.314  -24.973 73.935  1.00 12.12  ? 333  ILE C CG2   1 
ATOM   6229  C  CD1   . ILE C 2  333  ? 11.369  -25.159 74.220  1.00 12.43  ? 333  ILE C CD1   1 
ATOM   6230  N  N     . ARG C 2  334  ? 14.949  -25.015 70.729  1.00 14.85  ? 334  ARG C N     1 
ATOM   6231  C  CA    . ARG C 2  334  ? 16.264  -24.772 70.162  1.00 13.41  ? 334  ARG C CA    1 
ATOM   6232  C  C     . ARG C 2  334  ? 17.055  -23.926 71.148  1.00 12.27  ? 334  ARG C C     1 
ATOM   6233  O  O     . ARG C 2  334  ? 16.767  -22.743 71.336  1.00 13.31  ? 334  ARG C O     1 
ATOM   6234  C  CB    . ARG C 2  334  ? 16.135  -24.026 68.836  1.00 13.26  ? 334  ARG C CB    1 
ATOM   6235  C  CG    . ARG C 2  334  ? 15.018  -24.540 67.950  1.00 16.94  ? 334  ARG C CG    1 
ATOM   6236  C  CD    . ARG C 2  334  ? 14.985  -23.794 66.638  1.00 16.01  ? 334  ARG C CD    1 
ATOM   6237  N  NE    . ARG C 2  334  ? 16.232  -23.961 65.905  1.00 21.23  ? 334  ARG C NE    1 
ATOM   6238  C  CZ    . ARG C 2  334  ? 16.522  -23.330 64.774  1.00 31.56  ? 334  ARG C CZ    1 
ATOM   6239  N  NH1   . ARG C 2  334  ? 15.650  -22.480 64.247  1.00 31.27  ? 334  ARG C NH1   1 
ATOM   6240  N  NH2   . ARG C 2  334  ? 17.684  -23.546 64.172  1.00 32.33  ? 334  ARG C NH2   1 
ATOM   6241  N  N     . THR C 2  335  ? 18.051  -24.537 71.777  1.00 11.57  ? 335  THR C N     1 
ATOM   6242  C  CA    . THR C 2  335  ? 18.848  -23.854 72.787  1.00 8.63   ? 335  THR C CA    1 
ATOM   6243  C  C     . THR C 2  335  ? 20.032  -23.130 72.149  1.00 10.97  ? 335  THR C C     1 
ATOM   6244  O  O     . THR C 2  335  ? 20.185  -23.151 70.926  1.00 11.94  ? 335  THR C O     1 
ATOM   6245  C  CB    . THR C 2  335  ? 19.336  -24.839 73.865  1.00 10.70  ? 335  THR C CB    1 
ATOM   6246  O  OG1   . THR C 2  335  ? 19.877  -26.011 73.240  1.00 13.27  ? 335  THR C OG1   1 
ATOM   6247  C  CG2   . THR C 2  335  ? 18.181  -25.253 74.757  1.00 12.81  ? 335  THR C CG2   1 
ATOM   6248  N  N     . VAL C 2  336  ? 20.859  -22.500 72.982  1.00 9.02   ? 336  VAL C N     1 
ATOM   6249  C  CA    . VAL C 2  336  ? 21.995  -21.699 72.527  1.00 8.67   ? 336  VAL C CA    1 
ATOM   6250  C  C     . VAL C 2  336  ? 22.836  -22.414 71.483  1.00 13.48  ? 336  VAL C C     1 
ATOM   6251  O  O     . VAL C 2  336  ? 23.168  -21.849 70.436  1.00 14.34  ? 336  VAL C O     1 
ATOM   6252  C  CB    . VAL C 2  336  ? 22.943  -21.393 73.687  1.00 8.72   ? 336  VAL C CB    1 
ATOM   6253  C  CG1   . VAL C 2  336  ? 23.778  -20.164 73.373  1.00 9.13   ? 336  VAL C CG1   1 
ATOM   6254  C  CG2   . VAL C 2  336  ? 22.165  -21.201 74.958  1.00 15.35  ? 336  VAL C CG2   1 
ATOM   6255  N  N     . GLY C 2  337  ? 23.182  -23.661 71.787  1.00 12.94  ? 337  GLY C N     1 
ATOM   6256  C  CA    . GLY C 2  337  ? 24.024  -24.464 70.926  1.00 8.87   ? 337  GLY C CA    1 
ATOM   6257  C  C     . GLY C 2  337  ? 23.467  -24.615 69.529  1.00 8.86   ? 337  GLY C C     1 
ATOM   6258  O  O     . GLY C 2  337  ? 24.195  -24.467 68.553  1.00 11.90  ? 337  GLY C O     1 
ATOM   6259  N  N     . GLU C 2  338  ? 22.173  -24.895 69.430  1.00 9.69   ? 338  GLU C N     1 
ATOM   6260  C  CA    . GLU C 2  338  ? 21.544  -25.099 68.128  1.00 15.05  ? 338  GLU C CA    1 
ATOM   6261  C  C     . GLU C 2  338  ? 21.471  -23.812 67.303  1.00 15.39  ? 338  GLU C C     1 
ATOM   6262  O  O     . GLU C 2  338  ? 21.733  -23.827 66.101  1.00 18.55  ? 338  GLU C O     1 
ATOM   6263  C  CB    . GLU C 2  338  ? 20.153  -25.721 68.281  1.00 10.67  ? 338  GLU C CB    1 
ATOM   6264  C  CG    . GLU C 2  338  ? 19.492  -26.056 66.959  1.00 14.85  ? 338  GLU C CG    1 
ATOM   6265  C  CD    . GLU C 2  338  ? 18.179  -26.797 67.126  1.00 22.23  ? 338  GLU C CD    1 
ATOM   6266  O  OE1   . GLU C 2  338  ? 17.909  -27.299 68.237  1.00 19.64  ? 338  GLU C OE1   1 
ATOM   6267  O  OE2   . GLU C 2  338  ? 17.414  -26.875 66.141  1.00 30.13  ? 338  GLU C OE2   1 
ATOM   6268  N  N     . LEU C 2  339  ? 21.122  -22.705 67.952  1.00 13.36  ? 339  LEU C N     1 
ATOM   6269  C  CA    . LEU C 2  339  ? 21.020  -21.414 67.276  1.00 14.71  ? 339  LEU C CA    1 
ATOM   6270  C  C     . LEU C 2  339  ? 22.382  -20.937 66.763  1.00 16.28  ? 339  LEU C C     1 
ATOM   6271  O  O     . LEU C 2  339  ? 22.546  -20.600 65.571  1.00 22.36  ? 339  LEU C O     1 
ATOM   6272  C  CB    . LEU C 2  339  ? 20.418  -20.382 68.227  1.00 16.89  ? 339  LEU C CB    1 
ATOM   6273  C  CG    . LEU C 2  339  ? 19.080  -20.804 68.841  1.00 13.80  ? 339  LEU C CG    1 
ATOM   6274  C  CD1   . LEU C 2  339  ? 18.562  -19.754 69.811  1.00 9.19   ? 339  LEU C CD1   1 
ATOM   6275  C  CD2   . LEU C 2  339  ? 18.055  -21.090 67.751  1.00 14.71  ? 339  LEU C CD2   1 
ATOM   6276  N  N     . MET C 2  340  ? 23.356  -20.922 67.669  1.00 13.88  ? 340  MET C N     1 
ATOM   6277  C  CA    . MET C 2  340  ? 24.725  -20.564 67.316  1.00 16.82  ? 340  MET C CA    1 
ATOM   6278  C  C     . MET C 2  340  ? 25.261  -21.471 66.208  1.00 15.29  ? 340  MET C C     1 
ATOM   6279  O  O     . MET C 2  340  ? 25.888  -21.001 65.258  1.00 17.34  ? 340  MET C O     1 
ATOM   6280  C  CB    . MET C 2  340  ? 25.632  -20.626 68.547  1.00 11.53  ? 340  MET C CB    1 
ATOM   6281  C  CG    . MET C 2  340  ? 27.022  -20.050 68.329  1.00 13.63  ? 340  MET C CG    1 
ATOM   6282  S  SD    . MET C 2  340  ? 28.154  -21.148 67.445  1.00 13.05  ? 340  MET C SD    1 
ATOM   6283  C  CE    . MET C 2  340  ? 28.259  -22.519 68.590  1.00 14.73  ? 340  MET C CE    1 
ATOM   6284  N  N     . THR C 2  341  ? 25.017  -22.770 66.333  1.00 14.44  ? 341  THR C N     1 
ATOM   6285  C  CA    . THR C 2  341  ? 25.443  -23.713 65.307  1.00 18.83  ? 341  THR C CA    1 
ATOM   6286  C  C     . THR C 2  341  ? 24.792  -23.394 63.965  1.00 19.87  ? 341  THR C C     1 
ATOM   6287  O  O     . THR C 2  341  ? 25.422  -23.521 62.920  1.00 24.87  ? 341  THR C O     1 
ATOM   6288  C  CB    . THR C 2  341  ? 25.137  -25.163 65.710  1.00 11.67  ? 341  THR C CB    1 
ATOM   6289  O  OG1   . THR C 2  341  ? 25.907  -25.498 66.870  1.00 10.36  ? 341  THR C OG1   1 
ATOM   6290  C  CG2   . THR C 2  341  ? 25.484  -26.120 64.588  1.00 15.55  ? 341  THR C CG2   1 
ATOM   6291  N  N     . ASP C 2  342  ? 23.538  -22.962 64.000  1.00 14.78  ? 342  ASP C N     1 
ATOM   6292  C  CA    . ASP C 2  342  ? 22.817  -22.633 62.779  1.00 15.82  ? 342  ASP C CA    1 
ATOM   6293  C  C     . ASP C 2  342  ? 23.499  -21.475 62.060  1.00 18.47  ? 342  ASP C C     1 
ATOM   6294  O  O     . ASP C 2  342  ? 23.816  -21.559 60.857  1.00 25.48  ? 342  ASP C O     1 
ATOM   6295  C  CB    . ASP C 2  342  ? 21.371  -22.271 63.104  1.00 20.96  ? 342  ASP C CB    1 
ATOM   6296  C  CG    . ASP C 2  342  ? 20.404  -22.719 62.034  1.00 30.82  ? 342  ASP C CG    1 
ATOM   6297  O  OD1   . ASP C 2  342  ? 20.830  -22.874 60.870  1.00 44.12  ? 342  ASP C OD1   1 
ATOM   6298  O  OD2   . ASP C 2  342  ? 19.215  -22.917 62.359  1.00 40.03  ? 342  ASP C OD2   1 
ATOM   6299  N  N     . GLN C 2  343  ? 23.742  -20.394 62.795  1.00 15.65  ? 343  GLN C N     1 
ATOM   6300  C  CA    . GLN C 2  343  ? 24.414  -19.249 62.177  1.00 20.74  ? 343  GLN C CA    1 
ATOM   6301  C  C     . GLN C 2  343  ? 25.835  -19.592 61.718  1.00 19.92  ? 343  GLN C C     1 
ATOM   6302  O  O     . GLN C 2  343  ? 26.326  -19.064 60.709  1.00 20.40  ? 343  GLN C O     1 
ATOM   6303  C  CB    . GLN C 2  343  ? 24.403  -18.031 63.102  1.00 19.38  ? 343  GLN C CB    1 
ATOM   6304  C  CG    . GLN C 2  343  ? 23.006  -17.476 63.334  1.00 22.05  ? 343  GLN C CG    1 
ATOM   6305  C  CD    . GLN C 2  343  ? 22.144  -17.527 62.080  1.00 20.97  ? 343  GLN C CD    1 
ATOM   6306  O  OE1   . GLN C 2  343  ? 21.191  -18.302 62.001  1.00 19.09  ? 343  GLN C OE1   1 
ATOM   6307  N  NE2   . GLN C 2  343  ? 22.478  -16.699 61.093  1.00 16.67  ? 343  GLN C NE2   1 
ATOM   6308  N  N     . PHE C 2  344  ? 26.475  -20.493 62.457  1.00 22.89  ? 344  PHE C N     1 
ATOM   6309  C  CA    . PHE C 2  344  ? 27.793  -20.998 62.094  1.00 23.31  ? 344  PHE C CA    1 
ATOM   6310  C  C     . PHE C 2  344  ? 27.727  -21.701 60.740  1.00 20.08  ? 344  PHE C C     1 
ATOM   6311  O  O     . PHE C 2  344  ? 28.593  -21.516 59.886  1.00 24.60  ? 344  PHE C O     1 
ATOM   6312  C  CB    . PHE C 2  344  ? 28.304  -21.963 63.168  1.00 23.14  ? 344  PHE C CB    1 
ATOM   6313  C  CG    . PHE C 2  344  ? 29.765  -22.289 63.047  1.00 19.11  ? 344  PHE C CG    1 
ATOM   6314  C  CD1   . PHE C 2  344  ? 30.198  -23.296 62.200  1.00 20.36  ? 344  PHE C CD1   1 
ATOM   6315  C  CD2   . PHE C 2  344  ? 30.705  -21.587 63.781  1.00 14.34  ? 344  PHE C CD2   1 
ATOM   6316  C  CE1   . PHE C 2  344  ? 31.542  -23.594 62.085  1.00 24.11  ? 344  PHE C CE1   1 
ATOM   6317  C  CE2   . PHE C 2  344  ? 32.049  -21.880 63.671  1.00 17.22  ? 344  PHE C CE2   1 
ATOM   6318  C  CZ    . PHE C 2  344  ? 32.470  -22.885 62.823  1.00 19.97  ? 344  PHE C CZ    1 
ATOM   6319  N  N     . ARG C 2  345  ? 26.685  -22.501 60.556  1.00 20.09  ? 345  ARG C N     1 
ATOM   6320  C  CA    . ARG C 2  345  ? 26.454  -23.223 59.311  1.00 24.01  ? 345  ARG C CA    1 
ATOM   6321  C  C     . ARG C 2  345  ? 26.279  -22.253 58.151  1.00 23.27  ? 345  ARG C C     1 
ATOM   6322  O  O     . ARG C 2  345  ? 26.853  -22.445 57.076  1.00 24.65  ? 345  ARG C O     1 
ATOM   6323  C  CB    . ARG C 2  345  ? 25.214  -24.099 59.452  1.00 22.83  ? 345  ARG C CB    1 
ATOM   6324  C  CG    . ARG C 2  345  ? 24.908  -24.985 58.268  1.00 28.52  ? 345  ARG C CG    1 
ATOM   6325  C  CD    . ARG C 2  345  ? 23.813  -25.958 58.659  1.00 49.10  ? 345  ARG C CD    1 
ATOM   6326  N  NE    . ARG C 2  345  ? 24.178  -26.690 59.872  1.00 53.03  ? 345  ARG C NE    1 
ATOM   6327  C  CZ    . ARG C 2  345  ? 23.324  -27.367 60.635  1.00 58.50  ? 345  ARG C CZ    1 
ATOM   6328  N  NH1   . ARG C 2  345  ? 22.034  -27.411 60.322  1.00 60.69  ? 345  ARG C NH1   1 
ATOM   6329  N  NH2   . ARG C 2  345  ? 23.763  -27.997 61.718  1.00 41.99  ? 345  ARG C NH2   1 
ATOM   6330  N  N     . VAL C 2  346  ? 25.492  -21.204 58.376  1.00 23.53  ? 346  VAL C N     1 
ATOM   6331  C  CA    . VAL C 2  346  ? 25.309  -20.172 57.351  1.00 28.17  ? 346  VAL C CA    1 
ATOM   6332  C  C     . VAL C 2  346  ? 26.617  -19.459 56.939  1.00 29.18  ? 346  VAL C C     1 
ATOM   6333  O  O     . VAL C 2  346  ? 26.960  -19.389 55.739  1.00 29.40  ? 346  VAL C O     1 
ATOM   6334  C  CB    . VAL C 2  346  ? 24.245  -19.147 57.788  1.00 26.12  ? 346  VAL C CB    1 
ATOM   6335  C  CG1   . VAL C 2  346  ? 24.362  -17.864 56.980  1.00 21.78  ? 346  VAL C CG1   1 
ATOM   6336  C  CG2   . VAL C 2  346  ? 22.856  -19.753 57.654  1.00 23.48  ? 346  VAL C CG2   1 
ATOM   6337  N  N     . GLY C 2  347  ? 27.346  -18.942 57.928  1.00 24.71  ? 347  GLY C N     1 
ATOM   6338  C  CA    . GLY C 2  347  ? 28.614  -18.279 57.663  1.00 25.66  ? 347  GLY C CA    1 
ATOM   6339  C  C     . GLY C 2  347  ? 29.611  -19.193 56.968  1.00 30.38  ? 347  GLY C C     1 
ATOM   6340  O  O     . GLY C 2  347  ? 30.371  -18.769 56.087  1.00 31.79  ? 347  GLY C O     1 
ATOM   6341  N  N     . LEU C 2  348  ? 29.595  -20.461 57.366  1.00 29.02  ? 348  LEU C N     1 
ATOM   6342  C  CA    . LEU C 2  348  ? 30.446  -21.474 56.756  1.00 30.57  ? 348  LEU C CA    1 
ATOM   6343  C  C     . LEU C 2  348  ? 30.085  -21.674 55.288  1.00 34.54  ? 348  LEU C C     1 
ATOM   6344  O  O     . LEU C 2  348  ? 30.966  -21.805 54.437  1.00 31.49  ? 348  LEU C O     1 
ATOM   6345  C  CB    . LEU C 2  348  ? 30.322  -22.797 57.511  1.00 24.15  ? 348  LEU C CB    1 
ATOM   6346  C  CG    . LEU C 2  348  ? 31.630  -23.548 57.735  1.00 22.97  ? 348  LEU C CG    1 
ATOM   6347  C  CD1   . LEU C 2  348  ? 32.646  -22.628 58.395  1.00 28.56  ? 348  LEU C CD1   1 
ATOM   6348  C  CD2   . LEU C 2  348  ? 31.386  -24.778 58.584  1.00 19.98  ? 348  LEU C CD2   1 
ATOM   6349  N  N     . ALA C 2  349  ? 28.785  -21.704 55.000  1.00 36.48  ? 349  ALA C N     1 
ATOM   6350  C  CA    . ALA C 2  349  ? 28.310  -21.833 53.625  1.00 32.92  ? 349  ALA C CA    1 
ATOM   6351  C  C     . ALA C 2  349  ? 28.823  -20.680 52.771  1.00 32.09  ? 349  ALA C C     1 
ATOM   6352  O  O     . ALA C 2  349  ? 29.286  -20.882 51.638  1.00 40.74  ? 349  ALA C O     1 
ATOM   6353  C  CB    . ALA C 2  349  ? 26.794  -21.886 53.588  1.00 28.16  ? 349  ALA C CB    1 
ATOM   6354  N  N     . ARG C 2  350  ? 28.748  -19.470 53.318  1.00 29.77  ? 350  ARG C N     1 
ATOM   6355  C  CA    . ARG C 2  350  ? 29.271  -18.307 52.600  1.00 35.18  ? 350  ARG C CA    1 
ATOM   6356  C  C     . ARG C 2  350  ? 30.776  -18.429 52.331  1.00 39.92  ? 350  ARG C C     1 
ATOM   6357  O  O     . ARG C 2  350  ? 31.247  -18.206 51.198  1.00 44.93  ? 350  ARG C O     1 
ATOM   6358  C  CB    . ARG C 2  350  ? 28.943  -17.020 53.355  1.00 26.48  ? 350  ARG C CB    1 
ATOM   6359  C  CG    . ARG C 2  350  ? 27.462  -16.698 53.337  1.00 30.17  ? 350  ARG C CG    1 
ATOM   6360  C  CD    . ARG C 2  350  ? 27.085  -15.677 54.392  1.00 43.04  ? 350  ARG C CD    1 
ATOM   6361  N  NE    . ARG C 2  350  ? 25.636  -15.512 54.476  1.00 30.82  ? 350  ARG C NE    1 
ATOM   6362  C  CZ    . ARG C 2  350  ? 25.014  -14.866 55.455  1.00 26.62  ? 350  ARG C CZ    1 
ATOM   6363  N  NH1   . ARG C 2  350  ? 25.714  -14.326 56.445  1.00 32.85  ? 350  ARG C NH1   1 
ATOM   6364  N  NH2   . ARG C 2  350  ? 23.691  -14.768 55.449  1.00 24.98  ? 350  ARG C NH2   1 
ATOM   6365  N  N     . LEU C 2  351  ? 31.521  -18.802 53.371  1.00 35.83  ? 351  LEU C N     1 
ATOM   6366  C  CA    . LEU C 2  351  ? 32.953  -19.056 53.237  1.00 34.23  ? 351  LEU C CA    1 
ATOM   6367  C  C     . LEU C 2  351  ? 33.230  -20.064 52.120  1.00 39.57  ? 351  LEU C C     1 
ATOM   6368  O  O     . LEU C 2  351  ? 34.194  -19.921 51.364  1.00 37.33  ? 351  LEU C O     1 
ATOM   6369  C  CB    . LEU C 2  351  ? 33.532  -19.551 54.566  1.00 31.97  ? 351  LEU C CB    1 
ATOM   6370  C  CG    . LEU C 2  351  ? 35.019  -19.902 54.641  1.00 23.21  ? 351  LEU C CG    1 
ATOM   6371  C  CD1   . LEU C 2  351  ? 35.572  -19.509 55.996  1.00 25.75  ? 351  LEU C CD1   1 
ATOM   6372  C  CD2   . LEU C 2  351  ? 35.234  -21.384 54.405  1.00 18.93  ? 351  LEU C CD2   1 
ATOM   6373  N  N     . ALA C 2  352  ? 32.371  -21.074 52.018  1.00 36.03  ? 352  ALA C N     1 
ATOM   6374  C  CA    . ALA C 2  352  ? 32.491  -22.093 50.981  1.00 38.59  ? 352  ALA C CA    1 
ATOM   6375  C  C     . ALA C 2  352  ? 32.288  -21.506 49.588  1.00 50.21  ? 352  ALA C C     1 
ATOM   6376  O  O     . ALA C 2  352  ? 33.043  -21.818 48.662  1.00 57.67  ? 352  ALA C O     1 
ATOM   6377  C  CB    . ALA C 2  352  ? 31.507  -23.222 51.230  1.00 40.76  ? 352  ALA C CB    1 
ATOM   6378  N  N     . ARG C 2  353  ? 31.264  -20.666 49.441  1.00 49.81  ? 353  ARG C N     1 
ATOM   6379  C  CA    . ARG C 2  353  ? 31.029  -19.966 48.176  1.00 53.23  ? 353  ARG C CA    1 
ATOM   6380  C  C     . ARG C 2  353  ? 32.294  -19.216 47.742  1.00 53.25  ? 353  ARG C C     1 
ATOM   6381  O  O     . ARG C 2  353  ? 32.763  -19.352 46.597  1.00 57.36  ? 353  ARG C O     1 
ATOM   6382  C  CB    . ARG C 2  353  ? 29.845  -19.003 48.314  1.00 56.66  ? 353  ARG C CB    1 
ATOM   6383  C  CG    . ARG C 2  353  ? 28.890  -18.987 47.124  1.00 60.60  ? 353  ARG C CG    1 
ATOM   6384  C  CD    . ARG C 2  353  ? 29.305  -17.963 46.078  1.00 74.79  ? 353  ARG C CD    1 
ATOM   6385  N  NE    . ARG C 2  353  ? 29.222  -16.595 46.584  1.00 78.29  ? 353  ARG C NE    1 
ATOM   6386  C  CZ    . ARG C 2  353  ? 29.498  -15.511 45.865  1.00 81.37  ? 353  ARG C CZ    1 
ATOM   6387  N  NH1   . ARG C 2  353  ? 29.876  -15.628 44.598  1.00 81.99  ? 353  ARG C NH1   1 
ATOM   6388  N  NH2   . ARG C 2  353  ? 29.395  -14.305 46.410  1.00 73.51  ? 353  ARG C NH2   1 
ATOM   6389  N  N     . GLY C 2  354  ? 32.855  -18.444 48.672  1.00 53.00  ? 354  GLY C N     1 
ATOM   6390  C  CA    . GLY C 2  354  ? 34.117  -17.763 48.421  1.00 56.27  ? 354  GLY C CA    1 
ATOM   6391  C  C     . GLY C 2  354  ? 35.235  -18.711 48.007  1.00 59.31  ? 354  GLY C C     1 
ATOM   6392  O  O     . GLY C 2  354  ? 36.030  -18.407 47.105  1.00 58.30  ? 354  GLY C O     1 
ATOM   6393  N  N     . VAL C 2  355  ? 35.292  -19.868 48.665  1.00 56.38  ? 355  VAL C N     1 
ATOM   6394  C  CA    . VAL C 2  355  ? 36.304  -20.878 48.361  1.00 56.40  ? 355  VAL C CA    1 
ATOM   6395  C  C     . VAL C 2  355  ? 36.200  -21.382 46.922  1.00 63.29  ? 355  VAL C C     1 
ATOM   6396  O  O     . VAL C 2  355  ? 37.208  -21.464 46.224  1.00 67.63  ? 355  VAL C O     1 
ATOM   6397  C  CB    . VAL C 2  355  ? 36.254  -22.075 49.340  1.00 47.00  ? 355  VAL C CB    1 
ATOM   6398  C  CG1   . VAL C 2  355  ? 37.068  -23.239 48.803  1.00 39.16  ? 355  VAL C CG1   1 
ATOM   6399  C  CG2   . VAL C 2  355  ? 36.766  -21.662 50.708  1.00 42.84  ? 355  VAL C CG2   1 
ATOM   6400  N  N     . ARG C 2  356  ? 34.989  -21.713 46.481  1.00 60.11  ? 356  ARG C N     1 
ATOM   6401  C  CA    . ARG C 2  356  ? 34.783  -22.137 45.096  1.00 50.58  ? 356  ARG C CA    1 
ATOM   6402  C  C     . ARG C 2  356  ? 35.168  -21.030 44.114  1.00 63.52  ? 356  ARG C C     1 
ATOM   6403  O  O     . ARG C 2  356  ? 35.781  -21.299 43.068  1.00 69.18  ? 356  ARG C O     1 
ATOM   6404  C  CB    . ARG C 2  356  ? 33.340  -22.589 44.866  1.00 51.95  ? 356  ARG C CB    1 
ATOM   6405  C  CG    . ARG C 2  356  ? 33.061  -24.010 45.331  1.00 53.12  ? 356  ARG C CG    1 
ATOM   6406  C  CD    . ARG C 2  356  ? 31.576  -24.330 45.273  1.00 59.57  ? 356  ARG C CD    1 
ATOM   6407  N  NE    . ARG C 2  356  ? 30.802  -23.496 46.192  1.00 69.16  ? 356  ARG C NE    1 
ATOM   6408  C  CZ    . ARG C 2  356  ? 30.394  -23.883 47.397  1.00 60.18  ? 356  ARG C CZ    1 
ATOM   6409  N  NH1   . ARG C 2  356  ? 29.696  -23.051 48.160  1.00 52.71  ? 356  ARG C NH1   1 
ATOM   6410  N  NH2   . ARG C 2  356  ? 30.678  -25.102 47.840  1.00 45.53  ? 356  ARG C NH2   1 
ATOM   6411  N  N     . GLU C 2  357  ? 34.813  -19.790 44.454  1.00 64.40  ? 357  GLU C N     1 
ATOM   6412  C  CA    . GLU C 2  357  ? 35.263  -18.636 43.671  1.00 67.15  ? 357  GLU C CA    1 
ATOM   6413  C  C     . GLU C 2  357  ? 36.778  -18.651 43.454  1.00 63.75  ? 357  GLU C C     1 
ATOM   6414  O  O     . GLU C 2  357  ? 37.254  -18.738 42.314  1.00 69.41  ? 357  GLU C O     1 
ATOM   6415  C  CB    . GLU C 2  357  ? 34.848  -17.319 44.332  1.00 72.95  ? 357  GLU C CB    1 
ATOM   6416  C  CG    . GLU C 2  357  ? 33.466  -16.822 43.941  1.00 75.68  ? 357  GLU C CG    1 
ATOM   6417  C  CD    . GLU C 2  357  ? 33.198  -15.411 44.434  1.00 75.93  ? 357  GLU C CD    1 
ATOM   6418  O  OE1   . GLU C 2  357  ? 34.076  -14.838 45.117  1.00 70.28  ? 357  GLU C OE1   1 
ATOM   6419  O  OE2   . GLU C 2  357  ? 32.110  -14.874 44.137  1.00 77.08  ? 357  GLU C OE2   1 
ATOM   6420  N  N     . ARG C 2  358  ? 37.530  -18.560 44.549  1.00 61.41  ? 358  ARG C N     1 
ATOM   6421  C  CA    . ARG C 2  358  ? 38.991  -18.571 44.467  1.00 62.56  ? 358  ARG C CA    1 
ATOM   6422  C  C     . ARG C 2  358  ? 39.560  -19.815 43.782  1.00 66.22  ? 358  ARG C C     1 
ATOM   6423  O  O     . ARG C 2  358  ? 40.602  -19.745 43.128  1.00 61.10  ? 358  ARG C O     1 
ATOM   6424  C  CB    . ARG C 2  358  ? 39.618  -18.422 45.852  1.00 57.51  ? 358  ARG C CB    1 
ATOM   6425  C  CG    . ARG C 2  358  ? 39.878  -16.993 46.272  1.00 50.12  ? 358  ARG C CG    1 
ATOM   6426  C  CD    . ARG C 2  358  ? 38.854  -16.531 47.284  1.00 60.60  ? 358  ARG C CD    1 
ATOM   6427  N  NE    . ARG C 2  358  ? 39.346  -15.401 48.063  1.00 65.23  ? 358  ARG C NE    1 
ATOM   6428  C  CZ    . ARG C 2  358  ? 38.658  -14.811 49.033  1.00 60.72  ? 358  ARG C CZ    1 
ATOM   6429  N  NH1   . ARG C 2  358  ? 39.183  -13.787 49.693  1.00 56.11  ? 358  ARG C NH1   1 
ATOM   6430  N  NH2   . ARG C 2  358  ? 37.443  -15.246 49.341  1.00 55.67  ? 358  ARG C NH2   1 
ATOM   6431  N  N     . MET C 2  359  ? 38.885  -20.949 43.944  1.00 64.35  ? 359  MET C N     1 
ATOM   6432  C  CA    . MET C 2  359  ? 39.321  -22.193 43.319  1.00 66.95  ? 359  MET C CA    1 
ATOM   6433  C  C     . MET C 2  359  ? 39.233  -22.098 41.804  1.00 75.44  ? 359  MET C C     1 
ATOM   6434  O  O     . MET C 2  359  ? 40.115  -22.578 41.092  1.00 84.78  ? 359  MET C O     1 
ATOM   6435  C  CB    . MET C 2  359  ? 38.501  -23.387 43.815  1.00 61.24  ? 359  MET C CB    1 
ATOM   6436  C  CG    . MET C 2  359  ? 38.920  -23.911 45.178  1.00 64.08  ? 359  MET C CG    1 
ATOM   6437  S  SD    . MET C 2  359  ? 38.484  -25.646 45.414  1.00 65.33  ? 359  MET C SD    1 
ATOM   6438  C  CE    . MET C 2  359  ? 36.763  -25.634 44.923  1.00 62.79  ? 359  MET C CE    1 
ATOM   6439  N  N     . LEU C 2  360  ? 38.165  -21.480 41.311  1.00 75.30  ? 360  LEU C N     1 
ATOM   6440  C  CA    . LEU C 2  360  ? 38.043  -21.267 39.874  1.00 74.87  ? 360  LEU C CA    1 
ATOM   6441  C  C     . LEU C 2  360  ? 39.028  -20.216 39.360  1.00 78.40  ? 360  LEU C C     1 
ATOM   6442  O  O     . LEU C 2  360  ? 39.686  -20.422 38.341  1.00 77.65  ? 360  LEU C O     1 
ATOM   6443  C  CB    . LEU C 2  360  ? 36.610  -20.887 39.497  1.00 72.92  ? 360  LEU C CB    1 
ATOM   6444  C  CG    . LEU C 2  360  ? 35.862  -21.928 38.664  1.00 70.22  ? 360  LEU C CG    1 
ATOM   6445  C  CD1   . LEU C 2  360  ? 35.977  -23.308 39.297  1.00 73.58  ? 360  LEU C CD1   1 
ATOM   6446  C  CD2   . LEU C 2  360  ? 34.404  -21.530 38.490  1.00 60.97  ? 360  LEU C CD2   1 
ATOM   6447  N  N     . MET C 2  361  ? 39.138  -19.097 40.072  1.00 85.18  ? 361  MET C N     1 
ATOM   6448  C  CA    . MET C 2  361  ? 39.947  -17.971 39.594  1.00 86.48  ? 361  MET C CA    1 
ATOM   6449  C  C     . MET C 2  361  ? 41.463  -18.103 39.785  1.00 88.37  ? 361  MET C C     1 
ATOM   6450  O  O     . MET C 2  361  ? 42.235  -17.739 38.898  1.00 90.11  ? 361  MET C O     1 
ATOM   6451  C  CB    . MET C 2  361  ? 39.455  -16.658 40.212  1.00 85.22  ? 361  MET C CB    1 
ATOM   6452  C  CG    . MET C 2  361  ? 38.794  -15.719 39.217  1.00 89.39  ? 361  MET C CG    1 
ATOM   6453  S  SD    . MET C 2  361  ? 37.498  -16.538 38.269  1.00 91.99  ? 361  MET C SD    1 
ATOM   6454  C  CE    . MET C 2  361  ? 36.439  -17.124 39.591  1.00 78.80  ? 361  MET C CE    1 
ATOM   6455  N  N     . GLY C 2  362  ? 41.882  -18.615 40.939  1.00 93.03  ? 362  GLY C N     1 
ATOM   6456  C  CA    . GLY C 2  362  ? 43.288  -18.623 41.315  1.00 90.09  ? 362  GLY C CA    1 
ATOM   6457  C  C     . GLY C 2  362  ? 44.221  -19.397 40.401  1.00 89.20  ? 362  GLY C C     1 
ATOM   6458  O  O     . GLY C 2  362  ? 43.777  -20.190 39.569  1.00 88.16  ? 362  GLY C O     1 
ATOM   6459  N  N     . SER C 2  363  ? 45.521  -19.159 40.561  1.00 89.95  ? 363  SER C N     1 
ATOM   6460  C  CA    . SER C 2  363  ? 46.545  -19.841 39.774  1.00 94.35  ? 363  SER C CA    1 
ATOM   6461  C  C     . SER C 2  363  ? 46.562  -21.337 40.074  1.00 102.17 ? 363  SER C C     1 
ATOM   6462  O  O     . SER C 2  363  ? 46.451  -21.745 41.228  1.00 98.73  ? 363  SER C O     1 
ATOM   6463  C  CB    . SER C 2  363  ? 47.923  -19.235 40.051  1.00 87.60  ? 363  SER C CB    1 
ATOM   6464  O  OG    . SER C 2  363  ? 47.933  -17.845 39.775  1.00 79.30  ? 363  SER C OG    1 
ATOM   6465  N  N     . GLU C 2  364  ? 46.707  -22.150 39.033  1.00 109.48 ? 364  GLU C N     1 
ATOM   6466  C  CA    . GLU C 2  364  ? 46.614  -23.602 39.175  1.00 109.58 ? 364  GLU C CA    1 
ATOM   6467  C  C     . GLU C 2  364  ? 47.876  -24.255 39.743  1.00 115.47 ? 364  GLU C C     1 
ATOM   6468  O  O     . GLU C 2  364  ? 47.816  -25.357 40.291  1.00 110.43 ? 364  GLU C O     1 
ATOM   6469  C  CB    . GLU C 2  364  ? 46.232  -24.251 37.841  1.00 103.87 ? 364  GLU C CB    1 
ATOM   6470  C  CG    . GLU C 2  364  ? 44.798  -23.978 37.413  1.00 101.03 ? 364  GLU C CG    1 
ATOM   6471  C  CD    . GLU C 2  364  ? 43.781  -24.506 38.410  1.00 100.22 ? 364  GLU C CD    1 
ATOM   6472  O  OE1   . GLU C 2  364  ? 43.067  -23.686 39.026  1.00 98.03  ? 364  GLU C OE1   1 
ATOM   6473  O  OE2   . GLU C 2  364  ? 43.693  -25.742 38.577  1.00 93.11  ? 364  GLU C OE2   1 
ATOM   6474  N  N     . ASP C 2  365  ? 49.014  -23.580 39.611  1.00 122.56 ? 365  ASP C N     1 
ATOM   6475  C  CA    . ASP C 2  365  ? 50.277  -24.126 40.104  1.00 122.28 ? 365  ASP C CA    1 
ATOM   6476  C  C     . ASP C 2  365  ? 50.382  -24.068 41.627  1.00 116.81 ? 365  ASP C C     1 
ATOM   6477  O  O     . ASP C 2  365  ? 50.723  -25.065 42.268  1.00 106.69 ? 365  ASP C O     1 
ATOM   6478  C  CB    . ASP C 2  365  ? 51.473  -23.419 39.459  1.00 113.52 ? 365  ASP C CB    1 
ATOM   6479  C  CG    . ASP C 2  365  ? 51.617  -23.746 37.985  1.00 106.66 ? 365  ASP C CG    1 
ATOM   6480  O  OD1   . ASP C 2  365  ? 52.134  -22.893 37.233  1.00 97.62  ? 365  ASP C OD1   1 
ATOM   6481  O  OD2   . ASP C 2  365  ? 51.212  -24.856 37.577  1.00 104.38 ? 365  ASP C OD2   1 
ATOM   6482  N  N     . SER C 2  366  ? 50.095  -22.904 42.204  1.00 112.35 ? 366  SER C N     1 
ATOM   6483  C  CA    . SER C 2  366  ? 50.161  -22.753 43.654  1.00 104.01 ? 366  SER C CA    1 
ATOM   6484  C  C     . SER C 2  366  ? 48.893  -22.152 44.257  1.00 95.54  ? 366  SER C C     1 
ATOM   6485  O  O     . SER C 2  366  ? 48.590  -20.976 44.051  1.00 93.19  ? 366  SER C O     1 
ATOM   6486  C  CB    . SER C 2  366  ? 51.367  -21.894 44.043  1.00 97.40  ? 366  SER C CB    1 
ATOM   6487  O  OG    . SER C 2  366  ? 51.217  -20.566 43.573  1.00 94.00  ? 366  SER C OG    1 
ATOM   6488  N  N     . LEU C 2  367  ? 48.162  -22.968 45.009  1.00 88.87  ? 367  LEU C N     1 
ATOM   6489  C  CA    . LEU C 2  367  ? 47.074  -22.479 45.847  1.00 77.78  ? 367  LEU C CA    1 
ATOM   6490  C  C     . LEU C 2  367  ? 47.106  -23.164 47.206  1.00 67.18  ? 367  LEU C C     1 
ATOM   6491  O  O     . LEU C 2  367  ? 46.957  -24.380 47.299  1.00 59.20  ? 367  LEU C O     1 
ATOM   6492  C  CB    . LEU C 2  367  ? 45.715  -22.701 45.179  1.00 67.34  ? 367  LEU C CB    1 
ATOM   6493  C  CG    . LEU C 2  367  ? 45.271  -21.640 44.172  1.00 73.83  ? 367  LEU C CG    1 
ATOM   6494  C  CD1   . LEU C 2  367  ? 43.859  -21.919 43.682  1.00 76.06  ? 367  LEU C CD1   1 
ATOM   6495  C  CD2   . LEU C 2  367  ? 45.369  -20.245 44.772  1.00 73.84  ? 367  LEU C CD2   1 
ATOM   6496  N  N     . THR C 2  368  ? 47.310  -22.380 48.258  1.00 65.64  ? 368  THR C N     1 
ATOM   6497  C  CA    . THR C 2  368  ? 47.222  -22.893 49.617  1.00 60.55  ? 368  THR C CA    1 
ATOM   6498  C  C     . THR C 2  368  ? 45.796  -22.716 50.128  1.00 56.20  ? 368  THR C C     1 
ATOM   6499  O  O     . THR C 2  368  ? 45.058  -21.871 49.620  1.00 56.05  ? 368  THR C O     1 
ATOM   6500  C  CB    . THR C 2  368  ? 48.216  -22.180 50.560  1.00 58.92  ? 368  THR C CB    1 
ATOM   6501  O  OG1   . THR C 2  368  ? 48.063  -20.760 50.439  1.00 53.25  ? 368  THR C OG1   1 
ATOM   6502  C  CG2   . THR C 2  368  ? 49.647  -22.559 50.214  1.00 57.14  ? 368  THR C CG2   1 
ATOM   6503  N  N     . PRO C 2  369  ? 45.394  -23.525 51.122  1.00 51.29  ? 369  PRO C N     1 
ATOM   6504  C  CA    . PRO C 2  369  ? 44.098  -23.318 51.776  1.00 44.03  ? 369  PRO C CA    1 
ATOM   6505  C  C     . PRO C 2  369  ? 43.962  -21.911 52.357  1.00 46.06  ? 369  PRO C C     1 
ATOM   6506  O  O     . PRO C 2  369  ? 42.856  -21.375 52.392  1.00 46.97  ? 369  PRO C O     1 
ATOM   6507  C  CB    . PRO C 2  369  ? 44.113  -24.355 52.897  1.00 39.98  ? 369  PRO C CB    1 
ATOM   6508  C  CG    . PRO C 2  369  ? 44.940  -25.463 52.346  1.00 47.83  ? 369  PRO C CG    1 
ATOM   6509  C  CD    . PRO C 2  369  ? 46.017  -24.797 51.529  1.00 52.96  ? 369  PRO C CD    1 
ATOM   6510  N  N     . ALA C 2  370  ? 45.073  -21.324 52.793  1.00 46.39  ? 370  ALA C N     1 
ATOM   6511  C  CA    . ALA C 2  370  ? 45.065  -19.970 53.340  1.00 42.51  ? 370  ALA C CA    1 
ATOM   6512  C  C     . ALA C 2  370  ? 44.620  -18.946 52.301  1.00 46.48  ? 370  ALA C C     1 
ATOM   6513  O  O     . ALA C 2  370  ? 43.912  -17.991 52.620  1.00 51.01  ? 370  ALA C O     1 
ATOM   6514  C  CB    . ALA C 2  370  ? 46.437  -19.607 53.889  1.00 44.05  ? 370  ALA C CB    1 
ATOM   6515  N  N     . LYS C 2  371  ? 45.040  -19.152 51.057  1.00 48.94  ? 371  LYS C N     1 
ATOM   6516  C  CA    . LYS C 2  371  ? 44.668  -18.257 49.965  1.00 57.40  ? 371  LYS C CA    1 
ATOM   6517  C  C     . LYS C 2  371  ? 43.225  -18.486 49.518  1.00 51.10  ? 371  LYS C C     1 
ATOM   6518  O  O     . LYS C 2  371  ? 42.568  -17.572 49.020  1.00 49.68  ? 371  LYS C O     1 
ATOM   6519  C  CB    . LYS C 2  371  ? 45.620  -18.430 48.778  1.00 57.28  ? 371  LYS C CB    1 
ATOM   6520  C  CG    . LYS C 2  371  ? 47.056  -18.012 49.058  1.00 51.28  ? 371  LYS C CG    1 
ATOM   6521  C  CD    . LYS C 2  371  ? 47.977  -18.427 47.920  1.00 67.63  ? 371  LYS C CD    1 
ATOM   6522  C  CE    . LYS C 2  371  ? 49.436  -18.159 48.259  1.00 74.41  ? 371  LYS C CE    1 
ATOM   6523  N  NZ    . LYS C 2  371  ? 50.362  -18.737 47.244  1.00 65.71  ? 371  LYS C NZ    1 
ATOM   6524  N  N     . LEU C 2  372  ? 42.740  -19.711 49.695  1.00 47.28  ? 372  LEU C N     1 
ATOM   6525  C  CA    . LEU C 2  372  ? 41.384  -20.064 49.289  1.00 49.12  ? 372  LEU C CA    1 
ATOM   6526  C  C     . LEU C 2  372  ? 40.330  -19.600 50.290  1.00 56.38  ? 372  LEU C C     1 
ATOM   6527  O  O     . LEU C 2  372  ? 39.200  -19.282 49.915  1.00 57.85  ? 372  LEU C O     1 
ATOM   6528  C  CB    . LEU C 2  372  ? 41.264  -21.575 49.088  1.00 43.36  ? 372  LEU C CB    1 
ATOM   6529  C  CG    . LEU C 2  372  ? 41.940  -22.156 47.850  1.00 49.20  ? 372  LEU C CG    1 
ATOM   6530  C  CD1   . LEU C 2  372  ? 41.766  -23.663 47.817  1.00 47.28  ? 372  LEU C CD1   1 
ATOM   6531  C  CD2   . LEU C 2  372  ? 41.370  -21.522 46.595  1.00 50.06  ? 372  LEU C CD2   1 
ATOM   6532  N  N     . VAL C 2  373  ? 40.704  -19.564 51.564  1.00 48.56  ? 373  VAL C N     1 
ATOM   6533  C  CA    . VAL C 2  373  ? 39.745  -19.293 52.626  1.00 38.49  ? 373  VAL C CA    1 
ATOM   6534  C  C     . VAL C 2  373  ? 39.770  -17.841 53.096  1.00 41.38  ? 373  VAL C C     1 
ATOM   6535  O  O     . VAL C 2  373  ? 40.803  -17.333 53.536  1.00 39.82  ? 373  VAL C O     1 
ATOM   6536  C  CB    . VAL C 2  373  ? 39.966  -20.234 53.836  1.00 41.19  ? 373  VAL C CB    1 
ATOM   6537  C  CG1   . VAL C 2  373  ? 39.099  -19.813 55.011  1.00 31.33  ? 373  VAL C CG1   1 
ATOM   6538  C  CG2   . VAL C 2  373  ? 39.686  -21.682 53.449  1.00 30.97  ? 373  VAL C CG2   1 
ATOM   6539  N  N     . ASN C 2  374  ? 38.622  -17.179 52.974  1.00 40.89  ? 374  ASN C N     1 
ATOM   6540  C  CA    . ASN C 2  374  ? 38.393  -15.893 53.617  1.00 32.11  ? 374  ASN C CA    1 
ATOM   6541  C  C     . ASN C 2  374  ? 37.431  -16.111 54.776  1.00 34.45  ? 374  ASN C C     1 
ATOM   6542  O  O     . ASN C 2  374  ? 36.262  -16.437 54.570  1.00 33.41  ? 374  ASN C O     1 
ATOM   6543  C  CB    . ASN C 2  374  ? 37.807  -14.882 52.631  1.00 37.57  ? 374  ASN C CB    1 
ATOM   6544  C  CG    . ASN C 2  374  ? 37.777  -13.465 53.187  1.00 43.85  ? 374  ASN C CG    1 
ATOM   6545  O  OD1   . ASN C 2  374  ? 37.895  -13.253 54.394  1.00 42.21  ? 374  ASN C OD1   1 
ATOM   6546  N  ND2   . ASN C 2  374  ? 37.613  -12.487 52.303  1.00 49.76  ? 374  ASN C ND2   1 
ATOM   6547  N  N     . SER C 2  375  ? 37.928  -15.935 55.994  1.00 38.43  ? 375  SER C N     1 
ATOM   6548  C  CA    . SER C 2  375  ? 37.139  -16.214 57.187  1.00 33.47  ? 375  SER C CA    1 
ATOM   6549  C  C     . SER C 2  375  ? 36.040  -15.179 57.437  1.00 34.46  ? 375  SER C C     1 
ATOM   6550  O  O     . SER C 2  375  ? 35.093  -15.443 58.180  1.00 38.60  ? 375  SER C O     1 
ATOM   6551  C  CB    . SER C 2  375  ? 38.053  -16.321 58.412  1.00 31.28  ? 375  SER C CB    1 
ATOM   6552  O  OG    . SER C 2  375  ? 38.849  -15.158 58.567  1.00 34.35  ? 375  SER C OG    1 
ATOM   6553  N  N     . ARG C 2  376  ? 36.165  -14.015 56.805  1.00 34.69  ? 376  ARG C N     1 
ATOM   6554  C  CA    . ARG C 2  376  ? 35.273  -12.874 57.059  1.00 37.94  ? 376  ARG C CA    1 
ATOM   6555  C  C     . ARG C 2  376  ? 33.756  -13.143 57.098  1.00 32.33  ? 376  ARG C C     1 
ATOM   6556  O  O     . ARG C 2  376  ? 33.095  -12.714 58.044  1.00 28.35  ? 376  ARG C O     1 
ATOM   6557  C  CB    . ARG C 2  376  ? 35.594  -11.695 56.127  1.00 37.82  ? 376  ARG C CB    1 
ATOM   6558  C  CG    . ARG C 2  376  ? 36.541  -10.659 56.730  1.00 46.53  ? 376  ARG C CG    1 
ATOM   6559  C  CD    . ARG C 2  376  ? 37.872  -11.285 57.119  1.00 54.80  ? 376  ARG C CD    1 
ATOM   6560  N  NE    . ARG C 2  376  ? 38.841  -10.301 57.595  1.00 49.13  ? 376  ARG C NE    1 
ATOM   6561  C  CZ    . ARG C 2  376  ? 38.992  -9.957  58.870  1.00 53.76  ? 376  ARG C CZ    1 
ATOM   6562  N  NH1   . ARG C 2  376  ? 38.228  -10.512 59.801  1.00 60.96  ? 376  ARG C NH1   1 
ATOM   6563  N  NH2   . ARG C 2  376  ? 39.904  -9.056  59.214  1.00 48.49  ? 376  ARG C NH2   1 
ATOM   6564  N  N     . PRO C 2  377  ? 33.198  -13.837 56.083  1.00 27.64  ? 377  PRO C N     1 
ATOM   6565  C  CA    . PRO C 2  377  ? 31.746  -14.073 56.116  1.00 28.05  ? 377  PRO C CA    1 
ATOM   6566  C  C     . PRO C 2  377  ? 31.276  -14.845 57.351  1.00 27.31  ? 377  PRO C C     1 
ATOM   6567  O  O     . PRO C 2  377  ? 30.247  -14.495 57.936  1.00 29.42  ? 377  PRO C O     1 
ATOM   6568  C  CB    . PRO C 2  377  ? 31.488  -14.887 54.838  1.00 23.63  ? 377  PRO C CB    1 
ATOM   6569  C  CG    . PRO C 2  377  ? 32.825  -15.394 54.413  1.00 27.35  ? 377  PRO C CG    1 
ATOM   6570  C  CD    . PRO C 2  377  ? 33.799  -14.353 54.842  1.00 26.16  ? 377  PRO C CD    1 
ATOM   6571  N  N     . LEU C 2  378  ? 32.027  -15.872 57.739  1.00 26.90  ? 378  LEU C N     1 
ATOM   6572  C  CA    . LEU C 2  378  ? 31.732  -16.651 58.940  1.00 24.81  ? 378  LEU C CA    1 
ATOM   6573  C  C     . LEU C 2  378  ? 31.747  -15.775 60.195  1.00 25.60  ? 378  LEU C C     1 
ATOM   6574  O  O     . LEU C 2  378  ? 30.800  -15.796 60.998  1.00 27.24  ? 378  LEU C O     1 
ATOM   6575  C  CB    . LEU C 2  378  ? 32.751  -17.782 59.083  1.00 26.55  ? 378  LEU C CB    1 
ATOM   6576  C  CG    . LEU C 2  378  ? 32.731  -18.594 60.379  1.00 26.67  ? 378  LEU C CG    1 
ATOM   6577  C  CD1   . LEU C 2  378  ? 31.486  -19.462 60.459  1.00 22.30  ? 378  LEU C CD1   1 
ATOM   6578  C  CD2   . LEU C 2  378  ? 33.990  -19.437 60.495  1.00 23.26  ? 378  LEU C CD2   1 
ATOM   6579  N  N     . GLU C 2  379  ? 32.830  -15.013 60.351  1.00 24.17  ? 379  GLU C N     1 
ATOM   6580  C  CA    . GLU C 2  379  ? 32.979  -14.068 61.452  1.00 26.91  ? 379  GLU C CA    1 
ATOM   6581  C  C     . GLU C 2  379  ? 31.769  -13.153 61.532  1.00 27.45  ? 379  GLU C C     1 
ATOM   6582  O  O     . GLU C 2  379  ? 31.210  -12.931 62.608  1.00 24.61  ? 379  GLU C O     1 
ATOM   6583  C  CB    . GLU C 2  379  ? 34.223  -13.203 61.253  1.00 29.47  ? 379  GLU C CB    1 
ATOM   6584  C  CG    . GLU C 2  379  ? 35.528  -13.957 61.120  1.00 30.89  ? 379  GLU C CG    1 
ATOM   6585  C  CD    . GLU C 2  379  ? 36.728  -13.022 61.108  1.00 41.70  ? 379  GLU C CD    1 
ATOM   6586  O  OE1   . GLU C 2  379  ? 37.557  -13.114 60.177  1.00 40.24  ? 379  GLU C OE1   1 
ATOM   6587  O  OE2   . GLU C 2  379  ? 36.839  -12.191 62.035  1.00 42.37  ? 379  GLU C OE2   1 
ATOM   6588  N  N     . ALA C 2  380  ? 31.382  -12.623 60.375  1.00 31.77  ? 380  ALA C N     1 
ATOM   6589  C  CA    . ALA C 2  380  ? 30.234  -11.737 60.258  1.00 25.16  ? 380  ALA C CA    1 
ATOM   6590  C  C     . ALA C 2  380  ? 28.954  -12.419 60.722  1.00 23.06  ? 380  ALA C C     1 
ATOM   6591  O  O     . ALA C 2  380  ? 28.153  -11.816 61.427  1.00 22.57  ? 380  ALA C O     1 
ATOM   6592  C  CB    . ALA C 2  380  ? 30.086  -11.262 58.824  1.00 19.87  ? 380  ALA C CB    1 
ATOM   6593  N  N     . ALA C 2  381  ? 28.768  -13.676 60.328  1.00 23.61  ? 381  ALA C N     1 
ATOM   6594  C  CA    . ALA C 2  381  ? 27.570  -14.424 60.707  1.00 24.68  ? 381  ALA C CA    1 
ATOM   6595  C  C     . ALA C 2  381  ? 27.478  -14.614 62.219  1.00 26.25  ? 381  ALA C C     1 
ATOM   6596  O  O     . ALA C 2  381  ? 26.434  -14.353 62.832  1.00 25.98  ? 381  ALA C O     1 
ATOM   6597  C  CB    . ALA C 2  381  ? 27.532  -15.770 59.999  1.00 23.64  ? 381  ALA C CB    1 
ATOM   6598  N  N     . ILE C 2  382  ? 28.575  -15.069 62.816  1.00 26.00  ? 382  ILE C N     1 
ATOM   6599  C  CA    . ILE C 2  382  ? 28.626  -15.248 64.264  1.00 24.15  ? 382  ILE C CA    1 
ATOM   6600  C  C     . ILE C 2  382  ? 28.380  -13.932 65.009  1.00 21.10  ? 382  ILE C C     1 
ATOM   6601  O  O     . ILE C 2  382  ? 27.509  -13.852 65.884  1.00 23.30  ? 382  ILE C O     1 
ATOM   6602  C  CB    . ILE C 2  382  ? 29.970  -15.858 64.702  1.00 16.58  ? 382  ILE C CB    1 
ATOM   6603  C  CG1   . ILE C 2  382  ? 30.082  -17.295 64.189  1.00 17.86  ? 382  ILE C CG1   1 
ATOM   6604  C  CG2   . ILE C 2  382  ? 30.108  -15.819 66.208  1.00 11.63  ? 382  ILE C CG2   1 
ATOM   6605  C  CD1   . ILE C 2  382  ? 31.425  -17.942 64.459  1.00 20.72  ? 382  ILE C CD1   1 
ATOM   6606  N  N     . ARG C 2  383  ? 29.143  -12.906 64.642  1.00 22.59  ? 383  ARG C N     1 
ATOM   6607  C  CA    . ARG C 2  383  ? 29.037  -11.582 65.256  1.00 33.78  ? 383  ARG C CA    1 
ATOM   6608  C  C     . ARG C 2  383  ? 27.610  -11.036 65.167  1.00 30.81  ? 383  ARG C C     1 
ATOM   6609  O  O     . ARG C 2  383  ? 27.066  -10.501 66.142  1.00 26.52  ? 383  ARG C O     1 
ATOM   6610  C  CB    . ARG C 2  383  ? 30.030  -10.616 64.593  1.00 32.32  ? 383  ARG C CB    1 
