data_4OIO
# 
_entry.id   4OIO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OIO         
NDB   NA2887       
RCSB  RCSB084541   
WWPDB D_1000084541 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OIN . unspecified 
PDB 4OIP . unspecified 
PDB 4OIQ . unspecified 
PDB 4OIR . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4OIO 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
'Arnold, E.'    3 
# 
_citation.id                        primary 
_citation.title                     
;GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
;
_citation.journal_abbrev            Elife 
_citation.journal_volume            3 
_citation.page_first                e02450 
_citation.page_last                 e02450 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24755292 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.'            1  
primary 'Degen, D.'            2  
primary 'Ho, M.X.'             3  
primary 'Sineva, E.'           4  
primary 'Ebright, K.Y.'        5  
primary 'Ebright, Y.W.'        6  
primary 'Mekler, V.'           7  
primary 'Vahedian-Movahed, H.' 8  
primary 'Feng, Y.'             9  
primary 'Yin, R.'              10 
primary 'Tuske, S.'            11 
primary 'Irschik, H.'          12 
primary 'Jansen, R.'           13 
primary 'Maffioli, S.'         14 
primary 'Donadio, S.'          15 
primary 'Arnold, E.'           16 
primary 'Ebright, R.H.'        17 
# 
_cell.entry_id           4OIO 
_cell.length_a           184.110 
_cell.length_b           103.780 
_cell.length_c           296.090 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.86 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4OIO 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                 35056.164  2   
2.7.7.6 ? ? ?                                 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                  125436.539 1   
2.7.7.6 ? ? ?                                 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1   2.7.7.6 ? ? ?                                 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                 11533.316  1   
2.7.7.6 ? ? ?                                 
5  polymer     man 'DNA directed RNA polymerase sigma factor A'                                                50769.398  1   ? ? 
? ?                                 
6  polymer     syn "5'-D(*CP*CP*TP*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*GP*GP*G)-3'"                   6480.172   1   ? ? 
? 'promoter DNA template strand'    
7  polymer     syn "5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G)-3'" 8421.432   1   ? ? 
? 'promoter DNA nontemplate strand' 
8  non-polymer syn 'ZINC ION'                                                                                  65.409     2   ? ? 
? ?                                 
9  non-polymer syn 'MAGNESIUM ION'                                                                             24.305     2   ? ? 
? ?                                 
10 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                                                                 507.181    1   ? ? 
? ?                                 
11 non-polymer syn "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]methyl}phosphoryl]cytidine"         481.184    1   ? ? 
? ?                                 
12 water       nat water                                                                                       18.015     215 ? ? 
? ?                                 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha, RNA polymerase subunit alpha, Transcriptase subunit alpha' 
2 'RNAP subunit beta, RNA polymerase subunit beta, Transcriptase subunit beta'    
3 
;RNAP subunit beta', RNA polymerase subunit beta', Transcriptase subunit beta'
;
4 'RNAP omega subunit, RNA polymerase omega subunit, Transcriptase subunit omega' 
5 'RNA polymerase sigma factor'                                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)
(DG)
;
CCTGCATCCGTGAGTCGAGGG G   ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
6 20   DG  n 
6 21   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rpoD, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB8 / ATCC 27634 / DSM 579' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THET8   Q5SHR6 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8   Q8RQE9 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8   Q8RQE8 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8   Q8RQE7 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 UNP Q5SKW1_THET8 Q5SKW1 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 ? 
6 PDB 4OIO         4OIO   6 CCTGCATCCGTGAGTCGAGGG 1 ? 
7 PDB 4OIO         4OIO   7 TATAATGGGAGCTGTCACGGATGCAGG 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4OIO A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2 1 4OIO B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3 2 4OIO C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4 3 4OIO D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5 4 4OIO E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6 5 4OIO F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7 6 4OIO G 1  ? 21   ? 4OIO   1 ? 21   ? 1 21   
8 7 4OIO H 1  ? 27   ? 4OIO   1 ? 27   ? 1 27   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6 4OIO MET F 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 1  
6 4OIO GLY F 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 2  
6 4OIO SER F 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 3  
6 4OIO SER F 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 4  
6 4OIO HIS F 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 5  
6 4OIO HIS F 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 6  
6 4OIO HIS F 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 7  
6 4OIO HIS F 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 8  
6 4OIO HIS F 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 9  
6 4OIO HIS F 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 10 
6 4OIO SER F 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  11 
6 4OIO SER F 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  12 
6 4OIO GLY F 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  13 
6 4OIO LEU F 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  14 
6 4OIO VAL F 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  15 
6 4OIO PRO F 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  16 
6 4OIO ARG F 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  17 
6 4OIO GLY F 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  18 
6 4OIO SER F 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  19 
6 4OIO HIS F 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2TM non-polymer         . "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]methyl}phosphoryl]cytidine" CMPcPP 
'C10 H18 N3 O13 P3' 481.184 
ALA 'L-peptide linking' y ALANINE                                                                             ?      'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                            ?      
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                          ?      'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                     ?      'C4 H7 N O4' 
133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"                                                         ?      
'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                                                                            ?      
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                ?      
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                 ?      
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                ?      
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                        ?      
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                           ?      
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                     ?      'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                             ?      'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                           ?      
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                               ?      'H2 O' 18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                                                          ?      'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                             ?      'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                              ?      
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                          ?      
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                     ?      'Mg 2' 24.305 
PHE 'L-peptide linking' y PHENYLALANINE                                                                       ?      'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                             ?      'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                              ?      'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                           ?      'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                          ?      
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                            ?      'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                              ?      'C5 H11 N O2' 
117.146 
ZN  non-polymer         . 'ZINC ION'                                                                          ?      'Zn 2' 65.409 
# 
_exptl.entry_id          4OIO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.15 
_exptl_crystal.density_percent_sol   60.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl, pH 8.4, 200 mM potassium chloride, 50 mM magnesium chloride, 9.5% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-10-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     4OIO 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.10 
_reflns.number_obs                   100364 
_reflns.number_all                   100364 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.146 
_reflns.pdbx_Rsym_value              0.146 
_reflns.pdbx_netI_over_sigmaI        11.3 
_reflns.B_iso_Wilson_estimate        59.22 
_reflns.pdbx_redundancy              6.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.10 
_reflns_shell.d_res_low              3.15 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           1 
_reflns_shell.pdbx_Rsym_value        1 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        5.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4976 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4OIO 
_refine.ls_number_reflns_obs                     95176 
_refine.ls_number_reflns_all                     100364 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.919 
_refine.ls_d_res_high                            3.100 
_refine.ls_percent_reflns_obs                    96.1 
_refine.ls_R_factor_obs                          0.2061 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2050 
_refine.ls_R_factor_R_free                       0.2555 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.22 
_refine.ls_number_reflns_R_free                  2109 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.9 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4G7H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'ISOTROPIC TEMPERATURE FACTORS' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.46 
_refine.pdbx_overall_phase_error                 27.26 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27535 
_refine_hist.pdbx_number_atoms_nucleic_acid   826 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             215 
_refine_hist.number_atoms_total               28640 
_refine_hist.d_res_high                       3.100 
_refine_hist.d_res_low                        48.919 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.004  ? ? 29046 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.827  ? ? 39449 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 14.582 ? ? 11283 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.060  ? ? 4433  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 5021  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.100  3.1724  2742 0.2717 42.0  0.3201 . . 62  . . . . 'X-RAY DIFFRACTION' 
. 3.1724 3.2517  5175 0.2983 80.0  0.3319 . . 121 . . . . 'X-RAY DIFFRACTION' 
. 3.2517 3.3396  6528 0.2954 99.0  0.3503 . . 134 . . . . 'X-RAY DIFFRACTION' 
. 3.3396 3.4378  6465 0.2749 100.0 0.3847 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 3.4378 3.5488  6556 0.2603 100.0 0.3616 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 3.5488 3.6756  6479 0.2389 100.0 0.2898 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 3.6756 3.8227  6510 0.2250 100.0 0.2859 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 3.8227 3.9966  6542 0.2115 100.0 0.2881 . . 152 . . . . 'X-RAY DIFFRACTION' 
. 3.9966 4.2072  6545 0.1927 100.0 0.2588 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 4.2072 4.4706  6505 0.1772 100.0 0.2318 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 4.4706 4.8155  6564 0.1704 100.0 0.2216 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 4.8155 5.2996  6556 0.1729 100.0 0.2262 . . 152 . . . . 'X-RAY DIFFRACTION' 
. 5.2996 6.0652  6546 0.1859 100.0 0.2485 . . 151 . . . . 'X-RAY DIFFRACTION' 
. 6.0652 7.6369  6622 0.1922 100.0 0.2094 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 7.6369 48.9250 6732 0.1671 100.0 0.1847 . . 155 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OIO 
_struct.title                     
'Crystal structure of Thermus thermophilus pre-insertion substrate complex for de novo transcription initiation' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase subunit alpha (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta' (E.C.2.7.7.6), DNA-directed RNA polymerase subunit omega (E.C.2.7.7.6), DNA directed RNA polymerase sigma factor A
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OIO 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE' 
_struct_keywords.text            
;de novo transcription initiation, substrate complex, transcription initiation, i site, i+1 site, RNA polymerase, DNA/RNA/NTP binding, polymerization of ribonucleotides, nucleoid, TRANSCRIPTION, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 8  ? 
K N N 9  ? 
L N N 9  ? 
M N N 10 ? 
N N N 11 ? 
O N N 12 ? 
P N N 12 ? 
Q N N 12 ? 
R N N 12 ? 
S N N 12 ? 
T N N 12 ? 
U N N 12 ? 
V N N 12 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   2   ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   3   ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   6   TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   7   GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   8   ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   9   ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  10  PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  11  THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P12  12  TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P13  13  THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P14  14  PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P15  15  GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P16  16  PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P17  17  LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P18  18  ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P19  19  TYR C 214  ? GLN C 219  ? TYR C 214  GLN C 219  1 ? 6  
HELX_P HELX_P20  20  GLY C 220  ? MET C 222  ? GLY C 220  MET C 222  5 ? 3  
HELX_P HELX_P21  21  ASP C 223  ? MET C 229  ? ASP C 223  MET C 229  1 ? 7  
HELX_P HELX_P22  22  ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P23  23  LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P24  24  GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P25  25  VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P26  26  THR C 335  ? MET C 361  ? THR C 335  MET C 361  1 ? 27 
HELX_P HELX_P27  27  THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P28  28  SER C 375  ? ARG C 388  ? SER C 375  ARG C 388  1 ? 14 
HELX_P HELX_P29  29  ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P30  30  GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P31  31  HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P32  32  THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P33  33  SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P34  34  SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P35  35  ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P36  36  PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P37  37  ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P38  38  LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P39  39  ASN C 683  ? ASP C 686  ? ASN C 683  ASP C 686  5 ? 4  
HELX_P HELX_P40  40  GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P41  41  SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P42  42  THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P43  43  PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P44  44  GLY C 875  ? MET C 880  ? GLY C 875  MET C 880  1 ? 6  
HELX_P HELX_P45  45  LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P46  46  LYS C 910  ? PHE C 926  ? LYS C 910  PHE C 926  1 ? 17 
HELX_P HELX_P47  47  PHE C 926  ? GLU C 932  ? PHE C 926  GLU C 932  1 ? 7  
HELX_P HELX_P48  48  ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P49  49  THR C 958  ? GLN C 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P50  50  MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P51  51  GLY C 1033 ? TYR C 1043 ? GLY C 1033 TYR C 1043 1 ? 11 
HELX_P HELX_P52  52  ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P53  53  ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P54  54  PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P55  55  SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P56  56  ILE D 84   ? ARG D 89   ? ILE D 84   ARG D 89   1 ? 6  
HELX_P HELX_P57  57  ILE D 102  ? VAL D 105  ? ILE D 102  VAL D 105  5 ? 4  
HELX_P HELX_P58  58  SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P59  59  SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P60  60  THR D 154  ? TYR D 163  ? THR D 154  TYR D 163  1 ? 10 
HELX_P HELX_P61  61  GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P62  62  ASP D 469  ? GLU D 480  ? ASP D 469  GLU D 480  1 ? 12 
HELX_P HELX_P63  63  SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P64  64  ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P65  65  PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P66  66  ASP D 539  ? GLN D 560  ? ASP D 539  GLN D 560  1 ? 22 
HELX_P HELX_P67  67  PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P68  68  SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P69  69  GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P70  70  LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P71  71  PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P72  72  ASN D 669  ? GLU D 678  ? ASN D 669  GLU D 678  1 ? 10 
HELX_P HELX_P73  73  ARG D 679  ? ILE D 683  ? ARG D 679  ILE D 683  5 ? 5  
HELX_P HELX_P74  74  LYS D 684  ? ILE D 695  ? LYS D 684  ILE D 695  1 ? 12 
HELX_P HELX_P75  75  HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P76  76  HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P77  77  VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P78  78  SER D 752  ? MET D 763  ? SER D 752  MET D 763  1 ? 12 
HELX_P HELX_P79  79  LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P80  80  SER D 782  ? GLN D 794  ? SER D 782  GLN D 794  1 ? 13 
HELX_P HELX_P81  81  THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P82  82  SER D 835  ? TYR D 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P83  83  ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P84  84  SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P85  85  ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P86  86  GLU D 907  ? LEU D 922  ? GLU D 907  LEU D 922  1 ? 16 
HELX_P HELX_P87  87  GLY D 923  ? SER D 945  ? GLY D 923  SER D 945  1 ? 23 
HELX_P HELX_P88  88  GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P89  89  GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P90  90  THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P91  91  ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P92  92  ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P93  93  THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P94  94  LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P95  95  SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P96  96  CYS D 1201 ? GLY D 1206 ? CYS D 1201 GLY D 1206 1 ? 6  
HELX_P HELX_P97  97  ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P98  98  PRO D 1232 ? GLN D 1235 ? PRO D 1232 GLN D 1235 5 ? 4  
HELX_P HELX_P99  99  GLY D 1255 ? GLU D 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P100 100 ASP D 1331 ? LYS D 1339 ? ASP D 1331 LYS D 1339 1 ? 9  
HELX_P HELX_P101 101 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P102 102 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P103 103 LYS D 1397 ? ILE D 1408 ? LYS D 1397 ILE D 1408 1 ? 12 
HELX_P HELX_P104 104 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P105 105 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P106 106 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P107 107 GLY D 1461 ? LEU D 1468 ? GLY D 1461 LEU D 1468 1 ? 8  
HELX_P HELX_P108 108 ALA D 1474 ? GLY D 1477 ? ALA D 1474 GLY D 1477 5 ? 4  
HELX_P HELX_P109 109 SER D 1478 ? PHE D 1483 ? SER D 1478 PHE D 1483 1 ? 6  
HELX_P HELX_P110 110 GLN D 1489 ? ALA D 1498 ? GLN D 1489 ALA D 1498 1 ? 10 
HELX_P HELX_P111 111 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P112 112 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P113 113 ASN E 59   ? THR E 70   ? ASN E 59   THR E 70   1 ? 12 
HELX_P HELX_P114 114 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P115 115 ASP F 99   ? GLY F 109  ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P116 116 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P117 117 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P118 118 ASP F 172  ? SER F 185  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P119 119 PRO F 187  ? LYS F 220  ? PRO F 167  LYS F 200  1 ? 34 
HELX_P HELX_P120 120 LYS F 221  ? GLY F 226  ? LYS F 201  GLY F 206  5 ? 6  
HELX_P HELX_P121 121 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P122 122 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P123 123 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P124 124 THR F 307  ? GLY F 316  ? THR F 287  GLY F 296  1 ? 10 
HELX_P HELX_P125 125 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P126 126 PHE F 348  ? ILE F 353  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P127 127 SER F 360  ? LEU F 378  ? SER F 340  LEU F 358  1 ? 19 
HELX_P HELX_P128 128 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P129 129 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P130 130 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ASP 739  OD2 ? ? ? 1_555 K MG  .  MG    ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?               1.980 ? 
metalc2  metalc ? ? K MG  .    MG  ? ? ? 1_555 M ATP .  "O3'" ? ? D MG  2003 D ATP 2005 1_555 ? ? ? ? ? ? ?               1.981 ? 
metalc3  metalc ? ? D ASP 743  OD1 ? ? ? 1_555 K MG  .  MG    ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?               2.078 ? 
metalc4  metalc ? ? L MG  .    MG  ? ? ? 1_555 N 2TM .  O1B   ? ? D MG  2004 D 2TM 2006 1_555 ? ? ? ? ? ? ?               2.105 ? 
metalc5  metalc ? ? L MG  .    MG  ? ? ? 1_555 N 2TM .  O3G   ? ? D MG  2004 D 2TM 2006 1_555 ? ? ? ? ? ? ?               2.131 ? 
metalc6  metalc ? ? D ASP 739  OD1 ? ? ? 1_555 L MG  .  MG    ? ? D ASP 739  D MG  2004 1_555 ? ? ? ? ? ? ?               2.134 ? 
metalc7  metalc ? ? D ASP 741  OD1 ? ? ? 1_555 K MG  .  MG    ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?               2.222 ? 
metalc8  metalc ? ? D CYS 1204 SG  ? ? ? 1_555 I ZN  .  ZN    ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?               2.229 ? 
metalc9  metalc ? ? D CYS 1194 SG  ? ? ? 1_555 I ZN  .  ZN    ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?               2.246 ? 
metalc10 metalc ? ? D CYS 1112 SG  ? ? ? 1_555 I ZN  .  ZN    ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?               2.249 ? 
metalc11 metalc ? ? D CYS 76   SG  ? ? ? 1_555 J ZN  .  ZN    ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?               2.260 ? 
metalc12 metalc ? ? D CYS 73   SG  ? ? ? 1_555 J ZN  .  ZN    ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?               2.316 ? 
metalc13 metalc ? ? D CYS 60   SG  ? ? ? 1_555 J ZN  .  ZN    ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?               2.326 ? 
metalc14 metalc ? ? D CYS 1201 SG  ? ? ? 1_555 I ZN  .  ZN    ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?               2.353 ? 
metalc15 metalc ? ? D CYS 58   SG  ? ? ? 1_555 J ZN  .  ZN    ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?               2.412 ? 
hydrog1  hydrog ? ? G DG  4    N1  ? ? ? 1_555 H DC  24 N3    ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? G DG  4    N2  ? ? ? 1_555 H DC  24 O2    ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? G DG  4    O6  ? ? ? 1_555 H DC  24 N4    ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? G DC  5    N3  ? ? ? 1_555 H DG  23 N1    ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? G DC  5    N4  ? ? ? 1_555 H DG  23 O6    ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? G DC  5    O2  ? ? ? 1_555 H DG  23 N2    ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? G DA  6    N1  ? ? ? 1_555 H DT  22 N3    ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog8  hydrog ? ? G DT  7    N3  ? ? ? 1_555 H DA  21 N1    ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? G DT  7    O4  ? ? ? 1_555 H DA  21 N6    ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? G DC  8    N4  ? ? ? 1_555 H DG  19 O6    ? ? G DC  8    H DG  19   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog11 hydrog ? ? G DC  8    O2  ? ? ? 1_555 H DG  20 N1    ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog12 hydrog ? ? G DC  9    O2  ? ? ? 1_555 H DG  19 N2    ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog13 hydrog ? ? G DG  10   N1  ? ? ? 1_555 H DA  17 N1    ? ? G DG  10   H DA  17   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog14 hydrog ? ? G DG  10   O6  ? ? ? 1_555 H DA  17 N6    ? ? G DG  10   H DA  17   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog15 hydrog ? ? G DG  10   N2  ? ? ? 1_555 H DC  18 N3    ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog16 hydrog ? ? G DT  11   O4  ? ? ? 1_555 H DC  16 N4    ? ? G DT  11   H DC  16   1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog17 hydrog ? ? G DT  11   N3  ? ? ? 1_555 H DA  17 N1    ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog18 hydrog ? ? G DG  12   O6  ? ? ? 1_555 H DT  15 N3    ? ? G DG  12   H DT  15   1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog19 hydrog ? ? G DG  12   N1  ? ? ? 1_555 H DC  16 O2    ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -9.07  
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -10.38 
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 0.11   
4 ASP 295 C . ? ASP 295 C GLY 296 C ? GLY 296 C 1 -6.87  
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -3.32  
6 ALA 802 D . ? ALA 802 D GLY 803 D ? GLY 803 D 1 -2.49  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 3 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 8 ? 
Y  ? 4 ? 
Z  ? 2 ? 
AA ? 2 ? 
AB ? 2 ? 