ATOM   6611  C  CG    . ARG C 2  383  ? 30.106  -9.238  65.237  1.00 45.52  ? 383  ARG C CG    1 
ATOM   6612  C  CD    . ARG C 2  383  ? 31.329  -8.451  64.762  1.00 41.32  ? 383  ARG C CD    1 
ATOM   6613  N  NE    . ARG C 2  383  ? 31.266  -8.112  63.342  1.00 56.82  ? 383  ARG C NE    1 
ATOM   6614  C  CZ    . ARG C 2  383  ? 31.960  -8.728  62.389  1.00 54.07  ? 383  ARG C CZ    1 
ATOM   6615  N  NH1   . ARG C 2  383  ? 32.783  -9.723  62.697  1.00 45.38  ? 383  ARG C NH1   1 
ATOM   6616  N  NH2   . ARG C 2  383  ? 31.835  -8.345  61.124  1.00 37.46  ? 383  ARG C NH2   1 
ATOM   6617  N  N     . GLU C 2  384  ? 27.013  -11.195 63.990  1.00 28.62  ? 384  GLU C N     1 
ATOM   6618  C  CA    . GLU C 2  384  ? 25.641  -10.781 63.737  1.00 29.50  ? 384  GLU C CA    1 
ATOM   6619  C  C     . GLU C 2  384  ? 24.681  -11.509 64.664  1.00 28.70  ? 384  GLU C C     1 
ATOM   6620  O  O     . GLU C 2  384  ? 23.769  -10.901 65.226  1.00 29.42  ? 384  GLU C O     1 
ATOM   6621  C  CB    . GLU C 2  384  ? 25.264  -11.060 62.279  1.00 27.58  ? 384  GLU C CB    1 
ATOM   6622  C  CG    . GLU C 2  384  ? 23.885  -10.566 61.864  1.00 38.42  ? 384  GLU C CG    1 
ATOM   6623  C  CD    . GLU C 2  384  ? 23.862  -9.086  61.511  1.00 53.25  ? 384  GLU C CD    1 
ATOM   6624  O  OE1   . GLU C 2  384  ? 24.806  -8.355  61.887  1.00 50.17  ? 384  GLU C OE1   1 
ATOM   6625  O  OE2   . GLU C 2  384  ? 22.895  -8.655  60.847  1.00 52.00  ? 384  GLU C OE2   1 
ATOM   6626  N  N     . PHE C 2  385  ? 24.884  -12.815 64.819  1.00 26.94  ? 385  PHE C N     1 
ATOM   6627  C  CA    . PHE C 2  385  ? 24.041  -13.586 65.721  1.00 22.04  ? 385  PHE C CA    1 
ATOM   6628  C  C     . PHE C 2  385  ? 24.148  -13.072 67.151  1.00 24.80  ? 385  PHE C C     1 
ATOM   6629  O  O     . PHE C 2  385  ? 23.138  -12.875 67.820  1.00 24.57  ? 385  PHE C O     1 
ATOM   6630  C  CB    . PHE C 2  385  ? 24.380  -15.075 65.675  1.00 21.19  ? 385  PHE C CB    1 
ATOM   6631  C  CG    . PHE C 2  385  ? 23.662  -15.888 66.717  1.00 18.04  ? 385  PHE C CG    1 
ATOM   6632  C  CD1   . PHE C 2  385  ? 22.316  -16.187 66.577  1.00 17.26  ? 385  PHE C CD1   1 
ATOM   6633  C  CD2   . PHE C 2  385  ? 24.331  -16.346 67.841  1.00 18.06  ? 385  PHE C CD2   1 
ATOM   6634  C  CE1   . PHE C 2  385  ? 21.648  -16.931 67.536  1.00 18.30  ? 385  PHE C CE1   1 
ATOM   6635  C  CE2   . PHE C 2  385  ? 23.671  -17.093 68.804  1.00 19.14  ? 385  PHE C CE2   1 
ATOM   6636  C  CZ    . PHE C 2  385  ? 22.327  -17.387 68.649  1.00 17.23  ? 385  PHE C CZ    1 
ATOM   6637  N  N     . PHE C 2  386  ? 25.367  -12.834 67.620  1.00 20.44  ? 386  PHE C N     1 
ATOM   6638  C  CA    . PHE C 2  386  ? 25.529  -12.447 69.017  1.00 24.97  ? 386  PHE C CA    1 
ATOM   6639  C  C     . PHE C 2  386  ? 25.270  -10.967 69.275  1.00 31.05  ? 386  PHE C C     1 
ATOM   6640  O  O     . PHE C 2  386  ? 25.302  -10.517 70.421  1.00 31.75  ? 386  PHE C O     1 
ATOM   6641  C  CB    . PHE C 2  386  ? 26.900  -12.859 69.554  1.00 21.95  ? 386  PHE C CB    1 
ATOM   6642  C  CG    . PHE C 2  386  ? 26.985  -14.309 69.920  1.00 19.37  ? 386  PHE C CG    1 
ATOM   6643  C  CD1   . PHE C 2  386  ? 27.478  -15.238 69.019  1.00 20.37  ? 386  PHE C CD1   1 
ATOM   6644  C  CD2   . PHE C 2  386  ? 26.554  -14.746 71.159  1.00 14.56  ? 386  PHE C CD2   1 
ATOM   6645  C  CE1   . PHE C 2  386  ? 27.552  -16.578 69.351  1.00 15.52  ? 386  PHE C CE1   1 
ATOM   6646  C  CE2   . PHE C 2  386  ? 26.624  -16.085 71.497  1.00 18.04  ? 386  PHE C CE2   1 
ATOM   6647  C  CZ    . PHE C 2  386  ? 27.123  -17.002 70.591  1.00 16.00  ? 386  PHE C CZ    1 
ATOM   6648  N  N     . SER C 2  387  ? 24.999  -10.212 68.215  1.00 35.63  ? 387  SER C N     1 
ATOM   6649  C  CA    . SER C 2  387  ? 24.712  -8.789  68.372  1.00 36.67  ? 387  SER C CA    1 
ATOM   6650  C  C     . SER C 2  387  ? 23.267  -8.422  68.029  1.00 35.03  ? 387  SER C C     1 
ATOM   6651  O  O     . SER C 2  387  ? 22.513  -7.972  68.891  1.00 35.92  ? 387  SER C O     1 
ATOM   6652  C  CB    . SER C 2  387  ? 25.691  -7.944  67.552  1.00 35.74  ? 387  SER C CB    1 
ATOM   6653  O  OG    . SER C 2  387  ? 27.006  -8.046  68.074  1.00 32.21  ? 387  SER C OG    1 
ATOM   6654  N  N     . ARG C 2  388  ? 22.890  -8.611  66.770  1.00 32.71  ? 388  ARG C N     1 
ATOM   6655  C  CA    . ARG C 2  388  ? 21.599  -8.135  66.280  1.00 41.04  ? 388  ARG C CA    1 
ATOM   6656  C  C     . ARG C 2  388  ? 20.446  -9.148  66.285  1.00 37.06  ? 388  ARG C C     1 
ATOM   6657  O  O     . ARG C 2  388  ? 19.357  -8.842  65.799  1.00 41.78  ? 388  ARG C O     1 
ATOM   6658  C  CB    . ARG C 2  388  ? 21.757  -7.494  64.898  1.00 45.43  ? 388  ARG C CB    1 
ATOM   6659  C  CG    . ARG C 2  388  ? 22.085  -6.011  64.960  1.00 49.96  ? 388  ARG C CG    1 
ATOM   6660  C  CD    . ARG C 2  388  ? 22.993  -5.578  63.822  1.00 55.67  ? 388  ARG C CD    1 
ATOM   6661  N  NE    . ARG C 2  388  ? 24.350  -6.099  63.971  1.00 60.25  ? 388  ARG C NE    1 
ATOM   6662  C  CZ    . ARG C 2  388  ? 25.279  -5.553  64.752  1.00 61.59  ? 388  ARG C CZ    1 
ATOM   6663  N  NH1   . ARG C 2  388  ? 24.997  -4.471  65.466  1.00 58.73  ? 388  ARG C NH1   1 
ATOM   6664  N  NH2   . ARG C 2  388  ? 26.489  -6.092  64.823  1.00 50.07  ? 388  ARG C NH2   1 
ATOM   6665  N  N     . SER C 2  389  ? 20.673  -10.345 66.817  1.00 30.29  ? 389  SER C N     1 
ATOM   6666  C  CA    . SER C 2  389  ? 19.599  -11.336 66.893  1.00 26.52  ? 389  SER C CA    1 
ATOM   6667  C  C     . SER C 2  389  ? 18.570  -10.971 67.960  1.00 23.96  ? 389  SER C C     1 
ATOM   6668  O  O     . SER C 2  389  ? 18.903  -10.348 68.968  1.00 22.94  ? 389  SER C O     1 
ATOM   6669  C  CB    . SER C 2  389  ? 20.154  -12.735 67.157  1.00 20.74  ? 389  SER C CB    1 
ATOM   6670  O  OG    . SER C 2  389  ? 19.111  -13.695 67.206  1.00 24.19  ? 389  SER C OG    1 
ATOM   6671  N  N     . GLN C 2  390  ? 17.320  -11.359 67.731  1.00 23.97  ? 390  GLN C N     1 
ATOM   6672  C  CA    . GLN C 2  390  ? 16.249  -11.060 68.673  1.00 22.86  ? 390  GLN C CA    1 
ATOM   6673  C  C     . GLN C 2  390  ? 16.348  -11.963 69.894  1.00 26.86  ? 390  GLN C C     1 
ATOM   6674  O  O     . GLN C 2  390  ? 15.886  -11.611 70.980  1.00 29.30  ? 390  GLN C O     1 
ATOM   6675  C  CB    . GLN C 2  390  ? 14.881  -11.218 68.009  1.00 24.17  ? 390  GLN C CB    1 
ATOM   6676  C  CG    . GLN C 2  390  ? 13.721  -10.727 68.871  1.00 43.21  ? 390  GLN C CG    1 
ATOM   6677  C  CD    . GLN C 2  390  ? 12.393  -10.727 68.135  1.00 50.64  ? 390  GLN C CD    1 
ATOM   6678  O  OE1   . GLN C 2  390  ? 11.364  -10.331 68.686  1.00 35.29  ? 390  GLN C OE1   1 
ATOM   6679  N  NE2   . GLN C 2  390  ? 12.410  -11.172 66.881  1.00 47.89  ? 390  GLN C NE2   1 
ATOM   6680  N  N     . LEU C 2  391  ? 16.956  -13.130 69.708  1.00 27.27  ? 391  LEU C N     1 
ATOM   6681  C  CA    . LEU C 2  391  ? 17.119  -14.091 70.791  1.00 18.25  ? 391  LEU C CA    1 
ATOM   6682  C  C     . LEU C 2  391  ? 18.351  -13.771 71.629  1.00 16.18  ? 391  LEU C C     1 
ATOM   6683  O  O     . LEU C 2  391  ? 18.511  -14.280 72.742  1.00 12.64  ? 391  LEU C O     1 
ATOM   6684  C  CB    . LEU C 2  391  ? 17.188  -15.514 70.235  1.00 15.87  ? 391  LEU C CB    1 
ATOM   6685  C  CG    . LEU C 2  391  ? 15.855  -16.016 69.679  1.00 17.85  ? 391  LEU C CG    1 
ATOM   6686  C  CD1   . LEU C 2  391  ? 16.043  -17.233 68.793  1.00 18.49  ? 391  LEU C CD1   1 
ATOM   6687  C  CD2   . LEU C 2  391  ? 14.905  -16.327 70.821  1.00 13.73  ? 391  LEU C CD2   1 
ATOM   6688  N  N     . SER C 2  392  ? 19.214  -12.911 71.102  1.00 13.58  ? 392  SER C N     1 
ATOM   6689  C  CA    . SER C 2  392  ? 20.365  -12.468 71.865  1.00 13.96  ? 392  SER C CA    1 
ATOM   6690  C  C     . SER C 2  392  ? 19.933  -11.208 72.585  1.00 17.05  ? 392  SER C C     1 
ATOM   6691  O  O     . SER C 2  392  ? 19.753  -10.157 71.970  1.00 20.83  ? 392  SER C O     1 
ATOM   6692  C  CB    . SER C 2  392  ? 21.547  -12.175 70.940  1.00 18.61  ? 392  SER C CB    1 
ATOM   6693  O  OG    . SER C 2  392  ? 22.716  -11.855 71.678  1.00 15.01  ? 392  SER C OG    1 
ATOM   6694  N  N     . GLN C 2  393  ? 19.785  -11.312 73.900  1.00 14.10  ? 393  GLN C N     1 
ATOM   6695  C  CA    . GLN C 2  393  ? 19.205  -10.227 74.674  1.00 12.38  ? 393  GLN C CA    1 
ATOM   6696  C  C     . GLN C 2  393  ? 20.182  -9.691  75.703  1.00 16.23  ? 393  GLN C C     1 
ATOM   6697  O  O     . GLN C 2  393  ? 21.042  -10.417 76.194  1.00 14.94  ? 393  GLN C O     1 
ATOM   6698  C  CB    . GLN C 2  393  ? 17.924  -10.692 75.371  1.00 9.67   ? 393  GLN C CB    1 
ATOM   6699  C  CG    . GLN C 2  393  ? 16.835  -11.167 74.424  1.00 8.47   ? 393  GLN C CG    1 
ATOM   6700  C  CD    . GLN C 2  393  ? 15.615  -11.680 75.163  1.00 13.36  ? 393  GLN C CD    1 
ATOM   6701  O  OE1   . GLN C 2  393  ? 15.572  -11.670 76.395  1.00 10.83  ? 393  GLN C OE1   1 
ATOM   6702  N  NE2   . GLN C 2  393  ? 14.613  -12.132 74.414  1.00 15.27  ? 393  GLN C NE2   1 
ATOM   6703  N  N     . PHE C 2  394  ? 20.043  -8.408  76.015  1.00 20.11  ? 394  PHE C N     1 
ATOM   6704  C  CA    . PHE C 2  394  ? 20.816  -7.792  77.074  1.00 16.20  ? 394  PHE C CA    1 
ATOM   6705  C  C     . PHE C 2  394  ? 20.464  -8.542  78.353  1.00 17.87  ? 394  PHE C C     1 
ATOM   6706  O  O     . PHE C 2  394  ? 19.293  -8.644  78.718  1.00 17.93  ? 394  PHE C O     1 
ATOM   6707  C  CB    . PHE C 2  394  ? 20.419  -6.321  77.184  1.00 17.07  ? 394  PHE C CB    1 
ATOM   6708  C  CG    . PHE C 2  394  ? 21.496  -5.432  77.736  1.00 24.62  ? 394  PHE C CG    1 
ATOM   6709  C  CD1   . PHE C 2  394  ? 22.781  -5.473  77.222  1.00 22.94  ? 394  PHE C CD1   1 
ATOM   6710  C  CD2   . PHE C 2  394  ? 21.211  -4.526  78.751  1.00 26.29  ? 394  PHE C CD2   1 
ATOM   6711  C  CE1   . PHE C 2  394  ? 23.771  -4.645  77.724  1.00 26.11  ? 394  PHE C CE1   1 
ATOM   6712  C  CE2   . PHE C 2  394  ? 22.194  -3.691  79.257  1.00 24.56  ? 394  PHE C CE2   1 
ATOM   6713  C  CZ    . PHE C 2  394  ? 23.478  -3.750  78.744  1.00 32.73  ? 394  PHE C CZ    1 
ATOM   6714  N  N     . LYS C 2  395  ? 21.475  -9.079  79.026  1.00 18.25  ? 395  LYS C N     1 
ATOM   6715  C  CA    . LYS C 2  395  ? 21.249  -9.899  80.210  1.00 16.19  ? 395  LYS C CA    1 
ATOM   6716  C  C     . LYS C 2  395  ? 20.628  -9.071  81.317  1.00 16.84  ? 395  LYS C C     1 
ATOM   6717  O  O     . LYS C 2  395  ? 21.036  -7.932  81.549  1.00 13.62  ? 395  LYS C O     1 
ATOM   6718  C  CB    . LYS C 2  395  ? 22.568  -10.509 80.691  1.00 17.13  ? 395  LYS C CB    1 
ATOM   6719  C  CG    . LYS C 2  395  ? 22.523  -11.142 82.074  1.00 11.69  ? 395  LYS C CG    1 
ATOM   6720  C  CD    . LYS C 2  395  ? 23.873  -11.750 82.420  1.00 14.77  ? 395  LYS C CD    1 
ATOM   6721  C  CE    . LYS C 2  395  ? 23.970  -12.114 83.887  1.00 19.80  ? 395  LYS C CE    1 
ATOM   6722  N  NZ    . LYS C 2  395  ? 25.340  -12.574 84.249  1.00 26.89  ? 395  LYS C NZ    1 
ATOM   6723  N  N     . ASP C 2  396  ? 19.645  -9.638  82.008  1.00 18.20  ? 396  ASP C N     1 
ATOM   6724  C  CA    . ASP C 2  396  ? 19.049  -8.924  83.123  1.00 17.26  ? 396  ASP C CA    1 
ATOM   6725  C  C     . ASP C 2  396  ? 19.773  -9.338  84.399  1.00 16.70  ? 396  ASP C C     1 
ATOM   6726  O  O     . ASP C 2  396  ? 19.561  -10.429 84.924  1.00 15.42  ? 396  ASP C O     1 
ATOM   6727  C  CB    . ASP C 2  396  ? 17.564  -9.277  83.212  1.00 12.48  ? 396  ASP C CB    1 
ATOM   6728  C  CG    . ASP C 2  396  ? 16.860  -8.568  84.349  1.00 18.52  ? 396  ASP C CG    1 
ATOM   6729  O  OD1   . ASP C 2  396  ? 17.409  -7.576  84.880  1.00 16.78  ? 396  ASP C OD1   1 
ATOM   6730  O  OD2   . ASP C 2  396  ? 15.744  -9.003  84.705  1.00 17.11  ? 396  ASP C OD2   1 
ATOM   6731  N  N     . GLU C 2  397  ? 20.625  -8.442  84.887  1.00 16.42  ? 397  GLU C N     1 
ATOM   6732  C  CA    . GLU C 2  397  ? 21.388  -8.649  86.118  1.00 12.62  ? 397  GLU C CA    1 
ATOM   6733  C  C     . GLU C 2  397  ? 20.853  -7.944  87.357  1.00 15.99  ? 397  GLU C C     1 
ATOM   6734  O  O     . GLU C 2  397  ? 21.566  -7.857  88.356  1.00 27.81  ? 397  GLU C O     1 
ATOM   6735  C  CB    . GLU C 2  397  ? 22.885  -8.378  85.949  1.00 16.80  ? 397  GLU C CB    1 
ATOM   6736  C  CG    . GLU C 2  397  ? 23.310  -7.797  84.629  1.00 19.61  ? 397  GLU C CG    1 
ATOM   6737  C  CD    . GLU C 2  397  ? 24.818  -7.788  84.494  1.00 21.99  ? 397  GLU C CD    1 
ATOM   6738  O  OE1   . GLU C 2  397  ? 25.470  -8.665  85.102  1.00 21.54  ? 397  GLU C OE1   1 
ATOM   6739  O  OE2   . GLU C 2  397  ? 25.353  -6.904  83.794  1.00 28.42  ? 397  GLU C OE2   1 
ATOM   6740  N  N     . THR C 2  398  ? 19.648  -7.384  87.267  1.00 13.60  ? 398  THR C N     1 
ATOM   6741  C  CA    . THR C 2  398  ? 19.101  -6.539  88.328  1.00 15.50  ? 398  THR C CA    1 
ATOM   6742  C  C     . THR C 2  398  ? 19.328  -7.156  89.702  1.00 13.97  ? 398  THR C C     1 
ATOM   6743  O  O     . THR C 2  398  ? 19.895  -6.520  90.590  1.00 7.63   ? 398  THR C O     1 
ATOM   6744  C  CB    . THR C 2  398  ? 17.588  -6.358  88.142  1.00 13.22  ? 398  THR C CB    1 
ATOM   6745  O  OG1   . THR C 2  398  ? 17.315  -5.979  86.789  1.00 15.01  ? 398  THR C OG1   1 
ATOM   6746  C  CG2   . THR C 2  398  ? 17.057  -5.296  89.088  1.00 10.54  ? 398  THR C CG2   1 
ATOM   6747  N  N     . ASN C 2  399  ? 18.925  -8.414  89.844  1.00 14.78  ? 399  ASN C N     1 
ATOM   6748  C  CA    . ASN C 2  399  ? 19.293  -9.239  90.990  1.00 13.99  ? 399  ASN C CA    1 
ATOM   6749  C  C     . ASN C 2  399  ? 19.701  -10.609 90.451  1.00 12.98  ? 399  ASN C C     1 
ATOM   6750  O  O     . ASN C 2  399  ? 19.429  -10.907 89.290  1.00 12.63  ? 399  ASN C O     1 
ATOM   6751  C  CB    . ASN C 2  399  ? 18.142  -9.336  92.004  1.00 10.90  ? 399  ASN C CB    1 
ATOM   6752  C  CG    . ASN C 2  399  ? 16.891  -9.951  91.418  1.00 10.83  ? 399  ASN C CG    1 
ATOM   6753  O  OD1   . ASN C 2  399  ? 16.882  -11.116 91.027  1.00 12.45  ? 399  ASN C OD1   1 
ATOM   6754  N  ND2   . ASN C 2  399  ? 15.817  -9.173  91.373  1.00 10.47  ? 399  ASN C ND2   1 
ATOM   6755  N  N     . PRO C 2  400  ? 20.381  -11.434 91.267  1.00 13.13  ? 400  PRO C N     1 
ATOM   6756  C  CA    . PRO C 2  400  ? 20.827  -12.741 90.766  1.00 12.69  ? 400  PRO C CA    1 
ATOM   6757  C  C     . PRO C 2  400  ? 19.696  -13.596 90.189  1.00 13.07  ? 400  PRO C C     1 
ATOM   6758  O  O     . PRO C 2  400  ? 19.882  -14.272 89.161  1.00 19.80  ? 400  PRO C O     1 
ATOM   6759  C  CB    . PRO C 2  400  ? 21.414  -13.401 92.011  1.00 13.57  ? 400  PRO C CB    1 
ATOM   6760  C  CG    . PRO C 2  400  ? 21.898  -12.259 92.830  1.00 13.43  ? 400  PRO C CG    1 
ATOM   6761  C  CD    . PRO C 2  400  ? 20.896  -11.166 92.623  1.00 11.83  ? 400  PRO C CD    1 
ATOM   6762  N  N     . LEU C 2  401  ? 18.534  -13.551 90.834  1.00 7.19   ? 401  LEU C N     1 
ATOM   6763  C  CA    . LEU C 2  401  ? 17.376  -14.290 90.352  1.00 9.88   ? 401  LEU C CA    1 
ATOM   6764  C  C     . LEU C 2  401  ? 16.963  -13.826 88.957  1.00 15.32  ? 401  LEU C C     1 
ATOM   6765  O  O     . LEU C 2  401  ? 16.455  -14.617 88.167  1.00 16.05  ? 401  LEU C O     1 
ATOM   6766  C  CB    . LEU C 2  401  ? 16.200  -14.165 91.322  1.00 11.51  ? 401  LEU C CB    1 
ATOM   6767  C  CG    . LEU C 2  401  ? 14.880  -14.794 90.871  1.00 8.71   ? 401  LEU C CG    1 
ATOM   6768  C  CD1   . LEU C 2  401  ? 14.985  -16.306 90.841  1.00 8.43   ? 401  LEU C CD1   1 
ATOM   6769  C  CD2   . LEU C 2  401  ? 13.747  -14.347 91.768  1.00 9.27   ? 401  LEU C CD2   1 
ATOM   6770  N  N     . SER C 2  402  ? 17.190  -12.551 88.652  1.00 15.16  ? 402  SER C N     1 
ATOM   6771  C  CA    . SER C 2  402  ? 16.871  -12.023 87.326  1.00 13.88  ? 402  SER C CA    1 
ATOM   6772  C  C     . SER C 2  402  ? 17.687  -12.725 86.242  1.00 14.22  ? 402  SER C C     1 
ATOM   6773  O  O     . SER C 2  402  ? 17.147  -13.133 85.216  1.00 13.96  ? 402  SER C O     1 
ATOM   6774  C  CB    . SER C 2  402  ? 17.118  -10.517 87.265  1.00 14.78  ? 402  SER C CB    1 
ATOM   6775  O  OG    . SER C 2  402  ? 16.509  -9.857  88.358  1.00 17.37  ? 402  SER C OG    1 
ATOM   6776  N  N     . SER C 2  403  ? 18.989  -12.861 86.479  1.00 15.54  ? 403  SER C N     1 
ATOM   6777  C  CA    . SER C 2  403  ? 19.869  -13.563 85.552  1.00 13.94  ? 403  SER C CA    1 
ATOM   6778  C  C     . SER C 2  403  ? 19.440  -15.013 85.429  1.00 15.90  ? 403  SER C C     1 
ATOM   6779  O  O     . SER C 2  403  ? 19.223  -15.516 84.318  1.00 16.23  ? 403  SER C O     1 
ATOM   6780  C  CB    . SER C 2  403  ? 21.317  -13.507 86.037  1.00 12.71  ? 403  SER C CB    1 
ATOM   6781  O  OG    . SER C 2  403  ? 21.716  -12.176 86.293  1.00 19.86  ? 403  SER C OG    1 
ATOM   6782  N  N     . LEU C 2  404  ? 19.314  -15.677 86.579  1.00 16.32  ? 404  LEU C N     1 
ATOM   6783  C  CA    . LEU C 2  404  ? 18.955  -17.094 86.594  1.00 17.94  ? 404  LEU C CA    1 
ATOM   6784  C  C     . LEU C 2  404  ? 17.665  -17.354 85.813  1.00 14.71  ? 404  LEU C C     1 
ATOM   6785  O  O     . LEU C 2  404  ? 17.573  -18.308 85.043  1.00 13.60  ? 404  LEU C O     1 
ATOM   6786  C  CB    . LEU C 2  404  ? 18.823  -17.611 88.030  1.00 15.00  ? 404  LEU C CB    1 
ATOM   6787  C  CG    . LEU C 2  404  ? 18.428  -19.087 88.149  1.00 18.02  ? 404  LEU C CG    1 
ATOM   6788  C  CD1   . LEU C 2  404  ? 19.407  -19.962 87.385  1.00 19.51  ? 404  LEU C CD1   1 
ATOM   6789  C  CD2   . LEU C 2  404  ? 18.345  -19.525 89.601  1.00 17.81  ? 404  LEU C CD2   1 
ATOM   6790  N  N     . ARG C 2  405  ? 16.685  -16.481 86.006  1.00 11.56  ? 405  ARG C N     1 
ATOM   6791  C  CA    . ARG C 2  405  ? 15.395  -16.598 85.345  1.00 12.74  ? 405  ARG C CA    1 
ATOM   6792  C  C     . ARG C 2  405  ? 15.503  -16.294 83.849  1.00 13.83  ? 405  ARG C C     1 
ATOM   6793  O  O     . ARG C 2  405  ? 14.837  -16.926 83.025  1.00 11.28  ? 405  ARG C O     1 
ATOM   6794  C  CB    . ARG C 2  405  ? 14.392  -15.660 86.018  1.00 10.50  ? 405  ARG C CB    1 
ATOM   6795  C  CG    . ARG C 2  405  ? 13.033  -15.598 85.360  1.00 14.02  ? 405  ARG C CG    1 
ATOM   6796  C  CD    . ARG C 2  405  ? 12.859  -14.298 84.606  1.00 17.84  ? 405  ARG C CD    1 
ATOM   6797  N  NE    . ARG C 2  405  ? 11.464  -13.880 84.572  1.00 19.90  ? 405  ARG C NE    1 
ATOM   6798  C  CZ    . ARG C 2  405  ? 11.039  -12.758 84.006  1.00 20.70  ? 405  ARG C CZ    1 
ATOM   6799  N  NH1   . ARG C 2  405  ? 11.907  -11.944 83.423  1.00 22.60  ? 405  ARG C NH1   1 
ATOM   6800  N  NH2   . ARG C 2  405  ? 9.749   -12.453 84.023  1.00 20.99  ? 405  ARG C NH2   1 
ATOM   6801  N  N     . HIS C 2  406  ? 16.347  -15.326 83.508  1.00 11.90  ? 406  HIS C N     1 
ATOM   6802  C  CA    . HIS C 2  406  ? 16.533  -14.925 82.121  1.00 10.17  ? 406  HIS C CA    1 
ATOM   6803  C  C     . HIS C 2  406  ? 17.114  -16.075 81.313  1.00 9.75   ? 406  HIS C C     1 
ATOM   6804  O  O     . HIS C 2  406  ? 16.713  -16.312 80.173  1.00 6.69   ? 406  HIS C O     1 
ATOM   6805  C  CB    . HIS C 2  406  ? 17.448  -13.703 82.033  1.00 8.60   ? 406  HIS C CB    1 
ATOM   6806  C  CG    . HIS C 2  406  ? 17.461  -13.051 80.684  1.00 8.90   ? 406  HIS C CG    1 
ATOM   6807  N  ND1   . HIS C 2  406  ? 18.213  -11.930 80.407  1.00 13.95  ? 406  HIS C ND1   1 
ATOM   6808  C  CD2   . HIS C 2  406  ? 16.810  -13.359 79.538  1.00 7.16   ? 406  HIS C CD2   1 
ATOM   6809  C  CE1   . HIS C 2  406  ? 18.025  -11.576 79.148  1.00 14.12  ? 406  HIS C CE1   1 
ATOM   6810  N  NE2   . HIS C 2  406  ? 17.178  -12.428 78.598  1.00 7.72   ? 406  HIS C NE2   1 
ATOM   6811  N  N     . LYS C 2  407  ? 18.057  -16.793 81.912  1.00 12.25  ? 407  LYS C N     1 
ATOM   6812  C  CA    . LYS C 2  407  ? 18.684  -17.922 81.231  1.00 12.76  ? 407  LYS C CA    1 
ATOM   6813  C  C     . LYS C 2  407  ? 17.703  -19.073 81.015  1.00 9.76   ? 407  LYS C C     1 
ATOM   6814  O  O     . LYS C 2  407  ? 17.887  -19.896 80.120  1.00 10.45  ? 407  LYS C O     1 
ATOM   6815  C  CB    . LYS C 2  407  ? 19.914  -18.398 82.007  1.00 12.25  ? 407  LYS C CB    1 
ATOM   6816  C  CG    . LYS C 2  407  ? 21.042  -17.380 82.030  1.00 15.36  ? 407  LYS C CG    1 
ATOM   6817  C  CD    . LYS C 2  407  ? 21.913  -17.530 83.267  1.00 16.74  ? 407  LYS C CD    1 
ATOM   6818  C  CE    . LYS C 2  407  ? 22.900  -16.375 83.373  1.00 17.99  ? 407  LYS C CE    1 
ATOM   6819  N  NZ    . LYS C 2  407  ? 23.549  -16.298 84.713  1.00 18.44  ? 407  LYS C NZ    1 
ATOM   6820  N  N     . ARG C 2  408  ? 16.660  -19.118 81.837  1.00 7.92   ? 408  ARG C N     1 
ATOM   6821  C  CA    . ARG C 2  408  ? 15.666  -20.185 81.774  1.00 9.07   ? 408  ARG C CA    1 
ATOM   6822  C  C     . ARG C 2  408  ? 14.442  -19.826 80.932  1.00 10.78  ? 408  ARG C C     1 
ATOM   6823  O  O     . ARG C 2  408  ? 13.463  -20.568 80.911  1.00 12.22  ? 408  ARG C O     1 
ATOM   6824  C  CB    . ARG C 2  408  ? 15.249  -20.615 83.180  1.00 9.78   ? 408  ARG C CB    1 
ATOM   6825  C  CG    . ARG C 2  408  ? 16.391  -21.211 83.987  1.00 10.22  ? 408  ARG C CG    1 
ATOM   6826  C  CD    . ARG C 2  408  ? 15.996  -21.473 85.431  1.00 11.55  ? 408  ARG C CD    1 
ATOM   6827  N  NE    . ARG C 2  408  ? 14.800  -22.304 85.529  1.00 14.43  ? 408  ARG C NE    1 
ATOM   6828  C  CZ    . ARG C 2  408  ? 14.799  -23.627 85.416  1.00 13.62  ? 408  ARG C CZ    1 
ATOM   6829  N  NH1   . ARG C 2  408  ? 13.661  -24.299 85.520  1.00 10.80  ? 408  ARG C NH1   1 
ATOM   6830  N  NH2   . ARG C 2  408  ? 15.933  -24.279 85.197  1.00 12.69  ? 408  ARG C NH2   1 
ATOM   6831  N  N     . ARG C 2  409  ? 14.492  -18.675 80.267  1.00 10.12  ? 409  ARG C N     1 
ATOM   6832  C  CA    . ARG C 2  409  ? 13.383  -18.200 79.441  1.00 9.37   ? 409  ARG C CA    1 
ATOM   6833  C  C     . ARG C 2  409  ? 13.200  -18.997 78.156  1.00 10.21  ? 409  ARG C C     1 
ATOM   6834  O  O     . ARG C 2  409  ? 14.164  -19.501 77.582  1.00 10.45  ? 409  ARG C O     1 
ATOM   6835  C  CB    . ARG C 2  409  ? 13.587  -16.729 79.078  1.00 14.19  ? 409  ARG C CB    1 
ATOM   6836  C  CG    . ARG C 2  409  ? 13.306  -15.755 80.202  1.00 17.00  ? 409  ARG C CG    1 
ATOM   6837  C  CD    . ARG C 2  409  ? 11.896  -15.193 80.104  1.00 23.79  ? 409  ARG C CD    1 
ATOM   6838  N  NE    . ARG C 2  409  ? 10.917  -15.953 80.878  1.00 21.93  ? 409  ARG C NE    1 
ATOM   6839  C  CZ    . ARG C 2  409  ? 9.794   -15.431 81.368  1.00 23.99  ? 409  ARG C CZ    1 
ATOM   6840  N  NH1   . ARG C 2  409  ? 8.952   -16.187 82.062  1.00 22.73  ? 409  ARG C NH1   1 
ATOM   6841  N  NH2   . ARG C 2  409  ? 9.516   -14.148 81.170  1.00 20.82  ? 409  ARG C NH2   1 
ATOM   6842  N  N     . ILE C 2  410  ? 11.952  -19.087 77.702  1.00 9.12   ? 410  ILE C N     1 
ATOM   6843  C  CA    . ILE C 2  410  ? 11.625  -19.743 76.441  1.00 6.89   ? 410  ILE C CA    1 
ATOM   6844  C  C     . ILE C 2  410  ? 10.818  -18.785 75.574  1.00 9.17   ? 410  ILE C C     1 
ATOM   6845  O  O     . ILE C 2  410  ? 9.853   -18.189 76.045  1.00 10.04  ? 410  ILE C O     1 
ATOM   6846  C  CB    . ILE C 2  410  ? 10.785  -21.005 76.677  1.00 8.55   ? 410  ILE C CB    1 
ATOM   6847  C  CG1   . ILE C 2  410  ? 11.506  -21.965 77.624  1.00 8.53   ? 410  ILE C CG1   1 
ATOM   6848  C  CG2   . ILE C 2  410  ? 10.473  -21.693 75.360  1.00 9.69   ? 410  ILE C CG2   1 
ATOM   6849  C  CD1   . ILE C 2  410  ? 10.684  -23.188 77.983  1.00 9.90   ? 410  ILE C CD1   1 
ATOM   6850  N  N     . SER C 2  411  ? 11.201  -18.637 74.310  1.00 8.93   ? 411  SER C N     1 
ATOM   6851  C  CA    . SER C 2  411  ? 10.534  -17.678 73.428  1.00 8.38   ? 411  SER C CA    1 
ATOM   6852  C  C     . SER C 2  411  ? 9.986   -18.305 72.146  1.00 9.65   ? 411  SER C C     1 
ATOM   6853  O  O     . SER C 2  411  ? 10.688  -19.039 71.453  1.00 11.16  ? 411  SER C O     1 
ATOM   6854  C  CB    . SER C 2  411  ? 11.483  -16.526 73.080  1.00 9.62   ? 411  SER C CB    1 
ATOM   6855  O  OG    . SER C 2  411  ? 10.881  -15.620 72.169  1.00 11.44  ? 411  SER C OG    1 
ATOM   6856  N  N     . ALA C 2  412  ? 8.731   -18.000 71.831  1.00 9.37   ? 412  ALA C N     1 
ATOM   6857  C  CA    . ALA C 2  412  ? 8.113   -18.478 70.596  1.00 11.02  ? 412  ALA C CA    1 
ATOM   6858  C  C     . ALA C 2  412  ? 8.408   -17.535 69.438  1.00 15.73  ? 412  ALA C C     1 
ATOM   6859  O  O     . ALA C 2  412  ? 8.053   -17.810 68.293  1.00 19.04  ? 412  ALA C O     1 
ATOM   6860  C  CB    . ALA C 2  412  ? 6.613   -18.638 70.777  1.00 9.68   ? 412  ALA C CB    1 
ATOM   6861  N  N     . LEU C 2  413  ? 9.060   -16.421 69.749  1.00 14.81  ? 413  LEU C N     1 
ATOM   6862  C  CA    . LEU C 2  413  ? 9.389   -15.405 68.758  1.00 19.98  ? 413  LEU C CA    1 
ATOM   6863  C  C     . LEU C 2  413  ? 10.766  -15.656 68.141  1.00 21.95  ? 413  LEU C C     1 
ATOM   6864  O  O     . LEU C 2  413  ? 11.351  -16.721 68.323  1.00 22.07  ? 413  LEU C O     1 
ATOM   6865  C  CB    . LEU C 2  413  ? 9.345   -14.022 69.404  1.00 20.08  ? 413  LEU C CB    1 
ATOM   6866  C  CG    . LEU C 2  413  ? 8.135   -13.783 70.305  1.00 14.60  ? 413  LEU C CG    1 
ATOM   6867  C  CD1   . LEU C 2  413  ? 8.233   -12.434 70.996  1.00 17.87  ? 413  LEU C CD1   1 
ATOM   6868  C  CD2   . LEU C 2  413  ? 6.854   -13.883 69.499  1.00 20.08  ? 413  LEU C CD2   1 
ATOM   6869  N  N     . GLY C 2  414  ? 11.270  -14.677 67.396  1.00 25.29  ? 414  GLY C N     1 
ATOM   6870  C  CA    . GLY C 2  414  ? 12.593  -14.773 66.805  1.00 25.41  ? 414  GLY C CA    1 
ATOM   6871  C  C     . GLY C 2  414  ? 12.599  -15.409 65.427  1.00 30.70  ? 414  GLY C C     1 
ATOM   6872  O  O     . GLY C 2  414  ? 11.546  -15.770 64.897  1.00 27.36  ? 414  GLY C O     1 
ATOM   6873  N  N     . PRO C 2  415  ? 13.796  -15.550 64.835  1.00 36.91  ? 415  PRO C N     1 
ATOM   6874  C  CA    . PRO C 2  415  ? 13.970  -16.145 63.504  1.00 29.12  ? 415  PRO C CA    1 
ATOM   6875  C  C     . PRO C 2  415  ? 13.470  -17.585 63.464  1.00 31.72  ? 415  PRO C C     1 
ATOM   6876  O  O     . PRO C 2  415  ? 13.845  -18.390 64.317  1.00 33.39  ? 415  PRO C O     1 
ATOM   6877  C  CB    . PRO C 2  415  ? 15.490  -16.118 63.308  1.00 23.82  ? 415  PRO C CB    1 
ATOM   6878  C  CG    . PRO C 2  415  ? 15.973  -15.032 64.208  1.00 32.28  ? 415  PRO C CG    1 
ATOM   6879  C  CD    . PRO C 2  415  ? 15.073  -15.083 65.403  1.00 37.13  ? 415  PRO C CD    1 
ATOM   6880  N  N     . GLY C 2  416  ? 12.639  -17.902 62.475  1.00 28.20  ? 416  GLY C N     1 
ATOM   6881  C  CA    . GLY C 2  416  ? 12.065  -19.230 62.362  1.00 33.61  ? 416  GLY C CA    1 
ATOM   6882  C  C     . GLY C 2  416  ? 10.932  -19.451 63.347  1.00 39.24  ? 416  GLY C C     1 
ATOM   6883  O  O     . GLY C 2  416  ? 10.367  -20.544 63.430  1.00 38.94  ? 416  GLY C O     1 
ATOM   6884  N  N     . GLY C 2  417  ? 10.607  -18.409 64.105  1.00 33.92  ? 417  GLY C N     1 
ATOM   6885  C  CA    . GLY C 2  417  ? 9.539   -18.481 65.081  1.00 30.35  ? 417  GLY C CA    1 
ATOM   6886  C  C     . GLY C 2  417  ? 8.319   -17.686 64.670  1.00 34.82  ? 417  GLY C C     1 
ATOM   6887  O  O     . GLY C 2  417  ? 8.206   -17.245 63.527  1.00 43.43  ? 417  GLY C O     1 
ATOM   6888  N  N     . LEU C 2  418  ? 7.405   -17.500 65.616  1.00 40.84  ? 418  LEU C N     1 
ATOM   6889  C  CA    . LEU C 2  418  ? 6.185   -16.741 65.382  1.00 38.47  ? 418  LEU C CA    1 
ATOM   6890  C  C     . LEU C 2  418  ? 6.472   -15.250 65.308  1.00 45.92  ? 418  LEU C C     1 
ATOM   6891  O  O     . LEU C 2  418  ? 7.503   -14.776 65.790  1.00 38.98  ? 418  LEU C O     1 
ATOM   6892  C  CB    . LEU C 2  418  ? 5.170   -16.980 66.508  1.00 33.01  ? 418  LEU C CB    1 
ATOM   6893  C  CG    . LEU C 2  418  ? 4.254   -18.206 66.516  1.00 29.60  ? 418  LEU C CG    1 
ATOM   6894  C  CD1   . LEU C 2  418  ? 3.392   -18.241 65.265  1.00 45.77  ? 418  LEU C CD1   1 
ATOM   6895  C  CD2   . LEU C 2  418  ? 5.048   -19.490 66.663  1.00 34.31  ? 418  LEU C CD2   1 
ATOM   6896  N  N     . THR C 2  419  ? 5.553   -14.521 64.688  1.00 56.33  ? 419  THR C N     1 
ATOM   6897  C  CA    . THR C 2  419  ? 5.475   -13.078 64.854  1.00 58.59  ? 419  THR C CA    1 
ATOM   6898  C  C     . THR C 2  419  ? 4.169   -12.808 65.598  1.00 52.84  ? 419  THR C C     1 
ATOM   6899  O  O     . THR C 2  419  ? 3.210   -13.567 65.459  1.00 55.28  ? 419  THR C O     1 
ATOM   6900  C  CB    . THR C 2  419  ? 5.523   -12.330 63.502  1.00 58.87  ? 419  THR C CB    1 
ATOM   6901  O  OG1   . THR C 2  419  ? 5.317   -10.928 63.717  1.00 68.71  ? 419  THR C OG1   1 
ATOM   6902  C  CG2   . THR C 2  419  ? 4.458   -12.851 62.556  1.00 61.06  ? 419  THR C CG2   1 
ATOM   6903  N  N     . ARG C 2  420  ? 4.132   -11.747 66.397  1.00 45.98  ? 420  ARG C N     1 
ATOM   6904  C  CA    . ARG C 2  420  ? 2.985   -11.489 67.270  1.00 42.36  ? 420  ARG C CA    1 
ATOM   6905  C  C     . ARG C 2  420  ? 1.660   -11.312 66.527  1.00 58.53  ? 420  ARG C C     1 
ATOM   6906  O  O     . ARG C 2  420  ? 0.587   -11.405 67.123  1.00 59.64  ? 420  ARG C O     1 
ATOM   6907  C  CB    . ARG C 2  420  ? 3.256   -10.293 68.185  1.00 37.84  ? 420  ARG C CB    1 
ATOM   6908  C  CG    . ARG C 2  420  ? 4.181   -10.617 69.346  1.00 32.30  ? 420  ARG C CG    1 
ATOM   6909  C  CD    . ARG C 2  420  ? 4.296   -9.453  70.309  1.00 23.22  ? 420  ARG C CD    1 
ATOM   6910  N  NE    . ARG C 2  420  ? 5.141   -8.386  69.783  1.00 31.94  ? 420  ARG C NE    1 
ATOM   6911  C  CZ    . ARG C 2  420  ? 6.436   -8.260  70.056  1.00 40.27  ? 420  ARG C CZ    1 
ATOM   6912  N  NH1   . ARG C 2  420  ? 7.034   -9.138  70.852  1.00 31.71  ? 420  ARG C NH1   1 
ATOM   6913  N  NH2   . ARG C 2  420  ? 7.134   -7.258  69.535  1.00 50.72  ? 420  ARG C NH2   1 
ATOM   6914  N  N     . GLU C 2  421  ? 1.740   -11.058 65.227  1.00 64.07  ? 421  GLU C N     1 
ATOM   6915  C  CA    . GLU C 2  421  ? 0.551   -10.974 64.392  1.00 61.34  ? 421  GLU C CA    1 
ATOM   6916  C  C     . GLU C 2  421  ? 0.002   -12.370 64.114  1.00 66.68  ? 421  GLU C C     1 
ATOM   6917  O  O     . GLU C 2  421  ? -1.202  -12.608 64.225  1.00 70.94  ? 421  GLU C O     1 
ATOM   6918  C  CB    . GLU C 2  421  ? 0.879   -10.250 63.085  1.00 71.34  ? 421  GLU C CB    1 
ATOM   6919  C  CG    . GLU C 2  421  ? 1.259   -8.788  63.283  1.00 82.71  ? 421  GLU C CG    1 
ATOM   6920  C  CD    . GLU C 2  421  ? 2.205   -8.273  62.216  1.00 72.34  ? 421  GLU C CD    1 
ATOM   6921  O  OE1   . GLU C 2  421  ? 2.702   -9.091  61.411  1.00 63.50  ? 421  GLU C OE1   1 
ATOM   6922  O  OE2   . GLU C 2  421  ? 2.455   -7.047  62.188  1.00 64.62  ? 421  GLU C OE2   1 
ATOM   6923  N  N     . ARG C 2  422  ? 0.896   -13.294 63.771  1.00 67.58  ? 422  ARG C N     1 
ATOM   6924  C  CA    . ARG C 2  422  ? 0.522   -14.678 63.489  1.00 69.80  ? 422  ARG C CA    1 
ATOM   6925  C  C     . ARG C 2  422  ? 0.143   -15.459 64.748  1.00 70.27  ? 422  ARG C C     1 
ATOM   6926  O  O     . ARG C 2  422  ? -0.296  -16.608 64.665  1.00 64.59  ? 422  ARG C O     1 
ATOM   6927  C  CB    . ARG C 2  422  ? 1.651   -15.410 62.755  1.00 70.74  ? 422  ARG C CB    1 
ATOM   6928  C  CG    . ARG C 2  422  ? 1.859   -14.981 61.310  1.00 75.45  ? 422  ARG C CG    1 
ATOM   6929  C  CD    . ARG C 2  422  ? 2.837   -15.913 60.606  1.00 80.72  ? 422  ARG C CD    1 
ATOM   6930  N  NE    . ARG C 2  422  ? 4.116   -15.995 61.307  1.00 81.97  ? 422  ARG C NE    1 
ATOM   6931  C  CZ    . ARG C 2  422  ? 5.034   -16.932 61.084  1.00 88.62  ? 422  ARG C CZ    1 
ATOM   6932  N  NH1   . ARG C 2  422  ? 6.170   -16.925 61.771  1.00 73.13  ? 422  ARG C NH1   1 
ATOM   6933  N  NH2   . ARG C 2  422  ? 4.816   -17.879 60.179  1.00 89.10  ? 422  ARG C NH2   1 
ATOM   6934  N  N     . ALA C 2  423  ? 0.312   -14.837 65.911  1.00 66.91  ? 423  ALA C N     1 
ATOM   6935  C  CA    . ALA C 2  423  ? 0.094   -15.528 67.176  1.00 51.28  ? 423  ALA C CA    1 
ATOM   6936  C  C     . ALA C 2  423  ? -1.338  -15.370 67.672  1.00 43.79  ? 423  ALA C C     1 
ATOM   6937  O  O     . ALA C 2  423  ? -1.762  -14.275 68.040  1.00 45.02  ? 423  ALA C O     1 
ATOM   6938  C  CB    . ALA C 2  423  ? 1.073   -15.025 68.222  1.00 39.21  ? 423  ALA C CB    1 
ATOM   6939  N  N     . GLY C 2  424  ? -2.073  -16.477 67.682  1.00 36.37  ? 424  GLY C N     1 
ATOM   6940  C  CA    . GLY C 2  424  ? -3.446  -16.484 68.154  1.00 41.63  ? 424  GLY C CA    1 
ATOM   6941  C  C     . GLY C 2  424  ? -3.562  -17.118 69.525  1.00 43.96  ? 424  GLY C C     1 
ATOM   6942  O  O     . GLY C 2  424  ? -2.555  -17.477 70.128  1.00 47.55  ? 424  GLY C O     1 
ATOM   6943  N  N     . PHE C 2  425  ? -4.791  -17.268 70.011  1.00 40.25  ? 425  PHE C N     1 
ATOM   6944  C  CA    . PHE C 2  425  ? -5.040  -17.806 71.348  1.00 32.25  ? 425  PHE C CA    1 
ATOM   6945  C  C     . PHE C 2  425  ? -4.488  -19.212 71.580  1.00 29.33  ? 425  PHE C C     1 
ATOM   6946  O  O     . PHE C 2  425  ? -4.024  -19.522 72.677  1.00 33.94  ? 425  PHE C O     1 
ATOM   6947  C  CB    . PHE C 2  425  ? -6.537  -17.782 71.665  1.00 35.69  ? 425  PHE C CB    1 
ATOM   6948  C  CG    . PHE C 2  425  ? -7.033  -16.449 72.135  1.00 36.94  ? 425  PHE C CG    1 
ATOM   6949  C  CD1   . PHE C 2  425  ? -7.241  -16.210 73.484  1.00 42.39  ? 425  PHE C CD1   1 
ATOM   6950  C  CD2   . PHE C 2  425  ? -7.287  -15.431 71.231  1.00 36.79  ? 425  PHE C CD2   1 
ATOM   6951  C  CE1   . PHE C 2  425  ? -7.698  -14.980 73.925  1.00 39.84  ? 425  PHE C CE1   1 
ATOM   6952  C  CE2   . PHE C 2  425  ? -7.744  -14.199 71.664  1.00 39.63  ? 425  PHE C CE2   1 
ATOM   6953  C  CZ    . PHE C 2  425  ? -7.950  -13.973 73.014  1.00 36.15  ? 425  PHE C CZ    1 
ATOM   6954  N  N     . ASP C 2  426  ? -4.544  -20.055 70.555  1.00 29.00  ? 426  ASP C N     1 
ATOM   6955  C  CA    . ASP C 2  426  ? -4.147  -21.456 70.694  1.00 30.32  ? 426  ASP C CA    1 
ATOM   6956  C  C     . ASP C 2  426  ? -2.719  -21.634 71.202  1.00 26.54  ? 426  ASP C C     1 
ATOM   6957  O  O     . ASP C 2  426  ? -2.482  -22.368 72.159  1.00 30.07  ? 426  ASP C O     1 
ATOM   6958  C  CB    . ASP C 2  426  ? -4.321  -22.204 69.371  1.00 30.87  ? 426  ASP C CB    1 
ATOM   6959  C  CG    . ASP C 2  426  ? -5.770  -22.314 68.950  1.00 33.01  ? 426  ASP C CG    1 
ATOM   6960  O  OD1   . ASP C 2  426  ? -6.657  -22.103 69.804  1.00 30.02  ? 426  ASP C OD1   1 
ATOM   6961  O  OD2   . ASP C 2  426  ? -6.020  -22.620 67.765  1.00 36.52  ? 426  ASP C OD2   1 
ATOM   6962  N  N     . VAL C 2  427  ? -1.773  -20.959 70.560  1.00 25.71  ? 427  VAL C N     1 
ATOM   6963  C  CA    . VAL C 2  427  ? -0.363  -21.113 70.899  1.00 24.98  ? 427  VAL C CA    1 
ATOM   6964  C  C     . VAL C 2  427  ? -0.020  -20.435 72.229  1.00 20.45  ? 427  VAL C C     1 
ATOM   6965  O  O     . VAL C 2  427  ? 0.960   -20.789 72.885  1.00 18.44  ? 427  VAL C O     1 
ATOM   6966  C  CB    . VAL C 2  427  ? 0.545   -20.589 69.759  1.00 27.40  ? 427  VAL C CB    1 
ATOM   6967  C  CG1   . VAL C 2  427  ? 0.359   -19.090 69.563  1.00 23.12  ? 427  VAL C CG1   1 
ATOM   6968  C  CG2   . VAL C 2  427  ? 2.007   -20.939 70.020  1.00 24.17  ? 427  VAL C CG2   1 
ATOM   6969  N  N     . ARG C 2  428  ? -0.844  -19.473 72.634  1.00 19.11  ? 428  ARG C N     1 
ATOM   6970  C  CA    . ARG C 2  428  ? -0.611  -18.744 73.878  1.00 17.27  ? 428  ARG C CA    1 
ATOM   6971  C  C     . ARG C 2  428  ? -1.267  -19.461 75.051  1.00 14.55  ? 428  ARG C C     1 
ATOM   6972  O  O     . ARG C 2  428  ? -1.033  -19.122 76.210  1.00 12.24  ? 428  ARG C O     1 
ATOM   6973  C  CB    . ARG C 2  428  ? -1.135  -17.310 73.766  1.00 15.81  ? 428  ARG C CB    1 
ATOM   6974  C  CG    . ARG C 2  428  ? -0.735  -16.620 72.470  1.00 19.53  ? 428  ARG C CG    1 
ATOM   6975  C  CD    . ARG C 2  428  ? -1.448  -15.297 72.284  1.00 17.08  ? 428  ARG C CD    1 
ATOM   6976  N  NE    . ARG C 2  428  ? -0.676  -14.199 72.849  1.00 18.77  ? 428  ARG C NE    1 
ATOM   6977  C  CZ    . ARG C 2  428  ? -0.170  -13.196 72.140  1.00 16.46  ? 428  ARG C CZ    1 
ATOM   6978  N  NH1   . ARG C 2  428  ? -0.366  -13.132 70.829  1.00 13.73  ? 428  ARG C NH1   1 
ATOM   6979  N  NH2   . ARG C 2  428  ? 0.524   -12.250 72.750  1.00 15.80  ? 428  ARG C NH2   1 
ATOM   6980  N  N     . ASP C 2  429  ? -2.073  -20.470 74.742  1.00 14.55  ? 429  ASP C N     1 
ATOM   6981  C  CA    . ASP C 2  429  ? -2.780  -21.229 75.766  1.00 15.01  ? 429  ASP C CA    1 
ATOM   6982  C  C     . ASP C 2  429  ? -1.812  -22.002 76.639  1.00 13.85  ? 429  ASP C C     1 
ATOM   6983  O  O     . ASP C 2  429  ? -0.670  -22.244 76.254  1.00 17.22  ? 429  ASP C O     1 
ATOM   6984  C  CB    . ASP C 2  429  ? -3.755  -22.215 75.122  1.00 17.97  ? 429  ASP C CB    1 
ATOM   6985  C  CG    . ASP C 2  429  ? -5.165  -21.676 75.045  1.00 25.93  ? 429  ASP C CG    1 
ATOM   6986  O  OD1   . ASP C 2  429  ? -5.629  -21.081 76.040  1.00 24.39  ? 429  ASP C OD1   1 
ATOM   6987  O  OD2   . ASP C 2  429  ? -5.807  -21.849 73.987  1.00 30.84  ? 429  ASP C OD2   1 
ATOM   6988  N  N     . VAL C 2  430  ? -2.274  -22.388 77.821  1.00 14.84  ? 430  VAL C N     1 
ATOM   6989  C  CA    . VAL C 2  430  ? -1.526  -23.327 78.634  1.00 13.39  ? 430  VAL C CA    1 
ATOM   6990  C  C     . VAL C 2  430  ? -2.035  -24.703 78.251  1.00 14.06  ? 430  VAL C C     1 
ATOM   6991  O  O     . VAL C 2  430  ? -3.168  -25.067 78.562  1.00 14.14  ? 430  VAL C O     1 
ATOM   6992  C  CB    . VAL C 2  430  ? -1.774  -23.102 80.135  1.00 12.00  ? 430  VAL C CB    1 
ATOM   6993  C  CG1   . VAL C 2  430  ? -1.210  -24.256 80.950  1.00 10.77  ? 430  VAL C CG1   1 
ATOM   6994  C  CG2   . VAL C 2  430  ? -1.166  -21.785 80.581  1.00 8.94   ? 430  VAL C CG2   1 
ATOM   6995  N  N     . HIS C 2  431  ? -1.193  -25.463 77.563  1.00 12.32  ? 431  HIS C N     1 
ATOM   6996  C  CA    . HIS C 2  431  ? -1.562  -26.799 77.140  1.00 12.03  ? 431  HIS C CA    1 
ATOM   6997  C  C     . HIS C 2  431  ? -1.445  -27.683 78.365  1.00 15.79  ? 431  HIS C C     1 
ATOM   6998  O  O     . HIS C 2  431  ? -0.641  -27.402 79.255  1.00 14.47  ? 431  HIS C O     1 
ATOM   6999  C  CB    . HIS C 2  431  ? -0.617  -27.286 76.045  1.00 13.57  ? 431  HIS C CB    1 
ATOM   7000  C  CG    . HIS C 2  431  ? -1.165  -28.411 75.224  1.00 12.31  ? 431  HIS C CG    1 
ATOM   7001  N  ND1   . HIS C 2  431  ? -1.288  -29.695 75.707  1.00 11.11  ? 431  HIS C ND1   1 
ATOM   7002  C  CD2   . HIS C 2  431  ? -1.615  -28.444 73.947  1.00 15.64  ? 431  HIS C CD2   1 
ATOM   7003  C  CE1   . HIS C 2  431  ? -1.794  -30.470 74.765  1.00 15.16  ? 431  HIS C CE1   1 
ATOM   7004  N  NE2   . HIS C 2  431  ? -2.003  -29.735 73.687  1.00 14.69  ? 431  HIS C NE2   1 
ATOM   7005  N  N     . ARG C 2  432  ? -2.248  -28.740 78.422  1.00 13.38  ? 432  ARG C N     1 
ATOM   7006  C  CA    . ARG C 2  432  ? -2.175  -29.678 79.533  1.00 12.33  ? 432  ARG C CA    1 
ATOM   7007  C  C     . ARG C 2  432  ? -0.758  -30.234 79.663  1.00 10.24  ? 432  ARG C C     1 
ATOM   7008  O  O     . ARG C 2  432  ? -0.272  -30.474 80.768  1.00 9.25   ? 432  ARG C O     1 
ATOM   7009  C  CB    . ARG C 2  432  ? -3.187  -30.810 79.348  1.00 13.19  ? 432  ARG C CB    1 
ATOM   7010  C  CG    . ARG C 2  432  ? -3.047  -31.561 78.037  1.00 14.33  ? 432  ARG C CG    1 
ATOM   7011  C  CD    . ARG C 2  432  ? -3.936  -32.789 78.009  1.00 12.35  ? 432  ARG C CD    1 
ATOM   7012  N  NE    . ARG C 2  432  ? -3.630  -33.661 76.880  1.00 14.80  ? 432  ARG C NE    1 
ATOM   7013  C  CZ    . ARG C 2  432  ? -2.722  -34.631 76.913  1.00 14.58  ? 432  ARG C CZ    1 
ATOM   7014  N  NH1   . ARG C 2  432  ? -2.027  -34.850 78.021  1.00 17.85  ? 432  ARG C NH1   1 
ATOM   7015  N  NH2   . ARG C 2  432  ? -2.508  -35.380 75.842  1.00 12.23  ? 432  ARG C NH2   1 
ATOM   7016  N  N     . THR C 2  433  ? -0.088  -30.386 78.524  1.00 9.98   ? 433  THR C N     1 
ATOM   7017  C  CA    . THR C 2  433  ? 1.253   -30.954 78.471  1.00 12.33  ? 433  THR C CA    1 
ATOM   7018  C  C     . THR C 2  433  ? 2.327   -30.029 79.046  1.00 13.30  ? 433  THR C C     1 
ATOM   7019  O  O     . THR C 2  433  ? 3.489   -30.414 79.146  1.00 13.80  ? 433  THR C O     1 
ATOM   7020  C  CB    . THR C 2  433  ? 1.643   -31.344 77.031  1.00 13.48  ? 433  THR C CB    1 
ATOM   7021  O  OG1   . THR C 2  433  ? 1.658   -30.175 76.203  1.00 16.88  ? 433  THR C OG1   1 
ATOM   7022  C  CG2   . THR C 2  433  ? 0.654   -32.347 76.466  1.00 12.73  ? 433  THR C CG2   1 
ATOM   7023  N  N     . HIS C 2  434  ? 1.945   -28.809 79.411  1.00 14.65  ? 434  HIS C N     1 
ATOM   7024  C  CA    . HIS C 2  434  ? 2.884   -27.880 80.034  1.00 11.85  ? 434  HIS C CA    1 
ATOM   7025  C  C     . HIS C 2  434  ? 3.217   -28.313 81.455  1.00 11.28  ? 434  HIS C C     1 
ATOM   7026  O  O     . HIS C 2  434  ? 4.190   -27.842 82.045  1.00 13.93  ? 434  HIS C O     1 
ATOM   7027  C  CB    . HIS C 2  434  ? 2.321   -26.458 80.045  1.00 10.88  ? 434  HIS C CB    1 
ATOM   7028  C  CG    . HIS C 2  434  ? 2.287   -25.813 78.696  1.00 15.16  ? 434  HIS C CG    1 
ATOM   7029  N  ND1   . HIS C 2  434  ? 2.188   -24.448 78.527  1.00 13.01  ? 434  HIS C ND1   1 
ATOM   7030  C  CD2   . HIS C 2  434  ? 2.342   -26.344 77.451  1.00 14.04  ? 434  HIS C CD2   1 
ATOM   7031  C  CE1   . HIS C 2  434  ? 2.183   -24.167 77.236  1.00 13.33  ? 434  HIS C CE1   1 
ATOM   7032  N  NE2   . HIS C 2  434  ? 2.276   -25.299 76.562  1.00 12.28  ? 434  HIS C NE2   1 
ATOM   7033  N  N     . TYR C 2  435  ? 2.404   -29.217 81.989  1.00 8.56   ? 435  TYR C N     1 
ATOM   7034  C  CA    . TYR C 2  435  ? 2.550   -29.697 83.356  1.00 9.28   ? 435  TYR C CA    1 
ATOM   7035  C  C     . TYR C 2  435  ? 3.963   -30.235 83.581  1.00 11.09  ? 435  TYR C C     1 
ATOM   7036  O  O     . TYR C 2  435  ? 4.426   -31.110 82.854  1.00 13.77  ? 435  TYR C O     1 
ATOM   7037  C  CB    . TYR C 2  435  ? 1.519   -30.801 83.592  1.00 10.71  ? 435  TYR C CB    1 
ATOM   7038  C  CG    . TYR C 2  435  ? 1.321   -31.220 85.027  1.00 12.60  ? 435  TYR C CG    1 
ATOM   7039  C  CD1   . TYR C 2  435  ? 0.183   -30.841 85.727  1.00 9.77   ? 435  TYR C CD1   1 
ATOM   7040  C  CD2   . TYR C 2  435  ? 2.257   -32.016 85.678  1.00 13.66  ? 435  TYR C CD2   1 
ATOM   7041  C  CE1   . TYR C 2  435  ? -0.010  -31.231 87.036  1.00 12.30  ? 435  TYR C CE1   1 
ATOM   7042  C  CE2   . TYR C 2  435  ? 2.074   -32.409 86.988  1.00 12.62  ? 435  TYR C CE2   1 
ATOM   7043  C  CZ    . TYR C 2  435  ? 0.938   -32.016 87.661  1.00 14.20  ? 435  TYR C CZ    1 
ATOM   7044  O  OH    . TYR C 2  435  ? 0.751   -32.409 88.965  1.00 19.96  ? 435  TYR C OH    1 
ATOM   7045  N  N     . GLY C 2  436  ? 4.648   -29.702 84.587  1.00 10.34  ? 436  GLY C N     1 
ATOM   7046  C  CA    . GLY C 2  436  ? 6.007   -30.116 84.889  1.00 9.01   ? 436  GLY C CA    1 
ATOM   7047  C  C     . GLY C 2  436  ? 7.063   -29.622 83.909  1.00 12.44  ? 436  GLY C C     1 
ATOM   7048  O  O     . GLY C 2  436  ? 8.260   -29.794 84.139  1.00 13.46  ? 436  GLY C O     1 
ATOM   7049  N  N     . ARG C 2  437  ? 6.629   -28.993 82.823  1.00 10.17  ? 437  ARG C N     1 
ATOM   7050  C  CA    . ARG C 2  437  ? 7.551   -28.565 81.777  1.00 12.42  ? 437  ARG C CA    1 
ATOM   7051  C  C     . ARG C 2  437  ? 7.657   -27.043 81.674  1.00 14.64  ? 437  ARG C C     1 
ATOM   7052  O  O     . ARG C 2  437  ? 8.719   -26.459 81.904  1.00 9.93   ? 437  ARG C O     1 
ATOM   7053  C  CB    . ARG C 2  437  ? 7.130   -29.167 80.434  1.00 13.33  ? 437  ARG C CB    1 
ATOM   7054  C  CG    . ARG C 2  437  ? 7.244   -30.679 80.407  1.00 14.05  ? 437  ARG C CG    1 
ATOM   7055  C  CD    . ARG C 2  437  ? 6.588   -31.304 79.191  1.00 10.61  ? 437  ARG C CD    1 
ATOM   7056  N  NE    . ARG C 2  437  ? 6.584   -32.758 79.320  1.00 17.43  ? 437  ARG C NE    1 
ATOM   7057  C  CZ    . ARG C 2  437  ? 5.675   -33.445 80.007  1.00 22.04  ? 437  ARG C CZ    1 
ATOM   7058  N  NH1   . ARG C 2  437  ? 4.684   -32.810 80.617  1.00 20.38  ? 437  ARG C NH1   1 
ATOM   7059  N  NH2   . ARG C 2  437  ? 5.756   -34.768 80.086  1.00 19.30  ? 437  ARG C NH2   1 
ATOM   7060  N  N     . ILE C 2  438  ? 6.549   -26.412 81.310  1.00 16.89  ? 438  ILE C N     1 
ATOM   7061  C  CA    . ILE C 2  438  ? 6.494   -24.964 81.173  1.00 15.91  ? 438  ILE C CA    1 
ATOM   7062  C  C     . ILE C 2  438  ? 5.565   -24.393 82.232  1.00 10.25  ? 438  ILE C C     1 
ATOM   7063  O  O     . ILE C 2  438  ? 4.429   -24.838 82.367  1.00 12.06  ? 438  ILE C O     1 
ATOM   7064  C  CB    . ILE C 2  438  ? 5.981   -24.565 79.779  1.00 13.74  ? 438  ILE C CB    1 
ATOM   7065  C  CG1   . ILE C 2  438  ? 6.987   -24.985 78.704  1.00 10.06  ? 438  ILE C CG1   1 
ATOM   7066  C  CG2   . ILE C 2  438  ? 5.712   -23.072 79.715  1.00 11.51  ? 438  ILE C CG2   1 
ATOM   7067  C  CD1   . ILE C 2  438  ? 6.487   -24.781 77.295  1.00 13.32  ? 438  ILE C CD1   1 
ATOM   7068  N  N     . CYS C 2  439  ? 6.049   -23.411 82.983  1.00 9.03   ? 439  CYS C N     1 
ATOM   7069  C  CA    . CYS C 2  439  ? 5.252   -22.822 84.053  1.00 7.57   ? 439  CYS C CA    1 
ATOM   7070  C  C     . CYS C 2  439  ? 3.965   -22.181 83.543  1.00 8.00   ? 439  CYS C C     1 
ATOM   7071  O  O     . CYS C 2  439  ? 3.991   -21.362 82.628  1.00 11.77  ? 439  CYS C O     1 
ATOM   7072  C  CB    . CYS C 2  439  ? 6.062   -21.795 84.833  1.00 7.34   ? 439  CYS C CB    1 
ATOM   7073  S  SG    . CYS C 2  439  ? 5.150   -21.080 86.213  1.00 11.63  ? 439  CYS C SG    1 
ATOM   7074  N  N     . PRO C 2  440  ? 2.830   -22.569 84.134  1.00 7.92   ? 440  PRO C N     1 
ATOM   7075  C  CA    . PRO C 2  440  ? 1.502   -22.047 83.806  1.00 10.72  ? 440  PRO C CA    1 
ATOM   7076  C  C     . PRO C 2  440  ? 1.323   -20.608 84.294  1.00 9.47   ? 440  PRO C C     1 
ATOM   7077  O  O     . PRO C 2  440  ? 0.404   -19.914 83.862  1.00 9.45   ? 440  PRO C O     1 
ATOM   7078  C  CB    . PRO C 2  440  ? 0.576   -22.990 84.573  1.00 9.86   ? 440  PRO C CB    1 
ATOM   7079  C  CG    . PRO C 2  440  ? 1.363   -23.374 85.763  1.00 8.23   ? 440  PRO C CG    1 
ATOM   7080  C  CD    . PRO C 2  440  ? 2.776   -23.507 85.269  1.00 9.68   ? 440  PRO C CD    1 
ATOM   7081  N  N     . VAL C 2  441  ? 2.204   -20.182 85.193  1.00 10.23  ? 441  VAL C N     1 
ATOM   7082  C  CA    . VAL C 2  441  ? 2.077   -18.909 85.903  1.00 8.12   ? 441  VAL C CA    1 
ATOM   7083  C  C     . VAL C 2  441  ? 2.864   -17.747 85.294  1.00 8.83   ? 441  VAL C C     1 
ATOM   7084  O  O     . VAL C 2  441  ? 2.281   -16.716 84.964  1.00 10.21  ? 441  VAL C O     1 
ATOM   7085  C  CB    . VAL C 2  441  ? 2.392   -19.043 87.404  1.00 9.00   ? 441  VAL C CB    1 
ATOM   7086  C  CG1   . VAL C 2  441  ? 2.532   -17.678 88.042  1.00 9.35   ? 441  VAL C CG1   1 
ATOM   7087  C  CG2   . VAL C 2  441  ? 1.290   -19.821 88.092  1.00 11.04  ? 441  VAL C CG2   1 
ATOM   7088  N  N     . GLU C 2  442  ? 4.181   -17.888 85.162  1.00 8.08   ? 442  GLU C N     1 
ATOM   7089  C  CA    . GLU C 2  442  ? 5.004   -16.724 84.857  1.00 10.07  ? 442  GLU C CA    1 
ATOM   7090  C  C     . GLU C 2  442  ? 5.124   -16.470 83.357  1.00 11.27  ? 442  GLU C C     1 
ATOM   7091  O  O     . GLU C 2  442  ? 5.818   -17.180 82.631  1.00 11.50  ? 442  GLU C O     1 
ATOM   7092  C  CB    . GLU C 2  442  ? 6.406   -16.916 85.445  1.00 11.14  ? 442  GLU C CB    1 
ATOM   7093  C  CG    . GLU C 2  442  ? 7.416   -15.855 85.027  1.00 12.91  ? 442  GLU C CG    1 
ATOM   7094  C  CD    . GLU C 2  442  ? 8.855   -16.270 85.299  1.00 18.28  ? 442  GLU C CD    1 
ATOM   7095  O  OE1   . GLU C 2  442  ? 9.081   -17.406 85.768  1.00 14.28  ? 442  GLU C OE1   1 
ATOM   7096  O  OE2   . GLU C 2  442  ? 9.763   -15.454 85.039  1.00 22.46  ? 442  GLU C OE2   1 
ATOM   7097  N  N     . THR C 2  443  ? 4.435   -15.420 82.921  1.00 10.39  ? 443  THR C N     1 
ATOM   7098  C  CA    . THR C 2  443  ? 4.470   -14.931 81.551  1.00 10.41  ? 443  THR C CA    1 
ATOM   7099  C  C     . THR C 2  443  ? 4.202   -13.421 81.603  1.00 9.33   ? 443  THR C C     1 
ATOM   7100  O  O     . THR C 2  443  ? 3.636   -12.934 82.582  1.00 8.11   ? 443  THR C O     1 
ATOM   7101  C  CB    . THR C 2  443  ? 3.425   -15.657 80.684  1.00 6.42   ? 443  THR C CB    1 
ATOM   7102  O  OG1   . THR C 2  443  ? 3.646   -15.352 79.303  1.00 8.05   ? 443  THR C OG1   1 
ATOM   7103  C  CG2   . THR C 2  443  ? 2.018   -15.251 81.081  1.00 5.67   ? 443  THR C CG2   1 
ATOM   7104  N  N     . PRO C 2  444  ? 4.632   -12.666 80.577  1.00 8.95   ? 444  PRO C N     1 
ATOM   7105  C  CA    . PRO C 2  444  ? 4.288   -11.235 80.550  1.00 10.04  ? 444  PRO C CA    1 
ATOM   7106  C  C     . PRO C 2  444  ? 2.778   -10.993 80.484  1.00 7.42   ? 444  PRO C C     1 
ATOM   7107  O  O     . PRO C 2  444  ? 2.049   -11.857 79.998  1.00 9.07   ? 444  PRO C O     1 
ATOM   7108  C  CB    . PRO C 2  444  ? 4.957   -10.742 79.265  1.00 10.07  ? 444  PRO C CB    1 
ATOM   7109  C  CG    . PRO C 2  444  ? 6.099   -11.682 79.057  1.00 10.15  ? 444  PRO C CG    1 
ATOM   7110  C  CD    . PRO C 2  444  ? 5.614   -13.018 79.538  1.00 8.78   ? 444  PRO C CD    1 
ATOM   7111  N  N     . GLU C 2  445  ? 2.318   -9.844  80.971  1.00 5.46   ? 445  GLU C N     1 
ATOM   7112  C  CA    . GLU C 2  445  ? 0.890   -9.536  80.972  1.00 6.25   ? 445  GLU C CA    1 
ATOM   7113  C  C     . GLU C 2  445  ? 0.408   -9.075  79.603  1.00 9.32   ? 445  GLU C C     1 
ATOM   7114  O  O     . GLU C 2  445  ? -0.742  -9.301  79.228  1.00 9.75   ? 445  GLU C O     1 
ATOM   7115  C  CB    . GLU C 2  445  ? 0.567   -8.438  81.983  1.00 6.47   ? 445  GLU C CB    1 
ATOM   7116  C  CG    . GLU C 2  445  ? 0.923   -8.740  83.417  1.00 8.02   ? 445  GLU C CG    1 
ATOM   7117  C  CD    . GLU C 2  445  ? 0.273   -7.759  84.375  1.00 9.77   ? 445  GLU C CD    1 
ATOM   7118  O  OE1   . GLU C 2  445  ? -0.833  -7.272  84.054  1.00 8.03   ? 445  GLU C OE1   1 
ATOM   7119  O  OE2   . GLU C 2  445  ? 0.861   -7.469  85.439  1.00 9.03   ? 445  GLU C OE2   1 
ATOM   7120  N  N     . GLY C 2  446  ? 1.304   -8.438  78.859  1.00 8.43   ? 446  GLY C N     1 
ATOM   7121  C  CA    . GLY C 2  446  ? 0.946   -7.711  77.656  1.00 7.44   ? 446  GLY C CA    1 
ATOM   7122  C  C     . GLY C 2  446  ? 1.017   -8.511  76.371  1.00 8.27   ? 446  GLY C C     1 
ATOM   7123  O  O     . GLY C 2  446  ? 0.665   -9.688  76.337  1.00 8.55   ? 446  GLY C O     1 
ATOM   7124  N  N     . ALA C 2  447  ? 1.434   -7.839  75.303  1.00 7.89   ? 447  ALA C N     1 
ATOM   7125  C  CA    . ALA C 2  447  ? 1.459   -8.404  73.957  1.00 8.48   ? 447  ALA C CA    1 
ATOM   7126  C  C     . ALA C 2  447  ? 2.189   -9.741  73.831  1.00 10.48  ? 447  ALA C C     1 
ATOM   7127  O  O     . ALA C 2  447  ? 1.887   -10.534 72.943  1.00 13.19  ? 447  ALA C O     1 
ATOM   7128  C  CB    . ALA C 2  447  ? 2.050   -7.392  72.987  1.00 9.49   ? 447  ALA C CB    1 
ATOM   7129  N  N     . ASN C 2  448  ? 3.155   -9.987  74.706  1.00 9.13   ? 448  ASN C N     1 
ATOM   7130  C  CA    . ASN C 2  448  ? 3.941   -11.213 74.636  1.00 10.30  ? 448  ASN C CA    1 
ATOM   7131  C  C     . ASN C 2  448  ? 3.368   -12.361 75.457  1.00 11.61  ? 448  ASN C C     1 
ATOM   7132  O  O     . ASN C 2  448  ? 4.010   -13.402 75.597  1.00 12.97  ? 448  ASN C O     1 
ATOM   7133  C  CB    . ASN C 2  448  ? 5.389   -10.955 75.054  1.00 12.40  ? 448  ASN C CB    1 
ATOM   7134  C  CG    . ASN C 2  448  ? 6.206   -10.312 73.956  1.00 11.07  ? 448  ASN C CG    1 
ATOM   7135  O  OD1   . ASN C 2  448  ? 6.032   -10.618 72.778  1.00 14.06  ? 448  ASN C OD1   1 
ATOM   7136  N  ND2   . ASN C 2  448  ? 7.107   -9.416  74.338  1.00 11.32  ? 448  ASN C ND2   1 
ATOM   7137  N  N     . ILE C 2  449  ? 2.180   -12.164 76.022  1.00 10.39  ? 449  ILE C N     1 
ATOM   7138  C  CA    . ILE C 2  449  ? 1.603   -13.160 76.920  1.00 9.00   ? 449  ILE C CA    1 
ATOM   7139  C  C     . ILE C 2  449  ? 1.492   -14.537 76.263  1.00 11.91  ? 449  ILE C C     1 
ATOM   7140  O  O     . ILE C 2  449  ? 0.960   -14.682 75.159  1.00 14.08  ? 449  ILE C O     1 
ATOM   7141  C  CB    . ILE C 2  449  ? 0.240   -12.712 77.501  1.00 7.15   ? 449  ILE C CB    1 
ATOM   7142  C  CG1   . ILE C 2  449  ? -0.241  -13.716 78.546  1.00 7.24   ? 449  ILE C CG1   1 
ATOM   7143  C  CG2   . ILE C 2  449  ? -0.800  -12.527 76.404  1.00 6.93   ? 449  ILE C CG2   1 
ATOM   7144  C  CD1   . ILE C 2  449  ? -1.515  -13.311 79.234  1.00 10.08  ? 449  ILE C CD1   1 
ATOM   7145  N  N     . GLY C 2  450  ? 2.051   -15.537 76.936  1.00 9.45   ? 450  GLY C N     1 
ATOM   7146  C  CA    . GLY C 2  450  ? 2.023   -16.905 76.455  1.00 11.55  ? 450  GLY C CA    1 
ATOM   7147  C  C     . GLY C 2  450  ? 3.094   -17.206 75.422  1.00 11.52  ? 450  GLY C C     1 
ATOM   7148  O  O     . GLY C 2  450  ? 3.410   -18.369 75.177  1.00 13.93  ? 450  GLY C O     1 
ATOM   7149  N  N     . LEU C 2  451  ? 3.634   -16.162 74.797  1.00 9.19   ? 451  LEU C N     1 
ATOM   7150  C  CA    . LEU C 2  451  ? 4.727   -16.313 73.838  1.00 8.98   ? 451  LEU C CA    1 
ATOM   7151  C  C     . LEU C 2  451  ? 6.100   -16.384 74.509  1.00 10.27  ? 451  LEU C C     1 
ATOM   7152  O  O     . LEU C 2  451  ? 6.995   -17.082 74.033  1.00 13.60  ? 451  LEU C O     1 
ATOM   7153  C  CB    . LEU C 2  451  ? 4.689   -15.203 72.790  1.00 10.09  ? 451  LEU C CB    1 
ATOM   7154  C  CG    . LEU C 2  451  ? 3.357   -15.068 72.051  1.00 11.55  ? 451  LEU C CG    1 
ATOM   7155  C  CD1   . LEU C 2  451  ? 3.485   -14.105 70.883  1.00 10.81  ? 451  LEU C CD1   1 
ATOM   7156  C  CD2   . LEU C 2  451  ? 2.853   -16.424 71.585  1.00 9.75   ? 451  LEU C CD2   1 
ATOM   7157  N  N     . ILE C 2  452  ? 6.262   -15.642 75.600  1.00 7.72   ? 452  ILE C N     1 
ATOM   7158  C  CA    . ILE C 2  452  ? 7.478   -15.696 76.402  1.00 6.45   ? 452  ILE C CA    1 
ATOM   7159  C  C     . ILE C 2  452  ? 7.159   -16.414 77.704  1.00 7.81   ? 452  ILE C C     1 
ATOM   7160  O  O     . ILE C 2  452  ? 6.405   -15.903 78.528  1.00 8.96   ? 452  ILE C O     1 
ATOM   7161  C  CB    . ILE C 2  452  ? 7.999   -14.287 76.741  1.00 9.61   ? 452  ILE C CB    1 
ATOM   7162  C  CG1   . ILE C 2  452  ? 8.258   -13.479 75.466  1.00 10.12  ? 452  ILE C CG1   1 
ATOM   7163  C  CG2   . ILE C 2  452  ? 9.252   -14.368 77.603  1.00 7.42   ? 452  ILE C CG2   1 
ATOM   7164  C  CD1   . ILE C 2  452  ? 9.487   -13.897 74.712  1.00 8.44   ? 452  ILE C CD1   1 
ATOM   7165  N  N     . THR C 2  453  ? 7.722   -17.601 77.889  1.00 8.99   ? 453  THR C N     1 
ATOM   7166  C  CA    . THR C 2  453  ? 7.403   -18.412 79.059  1.00 8.56   ? 453  THR C CA    1 
ATOM   7167  C  C     . THR C 2  453  ? 8.644   -18.825 79.834  1.00 8.51   ? 453  THR C C     1 
ATOM   7168  O  O     . THR C 2  453  ? 9.760   -18.433 79.497  1.00 11.75  ? 453  THR C O     1 
ATOM   7169  C  CB    . THR C 2  453  ? 6.593   -19.667 78.678  1.00 10.28  ? 453  THR C CB    1 
ATOM   7170  O  OG1   . THR C 2  453  ? 7.282   -20.390 77.651  1.00 12.21  ? 453  THR C OG1   1 
ATOM   7171  C  CG2   . THR C 2  453  ? 5.201   -19.278 78.179  1.00 7.37   ? 453  THR C CG2   1 
ATOM   7172  N  N     . SER C 2  454  ? 8.441   -19.622 80.877  1.00 9.13   ? 454  SER C N     1 
ATOM   7173  C  CA    . SER C 2  454  ? 9.530   -19.999 81.768  1.00 10.67  ? 454  SER C CA    1 
ATOM   7174  C  C     . SER C 2  454  ? 9.615   -21.510 81.980  1.00 11.87  ? 454  SER C C     1 
ATOM   7175  O  O     . SER C 2  454  ? 8.597   -22.191 82.139  1.00 8.34   ? 454  SER C O     1 
ATOM   7176  C  CB    . SER C 2  454  ? 9.378   -19.286 83.110  1.00 11.03  ? 454  SER C CB    1 
ATOM   7177  O  OG    . SER C 2  454  ? 10.522  -19.473 83.918  1.00 13.38  ? 454  SER C OG    1 
ATOM   7178  N  N     . LEU C 2  455  ? 10.842  -22.024 81.977  1.00 15.18  ? 455  LEU C N     1 
ATOM   7179  C  CA    . LEU C 2  455  ? 11.094  -23.445 82.181  1.00 9.59   ? 455  LEU C CA    1 
ATOM   7180  C  C     . LEU C 2  455  ? 10.775  -23.811 83.619  1.00 9.78   ? 455  LEU C C     1 
ATOM   7181  O  O     . LEU C 2  455  ? 11.215  -23.129 84.542  1.00 12.33  ? 455  LEU C O     1 
ATOM   7182  C  CB    . LEU C 2  455  ? 12.557  -23.764 81.878  1.00 8.54   ? 455  LEU C CB    1 
ATOM   7183  C  CG    . LEU C 2  455  ? 12.962  -25.237 81.842  1.00 15.10  ? 455  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C 2  455  ? 12.308  -25.942 80.662  1.00 15.04  ? 455  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C 2  455  ? 14.475  -25.377 81.774  1.00 12.97  ? 455  LEU C CD2   1 
ATOM   7186  N  N     . ALA C 2  456  ? 10.011  -24.884 83.811  1.00 10.69  ? 456  ALA C N     1 
ATOM   7187  C  CA    . ALA C 2  456  ? 9.628   -25.323 85.152  1.00 9.23   ? 456  ALA C CA    1 
ATOM   7188  C  C     . ALA C 2  456  ? 10.853  -25.764 85.951  1.00 10.53  ? 456  ALA C C     1 
ATOM   7189  O  O     . ALA C 2  456  ? 11.886  -26.098 85.373  1.00 16.60  ? 456  ALA C O     1 
ATOM   7190  C  CB    . ALA C 2  456  ? 8.604   -26.440 85.077  1.00 10.44  ? 456  ALA C CB    1 
ATOM   7191  N  N     . ALA C 2  457  ? 10.736  -25.751 87.276  1.00 8.64   ? 457  ALA C N     1 
ATOM   7192  C  CA    . ALA C 2  457  ? 11.882  -25.984 88.156  1.00 11.53  ? 457  ALA C CA    1 
ATOM   7193  C  C     . ALA C 2  457  ? 12.594  -27.322 87.932  1.00 12.57  ? 457  ALA C C     1 
ATOM   7194  O  O     . ALA C 2  457  ? 13.818  -27.367 87.838  1.00 14.15  ? 457  ALA C O     1 
ATOM   7195  C  CB    . ALA C 2  457  ? 11.471  -25.832 89.617  1.00 9.66   ? 457  ALA C CB    1 
ATOM   7196  N  N     . TYR C 2  458  ? 11.828  -28.404 87.845  1.00 14.39  ? 458  TYR C N     1 
ATOM   7197  C  CA    . TYR C 2  458  ? 12.405  -29.735 87.671  1.00 14.84  ? 458  TYR C CA    1 
ATOM   7198  C  C     . TYR C 2  458  ? 12.537  -30.123 86.203  1.00 14.68  ? 458  TYR C C     1 
ATOM   7199  O  O     . TYR C 2  458  ? 13.016  -31.211 85.885  1.00 16.38  ? 458  TYR C O     1 
ATOM   7200  C  CB    . TYR C 2  458  ? 11.565  -30.787 88.400  1.00 16.77  ? 458  TYR C CB    1 
ATOM   7201  C  CG    . TYR C 2  458  ? 11.911  -30.969 89.860  1.00 16.83  ? 458  TYR C CG    1 
ATOM   7202  C  CD1   . TYR C 2  458  ? 11.127  -30.404 90.859  1.00 15.23  ? 458  TYR C CD1   1 
ATOM   7203  C  CD2   . TYR C 2  458  ? 13.020  -31.713 90.240  1.00 15.87  ? 458  TYR C CD2   1 
ATOM   7204  C  CE1   . TYR C 2  458  ? 11.441  -30.575 92.197  1.00 15.58  ? 458  TYR C CE1   1 
ATOM   7205  C  CE2   . TYR C 2  458  ? 13.342  -31.886 91.571  1.00 16.15  ? 458  TYR C CE2   1 
ATOM   7206  C  CZ    . TYR C 2  458  ? 12.552  -31.316 92.543  1.00 14.74  ? 458  TYR C CZ    1 
ATOM   7207  O  OH    . TYR C 2  458  ? 12.878  -31.491 93.865  1.00 15.52  ? 458  TYR C OH    1 
ATOM   7208  N  N     . ALA C 2  459  ? 12.112  -29.231 85.313  1.00 16.33  ? 459  ALA C N     1 
ATOM   7209  C  CA    . ALA C 2  459  ? 12.074  -29.525 83.881  1.00 14.56  ? 459  ALA C CA    1 
ATOM   7210  C  C     . ALA C 2  459  ? 13.461  -29.596 83.241  1.00 15.42  ? 459  ALA C C     1 
ATOM   7211  O  O     . ALA C 2  459  ? 14.376  -28.866 83.628  1.00 17.97  ? 459  ALA C O     1 
ATOM   7212  C  CB    . ALA C 2  459  ? 11.205  -28.506 83.158  1.00 13.27  ? 459  ALA C CB    1 
ATOM   7213  N  N     . ARG C 2  460  ? 13.599  -30.481 82.258  1.00 15.48  ? 460  ARG C N     1 
ATOM   7214  C  CA    . ARG C 2  460  ? 14.858  -30.677 81.544  1.00 13.67  ? 460  ARG C CA    1 
ATOM   7215  C  C     . ARG C 2  460  ? 14.621  -30.812 80.044  1.00 16.54  ? 460  ARG C C     1 
ATOM   7216  O  O     . ARG C 2  460  ? 13.627  -31.399 79.614  1.00 17.23  ? 460  ARG C O     1 
ATOM   7217  C  CB    . ARG C 2  460  ? 15.558  -31.942 82.032  1.00 18.75  ? 460  ARG C CB    1 
ATOM   7218  C  CG    . ARG C 2  460  ? 16.220  -31.843 83.386  1.00 18.87  ? 460  ARG C CG    1 
ATOM   7219  C  CD    . ARG C 2  460  ? 17.129  -33.041 83.574  1.00 28.56  ? 460  ARG C CD    1 
ATOM   7220  N  NE    . ARG C 2  460  ? 17.985  -32.928 84.749  1.00 35.88  ? 460  ARG C NE    1 
ATOM   7221  C  CZ    . ARG C 2  460  ? 19.137  -33.574 84.886  1.00 34.00  ? 460  ARG C CZ    1 
ATOM   7222  N  NH1   . ARG C 2  460  ? 19.568  -34.366 83.912  1.00 28.59  ? 460  ARG C NH1   1 
ATOM   7223  N  NH2   . ARG C 2  460  ? 19.862  -33.424 85.987  1.00 45.05  ? 460  ARG C NH2   1 
ATOM   7224  N  N     . VAL C 2  461  ? 15.540  -30.281 79.246  1.00 14.67  ? 461  VAL C N     1 
ATOM   7225  C  CA    . VAL C 2  461  ? 15.445  -30.418 77.800  1.00 15.23  ? 461  VAL C CA    1 
ATOM   7226  C  C     . VAL C 2  461  ? 16.359  -31.541 77.341  1.00 18.77  ? 461  VAL C C     1 
ATOM   7227  O  O     . VAL C 2  461  ? 17.568  -31.496 77.576  1.00 17.68  ? 461  VAL C O     1 
ATOM   7228  C  CB    . VAL C 2  461  ? 15.853  -29.126 77.076  1.00 14.13  ? 461  VAL C CB    1 
ATOM   7229  C  CG1   . VAL C 2  461  ? 15.582  -29.257 75.589  1.00 14.40  ? 461  VAL C CG1   1 
ATOM   7230  C  CG2   . VAL C 2  461  ? 15.106  -27.932 77.651  1.00 12.17  ? 461  VAL C CG2   1 
ATOM   7231  N  N     . ASP C 2  462  ? 15.785  -32.548 76.688  1.00 17.64  ? 462  ASP C N     1 
ATOM   7232  C  CA    . ASP C 2  462  ? 16.567  -33.690 76.223  1.00 17.13  ? 462  ASP C CA    1 
ATOM   7233  C  C     . ASP C 2  462  ? 17.417  -33.368 74.995  1.00 23.47  ? 462  ASP C C     1 
ATOM   7234  O  O     . ASP C 2  462  ? 17.373  -32.257 74.468  1.00 24.29  ? 462  ASP C O     1 
ATOM   7235  C  CB    . ASP C 2  462  ? 15.674  -34.908 75.955  1.00 18.47  ? 462  ASP C CB    1 
ATOM   7236  C  CG    . ASP C 2  462  ? 14.582  -34.635 74.925  1.00 21.52  ? 462  ASP C CG    1 
ATOM   7237  O  OD1   . ASP C 2  462  ? 14.809  -33.848 73.981  1.00 23.46  ? 462  ASP C OD1   1 
ATOM   7238  O  OD2   . ASP C 2  462  ? 13.488  -35.224 75.056  1.00 19.04  ? 462  ASP C OD2   1 
ATOM   7239  N  N     . GLU C 2  463  ? 18.173  -34.361 74.537  1.00 29.67  ? 463  GLU C N     1 
ATOM   7240  C  CA    . GLU C 2  463  ? 19.084  -34.186 73.414  1.00 23.46  ? 463  GLU C CA    1 
ATOM   7241  C  C     . GLU C 2  463  ? 18.332  -33.898 72.121  1.00 21.57  ? 463  GLU C C     1 
ATOM   7242  O  O     . GLU C 2  463  ? 18.882  -33.310 71.192  1.00 23.10  ? 463  GLU C O     1 
ATOM   7243  C  CB    . GLU C 2  463  ? 19.965  -35.425 73.255  1.00 31.12  ? 463  GLU C CB    1 
ATOM   7244  C  CG    . GLU C 2  463  ? 20.731  -35.789 74.520  1.00 46.92  ? 463  GLU C CG    1 
ATOM   7245  C  CD    . GLU C 2  463  ? 21.569  -37.043 74.362  1.00 60.90  ? 463  GLU C CD    1 
ATOM   7246  O  OE1   . GLU C 2  463  ? 22.178  -37.479 75.364  1.00 49.19  ? 463  GLU C OE1   1 
ATOM   7247  O  OE2   . GLU C 2  463  ? 21.617  -37.593 73.241  1.00 63.70  ? 463  GLU C OE2   1 
ATOM   7248  N  N     . LEU C 2  464  ? 17.070  -34.311 72.068  1.00 19.45  ? 464  LEU C N     1 
ATOM   7249  C  CA    . LEU C 2  464  ? 16.237  -34.069 70.897  1.00 21.57  ? 464  LEU C CA    1 
ATOM   7250  C  C     . LEU C 2  464  ? 15.536  -32.712 70.949  1.00 21.76  ? 464  LEU C C     1 
ATOM   7251  O  O     . LEU C 2  464  ? 14.987  -32.251 69.947  1.00 20.24  ? 464  LEU C O     1 
ATOM   7252  C  CB    . LEU C 2  464  ? 15.216  -35.193 70.725  1.00 24.75  ? 464  LEU C CB    1 
ATOM   7253  C  CG    . LEU C 2  464  ? 15.513  -36.192 69.605  1.00 25.13  ? 464  LEU C CG    1 
ATOM   7254  C  CD1   . LEU C 2  464  ? 16.986  -36.569 69.577  1.00 23.01  ? 464  LEU C CD1   1 
ATOM   7255  C  CD2   . LEU C 2  464  ? 14.631  -37.421 69.744  1.00 28.83  ? 464  LEU C CD2   1 
ATOM   7256  N  N     . GLY C 2  465  ? 15.560  -32.076 72.118  1.00 21.28  ? 465  GLY C N     1 
ATOM   7257  C  CA    . GLY C 2  465  ? 14.997  -30.746 72.277  1.00 20.38  ? 465  GLY C CA    1 
ATOM   7258  C  C     . GLY C 2  465  ? 13.609  -30.705 72.895  1.00 20.73  ? 465  GLY C C     1 
ATOM   7259  O  O     . GLY C 2  465  ? 12.946  -29.667 72.875  1.00 17.79  ? 465  GLY C O     1 
ATOM   7260  N  N     . PHE C 2  466  ? 13.167  -31.831 73.446  1.00 17.48  ? 466  PHE C N     1 
ATOM   7261  C  CA    . PHE C 2  466  ? 11.855  -31.906 74.075  1.00 14.33  ? 466  PHE C CA    1 
ATOM   7262  C  C     . PHE C 2  466  ? 11.963  -31.750 75.587  1.00 17.02  ? 466  PHE C C     1 
ATOM   7263  O  O     . PHE C 2  466  ? 12.872  -32.294 76.213  1.00 20.08  ? 466  PHE C O     1 
ATOM   7264  C  CB    . PHE C 2  466  ? 11.166  -33.222 73.719  1.00 12.50  ? 466  PHE C CB    1 
ATOM   7265  C  CG    . PHE C 2  466  ? 10.952  -33.409 72.248  1.00 15.68  ? 466  PHE C CG    1 
ATOM   7266  C  CD1   . PHE C 2  466  ? 11.832  -34.173 71.498  1.00 20.39  ? 466  PHE C CD1   1 
ATOM   7267  C  CD2   . PHE C 2  466  ? 9.879   -32.810 71.609  1.00 13.06  ? 466  PHE C CD2   1 
ATOM   7268  C  CE1   . PHE C 2  466  ? 11.640  -34.344 70.135  1.00 22.85  ? 466  PHE C CE1   1 
ATOM   7269  C  CE2   . PHE C 2  466  ? 9.683   -32.974 70.249  1.00 15.74  ? 466  PHE C CE2   1 
ATOM   7270  C  CZ    . PHE C 2  466  ? 10.562  -33.743 69.511  1.00 19.50  ? 466  PHE C CZ    1 
ATOM   7271  N  N     . ILE C 2  467  ? 11.038  -30.999 76.173  1.00 15.71  ? 467  ILE C N     1 
ATOM   7272  C  CA    . ILE C 2  467  ? 11.086  -30.741 77.605  1.00 14.63  ? 467  ILE C CA    1 
ATOM   7273  C  C     . ILE C 2  467  ? 10.562  -31.941 78.382  1.00 15.18  ? 467  ILE C C     1 
ATOM   7274  O  O     . ILE C 2  467  ? 9.460   -32.425 78.128  1.00 12.04  ? 467  ILE C O     1 
ATOM   7275  C  CB    . ILE C 2  467  ? 10.296  -29.479 77.991  1.00 13.35  ? 467  ILE C CB    1 
ATOM   7276  C  CG1   . ILE C 2  467  ? 10.626  -28.331 77.033  1.00 10.65  ? 467  ILE C CG1   1 
ATOM   7277  C  CG2   . ILE C 2  467  ? 10.598  -29.094 79.431  1.00 11.32  ? 467  ILE C CG2   1 
ATOM   7278  C  CD1   . ILE C 2  467  ? 9.882   -27.049 77.323  1.00 5.75   ? 467  ILE C CD1   1 
ATOM   7279  N  N     . ARG C 2  468  ? 11.366  -32.419 79.325  1.00 16.95  ? 468  ARG C N     1 
ATOM   7280  C  CA    . ARG C 2  468  ? 11.015  -33.596 80.105  1.00 15.75  ? 468  ARG C CA    1 
ATOM   7281  C  C     . ARG C 2  468  ? 10.893  -33.267 81.585  1.00 18.38  ? 468  ARG C C     1 
ATOM   7282  O  O     . ARG C 2  468  ? 11.660  -32.466 82.123  1.00 16.25  ? 468  ARG C O     1 
ATOM   7283  C  CB    . ARG C 2  468  ? 12.035  -34.719 79.880  1.00 13.50  ? 468  ARG C CB    1 
ATOM   7284  C  CG    . ARG C 2  468  ? 11.992  -35.310 78.474  1.00 17.08  ? 468  ARG C CG    1 
ATOM   7285  C  CD    . ARG C 2  468  ? 13.254  -36.101 78.144  1.00 24.53  ? 468  ARG C CD    1 
ATOM   7286  N  NE    . ARG C 2  468  ? 13.175  -37.511 78.526  1.00 30.85  ? 468  ARG C NE    1 
ATOM   7287  C  CZ    . ARG C 2  468  ? 13.295  -38.528 77.677  1.00 19.69  ? 468  ARG C CZ    1 
ATOM   7288  N  NH1   . ARG C 2  468  ? 13.500  -38.306 76.385  1.00 11.33  ? 468  ARG C NH1   1 
ATOM   7289  N  NH2   . ARG C 2  468  ? 13.210  -39.774 78.121  1.00 38.31  ? 468  ARG C NH2   1 
ATOM   7290  N  N     . THR C 2  469  ? 9.913   -33.886 82.233  1.00 19.42  ? 469  THR C N     1 
ATOM   7291  C  CA    . THR C 2  469  ? 9.670   -33.667 83.652  1.00 20.21  ? 469  THR C CA    1 
ATOM   7292  C  C     . THR C 2  469  ? 9.811   -34.988 84.400  1.00 19.06  ? 469  THR C C     1 
ATOM   7293  O  O     . THR C 2  469  ? 9.468   -36.042 83.868  1.00 18.40  ? 469  THR C O     1 
ATOM   7294  C  CB    . THR C 2  469  ? 8.267   -33.053 83.893  1.00 13.83  ? 469  THR C CB    1 
ATOM   7295  O  OG1   . THR C 2  469  ? 8.034   -32.908 85.298  1.00 14.60  ? 469  THR C OG1   1 
ATOM   7296  C  CG2   . THR C 2  469  ? 7.178   -33.925 83.292  1.00 14.99  ? 469  THR C CG2   1 
ATOM   7297  N  N     . PRO C 2  470  ? 10.343  -34.941 85.631  1.00 16.76  ? 470  PRO C N     1 
ATOM   7298  C  CA    . PRO C 2  470  ? 10.547  -36.167 86.404  1.00 16.89  ? 470  PRO C CA    1 
ATOM   7299  C  C     . PRO C 2  470  ? 9.268   -36.725 87.023  1.00 17.04  ? 470  PRO C C     1 
ATOM   7300  O  O     . PRO C 2  470  ? 8.383   -35.978 87.434  1.00 20.13  ? 470  PRO C O     1 
ATOM   7301  C  CB    . PRO C 2  470  ? 11.511  -35.721 87.504  1.00 15.41  ? 470  PRO C CB    1 
ATOM   7302  C  CG    . PRO C 2  470  ? 11.208  -34.292 87.695  1.00 16.23  ? 470  PRO C CG    1 
ATOM   7303  C  CD    . PRO C 2  470  ? 10.868  -33.758 86.335  1.00 16.43  ? 470  PRO C CD    1 
ATOM   7304  N  N     . TYR C 2  471  ? 9.188   -38.048 87.082  1.00 20.10  ? 471  TYR C N     1 
ATOM   7305  C  CA    . TYR C 2  471  ? 8.151   -38.732 87.839  1.00 22.23  ? 471  TYR C CA    1 
ATOM   7306  C  C     . TYR C 2  471  ? 8.807   -39.883 88.580  1.00 25.73  ? 471  TYR C C     1 
ATOM   7307  O  O     . TYR C 2  471  ? 10.013  -40.096 88.461  1.00 25.37  ? 471  TYR C O     1 
ATOM   7308  C  CB    . TYR C 2  471  ? 7.046   -39.256 86.923  1.00 20.64  ? 471  TYR C CB    1 
ATOM   7309  C  CG    . TYR C 2  471  ? 6.217   -38.174 86.269  1.00 26.21  ? 471  TYR C CG    1 
ATOM   7310  C  CD1   . TYR C 2  471  ? 5.364   -37.376 87.021  1.00 25.55  ? 471  TYR C CD1   1 
ATOM   7311  C  CD2   . TYR C 2  471  ? 6.276   -37.960 84.897  1.00 22.38  ? 471  TYR C CD2   1 
ATOM   7312  C  CE1   . TYR C 2  471  ? 4.598   -36.388 86.427  1.00 18.45  ? 471  TYR C CE1   1 
ATOM   7313  C  CE2   . TYR C 2  471  ? 5.516   -36.978 84.295  1.00 22.86  ? 471  TYR C CE2   1 
ATOM   7314  C  CZ    . TYR C 2  471  ? 4.678   -36.195 85.064  1.00 21.93  ? 471  TYR C CZ    1 
ATOM   7315  O  OH    . TYR C 2  471  ? 3.918   -35.217 84.465  1.00 19.93  ? 471  TYR C OH    1 
ATOM   7316  N  N     . ARG C 2  472  ? 8.015   -40.628 89.342  1.00 31.20  ? 472  ARG C N     1 
ATOM   7317  C  CA    . ARG C 2  472  ? 8.541   -41.732 90.133  1.00 31.96  ? 472  ARG C CA    1 
ATOM   7318  C  C     . ARG C 2  472  ? 7.772   -43.012 89.863  1.00 29.05  ? 472  ARG C C     1 
ATOM   7319  O  O     . ARG C 2  472  ? 6.543   -43.017 89.875  1.00 25.47  ? 472  ARG C O     1 
ATOM   7320  C  CB    . ARG C 2  472  ? 8.490   -41.395 91.622  1.00 28.77  ? 472  ARG C CB    1 
ATOM   7321  C  CG    . ARG C 2  472  ? 9.278   -40.154 91.984  1.00 37.40  ? 472  ARG C CG    1 
ATOM   7322  C  CD    . ARG C 2  472  ? 9.625   -40.138 93.456  1.00 42.25  ? 472  ARG C CD    1 
ATOM   7323  N  NE    . ARG C 2  472  ? 8.450   -39.958 94.300  1.00 42.85  ? 472  ARG C NE    1 
ATOM   7324  C  CZ    . ARG C 2  472  ? 8.271   -40.570 95.466  1.00 51.46  ? 472  ARG C CZ    1 
ATOM   7325  N  NH1   . ARG C 2  472  ? 9.185   -41.420 95.921  1.00 33.95  ? 472  ARG C NH1   1 
ATOM   7326  N  NH2   . ARG C 2  472  ? 7.171   -40.344 96.173  1.00 52.14  ? 472  ARG C NH2   1 
ATOM   7327  N  N     . ARG C 2  473  ? 8.507   -44.093 89.619  1.00 30.27  ? 473  ARG C N     1 
ATOM   7328  C  CA    . ARG C 2  473  ? 7.907   -45.393 89.348  1.00 27.41  ? 473  ARG C CA    1 
ATOM   7329  C  C     . ARG C 2  473  ? 7.088   -45.879 90.534  1.00 28.09  ? 473  ARG C C     1 
ATOM   7330  O  O     . ARG C 2  473  ? 7.556   -45.866 91.675  1.00 27.93  ? 473  ARG C O     1 
ATOM   7331  C  CB    . ARG C 2  473  ? 8.991   -46.422 89.026  1.00 36.86  ? 473  ARG C CB    1 
ATOM   7332  C  CG    . ARG C 2  473  ? 8.458   -47.789 88.618  1.00 37.65  ? 473  ARG C CG    1 
ATOM   7333  C  CD    . ARG C 2  473  ? 8.305   -47.890 87.111  1.00 30.19  ? 473  ARG C CD    1 
ATOM   7334  N  NE    . ARG C 2  473  ? 9.567   -47.608 86.432  1.00 34.36  ? 473  ARG C NE    1 
ATOM   7335  C  CZ    . ARG C 2  473  ? 9.715   -47.579 85.112  1.00 40.35  ? 473  ARG C CZ    1 
ATOM   7336  N  NH1   . ARG C 2  473  ? 8.677   -47.820 84.322  1.00 29.65  ? 473  ARG C NH1   1 
ATOM   7337  N  NH2   . ARG C 2  473  ? 10.902  -47.308 84.581  1.00 34.84  ? 473  ARG C NH2   1 
ATOM   7338  N  N     . VAL C 2  474  ? 5.858   -46.301 90.260  1.00 27.93  ? 474  VAL C N     1 
ATOM   7339  C  CA    . VAL C 2  474  ? 5.022   -46.914 91.285  1.00 37.49  ? 474  VAL C CA    1 
ATOM   7340  C  C     . VAL C 2  474  ? 4.623   -48.334 90.883  1.00 38.76  ? 474  VAL C C     1 
ATOM   7341  O  O     . VAL C 2  474  ? 3.890   -48.534 89.913  1.00 37.95  ? 474  VAL C O     1 
ATOM   7342  C  CB    . VAL C 2  474  ? 3.762   -46.078 91.575  1.00 32.46  ? 474  VAL C CB    1 
ATOM   7343  C  CG1   . VAL C 2  474  ? 2.832   -46.832 92.513  1.00 36.26  ? 474  VAL C CG1   1 
ATOM   7344  C  CG2   . VAL C 2  474  ? 4.146   -44.733 92.172  1.00 32.12  ? 474  VAL C CG2   1 
ATOM   7345  N  N     . VAL C 2  475  ? 5.117   -49.318 91.629  1.00 35.44  ? 475  VAL C N     1 
ATOM   7346  C  CA    . VAL C 2  475  ? 4.796   -50.715 91.361  1.00 34.90  ? 475  VAL C CA    1 
ATOM   7347  C  C     . VAL C 2  475  ? 4.040   -51.329 92.535  1.00 41.58  ? 475  VAL C C     1 
ATOM   7348  O  O     . VAL C 2  475  ? 4.549   -51.369 93.659  1.00 36.33  ? 475  VAL C O     1 
ATOM   7349  C  CB    . VAL C 2  475  ? 6.061   -51.545 91.075  1.00 33.84  ? 475  VAL C CB    1 
ATOM   7350  C  CG1   . VAL C 2  475  ? 5.698   -53.003 90.862  1.00 39.54  ? 475  VAL C CG1   1 
ATOM   7351  C  CG2   . VAL C 2  475  ? 6.795   -50.996 89.860  1.00 34.59  ? 475  VAL C CG2   1 
ATOM   7352  N  N     . GLY C 2  476  ? 2.822   -51.794 92.269  1.00 33.12  ? 476  GLY C N     1 
ATOM   7353  C  CA    . GLY C 2  476  ? 1.993   -52.411 93.289  1.00 35.43  ? 476  GLY C CA    1 
ATOM   7354  C  C     . GLY C 2  476  ? 1.692   -51.501 94.467  1.00 41.91  ? 476  GLY C C     1 
ATOM   7355  O  O     . GLY C 2  476  ? 1.629   -51.952 95.612  1.00 39.84  ? 476  GLY C O     1 
ATOM   7356  N  N     . GLY C 2  477  ? 1.513   -50.214 94.188  1.00 38.55  ? 477  GLY C N     1 
ATOM   7357  C  CA    . GLY C 2  477  ? 1.183   -49.248 95.220  1.00 35.03  ? 477  GLY C CA    1 
ATOM   7358  C  C     . GLY C 2  477  ? 2.383   -48.820 96.040  1.00 36.21  ? 477  GLY C C     1 
ATOM   7359  O  O     . GLY C 2  477  ? 2.252   -48.052 96.993  1.00 36.96  ? 477  GLY C O     1 
ATOM   7360  N  N     . VAL C 2  478  ? 3.557   -49.323 95.672  1.00 35.58  ? 478  VAL C N     1 
ATOM   7361  C  CA    . VAL C 2  478  ? 4.792   -48.951 96.350  1.00 42.90  ? 478  VAL C CA    1 
ATOM   7362  C  C     . VAL C 2  478  ? 5.547   -47.930 95.505  1.00 44.15  ? 478  VAL C C     1 
ATOM   7363  O  O     . VAL C 2  478  ? 5.800   -48.157 94.320  1.00 41.34  ? 478  VAL C O     1 
ATOM   7364  C  CB    . VAL C 2  478  ? 5.687   -50.178 96.611  1.00 43.52  ? 478  VAL C CB    1 
ATOM   7365  C  CG1   . VAL C 2  478  ? 6.890   -49.790 97.457  1.00 40.00  ? 478  VAL C CG1   1 
ATOM   7366  C  CG2   . VAL C 2  478  ? 4.890   -51.277 97.293  1.00 44.71  ? 478  VAL C CG2   1 
ATOM   7367  N  N     . VAL C 2  479  ? 5.899   -46.802 96.115  1.00 41.34  ? 479  VAL C N     1 
ATOM   7368  C  CA    . VAL C 2  479  ? 6.545   -45.716 95.389  1.00 39.60  ? 479  VAL C CA    1 
ATOM   7369  C  C     . VAL C 2  479  ? 8.059   -45.813 95.507  1.00 39.21  ? 479  VAL C C     1 
ATOM   7370  O  O     . VAL C 2  479  ? 8.615   -45.650 96.593  1.00 46.35  ? 479  VAL C O     1 
ATOM   7371  C  CB    . VAL C 2  479  ? 6.091   -44.341 95.913  1.00 37.06  ? 479  VAL C CB    1 
ATOM   7372  C  CG1   . VAL C 2  479  ? 6.336   -43.279 94.864  1.00 36.54  ? 479  VAL C CG1   1 
ATOM   7373  C  CG2   . VAL C 2  479  ? 4.620   -44.375 96.289  1.00 37.16  ? 479  VAL C CG2   1 
ATOM   7374  N  N     . THR C 2  480  ? 8.729   -46.072 94.389  1.00 33.90  ? 480  THR C N     1 
ATOM   7375  C  CA    . THR C 2  480  ? 10.174  -46.257 94.414  1.00 38.05  ? 480  THR C CA    1 
ATOM   7376  C  C     . THR C 2  480  ? 10.901  -44.921 94.477  1.00 44.15  ? 480  THR C C     1 