AC ? 3 ? 
AD ? 2 ? 
AE ? 3 ? 
AF ? 5 ? 
AG ? 4 ? 
AH ? 3 ? 
AI ? 4 ? 
AJ ? 3 ? 
AK ? 4 ? 
AL ? 3 ? 
AM ? 7 ? 
AN ? 3 ? 
AO ? 2 ? 
AP ? 2 ? 
AQ ? 2 ? 
AR ? 2 ? 
AS ? 4 ? 
AT ? 3 ? 
AU ? 2 ? 
AV ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? parallel      
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? parallel      
X  5 6 ? anti-parallel 
X  6 7 ? parallel      
X  7 8 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? parallel      
AM 1 2 ? parallel      
AM 2 3 ? anti-parallel 
AM 3 4 ? parallel      
AM 4 5 ? anti-parallel 
AM 5 6 ? anti-parallel 
AM 6 7 ? anti-parallel 
AN 1 2 ? parallel      
AN 2 3 ? anti-parallel 
AO 1 2 ? parallel      
AP 1 2 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AR 1 2 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
A  2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
A  3 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
A  4 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
B  1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
B  2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
B  3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
B  4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
C  1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
C  2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
D  1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
D  2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
E  1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
E  2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
F  1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
F  2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
F  3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
F  4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
G  1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
G  2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
G  3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
G  4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
H  1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
H  2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
I  1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
I  2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
J  1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
J  2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
K  1 ILE C 3    ? ARG C 5    ? ILE C 3    ARG C 5    
K  2 ARG C 900  ? ILE C 902  ? ARG C 900  ILE C 902  
K  3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
L  1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
L  2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
L  3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
M  1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
M  2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
M  3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
N  1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
N  2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
N  3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
N  4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
O  1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
O  2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
O  3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
O  4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
O  5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
P  1 ALA C 291  ? ARG C 292  ? ALA C 291  ARG C 292  
P  2 LYS C 299  ? ASP C 300  ? LYS C 299  ASP C 300  
Q  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
Q  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
Q  3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
R  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
R  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
R  3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
R  4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
R  5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
R  6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
S  1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
S  2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
T  1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
T  2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
T  3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
U  1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
U  2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
U  3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
U  4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
V  1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
V  2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
W  1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
W  2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
X  1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
X  2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
X  3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
X  4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
X  5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
X  6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
X  7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
X  8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
Y  1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
Y  2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
Y  3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
Y  4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
Z  1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
Z  2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AA 1 THR C 759  ? PHE C 761  ? THR C 759  PHE C 761  
AA 2 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AB 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AB 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AC 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AC 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AC 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AD 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AE 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AE 2 TYR D 132  ? LEU D 135  ? TYR D 132  LEU D 135  
AE 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AF 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AF 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AF 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AF 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AF 5 ARG D 318  ? GLU D 327  ? ARG D 318  GLU D 327  
AG 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AG 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AG 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AG 4 ALA D 359  ? VAL D 361  ? ALA D 359  VAL D 361  
AH 1 ILE D 241  ? ARG D 252  ? ILE D 241  ARG D 252  
AH 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AH 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AI 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AI 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AI 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AI 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AJ 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AJ 2 ASP D 365  ? ALA D 369  ? ASP D 365  ALA D 369  
AJ 3 VAL D 377  ? ALA D 379  ? VAL D 377  ALA D 379  
AK 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AK 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AK 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AK 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AL 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AL 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AL 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AM 1 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AM 2 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AM 3 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AM 4 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AM 5 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AM 6 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AM 7 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AN 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AN 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AN 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AO 1 VAL D 1106 ? VAL D 1107 ? VAL D 1106 VAL D 1107 
AO 2 GLY D 1199 ? VAL D 1200 ? GLY D 1199 VAL D 1200 
AP 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AP 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AQ 1 PHE D 1123 ? GLN D 1124 ? PHE D 1123 GLN D 1124 
AQ 2 ARG D 1133 ? LEU D 1134 ? ARG D 1133 LEU D 1134 
AR 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AR 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AS 1 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AS 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AS 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AS 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AT 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AT 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AT 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AU 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AU 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AV 1 LYS E 47   ? MET E 48   ? LYS E 47   MET E 48   
AV 2 PHE E 55   ? ASP E 56   ? PHE E 55   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
A  2 3 N PHE A 23   ? N PHE A 23   O LEU A 197  ? O LEU A 197  
A  3 4 O ARG A 198  ? O ARG A 198  N ALA A 178  ? N ALA A 178  
B  1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
B  2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
B  3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
C  1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
D  1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
E  1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
F  1 2 N THR B 12   ? N THR B 12   O VAL B 24   ? O VAL B 24   
F  2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
F  3 4 O TRP B 200  ? O TRP B 200  N ARG B 175  ? N ARG B 175  
G  1 2 N LEU B 101  ? N LEU B 101  O MET B 140  ? O MET B 140  
G  2 3 O ARG B 143  ? O ARG B 143  N THR B 54   ? N THR B 54   
G  3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
H  1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
I  1 2 N LYS B 107  ? N LYS B 107  O LEU B 132  ? O LEU B 132  
J  1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
K  1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
K  2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
L  1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
L  2 3 N LEU C 94   ? N LEU C 94   O LEU C 115  ? O LEU C 115  
M  1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
M  2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
N  1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
N  2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
N  3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
O  1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
O  2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
O  3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
O  4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
P  1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
Q  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
Q  2 3 N TYR C 471  ? N TYR C 471  O VAL C 484  ? O VAL C 484  
R  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
R  2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
R  3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
R  4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
R  5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
S  1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
T  1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
T  2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
U  1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
U  2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
U  3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
V  1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
W  1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
X  1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
X  2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
X  3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
X  4 5 O LYS C 851  ? O LYS C 851  N ILE C 690  ? N ILE C 690  
X  5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
X  6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
X  7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
Y  1 2 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
Y  2 3 O VAL C 822  ? O VAL C 822  N LEU C 806  ? N LEU C 806  
Y  3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
Z  1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AA 1 2 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AB 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AC 1 2 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AC 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AE 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AE 2 3 N LEU D 135  ? N LEU D 135  O ASP D 453  ? O ASP D 453  
AF 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AF 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AF 3 4 N LEU D 225  ? N LEU D 225  O VAL D 331  ? O VAL D 331  
AF 4 5 O THR D 334  ? O THR D 334  N GLU D 323  ? N GLU D 323  
AG 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AG 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AG 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AH 1 2 N PHE D 251  ? N PHE D 251  O LEU D 304  ? O LEU D 304  
AH 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AI 1 2 O VAL D 279  ? O VAL D 279  N LEU D 272  ? N LEU D 272  
AI 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AI 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AJ 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AJ 2 3 N ASP D 365  ? N ASP D 365  O ALA D 379  ? O ALA D 379  
AK 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AK 2 3 O VAL D 443  ? O VAL D 443  N ASP D 438  ? N ASP D 438  
AK 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AL 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AL 2 3 N THR D 537  ? N THR D 537  O VAL F 335  ? O VAL F 315  
AM 1 2 N VAL D 632  ? N VAL D 632  O LEU D 728  ? O LEU D 728  
AM 2 3 O GLN D 727  ? O GLN D 727  N GLY D 643  ? N GLY D 643  
AM 3 4 N LEU D 644  ? N LEU D 644  O VAL D 719  ? O VAL D 719  
AM 4 5 O GLN D 714  ? O GLN D 714  N LEU D 702  ? N LEU D 702  
AM 5 6 N LEU D 701  ? N LEU D 701  O HIS D 748  ? O HIS D 748  
AM 6 7 O MET D 745  ? O MET D 745  N SER D 629  ? N SER D 629  
AN 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AN 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AO 1 2 N VAL D 1106 ? N VAL D 1106 O VAL D 1200 ? O VAL D 1200 
AP 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AQ 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AR 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AS 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AS 2 3 O SER D 1291 ? O SER D 1291 N GLU D 1284 ? N GLU D 1284 
AS 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AT 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AT 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AU 1 2 N VAL D 1487 ? N VAL D 1487 O VAL E 74   ? O VAL E 74   
AV 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 2001'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 2002'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG D 2003'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 2004'  
AC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ATP D 2005' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 2TM D 2006' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
2  AC1 4  CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
3  AC1 4  CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
4  AC1 4  CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
5  AC2 4  CYS D 58   ? CYS D 58   . ? 1_555 ? 
6  AC2 4  CYS D 60   ? CYS D 60   . ? 1_555 ? 
7  AC2 4  CYS D 73   ? CYS D 73   . ? 1_555 ? 
8  AC2 4  CYS D 76   ? CYS D 76   . ? 1_555 ? 
9  AC3 4  ASP D 739  ? ASP D 739  . ? 1_555 ? 
10 AC3 4  ASP D 741  ? ASP D 741  . ? 1_555 ? 
11 AC3 4  ASP D 743  ? ASP D 743  . ? 1_555 ? 
12 AC3 4  ATP M .    ? ATP D 2005 . ? 1_555 ? 
13 AC4 3  GLU C 685  ? GLU C 685  . ? 1_555 ? 
14 AC4 3  ASP D 739  ? ASP D 739  . ? 1_555 ? 
15 AC4 3  2TM N .    ? 2TM D 2006 . ? 1_555 ? 
16 AC5 16 GLN C 567  ? GLN C 567  . ? 1_555 ? 
17 AC5 16 LYS C 838  ? LYS C 838  . ? 1_555 ? 
18 AC5 16 LYS C 846  ? LYS C 846  . ? 1_555 ? 
19 AC5 16 TYR C 998  ? TYR C 998  . ? 1_555 ? 
20 AC5 16 HIS C 999  ? HIS C 999  . ? 1_555 ? 
21 AC5 16 ARG D 704  ? ARG D 704  . ? 1_555 ? 
22 AC5 16 ASP D 741  ? ASP D 741  . ? 1_555 ? 
23 AC5 16 ASP D 743  ? ASP D 743  . ? 1_555 ? 
24 AC5 16 MG  K .    ? MG  D 2003 . ? 1_555 ? 
25 AC5 16 2TM N .    ? 2TM D 2006 . ? 1_555 ? 
26 AC5 16 HOH R .    ? HOH D 2105 . ? 1_555 ? 
27 AC5 16 HOH R .    ? HOH D 2120 . ? 1_555 ? 
28 AC5 16 HOH R .    ? HOH D 2132 . ? 1_555 ? 
29 AC5 16 HOH R .    ? HOH D 2168 . ? 1_555 ? 
30 AC5 16 DT  G 15   ? DT  G 15   . ? 1_555 ? 
31 AC5 16 DC  G 16   ? DC  G 16   . ? 1_555 ? 
32 AC6 10 ARG C 879  ? ARG C 879  . ? 1_555 ? 
33 AC6 10 ARG D 704  ? ARG D 704  . ? 1_555 ? 
34 AC6 10 PRO D 706  ? PRO D 706  . ? 1_555 ? 
35 AC6 10 ASN D 737  ? ASN D 737  . ? 1_555 ? 
36 AC6 10 ASP D 739  ? ASP D 739  . ? 1_555 ? 
37 AC6 10 ARG D 1029 ? ARG D 1029 . ? 1_555 ? 
38 AC6 10 MG  L .    ? MG  D 2004 . ? 1_555 ? 
39 AC6 10 ATP M .    ? ATP D 2005 . ? 1_555 ? 
40 AC6 10 HOH R .    ? HOH D 2167 . ? 1_555 ? 
41 AC6 10 DG  G 14   ? DG  G 14   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4OIO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4OIO 
_atom_sites.fract_transf_matrix[1][1]   0.005432 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000847 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009636 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003418 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? -16.225 17.156  144.425 1.00 73.96  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? -16.356 16.146  143.381 1.00 76.96  ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? -15.203 16.248  142.387 1.00 75.91  ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? -15.000 15.363  141.556 1.00 74.54  ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? -17.696 16.297  142.657 1.00 67.03  ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? -17.917 15.222  141.761 1.00 54.46  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? -14.452 17.340  142.484 1.00 79.37  ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? -13.295 17.577  141.629 1.00 71.55  ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? -12.039 16.946  142.223 1.00 67.65  ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? -11.674 17.233  143.364 1.00 76.24  ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? -13.091 19.084  141.448 1.00 75.88  ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? -11.662 19.511  141.146 1.00 70.84  ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? -11.370 19.515  139.656 1.00 63.00  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? -10.004 20.120  139.376 1.00 57.98  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? -10.081 21.253  138.411 1.00 56.30  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? -11.382 16.085  141.450 1.00 63.37  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? -10.140 15.459  141.894 1.00 55.22  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? -9.019  16.478  141.998 1.00 50.17  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? -9.090  17.555  141.409 1.00 55.31  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? -9.716  14.331  140.953 1.00 51.80  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? -10.190 12.925  141.314 1.00 57.47  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? -11.433 12.561  140.522 1.00 69.63  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? -9.082  11.922  141.056 1.00 46.47  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? -7.985  16.134  142.756 1.00 45.32  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? -6.843  17.020  142.930 1.00 55.40  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? -5.557  16.294  142.547 1.00 48.27  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? -5.603  15.157  142.075 1.00 46.26  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? -6.777  17.532  144.371 1.00 54.82  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? -8.092  18.113  144.883 1.00 59.15  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? -8.011  19.618  145.103 1.00 64.02  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? -9.322  20.164  145.656 1.00 57.65  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? -9.231  21.612  146.007 1.00 43.45  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? -4.419  16.953  142.754 1.00 35.97  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? -3.120  16.438  142.320 1.00 44.05  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? -2.820  15.011  142.792 1.00 44.60  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? -2.870  14.723  143.988 1.00 46.51  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? -2.007  17.385  142.754 1.00 51.21  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? -2.517  14.114  141.838 1.00 40.73  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? -2.197  12.696  142.032 1.00 38.53  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? -0.758  12.474  142.479 1.00 40.71  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? 0.096   13.333  142.255 1.00 39.73  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? -2.402  12.092  140.636 1.00 38.94  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? -2.707  13.252  139.710 1.00 43.92  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? -2.352  14.503  140.432 1.00 40.36  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? -0.492  11.328  143.096 1.00 45.10  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 0.864   11.002  143.522 1.00 53.40  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 1.727   10.614  142.328 1.00 45.27  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 1.257   9.975   141.388 1.00 42.09  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? 0.892   9.869   144.580 1.00 51.89  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? 0.205   10.318  145.863 1.00 52.34  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 0.250   8.600   144.037 1.00 53.80  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 2.992   11.013  142.367 1.00 46.98  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 3.927   10.655  141.312 1.00 46.36  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 4.833   9.519   141.773 1.00 47.99  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 5.571   9.658   142.747 1.00 54.68  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 4.768   11.866  140.908 1.00 50.50  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 5.527   11.675  139.626 1.00 52.86  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 6.568   12.521  139.290 1.00 59.21  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 5.192   10.655  138.751 1.00 51.73  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 7.268   12.345  138.109 1.00 56.60  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 5.887   10.476  137.571 1.00 51.36  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 6.925   11.325  137.249 1.00 52.78  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 4.773   8.393   141.071 1.00 41.05  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 5.631   7.257   141.384 1.00 44.32  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 6.686   7.083   140.293 1.00 44.12  ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 6.389   7.216   139.107 1.00 40.38  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 4.816   5.960   141.528 1.00 45.66  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 3.643   6.217   142.310 1.00 45.40  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 5.648   4.871   142.196 1.00 33.78  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 7.919   6.795   140.701 1.00 44.83  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 9.024   6.644   139.759 1.00 32.10  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 9.805   5.358   140.016 1.00 35.15  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 10.344  5.158   141.104 1.00 44.69  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 9.992   7.845   139.831 1.00 32.19  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 11.262  7.553   139.054 1.00 36.44  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 9.319   9.107   139.310 1.00 38.78  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 9.859   4.491   139.008 1.00 32.54  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 10.594  3.233   139.101 1.00 31.22  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 11.615  3.118   137.973 1.00 35.07  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 11.250  3.064   136.803 1.00 40.80  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 9.633   2.046   139.055 1.00 28.25  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 8.633   2.022   140.194 1.00 40.36  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 7.799   0.755   140.170 1.00 52.37  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 6.922   0.692   139.004 1.00 50.87  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 5.636   1.025   139.017 1.00 50.84  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 5.067   1.448   140.140 1.00 51.74  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 4.916   0.933   137.908 1.00 51.47  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 12.895  3.075   138.326 1.00 40.51  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 13.954  3.070   137.324 1.00 40.79  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 14.925  1.907   137.497 1.00 44.11  ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 15.450  1.681   138.587 1.00 55.37  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 14.759  4.389   137.347 1.00 45.52  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 15.438  4.520   138.604 1.00 36.65  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 13.840  5.587   137.138 1.00 39.66  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 15.157  1.174   136.413 1.00 46.60  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 16.175  0.131   136.391 1.00 53.63  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 17.289  0.545   135.440 1.00 50.24  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 17.109  0.539   134.223 1.00 54.35  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 15.571  -1.201  135.943 1.00 47.90  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 14.451  -1.703  136.841 1.00 60.77  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 13.691  -2.862  136.228 1.00 63.39  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 14.097  -3.410  135.204 1.00 65.68  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 12.576  -3.237  136.850 1.00 55.94  ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 18.443  0.894   136.001 1.00 52.17  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 19.554  1.396   135.214 1.00 48.58  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 19.259  2.735   134.563 1.00 43.97  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 18.282  3.405   134.905 1.00 35.44  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 20.114  3.128   133.623 1.00 46.18  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 19.932  4.369   132.879 1.00 44.27  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 19.129  4.125   131.607 1.00 45.98  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 18.762  5.066   130.905 1.00 42.66  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 21.288  4.977   132.508 1.00 38.97  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 22.139  5.406   133.690 1.00 43.34  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 23.477  5.967   133.232 1.00 33.48  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 23.319  7.109   132.336 1.00 34.20  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 23.218  8.370   132.744 1.00 46.66  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 23.257  8.653   134.039 1.00 52.92  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 23.076  9.349   131.859 1.00 47.26  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 18.876  2.855   131.306 1.00 47.47  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 