ATOM   7377  O  O     . THR C 2  480  ? 10.280  -43.859 94.433  1.00 50.45  ? 480  THR C O     1 
ATOM   7378  C  CB    . THR C 2  480  ? 10.662  -47.007 93.165  1.00 36.90  ? 480  THR C CB    1 
ATOM   7379  O  OG1   . THR C 2  480  ? 10.591  -46.139 92.027  1.00 40.52  ? 480  THR C OG1   1 
ATOM   7380  C  CG2   . THR C 2  480  ? 9.808   -48.243 92.915  1.00 29.08  ? 480  THR C CG2   1 
ATOM   7381  N  N     . ASP C 2  481  ? 12.223  -44.980 94.585  1.00 44.73  ? 481  ASP C N     1 
ATOM   7382  C  CA    . ASP C 2  481  ? 13.046  -43.782 94.485  1.00 44.05  ? 481  ASP C CA    1 
ATOM   7383  C  C     . ASP C 2  481  ? 13.608  -43.640 93.078  1.00 43.69  ? 481  ASP C C     1 
ATOM   7384  O  O     . ASP C 2  481  ? 14.378  -42.720 92.796  1.00 46.72  ? 481  ASP C O     1 
ATOM   7385  C  CB    . ASP C 2  481  ? 14.167  -43.788 95.524  1.00 48.02  ? 481  ASP C CB    1 
ATOM   7386  C  CG    . ASP C 2  481  ? 13.670  -43.437 96.912  1.00 60.53  ? 481  ASP C CG    1 
ATOM   7387  O  OD1   . ASP C 2  481  ? 12.561  -42.870 97.017  1.00 52.96  ? 481  ASP C OD1   1 
ATOM   7388  O  OD2   . ASP C 2  481  ? 14.387  -43.721 97.894  1.00 71.49  ? 481  ASP C OD2   1 
ATOM   7389  N  N     . GLU C 2  482  ? 13.228  -44.565 92.202  1.00 36.65  ? 482  GLU C N     1 
ATOM   7390  C  CA    . GLU C 2  482  ? 13.625  -44.493 90.804  1.00 34.18  ? 482  GLU C CA    1 
ATOM   7391  C  C     . GLU C 2  482  ? 12.894  -43.335 90.143  1.00 40.92  ? 482  GLU C C     1 
ATOM   7392  O  O     . GLU C 2  482  ? 11.662  -43.285 90.146  1.00 40.15  ? 482  GLU C O     1 
ATOM   7393  C  CB    . GLU C 2  482  ? 13.284  -45.795 90.078  1.00 38.62  ? 482  GLU C CB    1 
ATOM   7394  C  CG    . GLU C 2  482  ? 13.704  -45.813 88.614  1.00 40.64  ? 482  GLU C CG    1 
ATOM   7395  C  CD    . GLU C 2  482  ? 12.998  -46.891 87.812  1.00 45.80  ? 482  GLU C CD    1 
ATOM   7396  O  OE1   . GLU C 2  482  ? 13.338  -47.062 86.621  1.00 43.05  ? 482  GLU C OE1   1 
ATOM   7397  O  OE2   . GLU C 2  482  ? 12.099  -47.559 88.368  1.00 44.52  ? 482  GLU C OE2   1 
ATOM   7398  N  N     . VAL C 2  483  ? 13.655  -42.409 89.570  1.00 33.57  ? 483  VAL C N     1 
ATOM   7399  C  CA    . VAL C 2  483  ? 13.076  -41.231 88.941  1.00 27.51  ? 483  VAL C CA    1 
ATOM   7400  C  C     . VAL C 2  483  ? 13.223  -41.293 87.427  1.00 23.62  ? 483  VAL C C     1 
ATOM   7401  O  O     . VAL C 2  483  ? 14.313  -41.525 86.911  1.00 29.93  ? 483  VAL C O     1 
ATOM   7402  C  CB    . VAL C 2  483  ? 13.718  -39.941 89.476  1.00 26.53  ? 483  VAL C CB    1 
ATOM   7403  C  CG1   . VAL C 2  483  ? 13.169  -38.731 88.744  1.00 18.98  ? 483  VAL C CG1   1 
ATOM   7404  C  CG2   . VAL C 2  483  ? 13.475  -39.821 90.970  1.00 22.94  ? 483  VAL C CG2   1 
ATOM   7405  N  N     . VAL C 2  484  ? 12.117  -41.089 86.721  1.00 26.94  ? 484  VAL C N     1 
ATOM   7406  C  CA    . VAL C 2  484  ? 12.110  -41.177 85.265  1.00 30.20  ? 484  VAL C CA    1 
ATOM   7407  C  C     . VAL C 2  484  ? 11.651  -39.871 84.621  1.00 30.59  ? 484  VAL C C     1 
ATOM   7408  O  O     . VAL C 2  484  ? 10.559  -39.375 84.902  1.00 26.59  ? 484  VAL C O     1 
ATOM   7409  C  CB    . VAL C 2  484  ? 11.203  -42.327 84.779  1.00 31.59  ? 484  VAL C CB    1 
ATOM   7410  C  CG1   . VAL C 2  484  ? 11.038  -42.278 83.265  1.00 29.66  ? 484  VAL C CG1   1 
ATOM   7411  C  CG2   . VAL C 2  484  ? 11.766  -43.666 85.224  1.00 31.63  ? 484  VAL C CG2   1 
ATOM   7412  N  N     . TYR C 2  485  ? 12.495  -39.317 83.757  1.00 23.59  ? 485  TYR C N     1 
ATOM   7413  C  CA    . TYR C 2  485  ? 12.161  -38.104 83.028  1.00 16.51  ? 485  TYR C CA    1 
ATOM   7414  C  C     . TYR C 2  485  ? 11.484  -38.467 81.711  1.00 19.82  ? 485  TYR C C     1 
ATOM   7415  O  O     . TYR C 2  485  ? 12.091  -39.108 80.857  1.00 28.18  ? 485  TYR C O     1 
ATOM   7416  C  CB    . TYR C 2  485  ? 13.431  -37.299 82.751  1.00 14.85  ? 485  TYR C CB    1 
ATOM   7417  C  CG    . TYR C 2  485  ? 13.880  -36.405 83.887  1.00 16.51  ? 485  TYR C CG    1 
ATOM   7418  C  CD1   . TYR C 2  485  ? 14.650  -36.899 84.931  1.00 13.23  ? 485  TYR C CD1   1 
ATOM   7419  C  CD2   . TYR C 2  485  ? 13.545  -35.056 83.903  1.00 22.91  ? 485  TYR C CD2   1 
ATOM   7420  C  CE1   . TYR C 2  485  ? 15.064  -36.073 85.967  1.00 14.93  ? 485  TYR C CE1   1 
ATOM   7421  C  CE2   . TYR C 2  485  ? 13.955  -34.226 84.928  1.00 19.93  ? 485  TYR C CE2   1 
ATOM   7422  C  CZ    . TYR C 2  485  ? 14.711  -34.737 85.959  1.00 21.23  ? 485  TYR C CZ    1 
ATOM   7423  O  OH    . TYR C 2  485  ? 15.112  -33.900 86.976  1.00 18.86  ? 485  TYR C OH    1 
ATOM   7424  N  N     . MET C 2  486  ? 10.231  -38.059 81.537  1.00 15.98  ? 486  MET C N     1 
ATOM   7425  C  CA    . MET C 2  486  ? 9.516   -38.370 80.302  1.00 17.91  ? 486  MET C CA    1 
ATOM   7426  C  C     . MET C 2  486  ? 9.176   -37.126 79.492  1.00 18.77  ? 486  MET C C     1 
ATOM   7427  O  O     . MET C 2  486  ? 9.044   -36.031 80.038  1.00 18.64  ? 486  MET C O     1 
ATOM   7428  C  CB    . MET C 2  486  ? 8.212   -39.113 80.589  1.00 18.43  ? 486  MET C CB    1 
ATOM   7429  C  CG    . MET C 2  486  ? 8.198   -39.963 81.832  1.00 23.61  ? 486  MET C CG    1 
ATOM   7430  S  SD    . MET C 2  486  ? 6.566   -40.706 82.034  1.00 28.16  ? 486  MET C SD    1 
ATOM   7431  C  CE    . MET C 2  486  ? 6.703   -41.340 83.700  1.00 28.09  ? 486  MET C CE    1 
ATOM   7432  N  N     . THR C 2  487  ? 9.018   -37.308 78.185  1.00 18.70  ? 487  THR C N     1 
ATOM   7433  C  CA    . THR C 2  487  ? 8.422   -36.283 77.343  1.00 17.86  ? 487  THR C CA    1 
ATOM   7434  C  C     . THR C 2  487  ? 6.917   -36.321 77.568  1.00 18.43  ? 487  THR C C     1 
ATOM   7435  O  O     . THR C 2  487  ? 6.421   -37.160 78.318  1.00 19.24  ? 487  THR C O     1 
ATOM   7436  C  CB    . THR C 2  487  ? 8.699   -36.537 75.854  1.00 16.17  ? 487  THR C CB    1 
ATOM   7437  O  OG1   . THR C 2  487  ? 8.008   -37.721 75.434  1.00 18.76  ? 487  THR C OG1   1 
ATOM   7438  C  CG2   . THR C 2  487  ? 10.192  -36.700 75.606  1.00 12.22  ? 487  THR C CG2   1 
ATOM   7439  N  N     . ALA C 2  488  ? 6.186   -35.425 76.916  1.00 18.02  ? 488  ALA C N     1 
ATOM   7440  C  CA    . ALA C 2  488  ? 4.737   -35.390 77.076  1.00 17.90  ? 488  ALA C CA    1 
ATOM   7441  C  C     . ALA C 2  488  ? 4.107   -36.626 76.444  1.00 20.04  ? 488  ALA C C     1 
ATOM   7442  O  O     . ALA C 2  488  ? 3.129   -37.174 76.963  1.00 24.53  ? 488  ALA C O     1 
ATOM   7443  C  CB    . ALA C 2  488  ? 4.162   -34.120 76.476  1.00 16.36  ? 488  ALA C CB    1 
ATOM   7444  N  N     . THR C 2  489  ? 4.689   -37.070 75.333  1.00 16.39  ? 489  THR C N     1 
ATOM   7445  C  CA    . THR C 2  489  ? 4.204   -38.250 74.632  1.00 16.54  ? 489  THR C CA    1 
ATOM   7446  C  C     . THR C 2  489  ? 4.323   -39.489 75.513  1.00 24.18  ? 489  THR C C     1 
ATOM   7447  O  O     . THR C 2  489  ? 3.403   -40.306 75.582  1.00 26.51  ? 489  THR C O     1 
ATOM   7448  C  CB    . THR C 2  489  ? 4.981   -38.490 73.335  1.00 13.83  ? 489  THR C CB    1 
ATOM   7449  O  OG1   . THR C 2  489  ? 5.060   -37.269 72.591  1.00 20.80  ? 489  THR C OG1   1 
ATOM   7450  C  CG2   . THR C 2  489  ? 4.289   -39.549 72.493  1.00 16.35  ? 489  THR C CG2   1 
ATOM   7451  N  N     . GLU C 2  490  ? 5.462   -39.624 76.185  1.00 20.88  ? 490  GLU C N     1 
ATOM   7452  C  CA    . GLU C 2  490  ? 5.673   -40.737 77.101  1.00 24.05  ? 490  GLU C CA    1 
ATOM   7453  C  C     . GLU C 2  490  ? 4.767   -40.631 78.326  1.00 28.86  ? 490  GLU C C     1 
ATOM   7454  O  O     . GLU C 2  490  ? 4.238   -41.636 78.799  1.00 36.01  ? 490  GLU C O     1 
ATOM   7455  C  CB    . GLU C 2  490  ? 7.142   -40.821 77.526  1.00 24.05  ? 490  GLU C CB    1 
ATOM   7456  C  CG    . GLU C 2  490  ? 7.919   -41.954 76.861  1.00 33.20  ? 490  GLU C CG    1 
ATOM   7457  C  CD    . GLU C 2  490  ? 7.527   -43.326 77.386  1.00 29.50  ? 490  GLU C CD    1 
ATOM   7458  O  OE1   . GLU C 2  490  ? 7.294   -44.237 76.565  1.00 32.11  ? 490  GLU C OE1   1 
ATOM   7459  O  OE2   . GLU C 2  490  ? 7.461   -43.496 78.621  1.00 30.66  ? 490  GLU C OE2   1 
ATOM   7460  N  N     . GLU C 2  491  ? 4.589   -39.412 78.830  1.00 26.36  ? 491  GLU C N     1 
ATOM   7461  C  CA    . GLU C 2  491  ? 3.741   -39.174 79.995  1.00 21.62  ? 491  GLU C CA    1 
ATOM   7462  C  C     . GLU C 2  491  ? 2.290   -39.551 79.715  1.00 22.46  ? 491  GLU C C     1 
ATOM   7463  O  O     . GLU C 2  491  ? 1.573   -40.006 80.606  1.00 25.32  ? 491  GLU C O     1 
ATOM   7464  C  CB    . GLU C 2  491  ? 3.818   -37.708 80.428  1.00 24.97  ? 491  GLU C CB    1 
ATOM   7465  C  CG    . GLU C 2  491  ? 2.869   -37.345 81.562  1.00 23.89  ? 491  GLU C CG    1 
ATOM   7466  C  CD    . GLU C 2  491  ? 2.706   -35.851 81.737  1.00 26.70  ? 491  GLU C CD    1 
ATOM   7467  O  OE1   . GLU C 2  491  ? 1.614   -35.332 81.420  1.00 31.78  ? 491  GLU C OE1   1 
ATOM   7468  O  OE2   . GLU C 2  491  ? 3.667   -35.197 82.197  1.00 24.06  ? 491  GLU C OE2   1 
ATOM   7469  N  N     . ASP C 2  492  ? 1.862   -39.365 78.471  1.00 20.22  ? 492  ASP C N     1 
ATOM   7470  C  CA    . ASP C 2  492  ? 0.489   -39.678 78.088  1.00 25.23  ? 492  ASP C CA    1 
ATOM   7471  C  C     . ASP C 2  492  ? 0.136   -41.160 78.234  1.00 27.67  ? 492  ASP C C     1 
ATOM   7472  O  O     . ASP C 2  492  ? -1.040  -41.522 78.250  1.00 29.63  ? 492  ASP C O     1 
ATOM   7473  C  CB    . ASP C 2  492  ? 0.211   -39.213 76.656  1.00 19.70  ? 492  ASP C CB    1 
ATOM   7474  C  CG    . ASP C 2  492  ? -0.271  -37.779 76.593  1.00 23.67  ? 492  ASP C CG    1 
ATOM   7475  O  OD1   . ASP C 2  492  ? -0.636  -37.327 75.487  1.00 25.46  ? 492  ASP C OD1   1 
ATOM   7476  O  OD2   . ASP C 2  492  ? -0.296  -37.107 77.649  1.00 21.58  ? 492  ASP C OD2   1 
ATOM   7477  N  N     . ARG C 2  493  ? 1.151   -42.010 78.348  1.00 29.19  ? 493  ARG C N     1 
ATOM   7478  C  CA    . ARG C 2  493  ? 0.934   -43.454 78.377  1.00 33.60  ? 493  ARG C CA    1 
ATOM   7479  C  C     . ARG C 2  493  ? 0.614   -43.989 79.771  1.00 31.47  ? 493  ARG C C     1 
ATOM   7480  O  O     . ARG C 2  493  ? 0.326   -45.174 79.928  1.00 35.81  ? 493  ARG C O     1 
ATOM   7481  C  CB    . ARG C 2  493  ? 2.154   -44.189 77.809  1.00 33.21  ? 493  ARG C CB    1 
ATOM   7482  C  CG    . ARG C 2  493  ? 2.585   -43.704 76.432  1.00 40.61  ? 493  ARG C CG    1 
ATOM   7483  C  CD    . ARG C 2  493  ? 3.751   -44.512 75.878  1.00 43.84  ? 493  ARG C CD    1 
ATOM   7484  N  NE    . ARG C 2  493  ? 3.370   -45.885 75.558  1.00 47.02  ? 493  ARG C NE    1 
ATOM   7485  C  CZ    . ARG C 2  493  ? 3.736   -46.948 76.268  1.00 49.74  ? 493  ARG C CZ    1 
ATOM   7486  N  NH1   . ARG C 2  493  ? 4.502   -46.800 77.341  1.00 45.53  ? 493  ARG C NH1   1 
ATOM   7487  N  NH2   . ARG C 2  493  ? 3.341   -48.160 75.901  1.00 50.19  ? 493  ARG C NH2   1 
ATOM   7488  N  N     . TYR C 2  494  ? 0.649   -43.121 80.778  1.00 27.13  ? 494  TYR C N     1 
ATOM   7489  C  CA    . TYR C 2  494  ? 0.567   -43.586 82.160  1.00 26.29  ? 494  TYR C CA    1 
ATOM   7490  C  C     . TYR C 2  494  ? -0.495  -42.906 83.017  1.00 27.28  ? 494  TYR C C     1 
ATOM   7491  O  O     . TYR C 2  494  ? -1.039  -41.862 82.659  1.00 28.37  ? 494  TYR C O     1 
ATOM   7492  C  CB    . TYR C 2  494  ? 1.935   -43.466 82.837  1.00 28.27  ? 494  TYR C CB    1 
ATOM   7493  C  CG    . TYR C 2  494  ? 3.042   -44.113 82.043  1.00 34.37  ? 494  TYR C CG    1 
ATOM   7494  C  CD1   . TYR C 2  494  ? 3.061   -45.485 81.842  1.00 32.37  ? 494  TYR C CD1   1 
ATOM   7495  C  CD2   . TYR C 2  494  ? 4.061   -43.354 81.485  1.00 34.47  ? 494  TYR C CD2   1 
ATOM   7496  C  CE1   . TYR C 2  494  ? 4.063   -46.085 81.112  1.00 37.30  ? 494  TYR C CE1   1 
ATOM   7497  C  CE2   . TYR C 2  494  ? 5.071   -43.947 80.754  1.00 33.21  ? 494  TYR C CE2   1 
ATOM   7498  C  CZ    . TYR C 2  494  ? 5.066   -45.313 80.569  1.00 34.77  ? 494  TYR C CZ    1 
ATOM   7499  O  OH    . TYR C 2  494  ? 6.066   -45.917 79.841  1.00 39.73  ? 494  TYR C OH    1 
ATOM   7500  N  N     . THR C 2  495  ? -0.786  -43.535 84.152  1.00 24.40  ? 495  THR C N     1 
ATOM   7501  C  CA    . THR C 2  495  ? -1.662  -42.973 85.165  1.00 22.13  ? 495  THR C CA    1 
ATOM   7502  C  C     . THR C 2  495  ? -0.767  -42.461 86.280  1.00 22.28  ? 495  THR C C     1 
ATOM   7503  O  O     . THR C 2  495  ? -0.120  -43.251 86.965  1.00 24.04  ? 495  THR C O     1 
ATOM   7504  C  CB    . THR C 2  495  ? -2.608  -44.044 85.737  1.00 22.21  ? 495  THR C CB    1 
ATOM   7505  O  OG1   . THR C 2  495  ? -3.392  -44.611 84.681  1.00 20.12  ? 495  THR C OG1   1 
ATOM   7506  C  CG2   . THR C 2  495  ? -3.529  -43.444 86.784  1.00 21.87  ? 495  THR C CG2   1 
ATOM   7507  N  N     . ILE C 2  496  ? -0.719  -41.146 86.463  1.00 20.23  ? 496  ILE C N     1 
ATOM   7508  C  CA    . ILE C 2  496  ? 0.252   -40.559 87.383  1.00 20.60  ? 496  ILE C CA    1 
ATOM   7509  C  C     . ILE C 2  496  ? -0.379  -39.907 88.611  1.00 21.93  ? 496  ILE C C     1 
ATOM   7510  O  O     . ILE C 2  496  ? -1.119  -38.934 88.496  1.00 27.92  ? 496  ILE C O     1 
ATOM   7511  C  CB    . ILE C 2  496  ? 1.141   -39.530 86.668  1.00 24.01  ? 496  ILE C CB    1 
ATOM   7512  C  CG1   . ILE C 2  496  ? 1.647   -40.106 85.342  1.00 20.33  ? 496  ILE C CG1   1 
ATOM   7513  C  CG2   . ILE C 2  496  ? 2.289   -39.095 87.577  1.00 23.37  ? 496  ILE C CG2   1 
ATOM   7514  C  CD1   . ILE C 2  496  ? 2.611   -39.208 84.610  1.00 22.47  ? 496  ILE C CD1   1 
ATOM   7515  N  N     . ALA C 2  497  ? -0.061  -40.440 89.786  1.00 21.05  ? 497  ALA C N     1 
ATOM   7516  C  CA    . ALA C 2  497  ? -0.639  -39.951 91.034  1.00 26.67  ? 497  ALA C CA    1 
ATOM   7517  C  C     . ALA C 2  497  ? -0.072  -38.594 91.436  1.00 28.22  ? 497  ALA C C     1 
ATOM   7518  O  O     . ALA C 2  497  ? 1.059   -38.255 91.082  1.00 25.85  ? 497  ALA C O     1 
ATOM   7519  C  CB    . ALA C 2  497  ? -0.416  -40.962 92.148  1.00 28.91  ? 497  ALA C CB    1 
ATOM   7520  N  N     . GLN C 2  498  ? -0.865  -37.825 92.180  1.00 21.99  ? 498  GLN C N     1 
ATOM   7521  C  CA    . GLN C 2  498  ? -0.421  -36.535 92.699  1.00 24.27  ? 498  GLN C CA    1 
ATOM   7522  C  C     . GLN C 2  498  ? 0.643   -36.704 93.777  1.00 24.98  ? 498  GLN C C     1 
ATOM   7523  O  O     . GLN C 2  498  ? 0.733   -37.750 94.416  1.00 27.43  ? 498  GLN C O     1 
ATOM   7524  C  CB    . GLN C 2  498  ? -1.601  -35.723 93.236  1.00 23.16  ? 498  GLN C CB    1 
ATOM   7525  C  CG    . GLN C 2  498  ? -2.385  -34.988 92.156  1.00 24.12  ? 498  GLN C CG    1 
ATOM   7526  C  CD    . GLN C 2  498  ? -1.543  -33.955 91.430  1.00 22.27  ? 498  GLN C CD    1 
ATOM   7527  O  OE1   . GLN C 2  498  ? -0.684  -33.301 92.026  1.00 24.19  ? 498  GLN C OE1   1 
ATOM   7528  N  NE2   . GLN C 2  498  ? -1.778  -33.810 90.134  1.00 18.78  ? 498  GLN C NE2   1 
ATOM   7529  N  N     . ALA C 2  499  ? 1.448   -35.667 93.975  1.00 24.02  ? 499  ALA C N     1 
ATOM   7530  C  CA    . ALA C 2  499  ? 2.578   -35.752 94.891  1.00 23.27  ? 499  ALA C CA    1 
ATOM   7531  C  C     . ALA C 2  499  ? 2.145   -35.741 96.352  1.00 25.70  ? 499  ALA C C     1 
ATOM   7532  O  O     . ALA C 2  499  ? 2.931   -36.070 97.240  1.00 26.70  ? 499  ALA C O     1 
ATOM   7533  C  CB    . ALA C 2  499  ? 3.563   -34.625 94.619  1.00 23.86  ? 499  ALA C CB    1 
ATOM   7534  N  N     . ASN C 2  500  ? 0.900   -35.348 96.600  1.00 27.98  ? 500  ASN C N     1 
ATOM   7535  C  CA    . ASN C 2  500  ? 0.398   -35.242 97.966  1.00 26.68  ? 500  ASN C CA    1 
ATOM   7536  C  C     . ASN C 2  500  ? -0.395  -36.459 98.450  1.00 34.69  ? 500  ASN C C     1 
ATOM   7537  O  O     . ASN C 2  500  ? -0.938  -36.445 99.555  1.00 42.22  ? 500  ASN C O     1 
ATOM   7538  C  CB    . ASN C 2  500  ? -0.396  -33.940 98.165  1.00 25.14  ? 500  ASN C CB    1 
ATOM   7539  C  CG    . ASN C 2  500  ? -1.829  -34.031 97.660  1.00 28.36  ? 500  ASN C CG    1 
ATOM   7540  O  OD1   . ASN C 2  500  ? -2.154  -34.842 96.792  1.00 35.62  ? 500  ASN C OD1   1 
ATOM   7541  N  ND2   . ASN C 2  500  ? -2.695  -33.183 98.205  1.00 23.72  ? 500  ASN C ND2   1 
ATOM   7542  N  N     . THR C 2  501  ? -0.481  -37.496 97.619  1.00 35.23  ? 501  THR C N     1 
ATOM   7543  C  CA    . THR C 2  501  ? -1.148  -38.734 98.018  1.00 36.56  ? 501  THR C CA    1 
ATOM   7544  C  C     . THR C 2  501  ? -0.475  -39.312 99.259  1.00 36.97  ? 501  THR C C     1 
ATOM   7545  O  O     . THR C 2  501  ? 0.737   -39.538 99.259  1.00 30.16  ? 501  THR C O     1 
ATOM   7546  C  CB    . THR C 2  501  ? -1.126  -39.798 96.901  1.00 33.94  ? 501  THR C CB    1 
ATOM   7547  O  OG1   . THR C 2  501  ? 0.225   -40.194 96.641  1.00 39.95  ? 501  THR C OG1   1 
ATOM   7548  C  CG2   . THR C 2  501  ? -1.745  -39.257 95.627  1.00 28.25  ? 501  THR C CG2   1 
ATOM   7549  N  N     . PRO C 2  502  ? -1.265  -39.547 100.322 1.00 36.41  ? 502  PRO C N     1 
ATOM   7550  C  CA    . PRO C 2  502  ? -0.777  -39.999 101.631 1.00 35.32  ? 502  PRO C CA    1 
ATOM   7551  C  C     . PRO C 2  502  ? 0.060   -41.270 101.544 1.00 37.73  ? 502  PRO C C     1 
ATOM   7552  O  O     . PRO C 2  502  ? -0.352  -42.250 100.921 1.00 32.46  ? 502  PRO C O     1 
ATOM   7553  C  CB    . PRO C 2  502  ? -2.067  -40.279 102.405 1.00 36.20  ? 502  PRO C CB    1 
ATOM   7554  C  CG    . PRO C 2  502  ? -3.083  -39.408 101.766 1.00 39.66  ? 502  PRO C CG    1 
ATOM   7555  C  CD    . PRO C 2  502  ? -2.729  -39.383 100.310 1.00 32.60  ? 502  PRO C CD    1 
ATOM   7556  N  N     . LEU C 2  503  ? 1.230   -41.243 102.175 1.00 40.77  ? 503  LEU C N     1 
ATOM   7557  C  CA    . LEU C 2  503  ? 2.130   -42.387 102.171 1.00 47.13  ? 503  LEU C CA    1 
ATOM   7558  C  C     . LEU C 2  503  ? 2.500   -42.811 103.588 1.00 48.80  ? 503  LEU C C     1 
ATOM   7559  O  O     . LEU C 2  503  ? 2.803   -41.973 104.438 1.00 49.92  ? 503  LEU C O     1 
ATOM   7560  C  CB    . LEU C 2  503  ? 3.415   -42.063 101.403 1.00 38.03  ? 503  LEU C CB    1 
ATOM   7561  C  CG    . LEU C 2  503  ? 3.334   -41.571 99.960  1.00 27.04  ? 503  LEU C CG    1 
ATOM   7562  C  CD1   . LEU C 2  503  ? 4.732   -41.471 99.376  1.00 23.75  ? 503  LEU C CD1   1 
ATOM   7563  C  CD2   . LEU C 2  503  ? 2.467   -42.481 99.119  1.00 24.38  ? 503  LEU C CD2   1 
ATOM   7564  N  N     . GLU C 2  504  ? 2.470   -44.115 103.835 1.00 49.33  ? 504  GLU C N     1 
ATOM   7565  C  CA    . GLU C 2  504  ? 3.078   -44.673 105.035 1.00 54.91  ? 504  GLU C CA    1 
ATOM   7566  C  C     . GLU C 2  504  ? 4.279   -45.500 104.590 1.00 53.06  ? 504  GLU C C     1 
ATOM   7567  O  O     . GLU C 2  504  ? 4.128   -46.556 103.973 1.00 52.95  ? 504  GLU C O     1 
ATOM   7568  C  CB    . GLU C 2  504  ? 2.074   -45.513 105.832 1.00 48.67  ? 504  GLU C CB    1 
ATOM   7569  C  CG    . GLU C 2  504  ? 1.198   -46.429 104.989 1.00 57.16  ? 504  GLU C CG    1 
ATOM   7570  C  CD    . GLU C 2  504  ? 0.154   -47.159 105.811 1.00 64.67  ? 504  GLU C CD    1 
ATOM   7571  O  OE1   . GLU C 2  504  ? -0.188  -46.670 106.909 1.00 60.01  ? 504  GLU C OE1   1 
ATOM   7572  O  OE2   . GLU C 2  504  ? -0.323  -48.223 105.360 1.00 66.52  ? 504  GLU C OE2   1 
ATOM   7573  N  N     . GLY C 2  505  ? 5.475   -45.007 104.891 1.00 48.13  ? 505  GLY C N     1 
ATOM   7574  C  CA    . GLY C 2  505  ? 6.680   -45.579 104.323 1.00 50.52  ? 505  GLY C CA    1 
ATOM   7575  C  C     . GLY C 2  505  ? 6.724   -45.271 102.838 1.00 48.35  ? 505  GLY C C     1 
ATOM   7576  O  O     . GLY C 2  505  ? 6.505   -44.131 102.429 1.00 51.16  ? 505  GLY C O     1 
ATOM   7577  N  N     . ASN C 2  506  ? 7.007   -46.284 102.027 1.00 41.82  ? 506  ASN C N     1 
ATOM   7578  C  CA    . ASN C 2  506  ? 7.006   -46.118 100.578 1.00 42.77  ? 506  ASN C CA    1 
ATOM   7579  C  C     . ASN C 2  506  ? 5.695   -46.547 99.925  1.00 46.28  ? 506  ASN C C     1 
ATOM   7580  O  O     . ASN C 2  506  ? 5.563   -46.523 98.701  1.00 43.12  ? 506  ASN C O     1 
ATOM   7581  C  CB    . ASN C 2  506  ? 8.187   -46.856 99.950  1.00 46.89  ? 506  ASN C CB    1 
ATOM   7582  C  CG    . ASN C 2  506  ? 9.488   -46.092 100.095 1.00 60.56  ? 506  ASN C CG    1 
ATOM   7583  O  OD1   . ASN C 2  506  ? 9.996   -45.522 99.129  1.00 64.78  ? 506  ASN C OD1   1 
ATOM   7584  N  ND2   . ASN C 2  506  ? 10.026  -46.063 101.309 1.00 63.25  ? 506  ASN C ND2   1 
ATOM   7585  N  N     . ARG C 2  507  ? 4.731   -46.943 100.749 1.00 45.27  ? 507  ARG C N     1 
ATOM   7586  C  CA    . ARG C 2  507  ? 3.451   -47.431 100.248 1.00 44.55  ? 507  ARG C CA    1 
ATOM   7587  C  C     . ARG C 2  507  ? 2.362   -46.364 100.316 1.00 40.80  ? 507  ARG C C     1 
ATOM   7588  O  O     . ARG C 2  507  ? 2.270   -45.610 101.287 1.00 37.63  ? 507  ARG C O     1 
ATOM   7589  C  CB    . ARG C 2  507  ? 3.014   -48.682 101.019 1.00 53.98  ? 507  ARG C CB    1 
ATOM   7590  C  CG    . ARG C 2  507  ? 1.743   -49.337 100.486 1.00 57.81  ? 507  ARG C CG    1 
ATOM   7591  C  CD    . ARG C 2  507  ? 1.423   -50.636 101.218 1.00 66.71  ? 507  ARG C CD    1 
ATOM   7592  N  NE    . ARG C 2  507  ? 2.470   -51.643 101.050 1.00 72.79  ? 507  ARG C NE    1 
ATOM   7593  C  CZ    . ARG C 2  507  ? 2.515   -52.522 100.052 1.00 67.25  ? 507  ARG C CZ    1 
ATOM   7594  N  NH1   . ARG C 2  507  ? 1.570   -52.524 99.120  1.00 60.78  ? 507  ARG C NH1   1 
ATOM   7595  N  NH2   . ARG C 2  507  ? 3.508   -53.399 99.984  1.00 60.37  ? 507  ARG C NH2   1 
ATOM   7596  N  N     . ILE C 2  508  ? 1.540   -46.312 99.273  1.00 35.94  ? 508  ILE C N     1 
ATOM   7597  C  CA    . ILE C 2  508  ? 0.411   -45.397 99.222  1.00 38.07  ? 508  ILE C CA    1 
ATOM   7598  C  C     . ILE C 2  508  ? -0.721  -45.925 100.084 1.00 41.85  ? 508  ILE C C     1 
ATOM   7599  O  O     . ILE C 2  508  ? -1.197  -47.037 99.856  1.00 51.70  ? 508  ILE C O     1 
ATOM   7600  C  CB    . ILE C 2  508  ? -0.134  -45.280 97.783  1.00 34.47  ? 508  ILE C CB    1 
ATOM   7601  C  CG1   . ILE C 2  508  ? 0.972   -44.865 96.811  1.00 38.05  ? 508  ILE C CG1   1 
ATOM   7602  C  CG2   . ILE C 2  508  ? -1.300  -44.307 97.730  1.00 44.93  ? 508  ILE C CG2   1 
ATOM   7603  C  CD1   . ILE C 2  508  ? 0.543   -44.877 95.357  1.00 33.80  ? 508  ILE C CD1   1 
ATOM   7604  N  N     . ALA C 2  509  ? -1.164  -45.150 101.071 1.00 37.86  ? 509  ALA C N     1 
ATOM   7605  C  CA    . ALA C 2  509  ? -2.377  -45.546 101.771 1.00 39.25  ? 509  ALA C CA    1 
ATOM   7606  C  C     . ALA C 2  509  ? -3.507  -44.556 101.524 1.00 44.22  ? 509  ALA C C     1 
ATOM   7607  O  O     . ALA C 2  509  ? -3.592  -43.507 102.162 1.00 52.51  ? 509  ALA C O     1 
ATOM   7608  C  CB    . ALA C 2  509  ? -2.104  -45.668 103.263 1.00 39.36  ? 509  ALA C CB    1 
ATOM   7609  N  N     . ALA C 2  510  ? -4.380  -44.922 100.594 1.00 40.84  ? 510  ALA C N     1 
ATOM   7610  C  CA    . ALA C 2  510  ? -5.681  -44.303 100.409 1.00 33.20  ? 510  ALA C CA    1 
ATOM   7611  C  C     . ALA C 2  510  ? -6.508  -45.325 99.648  1.00 38.90  ? 510  ALA C C     1 
ATOM   7612  O  O     . ALA C 2  510  ? -5.965  -46.051 98.816  1.00 40.51  ? 510  ALA C O     1 
ATOM   7613  C  CB    . ALA C 2  510  ? -5.556  -43.020 99.618  1.00 36.25  ? 510  ALA C CB    1 
ATOM   7614  N  N     . GLU C 2  511  ? -7.811  -45.380 99.889  1.00 46.42  ? 511  GLU C N     1 
ATOM   7615  C  CA    . GLU C 2  511  ? -8.644  -46.274 99.096  1.00 46.29  ? 511  GLU C CA    1 
ATOM   7616  C  C     . GLU C 2  511  ? -8.780  -45.670 97.702  1.00 45.37  ? 511  GLU C C     1 
ATOM   7617  O  O     . GLU C 2  511  ? -8.928  -46.379 96.706  1.00 46.08  ? 511  GLU C O     1 
ATOM   7618  C  CB    . GLU C 2  511  ? -10.020 -46.465 99.738  1.00 57.40  ? 511  GLU C CB    1 
ATOM   7619  C  CG    . GLU C 2  511  ? -10.774 -47.686 99.220  1.00 70.53  ? 511  GLU C CG    1 
ATOM   7620  C  CD    . GLU C 2  511  ? -12.270 -47.612 99.476  1.00 79.90  ? 511  GLU C CD    1 
ATOM   7621  O  OE1   . GLU C 2  511  ? -12.840 -48.605 99.980  1.00 76.85  ? 511  GLU C OE1   1 
ATOM   7622  O  OE2   . GLU C 2  511  ? -12.877 -46.564 99.163  1.00 77.51  ? 511  GLU C OE2   1 
ATOM   7623  N  N     . ARG C 2  512  ? -8.708  -44.346 97.648  1.00 44.14  ? 512  ARG C N     1 
ATOM   7624  C  CA    . ARG C 2  512  ? -8.872  -43.607 96.409  1.00 39.17  ? 512  ARG C CA    1 
ATOM   7625  C  C     . ARG C 2  512  ? -7.765  -42.568 96.281  1.00 36.40  ? 512  ARG C C     1 
ATOM   7626  O  O     . ARG C 2  512  ? -7.514  -41.803 97.213  1.00 32.36  ? 512  ARG C O     1 
ATOM   7627  C  CB    . ARG C 2  512  ? -10.244 -42.927 96.392  1.00 40.84  ? 512  ARG C CB    1 
ATOM   7628  C  CG    . ARG C 2  512  ? -11.415 -43.901 96.407  1.00 47.38  ? 512  ARG C CG    1 
ATOM   7629  C  CD    . ARG C 2  512  ? -12.678 -43.278 96.991  1.00 56.81  ? 512  ARG C CD    1 
ATOM   7630  N  NE    . ARG C 2  512  ? -13.255 -42.239 96.138  1.00 70.64  ? 512  ARG C NE    1 
ATOM   7631  C  CZ    . ARG C 2  512  ? -13.113 -40.932 96.344  1.00 63.38  ? 512  ARG C CZ    1 
ATOM   7632  N  NH1   . ARG C 2  512  ? -12.403 -40.492 97.376  1.00 50.26  ? 512  ARG C NH1   1 
ATOM   7633  N  NH2   . ARG C 2  512  ? -13.681 -40.063 95.517  1.00 49.57  ? 512  ARG C NH2   1 
ATOM   7634  N  N     . VAL C 2  513  ? -7.094  -42.553 95.132  1.00 30.21  ? 513  VAL C N     1 
ATOM   7635  C  CA    . VAL C 2  513  ? -6.035  -41.582 94.876  1.00 33.05  ? 513  VAL C CA    1 
ATOM   7636  C  C     . VAL C 2  513  ? -6.357  -40.696 93.670  1.00 32.10  ? 513  VAL C C     1 
ATOM   7637  O  O     . VAL C 2  513  ? -7.038  -41.118 92.729  1.00 29.54  ? 513  VAL C O     1 
ATOM   7638  C  CB    . VAL C 2  513  ? -4.638  -42.251 94.697  1.00 31.34  ? 513  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C 2  513  ? -4.535  -43.531 95.517  1.00 22.99  ? 513  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C 2  513  ? -4.334  -42.514 93.233  1.00 24.31  ? 513  VAL C CG2   1 
ATOM   7641  N  N     . VAL C 2  514  ? -5.870  -39.460 93.718  1.00 33.95  ? 514  VAL C N     1 
ATOM   7642  C  CA    . VAL C 2  514  ? -6.090  -38.498 92.646  1.00 27.62  ? 514  VAL C CA    1 
ATOM   7643  C  C     . VAL C 2  514  ? -4.920  -38.521 91.674  1.00 26.24  ? 514  VAL C C     1 
ATOM   7644  O  O     . VAL C 2  514  ? -3.768  -38.328 92.067  1.00 24.11  ? 514  VAL C O     1 
ATOM   7645  C  CB    . VAL C 2  514  ? -6.262  -37.075 93.201  1.00 23.87  ? 514  VAL C CB    1 
ATOM   7646  C  CG1   . VAL C 2  514  ? -6.360  -36.069 92.067  1.00 22.77  ? 514  VAL C CG1   1 
ATOM   7647  C  CG2   . VAL C 2  514  ? -7.489  -37.004 94.095  1.00 20.92  ? 514  VAL C CG2   1 
ATOM   7648  N  N     . ALA C 2  515  ? -5.218  -38.763 90.404  1.00 23.97  ? 515  ALA C N     1 
ATOM   7649  C  CA    . ALA C 2  515  ? -4.169  -38.899 89.405  1.00 23.68  ? 515  ALA C CA    1 
ATOM   7650  C  C     . ALA C 2  515  ? -4.526  -38.225 88.085  1.00 26.26  ? 515  ALA C C     1 
ATOM   7651  O  O     . ALA C 2  515  ? -5.613  -37.668 87.926  1.00 21.70  ? 515  ALA C O     1 
ATOM   7652  C  CB    . ALA C 2  515  ? -3.853  -40.371 89.179  1.00 21.26  ? 515  ALA C CB    1 
ATOM   7653  N  N     . ARG C 2  516  ? -3.593  -38.283 87.142  1.00 22.45  ? 516  ARG C N     1 
ATOM   7654  C  CA    . ARG C 2  516  ? -3.815  -37.771 85.800  1.00 23.12  ? 516  ARG C CA    1 
ATOM   7655  C  C     . ARG C 2  516  ? -3.623  -38.885 84.780  1.00 24.36  ? 516  ARG C C     1 
ATOM   7656  O  O     . ARG C 2  516  ? -2.687  -39.680 84.882  1.00 24.08  ? 516  ARG C O     1 
ATOM   7657  C  CB    . ARG C 2  516  ? -2.850  -36.622 85.487  1.00 28.37  ? 516  ARG C CB    1 
ATOM   7658  C  CG    . ARG C 2  516  ? -3.146  -35.316 86.212  1.00 25.92  ? 516  ARG C CG    1 
ATOM   7659  C  CD    . ARG C 2  516  ? -2.049  -34.284 85.961  1.00 17.82  ? 516  ARG C CD    1 
ATOM   7660  N  NE    . ARG C 2  516  ? -0.734  -34.798 86.332  1.00 15.92  ? 516  ARG C NE    1 
ATOM   7661  C  CZ    . ARG C 2  516  ? 0.303   -34.879 85.504  1.00 17.72  ? 516  ARG C CZ    1 
ATOM   7662  N  NH1   . ARG C 2  516  ? 0.191   -34.464 84.249  1.00 17.71  ? 516  ARG C NH1   1 
ATOM   7663  N  NH2   . ARG C 2  516  ? 1.457   -35.370 85.936  1.00 19.06  ? 516  ARG C NH2   1 
ATOM   7664  N  N     . ARG C 2  517  ? -4.528  -38.944 83.811  1.00 20.39  ? 517  ARG C N     1 
ATOM   7665  C  CA    . ARG C 2  517  ? -4.365  -39.798 82.649  1.00 21.92  ? 517  ARG C CA    1 
ATOM   7666  C  C     . ARG C 2  517  ? -4.543  -38.927 81.421  1.00 26.90  ? 517  ARG C C     1 
ATOM   7667  O  O     . ARG C 2  517  ? -5.650  -38.456 81.150  1.00 25.33  ? 517  ARG C O     1 
ATOM   7668  C  CB    . ARG C 2  517  ? -5.407  -40.916 82.646  1.00 33.11  ? 517  ARG C CB    1 
ATOM   7669  C  CG    . ARG C 2  517  ? -5.132  -42.028 83.642  1.00 38.99  ? 517  ARG C CG    1 
ATOM   7670  C  CD    . ARG C 2  517  ? -6.220  -43.094 83.607  1.00 38.61  ? 517  ARG C CD    1 
ATOM   7671  N  NE    . ARG C 2  517  ? -5.915  -44.204 84.507  1.00 39.52  ? 517  ARG C NE    1 
ATOM   7672  C  CZ    . ARG C 2  517  ? -6.775  -45.164 84.828  1.00 42.61  ? 517  ARG C CZ    1 
ATOM   7673  N  NH1   . ARG C 2  517  ? -8.003  -45.154 84.327  1.00 51.55  ? 517  ARG C NH1   1 
ATOM   7674  N  NH2   . ARG C 2  517  ? -6.408  -46.134 85.656  1.00 40.74  ? 517  ARG C NH2   1 
ATOM   7675  N  N     . LYS C 2  518  ? -3.456  -38.737 80.676  1.00 26.70  ? 518  LYS C N     1 
ATOM   7676  C  CA    . LYS C 2  518  ? -3.422  -37.789 79.564  1.00 21.99  ? 518  LYS C CA    1 
ATOM   7677  C  C     . LYS C 2  518  ? -3.957  -36.417 79.979  1.00 23.18  ? 518  LYS C C     1 
ATOM   7678  O  O     . LYS C 2  518  ? -4.704  -35.780 79.237  1.00 21.75  ? 518  LYS C O     1 
ATOM   7679  C  CB    . LYS C 2  518  ? -4.193  -38.325 78.355  1.00 18.51  ? 518  LYS C CB    1 
ATOM   7680  C  CG    . LYS C 2  518  ? -3.455  -39.399 77.573  1.00 22.42  ? 518  LYS C CG    1 
ATOM   7681  C  CD    . LYS C 2  518  ? -4.189  -39.742 76.283  1.00 26.93  ? 518  LYS C CD    1 
ATOM   7682  C  CE    . LYS C 2  518  ? -3.351  -40.638 75.379  1.00 37.50  ? 518  LYS C CE    1 
ATOM   7683  N  NZ    . LYS C 2  518  ? -3.040  -41.956 76.006  1.00 49.59  ? 518  LYS C NZ    1 
ATOM   7684  N  N     . GLY C 2  519  ? -3.587  -35.987 81.182  1.00 19.01  ? 519  GLY C N     1 
ATOM   7685  C  CA    . GLY C 2  519  ? -3.975  -34.685 81.690  1.00 20.32  ? 519  GLY C CA    1 
ATOM   7686  C  C     . GLY C 2  519  ? -5.304  -34.694 82.420  1.00 26.47  ? 519  GLY C C     1 
ATOM   7687  O  O     . GLY C 2  519  ? -5.574  -33.818 83.244  1.00 23.73  ? 519  GLY C O     1 
ATOM   7688  N  N     . GLU C 2  520  ? -6.130  -35.694 82.128  1.00 26.95  ? 520  GLU C N     1 
ATOM   7689  C  CA    . GLU C 2  520  ? -7.466  -35.788 82.707  1.00 29.22  ? 520  GLU C CA    1 
ATOM   7690  C  C     . GLU C 2  520  ? -7.402  -36.227 84.167  1.00 27.45  ? 520  GLU C C     1 
ATOM   7691  O  O     . GLU C 2  520  ? -6.807  -37.256 84.477  1.00 27.90  ? 520  GLU C O     1 
ATOM   7692  C  CB    . GLU C 2  520  ? -8.319  -36.770 81.898  1.00 32.39  ? 520  GLU C CB    1 
ATOM   7693  C  CG    . GLU C 2  520  ? -9.783  -36.831 82.311  1.00 42.15  ? 520  GLU C CG    1 
ATOM   7694  C  CD    . GLU C 2  520  ? -10.555 -35.583 81.924  1.00 67.72  ? 520  GLU C CD    1 
ATOM   7695  O  OE1   . GLU C 2  520  ? -11.660 -35.376 82.469  1.00 71.84  ? 520  GLU C OE1   1 
ATOM   7696  O  OE2   . GLU C 2  520  ? -10.060 -34.812 81.071  1.00 65.49  ? 520  GLU C OE2   1 
ATOM   7697  N  N     . PRO C 2  521  ? -7.994  -35.432 85.075  1.00 31.80  ? 521  PRO C N     1 
ATOM   7698  C  CA    . PRO C 2  521  ? -8.042  -35.819 86.490  1.00 29.33  ? 521  PRO C CA    1 
ATOM   7699  C  C     . PRO C 2  521  ? -8.936  -37.033 86.691  1.00 30.38  ? 521  PRO C C     1 
ATOM   7700  O  O     . PRO C 2  521  ? -10.059 -37.059 86.188  1.00 31.67  ? 521  PRO C O     1 
ATOM   7701  C  CB    . PRO C 2  521  ? -8.658  -34.591 87.168  1.00 22.95  ? 521  PRO C CB    1 
ATOM   7702  C  CG    . PRO C 2  521  ? -8.398  -33.466 86.224  1.00 28.62  ? 521  PRO C CG    1 
ATOM   7703  C  CD    . PRO C 2  521  ? -8.524  -34.077 84.863  1.00 32.69  ? 521  PRO C CD    1 
ATOM   7704  N  N     . VAL C 2  522  ? -8.440  -38.024 87.425  1.00 32.10  ? 522  VAL C N     1 
ATOM   7705  C  CA    . VAL C 2  522  ? -9.177  -39.263 87.628  1.00 27.93  ? 522  VAL C CA    1 
ATOM   7706  C  C     . VAL C 2  522  ? -8.894  -39.855 89.011  1.00 28.50  ? 522  VAL C C     1 
ATOM   7707  O  O     . VAL C 2  522  ? -7.765  -39.807 89.501  1.00 31.82  ? 522  VAL C O     1 
ATOM   7708  C  CB    . VAL C 2  522  ? -8.848  -40.290 86.515  1.00 28.45  ? 522  VAL C CB    1 
ATOM   7709  C  CG1   . VAL C 2  522  ? -7.358  -40.595 86.489  1.00 27.68  ? 522  VAL C CG1   1 
ATOM   7710  C  CG2   . VAL C 2  522  ? -9.662  -41.566 86.686  1.00 44.71  ? 522  VAL C CG2   1 
ATOM   7711  N  N     . ILE C 2  523  ? -9.931  -40.393 89.645  1.00 31.88  ? 523  ILE C N     1 
ATOM   7712  C  CA    . ILE C 2  523  ? -9.782  -41.059 90.932  1.00 28.38  ? 523  ILE C CA    1 
ATOM   7713  C  C     . ILE C 2  523  ? -9.588  -42.551 90.696  1.00 26.37  ? 523  ILE C C     1 
ATOM   7714  O  O     . ILE C 2  523  ? -10.475 -43.224 90.168  1.00 28.57  ? 523  ILE C O     1 
ATOM   7715  C  CB    . ILE C 2  523  ? -11.019 -40.852 91.824  1.00 29.08  ? 523  ILE C CB    1 
ATOM   7716  C  CG1   . ILE C 2  523  ? -11.470 -39.390 91.794  1.00 22.91  ? 523  ILE C CG1   1 
ATOM   7717  C  CG2   . ILE C 2  523  ? -10.724 -41.290 93.247  1.00 27.62  ? 523  ILE C CG2   1 
ATOM   7718  C  CD1   . ILE C 2  523  ? -10.497 -38.441 92.447  1.00 25.77  ? 523  ILE C CD1   1 
ATOM   7719  N  N     . VAL C 2  524  ? -8.426  -43.067 91.079  1.00 25.72  ? 524  VAL C N     1 
ATOM   7720  C  CA    . VAL C 2  524  ? -8.109  -44.469 90.833  1.00 23.92  ? 524  VAL C CA    1 
ATOM   7721  C  C     . VAL C 2  524  ? -7.668  -45.183 92.103  1.00 26.91  ? 524  VAL C C     1 
ATOM   7722  O  O     . VAL C 2  524  ? -7.297  -44.550 93.085  1.00 27.30  ? 524  VAL C O     1 
ATOM   7723  C  CB    . VAL C 2  524  ? -7.000  -44.628 89.766  1.00 21.42  ? 524  VAL C CB    1 
ATOM   7724  C  CG1   . VAL C 2  524  ? -7.453  -44.059 88.427  1.00 25.05  ? 524  VAL C CG1   1 
ATOM   7725  C  CG2   . VAL C 2  524  ? -5.715  -43.965 90.229  1.00 18.12  ? 524  VAL C CG2   1 
ATOM   7726  N  N     . SER C 2  525  ? -7.720  -46.510 92.076  1.00 31.38  ? 525  SER C N     1 
ATOM   7727  C  CA    . SER C 2  525  ? -7.193  -47.320 93.166  1.00 28.96  ? 525  SER C CA    1 
ATOM   7728  C  C     . SER C 2  525  ? -5.677  -47.418 93.015  1.00 27.15  ? 525  SER C C     1 
ATOM   7729  O  O     . SER C 2  525  ? -5.162  -47.305 91.902  1.00 29.94  ? 525  SER C O     1 
ATOM   7730  C  CB    . SER C 2  525  ? -7.832  -48.709 93.141  1.00 31.50  ? 525  SER C CB    1 
ATOM   7731  O  OG    . SER C 2  525  ? -7.801  -49.262 91.835  1.00 32.95  ? 525  SER C OG    1 
ATOM   7732  N  N     . PRO C 2  526  ? -4.956  -47.620 94.132  1.00 27.35  ? 526  PRO C N     1 
ATOM   7733  C  CA    . PRO C 2  526  ? -3.489  -47.713 94.108  1.00 24.90  ? 526  PRO C CA    1 
ATOM   7734  C  C     . PRO C 2  526  ? -2.937  -48.747 93.120  1.00 27.96  ? 526  PRO C C     1 
ATOM   7735  O  O     . PRO C 2  526  ? -1.799  -48.606 92.677  1.00 29.40  ? 526  PRO C O     1 
ATOM   7736  C  CB    . PRO C 2  526  ? -3.146  -48.109 95.544  1.00 22.35  ? 526  PRO C CB    1 
ATOM   7737  C  CG    . PRO C 2  526  ? -4.234  -47.500 96.352  1.00 24.24  ? 526  PRO C CG    1 
ATOM   7738  C  CD    . PRO C 2  526  ? -5.479  -47.623 95.510  1.00 25.76  ? 526  PRO C CD    1 
ATOM   7739  N  N     . GLU C 2  527  ? -3.730  -49.758 92.776  1.00 33.24  ? 527  GLU C N     1 
ATOM   7740  C  CA    . GLU C 2  527  ? -3.304  -50.762 91.801  1.00 35.98  ? 527  GLU C CA    1 
ATOM   7741  C  C     . GLU C 2  527  ? -3.103  -50.141 90.423  1.00 29.88  ? 527  GLU C C     1 
ATOM   7742  O  O     . GLU C 2  527  ? -2.324  -50.642 89.612  1.00 29.06  ? 527  GLU C O     1 
ATOM   7743  C  CB    . GLU C 2  527  ? -4.319  -51.910 91.703  1.00 26.38  ? 527  GLU C CB    1 
ATOM   7744  C  CG    . GLU C 2  527  ? -4.367  -52.829 92.915  1.00 30.10  ? 527  GLU C CG    1 
ATOM   7745  C  CD    . GLU C 2  527  ? -5.108  -52.216 94.090  1.00 42.90  ? 527  GLU C CD    1 
ATOM   7746  O  OE1   . GLU C 2  527  ? -5.875  -51.254 93.873  1.00 39.29  ? 527  GLU C OE1   1 
ATOM   7747  O  OE2   . GLU C 2  527  ? -4.924  -52.693 95.231  1.00 46.27  ? 527  GLU C OE2   1 
ATOM   7748  N  N     . GLU C 2  528  ? -3.810  -49.046 90.164  1.00 29.42  ? 528  GLU C N     1 
ATOM   7749  C  CA    . GLU C 2  528  ? -3.788  -48.424 88.846  1.00 33.12  ? 528  GLU C CA    1 
ATOM   7750  C  C     . GLU C 2  528  ? -2.676  -47.387 88.687  1.00 25.71  ? 528  GLU C C     1 
ATOM   7751  O  O     . GLU C 2  528  ? -2.415  -46.920 87.580  1.00 20.85  ? 528  GLU C O     1 
ATOM   7752  C  CB    . GLU C 2  528  ? -5.141  -47.781 88.548  1.00 24.27  ? 528  GLU C CB    1 
ATOM   7753  C  CG    . GLU C 2  528  ? -6.323  -48.618 88.981  1.00 21.95  ? 528  GLU C CG    1 
ATOM   7754  C  CD    . GLU C 2  528  ? -7.646  -47.955 88.656  1.00 31.32  ? 528  GLU C CD    1 
ATOM   7755  O  OE1   . GLU C 2  528  ? -8.406  -47.647 89.602  1.00 26.84  ? 528  GLU C OE1   1 
ATOM   7756  O  OE2   . GLU C 2  528  ? -7.926  -47.745 87.454  1.00 24.69  ? 528  GLU C OE2   1 
ATOM   7757  N  N     . VAL C 2  529  ? -2.011  -47.039 89.784  1.00 24.49  ? 529  VAL C N     1 
ATOM   7758  C  CA    . VAL C 2  529  ? -1.017  -45.976 89.737  1.00 25.62  ? 529  VAL C CA    1 
ATOM   7759  C  C     . VAL C 2  529  ? 0.294   -46.482 89.162  1.00 21.58  ? 529  VAL C C     1 
ATOM   7760  O  O     . VAL C 2  529  ? 0.958   -47.330 89.751  1.00 35.62  ? 529  VAL C O     1 
ATOM   7761  C  CB    . VAL C 2  529  ? -0.738  -45.420 91.147  1.00 25.81  ? 529  VAL C CB    1 
ATOM   7762  C  CG1   . VAL C 2  529  ? 0.422   -44.440 91.114  1.00 24.90  ? 529  VAL C CG1   1 
ATOM   7763  C  CG2   . VAL C 2  529  ? -1.985  -44.768 91.714  1.00 22.34  ? 529  VAL C CG2   1 
ATOM   7764  N  N     . GLU C 2  530  ? 0.660   -45.951 88.003  1.00 17.74  ? 530  GLU C N     1 
ATOM   7765  C  CA    . GLU C 2  530  ? 1.934   -46.268 87.372  1.00 24.97  ? 530  GLU C CA    1 
ATOM   7766  C  C     . GLU C 2  530  ? 3.083   -45.390 87.876  1.00 30.39  ? 530  GLU C C     1 
ATOM   7767  O  O     . GLU C 2  530  ? 4.192   -45.872 88.116  1.00 28.74  ? 530  GLU C O     1 
ATOM   7768  C  CB    . GLU C 2  530  ? 1.793   -46.195 85.851  1.00 28.61  ? 530  GLU C CB    1 
ATOM   7769  C  CG    . GLU C 2  530  ? 0.409   -46.612 85.367  1.00 22.70  ? 530  GLU C CG    1 
ATOM   7770  C  CD    . GLU C 2  530  ? 0.415   -47.168 83.963  1.00 24.80  ? 530  GLU C CD    1 
ATOM   7771  O  OE1   . GLU C 2  530  ? -0.546  -46.899 83.209  1.00 25.37  ? 530  GLU C OE1   1 
ATOM   7772  O  OE2   . GLU C 2  530  ? 1.376   -47.885 83.616  1.00 30.50  ? 530  GLU C OE2   1 
ATOM   7773  N  N     . PHE C 2  531  ? 2.803   -44.097 88.033  1.00 31.18  ? 531  PHE C N     1 
ATOM   7774  C  CA    . PHE C 2  531  ? 3.818   -43.118 88.415  1.00 22.70  ? 531  PHE C CA    1 
ATOM   7775  C  C     . PHE C 2  531  ? 3.286   -42.100 89.419  1.00 24.10  ? 531  PHE C C     1 
ATOM   7776  O  O     . PHE C 2  531  ? 2.081   -42.019 89.652  1.00 31.85  ? 531  PHE C O     1 
ATOM   7777  C  CB    . PHE C 2  531  ? 4.350   -42.387 87.183  1.00 22.09  ? 531  PHE C CB    1 
ATOM   7778  C  CG    . PHE C 2  531  ? 5.202   -43.240 86.289  1.00 27.01  ? 531  PHE C CG    1 
ATOM   7779  C  CD1   . PHE C 2  531  ? 4.672   -43.819 85.146  1.00 29.48  ? 531  PHE C CD1   1 
ATOM   7780  C  CD2   . PHE C 2  531  ? 6.537   -43.459 86.589  1.00 25.02  ? 531  PHE C CD2   1 
ATOM   7781  C  CE1   . PHE C 2  531  ? 5.459   -44.601 84.319  1.00 26.89  ? 531  PHE C CE1   1 
ATOM   7782  C  CE2   . PHE C 2  531  ? 7.329   -44.242 85.766  1.00 23.37  ? 531  PHE C CE2   1 
ATOM   7783  C  CZ    . PHE C 2  531  ? 6.788   -44.812 84.630  1.00 25.89  ? 531  PHE C CZ    1 
ATOM   7784  N  N     . MET C 2  532  ? 4.190   -41.324 90.011  1.00 24.11  ? 532  MET C N     1 
ATOM   7785  C  CA    . MET C 2  532  ? 3.805   -40.275 90.957  1.00 26.32  ? 532  MET C CA    1 
ATOM   7786  C  C     . MET C 2  532  ? 4.715   -39.048 90.865  1.00 26.70  ? 532  MET C C     1 
ATOM   7787  O  O     . MET C 2  532  ? 5.922   -39.175 90.678  1.00 23.25  ? 532  MET C O     1 
ATOM   7788  C  CB    . MET C 2  532  ? 3.797   -40.824 92.384  1.00 24.38  ? 532  MET C CB    1 
ATOM   7789  C  CG    . MET C 2  532  ? 3.543   -39.787 93.463  1.00 20.05  ? 532  MET C CG    1 
ATOM   7790  S  SD    . MET C 2  532  ? 3.162   -40.555 95.045  1.00 22.16  ? 532  MET C SD    1 
ATOM   7791  C  CE    . MET C 2  532  ? 3.280   -39.157 96.155  1.00 28.98  ? 532  MET C CE    1 
ATOM   7792  N  N     . ASP C 2  533  ? 4.125   -37.863 91.008  1.00 27.27  ? 533  ASP C N     1 
ATOM   7793  C  CA    . ASP C 2  533  ? 4.866   -36.607 90.923  1.00 22.54  ? 533  ASP C CA    1 
ATOM   7794  C  C     . ASP C 2  533  ? 5.992   -36.530 91.949  1.00 25.54  ? 533  ASP C C     1 
ATOM   7795  O  O     . ASP C 2  533  ? 5.905   -37.112 93.030  1.00 31.27  ? 533  ASP C O     1 
ATOM   7796  C  CB    . ASP C 2  533  ? 3.927   -35.414 91.115  1.00 21.12  ? 533  ASP C CB    1 
ATOM   7797  C  CG    . ASP C 2  533  ? 2.941   -35.257 89.980  1.00 20.17  ? 533  ASP C CG    1 
ATOM   7798  O  OD1   . ASP C 2  533  ? 2.596   -36.275 89.345  1.00 24.83  ? 533  ASP C OD1   1 
ATOM   7799  O  OD2   . ASP C 2  533  ? 2.508   -34.114 89.727  1.00 19.15  ? 533  ASP C OD2   1 
ATOM   7800  N  N     . VAL C 2  534  ? 7.055   -35.817 91.593  1.00 22.35  ? 534  VAL C N     1 
ATOM   7801  C  CA    . VAL C 2  534  ? 8.183   -35.620 92.492  1.00 20.50  ? 534  VAL C CA    1 
ATOM   7802  C  C     . VAL C 2  534  ? 7.848   -34.570 93.545  1.00 20.05  ? 534  VAL C C     1 
ATOM   7803  O  O     . VAL C 2  534  ? 8.211   -34.712 94.714  1.00 27.28  ? 534  VAL C O     1 
ATOM   7804  C  CB    . VAL C 2  534  ? 9.450   -35.206 91.713  1.00 18.37  ? 534  VAL C CB    1 
ATOM   7805  C  CG1   . VAL C 2  534  ? 10.534  -34.699 92.654  1.00 15.30  ? 534  VAL C CG1   1 
ATOM   7806  C  CG2   . VAL C 2  534  ? 9.958   -36.371 90.878  1.00 21.69  ? 534  VAL C CG2   1 
ATOM   7807  N  N     . SER C 2  535  ? 7.111   -33.542 93.132  1.00 21.69  ? 535  SER C N     1 
ATOM   7808  C  CA    . SER C 2  535  ? 6.847   -32.386 93.984  1.00 23.18  ? 535  SER C CA    1 
ATOM   7809  C  C     . SER C 2  535  ? 5.905   -31.407 93.294  1.00 18.28  ? 535  SER C C     1 
ATOM   7810  O  O     . SER C 2  535  ? 5.870   -31.337 92.066  1.00 16.68  ? 535  SER C O     1 
ATOM   7811  C  CB    . SER C 2  535  ? 8.160   -31.668 94.313  1.00 20.06  ? 535  SER C CB    1 
ATOM   7812  O  OG    . SER C 2  535  ? 7.946   -30.545 95.147  1.00 15.74  ? 535  SER C OG    1 
ATOM   7813  N  N     . PRO C 2  536  ? 5.120   -30.657 94.084  1.00 21.20  ? 536  PRO C N     1 
ATOM   7814  C  CA    . PRO C 2  536  ? 4.337   -29.554 93.517  1.00 17.35  ? 536  PRO C CA    1 
ATOM   7815  C  C     . PRO C 2  536  ? 5.248   -28.526 92.853  1.00 14.78  ? 536  PRO C C     1 
ATOM   7816  O  O     . PRO C 2  536  ? 4.848   -27.894 91.870  1.00 19.62  ? 536  PRO C O     1 
ATOM   7817  C  CB    . PRO C 2  536  ? 3.633   -28.949 94.741  1.00 15.45  ? 536  PRO C CB    1 
ATOM   7818  C  CG    . PRO C 2  536  ? 4.312   -29.539 95.939  1.00 15.50  ? 536  PRO C CG    1 
ATOM   7819  C  CD    . PRO C 2  536  ? 4.814   -30.875 95.507  1.00 19.17  ? 536  PRO C CD    1 
ATOM   7820  N  N     . LYS C 2  537  ? 6.466   -28.390 93.374  1.00 12.26  ? 537  LYS C N     1 
ATOM   7821  C  CA    . LYS C 2  537  ? 7.457   -27.469 92.823  1.00 12.55  ? 537  LYS C CA    1 
ATOM   7822  C  C     . LYS C 2  537  ? 7.649   -27.651 91.322  1.00 12.58  ? 537  LYS C C     1 
ATOM   7823  O  O     . LYS C 2  537  ? 7.882   -26.684 90.600  1.00 15.84  ? 537  LYS C O     1 
ATOM   7824  C  CB    . LYS C 2  537  ? 8.811   -27.639 93.519  1.00 12.03  ? 537  LYS C CB    1 
ATOM   7825  C  CG    . LYS C 2  537  ? 8.783   -27.484 95.029  1.00 14.87  ? 537  LYS C CG    1 
ATOM   7826  C  CD    . LYS C 2  537  ? 10.166  -27.705 95.623  1.00 13.56  ? 537  LYS C CD    1 
ATOM   7827  C  CE    . LYS C 2  537  ? 10.103  -27.827 97.135  1.00 22.49  ? 537  LYS C CE    1 
ATOM   7828  N  NZ    . LYS C 2  537  ? 9.435   -26.652 97.763  1.00 31.81  ? 537  LYS C NZ    1 
ATOM   7829  N  N     . GLN C 2  538  ? 7.543   -28.890 90.854  1.00 13.69  ? 538  GLN C N     1 
ATOM   7830  C  CA    . GLN C 2  538  ? 7.822   -29.192 89.454  1.00 16.31  ? 538  GLN C CA    1 
ATOM   7831  C  C     . GLN C 2  538  ? 6.794   -28.573 88.513  1.00 15.75  ? 538  GLN C C     1 
ATOM   7832  O  O     . GLN C 2  538  ? 7.053   -28.418 87.319  1.00 14.72  ? 538  GLN C O     1 
ATOM   7833  C  CB    . GLN C 2  538  ? 7.923   -30.705 89.220  1.00 14.20  ? 538  GLN C CB    1 
ATOM   7834  C  CG    . GLN C 2  538  ? 6.594   -31.413 89.016  1.00 13.83  ? 538  GLN C CG    1 
ATOM   7835  C  CD    . GLN C 2  538  ? 6.761   -32.909 88.806  1.00 16.96  ? 538  GLN C CD    1 
ATOM   7836  O  OE1   . GLN C 2  538  ? 6.751   -33.686 89.759  1.00 22.93  ? 538  GLN C OE1   1 
ATOM   7837  N  NE2   . GLN C 2  538  ? 6.918   -33.317 87.554  1.00 14.43  ? 538  GLN C NE2   1 
ATOM   7838  N  N     . VAL C 2  539  ? 5.634   -28.208 89.047  1.00 11.03  ? 539  VAL C N     1 
ATOM   7839  C  CA    . VAL C 2  539  ? 4.596   -27.626 88.206  1.00 15.16  ? 539  VAL C CA    1 
ATOM   7840  C  C     . VAL C 2  539  ? 4.925   -26.182 87.812  1.00 13.44  ? 539  VAL C C     1 
ATOM   7841  O  O     . VAL C 2  539  ? 4.544   -25.721 86.734  1.00 7.49   ? 539  VAL C O     1 
ATOM   7842  C  CB    . VAL C 2  539  ? 3.206   -27.727 88.876  1.00 17.50  ? 539  VAL C CB    1 
ATOM   7843  C  CG1   . VAL C 2  539  ? 2.167   -26.886 88.137  1.00 11.12  ? 539  VAL C CG1   1 
ATOM   7844  C  CG2   . VAL C 2  539  ? 2.771   -29.181 88.934  1.00 17.37  ? 539  VAL C CG2   1 
ATOM   7845  N  N     . PHE C 2  540  ? 5.672   -25.485 88.663  1.00 11.14  ? 540  PHE C N     1 
ATOM   7846  C  CA    . PHE C 2  540  ? 5.905   -24.062 88.446  1.00 9.24   ? 540  PHE C CA    1 
ATOM   7847  C  C     . PHE C 2  540  ? 7.352   -23.702 88.140  1.00 10.40  ? 540  PHE C C     1 
ATOM   7848  O  O     . PHE C 2  540  ? 8.235   -24.559 88.154  1.00 13.41  ? 540  PHE C O     1 
ATOM   7849  C  CB    . PHE C 2  540  ? 5.402   -23.273 89.650  1.00 9.12   ? 540  PHE C CB    1 
ATOM   7850  C  CG    . PHE C 2  540  ? 3.982   -23.583 90.007  1.00 12.06  ? 540  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C 2  540  ? 3.689   -24.466 91.033  1.00 13.71  ? 540  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C 2  540  ? 2.938   -23.017 89.295  1.00 9.31   ? 540  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C 2  540  ? 2.380   -24.762 91.358  1.00 16.32  ? 540  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C 2  540  ? 1.629   -23.308 89.614  1.00 12.18  ? 540  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C 2  540  ? 1.348   -24.182 90.647  1.00 15.52  ? 540  PHE C CZ    1 
ATOM   7856  N  N     . SER C 2  541  ? 7.583   -22.419 87.871  1.00 10.07  ? 541  SER C N     1 
ATOM   7857  C  CA    . SER C 2  541  ? 8.912   -21.925 87.537  1.00 7.70   ? 541  SER C CA    1 
ATOM   7858  C  C     . SER C 2  541  ? 9.706   -21.660 88.799  1.00 8.17   ? 541  SER C C     1 
ATOM   7859  O  O     . SER C 2  541  ? 9.190   -21.808 89.904  1.00 11.01  ? 541  SER C O     1 
ATOM   7860  C  CB    . SER C 2  541  ? 8.805   -20.637 86.726  1.00 9.96   ? 541  SER C CB    1 
ATOM   7861  O  OG    . SER C 2  541  ? 7.967   -19.699 87.380  1.00 10.66  ? 541  SER C OG    1 
ATOM   7862  N  N     . VAL C 2  542  ? 10.958  -21.253 88.638  1.00 7.87   ? 542  VAL C N     1 
ATOM   7863  C  CA    . VAL C 2  542  ? 11.796  -20.936 89.786  1.00 8.68   ? 542  VAL C CA    1 
ATOM   7864  C  C     . VAL C 2  542  ? 11.242  -19.723 90.533  1.00 11.98  ? 542  VAL C C     1 
ATOM   7865  O  O     . VAL C 2  542  ? 11.257  -19.676 91.763  1.00 11.78  ? 542  VAL C O     1 
ATOM   7866  C  CB    . VAL C 2  542  ? 13.253  -20.701 89.366  1.00 6.61   ? 542  VAL C CB    1 
ATOM   7867  C  CG1   . VAL C 2  542  ? 14.072  -20.158 90.526  1.00 7.38   ? 542  VAL C CG1   1 
ATOM   7868  C  CG2   . VAL C 2  542  ? 13.854  -21.992 88.836  1.00 6.95   ? 542  VAL C CG2   1 
ATOM   7869  N  N     . ASN C 2  543  ? 10.729  -18.753 89.784  1.00 13.67  ? 543  ASN C N     1 
ATOM   7870  C  CA    . ASN C 2  543  ? 10.134  -17.564 90.386  1.00 12.66  ? 543  ASN C CA    1 
ATOM   7871  C  C     . ASN C 2  543  ? 8.849   -17.860 91.142  1.00 10.02  ? 543  ASN C C     1 
ATOM   7872  O  O     . ASN C 2  543  ? 8.699   -17.457 92.294  1.00 11.06  ? 543  ASN C O     1 
ATOM   7873  C  CB    . ASN C 2  543  ? 9.881   -16.489 89.331  1.00 15.15  ? 543  ASN C CB    1 
ATOM   7874  C  CG    . ASN C 2  543  ? 11.152  -15.811 88.888  1.00 14.70  ? 543  ASN C CG    1 
ATOM   7875  O  OD1   . ASN C 2  543  ? 11.975  -16.410 88.201  1.00 15.78  ? 543  ASN C OD1   1 
ATOM   7876  N  ND2   . ASN C 2  543  ? 11.326  -14.556 89.285  1.00 11.82  ? 543  ASN C ND2   1 
ATOM   7877  N  N     . THR C 2  544  ? 7.927   -18.560 90.489  1.00 8.82   ? 544  THR C N     1 
ATOM   7878  C  CA    . THR C 2  544  ? 6.638   -18.873 91.095  1.00 9.47   ? 544  THR C CA    1 
ATOM   7879  C  C     . THR C 2  544  ? 6.841   -19.701 92.361  1.00 12.60  ? 544  THR C C     1 
ATOM   7880  O  O     . THR C 2  544  ? 6.104   -19.557 93.338  1.00 13.50  ? 544  THR C O     1 
ATOM   7881  C  CB    . THR C 2  544  ? 5.716   -19.626 90.113  1.00 10.66  ? 544  THR C CB    1 
ATOM   7882  O  OG1   . THR C 2  544  ? 5.744   -18.978 88.836  1.00 10.19  ? 544  THR C OG1   1 
ATOM   7883  C  CG2   . THR C 2  544  ? 4.285   -19.645 90.625  1.00 9.06   ? 544  THR C CG2   1 
ATOM   7884  N  N     . ASN C 2  545  ? 7.871   -20.543 92.344  1.00 14.30  ? 545  ASN C N     1 
ATOM   7885  C  CA    . ASN C 2  545  ? 8.229   -21.359 93.500  1.00 10.92  ? 545  ASN C CA    1 
ATOM   7886  C  C     . ASN C 2  545  ? 8.708   -20.545 94.698  1.00 10.81  ? 545  ASN C C     1 
ATOM   7887  O  O     . ASN C 2  545  ? 8.926   -21.096 95.771  1.00 14.05  ? 545  ASN C O     1 
ATOM   7888  C  CB    . ASN C 2  545  ? 9.303   -22.382 93.126  1.00 10.93  ? 545  ASN C CB    1 
ATOM   7889  C  CG    . ASN C 2  545  ? 8.727   -23.629 92.496  1.00 10.34  ? 545  ASN C CG    1 
ATOM   7890  O  OD1   . ASN C 2  545  ? 8.033   -24.400 93.153  1.00 11.99  ? 545  ASN C OD1   1 
ATOM   7891  N  ND2   . ASN C 2  545  ? 9.027   -23.845 91.222  1.00 9.31   ? 545  ASN C ND2   1 
ATOM   7892  N  N     . LEU C 2  546  ? 8.899   -19.244 94.510  1.00 9.33   ? 546  LEU C N     1 
ATOM   7893  C  CA    . LEU C 2  546  ? 9.333   -18.380 95.600  1.00 8.34   ? 546  LEU C CA    1 
ATOM   7894  C  C     . LEU C 2  546  ? 8.164   -17.692 96.300  1.00 11.25  ? 546  LEU C C     1 
ATOM   7895  O  O     . LEU C 2  546  ? 8.370   -16.892 97.212  1.00 11.63  ? 546  LEU C O     1 
ATOM   7896  C  CB    . LEU C 2  546  ? 10.339  -17.344 95.100  1.00 6.94   ? 546  LEU C CB    1 
ATOM   7897  C  CG    . LEU C 2  546  ? 11.666  -17.927 94.618  1.00 10.06  ? 546  LEU C CG    1 
ATOM   7898  C  CD1   . LEU C 2  546  ? 12.596  -16.829 94.150  1.00 9.89   ? 546  LEU C CD1   1 
ATOM   7899  C  CD2   . LEU C 2  546  ? 12.318  -18.749 95.722  1.00 12.58  ? 546  LEU C CD2   1 
ATOM   7900  N  N     . ILE C 2  547  ? 6.942   -18.003 95.871  1.00 9.75   ? 547  ILE C N     1 
ATOM   7901  C  CA    . ILE C 2  547  ? 5.749   -17.425 96.483  1.00 10.09  ? 547  ILE C CA    1 
ATOM   7902  C  C     . ILE C 2  547  ? 5.147   -18.367 97.525  1.00 11.31  ? 547  ILE C C     1 
ATOM   7903  O  O     . ILE C 2  547  ? 4.510   -19.359 97.172  1.00 11.43  ? 547  ILE C O     1 
ATOM   7904  C  CB    . ILE C 2  547  ? 4.664   -17.135 95.420  1.00 8.94   ? 547  ILE C CB    1 
ATOM   7905  C  CG1   . ILE C 2  547  ? 5.208   -16.227 94.320  1.00 7.31   ? 547  ILE C CG1   1 
ATOM   7906  C  CG2   . ILE C 2  547  ? 3.428   -16.514 96.059  1.00 8.93   ? 547  ILE C CG2   1 
ATOM   7907  C  CD1   . ILE C 2  547  ? 4.217   -15.986 93.197  1.00 5.67   ? 547  ILE C CD1   1 
ATOM   7908  N  N     . PRO C 2  548  ? 5.324   -18.050 98.817  1.00 11.10  ? 548  PRO C N     1 
ATOM   7909  C  CA    . PRO C 2  548  ? 4.721   -18.898 99.851  1.00 9.75   ? 548  PRO C CA    1 
ATOM   7910  C  C     . PRO C 2  548  ? 3.205   -18.762 99.852  1.00 11.00  ? 548  PRO C C     1 
ATOM   7911  O  O     . PRO C 2  548  ? 2.694   -17.743 99.401  1.00 9.49   ? 548  PRO C O     1 
ATOM   7912  C  CB    . PRO C 2  548  ? 5.324   -18.357 101.154 1.00 9.53   ? 548  PRO C CB    1 
ATOM   7913  C  CG    . PRO C 2  548  ? 5.773   -16.980 100.837 1.00 10.57  ? 548  PRO C CG    1 
ATOM   7914  C  CD    . PRO C 2  548  ? 6.163   -16.983 99.388  1.00 10.18  ? 548  PRO C CD    1 
ATOM   7915  N  N     . PHE C 2  549  ? 2.508   -19.784 100.339 1.00 15.37  ? 549  PHE C N     1 
ATOM   7916  C  CA    . PHE C 2  549  ? 1.049   -19.825 100.316 1.00 9.58   ? 549  PHE C CA    1 
ATOM   7917  C  C     . PHE C 2  549  ? 0.507   -19.561 98.916  1.00 10.95  ? 549  PHE C C     1 
ATOM   7918  O  O     . PHE C 2  549  ? -0.499  -18.873 98.747  1.00 12.45  ? 549  PHE C O     1 
ATOM   7919  C  CB    . PHE C 2  549  ? 0.460   -18.828 101.313 1.00 10.79  ? 549  PHE C CB    1 
ATOM   7920  C  CG    . PHE C 2  549  ? 0.977   -18.993 102.711 1.00 12.13  ? 549  PHE C CG    1 
ATOM   7921  C  CD1   . PHE C 2  549  ? 0.597   -20.083 103.480 1.00 16.01  ? 549  PHE C CD1   1 
ATOM   7922  C  CD2   . PHE C 2  549  ? 1.836   -18.055 103.261 1.00 10.65  ? 549  PHE C CD2   1 
ATOM   7923  C  CE1   . PHE C 2  549  ? 1.072   -20.238 104.771 1.00 15.13  ? 549  PHE C CE1   1 
ATOM   7924  C  CE2   . PHE C 2  549  ? 2.313   -18.203 104.552 1.00 10.43  ? 549  PHE C CE2   1 
ATOM   7925  C  CZ    . PHE C 2  549  ? 1.930   -19.295 105.308 1.00 12.95  ? 549  PHE C CZ    1 
ATOM   7926  N  N     . LEU C 2  550  ? 1.188   -20.112 97.915  1.00 12.96  ? 550  LEU C N     1 
ATOM   7927  C  CA    . LEU C 2  550  ? 0.793   -19.944 96.519  1.00 12.35  ? 550  LEU C CA    1 
ATOM   7928  C  C     . LEU C 2  550  ? -0.612  -20.472 96.266  1.00 10.10  ? 550  LEU C C     1 
ATOM   7929  O  O     . LEU C 2  550  ? -1.360  -19.906 95.476  1.00 13.53  ? 550  LEU C O     1 
ATOM   7930  C  CB    . LEU C 2  550  ? 1.791   -20.648 95.594  1.00 10.32  ? 550  LEU C CB    1 
ATOM   7931  C  CG    . LEU C 2  550  ? 1.440   -20.704 94.105  1.00 13.20  ? 550  LEU C CG    1 
ATOM   7932  C  CD1   . LEU C 2  550  ? 1.350   -19.307 93.519  1.00 13.57  ? 550  LEU C CD1   1 
ATOM   7933  C  CD2   . LEU C 2  550  ? 2.456   -21.545 93.343  1.00 15.52  ? 550  LEU C CD2   1 
ATOM   7934  N  N     . GLU C 2  551  ? -0.967  -21.553 96.954  1.00 11.47  ? 551  GLU C N     1 
ATOM   7935  C  CA    . GLU C 2  551  ? -2.263  -22.199 96.773  1.00 12.53  ? 551  GLU C CA    1 
ATOM   7936  C  C     . GLU C 2  551  ? -3.420  -21.297 97.193  1.00 14.11  ? 551  GLU C C     1 
ATOM   7937  O  O     . GLU C 2  551  ? -4.573  -21.556 96.851  1.00 11.46  ? 551  GLU C O     1 
ATOM   7938  C  CB    . GLU C 2  551  ? -2.320  -23.512 97.557  1.00 13.14  ? 551  GLU C CB    1 
ATOM   7939  C  CG    . GLU C 2  551  ? -2.194  -23.358 99.069  1.00 12.57  ? 551  GLU C CG    1 
ATOM   7940  C  CD    . GLU C 2  551  ? -0.752  -23.318 99.546  1.00 12.87  ? 551  GLU C CD    1 
ATOM   7941  O  OE1   . GLU C 2  551  ? -0.528  -23.366 100.772 1.00 19.05  ? 551  GLU C OE1   1 
ATOM   7942  O  OE2   . GLU C 2  551  ? 0.161   -23.243 98.700  1.00 14.58  ? 551  GLU C OE2   1 
ATOM   7943  N  N     . HIS C 2  552  ? -3.104  -20.246 97.943  1.00 12.72  ? 552  HIS C N     1 
ATOM   7944  C  CA    . HIS C 2  552  ? -4.113  -19.309 98.420  1.00 13.04  ? 552  HIS C CA    1 
ATOM   7945  C  C     . HIS C 2  552  ? -4.232  -18.070 97.534  1.00 12.16  ? 552  HIS C C     1 
ATOM   7946  O  O     . HIS C 2  552  ? -5.059  -17.199 97.797  1.00 12.13  ? 552  HIS C O     1 
ATOM   7947  C  CB    . HIS C 2  552  ? -3.817  -18.902 99.866  1.00 13.27  ? 552  HIS C CB    1 
ATOM   7948  C  CG    . HIS C 2  552  ? -3.757  -20.058 100.818 1.00 18.48  ? 552  HIS C CG    1 
ATOM   7949  N  ND1   . HIS C 2  552  ? -4.882  -20.598 101.405 1.00 16.74  ? 552  HIS C ND1   1 
ATOM   7950  C  CD2   . HIS C 2  552  ? -2.708  -20.778 101.282 1.00 15.90  ? 552  HIS C CD2   1 
ATOM   7951  C  CE1   . HIS C 2  552  ? -4.528  -21.600 102.190 1.00 17.26  ? 552  HIS C CE1   1 
ATOM   7952  N  NE2   . HIS C 2  552  ? -3.214  -21.729 102.134 1.00 20.43  ? 552  HIS C NE2   1 
ATOM   7953  N  N     . ASP C 2  553  ? -3.407  -17.996 96.492  1.00 10.18  ? 553  ASP C N     1 
ATOM   7954  C  CA    . ASP C 2  553  ? -3.379  -16.838 95.602  1.00 8.39   ? 553  ASP C CA    1 
ATOM   7955  C  C     . ASP C 2  553  ? -3.951  -17.174 94.238  1.00 13.43  ? 553  ASP C C     1 
ATOM   7956  O  O     . ASP C 2  553  ? -3.587  -18.190 93.651  1.00 14.00  ? 553  ASP C O     1 
ATOM   7957  C  CB    . ASP C 2  553  ? -1.947  -16.343 95.401  1.00 6.65   ? 553  ASP C CB    1 
ATOM   7958  C  CG    . ASP C 2  553  ? -1.327  -15.810 96.669  1.00 8.43   ? 553  ASP C CG    1 
ATOM   7959  O  OD1   . ASP C 2  553  ? -0.086  -15.898 96.802  1.00 9.13   ? 553  ASP C OD1   1 
ATOM   7960  O  OD2   . ASP C 2  553  ? -2.076  -15.302 97.530  1.00 9.79   ? 553  ASP C OD2   1 
ATOM   7961  N  N     . ASP C 2  554  ? -4.830  -16.316 93.727  1.00 11.47  ? 554  ASP C N     1 
ATOM   7962  C  CA    . ASP C 2  554  ? -5.316  -16.462 92.361  1.00 11.15  ? 554  ASP C CA    1 
ATOM   7963  C  C     . ASP C 2  554  ? -4.130  -16.411 91.404  1.00 12.55  ? 554  ASP C C     1 
ATOM   7964  O  O     . ASP C 2  554  ? -3.166  -15.685 91.645  1.00 12.63  ? 554  ASP C O     1 
ATOM   7965  C  CB    . ASP C 2  554  ? -6.322  -15.363 92.024  1.00 10.64  ? 554  ASP C CB    1 
ATOM   7966  C  CG    . ASP C 2  554  ? -6.835  -15.459 90.598  1.00 14.01  ? 554  ASP C CG    1 
ATOM   7967  O  OD1   . ASP C 2  554  ? -6.911  -16.582 90.062  1.00 21.68  ? 554  ASP C OD1   1 
ATOM   7968  O  OD2   . ASP C 2  554  ? -7.160  -14.410 90.009  1.00 18.73  ? 554  ASP C OD2   1 
ATOM   7969  N  N     . ALA C 2  555  ? -4.200  -17.190 90.327  1.00 12.76  ? 555  ALA C N     1 
ATOM   7970  C  CA    . ALA C 2  555  ? -3.089  -17.311 89.386  1.00 11.97  ? 555  ALA C CA    1 
ATOM   7971  C  C     . ALA C 2  555  ? -2.667  -15.967 88.801  1.00 11.61  ? 555  ALA C C     1 
ATOM   7972  O  O     . ALA C 2  555  ? -1.477  -15.704 88.633  1.00 10.48  ? 555  ALA C O     1 
ATOM   7973  C  CB    . ALA C 2  555  ? -3.438  -18.290 88.275  1.00 10.62  ? 555  ALA C CB    1 
ATOM   7974  N  N     . ASN C 2  556  ? -3.649  -15.120 88.506  1.00 15.72  ? 556  ASN C N     1 
ATOM   7975  C  CA    . ASN C 2  556  ? -3.390  -13.811 87.913  1.00 10.79  ? 556  ASN C CA    1 
ATOM   7976  C  C     . ASN C 2  556  ? -2.451  -12.938 88.745  1.00 10.83  ? 556  ASN C C     1 
ATOM   7977  O  O     . ASN C 2  556  ? -1.630  -12.202 88.197  1.00 10.91  ? 556  ASN C O     1 
ATOM   7978  C  CB    . ASN C 2  556  ? -4.701  -13.071 87.638  1.00 9.45   ? 556  ASN C CB    1 
ATOM   7979  C  CG    . ASN C 2  556  ? -5.527  -13.733 86.548  1.00 18.62  ? 556  ASN C CG    1 
ATOM   7980  O  OD1   . ASN C 2  556  ? -5.353  -13.448 85.361  1.00 15.09  ? 556  ASN C OD1   1 
ATOM   7981  N  ND2   . ASN C 2  556  ? -6.432  -14.622 86.947  1.00 23.28  ? 556  ASN C ND2   1 
ATOM   7982  N  N     . ARG C 2  557  ? -2.576  -13.003 90.065  1.00 8.67   ? 557  ARG C N     1 
ATOM   7983  C  CA    . ARG C 2  557  ? -1.658  -12.266 90.921  1.00 8.38   ? 557  ARG C CA    1 
ATOM   7984  C  C     . ARG C 2  557  ? -0.352  -13.010 91.189  1.00 11.53  ? 557  ARG C C     1 
ATOM   7985  O  O     . ARG C 2  557  ? 0.672   -12.389 91.502  1.00 12.70  ? 557  ARG C O     1 
ATOM   7986  C  CB    . ARG C 2  557  ? -2.327  -11.865 92.231  1.00 9.45   ? 557  ARG C CB    1 
ATOM   7987  C  CG    . ARG C 2  557  ? -2.457  -10.366 92.379  1.00 9.80   ? 557  ARG C CG    1 
ATOM   7988  C  CD    . ARG C 2  557  ? -3.876  -9.918  92.105  1.00 9.36   ? 557  ARG C CD    1 
ATOM   7989  N  NE    . ARG C 2  557  ? -4.011  -8.923  91.037  1.00 11.45  ? 557  ARG C NE    1 
ATOM   7990  C  CZ    . ARG C 2  557  ? -3.513  -7.686  91.067  1.00 8.75   ? 557  ARG C CZ    1 
ATOM   7991  N  NH1   . ARG C 2  557  ? -3.722  -6.869  90.046  1.00 7.48   ? 557  ARG C NH1   1 
ATOM   7992  N  NH2   . ARG C 2  557  ? -2.799  -7.260  92.099  1.00 8.94   ? 557  ARG C NH2   1 
ATOM   7993  N  N     . ALA C 2  558  ? -0.385  -14.333 91.053  1.00 9.25   ? 558  ALA C N     1 
ATOM   7994  C  CA    . ALA C 2  558  ? 0.826   -15.129 91.196  1.00 8.14   ? 558  ALA C CA    1 
ATOM   7995  C  C     . ALA C 2  558  ? 1.764   -14.747 90.066  1.00 10.00  ? 558  ALA C C     1 
ATOM   7996  O  O     . ALA C 2  558  ? 2.969   -14.599 90.266  1.00 11.81  ? 558  ALA C O     1 
ATOM   7997  C  CB    . ALA C 2  558  ? 0.507   -16.610 91.149  1.00 7.03   ? 558  ALA C CB    1 
ATOM   7998  N  N     . LEU C 2  559  ? 1.190   -14.580 88.878  1.00 7.50   ? 559  LEU C N     1 
ATOM   7999  C  CA    . LEU C 2  559  ? 1.915   -14.101 87.708  1.00 9.76   ? 559  LEU C CA    1 
ATOM   8000  C  C     . LEU C 2  559  ? 2.654   -12.797 88.022  1.00 11.31  ? 559  LEU C C     1 
ATOM   8001  O  O     . LEU C 2  559  ? 3.840   -12.633 87.707  1.00 9.51   ? 559  LEU C O     1 
ATOM   8002  C  CB    . LEU C 2  559  ? 0.926   -13.899 86.556  1.00 5.80   ? 559  LEU C CB    1 
ATOM   8003  C  CG    . LEU C 2  559  ? 1.398   -13.402 85.192  1.00 5.58   ? 559  LEU C CG    1 
ATOM   8004  C  CD1   . LEU C 2  559  ? 0.469   -13.932 84.116  1.00 4.23   ? 559  LEU C CD1   1 
ATOM   8005  C  CD2   . LEU C 2  559  ? 1.424   -11.884 85.149  1.00 8.13   ? 559  LEU C CD2   1 
ATOM   8006  N  N     . MET C 2  560  ? 1.941   -11.874 88.655  1.00 10.41  ? 560  MET C N     1 
ATOM   8007  C  CA    . MET C 2  560  ? 2.488   -10.564 88.961  1.00 8.52   ? 560  MET C CA    1 
ATOM   8008  C  C     . MET C 2  560  ? 3.603   -10.643 90.001  1.00 9.70   ? 560  MET C C     1 
ATOM   8009  O  O     . MET C 2  560  ? 4.636   -9.989  89.852  1.00 9.30   ? 560  MET C O     1 
ATOM   8010  C  CB    . MET C 2  560  ? 1.371   -9.618  89.404  1.00 8.45   ? 560  MET C CB    1 
ATOM   8011  C  CG    . MET C 2  560  ? 0.253   -9.501  88.373  1.00 8.64   ? 560  MET C CG    1 
ATOM   8012  S  SD    . MET C 2  560  ? -1.054  -8.343  88.818  1.00 8.26   ? 560  MET C SD    1 
ATOM   8013  C  CE    . MET C 2  560  ? -2.213  -8.588  87.472  1.00 5.51   ? 560  MET C CE    1 
ATOM   8014  N  N     . GLY C 2  561  ? 3.403   -11.450 91.040  1.00 8.54   ? 561  GLY C N     1 
ATOM   8015  C  CA    . GLY C 2  561  ? 4.430   -11.645 92.052  1.00 7.12   ? 561  GLY C CA    1 
ATOM   8016  C  C     . GLY C 2  561  ? 5.695   -12.251 91.469  1.00 8.37   ? 561  GLY C C     1 
ATOM   8017  O  O     . GLY C 2  561  ? 6.819   -11.795 91.740  1.00 9.69   ? 561  GLY C O     1 
ATOM   8018  N  N     . SER C 2  562  ? 5.500   -13.287 90.658  1.00 8.49   ? 562  SER C N     1 
ATOM   8019  C  CA    . SER C 2  562  ? 6.587   -13.928 89.934  1.00 10.09  ? 562  SER C CA    1 
ATOM   8020  C  C     . SER C 2  562  ? 7.375   -12.891 89.159  1.00 10.21  ? 562  SER C C     1 
ATOM   8021  O  O     . SER C 2  562  ? 8.554   -12.670 89.431  1.00 12.41  ? 562  SER C O     1 
ATOM   8022  C  CB    . SER C 2  562  ? 6.048   -14.983 88.967  1.00 9.49   ? 562  SER C CB    1 
ATOM   8023  O  OG    . SER C 2  562  ? 5.567   -16.116 89.661  1.00 10.89  ? 562  SER C OG    1 
ATOM   8024  N  N     . ASN C 2  563  ? 6.712   -12.255 88.198  1.00 8.64   ? 563  ASN C N     1 
ATOM   8025  C  CA    . ASN C 2  563  ? 7.366   -11.268 87.349  1.00 8.80   ? 563  ASN C CA    1 
ATOM   8026  C  C     . ASN C 2  563  ? 8.078   -10.175 88.140  1.00 8.20   ? 563  ASN C C     1 
ATOM   8027  O  O     . ASN C 2  563  ? 9.169   -9.743  87.774  1.00 7.64   ? 563  ASN C O     1 
ATOM   8028  C  CB    . ASN C 2  563  ? 6.357   -10.641 86.386  1.00 8.26   ? 563  ASN C CB    1 
ATOM   8029  C  CG    . ASN C 2  563  ? 5.853   -11.624 85.357  1.00 8.58   ? 563  ASN C CG    1 
ATOM   8030  O  OD1   . ASN C 2  563  ? 6.518   -12.612 85.050  1.00 10.48  ? 563  ASN C OD1   1 
ATOM   8031  N  ND2   . ASN C 2  563  ? 4.675   -11.356 84.812  1.00 9.62   ? 563  ASN C ND2   1 
ATOM   8032  N  N     . MET C 2  564  ? 7.462   -9.741  89.232  1.00 7.95   ? 564  MET C N     1 
ATOM   8033  C  CA    . MET C 2  564  ? 7.996   -8.616  89.986  1.00 9.01   ? 564  MET C CA    1 
ATOM   8034  C  C     . MET C 2  564  ? 9.220   -8.981  90.817  1.00 10.05  ? 564  MET C C     1 
ATOM   8035  O  O     . MET C 2  564  ? 10.068  -8.126  91.078  1.00 8.82   ? 564  MET C O     1 
ATOM   8036  C  CB    . MET C 2  564  ? 6.912   -7.950  90.841  1.00 6.15   ? 564  MET C CB    1 
ATOM   8037  C  CG    . MET C 2  564  ? 5.938   -7.124  90.019  1.00 6.01   ? 564  MET C CG    1 
ATOM   8038  S  SD    . MET C 2  564  ? 4.779   -6.154  90.995  1.00 4.69   ? 564  MET C SD    1 
ATOM   8039  C  CE    . MET C 2  564  ? 3.838   -7.438  91.814  1.00 6.00   ? 564  MET C CE    1 
ATOM   8040  N  N     . GLN C 2  565  ? 9.327   -10.242 91.228  1.00 10.98  ? 565  GLN C N     1 
ATOM   8041  C  CA    . GLN C 2  565  ? 10.526  -10.658 91.952  1.00 8.14   ? 565  GLN C CA    1 
ATOM   8042  C  C     . GLN C 2  565  ? 11.786  -10.436 91.116  1.00 9.45   ? 565  GLN C C     1 
ATOM   8043  O  O     . GLN C 2  565  ? 12.843  -10.093 91.646  1.00 10.09  ? 565  GLN C O     1 
ATOM   8044  C  CB    . GLN C 2  565  ? 10.421  -12.107 92.412  1.00 6.48   ? 565  GLN C CB    1 
ATOM   8045  C  CG    . GLN C 2  565  ? 9.475   -12.287 93.574  1.00 7.93   ? 565  GLN C CG    1 
ATOM   8046  C  CD    . GLN C 2  565  ? 9.529   -13.676 94.148  1.00 7.65   ? 565  GLN C CD    1 
ATOM   8047  O  OE1   . GLN C 2  565  ? 10.093  -13.892 95.221  1.00 7.62   ? 565  GLN C OE1   1 
ATOM   8048  N  NE2   . GLN C 2  565  ? 8.939   -14.633 93.440  1.00 7.55   ? 565  GLN C NE2   1 
ATOM   8049  N  N     . THR C 2  566  ? 11.653  -10.611 89.806  1.00 10.12  ? 566  THR C N     1 
ATOM   8050  C  CA    . THR C 2  566  ? 12.729  -10.327 88.862  1.00 9.36   ? 566  THR C CA    1 
ATOM   8051  C  C     . THR C 2  566  ? 13.198  -8.880  88.965  1.00 10.53  ? 566  THR C C     1 
ATOM   8052  O  O     . THR C 2  566  ? 14.367  -8.574  88.741  1.00 12.21  ? 566  THR C O     1 
ATOM   8053  C  CB    . THR C 2  566  ? 12.260  -10.572 87.422  1.00 9.16   ? 566  THR C CB    1 
ATOM   8054  O  OG1   . THR C 2  566  ? 11.816  -11.927 87.290  1.00 16.55  ? 566  THR C OG1   1 
ATOM   8055  C  CG2   . THR C 2  566  ? 13.380  -10.317 86.441  1.00 14.52  ? 566  THR C CG2   1 
ATOM   8056  N  N     . GLN C 2  567  ? 12.277  -7.991  89.317  1.00 11.87  ? 567  GLN C N     1 
ATOM   8057  C  CA    . GLN C 2  567  ? 12.548  -6.560  89.301  1.00 8.03   ? 567  GLN C CA    1 
ATOM   8058  C  C     . GLN C 2  567  ? 13.059  -6.029  90.637  1.00 6.39   ? 567  GLN C C     1 
ATOM   8059  O  O     . GLN C 2  567  ? 13.260  -4.829  90.792  1.00 6.52   ? 567  GLN C O     1 
ATOM   8060  C  CB    . GLN C 2  567  ? 11.298  -5.805  88.848  1.00 5.33   ? 567  GLN C CB    1 
ATOM   8061  C  CG    . GLN C 2  567  ? 10.792  -6.279  87.498  1.00 6.82   ? 567  GLN C CG    1 
ATOM   8062  C  CD    . GLN C 2  567  ? 9.374   -5.838  87.197  1.00 9.29   ? 567  GLN C CD    1 
ATOM   8063  O  OE1   . GLN C 2  567  ? 8.938   -4.769  87.621  1.00 13.33  ? 567  GLN C OE1   1 
ATOM   8064  N  NE2   . GLN C 2  567  ? 8.644   -6.667  86.462  1.00 8.24   ? 567  GLN C NE2   1 
ATOM   8065  N  N     . ALA C 2  568  ? 13.268  -6.929  91.594  1.00 8.03   ? 568  ALA C N     1 
ATOM   8066  C  CA    . ALA C 2  568  ? 13.737  -6.548  92.930  1.00 8.25   ? 568  ALA C CA    1 
ATOM   8067  C  C     . ALA C 2  568  ? 15.163  -6.000  92.926  1.00 5.97   ? 568  ALA C C     1 
ATOM   8068  O  O     . ALA C 2  568  ? 16.075  -6.611  92.372  1.00 9.52   ? 568  ALA C O     1 
ATOM   8069  C  CB    . ALA C 2  568  ? 13.626  -7.727  93.894  1.00 7.14   ? 568  ALA C CB    1 
ATOM   8070  N  N     . VAL C 2  569  ? 15.348  -4.850  93.560  1.00 4.92   ? 569  VAL C N     1 
ATOM   8071  C  CA    . VAL C 2  569  ? 16.656  -4.212  93.623  1.00 6.65   ? 569  VAL C CA    1 
ATOM   8072  C  C     . VAL C 2  569  ? 17.434  -4.697  94.844  1.00 7.77   ? 569  VAL C C     1 
ATOM   8073  O  O     . VAL C 2  569  ? 16.887  -4.754  95.946  1.00 8.02   ? 569  VAL C O     1 
ATOM   8074  C  CB    . VAL C 2  569  ? 16.514  -2.681  93.693  1.00 5.62   ? 569  VAL C CB    1 
ATOM   8075  C  CG1   . VAL C 2  569  ? 17.875  -2.024  93.731  1.00 5.78   ? 569  VAL C CG1   1 
ATOM   8076  C  CG2   . VAL C 2  569  ? 15.702  -2.169  92.512  1.00 7.27   ? 569  VAL C CG2   1 
ATOM   8077  N  N     . PRO C 2  570  ? 18.712  -5.062  94.652  1.00 7.45   ? 570  PRO C N     1 
ATOM   8078  C  CA    . PRO C 2  570  ? 19.544  -5.463  95.792  1.00 8.62   ? 570  PRO C CA    1 
ATOM   8079  C  C     . PRO C 2  570  ? 19.682  -4.326  96.793  1.00 8.13   ? 570  PRO C C     1 
ATOM   8080  O  O     . PRO C 2  570  ? 20.064  -3.216  96.425  1.00 7.54   ? 570  PRO C O     1 
ATOM   8081  C  CB    . PRO C 2  570  ? 20.905  -5.758  95.148  1.00 7.14   ? 570  PRO C CB    1 
ATOM   8082  C  CG    . PRO C 2  570  ? 20.592  -6.090  93.736  1.00 9.42   ? 570  PRO C CG    1 
ATOM   8083  C  CD    . PRO C 2  570  ? 19.418  -5.219  93.370  1.00 10.08  ? 570  PRO C CD    1 
ATOM   8084  N  N     . LEU C 2  571  ? 19.392  -4.616  98.055  1.00 10.47  ? 571  LEU C N     1 
ATOM   8085  C  CA    . LEU C 2  571  ? 19.425  -3.611  99.106  1.00 9.23   ? 571  LEU C CA    1 
ATOM   8086  C  C     . LEU C 2  571  ? 20.674  -3.814  99.945  1.00 11.25  ? 571  LEU C C     1 
ATOM   8087  O  O     . LEU C 2  571  ? 21.161  -4.938  100.074 1.00 14.45  ? 571  LEU C O     1 
ATOM   8088  C  CB    . LEU C 2  571  ? 18.166  -3.708  99.968  1.00 9.95   ? 571  LEU C CB    1 
ATOM   8089  C  CG    . LEU C 2  571  ? 16.860  -3.479  99.199  1.00 12.19  ? 571  LEU C CG    1 
ATOM   8090  C  CD1   . LEU C 2  571  ? 15.640  -3.736  100.073 1.00 9.39   ? 571  LEU C CD1   1 
ATOM   8091  C  CD2   . LEU C 2  571  ? 16.823  -2.070  98.626  1.00 9.91   ? 571  LEU C CD2   1 
ATOM   8092  N  N     . ILE C 2  572  ? 21.215  -2.728  100.484 1.00 10.10  ? 572  ILE C N     1 
ATOM   8093  C  CA    . ILE C 2  572  ? 22.437  -2.817  101.273 1.00 11.89  ? 572  ILE C CA    1 
ATOM   8094  C  C     . ILE C 2  572  ? 22.197  -3.646  102.529 1.00 9.83   ? 572  ILE C C     1 
ATOM   8095  O  O     . ILE C 2  572  ? 23.065  -4.396  102.973 1.00 14.29  ? 572  ILE C O     1 
ATOM   8096  C  CB    . ILE C 2  572  ? 22.993  -1.421  101.637 1.00 10.13  ? 572  ILE C CB    1 
ATOM   8097  C  CG1   . ILE C 2  572  ? 21.948  -0.586  102.377 1.00 9.33   ? 572  ILE C CG1   1 
ATOM   8098  C  CG2   . ILE C 2  572  ? 23.423  -0.688  100.385 1.00 8.60   ? 572  ILE C CG2   1 
ATOM   8099  C  CD1   . ILE C 2  572  ? 22.449  0.781   102.785 1.00 10.82  ? 572  ILE C CD1   1 
ATOM   8100  N  N     . ARG C 2  573  ? 21.006  -3.491  103.088 1.00 8.40   ? 573  ARG C N     1 
ATOM   8101  C  CA    . ARG C 2  573  ? 20.583  -4.184  104.300 1.00 10.05  ? 573  ARG C CA    1 
ATOM   8102  C  C     . ARG C 2  573  ? 19.746  -5.446  104.053 1.00 11.72  ? 573  ARG C C     1 
ATOM   8103  O  O     . ARG C 2  573  ? 19.109  -5.959  104.973 1.00 18.46  ? 573  ARG C O     1 
ATOM   8104  C  CB    . ARG C 2  573  ? 19.923  -3.214  105.280 1.00 11.34  ? 573  ARG C CB    1 
ATOM   8105  C  CG    . ARG C 2  573  ? 20.813  -2.018  105.594 1.00 11.02  ? 573  ARG C CG    1 
ATOM   8106  C  CD    . ARG C 2  573  ? 20.539  -1.457  106.971 1.00 13.83  ? 573  ARG C CD    1 
ATOM   8107  N  NE    . ARG C 2  573  ? 20.618  -2.497  107.989 1.00 16.81  ? 573  ARG C NE    1 
ATOM   8108  C  CZ    . ARG C 2  573  ? 20.403  -2.292  109.283 1.00 16.61  ? 573  ARG C CZ    1 
ATOM   8109  N  NH1   . ARG C 2  573  ? 20.097  -1.078  109.721 1.00 16.80  ? 573  ARG C NH1   1 
ATOM   8110  N  NH2   . ARG C 2  573  ? 20.493  -3.302  110.137 1.00 15.66  ? 573  ARG C NH2   1 
ATOM   8111  N  N     . ALA C 2  574  ? 19.723  -5.906  102.804 1.00 9.83   ? 574  ALA C N     1 
ATOM   8112  C  CA    . ALA C 2  574  ? 18.780  -6.923  102.328 1.00 10.08  ? 574  ALA C CA    1 
ATOM   8113  C  C     . ALA C 2  574  ? 18.627  -8.164  103.211 1.00 10.45  ? 574  ALA C C     1 
ATOM   8114  O  O     . ALA C 2  574  ? 19.600  -8.697  103.740 1.00 14.45  ? 574  ALA C O     1 
ATOM   8115  C  CB    . ALA C 2  574  ? 19.150  -7.343  100.913 1.00 7.31   ? 574  ALA C CB    1 
ATOM   8116  N  N     . GLN C 2  575  ? 17.381  -8.609  103.359 1.00 10.08  ? 575  GLN C N     1 
ATOM   8117  C  CA    . GLN C 2  575  ? 17.041  -9.727  104.230 1.00 10.69  ? 575  GLN C CA    1 
ATOM   8118  C  C     . GLN C 2  575  ? 16.252  -10.802 103.498 1.00 11.59  ? 575  GLN C C     1 
ATOM   8119  O  O     . GLN C 2  575  ? 15.487  -10.508 102.582 1.00 14.13  ? 575  GLN C O     1 
ATOM   8120  C  CB    . GLN C 2  575  ? 16.186  -9.235  105.391 1.00 12.85  ? 575  GLN C CB    1 
ATOM   8121  C  CG    . GLN C 2  575  ? 16.804  -8.128  106.201 1.00 13.51  ? 575  GLN C CG    1 
ATOM   8122  C  CD    . GLN C 2  575  ? 15.796  -7.478  107.111 1.00 14.02  ? 575  GLN C CD    1 
ATOM   8123  O  OE1   . GLN C 2  575  ? 14.614  -7.393  106.779 1.00 11.13  ? 575  GLN C OE1   1 
ATOM   8124  N  NE2   . GLN C 2  575  ? 16.252  -7.018  108.272 1.00 24.68  ? 575  GLN C NE2   1 
ATOM   8125  N  N     . ALA C 2  576  ? 16.435  -12.049 103.913 1.00 12.97  ? 576  ALA C N     1 
ATOM   8126  C  CA    . ALA C 2  576  ? 15.623  -13.143 103.406 1.00 13.86  ? 576  ALA C CA    1 
ATOM   8127  C  C     . ALA C 2  576  ? 14.224  -13.018 103.997 1.00 15.25  ? 576  ALA C C     1 
ATOM   8128  O  O     . ALA C 2  576  ? 14.059  -12.448 105.077 1.00 16.30  ? 576  ALA C O     1 
ATOM   8129  C  CB    . ALA C 2  576  ? 16.244  -14.476 103.781 1.00 18.02  ? 576  ALA C CB    1 
ATOM   8130  N  N     . PRO C 2  577  ? 13.209  -13.539 103.291 1.00 13.63  ? 577  PRO C N     1 
ATOM   8131  C  CA    . PRO C 2  577  ? 11.828  -13.457 103.780 1.00 12.82  ? 577  PRO C CA    1 
ATOM   8132  C  C     . PRO C 2  577  ? 11.640  -14.186 105.109 1.00 15.08  ? 577  PRO C C     1 
ATOM   8133  O  O     . PRO C 2  577  ? 12.269  -15.220 105.331 1.00 15.37  ? 577  PRO C O     1 
ATOM   8134  C  CB    . PRO C 2  577  ? 11.028  -14.177 102.689 1.00 10.56  ? 577  PRO C CB    1 
ATOM   8135  C  CG    . PRO C 2  577  ? 11.882  -14.120 101.479 1.00 10.60  ? 577  PRO C CG    1 
ATOM   8136  C  CD    . PRO C 2  577  ? 13.289  -14.189 101.971 1.00 11.34  ? 577  PRO C CD    1 
ATOM   8137  N  N     . VAL C 2  578  ? 10.786  -13.650 105.976 1.00 17.08  ? 578  VAL C N     1 
ATOM   8138  C  CA    . VAL C 2  578  ? 10.428  -14.328 107.220 1.00 17.17  ? 578  VAL C CA    1 
ATOM   8139  C  C     . VAL C 2  578  ? 9.721   -15.645 106.912 1.00 15.11  ? 578  VAL C C     1 
ATOM   8140  O  O     . VAL C 2  578  ? 9.949   -16.658 107.571 1.00 18.91  ? 578  VAL C O     1 