18.243  2.479   130.045 1.00 46.21  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 16.734  2.227   130.121 1.00 43.42  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 16.105  1.936   129.105 1.00 48.36  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 18.959  1.269   129.433 1.00 47.52  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 20.440  1.516   129.159 1.00 54.84  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 21.155  0.293   128.614 1.00 64.98  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 22.386  0.369   128.407 1.00 61.97  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 20.487  -0.741  128.391 1.00 66.44  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 16.151  2.336   131.310 1.00 44.43  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 14.725  2.057   131.468 1.00 35.88  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 14.107  2.790   132.653 1.00 35.44  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 14.807  3.198   133.578 1.00 43.18  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 14.486  0.549   131.598 1.00 32.21  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 13.026  0.162   131.642 1.00 37.53  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 12.467  -0.390  132.787 1.00 43.88  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 12.201  0.367   130.543 1.00 39.20  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 11.127  -0.741  132.831 1.00 47.71  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 10.862  0.022   130.578 1.00 35.00  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 10.330  -0.533  131.722 1.00 43.89  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 8.996   -0.877  131.758 1.00 43.91  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 12.790  2.971   132.605 1.00 33.21  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 12.050  3.543   133.714 1.00 35.80  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 10.551  3.425   133.521 1.00 33.76  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 10.071  3.346   132.392 1.00 35.71  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 9.813   3.419   134.628 1.00 35.99  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 8.353   3.388   134.601 1.00 28.55  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 7.827   4.570   135.398 1.00 28.78  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 8.305   4.849   136.494 1.00 32.96  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 7.823   2.083   135.194 1.00 29.78  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 8.327   0.831   134.497 1.00 39.73  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 7.712   -0.437  135.057 1.00 47.68  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 6.883   -0.334  135.986 1.00 47.74  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 8.057   -1.534  134.568 1.00 46.48  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 6.844   5.271   134.847 1.00 30.64  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 6.364   6.499   135.466 1.00 29.21  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 4.848   6.480   135.634 1.00 30.80  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 4.106   6.449   134.654 1.00 28.26  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 6.826   7.711   134.652 1.00 26.54  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 8.322   7.803   134.507 1.00 31.65  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 9.062   8.630   135.333 1.00 39.47  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 8.991   7.049   133.555 1.00 33.45  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 10.439  8.711   135.206 1.00 37.89  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 10.366  7.122   133.426 1.00 33.85  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 11.090  7.955   134.252 1.00 33.75  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 4.398   6.495   136.886 1.00 35.91  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 2.984   6.325   137.203 1.00 32.33  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 2.345   7.604   137.732 1.00 33.45  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 2.956   8.342   138.503 1.00 41.03  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 2.777   5.215   138.250 1.00 30.30  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 1.316   4.796   138.299 1.00 30.65  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 3.660   4.025   137.940 1.00 30.64  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 1.112   7.859   137.308 1.00 29.83  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? 0.327   8.958   137.850 1.00 34.32  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? -1.078  8.472   138.201 1.00 42.57  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? -1.847  8.097   137.314 1.00 46.68  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? 0.242   10.091  136.831 1.00 26.52  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? 0.538   11.497  137.341 1.00 34.01  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 2.008   11.630  137.690 1.00 34.41  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? 0.131   12.529  136.307 1.00 41.26  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? -1.413  8.471   139.489 1.00 44.24  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? -2.756  8.088   139.925 1.00 45.30  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? -3.202  8.832   141.183 1.00 43.60  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? -2.372  9.189   142.021 1.00 39.46  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? -2.859  6.571   140.132 1.00 40.87  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? -1.906  5.996   141.168 1.00 51.10  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? -2.077  4.493   141.344 1.00 58.09  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? -3.183  3.979   141.058 1.00 45.42  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? -1.104  3.825   141.763 1.00 45.01  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? -4.518  9.078   141.315 1.00 43.68  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? -5.564  8.878   140.306 1.00 38.66  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? -5.677  10.040  139.317 1.00 42.06  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? -5.349  11.177  139.659 1.00 38.18  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? -6.837  8.768   141.145 1.00 38.49  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? -6.530  9.498   142.430 1.00 44.46  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? -5.047  9.770   142.500 1.00 49.63  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? -6.153  9.751   138.109 1.00 46.84  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? -6.432  10.783  137.114 1.00 44.60  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? -7.890  10.694  136.678 1.00 42.38  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? -8.491  9.619   136.726 1.00 42.14  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? -5.521  10.618  135.897 1.00 37.94  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? -4.044  10.973  136.058 1.00 34.85  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? -3.231  10.329  134.953 1.00 36.28  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? -3.857  12.480  136.045 1.00 40.22  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? -8.455  11.817  136.244 1.00 36.17  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? -9.840  11.838  135.786 1.00 41.22  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? -9.990  10.957  134.553 1.00 48.06  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? -9.011  10.684  133.859 1.00 48.65  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? -10.296 13.266  135.478 1.00 46.17  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? -10.702 14.085  136.701 1.00 63.23  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? -12.097 13.748  137.209 1.00 76.66  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? -12.722 12.805  136.675 1.00 77.08  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? -12.573 14.432  138.141 1.00 73.61  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? -11.211 10.498  134.297 1.00 51.14  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? -11.468 9.594   133.181 1.00 44.36  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? -11.052 10.203  131.848 1.00 46.22  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? -11.368 11.358  131.556 1.00 43.10  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? -12.945 9.203   133.129 1.00 52.55  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? -13.260 8.151   132.080 1.00 54.99  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? -14.737 7.812   132.066 1.00 60.53  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? -15.564 9.002   131.893 1.00 69.07  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? -15.900 9.515   130.714 1.00 61.31  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? -15.475 8.944   129.594 1.00 60.91  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? -16.660 10.601  130.654 1.00 48.26  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? -10.334 9.417   131.050 1.00 47.70  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? -9.892  9.846   129.736 1.00 39.13  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? -8.524  10.499  129.755 1.00 36.04  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? -7.841  10.549  128.735 1.00 44.33  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? -8.115  10.988  130.921 1.00 30.71  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? -6.830  11.667  131.055 1.00 31.39  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? -5.644  10.718  130.996 1.00 34.29  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? -4.492  11.153  131.020 1.00 33.34  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? -6.780  12.495  132.337 1.00 38.40  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? -7.261  13.900  132.158 1.00 35.85  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? -8.594  14.156  131.905 1.00 36.29  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? -6.379  14.964  132.237 1.00 31.16  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? -9.039  15.444  131.735 1.00 36.24  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? -6.822  16.260  132.070 1.00 30.93  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? -8.154  16.501  131.819 1.00 31.71  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? -5.928  9.422   130.944 1.00 38.90  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? -4.886  8.431   130.765 1.00 40.30  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? -4.142  8.662   129.465 1.00 34.44  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? -2.919  8.801   129.454 1.00 33.11  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? -4.882  8.714   128.363 1.00 32.51  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? -4.268  8.927   127.060 1.00 33.37  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? -4.161  10.408  126.710 1.00 30.90  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? -3.473  10.771  125.758 1.00 40.12  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? -5.028  8.190   125.935 1.00 32.61  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? -5.263  6.732   126.311 1.00 31.58  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? -6.338  8.877   125.651 1.00 25.69  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? -4.834  11.262  127.475 1.00 26.81  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? -4.758  12.700  127.234 1.00 28.45  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? -3.355  13.210  127.542 1.00 29.38  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? -2.784  13.983  126.778 1.00 31.47  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? -5.788  13.487  128.064 1.00 29.05  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? -7.111  13.111  127.666 1.00 32.64  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? -5.614  14.984  127.851 1.00 21.45  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? -2.814  12.787  128.678 1.00 32.56  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? -1.420  13.053  129.011 1.00 28.58  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? -0.488  12.048  128.346 1.00 30.28  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 0.597   12.402  127.888 1.00 32.96  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? -1.211  13.013  130.525 1.00 33.18  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? -1.696  14.216  131.329 1.00 38.40  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? -1.417  14.003  132.809 1.00 47.76  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? -1.032  15.490  130.828 1.00 34.58  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? -0.924  10.791  128.305 1.00 30.16  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? -0.072  9.685   127.903 1.00 35.28  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 0.485   9.752   126.496 1.00 38.31  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 1.696   9.648   126.293 1.00 37.71  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? -0.401  9.922   125.521 1.00 34.31  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? -0.003  9.933   124.113 1.00 34.04  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 0.870   11.106  123.623 1.00 25.80  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 1.853   10.876  122.921 1.00 27.83  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? -1.220  9.742   123.204 1.00 33.15  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? -0.830  9.445   121.776 1.00 30.04  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? -0.469  8.315   121.442 1.00 27.83  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? -0.902  10.459  120.922 1.00 26.53  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 0.513   12.357  123.970 1.00 22.65  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 1.332   13.488  123.517 1.00 26.63  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 2.764   13.392  124.007 1.00 29.30  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 3.691   13.723  123.269 1.00 30.28  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 0.661   14.692  124.176 1.00 20.29  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? -0.707  14.273  124.389 1.00 24.37  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? -0.674  12.822  124.704 1.00 29.58  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 2.938   12.954  125.247 1.00 28.78  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 4.271   12.756  125.792 1.00 29.86  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 5.023   11.742  124.946 1.00 28.73  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 6.182   11.954  124.600 1.00 27.98  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 4.197   12.296  127.246 1.00 34.39  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 3.739   13.379  128.222 1.00 36.91  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 3.624   12.821  129.630 1.00 34.75  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 4.693   14.569  128.176 1.00 28.74  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 4.346   10.652  124.596 1.00 27.56  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 4.949   9.616   123.770 1.00 24.96  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 5.354   10.154  122.401 1.00 25.93  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 6.401   9.787   121.869 1.00 30.67  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 4.000   8.429   123.605 1.00 25.99  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 4.575   7.337   122.731 1.00 24.92  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 3.655   6.148   122.611 1.00 24.81  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 4.215   5.168   121.688 1.00 26.80  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 4.015   5.181   120.375 1.00 25.54  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 3.256   6.123   119.830 1.00 25.96  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 4.570   4.252   119.608 1.00 24.66  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 4.525   11.026  121.836 1.00 25.28  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 4.818   11.620  120.534 1.00 24.70  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 6.027   12.550  120.604 1.00 28.06  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 6.815   12.631  119.661 1.00 29.43  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 3.598   12.367  119.987 1.00 26.12  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 2.424   11.466  119.632 1.00 25.22  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 1.277   12.257  119.025 1.00 23.48  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 1.713   13.049  117.882 1.00 24.17  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 1.821   12.576  116.646 1.00 27.28  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 1.525   11.310  116.389 1.00 25.67  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 2.230   13.367  115.665 1.00 29.79  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 6.170   13.249  121.727 1.00 27.78  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 7.309   14.137  121.934 1.00 25.81  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 8.551   13.331  122.308 1.00 24.17  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 9.665   13.662  121.899 1.00 27.96  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 7.009   15.204  123.011 1.00 24.80  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 5.788   16.032  122.606 1.00 23.75  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 8.205   16.118  123.216 1.00 25.15  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 5.403   17.083  123.608 1.00 21.98  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 8.349   12.263  123.073 1.00 24.90  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 9.445   11.386  123.473 1.00 27.21  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 10.076  10.685  122.276 1.00 25.42  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 11.288  10.477  122.238 1.00 32.77  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 8.969   10.347  124.494 1.00 23.51  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 8.774   10.815  125.937 1.00 20.84  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 8.088   9.737   126.750 1.00 22.41  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 10.100  11.194  126.565 1.00 23.53  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 9.254   10.322  121.300 1.00 22.91  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 9.739   9.580   120.143 1.00 24.61  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 10.401  10.467  119.091 1.00 27.58  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 11.199  9.989   118.283 1.00 28.10  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 8.608   8.761   119.518 1.00 20.07  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 8.250   7.499   120.304 1.00 21.95  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 7.138   6.720   119.624 1.00 21.93  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 9.485   6.630   120.486 1.00 26.68  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 10.089  11.759  119.118 1.00 27.78  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 10.558  12.671  118.079 1.00 26.71  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 11.525  13.751  118.565 1.00 27.40  ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 12.687  13.773  118.163 1.00 32.75  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 9.370   13.320  117.363 1.00 23.53  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 8.554   14.038  118.271 1.00 23.00  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 11.043  14.633  119.436 1.00 26.47  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 11.718  15.903  119.709 1.00 27.70  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 12.810  15.911  120.783 1.00 27.38  ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 13.383  16.964  121.073 1.00 25.87  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 10.681  16.983  120.021 1.00 26.84  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 9.863   17.221  118.891 1.00 32.99  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 13.102  14.757  121.373 1.00 27.05  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 14.113  14.693  122.428 1.00 29.74  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 15.530  14.748  121.869 1.00 28.31  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 15.922  13.883  121.087 1.00 36.17  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 13.971  13.424  123.286 1.00 32.12  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 12.593  13.381  123.945 1.00 25.88  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 15.065  13.374  124.337 1.00 29.22  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 12.251  14.638  124.710 1.00 30.55  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 16.303  15.768  122.277 1.00 28.42  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 17.683  15.967  121.816 1.00 31.08  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 18.609  14.829  122.233 1.00 31.02  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 18.349  14.157  123.232 1.00 32.27  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 18.100  17.267  122.510 1.00 26.43  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 16.815  17.964  122.813 1.00 27.46  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 15.851  16.870  123.141 1.00 27.34  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 19.680  14.624  121.472 1.00 26.70  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 20.613  13.547  121.744 1.00 34.05  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 21.875  13.657  120.913 1.00 38.16  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 22.143  14.698  120.315 1.00 43.36  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 22.653  12.579  120.872 1.00 36.82  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 23.929  12.587  120.163 1.00 40.63  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 24.064  11.447  119.153 1.00 38.86  ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 23.511  10.362  119.345 1.00 42.66  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 25.109  12.519  121.146 1.00 42.18  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 24.966  11.366  121.987 1.00 36.54  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 25.157  13.776  122.004 1.00 37.68  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 24.805  11.709  118.078 1.00 35.83  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 25.047  10.717  117.033 1.00 37.54  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 26.306  11.033  116.219 1.00 30.22  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 26.812  12.155  116.252 1.00 31.95  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 23.833  10.604  116.119 1.00 40.66  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 26.801  10.039  115.487 1.00 26.74  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 27.968  10.212  114.626 1.00 30.43  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 27.574  10.891  113.318 1.00 26.94  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 26.782  10.346  112.551 1.00 29.99  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 28.584  8.839   114.274 1.00 28.34  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 29.539  8.959   113.100 1.00 25.10  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 29.266  8.227   115.486 1.00 24.21  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 28.108  12.086  113.070 1.00 25.10  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 27.823  12.791  111.820 1.00 28.42  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 28.859  12.651  110.693 1.00 34.70  ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 28.569  12.982  109.541 1.00 34.26  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 27.581  14.290  112.076 1.00 31.21  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 28.766  14.882  112.622 1.00 34.76  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 26.430  14.482  113.045 1.00 34.09  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 30.055  12.164  111.012 1.00 39.31  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 31.120  12.056  110.010 1.00 32.08  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 32.166  10.997  110.355 1.00 29.71  ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 32.447  10.745  111.526 1.00 28.91  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 31.795  13.413  109.789 1.00 33.70  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 32.825  13.320  108.820 1.00 37.05  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 32.751  10.390  109.330 1.00 27.33  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 33.819  9.418   109.531 1.00 27.58  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 34.933  9.615   108.508 1.00 37.04  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 34.674  9.704   107.309 1.00 40.49  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 33.295  7.970   109.431 1.00 23.84  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 34.445  6.981   109.376 1.00 24.60  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 32.379  7.649   110.595 1.00 32.04  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 36.170  9.697   108.986 1.00 42.59  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 37.331  9.699   108.103 1.00 40.37  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 38.218  8.503   108.400 1.00 35.38  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 38.598  8.282   109.543 1.00 37.54  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 38.145  10.985  108.257 1.00 40.17  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 39.525  10.894  107.641 1.00 44.63  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 39.700  10.984  106.267 1.00 55.26  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 40.651  10.708  108.433 1.00 48.53  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 40.961  10.899  105.697 1.00 59.09  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 41.914  10.619  107.872 1.00 52.45  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 42.063  10.717  106.505 1.00 54.42  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 43.315  10.631  105.941 1.00 52.15  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 38.546  7.735   107.368 1.00 38.71  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 39.485  6.630   107.506 1.00 40.11  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 40.746  7.003   106.738 1.00 45.52  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 40.683  7.771   105.779 1.00 50.26  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 38.911  5.319   106.943 1.00 39.93  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 37.412  5.211   107.233 1.00 43.00  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 39.666  4.115   107.491 1.00 36.92  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 37.085  4.597   108.568 1.00 38.78  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 41.886  6.469   107.169 1.00 44.62  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 43.184  6.838   106.610 1.00 48.16  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 43.271  6.660   105.092 1.00 54.52  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 43.386  7.637   104.349 1.00 57.15  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 44.298  6.043   107.296 1.00 51.81  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 45.697  6.581   107.042 1.00 62.51  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 46.782  5.709   107.652 1.00 64.74  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 46.452  4.626   108.182 1.00 68.09  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 47.965  6.105   107.599 1.00 60.08  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 43.210  5.413   104.638 1.00 47.31  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 43.380  5.098   103.220 1.00 50.59  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 42.066  5.017   102.440 1.00 47.01  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 42.049  4.632   101.272 1.00 40.75  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 44.189  3.812   103.056 1.00 54.99  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 45.629  3.976   103.498 1.00 65.58  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 46.203  5.060   103.253 1.00 56.49  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 46.184  3.029   104.095 1.00 81.15  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 40.968  5.365   103.098 1.00 48.24  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 39.648  5.285   102.484 1.00 39.30  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 39.200  6.611   101.869 1.00 39.19  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 39.073  7.621   102.561 1.00 44.79  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 38.610  4.807   103.505 1.00 34.82  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 37.209  5.034   102.994 1.00 34.47  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 38.841  3.344   103.839 1.00 37.68  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 38.979  6.598   100.558 1.00 35.52  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 38.552  7.785   99.821  1.00 39.77  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 37.047  8.052   99.903  1.00 37.73  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 36.607  9.204   99.885  1.00 33.13  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 38.985  7.675   98.358  1.00 36.06  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 40.495  7.685   98.121  1.00 36.43  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 40.830  7.300   96.686  1.00 39.53  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 41.061  9.054   98.458  1.00 37.06  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 36.264  6.981   99.981  1.00 33.64  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 34.811  7.089   99.954  1.00 32.00  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 34.170  5.897   100.651 1.00 33.45  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 34.863  4.970   101.057 1.00 37.58  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 34.329  7.157   98.511  1.00 30.36  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 34.827  6.033   97.659  1.00 30.43  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 34.405  4.730   97.823  1.00 29.68  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 35.719  6.011   96.640  1.00 33.02  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 35.010  3.958   96.940  1.00 33.15  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 35.813  4.711   96.209  1.00 34.44  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 32.844  5.902   100.751 1.00 29.79  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 32.132  4.894   101.539 1.00 33.84  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 32.228  3.474   100.967 1.00 33.56  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 32.048  2.493   101.688 1.00 29.42  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 30.664  5.301   101.721 1.00 39.09  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 29.892  4.455   102.730 1.00 44.39  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 28.495  4.988   103.004 1.00 58.69  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 28.208  6.142   102.616 1.00 62.62  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 27.684  4.250   103.608 1.00 49.92  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 32.526  3.369   99.676  1.00 33.49  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 32.496  2.084   98.978  1.00 31.41  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 33.855  1.394   98.930  1.00 35.24  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 34.016  0.357   98.286  1.00 38.56  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 31.921  2.268   97.575  1.00 31.61  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 30.645  3.055   97.557  1.00 27.73  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 30.665  4.426   97.356  1.00 23.34  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 29.429  2.431   97.776  1.00 25.97  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 29.494  5.157   97.354  1.00 26.16  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 28.254  3.158   97.776  1.00 30.28  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 28.286  4.523   97.564  1.00 27.91  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 34.830  1.990   99.608  1.00 33.56  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 36.173  1.432   99.701  1.00 34.52  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 36.212  0.158   100.548 1.00 34.57  ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 35.295  -0.115  101.322 1.00 28.84  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 37.126  2.473   100.292 1.00 35.61  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 36.982  3.723   99.640  1.00 34.55  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 37.271  -0.627  100.378 1.00 35.72  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 37.509  -1.786  101.231 1.00 35.55  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 38.932  -1.747  101.770 1.00 41.61  ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 39.892  -1.723  101.000 1.00 53.24  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 37.297  -3.111  100.480 1.00 41.23  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 35.924  -3.229  100.089 1.00 44.90  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 37.650  -4.281  101.376 1.00 48.88  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 39.061  -1.741  103.093 1.00 40.06  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 40.365  -1.645  103.745 1.00 46.13  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 41.045  -3.013  103.814 1.00 46.81  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 40.414  -4.001  104.193 1.00 42.47  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 40.230  -1.076  105.170 1.00 40.84  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 39.139  -0.007  105.216 1.00 40.68  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 41.553  -0.509  105.654 1.00 42.83  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 38.844  0.502   106.608 1.00 45.82  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 42.337  -3.074  103.439 1.00 51.02  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 43.104  -4.326  103.453 1.00 44.92  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 43.313  -4.852  104.866 1.00 42.21  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 43.635  -4.079  105.769 1.00 41.11  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 44.454  -3.920  102.851 1.00 33.96  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 44.181  -2.674  102.091 1.00 40.63  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 43.116  -1.965  102.861 1.00 47.20  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 43.136  -6.157  105.048 1.00 36.33  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 43.309  -6.775  106.349 1.00 39.50  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 42.113  -6.564  107.255 1.00 40.56  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 42.176  -6.837  108.452 1.00 40.52  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 41.020  -6.067  106.682 1.00 46.42  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 39.788  -5.850  107.432 1.00 36.12  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 38.630  -6.604  106.786 1.00 36.56  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 38.396  -6.490  105.582 1.00 41.60  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 39.432  -4.355  107.523 1.00 33.16  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 38.230  -4.156  108.425 1.00 40.71  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 40.615  -3.554  108.041 1.00 36.75  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 37.910  -7.375  107.594 1.00 33.76  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 36.790  -8.177  107.114 1.00 36.57  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 35.629  -7.312  106.621 1.00 39.10  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 35.105  -7.521  105.524 1.00 37.47  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 36.312  -9.119  108.219 1.00 33.55  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 35.167  -10.025 107.824 1.00 27.89  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 34.822  -10.973 108.955 1.00 36.81  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 33.700  -11.918 108.563 1.00 47.25  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 33.472  -12.958 109.604 1.00 52.49  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 35.229  -6.342  107.436 1.00 35.43  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 34.158  -5.431  107.057 1.00 35.85  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 34.617  -4.453  105.984 1.00 31.91  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 35.800  -4.128  105.886 1.00 33.35  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 33.647  -4.649  108.272 1.00 39.21  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 32.810  -5.460  109.249 1.00 48.22  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 33.652  -6.246  110.234 1.00 49.94  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 34.882  -6.034  110.265 1.00 46.29  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 33.082  -7.073  110.979 1.00 50.52  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 33.673  -3.993  105.174 1.00 27.62  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 33.942  -2.910  104.246 1.00 26.23  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 33.576  -1.614  104.946 1.00 30.19  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 33.102  -1.637  106.081 1.00 33.08  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 33.124  -3.085  102.969 1.00 29.24  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 31.730  -3.608  103.240 1.00 36.34  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 31.078  -3.114  104.182 1.00 40.90  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 31.287  -4.525  102.517 1.00 47.64  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 33.788  -0.486  104.281 1.00 27.55  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 33.496  0.799   104.898 1.00 29.12  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 31.989  0.964   105.098 1.00 32.70  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 31.548  1.600   106.055 1.00 33.16  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 34.082  1.968   104.082 1.00 24.44  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 33.794  3.299   104.760 1.00 26.41  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 35.574  1.780   103.911 1.00 23.44  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 31.206  0.365   104.205 1.00 32.61  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 29.752  0.423   104.298 1.00 29.91  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 29.273  -0.165  105.619 1.00 32.09  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 28.387  0.389   106.272 1.00 39.80  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 29.081  -0.335  103.140 1.00 27.89  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 27.569  -0.237  103.247 1.00 22.13  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 29.554  0.213   101.812 1.00 32.09  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 29.874  -1.282  106.015 1.00 28.88  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 29.483  -1.957  107.245 1.00 29.12  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 30.054  -1.267  108.478 1.00 28.71  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 29.429  -1.261  109.536 1.00 28.49  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 29.901  -3.428  107.213 1.00 33.08  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 29.357  -4.242  108.371 1.00 36.70  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 29.248  -5.714  108.042 1.00 45.80  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 28.843  -6.491  108.933 1.00 51.65  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 29.559  -6.093  106.891 1.00 44.66  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 31.242  -0.685  108.335 1.00 30.47  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 31.875  0.030   109.438 1.00 26.99  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 31.048  1.247   109.841 1.00 27.18  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 30.799  1.463   111.026 1.00 33.33  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 33.325  0.437   109.101 1.00 28.72  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 34.217  -0.806  109.043 1.00 31.92  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 33.868  1.416   110.132 1.00 27.62  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 35.661  -0.514  108.701 1.00 37.69  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 30.614  2.027   108.853 1.00 27.96  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 29.702  3.142   109.094 1.00 28.29  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 28.419  2.626   109.731 1.00 30.87  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 27.915  3.200   110.697 1.00 30.21  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 29.321  3.865   107.788 1.00 29.36  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 30.560  4.439   107.104 1.00 32.56  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 28.330  4.981   108.070 1.00 24.55  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 31.135  5.623   107.817 1.00 29.97  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 27.903  1.532   109.180 1.00 32.54  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 26.684  0.907   109.677 1.00 28.36  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 26.832  0.464   111.131 1.00 28.05  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 25.869  0.485   111.894 1.00 28.24  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 26.316  -0.290  108.804 1.00 25.89  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 24.880  -0.317  108.294 1.00 23.87  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 24.627  0.890   107.413 1.00 21.90  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 24.610  -1.612  107.546 1.00 22.60  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 28.043  0.058   111.503 1.00 31.37  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 28.340  -0.300  112.884 1.00 25.75  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 28.516  0.936   113.759 1.00 30.96  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 28.028  0.978   114.887 1.00 39.38  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 29.581  -1.190  112.961 1.00 25.04  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 29.288  -2.632  112.592 1.00 28.79  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 28.150  -3.088  112.688 1.00 29.02  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 30.318  -3.360  112.177 1.00 33.29  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 29.201  1.946   113.230 1.00 31.48  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 29.425  3.196   113.957 1.00 35.03  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 28.131  3.984   114.136 1.00 33.81  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 28.086  4.971   114.870 1.00 37.90  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 30.466  4.061   113.241 1.00 33.41  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 31.905  3.544   113.226 1.00 32.58  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 32.798  4.466   112.414 1.00 40.30  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 32.429  3.405   114.640 1.00 34.75  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 27.084  3.546   113.450 1.00 31.77  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 25.783  4.185   113.534 1.00 33.88  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 25.089  3.756   114.825 1.00 39.37  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 24.217  4.457   115.337 1.00 39.45  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 24.946  3.793   112.316 1.00 35.64  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 23.865  4.782   111.930 1.00 33.95  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 23.251  4.398   110.593 1.00 31.67  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 22.134  5.347   110.197 1.00 38.84  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 21.543  4.984   108.877 1.00 39.59  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 25.493  2.599   115.344 1.00 39.99  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 24.923  2.049   116.572 1.00 42.43  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 25.579  2.648   117.811 1.00 43.17  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 25.070  2.507   118.923 1.00 48.96  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 25.081  0.525   116.601 1.00 40.40  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 24.204  -0.220  115.612 1.00 48.26  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 22.731  -0.137  115.961 1.00 69.42  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 22.255  -0.991  116.739 1.00 79.51  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 22.048  0.783   115.458 1.00 75.83  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 26.710  3.314   117.610 1.00 37.64  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 27.475  3.880   118.714 1.00 38.40  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 26.708  4.973   119.453 1.00 39.64  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 26.220  5.929   118.845 1.00 38.33  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 28.802  4.444   118.204 1.00 36.95  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 29.793  4.890   119.278 1.00 29.91  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 30.607  3.703   119.763 1.00 31.86  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 30.694  5.999   118.766 1.00 30.52  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 26.609  4.827   120.769 1.00 36.73  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 25.984  5.843   121.604 1.00 36.10  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 26.989  6.427   122.596 1.00 35.77  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 27.585  5.701   123.390 1.00 36.89  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 24.750  5.285   122.345 1.00 35.11  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 25.030  3.895   122.885 1.00 32.67  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 24.320  6.229   123.456 1.00 46.83  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 27.193  7.740   122.531 1.00 33.19  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 28.109  8.412   123.446 1.00 38.18  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 27.373  9.458   124.277 1.00 48.10  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 26.349  9.999   123.853 1.00 49.58  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 29.309  9.072   122.711 1.00 38.69  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 29.642  8.314   121.434 1.00 35.03  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 29.026  10.536  122.404 1.00 32.92  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 27.900  9.732   125.464 1.00 50.03  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 27.262  10.656  126.389 1.00 48.42  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 28.140  11.875  126.642 1.00 47.36  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 29.338  11.744  126.889 1.00 48.42  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 26.962  9.948   127.712 1.00 49.73  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 26.293  10.832  128.746 1.00 56.98  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 26.343  10.213  130.130 1.00 51.56  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 25.718  11.078  131.124 1.00 61.73  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 25.768  10.870  132.435 1.00 62.11  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 26.422  9.821   132.915 1.00 53.46  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 25.166  11.712  133.265 1.00 63.12  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 27.541  13.059  126.574 1.00 49.36  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 28.249  14.290  126.906 1.00 51.94  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 27.895  14.724  128.322 1.00 60.69  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 26.736  15.016  128.616 1.00 60.55  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 27.896  15.413  125.929 1.00 55.67  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 28.407  15.195  124.532 1.00 56.13  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 29.285  14.164  124.247 1.00 53.71  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 28.010  16.034  123.502 1.00 55.54  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 29.750  13.969  122.961 1.00 53.62  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 28.474  15.846  122.216 1.00 49.16  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 29.345  14.813  121.944 1.00 49.46  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 28.896  14.766  129.196 1.00 63.20  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 28.677  15.156  130.584 1.00 62.66  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 28.670  16.674  130.754 1.00 59.89  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 28.288  17.189  131.803 1.00 61.56  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 29.719  14.506  131.497 1.00 62.74  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 29.534  13.000  131.709 1.00 60.98  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 30.780  12.225  131.304 1.00 55.70  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 29.149  12.700  133.151 1.00 59.89  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 29.095  17.385  129.715 1.00 61.26  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 29.022  18.840  129.709 1.00 63.51  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 27.952  19.338  128.740 1.00 67.84  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 27.979  19.008  127.555 1.00 64.68  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 30.378  19.455  129.360 1.00 68.49  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 30.451  20.933  129.699 1.00 70.69  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 29.811  21.765  129.055 1.00 62.84  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 31.240  21.267  130.713 1.00 76.27  ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 26.998  20.129  129.249 1.00 67.14  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 25.900  20.684  128.450 1.00 64.92  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 26.390  21.630  127.360 1.00 69.33  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 25.774  21.713  126.300 1.00 78.55  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 25.082  21.472  129.479 1.00 65.20  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 25.443  20.878  130.793 1.00 72.19  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 26.880  20.494  130.670 1.00 67.61  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 27.485  22.335  127.622 1.00 71.07  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 27.981  23.347  126.693 1.00 79.84  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 28.730  22.741  125.505 1.00 84.02  ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 29.063  23.443  124.550 1.00 88.26  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 28.883  24.342  127.427 1.00 80.80  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 28.250  24.837  128.593 1.00 81.28  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 28.984  21.437  125.566 1.00 79.36  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 29.764  20.751  124.540 1.00 70.19  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 28.856  20.139  123.477 1.00 70.54  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 28.129  19.183  123.747 1.00 71.38  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 30.606  19.654  125.195 1.00 68.82  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 31.367  18.665  124.315 1.00 55.22  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 32.552  19.345  123.655 1.00 59.36  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 31.823  17.479  125.150 1.00 47.20  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 28.884  20.702  122.272 1.00 68.13  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 28.067  20.174  121.181 1.00 74.58  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 28.786  19.274  120.162 1.00 67.47  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 28.140  18.721  119.272 1.00 72.96  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 27.325  21.311  120.469 1.00 74.51  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 26.293  22.008  121.344 1.00 80.75  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 25.476  23.037  120.586 1.00 92.80  ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 25.602  23.172  119.369 1.00 92.72  ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 24.632  23.769  121.304 1.00 87.51  ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 30.104  19.124  120.280 1.00 61.72  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 30.844  18.279  119.335 1.00 52.90  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 32.122  17.643  119.886 1.00 46.23  ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 32.868  18.270  120.636 1.00 51.65  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 31.194  19.041  118.043 1.00 50.70  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 32.121  18.267  117.273 1.00 42.96  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 31.813  20.393  118.369 1.00 64.95  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 32.379  16.401  119.480 1.00 41.58  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 33.577  15.669  119.888 1.00 43.58  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 34.075  14.810  118.729 1.00 44.84  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 33.275  14.204  118.019 1.00 47.97  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 33.298  14.737  121.095 1.00 42.92  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 34.524  13.902  121.432 1.00 44.19  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 32.867  15.535  122.308 1.00 58.99  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 35.390  14.759  118.532 1.00 42.21  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 35.966  13.869  117.529 1.00 36.21  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 36.805  12.765  118.169 1.00 29.83  ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 37.894  13.015  118.680 1.00 29.53  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 36.821  14.640  116.505 1.00 46.53  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 35.978  15.505  115.731 1.00 57.68  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 37.536  13.674  115.570 1.00 37.66  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 36.286  11.542  118.122 1.00 35.86  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 36.974  10.368  118.653 1.00 34.10  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 38.081  9.916   117.712 1.00 34.53  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 38.054  10.213  116.520 1.00 35.15  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 35.988  9.215   118.867 1.00 35.23  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 35.220  9.125   120.189 1.00 39.42  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 34.422  10.389  120.474 1.00 35.52  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 34.304  7.913   120.171 1.00 38.40  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 39.057  9.196   118.253 1.00 42.51  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 40.138  8.657   117.438 1.00 39.21  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 40.348  7.181   117.737 1.00 45.04  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 40.403  6.774   118.898 1.00 53.44  