ATOM   8141  C  CB    . VAL C 2  578  ? 9.539   -13.444 108.114 1.00 12.25  ? 578  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C 2  578  ? 8.874   -14.274 109.198 1.00 16.92  ? 578  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C 2  578  ? 10.366  -12.334 108.737 1.00 13.77  ? 578  VAL C CG2   1 
ATOM   8144  N  N     . VAL C 2  579  ? 8.867   -15.626 105.896 1.00 12.64  ? 579  VAL C N     1 
ATOM   8145  C  CA    . VAL C 2  579  ? 8.267   -16.852 105.396 1.00 14.79  ? 579  VAL C CA    1 
ATOM   8146  C  C     . VAL C 2  579  ? 8.890   -17.199 104.050 1.00 14.05  ? 579  VAL C C     1 
ATOM   8147  O  O     . VAL C 2  579  ? 8.674   -16.498 103.064 1.00 15.51  ? 579  VAL C O     1 
ATOM   8148  C  CB    . VAL C 2  579  ? 6.745   -16.713 105.231 1.00 11.73  ? 579  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C 2  579  ? 6.146   -18.033 104.774 1.00 9.21   ? 579  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C 2  579  ? 6.109   -16.253 106.533 1.00 11.21  ? 579  VAL C CG2   1 
ATOM   8151  N  N     . MET C 2  580  ? 9.675   -18.271 104.011 1.00 16.11  ? 580  MET C N     1 
ATOM   8152  C  CA    . MET C 2  580  ? 10.301  -18.690 102.765 1.00 14.30  ? 580  MET C CA    1 
ATOM   8153  C  C     . MET C 2  580  ? 9.580   -19.897 102.180 1.00 14.30  ? 580  MET C C     1 
ATOM   8154  O  O     . MET C 2  580  ? 8.704   -20.473 102.824 1.00 15.73  ? 580  MET C O     1 
ATOM   8155  C  CB    . MET C 2  580  ? 11.764  -19.036 103.027 1.00 14.35  ? 580  MET C CB    1 
ATOM   8156  C  CG    . MET C 2  580  ? 12.633  -17.833 103.342 1.00 13.29  ? 580  MET C CG    1 
ATOM   8157  S  SD    . MET C 2  580  ? 14.232  -18.290 104.037 1.00 24.29  ? 580  MET C SD    1 
ATOM   8158  C  CE    . MET C 2  580  ? 13.734  -18.842 105.664 1.00 16.53  ? 580  MET C CE    1 
ATOM   8159  N  N     . THR C 2  581  ? 9.947   -20.284 100.962 1.00 12.71  ? 581  THR C N     1 
ATOM   8160  C  CA    . THR C 2  581  ? 9.380   -21.484 100.352 1.00 15.20  ? 581  THR C CA    1 
ATOM   8161  C  C     . THR C 2  581  ? 10.304  -22.694 100.415 1.00 17.42  ? 581  THR C C     1 
ATOM   8162  O  O     . THR C 2  581  ? 9.915   -23.797 100.027 1.00 21.30  ? 581  THR C O     1 
ATOM   8163  C  CB    . THR C 2  581  ? 8.982   -21.252 98.888  1.00 14.78  ? 581  THR C CB    1 
ATOM   8164  O  OG1   . THR C 2  581  ? 10.149  -20.944 98.113  1.00 15.75  ? 581  THR C OG1   1 
ATOM   8165  C  CG2   . THR C 2  581  ? 7.986   -20.117 98.781  1.00 10.23  ? 581  THR C CG2   1 
ATOM   8166  N  N     . GLY C 2  582  ? 11.520  -22.487 100.909 1.00 17.25  ? 582  GLY C N     1 
ATOM   8167  C  CA    . GLY C 2  582  ? 12.514  -23.545 100.947 1.00 17.39  ? 582  GLY C CA    1 
ATOM   8168  C  C     . GLY C 2  582  ? 13.462  -23.526 99.761  1.00 18.45  ? 582  GLY C C     1 
ATOM   8169  O  O     . GLY C 2  582  ? 14.459  -24.246 99.744  1.00 29.71  ? 582  GLY C O     1 
ATOM   8170  N  N     . LEU C 2  583  ? 13.157  -22.701 98.765  1.00 18.32  ? 583  LEU C N     1 
ATOM   8171  C  CA    . LEU C 2  583  ? 13.965  -22.637 97.550  1.00 14.83  ? 583  LEU C CA    1 
ATOM   8172  C  C     . LEU C 2  583  ? 14.996  -21.514 97.555  1.00 12.22  ? 583  LEU C C     1 
ATOM   8173  O  O     . LEU C 2  583  ? 15.763  -21.369 96.605  1.00 11.09  ? 583  LEU C O     1 
ATOM   8174  C  CB    . LEU C 2  583  ? 13.066  -22.474 96.328  1.00 12.20  ? 583  LEU C CB    1 
ATOM   8175  C  CG    . LEU C 2  583  ? 13.472  -23.382 95.175  1.00 16.78  ? 583  LEU C CG    1 
ATOM   8176  C  CD1   . LEU C 2  583  ? 13.241  -24.825 95.594  1.00 23.96  ? 583  LEU C CD1   1 
ATOM   8177  C  CD2   . LEU C 2  583  ? 12.698  -23.047 93.913  1.00 10.84  ? 583  LEU C CD2   1 
ATOM   8178  N  N     . GLU C 2  584  ? 15.014  -20.726 98.622  1.00 12.28  ? 584  GLU C N     1 
ATOM   8179  C  CA    . GLU C 2  584  ? 15.795  -19.490 98.654  1.00 13.45  ? 584  GLU C CA    1 
ATOM   8180  C  C     . GLU C 2  584  ? 17.309  -19.681 98.537  1.00 13.67  ? 584  GLU C C     1 
ATOM   8181  O  O     . GLU C 2  584  ? 17.999  -18.816 98.003  1.00 17.86  ? 584  GLU C O     1 
ATOM   8182  C  CB    . GLU C 2  584  ? 15.451  -18.664 99.900  1.00 11.74  ? 584  GLU C CB    1 
ATOM   8183  C  CG    . GLU C 2  584  ? 14.085  -17.977 99.849  1.00 12.57  ? 584  GLU C CG    1 
ATOM   8184  C  CD    . GLU C 2  584  ? 12.909  -18.944 99.953  1.00 17.24  ? 584  GLU C CD    1 
ATOM   8185  O  OE1   . GLU C 2  584  ? 11.752  -18.504 99.766  1.00 13.44  ? 584  GLU C OE1   1 
ATOM   8186  O  OE2   . GLU C 2  584  ? 13.132  -20.140 100.238 1.00 18.55  ? 584  GLU C OE2   1 
ATOM   8187  N  N     . GLU C 2  585  ? 17.826  -20.800 99.037  1.00 20.87  ? 585  GLU C N     1 
ATOM   8188  C  CA    . GLU C 2  585  ? 19.269  -21.059 98.993  1.00 19.86  ? 585  GLU C CA    1 
ATOM   8189  C  C     . GLU C 2  585  ? 19.775  -21.598 97.651  1.00 16.76  ? 585  GLU C C     1 
ATOM   8190  O  O     . GLU C 2  585  ? 20.820  -21.160 97.160  1.00 16.39  ? 585  GLU C O     1 
ATOM   8191  C  CB    . GLU C 2  585  ? 19.697  -21.971 100.145 1.00 22.40  ? 585  GLU C CB    1 
ATOM   8192  C  CG    . GLU C 2  585  ? 19.644  -21.284 101.502 1.00 27.17  ? 585  GLU C CG    1 
ATOM   8193  C  CD    . GLU C 2  585  ? 20.017  -22.202 102.655 1.00 39.05  ? 585  GLU C CD    1 
ATOM   8194  O  OE1   . GLU C 2  585  ? 19.144  -22.976 103.111 1.00 36.08  ? 585  GLU C OE1   1 
ATOM   8195  O  OE2   . GLU C 2  585  ? 21.180  -22.140 103.111 1.00 35.04  ? 585  GLU C OE2   1 
ATOM   8196  N  N     . ARG C 2  586  ? 19.035  -22.538 97.064  1.00 12.63  ? 586  ARG C N     1 
ATOM   8197  C  CA    . ARG C 2  586  ? 19.397  -23.108 95.766  1.00 13.40  ? 586  ARG C CA    1 
ATOM   8198  C  C     . ARG C 2  586  ? 19.506  -22.031 94.695  1.00 16.79  ? 586  ARG C C     1 
ATOM   8199  O  O     . ARG C 2  586  ? 20.340  -22.123 93.796  1.00 18.27  ? 586  ARG C O     1 
ATOM   8200  C  CB    . ARG C 2  586  ? 18.379  -24.162 95.314  1.00 15.53  ? 586  ARG C CB    1 
ATOM   8201  C  CG    . ARG C 2  586  ? 18.745  -25.596 95.653  1.00 15.38  ? 586  ARG C CG    1 
ATOM   8202  C  CD    . ARG C 2  586  ? 20.179  -25.934 95.253  1.00 21.95  ? 586  ARG C CD    1 
ATOM   8203  N  NE    . ARG C 2  586  ? 20.408  -25.887 93.809  1.00 21.29  ? 586  ARG C NE    1 
ATOM   8204  C  CZ    . ARG C 2  586  ? 20.111  -26.876 92.970  1.00 19.90  ? 586  ARG C CZ    1 
ATOM   8205  N  NH1   . ARG C 2  586  ? 19.554  -27.993 93.422  1.00 18.90  ? 586  ARG C NH1   1 
ATOM   8206  N  NH2   . ARG C 2  586  ? 20.363  -26.747 91.674  1.00 17.33  ? 586  ARG C NH2   1 
ATOM   8207  N  N     . VAL C 2  587  ? 18.647  -21.020 94.786  1.00 14.85  ? 587  VAL C N     1 
ATOM   8208  C  CA    . VAL C 2  587  ? 18.656  -19.928 93.823  1.00 14.85  ? 587  VAL C CA    1 
ATOM   8209  C  C     . VAL C 2  587  ? 19.960  -19.150 93.937  1.00 16.13  ? 587  VAL C C     1 
ATOM   8210  O  O     . VAL C 2  587  ? 20.614  -18.868 92.933  1.00 14.04  ? 587  VAL C O     1 
ATOM   8211  C  CB    . VAL C 2  587  ? 17.448  -18.985 94.015  1.00 14.11  ? 587  VAL C CB    1 
ATOM   8212  C  CG1   . VAL C 2  587  ? 17.610  -17.729 93.178  1.00 13.07  ? 587  VAL C CG1   1 
ATOM   8213  C  CG2   . VAL C 2  587  ? 16.157  -19.700 93.656  1.00 9.53   ? 587  VAL C CG2   1 
ATOM   8214  N  N     . VAL C 2  588  ? 20.343  -18.821 95.167  1.00 15.18  ? 588  VAL C N     1 
ATOM   8215  C  CA    . VAL C 2  588  ? 21.597  -18.118 95.407  1.00 18.69  ? 588  VAL C CA    1 
ATOM   8216  C  C     . VAL C 2  588  ? 22.785  -18.933 94.911  1.00 23.58  ? 588  VAL C C     1 
ATOM   8217  O  O     . VAL C 2  588  ? 23.695  -18.397 94.270  1.00 25.16  ? 588  VAL C O     1 
ATOM   8218  C  CB    . VAL C 2  588  ? 21.786  -17.806 96.898  1.00 17.00  ? 588  VAL C CB    1 
ATOM   8219  C  CG1   . VAL C 2  588  ? 23.205  -17.340 97.176  1.00 16.31  ? 588  VAL C CG1   1 
ATOM   8220  C  CG2   . VAL C 2  588  ? 20.791  -16.760 97.335  1.00 17.20  ? 588  VAL C CG2   1 
ATOM   8221  N  N     . ARG C 2  589  ? 22.761  -20.232 95.197  1.00 20.55  ? 589  ARG C N     1 
ATOM   8222  C  CA    . ARG C 2  589  ? 23.856  -21.119 94.816  1.00 20.70  ? 589  ARG C CA    1 
ATOM   8223  C  C     . ARG C 2  589  ? 24.009  -21.244 93.303  1.00 20.98  ? 589  ARG C C     1 
ATOM   8224  O  O     . ARG C 2  589  ? 25.091  -21.013 92.765  1.00 19.98  ? 589  ARG C O     1 
ATOM   8225  C  CB    . ARG C 2  589  ? 23.677  -22.501 95.445  1.00 20.53  ? 589  ARG C CB    1 
ATOM   8226  C  CG    . ARG C 2  589  ? 24.792  -23.477 95.114  1.00 21.54  ? 589  ARG C CG    1 
ATOM   8227  C  CD    . ARG C 2  589  ? 24.745  -24.692 96.021  1.00 23.98  ? 589  ARG C CD    1 
ATOM   8228  N  NE    . ARG C 2  589  ? 25.002  -24.342 97.416  1.00 30.60  ? 589  ARG C NE    1 
ATOM   8229  C  CZ    . ARG C 2  589  ? 26.198  -24.408 97.993  1.00 35.01  ? 589  ARG C CZ    1 
ATOM   8230  N  NH1   . ARG C 2  589  ? 27.252  -24.815 97.296  1.00 32.96  ? 589  ARG C NH1   1 
ATOM   8231  N  NH2   . ARG C 2  589  ? 26.342  -24.072 99.269  1.00 27.55  ? 589  ARG C NH2   1 
ATOM   8232  N  N     . ASP C 2  590  ? 22.923  -21.603 92.625  1.00 15.40  ? 590  ASP C N     1 
ATOM   8233  C  CA    . ASP C 2  590  ? 22.945  -21.817 91.182  1.00 13.92  ? 590  ASP C CA    1 
ATOM   8234  C  C     . ASP C 2  590  ? 23.249  -20.545 90.391  1.00 21.48  ? 590  ASP C C     1 
ATOM   8235  O  O     . ASP C 2  590  ? 23.836  -20.607 89.311  1.00 27.52  ? 590  ASP C O     1 
ATOM   8236  C  CB    . ASP C 2  590  ? 21.621  -22.420 90.707  1.00 15.55  ? 590  ASP C CB    1 
ATOM   8237  C  CG    . ASP C 2  590  ? 21.549  -23.918 90.922  1.00 17.74  ? 590  ASP C CG    1 
ATOM   8238  O  OD1   . ASP C 2  590  ? 22.037  -24.404 91.964  1.00 20.45  ? 590  ASP C OD1   1 
ATOM   8239  O  OD2   . ASP C 2  590  ? 21.004  -24.615 90.042  1.00 19.35  ? 590  ASP C OD2   1 
ATOM   8240  N  N     . SER C 2  591  ? 22.854  -19.396 90.930  1.00 20.79  ? 591  SER C N     1 
ATOM   8241  C  CA    . SER C 2  591  ? 23.051  -18.122 90.243  1.00 23.04  ? 591  SER C CA    1 
ATOM   8242  C  C     . SER C 2  591  ? 24.505  -17.664 90.287  1.00 28.90  ? 591  SER C C     1 
ATOM   8243  O  O     . SER C 2  591  ? 24.864  -16.663 89.667  1.00 33.50  ? 591  SER C O     1 
ATOM   8244  C  CB    . SER C 2  591  ? 22.177  -17.038 90.865  1.00 22.58  ? 591  SER C CB    1 
ATOM   8245  O  OG    . SER C 2  591  ? 22.697  -16.651 92.124  1.00 27.37  ? 591  SER C OG    1 
ATOM   8246  N  N     . LEU C 2  592  ? 25.325  -18.389 91.043  1.00 30.59  ? 592  LEU C N     1 
ATOM   8247  C  CA    . LEU C 2  592  ? 26.737  -18.059 91.225  1.00 28.94  ? 592  LEU C CA    1 
ATOM   8248  C  C     . LEU C 2  592  ? 26.918  -16.672 91.833  1.00 29.94  ? 592  LEU C C     1 
ATOM   8249  O  O     . LEU C 2  592  ? 27.949  -16.023 91.646  1.00 28.63  ? 592  LEU C O     1 
ATOM   8250  C  CB    . LEU C 2  592  ? 27.513  -18.201 89.913  1.00 22.63  ? 592  LEU C CB    1 
ATOM   8251  C  CG    . LEU C 2  592  ? 27.643  -19.638 89.404  1.00 23.59  ? 592  LEU C CG    1 
ATOM   8252  C  CD1   . LEU C 2  592  ? 28.417  -19.688 88.099  1.00 36.32  ? 592  LEU C CD1   1 
ATOM   8253  C  CD2   . LEU C 2  592  ? 28.314  -20.509 90.453  1.00 33.59  ? 592  LEU C CD2   1 
ATOM   8254  N  N     . ALA C 2  593  ? 25.903  -16.227 92.564  1.00 30.68  ? 593  ALA C N     1 
ATOM   8255  C  CA    . ALA C 2  593  ? 25.955  -14.943 93.244  1.00 40.43  ? 593  ALA C CA    1 
ATOM   8256  C  C     . ALA C 2  593  ? 26.925  -15.001 94.421  1.00 42.77  ? 593  ALA C C     1 
ATOM   8257  O  O     . ALA C 2  593  ? 27.845  -14.186 94.526  1.00 35.57  ? 593  ALA C O     1 
ATOM   8258  C  CB    . ALA C 2  593  ? 24.566  -14.550 93.718  1.00 34.06  ? 593  ALA C CB    1 
ATOM   8259  N  N     . ALA C 2  594  ? 26.704  -15.973 95.303  1.00 36.41  ? 594  ALA C N     1 
ATOM   8260  C  CA    . ALA C 2  594  ? 27.548  -16.178 96.478  1.00 29.76  ? 594  ALA C CA    1 
ATOM   8261  C  C     . ALA C 2  594  ? 28.830  -16.941 96.171  1.00 29.79  ? 594  ALA C C     1 
ATOM   8262  O  O     . ALA C 2  594  ? 28.893  -17.723 95.223  1.00 33.41  ? 594  ALA C O     1 
ATOM   8263  C  CB    . ALA C 2  594  ? 26.768  -16.890 97.569  1.00 28.25  ? 594  ALA C CB    1 
ATOM   8264  N  N     . LEU C 2  595  ? 29.846  -16.714 96.994  1.00 30.41  ? 595  LEU C N     1 
ATOM   8265  C  CA    . LEU C 2  595  ? 31.092  -17.456 96.896  1.00 30.92  ? 595  LEU C CA    1 
ATOM   8266  C  C     . LEU C 2  595  ? 31.106  -18.550 97.961  1.00 35.86  ? 595  LEU C C     1 
ATOM   8267  O  O     . LEU C 2  595  ? 30.762  -18.304 99.117  1.00 35.02  ? 595  LEU C O     1 
ATOM   8268  C  CB    . LEU C 2  595  ? 32.273  -16.510 97.081  1.00 33.93  ? 595  LEU C CB    1 
ATOM   8269  C  CG    . LEU C 2  595  ? 33.504  -16.783 96.222  1.00 35.48  ? 595  LEU C CG    1 
ATOM   8270  C  CD1   . LEU C 2  595  ? 34.400  -15.558 96.196  1.00 37.38  ? 595  LEU C CD1   1 
ATOM   8271  C  CD2   . LEU C 2  595  ? 34.262  -17.988 96.746  1.00 47.07  ? 595  LEU C CD2   1 
ATOM   8272  N  N     . TYR C 2  596  ? 31.504  -19.757 97.572  1.00 40.80  ? 596  TYR C N     1 
ATOM   8273  C  CA    . TYR C 2  596  ? 31.462  -20.901 98.480  1.00 41.61  ? 596  TYR C CA    1 
ATOM   8274  C  C     . TYR C 2  596  ? 32.824  -21.572 98.658  1.00 45.78  ? 596  TYR C C     1 
ATOM   8275  O  O     . TYR C 2  596  ? 33.729  -21.387 97.844  1.00 46.69  ? 596  TYR C O     1 
ATOM   8276  C  CB    . TYR C 2  596  ? 30.443  -21.931 97.989  1.00 37.96  ? 596  TYR C CB    1 
ATOM   8277  C  CG    . TYR C 2  596  ? 29.017  -21.433 97.972  1.00 33.69  ? 596  TYR C CG    1 
ATOM   8278  C  CD1   . TYR C 2  596  ? 28.394  -21.091 96.779  1.00 36.12  ? 596  TYR C CD1   1 
ATOM   8279  C  CD2   . TYR C 2  596  ? 28.291  -21.306 99.149  1.00 35.31  ? 596  TYR C CD2   1 
ATOM   8280  C  CE1   . TYR C 2  596  ? 27.085  -20.639 96.759  1.00 32.71  ? 596  TYR C CE1   1 
ATOM   8281  C  CE2   . TYR C 2  596  ? 26.984  -20.855 99.139  1.00 32.96  ? 596  TYR C CE2   1 
ATOM   8282  C  CZ    . TYR C 2  596  ? 26.387  -20.524 97.942  1.00 25.82  ? 596  TYR C CZ    1 
ATOM   8283  O  OH    . TYR C 2  596  ? 25.089  -20.073 97.931  1.00 24.45  ? 596  TYR C OH    1 
ATOM   8284  N  N     . ALA C 2  597  ? 32.958  -22.356 99.726  1.00 44.63  ? 597  ALA C N     1 
ATOM   8285  C  CA    . ALA C 2  597  ? 34.193  -23.088 99.997  1.00 46.98  ? 597  ALA C CA    1 
ATOM   8286  C  C     . ALA C 2  597  ? 34.303  -24.342 99.129  1.00 45.74  ? 597  ALA C C     1 
ATOM   8287  O  O     . ALA C 2  597  ? 33.384  -25.161 99.084  1.00 41.30  ? 597  ALA C O     1 
ATOM   8288  C  CB    . ALA C 2  597  ? 34.285  -23.448 101.471 1.00 42.74  ? 597  ALA C CB    1 
ATOM   8289  N  N     . GLU C 2  598  ? 35.437  -24.485 98.449  1.00 43.64  ? 598  GLU C N     1 
ATOM   8290  C  CA    . GLU C 2  598  ? 35.638  -25.570 97.492  1.00 49.26  ? 598  GLU C CA    1 
ATOM   8291  C  C     . GLU C 2  598  ? 35.718  -26.939 98.159  1.00 56.30  ? 598  GLU C C     1 
ATOM   8292  O  O     . GLU C 2  598  ? 35.122  -27.907 97.685  1.00 56.41  ? 598  GLU C O     1 
ATOM   8293  C  CB    . GLU C 2  598  ? 36.897  -25.320 96.661  1.00 58.67  ? 598  GLU C CB    1 
ATOM   8294  C  CG    . GLU C 2  598  ? 37.232  -26.441 95.691  1.00 59.62  ? 598  GLU C CG    1 
ATOM   8295  C  CD    . GLU C 2  598  ? 38.402  -26.098 94.793  1.00 64.55  ? 598  GLU C CD    1 
ATOM   8296  O  OE1   . GLU C 2  598  ? 38.714  -24.896 94.659  1.00 67.64  ? 598  GLU C OE1   1 
ATOM   8297  O  OE2   . GLU C 2  598  ? 39.010  -27.031 94.225  1.00 66.31  ? 598  GLU C OE2   1 
ATOM   8298  N  N     . GLU C 2  599  ? 36.464  -27.016 99.255  1.00 55.72  ? 599  GLU C N     1 
ATOM   8299  C  CA    . GLU C 2  599  ? 36.592  -28.259 100.002 1.00 57.04  ? 599  GLU C CA    1 
ATOM   8300  C  C     . GLU C 2  599  ? 36.570  -27.939 101.490 1.00 55.81  ? 599  GLU C C     1 
ATOM   8301  O  O     . GLU C 2  599  ? 36.502  -26.771 101.875 1.00 58.07  ? 599  GLU C O     1 
ATOM   8302  C  CB    . GLU C 2  599  ? 37.900  -28.963 99.635  1.00 56.34  ? 599  GLU C CB    1 
ATOM   8303  C  CG    . GLU C 2  599  ? 37.843  -30.482 99.719  1.00 65.29  ? 599  GLU C CG    1 
ATOM   8304  C  CD    . GLU C 2  599  ? 37.142  -31.109 98.527  1.00 67.25  ? 599  GLU C CD    1 
ATOM   8305  O  OE1   . GLU C 2  599  ? 37.156  -30.496 97.437  1.00 59.56  ? 599  GLU C OE1   1 
ATOM   8306  O  OE2   . GLU C 2  599  ? 36.579  -32.214 98.682  1.00 64.02  ? 599  GLU C OE2   1 
ATOM   8307  N  N     . ASP C 2  600  ? 36.626  -28.972 102.326 1.00 54.12  ? 600  ASP C N     1 
ATOM   8308  C  CA    . ASP C 2  600  ? 36.734  -28.772 103.764 1.00 45.51  ? 600  ASP C CA    1 
ATOM   8309  C  C     . ASP C 2  600  ? 38.074  -28.101 104.036 1.00 44.76  ? 600  ASP C C     1 
ATOM   8310  O  O     . ASP C 2  600  ? 39.078  -28.454 103.422 1.00 54.98  ? 600  ASP C O     1 
ATOM   8311  C  CB    . ASP C 2  600  ? 36.643  -30.109 104.504 1.00 48.54  ? 600  ASP C CB    1 
ATOM   8312  C  CG    . ASP C 2  600  ? 35.342  -30.851 104.222 1.00 55.05  ? 600  ASP C CG    1 
ATOM   8313  O  OD1   . ASP C 2  600  ? 35.252  -31.525 103.173 1.00 54.51  ? 600  ASP C OD1   1 
ATOM   8314  O  OD2   . ASP C 2  600  ? 34.414  -30.772 105.055 1.00 50.19  ? 600  ASP C OD2   1 
ATOM   8315  N  N     . GLY C 2  601  ? 38.093  -27.123 104.934 1.00 37.52  ? 601  GLY C N     1 
ATOM   8316  C  CA    . GLY C 2  601  ? 39.319  -26.397 105.210 1.00 42.92  ? 601  GLY C CA    1 
ATOM   8317  C  C     . GLY C 2  601  ? 39.230  -25.398 106.347 1.00 43.07  ? 601  GLY C C     1 
ATOM   8318  O  O     . GLY C 2  601  ? 38.307  -25.439 107.160 1.00 46.90  ? 601  GLY C O     1 
ATOM   8319  N  N     . GLU C 2  602  ? 40.209  -24.501 106.403 1.00 44.48  ? 602  GLU C N     1 
ATOM   8320  C  CA    . GLU C 2  602  ? 40.261  -23.465 107.427 1.00 50.39  ? 602  GLU C CA    1 
ATOM   8321  C  C     . GLU C 2  602  ? 40.518  -22.116 106.763 1.00 49.54  ? 602  GLU C C     1 
ATOM   8322  O  O     . GLU C 2  602  ? 41.282  -22.029 105.801 1.00 44.36  ? 602  GLU C O     1 
ATOM   8323  C  CB    . GLU C 2  602  ? 41.365  -23.775 108.442 1.00 51.96  ? 602  GLU C CB    1 
ATOM   8324  C  CG    . GLU C 2  602  ? 41.383  -22.862 109.662 1.00 57.14  ? 602  GLU C CG    1 
ATOM   8325  C  CD    . GLU C 2  602  ? 42.606  -23.078 110.538 1.00 62.89  ? 602  GLU C CD    1 
ATOM   8326  O  OE1   . GLU C 2  602  ? 43.699  -23.324 109.984 1.00 61.14  ? 602  GLU C OE1   1 
ATOM   8327  O  OE2   . GLU C 2  602  ? 42.476  -23.005 111.779 1.00 57.58  ? 602  GLU C OE2   1 
ATOM   8328  N  N     . VAL C 2  603  ? 39.877  -21.066 107.269 1.00 42.66  ? 603  VAL C N     1 
ATOM   8329  C  CA    . VAL C 2  603  ? 40.045  -19.741 106.687 1.00 46.06  ? 603  VAL C CA    1 
ATOM   8330  C  C     . VAL C 2  603  ? 41.331  -19.075 107.169 1.00 46.54  ? 603  VAL C C     1 
ATOM   8331  O  O     . VAL C 2  603  ? 41.511  -18.827 108.363 1.00 38.99  ? 603  VAL C O     1 
ATOM   8332  C  CB    . VAL C 2  603  ? 38.849  -18.826 107.003 1.00 43.12  ? 603  VAL C CB    1 
ATOM   8333  C  CG1   . VAL C 2  603  ? 39.158  -17.396 106.594 1.00 41.31  ? 603  VAL C CG1   1 
ATOM   8334  C  CG2   . VAL C 2  603  ? 37.599  -19.330 106.299 1.00 38.29  ? 603  VAL C CG2   1 
ATOM   8335  N  N     . ALA C 2  604  ? 42.224  -18.797 106.225 1.00 47.46  ? 604  ALA C N     1 
ATOM   8336  C  CA    . ALA C 2  604  ? 43.486  -18.135 106.523 1.00 35.76  ? 604  ALA C CA    1 
ATOM   8337  C  C     . ALA C 2  604  ? 43.342  -16.623 106.663 1.00 38.88  ? 604  ALA C C     1 
ATOM   8338  O  O     . ALA C 2  604  ? 43.816  -16.029 107.633 1.00 39.39  ? 604  ALA C O     1 
ATOM   8339  C  CB    . ALA C 2  604  ? 44.513  -18.469 105.454 1.00 39.06  ? 604  ALA C CB    1 
ATOM   8340  N  N     . LYS C 2  605  ? 42.680  -16.001 105.692 1.00 43.00  ? 605  LYS C N     1 
ATOM   8341  C  CA    . LYS C 2  605  ? 42.621  -14.543 105.638 1.00 42.16  ? 605  LYS C CA    1 
ATOM   8342  C  C     . LYS C 2  605  ? 41.229  -14.022 105.288 1.00 40.56  ? 605  LYS C C     1 
ATOM   8343  O  O     . LYS C 2  605  ? 40.541  -14.587 104.440 1.00 40.17  ? 605  LYS C O     1 
ATOM   8344  C  CB    . LYS C 2  605  ? 43.648  -14.005 104.634 1.00 43.12  ? 605  LYS C CB    1 
ATOM   8345  C  CG    . LYS C 2  605  ? 45.089  -14.398 104.938 1.00 41.21  ? 605  LYS C CG    1 
ATOM   8346  C  CD    . LYS C 2  605  ? 46.058  -13.916 103.866 1.00 45.45  ? 605  LYS C CD    1 
ATOM   8347  C  CE    . LYS C 2  605  ? 46.331  -12.424 103.978 1.00 50.81  ? 605  LYS C CE    1 
ATOM   8348  N  NZ    . LYS C 2  605  ? 47.365  -11.969 103.002 1.00 48.24  ? 605  LYS C NZ    1 
ATOM   8349  N  N     . VAL C 2  606  ? 40.818  -12.943 105.949 1.00 40.21  ? 606  VAL C N     1 
ATOM   8350  C  CA    . VAL C 2  606  ? 39.548  -12.289 105.638 1.00 36.01  ? 606  VAL C CA    1 
ATOM   8351  C  C     . VAL C 2  606  ? 39.724  -10.787 105.449 1.00 33.14  ? 606  VAL C C     1 
ATOM   8352  O  O     . VAL C 2  606  ? 40.240  -10.084 106.317 1.00 30.66  ? 606  VAL C O     1 
ATOM   8353  C  CB    . VAL C 2  606  ? 38.465  -12.569 106.697 1.00 34.25  ? 606  VAL C CB    1 
ATOM   8354  C  CG1   . VAL C 2  606  ? 37.329  -11.566 106.578 1.00 28.03  ? 606  VAL C CG1   1 
ATOM   8355  C  CG2   . VAL C 2  606  ? 37.940  -13.984 106.544 1.00 37.18  ? 606  VAL C CG2   1 
ATOM   8356  N  N     . ASP C 2  607  ? 39.284  -10.310 104.293 1.00 42.16  ? 607  ASP C N     1 
ATOM   8357  C  CA    . ASP C 2  607  ? 39.468  -8.927  103.899 1.00 38.33  ? 607  ASP C CA    1 
ATOM   8358  C  C     . ASP C 2  607  ? 38.193  -8.477  103.204 1.00 37.11  ? 607  ASP C C     1 
ATOM   8359  O  O     . ASP C 2  607  ? 37.370  -9.304  102.808 1.00 34.12  ? 607  ASP C O     1 
ATOM   8360  C  CB    . ASP C 2  607  ? 40.656  -8.834  102.937 1.00 35.30  ? 607  ASP C CB    1 
ATOM   8361  C  CG    . ASP C 2  607  ? 41.208  -7.432  102.821 1.00 42.64  ? 607  ASP C CG    1 
ATOM   8362  O  OD1   . ASP C 2  607  ? 40.941  -6.610  103.722 1.00 46.64  ? 607  ASP C OD1   1 
ATOM   8363  O  OD2   . ASP C 2  607  ? 41.921  -7.156  101.833 1.00 46.31  ? 607  ASP C OD2   1 
ATOM   8364  N  N     . GLY C 2  608  ? 38.014  -7.170  103.066 1.00 36.62  ? 608  GLY C N     1 
ATOM   8365  C  CA    . GLY C 2  608  ? 36.903  -6.663  102.287 1.00 34.86  ? 608  GLY C CA    1 
ATOM   8366  C  C     . GLY C 2  608  ? 37.082  -7.074  100.838 1.00 36.12  ? 608  GLY C C     1 
ATOM   8367  O  O     . GLY C 2  608  ? 36.119  -7.402  100.143 1.00 31.66  ? 608  GLY C O     1 
ATOM   8368  N  N     . ASN C 2  609  ? 38.331  -7.052  100.386 1.00 33.41  ? 609  ASN C N     1 
ATOM   8369  C  CA    . ASN C 2  609  ? 38.655  -7.376  99.005  1.00 30.14  ? 609  ASN C CA    1 
ATOM   8370  C  C     . ASN C 2  609  ? 38.987  -8.843  98.743  1.00 31.67  ? 609  ASN C C     1 
ATOM   8371  O  O     . ASN C 2  609  ? 39.009  -9.275  97.590  1.00 30.09  ? 609  ASN C O     1 
ATOM   8372  C  CB    . ASN C 2  609  ? 39.826  -6.509  98.545  1.00 32.39  ? 609  ASN C CB    1 
ATOM   8373  C  CG    . ASN C 2  609  ? 39.649  -5.051  98.917  1.00 33.02  ? 609  ASN C CG    1 
ATOM   8374  O  OD1   . ASN C 2  609  ? 38.555  -4.501  98.804  1.00 33.90  ? 609  ASN C OD1   1 
ATOM   8375  N  ND2   . ASN C 2  609  ? 40.724  -4.420  99.373  1.00 30.30  ? 609  ASN C ND2   1 
ATOM   8376  N  N     . ARG C 2  610  ? 39.235  -9.612  99.800  1.00 36.82  ? 610  ARG C N     1 
ATOM   8377  C  CA    . ARG C 2  610  ? 39.781  -10.957 99.619  1.00 38.36  ? 610  ARG C CA    1 
ATOM   8378  C  C     . ARG C 2  610  ? 39.434  -11.949 100.733 1.00 34.23  ? 610  ARG C C     1 
ATOM   8379  O  O     . ARG C 2  610  ? 39.338  -11.575 101.899 1.00 31.99  ? 610  ARG C O     1 
ATOM   8380  C  CB    . ARG C 2  610  ? 41.306  -10.859 99.422  1.00 42.54  ? 610  ARG C CB    1 
ATOM   8381  C  CG    . ARG C 2  610  ? 42.140  -11.995 100.011 1.00 44.78  ? 610  ARG C CG    1 
ATOM   8382  C  CD    . ARG C 2  610  ? 42.612  -11.686 101.432 1.00 47.50  ? 610  ARG C CD    1 
ATOM   8383  N  NE    . ARG C 2  610  ? 43.593  -10.606 101.480 1.00 45.48  ? 610  ARG C NE    1 
ATOM   8384  C  CZ    . ARG C 2  610  ? 44.033  -10.051 102.605 1.00 42.84  ? 610  ARG C CZ    1 
ATOM   8385  N  NH1   . ARG C 2  610  ? 43.571  -10.469 103.776 1.00 39.08  ? 610  ARG C NH1   1 
ATOM   8386  N  NH2   . ARG C 2  610  ? 44.928  -9.074  102.561 1.00 45.75  ? 610  ARG C NH2   1 
ATOM   8387  N  N     . ILE C 2  611  ? 39.258  -13.215 100.362 1.00 38.02  ? 611  ILE C N     1 
ATOM   8388  C  CA    . ILE C 2  611  ? 39.155  -14.301 101.334 1.00 35.53  ? 611  ILE C CA    1 
ATOM   8389  C  C     . ILE C 2  611  ? 40.124  -15.417 100.966 1.00 39.10  ? 611  ILE C C     1 
ATOM   8390  O  O     . ILE C 2  611  ? 39.973  -16.052 99.924  1.00 39.29  ? 611  ILE C O     1 
ATOM   8391  C  CB    . ILE C 2  611  ? 37.737  -14.908 101.388 1.00 30.20  ? 611  ILE C CB    1 
ATOM   8392  C  CG1   . ILE C 2  611  ? 36.695  -13.838 101.715 1.00 27.96  ? 611  ILE C CG1   1 
ATOM   8393  C  CG2   . ILE C 2  611  ? 37.682  -16.034 102.413 1.00 25.79  ? 611  ILE C CG2   1 
ATOM   8394  C  CD1   . ILE C 2  611  ? 35.300  -14.392 101.900 1.00 24.70  ? 611  ILE C CD1   1 
ATOM   8395  N  N     . VAL C 2  612  ? 41.114  -15.663 101.818 1.00 45.77  ? 612  VAL C N     1 
ATOM   8396  C  CA    . VAL C 2  612  ? 42.073  -16.735 101.565 1.00 42.92  ? 612  VAL C CA    1 
ATOM   8397  C  C     . VAL C 2  612  ? 41.789  -17.963 102.422 1.00 42.76  ? 612  VAL C C     1 
ATOM   8398  O  O     . VAL C 2  612  ? 41.755  -17.881 103.652 1.00 40.92  ? 612  VAL C O     1 
ATOM   8399  C  CB    . VAL C 2  612  ? 43.519  -16.283 101.806 1.00 41.90  ? 612  VAL C CB    1 
ATOM   8400  C  CG1   . VAL C 2  612  ? 44.475  -17.388 101.412 1.00 41.14  ? 612  VAL C CG1   1 
ATOM   8401  C  CG2   . VAL C 2  612  ? 43.818  -15.025 101.015 1.00 46.04  ? 612  VAL C CG2   1 
ATOM   8402  N  N     . VAL C 2  613  ? 41.595  -19.099 101.760 1.00 45.32  ? 613  VAL C N     1 
ATOM   8403  C  CA    . VAL C 2  613  ? 41.264  -20.345 102.439 1.00 48.76  ? 613  VAL C CA    1 
ATOM   8404  C  C     . VAL C 2  613  ? 42.369  -21.387 102.276 1.00 55.28  ? 613  VAL C C     1 
ATOM   8405  O  O     . VAL C 2  613  ? 42.930  -21.552 101.191 1.00 53.88  ? 613  VAL C O     1 
ATOM   8406  C  CB    . VAL C 2  613  ? 39.937  -20.931 101.907 1.00 47.37  ? 613  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C 2  613  ? 39.522  -22.151 102.714 1.00 48.14  ? 613  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C 2  613  ? 38.846  -19.880 101.942 1.00 50.16  ? 613  VAL C CG2   1 
ATOM   8409  N  N     . ARG C 2  614  ? 42.682  -22.079 103.367 1.00 56.90  ? 614  ARG C N     1 
ATOM   8410  C  CA    . ARG C 2  614  ? 43.613  -23.199 103.337 1.00 58.57  ? 614  ARG C CA    1 
ATOM   8411  C  C     . ARG C 2  614  ? 42.835  -24.508 103.436 1.00 61.87  ? 614  ARG C C     1 
ATOM   8412  O  O     . ARG C 2  614  ? 42.144  -24.752 104.425 1.00 58.70  ? 614  ARG C O     1 
ATOM   8413  C  CB    . ARG C 2  614  ? 44.616  -23.088 104.488 1.00 61.92  ? 614  ARG C CB    1 
ATOM   8414  C  CG    . ARG C 2  614  ? 45.530  -24.293 104.640 1.00 68.43  ? 614  ARG C CG    1 
ATOM   8415  C  CD    . ARG C 2  614  ? 46.615  -24.044 105.679 1.00 63.24  ? 614  ARG C CD    1 
ATOM   8416  N  NE    . ARG C 2  614  ? 47.441  -22.888 105.341 1.00 73.51  ? 614  ARG C NE    1 
ATOM   8417  C  CZ    . ARG C 2  614  ? 48.426  -22.905 104.447 1.00 72.81  ? 614  ARG C CZ    1 
ATOM   8418  N  NH1   . ARG C 2  614  ? 49.124  -21.803 104.206 1.00 58.74  ? 614  ARG C NH1   1 
ATOM   8419  N  NH2   . ARG C 2  614  ? 48.712  -24.021 103.788 1.00 70.99  ? 614  ARG C NH2   1 
ATOM   8420  N  N     . TYR C 2  615  ? 42.943  -25.344 102.407 1.00 63.30  ? 615  TYR C N     1 
ATOM   8421  C  CA    . TYR C 2  615  ? 42.183  -26.592 102.358 1.00 66.42  ? 615  TYR C CA    1 
ATOM   8422  C  C     . TYR C 2  615  ? 42.963  -27.784 102.914 1.00 71.57  ? 615  TYR C C     1 
ATOM   8423  O  O     . TYR C 2  615  ? 44.062  -27.628 103.447 1.00 72.02  ? 615  TYR C O     1 
ATOM   8424  C  CB    . TYR C 2  615  ? 41.714  -26.887 100.929 1.00 69.65  ? 615  TYR C CB    1 
ATOM   8425  C  CG    . TYR C 2  615  ? 40.724  -25.880 100.379 1.00 68.15  ? 615  TYR C CG    1 
ATOM   8426  C  CD1   . TYR C 2  615  ? 41.071  -25.037 99.329  1.00 64.28  ? 615  TYR C CD1   1 
ATOM   8427  C  CD2   . TYR C 2  615  ? 39.444  -25.769 100.912 1.00 62.40  ? 615  TYR C CD2   1 
ATOM   8428  C  CE1   . TYR C 2  615  ? 40.170  -24.115 98.822  1.00 57.93  ? 615  TYR C CE1   1 
ATOM   8429  C  CE2   . TYR C 2  615  ? 38.537  -24.849 100.412 1.00 56.65  ? 615  TYR C CE2   1 
ATOM   8430  C  CZ    . TYR C 2  615  ? 38.905  -24.026 99.368  1.00 54.48  ? 615  TYR C CZ    1 
ATOM   8431  O  OH    . TYR C 2  615  ? 38.009  -23.110 98.867  1.00 43.45  ? 615  TYR C OH    1 
ATOM   8432  N  N     . GLU C 2  616  ? 42.378  -28.973 102.785 1.00 76.22  ? 616  GLU C N     1 
ATOM   8433  C  CA    . GLU C 2  616  ? 42.993  -30.207 103.270 1.00 76.82  ? 616  GLU C CA    1 
ATOM   8434  C  C     . GLU C 2  616  ? 44.279  -30.516 102.518 1.00 81.32  ? 616  GLU C C     1 
ATOM   8435  O  O     . GLU C 2  616  ? 45.166  -31.197 103.031 1.00 85.20  ? 616  GLU C O     1 
ATOM   8436  C  CB    . GLU C 2  616  ? 42.025  -31.383 103.115 1.00 79.92  ? 616  GLU C CB    1 
ATOM   8437  C  CG    . GLU C 2  616  ? 40.701  -31.228 103.846 1.00 75.15  ? 616  GLU C CG    1 
ATOM   8438  C  CD    . GLU C 2  616  ? 40.794  -31.565 105.323 1.00 79.41  ? 616  GLU C CD    1 
ATOM   8439  O  OE1   . GLU C 2  616  ? 41.718  -31.064 106.000 1.00 78.47  ? 616  GLU C OE1   1 
ATOM   8440  O  OE2   . GLU C 2  616  ? 39.938  -32.336 105.808 1.00 81.53  ? 616  GLU C OE2   1 
ATOM   8441  N  N     . ASP C 2  617  ? 44.370  -30.009 101.294 1.00 81.05  ? 617  ASP C N     1 
ATOM   8442  C  CA    . ASP C 2  617  ? 45.523  -30.250 100.440 1.00 77.35  ? 617  ASP C CA    1 
ATOM   8443  C  C     . ASP C 2  617  ? 46.736  -29.459 100.920 1.00 78.35  ? 617  ASP C C     1 
ATOM   8444  O  O     . ASP C 2  617  ? 47.858  -29.690 100.469 1.00 82.42  ? 617  ASP C O     1 
ATOM   8445  C  CB    . ASP C 2  617  ? 45.184  -29.868 99.000  1.00 76.87  ? 617  ASP C CB    1 
ATOM   8446  C  CG    . ASP C 2  617  ? 43.730  -30.134 98.658  1.00 83.03  ? 617  ASP C CG    1 
ATOM   8447  O  OD1   . ASP C 2  617  ? 43.149  -31.087 99.220  1.00 85.04  ? 617  ASP C OD1   1 
ATOM   8448  O  OD2   . ASP C 2  617  ? 43.164  -29.384 97.836  1.00 84.71  ? 617  ASP C OD2   1 
ATOM   8449  N  N     . GLY C 2  618  ? 46.503  -28.525 101.838 1.00 79.83  ? 618  GLY C N     1 
ATOM   8450  C  CA    . GLY C 2  618  ? 47.558  -27.670 102.349 1.00 77.14  ? 618  GLY C CA    1 
ATOM   8451  C  C     . GLY C 2  618  ? 47.788  -26.468 101.453 1.00 75.95  ? 618  GLY C C     1 
ATOM   8452  O  O     . GLY C 2  618  ? 48.598  -25.594 101.764 1.00 68.71  ? 618  GLY C O     1 
ATOM   8453  N  N     . ARG C 2  619  ? 47.067  -26.427 100.336 1.00 70.80  ? 619  ARG C N     1 
ATOM   8454  C  CA    . ARG C 2  619  ? 47.207  -25.348 99.366  1.00 67.75  ? 619  ARG C CA    1 
ATOM   8455  C  C     . ARG C 2  619  ? 46.456  -24.094 99.799  1.00 69.86  ? 619  ARG C C     1 
ATOM   8456  O  O     . ARG C 2  619  ? 45.423  -24.169 100.464 1.00 68.69  ? 619  ARG C O     1 
ATOM   8457  C  CB    . ARG C 2  619  ? 46.731  -25.802 97.985  1.00 64.27  ? 619  ARG C CB    1 
ATOM   8458  C  CG    . ARG C 2  619  ? 45.298  -26.300 97.947  1.00 59.09  ? 619  ARG C CG    1 
ATOM   8459  C  CD    . ARG C 2  619  ? 44.980  -26.924 96.599  1.00 60.56  ? 619  ARG C CD    1 
ATOM   8460  N  NE    . ARG C 2  619  ? 43.634  -27.487 96.559  1.00 66.10  ? 619  ARG C NE    1 
ATOM   8461  C  CZ    . ARG C 2  619  ? 42.606  -26.926 95.931  1.00 67.73  ? 619  ARG C CZ    1 
ATOM   8462  N  NH1   . ARG C 2  619  ? 41.417  -27.513 95.950  1.00 65.77  ? 619  ARG C NH1   1 
ATOM   8463  N  NH2   . ARG C 2  619  ? 42.767  -25.784 95.278  1.00 64.53  ? 619  ARG C NH2   1 
ATOM   8464  N  N     . LEU C 2  620  ? 46.989  -22.939 99.415  1.00 67.84  ? 620  LEU C N     1 
ATOM   8465  C  CA    . LEU C 2  620  ? 46.400  -21.662 99.787  1.00 58.77  ? 620  LEU C CA    1 
ATOM   8466  C  C     . LEU C 2  620  ? 45.647  -21.070 98.600  1.00 52.93  ? 620  LEU C C     1 
ATOM   8467  O  O     . LEU C 2  620  ? 46.258  -20.612 97.633  1.00 46.02  ? 620  LEU C O     1 
ATOM   8468  C  CB    . LEU C 2  620  ? 47.502  -20.704 100.245 1.00 50.67  ? 620  LEU C CB    1 
ATOM   8469  C  CG    . LEU C 2  620  ? 47.172  -19.740 101.382 1.00 54.27  ? 620  LEU C CG    1 
ATOM   8470  C  CD1   . LEU C 2  620  ? 46.556  -20.492 102.548 1.00 57.17  ? 620  LEU C CD1   1 
ATOM   8471  C  CD2   . LEU C 2  620  ? 48.418  -18.987 101.824 1.00 47.83  ? 620  LEU C CD2   1 
ATOM   8472  N  N     . VAL C 2  621  ? 44.319  -21.067 98.683  1.00 54.47  ? 621  VAL C N     1 
ATOM   8473  C  CA    . VAL C 2  621  ? 43.485  -20.580 97.585  1.00 55.12  ? 621  VAL C CA    1 
ATOM   8474  C  C     . VAL C 2  621  ? 42.862  -19.224 97.907  1.00 46.44  ? 621  VAL C C     1 
ATOM   8475  O  O     . VAL C 2  621  ? 42.163  -19.072 98.910  1.00 48.02  ? 621  VAL C O     1 
ATOM   8476  C  CB    . VAL C 2  621  ? 42.370  -21.579 97.235  1.00 43.29  ? 621  VAL C CB    1 
ATOM   8477  C  CG1   . VAL C 2  621  ? 41.557  -21.067 96.056  1.00 40.50  ? 621  VAL C CG1   1 
ATOM   8478  C  CG2   . VAL C 2  621  ? 42.964  -22.940 96.927  1.00 48.38  ? 621  VAL C CG2   1 
ATOM   8479  N  N     . GLU C 2  622  ? 43.116  -18.244 97.046  1.00 30.57  ? 622  GLU C N     1 
ATOM   8480  C  CA    . GLU C 2  622  ? 42.686  -16.877 97.306  1.00 39.38  ? 622  GLU C CA    1 
ATOM   8481  C  C     . GLU C 2  622  ? 41.510  -16.463 96.430  1.00 43.19  ? 622  GLU C C     1 
ATOM   8482  O  O     . GLU C 2  622  ? 41.572  -16.542 95.202  1.00 44.83  ? 622  GLU C O     1 
ATOM   8483  C  CB    . GLU C 2  622  ? 43.854  -15.902 97.132  1.00 41.01  ? 622  GLU C CB    1 
ATOM   8484  C  CG    . GLU C 2  622  ? 43.488  -14.443 97.361  1.00 36.64  ? 622  GLU C CG    1 
ATOM   8485  C  CD    . GLU C 2  622  ? 44.707  -13.547 97.467  1.00 48.17  ? 622  GLU C CD    1 
ATOM   8486  O  OE1   . GLU C 2  622  ? 45.798  -14.063 97.791  1.00 58.71  ? 622  GLU C OE1   1 
ATOM   8487  O  OE2   . GLU C 2  622  ? 44.577  -12.328 97.227  1.00 45.21  ? 622  GLU C OE2   1 
ATOM   8488  N  N     . TYR C 2  623  ? 40.439  -16.018 97.077  1.00 38.93  ? 623  TYR C N     1 
ATOM   8489  C  CA    . TYR C 2  623  ? 39.241  -15.590 96.374  1.00 31.84  ? 623  TYR C CA    1 
ATOM   8490  C  C     . TYR C 2  623  ? 39.086  -14.077 96.438  1.00 34.02  ? 623  TYR C C     1 
ATOM   8491  O  O     . TYR C 2  623  ? 38.820  -13.519 97.504  1.00 35.06  ? 623  TYR C O     1 
ATOM   8492  C  CB    . TYR C 2  623  ? 38.005  -16.258 96.972  1.00 26.08  ? 623  TYR C CB    1 
ATOM   8493  C  CG    . TYR C 2  623  ? 38.012  -17.764 96.880  1.00 27.59  ? 623  TYR C CG    1 
ATOM   8494  C  CD1   . TYR C 2  623  ? 37.711  -18.406 95.688  1.00 30.86  ? 623  TYR C CD1   1 
ATOM   8495  C  CD2   . TYR C 2  623  ? 38.309  -18.545 97.987  1.00 34.39  ? 623  TYR C CD2   1 
ATOM   8496  C  CE1   . TYR C 2  623  ? 37.712  -19.783 95.599  1.00 35.06  ? 623  TYR C CE1   1 
ATOM   8497  C  CE2   . TYR C 2  623  ? 38.312  -19.924 97.909  1.00 36.77  ? 623  TYR C CE2   1 
ATOM   8498  C  CZ    . TYR C 2  623  ? 38.012  -20.539 96.713  1.00 39.44  ? 623  TYR C CZ    1 
ATOM   8499  O  OH    . TYR C 2  623  ? 38.013  -21.914 96.629  1.00 47.95  ? 623  TYR C OH    1 
ATOM   8500  N  N     . PRO C 2  624  ? 39.269  -13.405 95.295  1.00 31.44  ? 624  PRO C N     1 
ATOM   8501  C  CA    . PRO C 2  624  ? 38.969  -11.974 95.222  1.00 34.07  ? 624  PRO C CA    1 
ATOM   8502  C  C     . PRO C 2  624  ? 37.461  -11.752 95.246  1.00 32.01  ? 624  PRO C C     1 
ATOM   8503  O  O     . PRO C 2  624  ? 36.714  -12.523 94.643  1.00 30.41  ? 624  PRO C O     1 
ATOM   8504  C  CB    . PRO C 2  624  ? 39.549  -11.564 93.866  1.00 23.89  ? 624  PRO C CB    1 
ATOM   8505  C  CG    . PRO C 2  624  ? 39.541  -12.813 93.061  1.00 25.34  ? 624  PRO C CG    1 
ATOM   8506  C  CD    . PRO C 2  624  ? 39.813  -13.926 94.030  1.00 27.18  ? 624  PRO C CD    1 
ATOM   8507  N  N     . LEU C 2  625  ? 37.018  -10.713 95.944  1.00 34.40  ? 625  LEU C N     1 
ATOM   8508  C  CA    . LEU C 2  625  ? 35.597  -10.409 96.018  1.00 27.16  ? 625  LEU C CA    1 
ATOM   8509  C  C     . LEU C 2  625  ? 35.254  -9.262  95.079  1.00 30.08  ? 625  LEU C C     1 
ATOM   8510  O  O     . LEU C 2  625  ? 35.930  -8.233  95.067  1.00 29.48  ? 625  LEU C O     1 
ATOM   8511  C  CB    . LEU C 2  625  ? 35.198  -10.057 97.452  1.00 27.51  ? 625  LEU C CB    1 
ATOM   8512  C  CG    . LEU C 2  625  ? 35.483  -11.117 98.518  1.00 27.24  ? 625  LEU C CG    1 
ATOM   8513  C  CD1   . LEU C 2  625  ? 35.075  -10.621 99.894  1.00 24.74  ? 625  LEU C CD1   1 
ATOM   8514  C  CD2   . LEU C 2  625  ? 34.778  -12.421 98.188  1.00 26.11  ? 625  LEU C CD2   1 
ATOM   8515  N  N     . ARG C 2  626  ? 34.207  -9.450  94.284  1.00 30.06  ? 626  ARG C N     1 
ATOM   8516  C  CA    . ARG C 2  626  ? 33.720  -8.395  93.409  1.00 30.20  ? 626  ARG C CA    1 
ATOM   8517  C  C     . ARG C 2  626  ? 33.103  -7.304  94.271  1.00 31.41  ? 626  ARG C C     1 
ATOM   8518  O  O     . ARG C 2  626  ? 32.204  -7.571  95.065  1.00 30.98  ? 626  ARG C O     1 
ATOM   8519  C  CB    . ARG C 2  626  ? 32.685  -8.956  92.437  1.00 37.21  ? 626  ARG C CB    1 
ATOM   8520  C  CG    . ARG C 2  626  ? 32.004  -7.915  91.573  1.00 35.95  ? 626  ARG C CG    1 
ATOM   8521  C  CD    . ARG C 2  626  ? 31.155  -8.563  90.493  1.00 34.27  ? 626  ARG C CD    1 
ATOM   8522  N  NE    . ARG C 2  626  ? 31.935  -9.490  89.679  1.00 40.09  ? 626  ARG C NE    1 
ATOM   8523  C  CZ    . ARG C 2  626  ? 31.819  -10.813 89.729  1.00 41.61  ? 626  ARG C CZ    1 