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 41.437  9.434   117.665 1.00 32.46  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 41.407  10.920  117.302 1.00 32.15  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 41.120  11.779  118.524 1.00 29.20  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 42.707  11.338  116.635 1.00 53.32  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 40.454  6.380   116.684 1.00 44.34  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 40.685  4.953   116.838 1.00 40.73  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 41.879  4.524   115.998 1.00 45.37  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 41.851  4.610   114.772 1.00 44.66  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 39.436  4.160   116.442 1.00 34.91  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 39.379  2.672   116.798 1.00 41.41  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 37.950  2.266   117.117 1.00 42.43  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 39.933  1.805   115.673 1.00 40.39  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 42.931  4.075   116.669 1.00 50.26  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 44.099  3.532   115.994 1.00 43.06  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 44.336  2.129   116.528 1.00 46.31  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 44.601  1.944   117.714 1.00 57.02  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 45.321  4.423   116.230 1.00 41.26  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 45.118  5.871   115.790 1.00 55.17  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 46.096  6.822   116.472 1.00 63.30  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 47.508  6.671   115.929 1.00 68.41  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 47.633  7.211   114.547 1.00 55.72  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 44.216  1.139   115.652 1.00 44.37  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 44.364  -0.252  116.055 1.00 57.52  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 44.934  -1.086  114.917 1.00 58.05  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 44.907  -0.669  113.760 1.00 62.35  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 43.028  -0.816  116.513 1.00 54.98  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 45.451  -2.262  115.253 1.00 53.07  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 46.041  -3.147  114.258 1.00 54.91  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 46.164  -4.571  114.785 1.00 57.88  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 45.664  -4.889  115.864 1.00 55.54  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 47.411  -2.623  113.822 1.00 61.92  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 48.380  -2.386  114.967 1.00 66.48  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 49.671  -1.734  114.510 1.00 85.58  ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 50.518  -1.421  115.374 1.00 95.25  ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 49.836  -1.534  113.287 1.00 82.80  ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 46.821  -5.426  114.007 1.00 60.29  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 47.061  -6.802  114.402 1.00 53.70  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 45.801  -7.641  114.376 1.00 55.19  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 44.704  -7.114  114.192 1.00 59.77  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 45.949  -8.959  114.571 1.00 53.34  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 44.823  -9.899  114.547 1.00 54.83  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 43.903  -9.745  115.755 1.00 63.53  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 43.806  -10.657 116.576 1.00 75.85  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 45.511  -11.266 114.575 1.00 59.98  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 46.824  -11.012 115.226 1.00 71.14  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 47.237  -9.642  114.779 1.00 63.96  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 43.232  -8.601  115.850 1.00 62.37  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 42.295  -8.337  116.935 1.00 59.36  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 40.932  -7.973  116.367 1.00 55.44  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 40.812  -7.636  115.190 1.00 54.31  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 42.794  -7.180  117.801 1.00 63.09  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 42.786  -5.836  117.083 1.00 58.46  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 43.117  -4.686  118.024 1.00 60.74  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 42.019  -4.475  119.054 1.00 43.50  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 42.289  -3.281  119.901 1.00 40.37  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 39.904  -8.045  117.205 1.00 54.78  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 38.590  -7.550  116.823 1.00 46.54  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 38.324  -6.233  117.537 1.00 44.72  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 38.078  -6.210  118.743 1.00 43.85  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 37.510  -8.570  117.176 1.00 41.93  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 37.630  -9.875  116.415 1.00 51.18  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 36.444  -10.788 116.644 1.00 69.41  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 35.736  -10.599 117.657 1.00 64.32  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 36.216  -11.688 115.806 1.00 71.83  ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 38.354  -5.138  116.786 1.00 42.02  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 38.235  -3.811  117.378 1.00 42.60  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 36.823  -3.550  117.893 1.00 44.89  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 35.850  -3.642  117.145 1.00 46.73  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 38.629  -2.706  116.377 1.00 35.64  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 38.502  -1.340  117.020 1.00 33.23  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 40.045  -2.929  115.873 1.00 37.75  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 36.721  -3.225  119.177 1.00 46.09  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 35.439  -2.901  119.786 1.00 38.28  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 35.316  -1.399  119.978 1.00 37.75  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 36.236  -0.645  119.665 1.00 39.00  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 35.278  -3.623  121.123 1.00 37.12  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 35.150  -5.129  120.993 1.00 41.88  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 33.900  -5.503  120.218 1.00 42.27  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 33.773  -7.009  120.056 1.00 45.80  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 34.863  -7.573  119.215 1.00 46.43  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 34.177  -0.969  120.506 1.00 40.97  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 33.888  0.452   120.640 1.00 40.21  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 34.767  1.124   121.687 1.00 47.51  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 35.050  2.315   121.591 1.00 51.58  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 32.418  0.663   120.961 1.00 46.69  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 35.201  0.360   122.684 1.00 51.71  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 35.994  0.920   123.775 1.00 50.82  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 37.411  1.298   123.351 1.00 50.40  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 38.092  2.047   124.050 1.00 53.86  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 36.035  -0.039  124.967 1.00 49.37  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 36.332  -1.476  124.597 1.00 47.93  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 36.409  -2.351  125.833 1.00 51.68  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 36.284  -3.765  125.496 1.00 60.70  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 35.165  -4.466  125.637 1.00 68.64  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 35.135  -5.750  125.301 1.00 66.48  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 34.075  -3.883  126.120 1.00 62.98  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 37.845  0.793   122.200 1.00 46.11  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 39.195  1.063   121.709 1.00 46.47  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 39.410  2.532   121.348 1.00 46.34  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 40.544  2.972   121.152 1.00 44.13  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 39.527  0.159   120.522 1.00 44.30  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 39.803  -1.270  120.941 1.00 49.54  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 38.846  -2.068  121.011 1.00 46.55  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 40.981  -1.593  121.206 1.00 60.99  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 38.317  3.284   121.258 1.00 41.25  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 38.394  4.721   121.045 1.00 43.10  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 39.151  5.386   122.183 1.00 52.75  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 38.891  5.107   123.354 1.00 54.19  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 36.994  5.330   120.944 1.00 42.28  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 36.341  5.124   119.612 1.00 46.58  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 35.157  4.418   119.506 1.00 42.96  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 36.915  5.636   118.461 1.00 46.95  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 34.556  4.225   118.280 1.00 40.55  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 36.320  5.446   117.234 1.00 45.03  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 35.138  4.739   117.142 1.00 41.88  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 40.091  6.260   121.837 1.00 49.83  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 40.835  7.004   122.844 1.00 48.51  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 39.892  7.910   123.627 1.00 49.37  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 39.101  8.650   123.037 1.00 43.08  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 41.961  7.818   122.206 1.00 44.41  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 42.998  7.020   121.415 1.00 39.60  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 44.227  7.873   121.136 1.00 31.65  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 43.372  5.738   122.145 1.00 37.36  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 39.969  7.839   124.965 1.00 51.95  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 39.078  8.557   125.884 1.00 52.07  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 39.195  10.075  125.775 1.00 46.44  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 40.276  10.603  125.514 1.00 40.78  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 39.555  8.094   127.266 1.00 50.00  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 40.271  6.806   127.017 1.00 44.96  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 40.924  6.982   125.687 1.00 47.35  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 38.074  10.764  125.968 1.00 46.67  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 38.046  12.222  125.976 1.00 60.94  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 37.369  12.705  127.262 1.00 68.63  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 36.509  12.015  127.815 1.00 60.85  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 37.297  12.786  124.742 1.00 54.80  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 37.531  14.284  124.604 1.00 52.14  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 37.737  12.070  123.474 1.00 51.57  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 37.773  13.877  127.745 1.00 65.77  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 37.167  14.467  128.933 1.00 64.55  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 35.708  14.830  128.672 1.00 66.10  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 35.368  15.321  127.594 1.00 63.69  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 37.951  15.693  129.375 1.00 73.18  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 34.858  14.581  129.668 1.00 66.81  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 33.416  14.816  129.565 1.00 70.58  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 32.775  14.012  128.436 1.00 61.67  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 31.776  14.433  127.850 1.00 61.00  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 33.104  16.308  129.395 1.00 76.19  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 33.479  17.126  130.614 1.00 75.33  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 33.482  16.564  131.731 1.00 73.25  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 33.766  18.331  130.453 1.00 70.65  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 33.365  12.862  128.127 1.00 51.65  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 32.847  11.986  127.084 1.00 51.03  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 32.899  10.529  127.531 1.00 48.42  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 33.957  10.029  127.910 1.00 46.21  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 33.644  12.128  125.767 1.00 60.60  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 33.088  11.188  124.705 1.00 62.62  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 33.621  13.567  125.269 1.00 54.34  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 31.756  9.852   127.482 1.00 50.67  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 31.690  8.438   127.836 1.00 53.17  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 30.835  7.654   126.844 1.00 51.39  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 29.711  8.049   126.533 1.00 49.95  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 31.131  8.256   129.248 1.00 54.96  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 31.044  6.801   129.691 1.00 57.95  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 29.862  6.534   130.606 1.00 65.43  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 29.059  7.464   130.832 1.00 68.35  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 29.734  5.390   131.095 1.00 58.57  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 31.372  6.540   126.355 1.00 46.16  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 30.635  5.674   125.441 1.00 49.46  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 29.826  4.626   126.211 1.00 50.63  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 30.377  3.844   126.984 1.00 55.26  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 31.573  5.008   124.411 1.00 42.73  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 32.765  4.357   125.110 1.00 60.27  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 32.081  6.037   123.418 1.00 33.56  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 33.795  3.802   124.158 1.00 60.00  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 28.514  4.620   125.993 1.00 44.67  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 27.606  3.790   126.783 1.00 41.41  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 27.595  2.316   126.380 1.00 47.97  ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 27.015  1.485   127.078 1.00 51.46  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 26.184  4.352   126.730 1.00 39.53  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 26.068  5.799   127.183 1.00 51.10  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 26.686  6.066   128.856 1.00 64.21  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 25.741  4.846   129.766 1.00 49.47  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 28.224  1.990   125.256 1.00 49.50  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 28.293  0.597   124.816 1.00 57.08  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 29.678  0.187   124.314 1.00 59.43  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 29.932  0.165   123.109 1.00 60.17  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 27.206  0.283   123.778 1.00 53.89  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 27.211  1.249   122.606 1.00 47.39  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 27.771  2.342   122.687 1.00 50.88  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 26.575  0.849   121.511 1.00 43.96  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 30.579  -0.141  125.249 1.00 49.52  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 31.957  -0.527  124.933 1.00 49.03  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 32.038  -1.868  124.208 1.00 53.09  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 32.989  -2.097  123.460 1.00 53.60  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 32.612  -0.639  126.315 1.00 66.80  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 31.722  0.140   127.234 1.00 57.49  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 30.349  -0.074  126.700 1.00 45.24  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 31.056  -2.738  124.428 1.00 55.25  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 31.056  -4.070  123.822 1.00 58.41  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 30.681  -4.069  122.342 1.00 56.75  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 30.799  -5.097  121.671 1.00 55.74  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 30.121  -5.014  124.584 1.00 69.76  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 30.814  -5.724  125.727 1.00 80.42  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 32.052  -5.881  125.662 1.00 81.20  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 30.121  -6.132  126.684 1.00 79.41  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 30.229  -2.922  121.841 1.00 52.39  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 29.794  -2.809  120.452 1.00 46.23  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 30.908  -3.177  119.484 1.00 45.04  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 32.004  -2.619  119.539 1.00 46.34  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 29.293  -1.392  120.156 1.00 44.49  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 28.977  -1.057  118.695 1.00 39.81  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 27.967  -2.033  118.106 1.00 41.51  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 28.470  0.369   118.576 1.00 36.61  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 30.618  -4.118  118.595 1.00 43.18  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 31.587  -4.532  117.594 1.00 43.04  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 31.657  -3.487  116.490 1.00 41.91  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 30.638  -2.922  116.095 1.00 42.69  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 31.208  -5.893  117.012 1.00 43.04  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 32.304  -6.533  116.217 1.00 44.63  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 32.707  -6.059  114.990 1.00 45.19  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 33.079  -7.612  116.480 1.00 52.61  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 33.686  -6.818  114.528 1.00 50.97  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 33.930  -7.766  115.411 1.00 52.11  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 32.864  -3.225  116.003 1.00 43.49  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 33.058  -2.279  114.911 1.00 42.33  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 33.697  -2.953  113.703 1.00 43.21  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 33.080  -3.061  112.643 1.00 47.94  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 33.904  -1.070  115.344 1.00 36.37  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 33.138  -0.236  116.370 1.00 36.00  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 34.264  -0.211  114.142 1.00 38.74  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 33.901  0.968   116.860 1.00 46.47  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 34.932  -3.413  113.866 1.00 38.78  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 35.643  -4.060  112.774 1.00 40.59  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 36.416  -5.287  113.243 1.00 43.52  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 36.896  -5.337  114.375 1.00 45.71  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 36.578  -3.071  112.095 1.00 43.12  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 36.521  -6.280  112.367 1.00 42.58  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 37.374  -7.431  112.620 1.00 42.74  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 38.643  -7.285  111.793 1.00 41.89  ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 38.605  -7.361  110.566 1.00 43.07  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 36.672  -8.758  112.264 1.00 42.43  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 35.562  -8.965  113.146 1.00 45.78  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 37.637  -9.928  112.395 1.00 40.09  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 39.766  -7.060  112.467 1.00 46.09  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 41.039  -6.894  111.778 1.00 39.35  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 41.813  -8.206  111.703 1.00 46.13  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 41.376  -9.233  112.222 1.00 48.69  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 41.885  -5.801  112.434 1.00 40.33  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 41.708  -4.384  111.877 1.00 44.82  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 40.260  -3.918  111.969 1.00 39.32  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 42.633  -3.408  112.590 1.00 50.98  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 42.972  -8.155  111.062 1.00 47.51  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 43.711  -9.357  110.720 1.00 45.68  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 45.193  -9.065  110.896 1.00 52.54  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 45.566  -7.941  111.233 1.00 56.95  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 43.417  -9.710  109.265 1.00 41.53  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 43.648  -11.148 108.877 1.00 47.51  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 43.516  -11.354 107.381 1.00 52.07  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 43.335  -10.355 106.651 1.00 45.47  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 43.595  -12.514 106.935 1.00 53.69  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 46.040  -10.064 110.671 1.00 53.56  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 47.474  -9.836  110.737 1.00 57.42  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 47.875  -8.848  109.654 1.00 56.25  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 47.613  -9.068  108.473 1.00 55.56  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 48.244  -11.147 110.567 1.00 68.15  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 48.533  -11.877 111.871 1.00 83.26  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 49.592  -11.183 112.714 1.00 83.93  ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 49.777  -11.589 113.882 1.00 77.90  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 50.241  -10.239 112.211 1.00 71.90  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 48.506  -7.755  110.066 1.00 58.66  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 48.945  -6.735  109.135 1.00 60.81  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 47.862  -5.713  108.852 1.00 57.92  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 48.151  -4.593  108.430 1.00 65.05  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 46.612  -6.100  109.087 1.00 49.45  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 45.484  -5.216  108.859 1.00 49.16  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 45.459  -4.049  109.825 1.00 48.30  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 45.467  -4.240  111.039 1.00 51.53  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 45.420  -2.836  109.285 1.00 51.21  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 45.405  -1.639  110.116 1.00 55.11  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 44.119  -0.842  109.952 1.00 52.92  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 43.576  -0.734  108.854 1.00 54.47  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 46.608  -0.745  109.803 1.00 60.65  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 47.942  -1.322  110.233 1.00 72.26  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 49.054  -0.296  110.099 1.00 77.49  ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 50.348  -0.852  110.479 1.00 90.71  ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 51.196  -1.417  109.626 1.00 94.78  ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 50.889  -1.495  108.337 1.00 87.45  ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 52.353  -1.900  110.060 1.00 90.69  ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 43.637  -0.284  111.057 1.00 49.87  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 42.482  0.600   111.025 1.00 52.59  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 42.773  1.879   111.804 1.00 56.10  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 43.015  1.841   113.010 1.00 66.90  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 41.248  -0.102  111.592 1.00 52.76  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 39.961  0.723   111.649 1.00 46.97  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 39.620  1.286   110.281 1.00 49.93  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 38.815  -0.121  112.178 1.00 50.42  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 42.760  3.007   111.104 1.00 46.50  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1  139  ? 42.970  4.305   111.729 1.00 44.41  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1  139  ? 41.895  5.280   111.263 1.00 44.02  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1  139  ? 41.826  5.615   110.082 1.00 49.70  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1  139  ? 44.368  4.831   111.390 1.00 48.26  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1  139  ? 44.581  6.273   111.827 1.00 60.85  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1  139  ? 43.944  6.758   112.765 1.00 62.83  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1  139  ? 45.485  6.967   111.143 1.00 57.06  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1  140  ? 41.060  5.742   112.188 1.00 39.76  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1  140  ? 39.940  6.597   111.811 1.00 36.20  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1  140  ? 39.575  7.668   112.833 1.00 33.37  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1  140  ? 39.790  7.503   114.030 1.00 38.32  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1  140  ? 38.710  5.751   111.482 1.00 42.24  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1  140  ? 38.273  4.806   112.582 1.00 45.25  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1  140  ? 36.846  3.826   112.077 1.00 48.16  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1  140  ? 36.644  2.763   113.505 1.00 52.30  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1  141  ? 39.014  8.766   112.335 1.00 37.49  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1  141  ? 38.583  9.876   113.175 1.00 37.24  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1  141  ? 37.100  10.135  112.949 1.00 31.86  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1  141  ? 36.697  10.562  111.870 1.00 36.78  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1  141  ? 39.381  11.134  112.836 1.00 32.48  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1  141  ? 40.884  10.943  112.886 1.00 37.52  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1  141  ? 41.638  12.192  112.483 1.00 55.54  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1  141  ? 40.979  13.202  112.152 1.00 56.85  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1  141  ? 42.887  12.164  112.497 1.00 57.71  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1  142  ? 36.295  9.895   113.977 1.00 24.97  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1  142  ? 34.844  9.938   113.833 1.00 31.35  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1  142  ? 34.194  11.085  114.610 1.00 30.14  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1  142  ? 34.254  11.135  115.837 1.00 31.84  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1  142  ? 34.214  8.583   114.237 1.00 31.44  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1  142  ? 34.913  8.014   115.451 1.00 33.91  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1  142  ? 32.734  8.734   114.493 1.00 30.75  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1  143  ? 33.570  12.007  113.884 1.00 33.82  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1  143  ? 32.942  13.171  114.502 1.00 35.17  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1  143  ? 31.553  12.872  115.067 1.00 34.42  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1  143  ? 30.684  12.352  114.371 1.00 31.38  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1  143  ? 32.874  14.338  113.515 1.00 31.21  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1  143  ? 31.931  15.450  113.941 1.00 33.82  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1  143  ? 32.213  16.731  113.181 1.00 36.23  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1  143  ? 31.119  17.688  113.300 1.00 36.87  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1  143  ? 31.186  18.949  112.884 1.00 51.09  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1  143  ? 32.302  19.407  112.332 1.00 56.00  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1  143  ? 30.141  19.755  113.026 1.00 45.16  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1  144  ? 31.360  13.211  116.337 1.00 39.08  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1  144  ? 30.084  13.021  117.013 1.00 36.36  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1  144  ? 29.486  14.374  117.388 1.00 39.97  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1  144  ? 30.147  15.191  118.029 1.00 43.75  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1  144  ? 30.253  12.178  118.291 1.00 32.95  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1  144  ? 28.937  12.075  119.039 1.00 35.23  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1  144  ? 30.791  10.797  117.953 1.00 28.14  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1  145  ? 28.238  14.607  116.989 1.00 35.87  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1  145  ? 27.571  15.878  117.263 1.00 40.12  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1  145  ? 26.304  15.681  118.081 1.00 49.67  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1  145  ? 25.762  14.577  118.153 1.00 51.49  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1  145  ? 27.217  16.607  115.961 1.00 39.85  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1  145  ? 28.437  17.144  115.237 1.00 52.43  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1  145  ? 29.463  17.392  115.903 1.00 53.82  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1  145  ? 28.366  17.323  114.001 1.00 49.19  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1  146  ? 25.844  16.760  118.704 1.00 50.07  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1  146  ? 24.565  16.765  119.398 1.00 47.64  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1  146  ? 23.519  17.406  118.492 1.00 46.81  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1  146  ? 23.778  18.437  117.872 1.00 49.81  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1  146  ? 24.678  17.527  120.721 1.00 50.47  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1  146  ? 23.347  17.805  121.406 1.00 62.61  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1  146  ? 23.551  18.525  122.731 1.00 73.91  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1  146  ? 24.006  17.621  123.785 1.00 77.75  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1  146  ? 24.782  17.987  124.801 1.00 69.17  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1  146  ? 25.204  19.240  124.896 1.00 72.18  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1  146  ? 25.145  17.098  125.717 1.00 52.92  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1  147  ? 22.346  16.787  118.401 1.00 39.54  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1  147  ? 21.291  17.291  117.541 1.00 36.05  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1  147  ? 19.930  16.725  117.891 1.00 34.67  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1  147  ? 19.791  15.988  118.868 1.00 37.12  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1  148  ? 18.923  17.068  117.092 1.00 33.93  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1  148  ? 17.556  16.624  117.352 1.00 38.17  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1  148  ? 16.946  15.894  116.158 1.00 36.93  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1  148  ? 17.198  16.244  115.004 1.00 34.67  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1  148  ? 16.633  17.802  117.748 1.00 31.32  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1  148  ? 17.015  18.348  119.110 1.00 27.35  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1  148  ? 16.685  18.902  116.698 1.00 35.79  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1  149  ? 16.139  14.879  116.449 1.00 35.21  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1  149  ? 15.426  14.148  115.419 1.00 34.53  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1  149  ? 16.342  13.323  114.543 1.00 32.82  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1  149  ? 17.455  12.982  114.942 1.00 35.75  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1  150  ? 15.871  13.002  113.342 1.00 32.24  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1  150  ? 16.656  12.213  112.400 1.00 36.33  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1  150  ? 17.049  13.023  111.172 1.00 35.41  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1  150  ? 16.204  13.376  110.350 1.00 34.68  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1  150  ? 15.896  10.953  111.979 1.00 36.23  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1  150  ? 16.413  10.325  110.704 1.00 31.37  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1  150  ? 17.659  9.717   110.660 1.00 35.48  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1  150  ? 15.651  10.336  109.546 1.00 31.93  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1  150  ? 18.133  9.142   109.495 1.00 37.27  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1  150  ? 16.115  9.763   108.379 1.00 37.71  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1  150  ? 17.356  9.168   108.357 1.00 35.90  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1  150  ? 17.818  8.596   107.191 1.00 36.05  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1  151  ? 18.342  13.307  111.055 1.00 42.86  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1  151  ? 18.865  14.058  109.922 1.00 40.90  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1  151  ? 19.764  13.185  109.047 1.00 41.99  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1  151  ? 20.842  12.768  109.476 1.00 32.61  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1  151  ? 19.645  15.298  110.382 1.00 34.55  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1  151  ? 20.224  16.025  109.183 1.00 39.47  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1  151  ? 18.743  16.221  111.190 1.00 28.61  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1  152  ? 19.309  12.903  107.814 1.00 43.91  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1  152  ? 20.020  12.071  106.837 1.00 39.10  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1  152  ? 21.368  12.664  106.454 1.00 38.79  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1  152  ? 21.554  13.876  106.543 1.00 39.54  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1  152  ? 19.089  12.091  105.621 1.00 40.54  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1  152  ? 17.749  12.411  106.171 1.00 40.89  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1  152  ? 18.006  13.356  107.299 1.00 41.20  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1  153  ? 22.290  11.808  106.025 1.00 39.93  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  153  ? 23.629  12.237  105.643 1.00 36.83  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  153  ? 23.603  13.246  104.496 1.00 38.71  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  153  ? 24.429  14.158  104.441 1.00 37.97  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  153  ? 24.480  11.033  105.270 1.00 32.53  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  154  ? 22.650  13.078  103.586 1.00 36.70  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  154  ? 22.538  13.957  102.430 1.00 39.55  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  154  ? 22.202  15.387  102.851 1.00 43.26  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  154  ? 22.553  16.344  102.163 1.00 42.22  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  154  ? 21.485  13.428  101.452 1.00 44.65  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1  154  ? 21.607  11.938  101.141 1.00 61.01  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1  154  ? 20.736  11.068  102.043 1.00 68.58  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1  154  ? 19.493  11.209  101.986 1.00 65.84  ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1  154  ? 21.291  10.244  102.805 1.00 53.43  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1  155  ? 21.517  15.524  103.983 1.00 46.11  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1  155  ? 21.119  16.836  104.487 1.00 44.26  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1  155  ? 22.277  17.657  105.055 1.00 44.37  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1  155  ? 22.494  18.794  104.638 1.00 61.28  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1  155  ? 20.018  16.693  105.542 1.00 43.72  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1  155  ? 18.719  17.398  105.186 1.00 47.32  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1  155  ? 18.940  18.884  104.949 1.00 57.17  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1  155  ? 17.627  19.600  104.657 1.00 69.24  ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1  155  ? 16.930  19.048  103.460 1.00 59.08  ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1  156  ? 23.009  17.090  106.011 1.00 40.30  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1  156  ? 24.087  17.826  106.679 1.00 40.03  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1  156  ? 25.414  17.856  105.917 1.00 43.81  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1  156  ? 26.112  18.871  105.925 1.00 45.52  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1  156  ? 24.290  17.343  108.124 1.00 37.85  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1  156  ? 24.705  15.909  108.241 1.00 35.16  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1  156  ? 25.993  15.482  107.995 1.00 32.64  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1  156  ? 24.009  14.805  108.599 1.00 34.65  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1  156  ? 26.069  14.179  108.187 1.00 29.74  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1  156  ? 24.877  13.742  108.555 1.00 29.12  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1  157  ? 25.758  16.744  105.271 1.00 42.87  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1  157  ? 26.990  16.640  104.505 1.00 37.97  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1  157  ? 28.241  17.002  105.287 1.00 41.27  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1  157  ? 29.220  17.479  104.716 1.00 45.57  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1  158  ? 28.206  16.772  106.596 1.00 44.87  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1  158  ? 29.294  17.164  107.488 1.00 44.03  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1  158  ? 30.587  16.409  107.199 1.00 43.37  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1  158  ? 30.615  15.178  107.199 1.00 40.29  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1  158  ? 28.902  16.954  108.968 1.00 44.84  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1  158  ? 27.755  17.894  109.352 1.00 47.26  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1  158  ? 30.099  17.170  109.881 1.00 41.18  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1  158  ? 27.256  17.705  110.770 1.00 44.22  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1  159  ? 31.659  17.161  106.964 1.00 53.47  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1  159  ? 32.964  16.582  106.668 1.00 53.71  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1  159  ? 34.082  17.328  107.393 1.00 55.38  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1  159  ? 34.175  18.556  107.316 1.00 48.86  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1  159  ? 33.224  16.586  105.158 1.00 46.28  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1  159  ? 32.289  15.689  104.360 1.00 45.08  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1  159  ? 32.449  15.899  102.862 1.00 46.47  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1  159  ? 33.817  15.451  102.379 1.00 52.73  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1  159  ? 33.990  15.692  100.920 1.00 57.08  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1  160  ? 34.924  16.580  108.100 1.00 60.49  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1  160  ? 36.103  17.149  108.743 1.00 69.39  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1  160  ? 37.158  17.510  107.696 1.00 61.15  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1  160  ? 37.670  18.630  107.672 1.00 55.09  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1  160  ? 36.692  16.166  109.762 1.00 73.88  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1  160  ? 35.768  15.916  110.944 1.00 70.46  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1  160  ? 35.062  16.857  111.369 1.00 60.96  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1  160  ? 35.755  14.773  111.453 1.00 67.00  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1  161  ? 37.473  16.552  106.829 1.00 53.07  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1  161  ? 38.449  16.762  105.766 1.00 52.95  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1  161  ? 37.913  16.290  104.413 1.00 49.21  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1  161  ? 36.757  15.888  104.305 1.00 49.74  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1  161  ? 39.769  16.068  106.107 1.00 59.87  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1  161  ? 39.616  14.637  106.590 1.00 57.49  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1  161  ? 40.934  14.093  107.115 1.00 58.49  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1  161  ? 41.303  14.687  108.396 1.00 74.56  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1  161  ? 42.427  14.410  109.050 1.00 83.59  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1  161  ? 43.299  13.548  108.543 1.00 72.08  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1  161  ? 42.682  14.998  110.213 1.00 85.53  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1  162  ? 38.757  16.345  103.387 1.00 48.32  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1  162  ? 38.335  16.041  102.020 1.00 53.06  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1  162  ? 37.846  14.600  101.845 1.00 55.35  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1  162  ? 36.880  14.346  101.123 1.00 58.15  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1  162  ? 39.457  16.355  101.001 1.00 53.27  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1  162  ? 39.784  17.850  101.019 1.00 56.64  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1  162  ? 39.057  15.929  99.599  1.00 46.76  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1  162  ? 40.782  18.271  99.963  1.00 54.21  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1  163  ? 38.498  13.662  102.523 1.00 49.39  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1  163  ? 38.133  12.253  102.397 1.00 51.97  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1  163  ? 37.058  11.802  103.384 1.00 47.92  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1  163  ? 36.715  10.620  103.438 1.00 43.59  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1  163  ? 39.368  11.360  102.521 1.00 53.09  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1  163  ? 40.231  11.390  101.280 1.00 51.55  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1  163  ? 39.740  11.627  100.176 1.00 48.94  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1  163  ? 41.525  11.144  101.453 1.00 59.58  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1  164  ? 36.534  12.742  104.163 1.00 45.07  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1  164  ? 35.527  12.424  105.171 1.00 45.26  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1  164  ? 34.225  11.919  104.551 1.00 43.27  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1  164  ? 33.853  12.315  103.447 1.00 47.26  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1  164  ? 35.262  13.628  106.062 1.00 49.72  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1  165  ? 33.545  11.037  105.274 1.00 37.74  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1  165  ? 32.291  10.453  104.821 1.00 26.38  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1  165  ? 31.134  10.850  105.730 1.00 30.53  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1  165  ? 31.079  10.424  106.884 1.00 28.51  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1  165  ? 32.373  8.924   104.818 1.00 27.56  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1  165  ? 33.575  8.454   104.002 1.00 27.84  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1  165  ? 31.082  8.322   104.293 1.00 37.21  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1  165  ? 33.824  6.970   104.107 1.00 30.56  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1  166  ? 30.210  11.676  105.216 1.00 32.51  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1  166  ? 28.979  12.014  105.936 1.00 30.83  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1  166  ? 28.173  10.769  106.309 1.00 34.53  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1  166  ? 28.096  9.821   105.523 1.00 34.02  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1  166  ? 28.215  12.861  104.920 1.00 23.36  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1  166  ? 29.282  13.514  104.131 1.00 22.91  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1  166  ? 30.358  12.475  103.988 1.00 27.72  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1  167  ? 27.587  10.780  107.504 1.00 31.40  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1  167  ? 26.869  9.624   108.032 1.00 32.07  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1  167  ? 25.451  9.997   108.459 1.00 34.40  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1  167  ? 25.245  11.034  109.090 1.00 32.37  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1  167  ? 27.612  9.021   109.244 1.00 29.71  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1  167  ? 26.815  7.875   109.855 1.00 32.18  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1  167  ? 29.002  8.555   108.840 1.00 31.68  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1  168  ? 24.480  9.158   108.103 1.00 37.66  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1  168  ? 23.101  9.337   108.553 1.00 39.75  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1  168  ? 23.050  9.317   110.078 1.00 36.55  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1  168  ? 23.533  8.379   110.710 1.00 35.50  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1  168  ? 22.200  8.235   107.986 1.00 37.93  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1  168  ? 22.036  8.325   106.479 1.00 44.80  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1  168  ? 21.696  9.416   105.975 1.00 45.77  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1  168  ? 22.250  7.302   105.794 1.00 50.25  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1  169  ? 22.462  10.352  110.668 1.00 35.86  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1  169  ? 22.488  10.500  112.117 1.00 38.27  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1  169  ? 21.107  10.415  112.753 1.00 41.32  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1  169  ? 20.222  11.213  112.445 1.00 35.28  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1  169  ? 23.163  11.809  112.501 1.00 35.03  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1  170  ? 20.934  9.450   113.651 1.00 43.83  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1  170  ? 19.727  9.383   114.459 1.00 41.56  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1  170  ? 20.063  9.953   115.826 1.00 39.08  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1  170  ? 20.751  9.322   116.629 1.00 45.49  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1  170  ? 19.239  7.938   114.627 1.00 42.34  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1  170  ? 17.987  7.898   115.494 1.00 47.16  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1  170  ? 18.980  7.312   113.269 1.00 41.12  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1  171  ? 19.563  11.151  116.089 1.00 30.19  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1  171  ? 19.953  11.879  117.284 1.00 35.24  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1  171  ? 19.209  11.408  118.524 1.00 35.93  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1  171  ? 19.799  11.289  119.596 1.00 38.53  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1  171  ? 19.773  13.382  117.070 1.00 33.77  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1  171  ? 20.828  13.995  116.193 1.00 38.29  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1  171  ? 22.174  13.814  116.478 1.00 39.55  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1  171  ? 20.480  14.736  115.076 1.00 37.27  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1  171  ? 23.152  14.370  115.673 1.00 30.63  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1  171  ? 21.455  15.295  114.265 1.00 32.44  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1  171  ? 22.792  15.111  114.566 1.00 29.64  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1  172  ? 17.919  11.130  118.362 1.00 38.29  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1  172  ? 17.048  10.780  119.479 1.00 34.25  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1  172  ? 17.606  9.635   120.316 1.00 39.34  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1  172  ? 17.881  8.551   119.797 1.00 44.38  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1  172  ? 15.646  10.426  118.975 1.00 36.66  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1  172  ? 14.840  9.906   120.018 1.00 28.74  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1  173  ? 17.798  9.891   121.617 1.00 40.29  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1  173  ? 18.262  8.904   122.596 1.00 37.72  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1  173  ? 17.190  7.869   122.921 1.00 36.78  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1  173  ? 17.509  6.788   123.413 1.00 35.88  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1  173  ? 18.558  9.757   123.828 1.00 34.43  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1  173  ? 17.635  10.911  123.704 1.00 32.03  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1  173  ? 17.549  11.204  122.238 1.00 33.99  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1  174  ? 15.933  8.197   122.638 1.00 37.51  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1  174  ? 14.821  7.329   123.007 1.00 36.83  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1  174  ? 14.642  6.175   122.024 1.00 35.69  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1  174  ? 14.378  6.385   120.840 1.00 34.65  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1  174  ? 13.507  8.122   123.094 1.00 33.47  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1  174  ? 12.328  7.179   123.221 1.00 38.21  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1  174  ? 13.554  9.092   124.261 1.00 28.51  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1  175  ? 14.800  4.955   122.528 1.00 33.17  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1  175  ? 14.628  3.759   121.714 1.00 32.15  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1  175  ? 13.171  3.297   121.585 1.00 32.63  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1  175  ? 12.729  2.926   120.500 1.00 38.62  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1  175  ? 15.538  2.631   122.216 1.00 27.10  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1  175  ? 17.031  2.953   122.107 1.00 36.99  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1  175  ? 17.435  3.297   120.663 1.00 75.75  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1  175  ? 18.795  3.838   120.560 1.00 80.46  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1  175  ? 19.328  4.338   119.446 1.00 70.51  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1  175  ? 18.624  4.372   118.321 1.00 56.73  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1  175  ? 20.570  4.807   119.454 1.00 60.52  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1  176  ? 12.432  3.309   122.691 1.00 35.53  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1  176  ? 11.029  2.887   122.674 1.00 34.06  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1  176  ? 10.208  3.537   123.788 1.00 31.80  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1  176  ? 10.716  3.764   124.884 1.00 36.26  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1  176  ? 10.943  1.364   122.785 1.00 32.88  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1  176  ? 9.539   0.809   122.679 1.00 30.58  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1  176  ? 9.561   -0.656  122.286 1.00 34.36  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1  176  ? 10.165  -1.484  123.323 1.00 38.96  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1  176  ? 10.639  -2.709  123.118 1.00 52.63  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1  176  ? 10.584  -3.248  121.908 1.00 45.57  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1  176  ? 11.175  -3.391  124.123 1.00 53.82  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1  177  ? 8.939   3.826   123.513 1.00 27.98  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1  177  ? 8.042   4.374   124.532 1.00 28.63  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1  177  ? 6.633   3.785   124.447 1.00 29.58  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1  177  ? 6.012   3.790   123.387 1.00 31.15  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1  177  ? 7.943   5.914   124.452 1.00 21.64  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1  177  ? 6.813   6.420   125.327 1.00 23.56  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1  177  ? 9.244   6.554   124.872 1.00 24.34  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1  178  ? 6.135   3.285   125.573 1.00 31.86  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1  178  ? 4.768   2.786   125.658 1.00 27.74  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1  178  ? 4.103   3.287   126.935 1.00 31.51  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1  178  ? 4.734   3.351   127.990 1.00 31.11  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1  178  ? 4.754   1.269   125.621 1.00 23.91  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1  179  ? 