ATOM   8524  N  NH1   . ARG C 2  626  ? 30.942  -11.376 90.551  1.00 36.48  ? 626  ARG C NH1   1 
ATOM   8525  N  NH2   . ARG C 2  626  ? 32.578  -11.573 88.950  1.00 43.07  ? 626  ARG C NH2   1 
ATOM   8526  N  N     . ARG C 2  627  ? 33.588  -6.077  94.113  1.00 32.79  ? 627  ARG C N     1 
ATOM   8527  C  CA    . ARG C 2  627  ? 33.208  -4.993  95.013  1.00 26.60  ? 627  ARG C CA    1 
ATOM   8528  C  C     . ARG C 2  627  ? 32.676  -3.752  94.309  1.00 25.60  ? 627  ARG C C     1 
ATOM   8529  O  O     . ARG C 2  627  ? 33.407  -3.065  93.597  1.00 31.15  ? 627  ARG C O     1 
ATOM   8530  C  CB    . ARG C 2  627  ? 34.385  -4.621  95.912  1.00 27.34  ? 627  ARG C CB    1 
ATOM   8531  C  CG    . ARG C 2  627  ? 34.503  -5.503  97.132  1.00 30.29  ? 627  ARG C CG    1 
ATOM   8532  C  CD    . ARG C 2  627  ? 33.222  -5.438  97.937  1.00 30.53  ? 627  ARG C CD    1 
ATOM   8533  N  NE    . ARG C 2  627  ? 33.370  -6.056  99.247  1.00 31.18  ? 627  ARG C NE    1 
ATOM   8534  C  CZ    . ARG C 2  627  ? 32.581  -5.794  100.282 1.00 31.83  ? 627  ARG C CZ    1 
ATOM   8535  N  NH1   . ARG C 2  627  ? 31.591  -4.919  100.157 1.00 26.09  ? 627  ARG C NH1   1 
ATOM   8536  N  NH2   . ARG C 2  627  ? 32.786  -6.402  101.442 1.00 36.62  ? 627  ARG C NH2   1 
ATOM   8537  N  N     . PHE C 2  628  ? 31.399  -3.472  94.546  1.00 24.23  ? 628  PHE C N     1 
ATOM   8538  C  CA    . PHE C 2  628  ? 30.699  -2.333  93.965  1.00 22.46  ? 628  PHE C CA    1 
ATOM   8539  C  C     . PHE C 2  628  ? 30.864  -2.259  92.454  1.00 27.53  ? 628  PHE C C     1 
ATOM   8540  O  O     . PHE C 2  628  ? 31.247  -1.226  91.907  1.00 29.99  ? 628  PHE C O     1 
ATOM   8541  C  CB    . PHE C 2  628  ? 31.140  -1.035  94.637  1.00 24.59  ? 628  PHE C CB    1 
ATOM   8542  C  CG    . PHE C 2  628  ? 30.955  -1.041  96.126  1.00 29.78  ? 628  PHE C CG    1 
ATOM   8543  C  CD1   . PHE C 2  628  ? 29.710  -0.808  96.683  1.00 26.56  ? 628  PHE C CD1   1 
ATOM   8544  C  CD2   . PHE C 2  628  ? 32.023  -1.296  96.968  1.00 26.33  ? 628  PHE C CD2   1 
ATOM   8545  C  CE1   . PHE C 2  628  ? 29.537  -0.820  98.052  1.00 22.76  ? 628  PHE C CE1   1 
ATOM   8546  C  CE2   . PHE C 2  628  ? 31.855  -1.306  98.338  1.00 20.74  ? 628  PHE C CE2   1 
ATOM   8547  C  CZ    . PHE C 2  628  ? 30.610  -1.067  98.880  1.00 19.91  ? 628  PHE C CZ    1 
ATOM   8548  N  N     . TYR C 2  629  ? 30.582  -3.378  91.794  1.00 26.19  ? 629  TYR C N     1 
ATOM   8549  C  CA    . TYR C 2  629  ? 30.579  -3.450  90.341  1.00 29.41  ? 629  TYR C CA    1 
ATOM   8550  C  C     . TYR C 2  629  ? 29.206  -3.062  89.812  1.00 23.59  ? 629  TYR C C     1 
ATOM   8551  O  O     . TYR C 2  629  ? 28.187  -3.366  90.434  1.00 20.30  ? 629  TYR C O     1 
ATOM   8552  C  CB    . TYR C 2  629  ? 30.941  -4.862  89.871  1.00 35.95  ? 629  TYR C CB    1 
ATOM   8553  C  CG    . TYR C 2  629  ? 32.424  -5.096  89.655  1.00 48.53  ? 629  TYR C CG    1 
ATOM   8554  C  CD1   . TYR C 2  629  ? 33.340  -4.900  90.684  1.00 49.03  ? 629  TYR C CD1   1 
ATOM   8555  C  CD2   . TYR C 2  629  ? 32.906  -5.531  88.425  1.00 55.50  ? 629  TYR C CD2   1 
ATOM   8556  C  CE1   . TYR C 2  629  ? 34.697  -5.122  90.489  1.00 55.28  ? 629  TYR C CE1   1 
ATOM   8557  C  CE2   . TYR C 2  629  ? 34.260  -5.755  88.222  1.00 63.22  ? 629  TYR C CE2   1 
ATOM   8558  C  CZ    . TYR C 2  629  ? 35.150  -5.549  89.256  1.00 58.70  ? 629  TYR C CZ    1 
ATOM   8559  O  OH    . TYR C 2  629  ? 36.494  -5.770  89.057  1.00 50.28  ? 629  TYR C OH    1 
ATOM   8560  N  N     . ARG C 2  630  ? 29.184  -2.382  88.669  1.00 26.34  ? 630  ARG C N     1 
ATOM   8561  C  CA    . ARG C 2  630  ? 27.931  -1.977  88.039  1.00 19.49  ? 630  ARG C CA    1 
ATOM   8562  C  C     . ARG C 2  630  ? 27.390  -3.059  87.110  1.00 16.23  ? 630  ARG C C     1 
ATOM   8563  O  O     . ARG C 2  630  ? 28.107  -3.562  86.248  1.00 24.27  ? 630  ARG C O     1 
ATOM   8564  C  CB    . ARG C 2  630  ? 28.120  -0.675  87.259  1.00 15.29  ? 630  ARG C CB    1 
ATOM   8565  C  CG    . ARG C 2  630  ? 26.913  -0.272  86.440  1.00 14.58  ? 630  ARG C CG    1 
ATOM   8566  C  CD    . ARG C 2  630  ? 27.252  0.818   85.443  1.00 14.37  ? 630  ARG C CD    1 
ATOM   8567  N  NE    . ARG C 2  630  ? 26.651  0.541   84.144  1.00 15.04  ? 630  ARG C NE    1 
ATOM   8568  C  CZ    . ARG C 2  630  ? 25.439  0.946   83.784  1.00 21.89  ? 630  ARG C CZ    1 
ATOM   8569  N  NH1   . ARG C 2  630  ? 24.702  1.658   84.626  1.00 23.74  ? 630  ARG C NH1   1 
ATOM   8570  N  NH2   . ARG C 2  630  ? 24.966  0.642   82.580  1.00 19.40  ? 630  ARG C NH2   1 
ATOM   8571  N  N     . SER C 2  631  ? 26.122  -3.411  87.290  1.00 15.20  ? 631  SER C N     1 
ATOM   8572  C  CA    . SER C 2  631  ? 25.463  -4.382  86.425  1.00 17.68  ? 631  SER C CA    1 
ATOM   8573  C  C     . SER C 2  631  ? 24.865  -3.690  85.204  1.00 21.72  ? 631  SER C C     1 
ATOM   8574  O  O     . SER C 2  631  ? 24.945  -2.467  85.071  1.00 19.40  ? 631  SER C O     1 
ATOM   8575  C  CB    . SER C 2  631  ? 24.351  -5.100  87.188  1.00 21.58  ? 631  SER C CB    1 
ATOM   8576  O  OG    . SER C 2  631  ? 23.259  -4.226  87.426  1.00 20.07  ? 631  SER C OG    1 
ATOM   8577  N  N     . ASN C 2  632  ? 24.251  -4.477  84.324  1.00 18.88  ? 632  ASN C N     1 
ATOM   8578  C  CA    . ASN C 2  632  ? 23.612  -3.940  83.127  1.00 16.83  ? 632  ASN C CA    1 
ATOM   8579  C  C     . ASN C 2  632  ? 22.537  -2.917  83.466  1.00 17.41  ? 632  ASN C C     1 
ATOM   8580  O  O     . ASN C 2  632  ? 22.338  -1.948  82.736  1.00 20.21  ? 632  ASN C O     1 
ATOM   8581  C  CB    . ASN C 2  632  ? 22.992  -5.065  82.293  1.00 22.12  ? 632  ASN C CB    1 
ATOM   8582  C  CG    . ASN C 2  632  ? 23.997  -5.752  81.388  1.00 18.33  ? 632  ASN C CG    1 
ATOM   8583  O  OD1   . ASN C 2  632  ? 25.106  -5.261  81.181  1.00 21.96  ? 632  ASN C OD1   1 
ATOM   8584  N  ND2   . ASN C 2  632  ? 23.604  -6.892  80.829  1.00 16.94  ? 632  ASN C ND2   1 
ATOM   8585  N  N     . GLN C 2  633  ? 21.844  -3.144  84.576  1.00 16.38  ? 633  GLN C N     1 
ATOM   8586  C  CA    . GLN C 2  633  ? 20.744  -2.278  84.984  1.00 14.68  ? 633  GLN C CA    1 
ATOM   8587  C  C     . GLN C 2  633  ? 21.203  -1.205  85.963  1.00 15.39  ? 633  GLN C C     1 
ATOM   8588  O  O     . GLN C 2  633  ? 20.397  -0.423  86.470  1.00 11.80  ? 633  GLN C O     1 
ATOM   8589  C  CB    . GLN C 2  633  ? 19.600  -3.099  85.581  1.00 13.02  ? 633  GLN C CB    1 
ATOM   8590  C  CG    . GLN C 2  633  ? 18.741  -3.816  84.550  1.00 11.93  ? 633  GLN C CG    1 
ATOM   8591  C  CD    . GLN C 2  633  ? 19.515  -4.831  83.730  1.00 13.74  ? 633  GLN C CD    1 
ATOM   8592  O  OE1   . GLN C 2  633  ? 20.240  -5.667  84.272  1.00 13.81  ? 633  GLN C OE1   1 
ATOM   8593  N  NE2   . GLN C 2  633  ? 19.369  -4.758  82.413  1.00 16.25  ? 633  GLN C NE2   1 
ATOM   8594  N  N     . GLY C 2  634  ? 22.503  -1.176  86.233  1.00 13.78  ? 634  GLY C N     1 
ATOM   8595  C  CA    . GLY C 2  634  ? 23.065  -0.157  87.095  1.00 14.88  ? 634  GLY C CA    1 
ATOM   8596  C  C     . GLY C 2  634  ? 22.925  -0.478  88.568  1.00 17.22  ? 634  GLY C C     1 
ATOM   8597  O  O     . GLY C 2  634  ? 23.231  0.354   89.421  1.00 18.70  ? 634  GLY C O     1 
ATOM   8598  N  N     . THR C 2  635  ? 22.454  -1.682  88.874  1.00 15.78  ? 635  THR C N     1 
ATOM   8599  C  CA    . THR C 2  635  ? 22.400  -2.127  90.257  1.00 14.45  ? 635  THR C CA    1 
ATOM   8600  C  C     . THR C 2  635  ? 23.801  -2.528  90.682  1.00 19.56  ? 635  THR C C     1 
ATOM   8601  O  O     . THR C 2  635  ? 24.565  -3.066  89.883  1.00 25.18  ? 635  THR C O     1 
ATOM   8602  C  CB    . THR C 2  635  ? 21.423  -3.301  90.455  1.00 12.68  ? 635  THR C CB    1 
ATOM   8603  O  OG1   . THR C 2  635  ? 21.695  -4.329  89.495  1.00 12.86  ? 635  THR C OG1   1 
ATOM   8604  C  CG2   . THR C 2  635  ? 19.993  -2.829  90.278  1.00 15.10  ? 635  THR C CG2   1 
ATOM   8605  N  N     . ALA C 2  636  ? 24.150  -2.247  91.932  1.00 21.44  ? 636  ALA C N     1 
ATOM   8606  C  CA    . ALA C 2  636  ? 25.485  -2.560  92.424  1.00 21.18  ? 636  ALA C CA    1 
ATOM   8607  C  C     . ALA C 2  636  ? 25.596  -4.028  92.810  1.00 20.68  ? 636  ALA C C     1 
ATOM   8608  O  O     . ALA C 2  636  ? 24.841  -4.518  93.648  1.00 20.67  ? 636  ALA C O     1 
ATOM   8609  C  CB    . ALA C 2  636  ? 25.841  -1.673  93.598  1.00 17.13  ? 636  ALA C CB    1 
ATOM   8610  N  N     . LEU C 2  637  ? 26.538  -4.727  92.188  1.00 24.65  ? 637  LEU C N     1 
ATOM   8611  C  CA    . LEU C 2  637  ? 26.796  -6.118  92.526  1.00 25.02  ? 637  LEU C CA    1 
ATOM   8612  C  C     . LEU C 2  637  ? 28.094  -6.205  93.314  1.00 28.33  ? 637  LEU C C     1 
ATOM   8613  O  O     . LEU C 2  637  ? 29.174  -6.021  92.755  1.00 29.77  ? 637  LEU C O     1 
ATOM   8614  C  CB    . LEU C 2  637  ? 26.919  -6.959  91.257  1.00 20.90  ? 637  LEU C CB    1 
ATOM   8615  C  CG    . LEU C 2  637  ? 25.817  -6.807  90.207  1.00 31.95  ? 637  LEU C CG    1 
ATOM   8616  C  CD1   . LEU C 2  637  ? 26.077  -7.745  89.036  1.00 25.29  ? 637  LEU C CD1   1 
ATOM   8617  C  CD2   . LEU C 2  637  ? 24.430  -7.045  90.807  1.00 27.56  ? 637  LEU C CD2   1 
ATOM   8618  N  N     . ASP C 2  638  ? 27.994  -6.487  94.609  1.00 27.03  ? 638  ASP C N     1 
ATOM   8619  C  CA    . ASP C 2  638  ? 29.194  -6.641  95.422  1.00 33.42  ? 638  ASP C CA    1 
ATOM   8620  C  C     . ASP C 2  638  ? 29.102  -7.785  96.421  1.00 31.92  ? 638  ASP C C     1 
ATOM   8621  O  O     . ASP C 2  638  ? 28.035  -8.086  96.957  1.00 30.94  ? 638  ASP C O     1 
ATOM   8622  C  CB    . ASP C 2  638  ? 29.583  -5.334  96.122  1.00 30.84  ? 638  ASP C CB    1 
ATOM   8623  C  CG    . ASP C 2  638  ? 28.708  -5.016  97.305  1.00 36.04  ? 638  ASP C CG    1 
ATOM   8624  O  OD1   . ASP C 2  638  ? 27.499  -5.320  97.256  1.00 50.02  ? 638  ASP C OD1   1 
ATOM   8625  O  OD2   . ASP C 2  638  ? 29.237  -4.452  98.285  1.00 35.28  ? 638  ASP C OD2   1 
ATOM   8626  N  N     . GLN C 2  639  ? 30.242  -8.419  96.656  1.00 29.51  ? 639  GLN C N     1 
ATOM   8627  C  CA    . GLN C 2  639  ? 30.312  -9.575  97.528  1.00 28.53  ? 639  GLN C CA    1 
ATOM   8628  C  C     . GLN C 2  639  ? 30.942  -9.181  98.854  1.00 29.43  ? 639  GLN C C     1 
ATOM   8629  O  O     . GLN C 2  639  ? 31.948  -8.474  98.883  1.00 32.97  ? 639  GLN C O     1 
ATOM   8630  C  CB    . GLN C 2  639  ? 31.128  -10.678 96.855  1.00 27.27  ? 639  GLN C CB    1 
ATOM   8631  C  CG    . GLN C 2  639  ? 30.620  -11.049 95.467  1.00 28.50  ? 639  GLN C CG    1 
ATOM   8632  C  CD    . GLN C 2  639  ? 31.569  -11.962 94.717  1.00 32.29  ? 639  GLN C CD    1 
ATOM   8633  O  OE1   . GLN C 2  639  ? 32.673  -11.560 94.348  1.00 34.50  ? 639  GLN C OE1   1 
ATOM   8634  N  NE2   . GLN C 2  639  ? 31.145  -13.199 94.488  1.00 32.50  ? 639  GLN C NE2   1 
ATOM   8635  N  N     . ARG C 2  640  ? 30.344  -9.631  99.951  1.00 28.75  ? 640  ARG C N     1 
ATOM   8636  C  CA    . ARG C 2  640  ? 30.883  -9.339  101.270 1.00 27.71  ? 640  ARG C CA    1 
ATOM   8637  C  C     . ARG C 2  640  ? 31.240  -10.644 101.964 1.00 30.34  ? 640  ARG C C     1 
ATOM   8638  O  O     . ARG C 2  640  ? 30.503  -11.624 101.860 1.00 29.16  ? 640  ARG C O     1 
ATOM   8639  C  CB    . ARG C 2  640  ? 29.860  -8.566  102.109 1.00 25.70  ? 640  ARG C CB    1 
ATOM   8640  C  CG    . ARG C 2  640  ? 29.613  -7.133  101.649 1.00 27.39  ? 640  ARG C CG    1 
ATOM   8641  C  CD    . ARG C 2  640  ? 28.486  -7.026  100.626 1.00 35.00  ? 640  ARG C CD    1 
ATOM   8642  N  NE    . ARG C 2  640  ? 27.204  -6.709  101.255 1.00 39.92  ? 640  ARG C NE    1 
ATOM   8643  C  CZ    . ARG C 2  640  ? 26.174  -7.546  101.326 1.00 32.55  ? 640  ARG C CZ    1 
ATOM   8644  N  NH1   . ARG C 2  640  ? 26.262  -8.760  100.797 1.00 27.63  ? 640  ARG C NH1   1 
ATOM   8645  N  NH2   . ARG C 2  640  ? 25.052  -7.165  101.922 1.00 28.46  ? 640  ARG C NH2   1 
ATOM   8646  N  N     . PRO C 2  641  ? 32.372  -10.658 102.687 1.00 26.84  ? 641  PRO C N     1 
ATOM   8647  C  CA    . PRO C 2  641  ? 32.794  -11.875 103.382 1.00 21.49  ? 641  PRO C CA    1 
ATOM   8648  C  C     . PRO C 2  641  ? 31.861  -12.199 104.540 1.00 26.14  ? 641  PRO C C     1 
ATOM   8649  O  O     . PRO C 2  641  ? 31.580  -11.330 105.363 1.00 22.68  ? 641  PRO C O     1 
ATOM   8650  C  CB    . PRO C 2  641  ? 34.183  -11.510 103.906 1.00 27.17  ? 641  PRO C CB    1 
ATOM   8651  C  CG    . PRO C 2  641  ? 34.167  -10.026 104.021 1.00 25.59  ? 641  PRO C CG    1 
ATOM   8652  C  CD    . PRO C 2  641  ? 33.303  -9.538  102.903 1.00 26.25  ? 641  PRO C CD    1 
ATOM   8653  N  N     . ARG C 2  642  ? 31.375  -13.435 104.584 1.00 30.39  ? 642  ARG C N     1 
ATOM   8654  C  CA    . ARG C 2  642  ? 30.532  -13.900 105.682 1.00 28.46  ? 642  ARG C CA    1 
ATOM   8655  C  C     . ARG C 2  642  ? 31.274  -14.754 106.719 1.00 29.57  ? 642  ARG C C     1 
ATOM   8656  O  O     . ARG C 2  642  ? 30.673  -15.242 107.679 1.00 23.47  ? 642  ARG C O     1 
ATOM   8657  C  CB    . ARG C 2  642  ? 29.290  -14.613 105.141 1.00 27.11  ? 642  ARG C CB    1 
ATOM   8658  C  CG    . ARG C 2  642  ? 28.290  -13.656 104.509 1.00 22.02  ? 642  ARG C CG    1 
ATOM   8659  C  CD    . ARG C 2  642  ? 27.816  -12.637 105.535 1.00 23.57  ? 642  ARG C CD    1 
ATOM   8660  N  NE    . ARG C 2  642  ? 27.066  -11.532 104.942 1.00 25.31  ? 642  ARG C NE    1 
ATOM   8661  C  CZ    . ARG C 2  642  ? 27.519  -10.286 104.844 1.00 22.95  ? 642  ARG C CZ    1 
ATOM   8662  N  NH1   . ARG C 2  642  ? 28.724  -9.976  105.300 1.00 25.45  ? 642  ARG C NH1   1 
ATOM   8663  N  NH2   . ARG C 2  642  ? 26.766  -9.344  104.293 1.00 25.77  ? 642  ARG C NH2   1 
ATOM   8664  N  N     . VAL C 2  643  ? 32.576  -14.938 106.515 1.00 31.53  ? 643  VAL C N     1 
ATOM   8665  C  CA    . VAL C 2  643  ? 33.382  -15.753 107.418 1.00 33.34  ? 643  VAL C CA    1 
ATOM   8666  C  C     . VAL C 2  643  ? 34.409  -14.907 108.158 1.00 32.93  ? 643  VAL C C     1 
ATOM   8667  O  O     . VAL C 2  643  ? 34.522  -13.705 107.923 1.00 33.47  ? 643  VAL C O     1 
ATOM   8668  C  CB    . VAL C 2  643  ? 34.124  -16.869 106.662 1.00 26.10  ? 643  VAL C CB    1 
ATOM   8669  C  CG1   . VAL C 2  643  ? 33.136  -17.800 105.986 1.00 25.22  ? 643  VAL C CG1   1 
ATOM   8670  C  CG2   . VAL C 2  643  ? 35.080  -16.272 105.645 1.00 27.91  ? 643  VAL C CG2   1 
ATOM   8671  N  N     . VAL C 2  644  ? 35.165  -15.544 109.046 1.00 35.71  ? 644  VAL C N     1 
ATOM   8672  C  CA    . VAL C 2  644  ? 36.183  -14.845 109.823 1.00 39.01  ? 644  VAL C CA    1 
ATOM   8673  C  C     . VAL C 2  644  ? 37.481  -15.633 109.866 1.00 37.11  ? 644  VAL C C     1 
ATOM   8674  O  O     . VAL C 2  644  ? 37.508  -16.821 109.544 1.00 37.97  ? 644  VAL C O     1 
ATOM   8675  C  CB    . VAL C 2  644  ? 35.720  -14.582 111.266 1.00 37.36  ? 644  VAL C CB    1 
ATOM   8676  C  CG1   . VAL C 2  644  ? 34.702  -13.450 111.304 1.00 34.14  ? 644  VAL C CG1   1 
ATOM   8677  C  CG2   . VAL C 2  644  ? 35.156  -15.856 111.880 1.00 37.73  ? 644  VAL C CG2   1 
ATOM   8678  N  N     . VAL C 2  645  ? 38.554  -14.961 110.271 1.00 39.69  ? 645  VAL C N     1 
ATOM   8679  C  CA    . VAL C 2  645  ? 39.868  -15.584 110.347 1.00 40.13  ? 645  VAL C CA    1 
ATOM   8680  C  C     . VAL C 2  645  ? 39.874  -16.706 111.375 1.00 36.63  ? 645  VAL C C     1 
ATOM   8681  O  O     . VAL C 2  645  ? 39.455  -16.516 112.516 1.00 34.66  ? 645  VAL C O     1 
ATOM   8682  C  CB    . VAL C 2  645  ? 40.957  -14.558 110.709 1.00 36.69  ? 645  VAL C CB    1 
ATOM   8683  C  CG1   . VAL C 2  645  ? 42.334  -15.201 110.648 1.00 34.40  ? 645  VAL C CG1   1 
ATOM   8684  C  CG2   . VAL C 2  645  ? 40.884  -13.361 109.773 1.00 38.91  ? 645  VAL C CG2   1 
ATOM   8685  N  N     . GLY C 2  646  ? 40.337  -17.880 110.959 1.00 37.81  ? 646  GLY C N     1 
ATOM   8686  C  CA    . GLY C 2  646  ? 40.438  -19.019 111.852 1.00 41.19  ? 646  GLY C CA    1 
ATOM   8687  C  C     . GLY C 2  646  ? 39.232  -19.935 111.805 1.00 45.53  ? 646  GLY C C     1 
ATOM   8688  O  O     . GLY C 2  646  ? 39.248  -21.026 112.375 1.00 53.27  ? 646  GLY C O     1 
ATOM   8689  N  N     . GLN C 2  647  ? 38.181  -19.496 111.123 1.00 48.14  ? 647  GLN C N     1 
ATOM   8690  C  CA    . GLN C 2  647  ? 36.965  -20.291 111.024 1.00 45.12  ? 647  GLN C CA    1 
ATOM   8691  C  C     . GLN C 2  647  ? 37.189  -21.544 110.187 1.00 42.48  ? 647  GLN C C     1 
ATOM   8692  O  O     . GLN C 2  647  ? 37.757  -21.479 109.098 1.00 45.90  ? 647  GLN C O     1 
ATOM   8693  C  CB    . GLN C 2  647  ? 35.824  -19.459 110.434 1.00 42.23  ? 647  GLN C CB    1 
ATOM   8694  C  CG    . GLN C 2  647  ? 34.551  -20.250 110.188 1.00 43.49  ? 647  GLN C CG    1 
ATOM   8695  C  CD    . GLN C 2  647  ? 33.386  -19.370 109.795 1.00 40.83  ? 647  GLN C CD    1 
ATOM   8696  O  OE1   . GLN C 2  647  ? 33.399  -18.161 110.031 1.00 39.28  ? 647  GLN C OE1   1 
ATOM   8697  N  NE2   . GLN C 2  647  ? 32.368  -19.972 109.188 1.00 39.57  ? 647  GLN C NE2   1 
ATOM   8698  N  N     . ARG C 2  648  ? 36.750  -22.686 110.707 1.00 40.58  ? 648  ARG C N     1 
ATOM   8699  C  CA    . ARG C 2  648  ? 36.786  -23.924 109.942 1.00 49.34  ? 648  ARG C CA    1 
ATOM   8700  C  C     . ARG C 2  648  ? 35.584  -23.976 109.013 1.00 45.61  ? 648  ARG C C     1 
ATOM   8701  O  O     . ARG C 2  648  ? 34.455  -23.727 109.434 1.00 52.82  ? 648  ARG C O     1 
ATOM   8702  C  CB    . ARG C 2  648  ? 36.761  -25.141 110.866 1.00 53.78  ? 648  ARG C CB    1 
ATOM   8703  C  CG    . ARG C 2  648  ? 37.951  -25.267 111.793 1.00 69.51  ? 648  ARG C CG    1 
ATOM   8704  C  CD    . ARG C 2  648  ? 37.831  -26.535 112.622 1.00 93.61  ? 648  ARG C CD    1 
ATOM   8705  N  NE    . ARG C 2  648  ? 38.812  -26.593 113.701 1.00 111.03 ? 648  ARG C NE    1 
ATOM   8706  C  CZ    . ARG C 2  648  ? 38.865  -27.565 114.605 1.00 105.81 ? 648  ARG C CZ    1 
ATOM   8707  N  NH1   . ARG C 2  648  ? 37.992  -28.563 114.561 1.00 93.50  ? 648  ARG C NH1   1 
ATOM   8708  N  NH2   . ARG C 2  648  ? 39.791  -27.540 115.555 1.00 103.87 ? 648  ARG C NH2   1 
ATOM   8709  N  N     . VAL C 2  649  ? 35.823  -24.303 107.749 1.00 39.59  ? 649  VAL C N     1 
ATOM   8710  C  CA    . VAL C 2  649  ? 34.737  -24.417 106.787 1.00 40.24  ? 649  VAL C CA    1 
ATOM   8711  C  C     . VAL C 2  649  ? 34.722  -25.786 106.115 1.00 47.07  ? 649  VAL C C     1 
ATOM   8712  O  O     . VAL C 2  649  ? 35.739  -26.253 105.603 1.00 52.36  ? 649  VAL C O     1 
ATOM   8713  C  CB    . VAL C 2  649  ? 34.793  -23.300 105.721 1.00 45.52  ? 649  VAL C CB    1 
ATOM   8714  C  CG1   . VAL C 2  649  ? 34.390  -21.963 106.333 1.00 45.42  ? 649  VAL C CG1   1 
ATOM   8715  C  CG2   . VAL C 2  649  ? 36.180  -23.213 105.097 1.00 39.63  ? 649  VAL C CG2   1 
ATOM   8716  N  N     . ARG C 2  650  ? 33.564  -26.435 106.140 1.00 47.21  ? 650  ARG C N     1 
ATOM   8717  C  CA    . ARG C 2  650  ? 33.387  -27.697 105.439 1.00 40.42  ? 650  ARG C CA    1 
ATOM   8718  C  C     . ARG C 2  650  ? 33.108  -27.409 103.973 1.00 43.52  ? 650  ARG C C     1 
ATOM   8719  O  O     . ARG C 2  650  ? 33.042  -26.250 103.568 1.00 48.69  ? 650  ARG C O     1 
ATOM   8720  C  CB    . ARG C 2  650  ? 32.244  -28.499 106.061 1.00 48.20  ? 650  ARG C CB    1 
ATOM   8721  C  CG    . ARG C 2  650  ? 32.567  -29.062 107.437 1.00 52.54  ? 650  ARG C CG    1 
ATOM   8722  C  CD    . ARG C 2  650  ? 31.316  -29.553 108.148 1.00 61.44  ? 650  ARG C CD    1 
ATOM   8723  N  NE    . ARG C 2  650  ? 31.635  -30.369 109.318 1.00 78.64  ? 650  ARG C NE    1 
ATOM   8724  C  CZ    . ARG C 2  650  ? 31.869  -29.886 110.535 1.00 66.68  ? 650  ARG C CZ    1 
ATOM   8725  N  NH1   . ARG C 2  650  ? 31.828  -28.579 110.759 1.00 54.53  ? 650  ARG C NH1   1 
ATOM   8726  N  NH2   . ARG C 2  650  ? 32.147  -30.715 111.532 1.00 59.71  ? 650  ARG C NH2   1 
ATOM   8727  N  N     . LYS C 2  651  ? 32.945  -28.457 103.176 1.00 50.64  ? 651  LYS C N     1 
ATOM   8728  C  CA    . LYS C 2  651  ? 32.701  -28.277 101.751 1.00 50.98  ? 651  LYS C CA    1 
ATOM   8729  C  C     . LYS C 2  651  ? 31.320  -27.671 101.519 1.00 54.13  ? 651  LYS C C     1 
ATOM   8730  O  O     . LYS C 2  651  ? 30.365  -27.985 102.233 1.00 50.49  ? 651  LYS C O     1 
ATOM   8731  C  CB    . LYS C 2  651  ? 32.835  -29.605 101.006 1.00 43.76  ? 651  LYS C CB    1 
ATOM   8732  C  CG    . LYS C 2  651  ? 32.878  -29.468 99.497  1.00 40.49  ? 651  LYS C CG    1 
ATOM   8733  C  CD    . LYS C 2  651  ? 32.870  -30.826 98.818  1.00 49.90  ? 651  LYS C CD    1 
ATOM   8734  C  CE    . LYS C 2  651  ? 33.021  -30.687 97.313  1.00 56.66  ? 651  LYS C CE    1 
ATOM   8735  N  NZ    . LYS C 2  651  ? 34.277  -29.969 96.954  1.00 52.73  ? 651  LYS C NZ    1 
ATOM   8736  N  N     . GLY C 2  652  ? 31.223  -26.790 100.528 1.00 47.45  ? 652  GLY C N     1 
ATOM   8737  C  CA    . GLY C 2  652  ? 29.961  -26.161 100.186 1.00 42.20  ? 652  GLY C CA    1 
ATOM   8738  C  C     . GLY C 2  652  ? 29.489  -25.151 101.215 1.00 45.57  ? 652  GLY C C     1 
ATOM   8739  O  O     . GLY C 2  652  ? 28.326  -24.746 101.208 1.00 47.30  ? 652  GLY C O     1 
ATOM   8740  N  N     . ASP C 2  653  ? 30.389  -24.750 102.107 1.00 49.74  ? 653  ASP C N     1 
ATOM   8741  C  CA    . ASP C 2  653  ? 30.082  -23.715 103.089 1.00 46.01  ? 653  ASP C CA    1 
ATOM   8742  C  C     . ASP C 2  653  ? 30.128  -22.337 102.441 1.00 39.81  ? 653  ASP C C     1 
ATOM   8743  O  O     . ASP C 2  653  ? 30.815  -22.136 101.438 1.00 37.83  ? 653  ASP C O     1 
ATOM   8744  C  CB    . ASP C 2  653  ? 31.057  -23.774 104.267 1.00 42.18  ? 653  ASP C CB    1 
ATOM   8745  C  CG    . ASP C 2  653  ? 30.547  -24.637 105.405 1.00 47.60  ? 653  ASP C CG    1 
ATOM   8746  O  OD1   . ASP C 2  653  ? 31.032  -24.463 106.545 1.00 43.55  ? 653  ASP C OD1   1 
ATOM   8747  O  OD2   . ASP C 2  653  ? 29.659  -25.482 105.160 1.00 44.16  ? 653  ASP C OD2   1 
ATOM   8748  N  N     . LEU C 2  654  ? 29.400  -21.387 103.018 1.00 32.47  ? 654  LEU C N     1 
ATOM   8749  C  CA    . LEU C 2  654  ? 29.359  -20.041 102.471 1.00 27.60  ? 654  LEU C CA    1 
ATOM   8750  C  C     . LEU C 2  654  ? 30.596  -19.253 102.878 1.00 29.48  ? 654  LEU C C     1 
ATOM   8751  O  O     . LEU C 2  654  ? 30.839  -19.037 104.064 1.00 27.26  ? 654  LEU C O     1 
ATOM   8752  C  CB    . LEU C 2  654  ? 28.114  -19.310 102.969 1.00 22.32  ? 654  LEU C CB    1 
ATOM   8753  C  CG    . LEU C 2  654  ? 28.023  -17.839 102.563 1.00 20.85  ? 654  LEU C CG    1 
ATOM   8754  C  CD1   . LEU C 2  654  ? 27.691  -17.728 101.087 1.00 23.75  ? 654  LEU C CD1   1 
ATOM   8755  C  CD2   . LEU C 2  654  ? 27.005  -17.098 103.409 1.00 19.13  ? 654  LEU C CD2   1 
ATOM   8756  N  N     . LEU C 2  655  ? 31.391  -18.849 101.891 1.00 28.91  ? 655  LEU C N     1 
ATOM   8757  C  CA    . LEU C 2  655  ? 32.478  -17.902 102.124 1.00 27.84  ? 655  LEU C CA    1 
ATOM   8758  C  C     . LEU C 2  655  ? 32.034  -16.437 102.080 1.00 24.70  ? 655  LEU C C     1 
ATOM   8759  O  O     . LEU C 2  655  ? 32.451  -15.632 102.913 1.00 22.24  ? 655  LEU C O     1 
ATOM   8760  C  CB    . LEU C 2  655  ? 33.631  -18.150 101.151 1.00 31.51  ? 655  LEU C CB    1 
ATOM   8761  C  CG    . LEU C 2  655  ? 34.404  -19.442 101.418 1.00 33.77  ? 655  LEU C CG    1 
ATOM   8762  C  CD1   . LEU C 2  655  ? 35.462  -19.670 100.355 1.00 34.30  ? 655  LEU C CD1   1 
ATOM   8763  C  CD2   . LEU C 2  655  ? 35.030  -19.395 102.801 1.00 32.90  ? 655  LEU C CD2   1 
ATOM   8764  N  N     . ALA C 2  656  ? 31.196  -16.093 101.103 1.00 29.76  ? 656  ALA C N     1 
ATOM   8765  C  CA    . ALA C 2  656  ? 30.775  -14.703 100.919 1.00 30.32  ? 656  ALA C CA    1 
ATOM   8766  C  C     . ALA C 2  656  ? 29.381  -14.543 100.310 1.00 27.40  ? 656  ALA C C     1 
ATOM   8767  O  O     . ALA C 2  656  ? 28.992  -15.291 99.415  1.00 24.77  ? 656  ALA C O     1 
ATOM   8768  C  CB    . ALA C 2  656  ? 31.802  -13.947 100.082 1.00 27.57  ? 656  ALA C CB    1 
ATOM   8769  N  N     . ASP C 2  657  ? 28.652  -13.540 100.792 1.00 27.64  ? 657  ASP C N     1 
ATOM   8770  C  CA    . ASP C 2  657  ? 27.340  -13.187 100.257 1.00 20.53  ? 657  ASP C CA    1 
ATOM   8771  C  C     . ASP C 2  657  ? 27.485  -12.232 99.085  1.00 25.01  ? 657  ASP C C     1 
ATOM   8772  O  O     . ASP C 2  657  ? 28.148  -11.201 99.199  1.00 24.60  ? 657  ASP C O     1 
ATOM   8773  C  CB    . ASP C 2  657  ? 26.500  -12.486 101.325 1.00 20.21  ? 657  ASP C CB    1 
ATOM   8774  C  CG    . ASP C 2  657  ? 25.642  -13.439 102.119 1.00 20.32  ? 657  ASP C CG    1 
ATOM   8775  O  OD1   . ASP C 2  657  ? 25.259  -14.500 101.583 1.00 20.85  ? 657  ASP C OD1   1 
ATOM   8776  O  OD2   . ASP C 2  657  ? 25.337  -13.113 103.283 1.00 20.31  ? 657  ASP C OD2   1 
ATOM   8777  N  N     . GLY C 2  658  ? 26.850  -12.562 97.966  1.00 25.98  ? 658  GLY C N     1 
ATOM   8778  C  CA    . GLY C 2  658  ? 26.794  -11.647 96.842  1.00 25.67  ? 658  GLY C CA    1 
ATOM   8779  C  C     . GLY C 2  658  ? 25.616  -10.705 96.998  1.00 24.93  ? 658  GLY C C     1 
ATOM   8780  O  O     . GLY C 2  658  ? 25.089  -10.545 98.102  1.00 22.72  ? 658  GLY C O     1 
ATOM   8781  N  N     . PRO C 2  659  ? 25.188  -10.079 95.891  1.00 30.08  ? 659  PRO C N     1 
ATOM   8782  C  CA    . PRO C 2  659  ? 24.040  -9.165  95.907  1.00 17.32  ? 659  PRO C CA    1 
ATOM   8783  C  C     . PRO C 2  659  ? 22.742  -9.893  96.239  1.00 14.06  ? 659  PRO C C     1 
ATOM   8784  O  O     . PRO C 2  659  ? 22.543  -11.023 95.793  1.00 14.87  ? 659  PRO C O     1 
ATOM   8785  C  CB    . PRO C 2  659  ? 23.996  -8.639  94.469  1.00 19.24  ? 659  PRO C CB    1 
ATOM   8786  C  CG    . PRO C 2  659  ? 24.667  -9.697  93.655  1.00 17.75  ? 659  PRO C CG    1 
ATOM   8787  C  CD    . PRO C 2  659  ? 25.750  -10.241 94.538  1.00 26.38  ? 659  PRO C CD    1 
ATOM   8788  N  N     . ALA C 2  660  ? 21.879  -9.248  97.018  1.00 13.92  ? 660  ALA C N     1 
ATOM   8789  C  CA    . ALA C 2  660  ? 20.574  -9.803  97.371  1.00 12.45  ? 660  ALA C CA    1 
ATOM   8790  C  C     . ALA C 2  660  ? 20.675  -11.165 98.056  1.00 14.69  ? 660  ALA C C     1 
ATOM   8791  O  O     . ALA C 2  660  ? 19.836  -12.043 97.847  1.00 13.07  ? 660  ALA C O     1 
ATOM   8792  C  CB    . ALA C 2  660  ? 19.672  -9.883  96.139  1.00 9.03   ? 660  ALA C CB    1 
ATOM   8793  N  N     . SER C 2  661  ? 21.704  -11.334 98.879  1.00 19.66  ? 661  SER C N     1 
ATOM   8794  C  CA    . SER C 2  661  ? 21.899  -12.581 99.608  1.00 20.53  ? 661  SER C CA    1 
ATOM   8795  C  C     . SER C 2  661  ? 22.219  -12.315 101.076 1.00 19.06  ? 661  SER C C     1 
ATOM   8796  O  O     . SER C 2  661  ? 23.180  -11.616 101.394 1.00 21.70  ? 661  SER C O     1 
ATOM   8797  C  CB    . SER C 2  661  ? 23.016  -13.406 98.967  1.00 18.78  ? 661  SER C CB    1 
ATOM   8798  O  OG    . SER C 2  661  ? 23.169  -14.658 99.615  1.00 16.70  ? 661  SER C OG    1 
ATOM   8799  N  N     . GLU C 2  662  ? 21.404  -12.869 101.965 1.00 15.57  ? 662  GLU C N     1 
ATOM   8800  C  CA    . GLU C 2  662  ? 21.651  -12.749 103.392 1.00 16.78  ? 662  GLU C CA    1 
ATOM   8801  C  C     . GLU C 2  662  ? 22.000  -14.126 103.941 1.00 21.79  ? 662  GLU C C     1 
ATOM   8802  O  O     . GLU C 2  662  ? 21.130  -14.990 104.068 1.00 25.69  ? 662  GLU C O     1 
ATOM   8803  C  CB    . GLU C 2  662  ? 20.412  -12.194 104.100 1.00 17.37  ? 662  GLU C CB    1 
ATOM   8804  C  CG    . GLU C 2  662  ? 20.573  -11.996 105.603 1.00 18.24  ? 662  GLU C CG    1 
ATOM   8805  C  CD    . GLU C 2  662  ? 19.247  -11.791 106.316 1.00 13.50  ? 662  GLU C CD    1 
ATOM   8806  O  OE1   . GLU C 2  662  ? 18.258  -12.462 105.952 1.00 10.62  ? 662  GLU C OE1   1 
ATOM   8807  O  OE2   . GLU C 2  662  ? 19.194  -10.956 107.244 1.00 15.97  ? 662  GLU C OE2   1 
ATOM   8808  N  N     . ASN C 2  663  ? 23.275  -14.312 104.274 1.00 20.74  ? 663  ASN C N     1 
ATOM   8809  C  CA    . ASN C 2  663  ? 23.796  -15.588 104.767 1.00 22.83  ? 663  ASN C CA    1 
ATOM   8810  C  C     . ASN C 2  663  ? 23.504  -16.782 103.855 1.00 20.79  ? 663  ASN C C     1 
ATOM   8811  O  O     . ASN C 2  663  ? 23.282  -17.893 104.331 1.00 21.68  ? 663  ASN C O     1 
ATOM   8812  C  CB    . ASN C 2  663  ? 23.295  -15.866 106.188 1.00 23.66  ? 663  ASN C CB    1 
ATOM   8813  C  CG    . ASN C 2  663  ? 23.716  -14.791 107.174 1.00 31.00  ? 663  ASN C CG    1 
ATOM   8814  O  OD1   . ASN C 2  663  ? 24.833  -14.271 107.109 1.00 30.87  ? 663  ASN C OD1   1 
ATOM   8815  N  ND2   . ASN C 2  663  ? 22.818  -14.448 108.093 1.00 26.83  ? 663  ASN C ND2   1 
ATOM   8816  N  N     . GLY C 2  664  ? 23.502  -16.548 102.547 1.00 19.67  ? 664  GLY C N     1 
ATOM   8817  C  CA    . GLY C 2  664  ? 23.259  -17.612 101.590 1.00 18.45  ? 664  GLY C CA    1 
ATOM   8818  C  C     . GLY C 2  664  ? 21.806  -17.767 101.172 1.00 20.08  ? 664  GLY C C     1 
ATOM   8819  O  O     . GLY C 2  664  ? 21.501  -18.519 100.244 1.00 19.10  ? 664  GLY C O     1 
ATOM   8820  N  N     . PHE C 2  665  ? 20.907  -17.067 101.860 1.00 19.45  ? 665  PHE C N     1 
ATOM   8821  C  CA    . PHE C 2  665  ? 19.492  -17.062 101.491 1.00 19.86  ? 665  PHE C CA    1 
ATOM   8822  C  C     . PHE C 2  665  ? 19.196  -15.874 100.587 1.00 16.94  ? 665  PHE C C     1 
ATOM   8823  O  O     . PHE C 2  665  ? 19.720  -14.781 100.811 1.00 17.55  ? 665  PHE C O     1 
ATOM   8824  C  CB    . PHE C 2  665  ? 18.608  -16.974 102.733 1.00 18.87  ? 665  PHE C CB    1 
ATOM   8825  C  CG    . PHE C 2  665  ? 18.693  -18.173 103.633 1.00 23.50  ? 665  PHE C CG    1 
ATOM   8826  C  CD1   . PHE C 2  665  ? 17.754  -19.188 103.544 1.00 23.50  ? 665  PHE C CD1   1 
ATOM   8827  C  CD2   . PHE C 2  665  ? 19.697  -18.275 104.582 1.00 21.03  ? 665  PHE C CD2   1 
ATOM   8828  C  CE1   . PHE C 2  665  ? 17.824  -20.290 104.376 1.00 20.44  ? 665  PHE C CE1   1 
ATOM   8829  C  CE2   . PHE C 2  665  ? 19.771  -19.373 105.415 1.00 20.26  ? 665  PHE C CE2   1 
ATOM   8830  C  CZ    . PHE C 2  665  ? 18.832  -20.382 105.311 1.00 20.21  ? 665  PHE C CZ    1 
ATOM   8831  N  N     . LEU C 2  666  ? 18.357  -16.083 99.573  1.00 11.72  ? 666  LEU C N     1 
ATOM   8832  C  CA    . LEU C 2  666  ? 18.013  -15.013 98.641  1.00 11.54  ? 666  LEU C CA    1 
ATOM   8833  C  C     . LEU C 2  666  ? 17.320  -13.876 99.379  1.00 14.64  ? 666  LEU C C     1 
ATOM   8834  O  O     . LEU C 2  666  ? 16.294  -14.087 100.024 1.00 14.27  ? 666  LEU C O     1 
ATOM   8835  C  CB    . LEU C 2  666  ? 17.099  -15.546 97.536  1.00 9.57   ? 666  LEU C CB    1 
ATOM   8836  C  CG    . LEU C 2  666  ? 16.710  -14.562 96.429  1.00 10.30  ? 666  LEU C CG    1 
ATOM   8837  C  CD1   . LEU C 2  666  ? 17.916  -14.216 95.571  1.00 8.77   ? 666  LEU C CD1   1 
ATOM   8838  C  CD2   . LEU C 2  666  ? 15.590  -15.120 95.565  1.00 8.11   ? 666  LEU C CD2   1 
ATOM   8839  N  N     . ALA C 2  667  ? 17.880  -12.672 99.290  1.00 11.82  ? 667  ALA C N     1 
ATOM   8840  C  CA    . ALA C 2  667  ? 17.267  -11.522 99.943  1.00 11.29  ? 667  ALA C CA    1 
ATOM   8841  C  C     . ALA C 2  667  ? 16.824  -10.477 98.929  1.00 9.52   ? 667  ALA C C     1 
ATOM   8842  O  O     . ALA C 2  667  ? 17.623  -9.661  98.485  1.00 12.49  ? 667  ALA C O     1 
ATOM   8843  C  CB    . ALA C 2  667  ? 18.261  -10.912 100.906 1.00 12.38  ? 667  ALA C CB    1 
ATOM   8844  N  N     . LEU C 2  668  ? 15.532  -10.434 98.638  1.00 7.95   ? 668  LEU C N     1 
ATOM   8845  C  CA    . LEU C 2  668  ? 15.043  -9.557  97.583  1.00 7.39   ? 668  LEU C CA    1 
ATOM   8846  C  C     . LEU C 2  668  ? 14.457  -8.253  98.099  1.00 7.88   ? 668  LEU C C     1 
ATOM   8847  O  O     . LEU C 2  668  ? 14.042  -7.406  97.316  1.00 10.07  ? 668  LEU C O     1 
ATOM   8848  C  CB    . LEU C 2  668  ? 14.039  -10.289 96.693  1.00 6.95   ? 668  LEU C CB    1 
ATOM   8849  C  CG    . LEU C 2  668  ? 14.652  -11.336 95.764  1.00 5.57   ? 668  LEU C CG    1 
ATOM   8850  C  CD1   . LEU C 2  668  ? 13.613  -11.871 94.792  1.00 5.31   ? 668  LEU C CD1   1 
ATOM   8851  C  CD2   . LEU C 2  668  ? 15.848  -10.757 95.021  1.00 5.52   ? 668  LEU C CD2   1 
ATOM   8852  N  N     . GLY C 2  669  ? 14.440  -8.086  99.414  1.00 8.60   ? 669  GLY C N     1 
ATOM   8853  C  CA    . GLY C 2  669  ? 13.736  -6.970  100.015 1.00 8.61   ? 669  GLY C CA    1 
ATOM   8854  C  C     . GLY C 2  669  ? 13.900  -6.926  101.519 1.00 10.75  ? 669  GLY C C     1 
ATOM   8855  O  O     . GLY C 2  669  ? 14.879  -7.440  102.063 1.00 8.91   ? 669  GLY C O     1 
ATOM   8856  N  N     . GLN C 2  670  ? 12.956  -6.273  102.188 1.00 9.64   ? 670  GLN C N     1 
ATOM   8857  C  CA    . GLN C 2  670  ? 12.965  -6.202  103.641 1.00 11.46  ? 670  GLN C CA    1 
ATOM   8858  C  C     . GLN C 2  670  ? 11.756  -6.915  104.236 1.00 12.61  ? 670  GLN C C     1 
ATOM   8859  O  O     . GLN C 2  670  ? 10.724  -7.077  103.574 1.00 11.43  ? 670  GLN C O     1 
ATOM   8860  C  CB    . GLN C 2  670  ? 12.977  -4.745  104.109 1.00 9.24   ? 670  GLN C CB    1 
ATOM   8861  C  CG    . GLN C 2  670  ? 14.045  -3.873  103.461 1.00 11.31  ? 670  GLN C CG    1 
ATOM   8862  C  CD    . GLN C 2  670  ? 15.423  -4.065  104.067 1.00 15.80  ? 670  GLN C CD    1 
ATOM   8863  O  OE1   . GLN C 2  670  ? 15.676  -5.040  104.774 1.00 14.99  ? 670  GLN C OE1   1 
ATOM   8864  N  NE2   . GLN C 2  670  ? 16.322  -3.124  103.794 1.00 15.26  ? 670  GLN C NE2   1 
ATOM   8865  N  N     . ASN C 2  671  ? 11.901  -7.362  105.480 1.00 14.26  ? 671  ASN C N     1 
ATOM   8866  C  CA    . ASN C 2  671  ? 10.763  -7.822  106.262 1.00 12.26  ? 671  ASN C CA    1 
ATOM   8867  C  C     . ASN C 2  671  ? 10.271  -6.666  107.110 1.00 12.99  ? 671  ASN C C     1 
ATOM   8868  O  O     . ASN C 2  671  ? 10.953  -6.245  108.044 1.00 14.02  ? 671  ASN C O     1 
ATOM   8869  C  CB    . ASN C 2  671  ? 11.161  -8.983  107.168 1.00 7.21   ? 671  ASN C CB    1 
ATOM   8870  C  CG    . ASN C 2  671  ? 11.634  -10.187 106.393 1.00 11.43  ? 671  ASN C CG    1 
ATOM   8871  O  OD1   . ASN C 2  671  ? 10.846  -10.868 105.737 1.00 14.17  ? 671  ASN C OD1   1 
ATOM   8872  N  ND2   . ASN C 2  671  ? 12.926  -10.470 106.475 1.00 17.74  ? 671  ASN C ND2   1 
ATOM   8873  N  N     . VAL C 2  672  ? 9.088   -6.152  106.795 1.00 10.55  ? 672  VAL C N     1 
ATOM   8874  C  CA    . VAL C 2  672  ? 8.579   -4.985  107.505 1.00 10.73  ? 672  VAL C CA    1 
ATOM   8875  C  C     . VAL C 2  672  ? 7.308   -5.314  108.268 1.00 11.99  ? 672  VAL C C     1 
ATOM   8876  O  O     . VAL C 2  672  ? 6.601   -6.266  107.936 1.00 14.57  ? 672  VAL C O     1 
ATOM   8877  C  CB    . VAL C 2  672  ? 8.317   -3.797  106.559 1.00 8.73   ? 672  VAL C CB    1 
ATOM   8878  C  CG1   . VAL C 2  672  ? 9.623   -3.137  106.160 1.00 8.23   ? 672  VAL C CG1   1 
ATOM   8879  C  CG2   . VAL C 2  672  ? 7.539   -4.251  105.338 1.00 7.44   ? 672  VAL C CG2   1 
ATOM   8880  N  N     . LEU C 2  673  ? 7.022   -4.516  109.290 1.00 12.12  ? 673  LEU C N     1 
ATOM   8881  C  CA    . LEU C 2  673  ? 5.841   -4.723  110.110 1.00 11.01  ? 673  LEU C CA    1 
ATOM   8882  C  C     . LEU C 2  673  ? 4.687   -3.917  109.528 1.00 12.75  ? 673  LEU C C     1 
ATOM   8883  O  O     . LEU C 2  673  ? 4.691   -2.686  109.567 1.00 11.37  ? 673  LEU C O     1 
ATOM   8884  C  CB    . LEU C 2  673  ? 6.122   -4.262  111.537 1.00 8.45   ? 673  LEU C CB    1 
ATOM   8885  C  CG    . LEU C 2  673  ? 5.099   -4.628  112.607 1.00 12.73  ? 673  LEU C CG    1 
ATOM   8886  C  CD1   . LEU C 2  673  ? 5.053   -6.137  112.802 1.00 10.04  ? 673  LEU C CD1   1 
ATOM   8887  C  CD2   . LEU C 2  673  ? 5.432   -3.916  113.910 1.00 13.55  ? 673  LEU C CD2   1 
ATOM   8888  N  N     . VAL C 2  674  ? 3.696   -4.620  108.991 1.00 7.73   ? 674  VAL C N     1 
ATOM   8889  C  CA    . VAL C 2  674  ? 2.560   -3.974  108.354 1.00 7.66   ? 674  VAL C CA    1 
ATOM   8890  C  C     . VAL C 2  674  ? 1.297   -4.040  109.199 1.00 10.21  ? 674  VAL C C     1 
ATOM   8891  O  O     . VAL C 2  674  ? 1.075   -4.996  109.953 1.00 12.37  ? 674  VAL C O     1 
ATOM   8892  C  CB    . VAL C 2  674  ? 2.244   -4.581  106.969 1.00 7.62   ? 674  VAL C CB    1 
ATOM   8893  C  CG1   . VAL C 2  674  ? 3.459   -4.510  106.064 1.00 12.40  ? 674  VAL C CG1   1 
ATOM   8894  C  CG2   . VAL C 2  674  ? 1.755   -6.015  107.108 1.00 7.91   ? 674  VAL C CG2   1 
ATOM   8895  N  N     . ALA C 2  675  ? 0.490   -2.992  109.075 1.00 7.18   ? 675  ALA C N     1 
ATOM   8896  C  CA    . ALA C 2  675  ? -0.880  -2.992  109.554 1.00 6.36   ? 675  ALA C CA    1 
ATOM   8897  C  C     . ALA C 2  675  ? -1.762  -2.898  108.317 1.00 8.07   ? 675  ALA C C     1 
ATOM   8898  O  O     . ALA C 2  675  ? -1.469  -2.116  107.410 1.00 8.81   ? 675  ALA C O     1 
ATOM   8899  C  CB    . ALA C 2  675  ? -1.117  -1.806  110.461 1.00 6.65   ? 675  ALA C CB    1 
ATOM   8900  N  N     . ILE C 2  676  ? -2.825  -3.693  108.250 1.00 7.78   ? 676  ILE C N     1 
ATOM   8901  C  CA    . ILE C 2  676  ? -3.698  -3.599  107.091 1.00 8.18   ? 676  ILE C CA    1 
ATOM   8902  C  C     . ILE C 2  676  ? -4.947  -2.812  107.469 1.00 10.76  ? 676  ILE C C     1 
ATOM   8903  O  O     . ILE C 2  676  ? -5.891  -3.341  108.056 1.00 10.38  ? 676  ILE C O     1 
ATOM   8904  C  CB    . ILE C 2  676  ? -4.079  -5.006  106.589 1.00 6.54   ? 676  ILE C CB    1 
ATOM   8905  C  CG1   . ILE C 2  676  ? -2.810  -5.816  106.307 1.00 6.05   ? 676  ILE C CG1   1 
ATOM   8906  C  CG2   . ILE C 2  676  ? -4.959  -4.924  105.358 1.00 5.30   ? 676  ILE C CG2   1 