2.829   3.650   126.842 1.00 36.19  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1  179  ? 2.080   4.011   128.037 1.00 29.97  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1  179  ? 0.871   3.101   128.233 1.00 31.85  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1  179  ? 0.331   2.542   127.278 1.00 29.59  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1  179  ? 1.686   5.493   128.042 1.00 28.17  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1  179  ? 0.615   5.846   127.057 1.00 29.62  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1  179  ? -0.703  5.958   127.462 1.00 32.84  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1  179  ? 0.926   6.082   125.731 1.00 36.68  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1  179  ? -1.694  6.290   126.560 1.00 33.20  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1  179  ? -0.062  6.413   124.823 1.00 41.70  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1  179  ? -1.373  6.519   125.239 1.00 37.09  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1  180  ? 0.469   2.951   129.488 1.00 38.79  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1  180  ? -0.583  2.021   129.859 1.00 31.76  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1  180  ? -1.626  2.745   130.698 1.00 31.69  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1  180  ? -1.285  3.509   131.604 1.00 29.78  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1  180  ? 0.016   0.864   130.660 1.00 34.41  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1  180  ? -0.907  -0.323  130.849 1.00 41.81  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1  180  ? -0.462  -1.533  130.049 1.00 51.19  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1  180  ? 0.414   -1.436  129.187 1.00 49.90  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1  180  ? -1.062  -2.683  130.336 1.00 50.01  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1  181  ? -2.896  2.517   130.387 1.00 31.41  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1  181  ? -3.978  3.075   131.185 1.00 29.62  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1  181  ? -4.724  1.969   131.919 1.00 37.36  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1  181  ? -5.407  1.150   131.304 1.00 37.02  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1  181  ? -4.971  3.865   130.331 1.00 24.37  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1  181  ? -6.070  4.433   131.211 1.00 34.01  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1  181  ? -4.255  4.974   129.585 1.00 28.27  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1  182  ? -4.584  1.956   133.240 1.00 45.55  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1  182  ? -5.218  0.944   134.077 1.00 42.92  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1  182  ? -6.308  1.560   134.953 1.00 41.34  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1  182  ? -6.266  2.748   135.279 1.00 37.95  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1  182  ? -4.171  0.213   134.923 1.00 38.51  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1  182  ? -3.267  -0.709  134.110 1.00 48.82  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1  182  ? -2.025  -1.146  134.869 1.00 54.13  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1  182  ? -1.608  -0.422  135.799 1.00 54.06  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1  182  ? -1.463  -2.211  134.533 1.00 48.11  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1  183  ? -7.292  0.745   135.314 1.00 41.23  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1  183  ? -8.439  1.218   136.078 1.00 44.27  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1  183  ? -8.118  1.418   137.562 1.00 38.83  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1  183  ? -7.544  0.541   138.206 1.00 35.00  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1  183  ? -9.600  0.237   135.920 1.00 46.50  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1  183  ? -10.940 0.878   136.191 1.00 50.01  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1  183  ? -11.037 2.120   136.079 1.00 39.10  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1  183  ? -11.896 0.137   136.509 1.00 54.85  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1  184  ? -8.495  2.576   138.097 1.00 42.89  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1  184  ? -8.300  2.875   139.516 1.00 47.27  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1  184  ? -9.513  3.597   140.110 1.00 48.81  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1  184  ? -10.405 4.038   139.383 1.00 41.53  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1  184  ? -7.028  3.719   139.757 1.00 44.05  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1  184  ? -6.693  3.701   141.150 1.00 53.45  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1  184  ? -7.242  5.157   139.313 1.00 36.76  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1  185  ? -9.551  3.700   141.435 1.00 55.16  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1  185  ? -10.641 4.396   142.113 1.00 58.16  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1  185  ? -10.159 5.106   143.377 1.00 53.26  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1  185  ? -9.301  4.597   144.097 1.00 53.17  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1  185  ? -11.776 3.423   142.449 1.00 60.09  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1  185  ? -11.373 2.297   143.390 1.00 60.78  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1  185  ? -12.531 1.350   143.665 1.00 68.59  ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1  185  ? -13.728 2.051   144.127 1.00 89.17  ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1  185  ? -13.959 2.398   145.391 1.00 81.66  ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1  185  ? -13.070 2.118   146.335 1.00 69.98  ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1  185  ? -15.081 3.030   145.710 1.00 70.69  ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1  186  ? -10.695 6.298   143.622 1.00 51.95  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1  186  ? -10.409 7.038   144.847 1.00 55.10  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1  186  ? -11.525 6.826   145.869 1.00 72.72  ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1  186  ? -11.493 7.371   146.973 1.00 70.09  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1  186  ? -10.246 8.527   144.541 1.00 58.82  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1  186  ? -9.608  9.413   145.612 1.00 53.59  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1  186  ? -8.193  8.953   145.920 1.00 50.70  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1  186  ? -9.620  10.869  145.180 1.00 57.25  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1  187  ? -12.517 6.027   145.490 1.00 82.37  ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1  187  ? -13.712 5.856   146.295 1.00 70.03  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1  187  ? -14.752 6.876   145.876 1.00 82.80  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1  187  ? -15.951 6.692   146.090 1.00 73.19  ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1  188  ? -14.273 7.953   145.261 1.00 98.91  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1  188  ? -15.125 9.014   144.740 1.00 108.45 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1  188  ? -16.004 8.484   143.616 1.00 102.91 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1  188  ? -17.214 8.712   143.595 1.00 107.05 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1  188  ? -14.264 10.175  144.233 1.00 96.84  ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1  188  ? -15.005 11.186  143.374 1.00 91.33  ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1  188  ? -14.127 12.352  142.964 1.00 75.36  ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1  188  ? -13.171 12.699  143.659 1.00 67.85  ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1  188  ? -14.445 12.962  141.828 1.00 74.55  ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1  189  ? -15.384 7.768   142.685 1.00 79.75  ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1  189  ? -16.105 7.182   141.569 1.00 90.31  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1  189  ? -15.255 6.065   140.974 1.00 85.84  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1  189  ? -14.135 5.817   141.427 1.00 69.92  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1  189  ? -16.404 8.262   140.518 1.00 95.93  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1  189  ? -17.501 7.918   139.509 1.00 88.15  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1  189  ? -17.846 9.113   138.626 1.00 84.13  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1  189  ? -16.665 9.717   138.012 1.00 84.83  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1  189  ? -16.237 9.448   136.782 1.00 83.21  ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1  189  ? -16.893 8.582   136.021 1.00 79.54  ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1  189  ? -15.151 10.049  136.310 1.00 72.52  ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1  190  ? -15.800 5.382   139.974 1.00 82.75  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1  190  ? -15.050 4.410   139.197 1.00 79.92  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1  190  ? -14.547 5.074   137.920 1.00 62.03  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1  190  ? -14.646 6.292   137.769 1.00 57.28  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1  190  ? -15.913 3.187   138.839 1.00 87.07  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1  190  ? -17.151 3.627   138.265 1.00 84.70  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1  190  ? -16.207 2.362   140.084 1.00 74.15  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1  191  ? -13.991 4.269   137.020 1.00 64.44  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  191  ? -13.540 4.738   135.709 1.00 62.06  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  191  ? -12.469 5.824   135.784 1.00 51.81  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  191  ? -12.332 6.630   134.867 1.00 48.96  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  191  ? -14.724 5.218   134.862 1.00 69.42  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  191  ? -14.789 4.533   133.508 1.00 78.54  ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  191  ? -13.726 4.120   132.994 1.00 67.82  ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  191  ? -15.905 4.407   132.959 1.00 82.42  ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1  192  ? -11.714 5.839   136.877 1.00 53.88  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1  192  ? -10.581 6.746   137.011 1.00 44.39  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1  192  ? -9.345  6.130   136.362 1.00 41.06  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1  192  ? -9.149  4.915   136.413 1.00 46.32  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1  192  ? -10.317 7.063   138.483 1.00 41.73  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1  192  ? -10.712 8.460   138.960 1.00 40.53  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1  192  ? -12.156 8.768   138.602 1.00 47.59  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1  192  ? -10.487 8.581   140.456 1.00 41.42  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1  193  ? -8.516  6.963   135.742 1.00 36.63  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1  193  ? -7.361  6.463   135.003 1.00 41.06  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1  193  ? -6.085  6.411   135.840 1.00 35.49  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1  193  ? -5.781  7.340   136.587 1.00 33.23  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1  193  ? -7.115  7.304   133.743 1.00 42.36  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1  193  ? -8.217  7.152   132.708 1.00 45.43  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1  193  ? -9.032  6.212   132.826 1.00 49.24  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1  193  ? -8.261  7.970   131.767 1.00 43.97  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1  194  ? -5.347  5.313   135.707 1.00 35.35  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1  194  ? -4.001  5.211   136.260 1.00 32.74  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1  194  ? -3.003  5.108   135.113 1.00 33.76  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1  194  ? -2.921  4.080   134.442 1.00 35.94  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1  194  ? -3.884  3.983   137.160 1.00 37.80  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1  194  ? -2.471  3.684   137.631 1.00 33.03  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1  194  ? -2.386  2.294   138.237 1.00 40.11  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1  194  ? -0.942  1.866   138.450 1.00 48.55  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1  194  ? -0.835  0.437   138.860 1.00 36.68  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1  195  ? -2.233  6.170   134.903 1.00 32.56  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1  195  ? -1.339  6.251   133.752 1.00 30.92  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1  195  ? 0.074   5.782   134.073 1.00 26.12  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1  195  ? 0.697   6.271   135.009 1.00 27.06  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1  195  ? -1.295  7.683   133.221 1.00 28.08  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1  195  ? -0.249  7.945   132.139 1.00 28.35  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1  195  ? -0.535  7.099   130.905 1.00 29.84  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1  195  ? -0.207  9.420   131.792 1.00 22.90  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1  196  ? 0.580   4.840   133.283 1.00 28.07  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1  196  ? 1.939   4.345   133.470 1.00 32.41  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1  196  ? 2.774   4.508   132.203 1.00 32.56  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1  196  ? 2.496   3.881   131.184 1.00 33.25  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1  196  ? 1.955   2.860   133.873 1.00 35.24  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1  196  ? 0.813   2.562   134.689 1.00 35.34  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1  196  ? 3.235   2.538   134.634 1.00 30.47  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1  197  ? 3.806   5.342   132.275 1.00 30.69  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1  197  ? 4.667   5.600   131.125 1.00 26.45  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1  197  ? 5.984   4.826   131.189 1.00 30.98  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1  197  ? 6.818   5.079   132.056 1.00 34.03  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1  197  ? 4.955   7.096   131.018 1.00 29.66  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1  197  ? 4.205   7.857   129.929 1.00 35.90  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1  197  ? 4.375   9.350   130.128 1.00 41.11  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1  197  ? 4.714   7.443   128.561 1.00 34.47  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1  198  ? 6.169   3.890   130.263 1.00 31.05  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1  198  ? 7.403   3.115   130.186 1.00 24.93  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1  198  ? 8.313   3.716   129.124 1.00 29.55  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1  198  ? 7.863   4.035   128.025 1.00 31.40  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1  198  ? 7.094   1.656   129.861 1.00 23.60  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1  198  ? 6.037   1.045   130.763 1.00 28.20  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1  198  ? 5.514   -0.265  130.204 1.00 30.88  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1  198  ? 6.510   -1.330  130.276 1.00 40.05  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1  198  ? 6.369   -2.523  129.709 1.00 44.51  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1  198  ? 5.271   -2.806  129.019 1.00 43.10  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1  198  ? 7.327   -3.431  129.827 1.00 45.35  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1  199  ? 9.591   3.884   129.456 1.00 36.09  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1  199  ? 10.535  4.558   128.565 1.00 32.13  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1  199  ? 11.879  3.835   128.468 1.00 30.87  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1  199  ? 12.545  3.609   129.475 1.00 38.56  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1  199  ? 10.791  6.014   129.018 1.00 27.34  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1  199  ? 9.503   6.836   128.951 1.00 21.17  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1  199  ? 11.878  6.658   128.171 1.00 27.67  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1  199  ? 9.632   8.205   129.557 1.00 26.95  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1  200  ? 12.272  3.482   127.249 1.00 30.28  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1  200  ? 13.580  2.888   127.004 1.00 30.25  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1  200  ? 14.519  3.926   126.401 1.00 31.28  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1  200  ? 14.091  4.779   125.627 1.00 38.87  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1  200  ? 13.459  1.698   126.057 1.00 29.96  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1  200  ? 12.797  0.491   126.650 1.00 34.26  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1  200  ? 13.414  -0.629  127.123 1.00 33.29  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1  200  ? 11.390  0.276   126.819 1.00 32.49  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1  200  ? 12.480  -1.528  127.578 1.00 38.21  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1  200  ? 11.230  -0.996  127.403 1.00 34.89  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1  200  ? 10.252  1.034   126.533 1.00 31.55  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1  200  ? 9.978   -1.525  127.707 1.00 34.31  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1  200  ? 9.011   0.507   126.837 1.00 31.73  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1  200  ? 8.884   -0.760  127.418 1.00 33.29  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1  201  ? 15.798  3.856   126.756 1.00 36.41  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1  201  ? 16.782  4.815   126.262 1.00 36.75  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1  201  ? 18.140  4.146   126.054 1.00 39.89  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1  201  ? 18.445  3.144   126.697 1.00 44.10  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1  201  ? 16.937  6.002   127.233 1.00 36.51  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1  201  ? 15.652  6.373   127.744 1.00 44.82  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1  201  ? 17.540  7.194   126.526 1.00 47.19  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1  202  ? 18.949  4.696   125.151 1.00 44.15  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1  202  ? 20.275  4.143   124.872 1.00 52.49  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1  202  ? 21.278  4.380   126.008 1.00 55.76  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1  202  ? 22.357  3.783   126.031 1.00 49.27  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1  202  ? 20.829  4.670   123.539 1.00 52.97  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1  202  ? 20.835  6.191   123.457 1.00 53.05  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1  202  ? 20.588  6.856   124.486 1.00 48.11  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1  202  ? 21.098  6.724   122.355 1.00 53.89  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1  203  ? 20.914  5.252   126.945 1.00 51.48  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1  203  ? 21.755  5.538   128.092 1.00 40.14  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1  203  ? 22.442  6.890   128.035 1.00 38.94  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1  203  ? 22.946  7.369   129.050 1.00 36.97  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1  204  ? 22.463  7.507   126.856 1.00 41.57  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1  204  ? 23.060  8.831   126.692 1.00 43.45  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1  204  ? 22.305  9.861   127.527 1.00 42.82  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1  204  ? 22.884  10.835  128.011 1.00 39.71  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1  204  ? 23.081  9.242   125.219 1.00 47.24  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1  204  ? 21.792  9.142   124.639 1.00 53.26  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1  205  ? 21.001  9.645   127.669 1.00 41.02  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1  205  ? 20.204  10.336  128.675 1.00 47.99  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1  205  ? 19.382  9.280   129.406 1.00 45.13  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1  205  ? 19.210  8.169   128.910 1.00 44.26  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1  205  ? 19.264  11.408  128.072 1.00 40.26  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1  205  ? 20.026  12.335  127.130 1.00 37.24  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1  205  ? 18.090  10.758  127.363 1.00 38.23  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1  206  ? 18.899  9.609   130.597 1.00 41.37  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1  206  ? 18.065  8.681   131.345 1.00 38.70  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1  206  ? 16.599  8.904   130.984 1.00 39.04  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1  206  ? 16.237  9.984   130.517 1.00 39.85  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1  206  ? 18.275  8.842   132.859 1.00 43.54  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1  206  ? 17.823  10.136  133.273 1.00 46.03  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1  206  ? 19.745  8.683   133.205 1.00 44.88  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1  207  ? 15.754  7.877   131.179 1.00 34.88  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1  207  ? 14.316  7.991   130.911 1.00 34.22  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1  207  ? 13.667  9.146   131.665 1.00 41.34  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1  207  ? 12.778  9.803   131.120 1.00 41.23  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1  207  ? 13.766  6.661   131.425 1.00 36.27  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1  207  ? 14.892  5.715   131.247 1.00 36.62  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1  207  ? 16.128  6.500   131.550 1.00 34.37  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1  208  ? 14.106  9.384   132.899 1.00 41.28  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1  208  ? 13.567  10.473  133.706 1.00 35.84  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1  208  ? 13.940  11.833  133.122 1.00 35.39  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1  208  ? 13.122  12.752  133.107 1.00 37.09  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1  208  ? 14.039  10.366  135.158 1.00 37.48  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1  208  ? 13.603  11.501  136.092 1.00 36.18  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1  208  ? 12.093  11.668  136.083 1.00 31.93  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1  208  ? 14.102  11.264  137.508 1.00 40.68  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1  209  ? 15.175  11.956  132.645 1.00 36.28  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1  209  ? 15.616  13.183  131.994 1.00 41.19  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1  209  ? 14.730  13.474  130.796 1.00 38.69  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1  209  ? 14.254  14.596  130.621 1.00 36.58  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1  209  ? 17.068  13.064  131.526 1.00 48.47  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1  209  ? 18.109  13.147  132.626 1.00 46.66  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1  209  ? 19.522  13.081  132.080 1.00 58.10  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1  209  ? 20.346  12.320  132.635 1.00 57.88  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1  209  ? 19.808  13.794  131.093 1.00 64.45  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1  210  ? 14.514  12.446  129.980 1.00 36.38  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1  210  ? 13.719  12.563  128.764 1.00 34.54  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1  210  ? 12.313  13.058  129.066 1.00 30.65  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1  210  ? 11.828  13.996  128.433 1.00 26.17  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1  210  ? 13.664  11.228  128.042 1.00 34.07  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1  211  ? 11.672  12.421  130.041 1.00 29.21  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1  211  ? 10.316  12.776  130.437 1.00 28.12  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1  211  ? 10.216  14.242  130.849 1.00 27.60  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1  211  ? 9.271   14.940  130.479 1.00 23.68  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1  211  ? 9.843   11.878  131.579 1.00 27.18  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1  211  ? 8.461   12.213  132.141 1.00 39.68  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1  211  ? 7.391   12.064  131.064 1.00 34.11  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1  211  ? 8.140   11.353  133.357 1.00 38.69  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1  212  ? 11.200  14.706  131.608 1.00 31.35  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1  212  ? 11.209  16.088  132.068 1.00 38.00  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1  212  ? 11.443  17.079  130.932 1.00 33.49  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1  212  ? 10.899  18.183  130.939 1.00 32.64  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1  212  ? 12.230  16.282  133.194 1.00 37.84  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1  212  ? 11.799  15.609  134.487 1.00 37.91  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1  212  ? 12.503  14.752  135.021 1.00 36.09  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1  212  ? 10.630  15.992  134.991 1.00 37.19  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1  213  ? 12.251  16.676  129.956 1.00 35.42  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1  213  ? 12.470  17.490  128.769 1.00 31.18  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1  213  ? 11.210  17.470  127.920 1.00 31.15  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1  213  ? 10.823  18.481  127.334 1.00 31.07  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1  213  ? 13.658  16.961  127.966 1.00 26.74  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1  213  ? 14.968  16.987  128.730 1.00 36.19  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1  213  ? 16.116  16.388  127.946 1.00 34.36  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1  213  ? 16.165  16.488  126.722 1.00 35.05  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1  213  ? 17.048  15.758  128.652 1.00 41.11  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1  214  ? 10.570  16.307  127.874 1.00 31.47  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1  214  ? 9.349   16.127  127.103 1.00 28.01  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1  214  ? 8.228   17.015  127.626 1.00 29.84  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1  214  ? 7.564   17.705  126.852 1.00 28.96  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1  214  ? 8.924   14.669  127.117 1.00 26.17  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1  215  ? 8.018   17.001  128.939 1.00 31.44  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1  215  ? 6.958   17.813  129.524 1.00 33.40  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1  215  ? 7.279   19.296  129.392 1.00 30.15  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1  215  ? 