ATOM   8907  C  CD1   . ILE C 2  676  ? -3.068  -7.205  105.793 1.00 5.84   ? 676  ILE C CD1   1 
ATOM   8908  N  N     . MET C 2  677  ? -4.931  -1.535  107.102 1.00 8.30   ? 677  MET C N     1 
ATOM   8909  C  CA    . MET C 2  677  ? -6.013  -0.601  107.382 1.00 8.14   ? 677  MET C CA    1 
ATOM   8910  C  C     . MET C 2  677  ? -5.996  0.510   106.336 1.00 9.53   ? 677  MET C C     1 
ATOM   8911  O  O     . MET C 2  677  ? -4.961  0.751   105.713 1.00 8.88   ? 677  MET C O     1 
ATOM   8912  C  CB    . MET C 2  677  ? -5.867  -0.027  108.790 1.00 8.58   ? 677  MET C CB    1 
ATOM   8913  C  CG    . MET C 2  677  ? -4.472  0.485   109.103 1.00 9.33   ? 677  MET C CG    1 
ATOM   8914  S  SD    . MET C 2  677  ? -4.363  1.265   110.720 1.00 12.65  ? 677  MET C SD    1 
ATOM   8915  C  CE    . MET C 2  677  ? -5.636  2.518   110.568 1.00 9.23   ? 677  MET C CE    1 
ATOM   8916  N  N     . PRO C 2  678  ? -7.133  1.192   106.130 1.00 7.99   ? 678  PRO C N     1 
ATOM   8917  C  CA    . PRO C 2  678  ? -7.061  2.408   105.312 1.00 6.82   ? 678  PRO C CA    1 
ATOM   8918  C  C     . PRO C 2  678  ? -6.365  3.496   106.119 1.00 6.46   ? 678  PRO C C     1 
ATOM   8919  O  O     . PRO C 2  678  ? -6.499  3.491   107.338 1.00 7.83   ? 678  PRO C O     1 
ATOM   8920  C  CB    . PRO C 2  678  ? -8.535  2.786   105.106 1.00 6.52   ? 678  PRO C CB    1 
ATOM   8921  C  CG    . PRO C 2  678  ? -9.333  1.596   105.548 1.00 6.79   ? 678  PRO C CG    1 
ATOM   8922  C  CD    . PRO C 2  678  ? -8.504  0.899   106.573 1.00 7.00   ? 678  PRO C CD    1 
ATOM   8923  N  N     . PHE C 2  679  ? -5.602  4.380   105.487 1.00 4.89   ? 679  PHE C N     1 
ATOM   8924  C  CA    . PHE C 2  679  ? -5.090  5.524   106.227 1.00 6.14   ? 679  PHE C CA    1 
ATOM   8925  C  C     . PHE C 2  679  ? -5.311  6.844   105.484 1.00 8.37   ? 679  PHE C C     1 
ATOM   8926  O  O     . PHE C 2  679  ? -4.603  7.149   104.524 1.00 7.73   ? 679  PHE C O     1 
ATOM   8927  C  CB    . PHE C 2  679  ? -3.601  5.310   106.501 1.00 6.03   ? 679  PHE C CB    1 
ATOM   8928  C  CG    . PHE C 2  679  ? -3.070  6.115   107.645 1.00 7.61   ? 679  PHE C CG    1 
ATOM   8929  C  CD1   . PHE C 2  679  ? -3.192  5.654   108.947 1.00 7.51   ? 679  PHE C CD1   1 
ATOM   8930  C  CD2   . PHE C 2  679  ? -2.436  7.326   107.421 1.00 8.38   ? 679  PHE C CD2   1 
ATOM   8931  C  CE1   . PHE C 2  679  ? -2.698  6.388   110.005 1.00 6.27   ? 679  PHE C CE1   1 
ATOM   8932  C  CE2   . PHE C 2  679  ? -1.944  8.066   108.474 1.00 8.83   ? 679  PHE C CE2   1 
ATOM   8933  C  CZ    . PHE C 2  679  ? -2.071  7.595   109.768 1.00 9.21   ? 679  PHE C CZ    1 
ATOM   8934  N  N     . ASP C 2  680  ? -6.278  7.628   105.956 1.00 9.33   ? 680  ASP C N     1 
ATOM   8935  C  CA    . ASP C 2  680  ? -6.526  9.001   105.491 1.00 9.78   ? 680  ASP C CA    1 
ATOM   8936  C  C     . ASP C 2  680  ? -6.434  9.221   103.973 1.00 8.86   ? 680  ASP C C     1 
ATOM   8937  O  O     . ASP C 2  680  ? -6.052  10.295  103.515 1.00 9.61   ? 680  ASP C O     1 
ATOM   8938  C  CB    . ASP C 2  680  ? -5.682  10.016  106.268 1.00 9.01   ? 680  ASP C CB    1 
ATOM   8939  C  CG    . ASP C 2  680  ? -6.219  10.260  107.670 1.00 16.40  ? 680  ASP C CG    1 
ATOM   8940  O  OD1   . ASP C 2  680  ? -7.443  10.105  107.873 1.00 13.56  ? 680  ASP C OD1   1 
ATOM   8941  O  OD2   . ASP C 2  680  ? -5.420  10.600  108.571 1.00 24.48  ? 680  ASP C OD2   1 
ATOM   8942  N  N     . GLY C 2  681  ? -6.808  8.207   103.203 1.00 8.83   ? 681  GLY C N     1 
ATOM   8943  C  CA    . GLY C 2  681  ? -6.740  8.288   101.759 1.00 6.60   ? 681  GLY C CA    1 
ATOM   8944  C  C     . GLY C 2  681  ? -5.350  8.200   101.161 1.00 6.04   ? 681  GLY C C     1 
ATOM   8945  O  O     . GLY C 2  681  ? -5.207  8.250   99.944  1.00 6.32   ? 681  GLY C O     1 
ATOM   8946  N  N     . TYR C 2  682  ? -4.325  8.073   101.997 1.00 6.04   ? 682  TYR C N     1 
ATOM   8947  C  CA    . TYR C 2  682  ? -2.956  8.014   101.485 1.00 5.27   ? 682  TYR C CA    1 
ATOM   8948  C  C     . TYR C 2  682  ? -2.603  6.645   100.918 1.00 5.08   ? 682  TYR C C     1 
ATOM   8949  O  O     . TYR C 2  682  ? -1.650  6.513   100.159 1.00 5.82   ? 682  TYR C O     1 
ATOM   8950  C  CB    . TYR C 2  682  ? -1.940  8.443   102.548 1.00 5.54   ? 682  TYR C CB    1 
ATOM   8951  C  CG    . TYR C 2  682  ? -1.979  9.923   102.848 1.00 7.61   ? 682  TYR C CG    1 
ATOM   8952  C  CD1   . TYR C 2  682  ? -1.394  10.841  101.985 1.00 8.79   ? 682  TYR C CD1   1 
ATOM   8953  C  CD2   . TYR C 2  682  ? -2.607  10.404  103.988 1.00 6.63   ? 682  TYR C CD2   1 
ATOM   8954  C  CE1   . TYR C 2  682  ? -1.433  12.196  102.250 1.00 7.36   ? 682  TYR C CE1   1 
ATOM   8955  C  CE2   . TYR C 2  682  ? -2.651  11.755  104.261 1.00 6.97   ? 682  TYR C CE2   1 
ATOM   8956  C  CZ    . TYR C 2  682  ? -2.062  12.646  103.391 1.00 8.65   ? 682  TYR C CZ    1 
ATOM   8957  O  OH    . TYR C 2  682  ? -2.102  13.995  103.665 1.00 10.85  ? 682  TYR C OH    1 
ATOM   8958  N  N     . ASN C 2  683  ? -3.343  5.620   101.323 1.00 5.01   ? 683  ASN C N     1 
ATOM   8959  C  CA    . ASN C 2  683  ? -3.231  4.304   100.697 1.00 4.72   ? 683  ASN C CA    1 
ATOM   8960  C  C     . ASN C 2  683  ? -4.305  3.998   99.646  1.00 4.99   ? 683  ASN C C     1 
ATOM   8961  O  O     . ASN C 2  683  ? -4.436  2.864   99.194  1.00 6.69   ? 683  ASN C O     1 
ATOM   8962  C  CB    . ASN C 2  683  ? -3.057  3.172   101.717 1.00 5.72   ? 683  ASN C CB    1 
ATOM   8963  C  CG    . ASN C 2  683  ? -4.084  3.208   102.815 1.00 6.51   ? 683  ASN C CG    1 
ATOM   8964  O  OD1   . ASN C 2  683  ? -5.024  3.999   102.779 1.00 10.11  ? 683  ASN C OD1   1 
ATOM   8965  N  ND2   . ASN C 2  683  ? -3.916  2.339   103.803 1.00 7.76   ? 683  ASN C ND2   1 
ATOM   8966  N  N     . PHE C 2  684  ? -5.101  5.009   99.311  1.00 5.95   ? 684  PHE C N     1 
ATOM   8967  C  CA    . PHE C 2  684  ? -6.145  4.913   98.282  1.00 6.09   ? 684  PHE C CA    1 
ATOM   8968  C  C     . PHE C 2  684  ? -5.616  4.352   96.954  1.00 5.99   ? 684  PHE C C     1 
ATOM   8969  O  O     . PHE C 2  684  ? -4.552  4.750   96.484  1.00 5.44   ? 684  PHE C O     1 
ATOM   8970  C  CB    . PHE C 2  684  ? -6.745  6.307   98.080  1.00 4.69   ? 684  PHE C CB    1 
ATOM   8971  C  CG    . PHE C 2  684  ? -7.779  6.402   96.991  1.00 5.19   ? 684  PHE C CG    1 
ATOM   8972  C  CD1   . PHE C 2  684  ? -9.080  5.987   97.209  1.00 5.90   ? 684  PHE C CD1   1 
ATOM   8973  C  CD2   . PHE C 2  684  ? -7.463  6.977   95.771  1.00 4.71   ? 684  PHE C CD2   1 
ATOM   8974  C  CE1   . PHE C 2  684  ? -10.035 6.103   96.217  1.00 4.50   ? 684  PHE C CE1   1 
ATOM   8975  C  CE2   . PHE C 2  684  ? -8.417  7.100   94.779  1.00 4.81   ? 684  PHE C CE2   1 
ATOM   8976  C  CZ    . PHE C 2  684  ? -9.701  6.659   95.002  1.00 4.93   ? 684  PHE C CZ    1 
ATOM   8977  N  N     . GLU C 2  685  ? -6.361  3.414   96.372  1.00 6.26   ? 685  GLU C N     1 
ATOM   8978  C  CA    . GLU C 2  685  ? -6.016  2.809   95.081  1.00 6.14   ? 685  GLU C CA    1 
ATOM   8979  C  C     . GLU C 2  685  ? -4.581  2.284   94.980  1.00 6.85   ? 685  GLU C C     1 
ATOM   8980  O  O     . GLU C 2  685  ? -3.812  2.710   94.115  1.00 5.37   ? 685  GLU C O     1 
ATOM   8981  C  CB    . GLU C 2  685  ? -6.350  3.749   93.920  1.00 7.11   ? 685  GLU C CB    1 
ATOM   8982  C  CG    . GLU C 2  685  ? -7.845  3.997   93.737  1.00 8.10   ? 685  GLU C CG    1 
ATOM   8983  C  CD    . GLU C 2  685  ? -8.564  2.881   93.000  1.00 12.44  ? 685  GLU C CD    1 
ATOM   8984  O  OE1   . GLU C 2  685  ? -8.457  1.709   93.422  1.00 15.72  ? 685  GLU C OE1   1 
ATOM   8985  O  OE2   . GLU C 2  685  ? -9.245  3.183   91.994  1.00 17.26  ? 685  GLU C OE2   1 
ATOM   8986  N  N     . ASP C 2  686  ? -4.235  1.392   95.905  1.00 6.56   ? 686  ASP C N     1 
ATOM   8987  C  CA    . ASP C 2  686  ? -2.961  0.671   95.911  1.00 5.50   ? 686  ASP C CA    1 
ATOM   8988  C  C     . ASP C 2  686  ? -1.747  1.490   96.346  1.00 6.71   ? 686  ASP C C     1 
ATOM   8989  O  O     . ASP C 2  686  ? -0.642  0.952   96.435  1.00 9.64   ? 686  ASP C O     1 
ATOM   8990  C  CB    . ASP C 2  686  ? -2.688  -0.026  94.575  1.00 6.35   ? 686  ASP C CB    1 
ATOM   8991  C  CG    . ASP C 2  686  ? -3.727  -1.078  94.248  1.00 12.26  ? 686  ASP C CG    1 
ATOM   8992  O  OD1   . ASP C 2  686  ? -3.934  -1.361  93.048  1.00 12.77  ? 686  ASP C OD1   1 
ATOM   8993  O  OD2   . ASP C 2  686  ? -4.342  -1.620  95.192  1.00 13.67  ? 686  ASP C OD2   1 
ATOM   8994  N  N     . ALA C 2  687  ? -1.936  2.776   96.621  1.00 3.81   ? 687  ALA C N     1 
ATOM   8995  C  CA    . ALA C 2  687  ? -0.843  3.573   97.159  1.00 3.62   ? 687  ALA C CA    1 
ATOM   8996  C  C     . ALA C 2  687  ? -0.464  2.998   98.520  1.00 5.88   ? 687  ALA C C     1 
ATOM   8997  O  O     . ALA C 2  687  ? -1.269  2.320   99.157  1.00 5.72   ? 687  ALA C O     1 
ATOM   8998  C  CB    . ALA C 2  687  ? -1.249  5.021   97.284  1.00 4.21   ? 687  ALA C CB    1 
ATOM   8999  N  N     . ILE C 2  688  ? 0.769   3.241   98.951  1.00 6.10   ? 688  ILE C N     1 
ATOM   9000  C  CA    . ILE C 2  688  ? 1.276   2.656   100.188 1.00 4.25   ? 688  ILE C CA    1 
ATOM   9001  C  C     . ILE C 2  688  ? 1.824   3.734   101.117 1.00 6.41   ? 688  ILE C C     1 
ATOM   9002  O  O     . ILE C 2  688  ? 2.470   4.681   100.667 1.00 8.35   ? 688  ILE C O     1 
ATOM   9003  C  CB    . ILE C 2  688  ? 2.397   1.636   99.897  1.00 3.67   ? 688  ILE C CB    1 
ATOM   9004  C  CG1   . ILE C 2  688  ? 1.899   0.530   98.971  1.00 5.00   ? 688  ILE C CG1   1 
ATOM   9005  C  CG2   . ILE C 2  688  ? 2.919   1.023   101.174 1.00 4.71   ? 688  ILE C CG2   1 
ATOM   9006  C  CD1   . ILE C 2  688  ? 2.935   -0.543  98.711  1.00 4.66   ? 688  ILE C CD1   1 
ATOM   9007  N  N     . VAL C 2  689  ? 1.560   3.587   102.413 1.00 5.59   ? 689  VAL C N     1 
ATOM   9008  C  CA    . VAL C 2  689  ? 2.109   4.485   103.423 1.00 6.45   ? 689  VAL C CA    1 
ATOM   9009  C  C     . VAL C 2  689  ? 3.236   3.797   104.185 1.00 10.20  ? 689  VAL C C     1 
ATOM   9010  O  O     . VAL C 2  689  ? 3.062   2.681   104.678 1.00 9.90   ? 689  VAL C O     1 
ATOM   9011  C  CB    . VAL C 2  689  ? 1.035   4.895   104.443 1.00 7.71   ? 689  VAL C CB    1 
ATOM   9012  C  CG1   . VAL C 2  689  ? 1.647   5.743   105.545 1.00 6.33   ? 689  VAL C CG1   1 
ATOM   9013  C  CG2   . VAL C 2  689  ? -0.105  5.633   103.753 1.00 7.22   ? 689  VAL C CG2   1 
ATOM   9014  N  N     . ILE C 2  690  ? 4.387   4.457   104.287 1.00 9.69   ? 690  ILE C N     1 
ATOM   9015  C  CA    . ILE C 2  690  ? 5.512   3.897   105.032 1.00 8.30   ? 690  ILE C CA    1 
ATOM   9016  C  C     . ILE C 2  690  ? 5.970   4.808   106.165 1.00 10.53  ? 690  ILE C C     1 
ATOM   9017  O  O     . ILE C 2  690  ? 5.686   6.006   106.174 1.00 13.09  ? 690  ILE C O     1 
ATOM   9018  C  CB    . ILE C 2  690  ? 6.727   3.619   104.128 1.00 8.93   ? 690  ILE C CB    1 
ATOM   9019  C  CG1   . ILE C 2  690  ? 7.381   4.934   103.702 1.00 8.65   ? 690  ILE C CG1   1 
ATOM   9020  C  CG2   . ILE C 2  690  ? 6.323   2.778   102.924 1.00 8.15   ? 690  ILE C CG2   1 
ATOM   9021  C  CD1   . ILE C 2  690  ? 8.704   4.752   103.011 1.00 10.81  ? 690  ILE C CD1   1 
ATOM   9022  N  N     . SER C 2  691  ? 6.691   4.228   107.117 1.00 11.03  ? 691  SER C N     1 
ATOM   9023  C  CA    . SER C 2  691  ? 7.256   4.991   108.218 1.00 10.22  ? 691  SER C CA    1 
ATOM   9024  C  C     . SER C 2  691  ? 8.623   5.559   107.851 1.00 14.47  ? 691  SER C C     1 
ATOM   9025  O  O     . SER C 2  691  ? 9.416   4.901   107.176 1.00 14.15  ? 691  SER C O     1 
ATOM   9026  C  CB    . SER C 2  691  ? 7.379   4.109   109.459 1.00 15.02  ? 691  SER C CB    1 
ATOM   9027  O  OG    . SER C 2  691  ? 7.851   4.852   110.568 1.00 21.96  ? 691  SER C OG    1 
ATOM   9028  N  N     . GLU C 2  692  ? 8.895   6.780   108.307 1.00 14.98  ? 692  GLU C N     1 
ATOM   9029  C  CA    . GLU C 2  692  ? 10.203  7.408   108.124 1.00 13.38  ? 692  GLU C CA    1 
ATOM   9030  C  C     . GLU C 2  692  ? 11.274  6.591   108.841 1.00 13.36  ? 692  GLU C C     1 
ATOM   9031  O  O     . GLU C 2  692  ? 12.467  6.699   108.547 1.00 13.20  ? 692  GLU C O     1 
ATOM   9032  C  CB    . GLU C 2  692  ? 10.182  8.843   108.655 1.00 12.83  ? 692  GLU C CB    1 
ATOM   9033  C  CG    . GLU C 2  692  ? 11.397  9.679   108.282 1.00 13.59  ? 692  GLU C CG    1 
ATOM   9034  C  CD    . GLU C 2  692  ? 11.301  11.107  108.790 1.00 22.15  ? 692  GLU C CD    1 
ATOM   9035  O  OE1   . GLU C 2  692  ? 10.773  11.309  109.902 1.00 27.51  ? 692  GLU C OE1   1 
ATOM   9036  O  OE2   . GLU C 2  692  ? 11.748  12.030  108.076 1.00 23.60  ? 692  GLU C OE2   1 
ATOM   9037  N  N     . GLU C 2  693  ? 10.830  5.760   109.777 1.00 14.08  ? 693  GLU C N     1 
ATOM   9038  C  CA    . GLU C 2  693  ? 11.713  4.867   110.506 1.00 17.31  ? 693  GLU C CA    1 
ATOM   9039  C  C     . GLU C 2  693  ? 12.455  3.934   109.550 1.00 16.29  ? 693  GLU C C     1 
ATOM   9040  O  O     . GLU C 2  693  ? 13.575  3.509   109.832 1.00 17.28  ? 693  GLU C O     1 
ATOM   9041  C  CB    . GLU C 2  693  ? 10.913  4.061   111.534 1.00 18.24  ? 693  GLU C CB    1 
ATOM   9042  C  CG    . GLU C 2  693  ? 11.706  3.667   112.772 1.00 29.55  ? 693  GLU C CG    1 
ATOM   9043  C  CD    . GLU C 2  693  ? 12.146  4.868   113.598 1.00 23.29  ? 693  GLU C CD    1 
ATOM   9044  O  OE1   . GLU C 2  693  ? 13.123  4.736   114.367 1.00 24.52  ? 693  GLU C OE1   1 
ATOM   9045  O  OE2   . GLU C 2  693  ? 11.515  5.941   113.485 1.00 16.66  ? 693  GLU C OE2   1 
ATOM   9046  N  N     . LEU C 2  694  ? 11.829  3.623   108.418 1.00 14.14  ? 694  LEU C N     1 
ATOM   9047  C  CA    . LEU C 2  694  ? 12.461  2.789   107.401 1.00 15.45  ? 694  LEU C CA    1 
ATOM   9048  C  C     . LEU C 2  694  ? 13.668  3.490   106.779 1.00 16.01  ? 694  LEU C C     1 
ATOM   9049  O  O     . LEU C 2  694  ? 14.691  2.855   106.510 1.00 14.64  ? 694  LEU C O     1 
ATOM   9050  C  CB    . LEU C 2  694  ? 11.457  2.394   106.312 1.00 9.38   ? 694  LEU C CB    1 
ATOM   9051  C  CG    . LEU C 2  694  ? 10.317  1.462   106.722 1.00 7.68   ? 694  LEU C CG    1 
ATOM   9052  C  CD1   . LEU C 2  694  ? 9.463   1.109   105.522 1.00 11.16  ? 694  LEU C CD1   1 
ATOM   9053  C  CD2   . LEU C 2  694  ? 10.852  0.204   107.375 1.00 11.17  ? 694  LEU C CD2   1 
ATOM   9054  N  N     . LEU C 2  695  ? 13.545  4.796   106.553 1.00 12.03  ? 695  LEU C N     1 
ATOM   9055  C  CA    . LEU C 2  695  ? 14.650  5.582   106.016 1.00 11.86  ? 695  LEU C CA    1 
ATOM   9056  C  C     . LEU C 2  695  ? 15.731  5.784   107.073 1.00 13.95  ? 695  LEU C C     1 
ATOM   9057  O  O     . LEU C 2  695  ? 16.923  5.742   106.765 1.00 10.24  ? 695  LEU C O     1 
ATOM   9058  C  CB    . LEU C 2  695  ? 14.165  6.940   105.501 1.00 10.83  ? 695  LEU C CB    1 
ATOM   9059  C  CG    . LEU C 2  695  ? 13.066  6.922   104.436 1.00 14.64  ? 695  LEU C CG    1 
ATOM   9060  C  CD1   . LEU C 2  695  ? 12.941  8.275   103.760 1.00 9.40   ? 695  LEU C CD1   1 
ATOM   9061  C  CD2   . LEU C 2  695  ? 13.319  5.833   103.413 1.00 15.12  ? 695  LEU C CD2   1 
ATOM   9062  N  N     . LYS C 2  696  ? 15.302  6.002   108.316 1.00 16.11  ? 696  LYS C N     1 
ATOM   9063  C  CA    . LYS C 2  696  ? 16.225  6.218   109.429 1.00 13.72  ? 696  LYS C CA    1 
ATOM   9064  C  C     . LYS C 2  696  ? 17.199  5.061   109.580 1.00 13.48  ? 696  LYS C C     1 
ATOM   9065  O  O     . LYS C 2  696  ? 18.398  5.271   109.753 1.00 16.14  ? 696  LYS C O     1 
ATOM   9066  C  CB    . LYS C 2  696  ? 15.462  6.415   110.743 1.00 16.66  ? 696  LYS C CB    1 
ATOM   9067  C  CG    . LYS C 2  696  ? 14.713  7.736   110.853 1.00 17.02  ? 696  LYS C CG    1 
ATOM   9068  C  CD    . LYS C 2  696  ? 13.867  7.774   112.119 1.00 14.63  ? 696  LYS C CD    1 
ATOM   9069  C  CE    . LYS C 2  696  ? 13.056  9.058   112.216 1.00 18.83  ? 696  LYS C CE    1 
ATOM   9070  N  NZ    . LYS C 2  696  ? 12.197  9.081   113.436 1.00 19.64  ? 696  LYS C NZ    1 
ATOM   9071  N  N     . ARG C 2  697  ? 16.679  3.840   109.513 1.00 15.07  ? 697  ARG C N     1 
ATOM   9072  C  CA    . ARG C 2  697  ? 17.510  2.645   109.651 1.00 14.50  ? 697  ARG C CA    1 
ATOM   9073  C  C     . ARG C 2  697  ? 18.000  2.071   108.320 1.00 16.52  ? 697  ARG C C     1 
ATOM   9074  O  O     . ARG C 2  697  ? 18.530  0.960   108.273 1.00 18.85  ? 697  ARG C O     1 
ATOM   9075  C  CB    . ARG C 2  697  ? 16.873  1.586   110.562 1.00 14.89  ? 697  ARG C CB    1 
ATOM   9076  C  CG    . ARG C 2  697  ? 15.599  0.939   110.077 1.00 16.08  ? 697  ARG C CG    1 
ATOM   9077  C  CD    . ARG C 2  697  ? 15.063  0.034   111.175 1.00 16.88  ? 697  ARG C CD    1 
ATOM   9078  N  NE    . ARG C 2  697  ? 14.054  -0.912  110.708 1.00 21.52  ? 697  ARG C NE    1 
ATOM   9079  C  CZ    . ARG C 2  697  ? 12.743  -0.716  110.807 1.00 27.45  ? 697  ARG C CZ    1 
ATOM   9080  N  NH1   . ARG C 2  697  ? 12.273  0.399   111.356 1.00 23.49  ? 697  ARG C NH1   1 
ATOM   9081  N  NH2   . ARG C 2  697  ? 11.901  -1.638  110.358 1.00 25.02  ? 697  ARG C NH2   1 
ATOM   9082  N  N     . ASP C 2  698  ? 17.773  2.824   107.246 1.00 20.63  ? 698  ASP C N     1 
ATOM   9083  C  CA    . ASP C 2  698  ? 18.289  2.497   105.913 1.00 14.93  ? 698  ASP C CA    1 
ATOM   9084  C  C     . ASP C 2  698  ? 17.689  1.232   105.320 1.00 16.72  ? 698  ASP C C     1 
ATOM   9085  O  O     . ASP C 2  698  ? 18.357  0.501   104.588 1.00 17.52  ? 698  ASP C O     1 
ATOM   9086  C  CB    . ASP C 2  698  ? 19.819  2.407   105.911 1.00 11.40  ? 698  ASP C CB    1 
ATOM   9087  C  CG    . ASP C 2  698  ? 20.473  3.648   105.344 1.00 18.93  ? 698  ASP C CG    1 
ATOM   9088  O  OD1   . ASP C 2  698  ? 21.461  4.127   105.940 1.00 27.79  ? 698  ASP C OD1   1 
ATOM   9089  O  OD2   . ASP C 2  698  ? 20.002  4.145   104.300 1.00 16.65  ? 698  ASP C OD2   1 
ATOM   9090  N  N     . PHE C 2  699  ? 16.426  0.976   105.641 1.00 14.94  ? 699  PHE C N     1 
ATOM   9091  C  CA    . PHE C 2  699  ? 15.678  -0.072  104.966 1.00 14.18  ? 699  PHE C CA    1 
ATOM   9092  C  C     . PHE C 2  699  ? 15.307  0.430   103.580 1.00 12.67  ? 699  PHE C C     1 
ATOM   9093  O  O     . PHE C 2  699  ? 15.003  1.608   103.410 1.00 16.64  ? 699  PHE C O     1 
ATOM   9094  C  CB    . PHE C 2  699  ? 14.432  -0.446  105.767 1.00 14.01  ? 699  PHE C CB    1 
ATOM   9095  C  CG    . PHE C 2  699  ? 14.656  -1.571  106.733 1.00 18.55  ? 699  PHE C CG    1 
ATOM   9096  C  CD1   . PHE C 2  699  ? 15.840  -1.658  107.452 1.00 18.96  ? 699  PHE C CD1   1 
ATOM   9097  C  CD2   . PHE C 2  699  ? 13.692  -2.546  106.920 1.00 15.83  ? 699  PHE C CD2   1 
ATOM   9098  C  CE1   . PHE C 2  699  ? 16.058  -2.695  108.337 1.00 14.12  ? 699  PHE C CE1   1 
ATOM   9099  C  CE2   . PHE C 2  699  ? 13.904  -3.588  107.807 1.00 17.60  ? 699  PHE C CE2   1 
ATOM   9100  C  CZ    . PHE C 2  699  ? 15.089  -3.661  108.515 1.00 14.67  ? 699  PHE C CZ    1 
ATOM   9101  N  N     . TYR C 2  700  ? 15.356  -0.458  102.593 1.00 11.63  ? 700  TYR C N     1 
ATOM   9102  C  CA    . TYR C 2  700  ? 15.082  -0.097  101.202 1.00 10.13  ? 700  TYR C CA    1 
ATOM   9103  C  C     . TYR C 2  700  ? 16.016  0.995   100.685 1.00 11.77  ? 700  TYR C C     1 
ATOM   9104  O  O     . TYR C 2  700  ? 15.594  1.895   99.960  1.00 11.87  ? 700  TYR C O     1 
ATOM   9105  C  CB    . TYR C 2  700  ? 13.613  0.307   101.006 1.00 9.09   ? 700  TYR C CB    1 
ATOM   9106  C  CG    . TYR C 2  700  ? 12.637  -0.773  101.405 1.00 8.25   ? 700  TYR C CG    1 
ATOM   9107  C  CD1   . TYR C 2  700  ? 11.800  -0.614  102.501 1.00 6.68   ? 700  TYR C CD1   1 
ATOM   9108  C  CD2   . TYR C 2  700  ? 12.569  -1.964  100.694 1.00 7.98   ? 700  TYR C CD2   1 
ATOM   9109  C  CE1   . TYR C 2  700  ? 10.916  -1.606  102.870 1.00 5.75   ? 700  TYR C CE1   1 
ATOM   9110  C  CE2   . TYR C 2  700  ? 11.692  -2.958  101.053 1.00 6.31   ? 700  TYR C CE2   1 
ATOM   9111  C  CZ    . TYR C 2  700  ? 10.868  -2.777  102.140 1.00 7.71   ? 700  TYR C CZ    1 
ATOM   9112  O  OH    . TYR C 2  700  ? 9.997   -3.777  102.495 1.00 9.03   ? 700  TYR C OH    1 
ATOM   9113  N  N     . THR C 2  701  ? 17.284  0.921   101.076 1.00 16.22  ? 701  THR C N     1 
ATOM   9114  C  CA    . THR C 2  701  ? 18.313  1.770   100.484 1.00 13.00  ? 701  THR C CA    1 
ATOM   9115  C  C     . THR C 2  701  ? 19.186  0.918   99.573  1.00 9.38   ? 701  THR C C     1 
ATOM   9116  O  O     . THR C 2  701  ? 19.653  -0.150  99.971  1.00 8.25   ? 701  THR C O     1 
ATOM   9117  C  CB    . THR C 2  701  ? 19.193  2.446   101.543 1.00 10.52  ? 701  THR C CB    1 
ATOM   9118  O  OG1   . THR C 2  701  ? 18.386  3.297   102.365 1.00 13.93  ? 701  THR C OG1   1 
ATOM   9119  C  CG2   . THR C 2  701  ? 20.267  3.282   100.876 1.00 11.53  ? 701  THR C CG2   1 
ATOM   9120  N  N     . SER C 2  702  ? 19.398  1.382   98.347  1.00 7.94   ? 702  SER C N     1 
ATOM   9121  C  CA    . SER C 2  702  ? 20.133  0.584   97.376  1.00 7.73   ? 702  SER C CA    1 
ATOM   9122  C  C     . SER C 2  702  ? 21.195  1.397   96.656  1.00 9.24   ? 702  SER C C     1 
ATOM   9123  O  O     . SER C 2  702  ? 21.000  2.574   96.379  1.00 11.95  ? 702  SER C O     1 
ATOM   9124  C  CB    . SER C 2  702  ? 19.170  -0.040  96.365  1.00 8.98   ? 702  SER C CB    1 
ATOM   9125  O  OG    . SER C 2  702  ? 18.377  0.948   95.731  1.00 7.71   ? 702  SER C OG    1 
ATOM   9126  N  N     . ILE C 2  703  ? 22.321  0.763   96.354  1.00 8.36   ? 703  ILE C N     1 
ATOM   9127  C  CA    . ILE C 2  703  ? 23.406  1.436   95.655  1.00 9.65   ? 703  ILE C CA    1 
ATOM   9128  C  C     . ILE C 2  703  ? 23.259  1.260   94.151  1.00 10.54  ? 703  ILE C C     1 
ATOM   9129  O  O     . ILE C 2  703  ? 23.043  0.154   93.666  1.00 13.37  ? 703  ILE C O     1 
ATOM   9130  C  CB    . ILE C 2  703  ? 24.775  0.894   96.091  1.00 9.14   ? 703  ILE C CB    1 
ATOM   9131  C  CG1   . ILE C 2  703  ? 24.942  1.027   97.603  1.00 11.39  ? 703  ILE C CG1   1 
ATOM   9132  C  CG2   . ILE C 2  703  ? 25.891  1.632   95.382  1.00 9.77   ? 703  ILE C CG2   1 
ATOM   9133  C  CD1   . ILE C 2  703  ? 26.197  0.375   98.124  1.00 12.17  ? 703  ILE C CD1   1 
ATOM   9134  N  N     . HIS C 2  704  ? 23.367  2.356   93.413  1.00 13.43  ? 704  HIS C N     1 
ATOM   9135  C  CA    . HIS C 2  704  ? 23.296  2.291   91.960  1.00 13.70  ? 704  HIS C CA    1 
ATOM   9136  C  C     . HIS C 2  704  ? 24.486  3.011   91.346  1.00 15.82  ? 704  HIS C C     1 
ATOM   9137  O  O     . HIS C 2  704  ? 24.857  4.089   91.790  1.00 17.13  ? 704  HIS C O     1 
ATOM   9138  C  CB    . HIS C 2  704  ? 21.987  2.899   91.460  1.00 15.70  ? 704  HIS C CB    1 
ATOM   9139  C  CG    . HIS C 2  704  ? 20.768  2.179   91.944  1.00 14.67  ? 704  HIS C CG    1 
ATOM   9140  N  ND1   . HIS C 2  704  ? 20.067  1.290   91.157  1.00 14.36  ? 704  HIS C ND1   1 
ATOM   9141  C  CD2   . HIS C 2  704  ? 20.133  2.205   93.139  1.00 12.23  ? 704  HIS C CD2   1 
ATOM   9142  C  CE1   . HIS C 2  704  ? 19.050  0.805   91.846  1.00 13.97  ? 704  HIS C CE1   1 
ATOM   9143  N  NE2   . HIS C 2  704  ? 19.066  1.345   93.051  1.00 11.89  ? 704  HIS C NE2   1 
ATOM   9144  N  N     . ILE C 2  705  ? 25.087  2.410   90.328  1.00 14.80  ? 705  ILE C N     1 
ATOM   9145  C  CA    . ILE C 2  705  ? 26.258  2.994   89.693  1.00 13.71  ? 705  ILE C CA    1 
ATOM   9146  C  C     . ILE C 2  705  ? 25.975  3.286   88.229  1.00 16.49  ? 705  ILE C C     1 
ATOM   9147  O  O     . ILE C 2  705  ? 25.517  2.418   87.488  1.00 19.99  ? 705  ILE C O     1 
ATOM   9148  C  CB    . ILE C 2  705  ? 27.471  2.058   89.795  1.00 16.22  ? 705  ILE C CB    1 
ATOM   9149  C  CG1   . ILE C 2  705  ? 27.676  1.615   91.245  1.00 12.95  ? 705  ILE C CG1   1 
ATOM   9150  C  CG2   . ILE C 2  705  ? 28.715  2.742   89.252  1.00 16.39  ? 705  ILE C CG2   1 
ATOM   9151  C  CD1   . ILE C 2  705  ? 28.538  0.393   91.383  1.00 14.26  ? 705  ILE C CD1   1 
ATOM   9152  N  N     . GLU C 2  706  ? 26.241  4.517   87.817  1.00 13.03  ? 706  GLU C N     1 
ATOM   9153  C  CA    . GLU C 2  706  ? 26.013  4.921   86.441  1.00 16.09  ? 706  GLU C CA    1 
ATOM   9154  C  C     . GLU C 2  706  ? 27.340  5.248   85.768  1.00 19.02  ? 706  GLU C C     1 
ATOM   9155  O  O     . GLU C 2  706  ? 28.245  5.808   86.392  1.00 21.04  ? 706  GLU C O     1 
ATOM   9156  C  CB    . GLU C 2  706  ? 25.067  6.122   86.387  1.00 16.83  ? 706  GLU C CB    1 
ATOM   9157  C  CG    . GLU C 2  706  ? 24.672  6.540   84.983  1.00 25.89  ? 706  GLU C CG    1 
ATOM   9158  C  CD    . GLU C 2  706  ? 23.937  5.445   84.228  1.00 36.17  ? 706  GLU C CD    1 
ATOM   9159  O  OE1   . GLU C 2  706  ? 22.688  5.405   84.304  1.00 41.45  ? 706  GLU C OE1   1 
ATOM   9160  O  OE2   . GLU C 2  706  ? 24.607  4.630   83.555  1.00 26.08  ? 706  GLU C OE2   1 
ATOM   9161  N  N     . ARG C 2  707  ? 27.448  4.890   84.494  1.00 19.10  ? 707  ARG C N     1 
ATOM   9162  C  CA    . ARG C 2  707  ? 28.680  5.071   83.740  1.00 18.30  ? 707  ARG C CA    1 
ATOM   9163  C  C     . ARG C 2  707  ? 28.541  6.165   82.681  1.00 17.71  ? 707  ARG C C     1 
ATOM   9164  O  O     . ARG C 2  707  ? 27.613  6.149   81.874  1.00 19.21  ? 707  ARG C O     1 
ATOM   9165  C  CB    . ARG C 2  707  ? 29.079  3.745   83.090  1.00 21.94  ? 707  ARG C CB    1 
ATOM   9166  C  CG    . ARG C 2  707  ? 30.114  3.860   81.991  1.00 24.68  ? 707  ARG C CG    1 
ATOM   9167  C  CD    . ARG C 2  707  ? 30.385  2.504   81.370  1.00 26.10  ? 707  ARG C CD    1 
ATOM   9168  N  NE    . ARG C 2  707  ? 30.807  2.620   79.978  1.00 43.36  ? 707  ARG C NE    1 
ATOM   9169  C  CZ    . ARG C 2  707  ? 31.151  1.589   79.214  1.00 54.87  ? 707  ARG C CZ    1 
ATOM   9170  N  NH1   . ARG C 2  707  ? 31.131  0.357   79.709  1.00 59.94  ? 707  ARG C NH1   1 
ATOM   9171  N  NH2   . ARG C 2  707  ? 31.519  1.788   77.955  1.00 56.05  ? 707  ARG C NH2   1 
ATOM   9172  N  N     . TYR C 2  708  ? 29.465  7.119   82.692  1.00 16.29  ? 708  TYR C N     1 
ATOM   9173  C  CA    . TYR C 2  708  ? 29.465  8.179   81.690  1.00 19.36  ? 708  TYR C CA    1 
ATOM   9174  C  C     . TYR C 2  708  ? 30.699  8.053   80.806  1.00 20.89  ? 708  TYR C C     1 
ATOM   9175  O  O     . TYR C 2  708  ? 31.738  7.589   81.258  1.00 16.97  ? 708  TYR C O     1 
ATOM   9176  C  CB    . TYR C 2  708  ? 29.402  9.549   82.360  1.00 15.75  ? 708  TYR C CB    1 
ATOM   9177  C  CG    . TYR C 2  708  ? 28.186  9.709   83.238  1.00 16.79  ? 708  TYR C CG    1 
ATOM   9178  C  CD1   . TYR C 2  708  ? 28.193  9.272   84.556  1.00 20.60  ? 708  TYR C CD1   1 
ATOM   9179  C  CD2   . TYR C 2  708  ? 27.026  10.286  82.749  1.00 15.66  ? 708  TYR C CD2   1 
ATOM   9180  C  CE1   . TYR C 2  708  ? 27.081  9.409   85.363  1.00 20.79  ? 708  TYR C CE1   1 
ATOM   9181  C  CE2   . TYR C 2  708  ? 25.909  10.427  83.547  1.00 21.38  ? 708  TYR C CE2   1 
ATOM   9182  C  CZ    . TYR C 2  708  ? 25.940  9.989   84.853  1.00 23.64  ? 708  TYR C CZ    1 
ATOM   9183  O  OH    . TYR C 2  708  ? 24.827  10.131  85.652  1.00 26.42  ? 708  TYR C OH    1 
ATOM   9184  N  N     . GLU C 2  709  ? 30.581  8.448   79.543  1.00 22.92  ? 709  GLU C N     1 
ATOM   9185  C  CA    . GLU C 2  709  ? 31.658  8.216   78.586  1.00 22.05  ? 709  GLU C CA    1 
ATOM   9186  C  C     . GLU C 2  709  ? 31.821  9.352   77.583  1.00 20.35  ? 709  GLU C C     1 
ATOM   9187  O  O     . GLU C 2  709  ? 30.844  9.850   77.029  1.00 20.62  ? 709  GLU C O     1 
ATOM   9188  C  CB    . GLU C 2  709  ? 31.411  6.902   77.847  1.00 26.64  ? 709  GLU C CB    1 
ATOM   9189  C  CG    . GLU C 2  709  ? 32.546  6.461   76.947  1.00 32.87  ? 709  GLU C CG    1 
ATOM   9190  C  CD    . GLU C 2  709  ? 32.243  5.153   76.246  1.00 45.06  ? 709  GLU C CD    1 
ATOM   9191  O  OE1   . GLU C 2  709  ? 31.047  4.830   76.075  1.00 44.12  ? 709  GLU C OE1   1 
ATOM   9192  O  OE2   . GLU C 2  709  ? 33.200  4.444   75.874  1.00 50.45  ? 709  GLU C OE2   1 
ATOM   9193  N  N     . ILE C 2  710  ? 33.064  9.749   77.338  1.00 25.15  ? 710  ILE C N     1 
ATOM   9194  C  CA    . ILE C 2  710  ? 33.338  10.798  76.363  1.00 21.03  ? 710  ILE C CA    1 
ATOM   9195  C  C     . ILE C 2  710  ? 34.545  10.444  75.500  1.00 26.69  ? 710  ILE C C     1 
ATOM   9196  O  O     . ILE C 2  710  ? 35.475  9.771   75.955  1.00 32.80  ? 710  ILE C O     1 
ATOM   9197  C  CB    . ILE C 2  710  ? 33.551  12.168  77.049  1.00 20.51  ? 710  ILE C CB    1 
ATOM   9198  C  CG1   . ILE C 2  710  ? 33.505  13.303  76.025  1.00 17.69  ? 710  ILE C CG1   1 
ATOM   9199  C  CG2   . ILE C 2  710  ? 34.853  12.186  77.837  1.00 21.44  ? 710  ILE C CG2   1 
ATOM   9200  C  CD1   . ILE C 2  710  ? 33.688  14.668  76.633  1.00 22.52  ? 710  ILE C CD1   1 
ATOM   9201  N  N     . GLU C 2  711  ? 34.517  10.884  74.245  1.00 28.76  ? 711  GLU C N     1 
ATOM   9202  C  CA    . GLU C 2  711  ? 35.627  10.657  73.331  1.00 25.56  ? 711  GLU C CA    1 
ATOM   9203  C  C     . GLU C 2  711  ? 36.200  11.968  72.802  1.00 27.31  ? 711  GLU C C     1 
ATOM   9204  O  O     . GLU C 2  711  ? 35.466  12.920  72.535  1.00 32.19  ? 711  GLU C O     1 
ATOM   9205  C  CB    . GLU C 2  711  ? 35.193  9.764   72.166  1.00 32.64  ? 711  GLU C CB    1 
ATOM   9206  C  CG    . GLU C 2  711  ? 34.879  8.331   72.569  1.00 41.77  ? 711  GLU C CG    1 
ATOM   9207  C  CD    . GLU C 2  711  ? 34.471  7.459   71.393  1.00 42.98  ? 711  GLU C CD    1 
ATOM   9208  O  OE1   . GLU C 2  711  ? 34.357  7.985   70.265  1.00 30.91  ? 711  GLU C OE1   1 
ATOM   9209  O  OE2   . GLU C 2  711  ? 34.262  6.245   71.602  1.00 50.05  ? 711  GLU C OE2   1 
ATOM   9210  N  N     . ALA C 2  712  ? 37.521  12.008  72.670  1.00 30.68  ? 712  ALA C N     1 
ATOM   9211  C  CA    . ALA C 2  712  ? 38.211  13.119  72.030  1.00 28.59  ? 712  ALA C CA    1 
ATOM   9212  C  C     . ALA C 2  712  ? 38.864  12.595  70.761  1.00 27.63  ? 712  ALA C C     1 
ATOM   9213  O  O     . ALA C 2  712  ? 39.738  11.725  70.820  1.00 29.89  ? 712  ALA C O     1 
ATOM   9214  C  CB    . ALA C 2  712  ? 39.250  13.704  72.961  1.00 32.82  ? 712  ALA C CB    1 
ATOM   9215  N  N     . ARG C 2  713  ? 38.435  13.121  69.617  1.00 28.88  ? 713  ARG C N     1 
ATOM   9216  C  CA    . ARG C 2  713  ? 38.826  12.568  68.324  1.00 33.01  ? 713  ARG C CA    1 
ATOM   9217  C  C     . ARG C 2  713  ? 39.489  13.592  67.407  1.00 31.41  ? 713  ARG C C     1 
ATOM   9218  O  O     . ARG C 2  713  ? 39.366  14.798  67.611  1.00 34.13  ? 713  ARG C O     1 
ATOM   9219  C  CB    . ARG C 2  713  ? 37.603  11.982  67.616  1.00 33.29  ? 713  ARG C CB    1 
ATOM   9220  C  CG    . ARG C 2  713  ? 36.602  13.036  67.163  1.00 36.89  ? 713  ARG C CG    1 
ATOM   9221  C  CD    . ARG C 2  713  ? 35.574  12.466  66.198  1.00 43.82  ? 713  ARG C CD    1 
ATOM   9222  N  NE    . ARG C 2  713  ? 34.827  13.520  65.513  1.00 52.39  ? 713  ARG C NE    1 
ATOM   9223  C  CZ    . ARG C 2  713  ? 35.143  14.005  64.315  1.00 50.50  ? 713  ARG C CZ    1 
ATOM   9224  N  NH1   . ARG C 2  713  ? 36.194  13.528  63.659  1.00 42.32  ? 713  ARG C NH1   1 
ATOM   9225  N  NH2   . ARG C 2  713  ? 34.406  14.965  63.769  1.00 43.86  ? 713  ARG C NH2   1 
ATOM   9226  N  N     . ASP C 2  714  ? 40.193  13.096  66.394  1.00 32.92  ? 714  ASP C N     1 
ATOM   9227  C  CA    . ASP C 2  714  ? 40.781  13.949  65.369  1.00 32.13  ? 714  ASP C CA    1 
ATOM   9228  C  C     . ASP C 2  714  ? 39.705  14.442  64.413  1.00 38.59  ? 714  ASP C C     1 
ATOM   9229  O  O     . ASP C 2  714  ? 38.918  13.648  63.895  1.00 35.71  ? 714  ASP C O     1 
ATOM   9230  C  CB    . ASP C 2  714  ? 41.845  13.184  64.577  1.00 27.71  ? 714  ASP C CB    1 
ATOM   9231  C  CG    . ASP C 2  714  ? 43.205  13.212  65.243  1.00 32.10  ? 714  ASP C CG    1 
ATOM   9232  O  OD1   . ASP C 2  714  ? 43.516  14.216  65.915  1.00 41.81  ? 714  ASP C OD1   1 
ATOM   9233  O  OD2   . ASP C 2  714  ? 43.965  12.233  65.089  1.00 27.00  ? 714  ASP C OD2   1 
ATOM   9234  N  N     . THR C 2  715  ? 39.668  15.752  64.182  1.00 37.36  ? 715  THR C N     1 
ATOM   9235  C  CA    . THR C 2  715  ? 38.758  16.316  63.192  1.00 38.18  ? 715  THR C CA    1 
ATOM   9236  C  C     . THR C 2  715  ? 39.541  17.067  62.125  1.00 42.93  ? 715  THR C C     1 
ATOM   9237  O  O     . THR C 2  715  ? 40.767  17.173  62.200  1.00 46.22  ? 715  THR C O     1 
ATOM   9238  C  CB    . THR C 2  715  ? 37.734  17.281  63.824  1.00 38.26  ? 715  THR C CB    1 
ATOM   9239  O  OG1   . THR C 2  715  ? 38.346  18.556  64.048  1.00 42.88  ? 715  THR C OG1   1 
ATOM   9240  C  CG2   . THR C 2  715  ? 37.212  16.728  65.140  1.00 42.50  ? 715  THR C CG2   1 
ATOM   9241  N  N     . LYS C 2  716  ? 38.827  17.597  61.138  1.00 38.74  ? 716  LYS C N     1 
ATOM   9242  C  CA    . LYS C 2  716  ? 39.456  18.344  60.058  1.00 42.81  ? 716  LYS C CA    1 
ATOM   9243  C  C     . LYS C 2  716  ? 39.661  19.798  60.455  1.00 48.54  ? 716  LYS C C     1 
ATOM   9244  O  O     . LYS C 2  716  ? 40.402  20.538  59.805  1.00 48.47  ? 716  LYS C O     1 
ATOM   9245  C  CB    . LYS C 2  716  ? 38.612  18.248  58.789  1.00 35.13  ? 716  LYS C CB    1 
ATOM   9246  C  CG    . LYS C 2  716  ? 38.382  16.822  58.352  1.00 37.00  ? 716  LYS C CG    1 
ATOM   9247  C  CD    . LYS C 2  716  ? 37.787  16.736  56.968  1.00 35.11  ? 716  LYS C CD    1 
ATOM   9248  C  CE    . LYS C 2  716  ? 37.841  15.302  56.479  1.00 39.32  ? 716  LYS C CE    1 
ATOM   9249  N  NZ    . LYS C 2  716  ? 39.240  14.783  56.484  1.00 26.78  ? 716  LYS C NZ    1 
ATOM   9250  N  N     . LEU C 2  717  ? 38.994  20.195  61.532  1.00 44.69  ? 717  LEU C N     1 
ATOM   9251  C  CA    . LEU C 2  717  ? 39.090  21.551  62.055  1.00 40.01  ? 717  LEU C CA    1 
ATOM   9252  C  C     . LEU C 2  717  ? 40.125  21.624  63.173  1.00 37.09  ? 717  LEU C C     1 
ATOM   9253  O  O     . LEU C 2  717  ? 40.303  22.665  63.805  1.00 33.07  ? 717  LEU C O     1 
ATOM   9254  C  CB    . LEU C 2  717  ? 37.725  22.039  62.543  1.00 34.53  ? 717  LEU C CB    1 
ATOM   9255  C  CG    . LEU C 2  717  ? 36.747  22.552  61.479  1.00 42.71  ? 717  LEU C CG    1 
ATOM   9256  C  CD1   . LEU C 2  717  ? 36.382  21.490  60.446  1.00 38.15  ? 717  LEU C CD1   1 
ATOM   9257  C  CD2   . LEU C 2  717  ? 35.493  23.093  62.141  1.00 50.07  ? 717  LEU C CD2   1 
ATOM   9258  N  N     . GLY C 2  718  ? 40.815  20.510  63.397  1.00 38.79  ? 718  GLY C N     1 
ATOM   9259  C  CA    . GLY C 2  718  ? 41.735  20.377  64.513  1.00 38.06  ? 718  GLY C CA    1 
ATOM   9260  C  C     . GLY C 2  718  ? 41.211  19.407  65.556  1.00 38.94  ? 718  GLY C C     1 
ATOM   9261  O  O     . GLY C 2  718  ? 40.010  19.142  65.622  1.00 39.98  ? 718  GLY C O     1 
ATOM   9262  N  N     . PRO C 2  719  ? 42.115  18.866  66.381  1.00 33.97  ? 719  PRO C N     1 
ATOM   9263  C  CA    . PRO C 2  719  ? 41.775  17.787  67.312  1.00 34.85  ? 719  PRO C CA    1 
ATOM   9264  C  C     . PRO C 2  719  ? 40.965  18.242  68.523  1.00 36.13  ? 719  PRO C C     1 
ATOM   9265  O  O     . PRO C 2  719  ? 41.222  19.307  69.087  1.00 32.74  ? 719  PRO C O     1 
ATOM   9266  C  CB    . PRO C 2  719  ? 43.149  17.297  67.771  1.00 35.00  ? 719  PRO C CB    1 
ATOM   9267  C  CG    . PRO C 2  719  ? 43.995  18.519  67.731  1.00 35.77  ? 719  PRO C CG    1 
ATOM   9268  C  CD    . PRO C 2  719  ? 43.514  19.302  66.532  1.00 42.17  ? 719  PRO C CD    1 
ATOM   9269  N  N     . GLU C 2  720  ? 39.995  17.425  68.920  1.00 34.77  ? 720  GLU C N     1 
ATOM   9270  C  CA    . GLU C 2  720  ? 39.365  17.584  70.219  1.00 27.17  ? 720  GLU C CA    1 
ATOM   9271  C  C     . GLU C 2  720  ? 40.390  17.122  71.235  1.00 32.81  ? 720  GLU C C     1 
ATOM   9272  O  O     . GLU C 2  720  ? 41.226  16.270  70.934  1.00 37.12  ? 720  GLU C O     1 
ATOM   9273  C  CB    . GLU C 2  720  ? 38.114  16.719  70.324  1.00 21.18  ? 720  GLU C CB    1 
ATOM   9274  C  CG    . GLU C 2  720  ? 37.055  17.033  69.291  1.00 29.51  ? 720  GLU C CG    1 
ATOM   9275  C  CD    . GLU C 2  720  ? 35.842  16.132  69.410  1.00 37.55  ? 720  GLU C CD    1 
ATOM   9276  O  OE1   . GLU C 2  720  ? 36.013  14.943  69.766  1.00 29.51  ? 720  GLU C OE1   1 
ATOM   9277  O  OE2   . GLU C 2  720  ? 34.717  16.617  69.152  1.00 34.85  ? 720  GLU C OE2   1 
ATOM   9278  N  N     . ARG C 2  721  ? 40.347  17.682  72.435  1.00 33.19  ? 721  ARG C N     1 
ATOM   9279  C  CA    . ARG C 2  721  ? 41.290  17.259  73.458  1.00 37.40  ? 721  ARG C CA    1 
ATOM   9280  C  C     . ARG C 2  721  ? 40.706  17.349  74.861  1.00 39.11  ? 721  ARG C C     1 
ATOM   9281  O  O     . ARG C 2  721  ? 39.917  18.246  75.172  1.00 32.92  ? 721  ARG C O     1 
ATOM   9282  C  CB    . ARG C 2  721  ? 42.607  18.037  73.348  1.00 39.59  ? 721  ARG C CB    1 
ATOM   9283  C  CG    . ARG C 2  721  ? 42.466  19.540  73.470  1.00 31.90  ? 721  ARG C CG    1 
ATOM   9284  C  CD    . ARG C 2  721  ? 43.543  20.255  72.666  1.00 43.72  ? 721  ARG C CD    1 
ATOM   9285  N  NE    . ARG C 2  721  ? 43.463  21.706  72.816  1.00 65.51  ? 721  ARG C NE    1 
ATOM   9286  C  CZ    . ARG C 2  721  ? 42.574  22.479  72.197  1.00 60.14  ? 721  ARG C CZ    1 
ATOM   9287  N  NH1   . ARG C 2  721  ? 41.673  21.945  71.381  1.00 50.46  ? 721  ARG C NH1   1 
ATOM   9288  N  NH2   . ARG C 2  721  ? 42.582  23.791  72.401  1.00 51.19  ? 721  ARG C NH2   1 
ATOM   9289  N  N     . ILE C 2  722  ? 41.098  16.398  75.700  1.00 33.44  ? 722  ILE C N     1 
ATOM   9290  C  CA