6.376   20.124  129.276 1.00 35.18  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1  215  ? 6.668   17.451  131.002 1.00 30.10  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1  215  ? 6.296   15.984  131.126 1.00 32.26  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1  215  ? 7.852   17.774  131.881 1.00 34.59  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1  216  ? 8.566   19.625  129.392 1.00 29.66  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1  216  ? 8.992   21.005  129.218 1.00 34.53  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1  216  ? 8.580   21.507  127.842 1.00 38.30  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1  216  ? 8.009   22.589  127.715 1.00 38.54  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1  216  ? 10.505  21.137  129.402 1.00 38.70  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1  216  ? 11.066  22.496  129.006 1.00 41.46  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1  216  ? 10.483  23.637  129.820 1.00 44.04  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1  216  ? 10.179  23.430  131.014 1.00 50.77  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1  216  ? 10.325  24.744  129.260 1.00 39.14  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1  217  ? 8.863   20.706  126.818 1.00 36.73  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1  217  ? 8.489   21.043  125.448 1.00 36.74  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1  217  ? 6.974   21.180  125.306 1.00 33.56  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1  217  ? 6.481   22.101  124.653 1.00 32.72  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1  217  ? 9.000   19.987  124.448 1.00 33.50  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1  217  ? 10.526  19.910  124.487 1.00 40.31  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1  217  ? 8.529   20.307  123.039 1.00 29.88  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1  217  ? 11.109  18.911  123.506 1.00 36.72  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1  218  ? 6.239   20.269  125.933 1.00 27.92  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1  218  ? 4.787   20.287  125.846 1.00 25.80  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1  218  ? 4.197   21.533  126.499 1.00 31.04  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1  218  ? 3.307   22.171  125.932 1.00 29.95  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1  218  ? 4.192   19.018  126.459 1.00 23.65  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1  218  ? 2.671   18.880  126.358 1.00 26.61  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1  218  ? 2.191   19.102  124.933 1.00 16.46  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1  218  ? 2.230   17.518  126.864 1.00 28.89  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1  219  ? 4.695   21.886  127.682 1.00 31.88  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1  219  ? 4.195   23.068  128.382 1.00 39.58  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1  219  ? 4.669   24.349  127.708 1.00 39.70  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1  219  ? 4.001   25.381  127.773 1.00 39.87  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1  219  ? 4.601   23.068  129.861 1.00 45.62  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1  219  ? 6.094   23.208  130.117 1.00 46.40  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1  219  ? 6.367   24.075  131.337 1.00 43.43  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1  219  ? 6.151   25.490  131.052 1.00 43.07  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1  219  ? 7.111   26.329  130.675 1.00 41.23  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1  219  ? 6.827   27.601  130.432 1.00 40.58  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1  219  ? 8.358   25.897  130.544 1.00 36.50  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1  220  ? 5.826   24.274  127.061 1.00 38.64  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1  220  ? 6.364   25.415  126.343 1.00 39.09  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1  220  ? 5.509   25.695  125.115 1.00 37.72  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1  220  ? 5.393   26.835  124.675 1.00 41.56  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1  220  ? 7.811   25.149  125.935 1.00 41.78  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1  220  ? 8.522   26.333  125.316 1.00 54.47  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1  220  ? 9.939   25.996  124.904 1.00 74.74  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1  220  ? 10.484  24.996  125.419 1.00 66.94  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1  220  ? 10.504  26.724  124.060 1.00 87.96  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1  221  ? 4.901   24.648  124.568 1.00 37.86  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1  221  ? 4.055   24.798  123.389 1.00 42.73  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1  221  ? 2.699   25.391  123.740 1.00 35.56  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1  221  ? 2.052   26.025  122.908 1.00 34.05  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1  221  ? 3.888   23.465  122.655 1.00 42.78  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1  221  ? 4.972   23.190  121.655 1.00 42.33  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1  221  ? 6.251   22.842  122.022 1.00 43.77  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1  221  ? 4.960   23.227  120.302 1.00 37.57  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1  221  ? 6.986   22.670  120.934 1.00 35.94  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1  221  ? 6.227   22.897  119.881 1.00 36.79  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1  222  ? 2.277   25.192  124.981 1.00 36.72  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1  222  ? 1.022   25.760  125.447 1.00 39.14  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1  222  ? 1.132   27.277  125.562 1.00 43.56  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1  222  ? 0.124   27.985  125.576 1.00 44.25  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1  222  ? 0.625   25.137  126.782 1.00 27.75  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1  222  ? 0.371   23.633  126.693 1.00 24.93  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1  222  ? 0.077   23.056  128.059 1.00 36.35  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1  222  ? -0.774  23.351  125.736 1.00 28.65  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1  223  ? 2.368   27.764  125.630 1.00 40.39  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1  223  ? 2.642   29.193  125.697 1.00 37.01  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1  223  ? 2.202   29.891  124.420 1.00 41.56  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1  223  ? 1.802   31.050  124.444 1.00 49.84  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1  223  ? 4.146   29.457  125.889 1.00 39.93  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1  223  ? 4.623   28.715  127.017 1.00 47.20  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1  223  ? 4.419   30.938  126.105 1.00 47.83  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1  224  ? 2.269   29.171  123.305 1.00 44.60  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1  224  ? 2.024   29.763  121.991 1.00 45.99  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1  224  ? 0.589   30.265  121.827 1.00 50.92  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1  224  ? 0.309   31.097  120.963 1.00 51.65  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1  224  ? 2.392   28.769  120.883 1.00 45.68  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1  224  ? 3.821   28.267  120.973 1.00 48.92  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1  224  ? 4.831   29.074  121.487 1.00 44.78  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1  224  ? 4.158   26.985  120.555 1.00 44.52  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1  224  ? 6.136   28.622  121.578 1.00 44.53  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1  224  ? 5.464   26.524  120.640 1.00 45.96  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1  224  ? 6.449   27.347  121.154 1.00 55.14  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1  224  ? 7.750   26.896  121.246 1.00 54.98  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1  225  ? -0.308  29.769  122.677 1.00 53.38  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1  225  ? -1.710  30.174  122.651 1.00 53.44  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1  225  ? -1.940  31.501  123.373 1.00 60.03  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1  225  ? -3.045  32.044  123.343 1.00 67.58  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1  225  ? -2.588  29.098  123.295 1.00 43.77  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1  225  ? -2.640  27.811  122.526 1.00 40.52  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1  225  ? -1.700  26.816  122.746 1.00 42.83  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1  225  ? -3.637  27.588  121.591 1.00 40.03  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1  225  ? -1.749  25.624  122.041 1.00 35.68  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1  225  ? -3.691  26.400  120.882 1.00 39.06  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1  225  ? -2.745  25.416  121.107 1.00 30.34  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1  226  ? -0.897  32.012  124.022 1.00 58.78  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1  226  ? -0.997  33.221  124.841 1.00 68.90  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1  226  ? -1.530  34.441  124.091 1.00 77.32  ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1  226  ? -2.593  34.967  124.425 1.00 72.59  ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1  226  ? 0.352   33.556  125.483 1.00 67.36  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1  226  ? 0.793   32.501  126.320 1.00 60.22  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1  227  ? -0.782  34.891  123.089 1.00 72.76  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1  227  ? -1.123  36.109  122.363 1.00 71.45  ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1  227  ? -1.967  35.820  121.125 1.00 69.34  ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1  227  ? -1.457  35.307  120.130 1.00 73.16  ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1  227  ? 0.158   36.852  121.971 1.00 76.85  ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1  227  ? -0.114  38.156  121.243 1.00 87.10  ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1  227  ? -1.215  38.704  121.308 1.00 90.12  ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1  227  ? 0.897   38.664  120.548 1.00 81.43  ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1  228  ? -3.264  36.166  121.182 1.00 72.70  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1  228  ? -4.194  35.931  120.074 1.00 74.47  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1  228  ? -4.072  37.003  118.996 1.00 69.85  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1  228  ? -3.169  37.838  119.066 1.00 68.62  ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1  228  ? -5.560  36.017  120.754 1.00 66.52  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1  228  ? -5.351  36.992  121.853 1.00 78.10  ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1  228  ? -3.935  36.791  122.336 1.00 76.05  ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1  229  ? -4.965  36.972  118.011 1.00 61.51  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1  229  ? -4.936  37.944  116.923 1.00 64.58  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1  229  ? -6.332  38.158  116.342 1.00 53.36  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1  229  ? -6.514  38.172  115.124 1.00 48.67  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1  229  ? -3.973  37.487  115.824 1.00 66.38  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1  229  ? -3.236  38.619  115.121 1.00 73.68  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1  229  ? -2.051  39.133  115.920 1.00 70.70  ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1  229  ? -1.546  38.451  116.813 1.00 68.05  ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1  229  ? -1.602  40.342  115.601 1.00 75.88  ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LYS B 1  7    ? 11.093  28.607  115.528 1.00 57.18  ? 7    LYS B N     1 
ATOM   1784  C  CA    . LYS B 1  7    ? 10.798  29.987  115.902 1.00 63.26  ? 7    LYS B CA    1 
ATOM   1785  C  C     . LYS B 1  7    ? 9.531   30.073  116.751 1.00 65.30  ? 7    LYS B C     1 
ATOM   1786  O  O     . LYS B 1  7    ? 9.012   29.057  117.215 1.00 66.00  ? 7    LYS B O     1 
ATOM   1787  C  CB    . LYS B 1  7    ? 10.649  30.865  114.656 1.00 61.87  ? 7    LYS B CB    1 
ATOM   1788  C  CG    . LYS B 1  7    ? 9.415   30.553  113.819 1.00 59.96  ? 7    LYS B CG    1 
ATOM   1789  C  CD    . LYS B 1  7    ? 9.110   31.673  112.839 1.00 57.51  ? 7    LYS B CD    1 
ATOM   1790  C  CE    . LYS B 1  7    ? 7.715   31.522  112.253 1.00 49.20  ? 7    LYS B CE    1 
ATOM   1791  N  NZ    . LYS B 1  7    ? 7.367   32.633  111.324 1.00 42.24  ? 7    LYS B NZ    1 
ATOM   1792  N  N     . ALA B 1  8    ? 9.042   31.293  116.954 1.00 69.57  ? 8    ALA B N     1 
ATOM   1793  C  CA    . ALA B 1  8    ? 7.808   31.518  117.701 1.00 53.78  ? 8    ALA B CA    1 
ATOM   1794  C  C     . ALA B 1  8    ? 6.599   31.473  116.772 1.00 47.80  ? 8    ALA B C     1 
ATOM   1795  O  O     . ALA B 1  8    ? 6.485   32.280  115.849 1.00 45.33  ? 8    ALA B O     1 
ATOM   1796  C  CB    . ALA B 1  8    ? 7.866   32.848  118.436 1.00 55.48  ? 8    ALA B CB    1 
ATOM   1797  N  N     . PRO B 1  9    ? 5.695   30.513  117.009 1.00 45.54  ? 9    PRO B N     1 
ATOM   1798  C  CA    . PRO B 1  9    ? 4.501   30.326  116.178 1.00 48.28  ? 9    PRO B CA    1 
ATOM   1799  C  C     . PRO B 1  9    ? 3.476   31.436  116.372 1.00 44.85  ? 9    PRO B C     1 
ATOM   1800  O  O     . PRO B 1  9    ? 3.229   31.851  117.503 1.00 48.88  ? 9    PRO B O     1 
ATOM   1801  C  CB    . PRO B 1  9    ? 3.927   28.998  116.687 1.00 45.36  ? 9    PRO B CB    1 
ATOM   1802  C  CG    . PRO B 1  9    ? 5.053   28.338  117.426 1.00 48.92  ? 9    PRO B CG    1 
ATOM   1803  C  CD    . PRO B 1  9    ? 5.826   29.460  118.027 1.00 42.53  ? 9    PRO B CD    1 
ATOM   1804  N  N     . VAL B 1  10   ? 2.880   31.904  115.280 1.00 45.78  ? 10   VAL B N     1 
ATOM   1805  C  CA    . VAL B 1  10   ? 1.821   32.899  115.376 1.00 47.41  ? 10   VAL B CA    1 
ATOM   1806  C  C     . VAL B 1  10   ? 0.465   32.245  115.644 1.00 50.12  ? 10   VAL B C     1 
ATOM   1807  O  O     . VAL B 1  10   ? 0.174   31.133  115.161 1.00 53.84  ? 10   VAL B O     1 
ATOM   1808  C  CB    . VAL B 1  10   ? 1.756   33.826  114.134 1.00 51.14  ? 10   VAL B CB    1 
ATOM   1809  C  CG1   . VAL B 1  10   ? 3.149   34.322  113.771 1.00 49.35  ? 10   VAL B CG1   1 
ATOM   1810  C  CG2   . VAL B 1  10   ? 1.112   33.120  112.949 1.00 57.10  ? 10   VAL B CG2   1 
ATOM   1811  N  N     . PHE B 1  11   ? -0.344  32.951  116.430 1.00 46.69  ? 11   PHE B N     1 
ATOM   1812  C  CA    . PHE B 1  11   ? -1.649  32.477  116.872 1.00 51.02  ? 11   PHE B CA    1 
ATOM   1813  C  C     . PHE B 1  11   ? -2.724  33.459  116.414 1.00 48.78  ? 11   PHE B C     1 
ATOM   1814  O  O     . PHE B 1  11   ? -2.636  34.655  116.685 1.00 54.70  ? 11   PHE B O     1 
ATOM   1815  C  CB    . PHE B 1  11   ? -1.654  32.333  118.397 1.00 52.55  ? 11   PHE B CB    1 
ATOM   1816  C  CG    . PHE B 1  11   ? -2.941  31.800  118.962 1.00 55.68  ? 11   PHE B CG    1 
ATOM   1817  C  CD1   . PHE B 1  11   ? -3.461  30.593  118.527 1.00 52.21  ? 11   PHE B CD1   1 
ATOM   1818  C  CD2   . PHE B 1  11   ? -3.616  32.495  119.952 1.00 59.75  ? 11   PHE B CD2   1 
ATOM   1819  C  CE1   . PHE B 1  11   ? -4.643  30.100  119.056 1.00 51.41  ? 11   PHE B CE1   1 
ATOM   1820  C  CE2   . PHE B 1  11   ? -4.796  32.008  120.485 1.00 56.83  ? 11   PHE B CE2   1 
ATOM   1821  C  CZ    . PHE B 1  11   ? -5.310  30.809  120.037 1.00 49.63  ? 11   PHE B CZ    1 
ATOM   1822  N  N     . THR B 1  12   ? -3.733  32.946  115.717 1.00 47.77  ? 12   THR B N     1 
ATOM   1823  C  CA    . THR B 1  12   ? -4.740  33.780  115.069 1.00 45.63  ? 12   THR B CA    1 
ATOM   1824  C  C     . THR B 1  12   ? -6.141  33.388  115.520 1.00 42.51  ? 12   THR B C     1 
ATOM   1825  O  O     . THR B 1  12   ? -6.415  32.214  115.749 1.00 40.81  ? 12   THR B O     1 
ATOM   1826  C  CB    . THR B 1  12   ? -4.656  33.639  113.539 1.00 45.86  ? 12   THR B CB    1 
ATOM   1827  O  OG1   . THR B 1  12   ? -3.289  33.752  113.124 1.00 52.94  ? 12   THR B OG1   1 
ATOM   1828  C  CG2   . THR B 1  12   ? -5.491  34.709  112.844 1.00 54.62  ? 12   THR B CG2   1 
ATOM   1829  N  N     . VAL B 1  13   ? -7.026  34.372  115.649 1.00 42.32  ? 13   VAL B N     1 
ATOM   1830  C  CA    . VAL B 1  13   ? -8.378  34.120  116.135 1.00 42.31  ? 13   VAL B CA    1 
ATOM   1831  C  C     . VAL B 1  13   ? -9.447  34.745  115.243 1.00 48.41  ? 13   VAL B C     1 
ATOM   1832  O  O     . VAL B 1  13   ? -9.334  35.902  114.839 1.00 49.16  ? 13   VAL B O     1 
ATOM   1833  C  CB    . VAL B 1  13   ? -8.563  34.646  117.575 1.00 48.60  ? 13   VAL B CB    1 
ATOM   1834  C  CG1   . VAL B 1  13   ? -9.993  34.433  118.045 1.00 44.41  ? 13   VAL B CG1   1 
ATOM   1835  C  CG2   . VAL B 1  13   ? -7.583  33.971  118.524 1.00 53.00  ? 13   VAL B CG2   1 
ATOM   1836  N  N     . ARG B 1  14   ? -10.474 33.961  114.926 1.00 48.82  ? 14   ARG B N     1 
ATOM   1837  C  CA    . ARG B 1  14   ? -11.669 34.466  114.264 1.00 46.66  ? 14   ARG B CA    1 
ATOM   1838  C  C     . ARG B 1  14   ? -12.902 34.015  115.039 1.00 57.75  ? 14   ARG B C     1 
ATOM   1839  O  O     . ARG B 1  14   ? -13.202 32.822  115.093 1.00 62.38  ? 14   ARG B O     1 
ATOM   1840  C  CB    . ARG B 1  14   ? -11.749 33.954  112.825 1.00 50.31  ? 14   ARG B CB    1 
ATOM   1841  C  CG    . ARG B 1  14   ? -10.771 34.613  111.863 1.00 72.34  ? 14   ARG B CG    1 
ATOM   1842  C  CD    . ARG B 1  14   ? -10.875 34.004  110.469 1.00 76.02  ? 14   ARG B CD    1 
ATOM   1843  N  NE    . ARG B 1  14   ? -10.542 32.581  110.479 1.00 77.92  ? 14   ARG B NE    1 
ATOM   1844  C  CZ    . ARG B 1  14   ? -9.330  32.094  110.229 1.00 76.01  ? 14   ARG B CZ    1 
ATOM   1845  N  NH1   . ARG B 1  14   ? -8.328  32.914  109.939 1.00 75.74  ? 14   ARG B NH1   1 
ATOM   1846  N  NH2   . ARG B 1  14   ? -9.121  30.785  110.266 1.00 61.92  ? 14   ARG B NH2   1 
ATOM   1847  N  N     . THR B 1  15   ? -13.619 34.966  115.632 1.00 68.95  ? 15   THR B N     1 
ATOM   1848  C  CA    . THR B 1  15   ? -14.804 34.643  116.425 1.00 76.67  ? 15   THR B CA    1 
ATOM   1849  C  C     . THR B 1  15   ? -16.076 35.278  115.876 1.00 78.05  ? 15   THR B C     1 
ATOM   1850  O  O     . THR B 1  15   ? -16.074 36.428  115.439 1.00 86.80  ? 15   THR B O     1 
ATOM   1851  C  CB    . THR B 1  15   ? -14.649 35.068  117.903 1.00 66.21  ? 15   THR B CB    1 
ATOM   1852  O  OG1   . THR B 1  15   ? -14.325 36.462  117.973 1.00 73.36  ? 15   THR B OG1   1 
ATOM   1853  C  CG2   . THR B 1  15   ? -13.558 34.262  118.586 1.00 61.20  ? 15   THR B CG2   1 
ATOM   1854  N  N     . GLN B 1  16   ? -17.162 34.513  115.900 1.00 75.55  ? 16   GLN B N     1 
ATOM   1855  C  CA    . GLN B 1  16   ? -18.473 35.033  115.547 1.00 73.45  ? 16   GLN B CA    1 
ATOM   1856  C  C     . GLN B 1  16   ? -19.433 34.712  116.683 1.00 80.71  ? 16   GLN B C     1 
ATOM   1857  O  O     . GLN B 1  16   ? -19.763 33.548  116.917 1.00 74.06  ? 16   GLN B O     1 
ATOM   1858  C  CB    . GLN B 1  16   ? -18.964 34.393  114.250 1.00 75.46  ? 16   GLN B CB    1 
ATOM   1859  C  CG    . GLN B 1  16   ? -17.931 34.395  113.132 1.00 91.84  ? 16   GLN B CG    1 
ATOM   1860  C  CD    . GLN B 1  16   ? -18.357 33.560  111.938 1.00 100.94 ? 16   GLN B CD    1 
ATOM   1861  O  OE1   . GLN B 1  16   ? -19.536 33.247  111.774 1.00 108.96 ? 16   GLN B OE1   1 
ATOM   1862  N  NE2   . GLN B 1  16   ? -17.394 33.190  111.101 1.00 82.33  ? 16   GLN B NE2   1 
ATOM   1863  N  N     . GLY B 1  17   ? -19.888 35.748  117.382 1.00 77.12  ? 17   GLY B N     1 
ATOM   1864  C  CA    . GLY B 1  17   ? -20.741 35.570  118.544 1.00 70.69  ? 17   GLY B CA    1 
ATOM   1865  C  C     . GLY B 1  17   ? -20.019 34.910  119.706 1.00 61.74  ? 17   GLY B C     1 
ATOM   1866  O  O     . GLY B 1  17   ? -18.793 34.787  119.702 1.00 63.82  ? 17   GLY B O     1 
ATOM   1867  N  N     . ARG B 1  18   ? -20.781 34.489  120.710 1.00 54.78  ? 18   ARG B N     1 
ATOM   1868  C  CA    . ARG B 1  18   ? -20.211 33.801  121.863 1.00 55.60  ? 18   ARG B CA    1 
ATOM   1869  C  C     . ARG B 1  18   ? -20.276 32.287  121.699 1.00 57.12  ? 18   ARG B C     1 
ATOM   1870  O  O     . ARG B 1  18   ? -19.790 31.545  122.552 1.00 55.74  ? 18   ARG B O     1 
ATOM   1871  C  CB    . ARG B 1  18   ? -20.954 34.194  123.144 1.00 61.80  ? 18   ARG B CB    1 
ATOM   1872  C  CG    . ARG B 1  18   ? -20.806 35.650  123.550 1.00 57.35  ? 18   ARG B CG    1 
ATOM   1873  C  CD    . ARG B 1  18   ? -21.564 35.941  124.838 1.00 44.72  ? 18   ARG B CD    1 
ATOM   1874  N  NE    . ARG B 1  18   ? -21.153 35.068  125.935 1.00 48.53  ? 18   ARG B NE    1 
ATOM   1875  C  CZ    . ARG B 1  18   ? -20.116 35.307  126.733 1.00 57.55  ? 18   ARG B CZ    1 
ATOM   1876  N  NH1   . ARG B 1  18   ? -19.815 34.458  127.707 1.00 56.42  ? 18   ARG B NH1   1 
ATOM   1877  N  NH2   . ARG B 1  18   ? -19.376 36.394  126.557 1.00 55.17  ? 18   ARG B NH2   1 
ATOM   1878  N  N     . GLU B 1  19   ? -20.896 31.831  120.615 1.00 59.74  ? 19   GLU B N     1 
ATOM   1879  C  CA    . GLU B 1  19   ? -21.125 30.401  120.416 1.00 58.17  ? 19   GLU B CA    1 
ATOM   1880  C  C     . GLU B 1  19   ? -20.134 29.671  119.500 1.00 53.54  ? 19   GLU B C     1 
ATOM   1881  O  O     . GLU B 1  19   ? -20.221 28.453  119.343 1.00 46.29  ? 19   GLU B O     1 
ATOM   1882  C  CB    . GLU B 1  19   ? -22.557 30.161  119.933 1.00 52.58  ? 19   GLU B CB    1 
ATOM   1883  C  CG    . GLU B 1  19   ? -23.614 30.577  120.937 1.00 55.85  ? 19   GLU B CG    1 
ATOM   1884  C  CD    . GLU B 1  19   ? -24.986 30.042  120.588 1.00 75.35  ? 19   GLU B CD    1 
ATOM   1885  O  OE1   . GLU B 1  19   ? -25.847 29.973  121.492 1.00 82.18  ? 19   GLU B OE1   1 
ATOM   1886  O  OE2   . GLU B 1  19   ? -25.204 29.690  119.409 1.00 84.79  ? 19   GLU B OE2   1 
ATOM   1887  N  N     . TYR B 1  20   ? -19.197 30.398  118.900 1.00 49.81  ? 20   TYR B N     1 
ATOM   1888  C  CA    . TYR B 1  20   ? -18.306 29.784  117.920 1.00 43.97  ? 20   TYR B CA    1 
ATOM   1889  C  C     . TYR B 1  20   ? -16.946 30.459  117.833 1.00 50.68  ? 20   TYR B C     1 
ATOM   1890  O  O     . TYR B 1  20   ? -16.833 31.672  118.006 1.00 62.90  ? 20   TYR B O     1 
ATOM   1891  C  CB    . TYR B 1  20   ? -18.972 29.781  116.541 1.00 45.93  ? 20   TYR B CB    1 
ATOM   1892  C  CG    . TYR B 1  20   ? -18.056 29.380  115.408 1.00 45.20  ? 20   TYR B CG    1 
ATOM   1893  C  CD1   . TYR B 1  20   ? -17.440 30.339  114.615 1.00 60.56  ? 20   TYR B CD1   1 
ATOM   1894  C  CD2   . TYR B 1  20   ? -17.807 28.043  115.132 1.00 45.93  ? 20   TYR B CD2   1 
ATOM   1895  C  CE1   . TYR B 1  20   ? -16.601 29.977  113.576 1.00 66.15  ? 20   TYR B CE1   1 
ATOM   1896  C  CE2   . TYR B 1  20   ? -16.969 27.671  114.095 1.00 51.99  ? 20   TYR B CE2   1 
ATOM   1897  C  CZ    . TYR B 1  20   ? -16.369 28.642  113.321 1.00 60.52  ? 20   TYR B CZ    1 
ATOM   1898  O  OH    . TYR B 1  20   ? -15.534 28.280  112.288 1.00 61.30  ? 20   TYR B OH    1 
ATOM   1899  N  N     . GLY B 1  21   ? -15.913 29.671  117.547 1.00 43.96  ? 21   GLY B N     1 
ATOM   1900  C  CA    . GLY B 1  21   ? -14.594 30.231  117.320 1.00 47.21  ? 21   GLY B CA    1 
ATOM   1901  C  C     . GLY B 1  21   ? -13.707 29.377  116.433 1.00 54.62  ? 21   GLY B C     1 
ATOM   1902  O  O     . GLY B 1  21   ? -13.868 28.156  116.359 1.00 53.45  ? 21   GLY B O     1 
ATOM   1903  N  N     . GLU B 1  22   ? -12.758 30.030  115.766 1.00 50.59  ? 22   GLU B N     1 
ATOM   1904  C  CA    . GLU B 1  22   ? -11.809 29.349  114.894 1.00 38.91  ? 22   GLU B CA    1 
ATOM   1905  C  C     . GLU B 1  22   ? -10.403 29.893  115.131 1.00 39.51  ? 22   GLU B C     1 
ATOM   1906  O  O     . GLU B 1  22   ? -10.152 31.083  114.959 1.00 49.47  ? 22   GLU B O     1 
ATOM   1907  C  CB    . GLU B 1  22   ? -12.216 29.510  113.427 1.00 48.23  ? 22   GLU B CB    1 
ATOM   1908  C  CG    . GLU B 1  22   ? -11.405 28.658  112.459 1.00 62.20  ? 22   GLU B CG    1 
ATOM   1909  C  CD    . GLU B 1  22   ? -11.971 28.667  111.048 1.00 71.29  ? 22   GLU B CD    1 
ATOM   1910  O  OE1   . GLU B 1  22   ? -13.046 29.270  110.836 1.00 68.83  ? 22   GLU B OE1   1 
ATOM   1911  O  OE2   . GLU B 1  22   ? -11.340 28.067  110.150 1.00 71.60  ? 22   GLU B OE2   1 
ATOM   1912  N  N     . PHE B 1  23   ? -9.489  29.011  115.519 1.00 35.94  ? 23   PHE B N     1 
ATOM   1913  C  CA    . PHE B 1  23   ? -8.157  29.410  115.955 1.00 38.33  ? 23   PHE B CA    1 
ATOM   1914  C  C     . PHE B 1  23   ? -7.074  28.760  115.102 1.00 37.42  ? 23   PHE B C     1 
ATOM   1915  O  O     . PHE B 1  23   ? -7.157  27.581  114.783 1.00 42.05  ? 23   PHE B O     1 
ATOM   1916  C  CB    . PHE B 1  23   ? -7.967  29.034  117.425 1.00 37.34  ? 23   PHE B CB    1 
ATOM   1917  C  CG    . PHE B 1  23   ? -9.098  29.476  118.307 1.00 39.94  ? 23   PHE B CG    1 
ATOM   1918  C  CD1   . PHE B 1  23   ? -9.074  30.720  118.913 1.00 42.25  ? 23   PHE B CD1   1 
ATOM   1919  C  CD2   . PHE B 1  23   ? -10.192 28.654  118.518 1.00 42.87  ? 23   PHE B CD2   1 
ATOM   1920  C  CE1   . PHE B 1  23   ? -10.115 31.133  119.717 1.00 39.27  ? 23   PHE B CE1   1 
ATOM   1921  C  CE2   . PHE B 1  23   ? -11.237 29.062  119.320 1.00 45.45  ? 23   PHE B CE2   1 
ATOM   1922  C  CZ    . PHE B 1  23   ? -11.198 30.303  119.921 1.00 43.15  ? 23   PHE B CZ    1 
ATOM   1923  N  N     . VAL B 1  24   ? -6.057  29.530  114.735 1.00 38.29  ? 24   VAL B N     1 
ATOM   1924  C  CA    . VAL B 1  24   ? -5.008  29.021  113.858 1.00 42.65  ? 24   VAL B CA    1 
ATOM   1925  C  C     . VAL B 1  24   ? -3.603  29.237  114.422 1.00 40.23  ? 24   VAL B C     1 
ATOM   1926  O  O     . VAL B 1  24   ? -3.149  30.367  114.569 1.00 45.36  ? 24   VAL B O     1 
ATOM   1927  C  CB    . VAL B 1  24   ? -5.106  29.646  112.451 1.00 47.09  ? 24   VAL B CB    1 
ATOM   1928  C  CG1   . VAL B 1  24   ? -3.873  29.307  111.626 1.00 56.50  ? 24   VAL B CG1   1 
ATOM   1929  C  CG2   . VAL B 1  24   ? -6.373  29.177  111.750 1.00 40.79  ? 24   VAL B CG2   1 
ATOM   1930  N  N     . LEU B 1  25   ? -2.918  28.141  114.727 1.00 36.92  ? 25   LEU B N     1 
ATOM   1931  C  CA    . LEU B 1  25   ? -1.559  28.209  115.244 1.00 38.13  ? 25   LEU B CA    1 
ATOM   1932  C  C     . LEU B 1  25   ? -0.585  27.664  114.207 1.00 45.18  ? 25   LEU B C     1 
ATOM   1933  O  O     . LEU B 1  25   ? -0.586  26.460  113.918 1.00 47.16  ? 25   LEU B O     1 
ATOM   1934  C  CB    . LEU B 1  25   ? -1.452  27.413  116.547 1.00 34.24  ? 25   LEU B CB    1 
ATOM   1935  C  CG    . LEU B 1  25   ? -0.118  27.447  117.292 1.00 40.01  ? 25   LEU B CG    1 
ATOM   1936  C  CD1   . LEU B 1  25   ? 0.350   28.879  117.472 1.00 50.15  ? 25   LEU B CD1   1 
ATOM   1937  C  CD2   . LEU B 1  25   ? -0.242  26.754  118.641 1.00 29.34  ? 25   LEU B CD2   1 
ATOM   1938  N  N     . GLU B 1  26   ? 0.215   28.556  113.618 1.00 57.55  ? 26   GLU B N     1 
ATOM   1939  C  CA    . GLU B 1  26   ? 1.215   28.143  112.622 1.00 50.53  ? 26   GLU B CA    1 
ATOM   1940  C  C     . GLU B 1  26   ? 2.451   29.046  112.608 1.00 46.27  ? 26   GLU B C     1 
ATOM   1941  O  O     . GLU B 1  26   ? 2.367   30.209  112.991 1.00 45.97  ? 26   GLU B O     1 
ATOM   1942  C  CB    . GLU B 1  26   ? 0.593   28.077  111.220 1.00 41.32  ? 26   GLU B CB    1 
ATOM   1943  C  CG    . GLU B 1  26   ? -0.018  29.384  110.737 1.00 52.59  ? 26   GLU B CG    1 
ATOM   1944  C  CD    . GLU B 1  26   ? -0.554  29.290  109.318 1.00 64.69  ? 26   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B 1  26   ? 0.056   28.571  108.497 1.00 62.71  ? 26   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B 1  26   ? -1.587  29.931  109.024 1.00 62.82  ? 26   GLU B OE2   1 
ATOM   1947  N  N     . PRO B 1  27   ? 3.606   28.518  112.165 1.00 42.93  ? 27   PRO B N     1 
ATOM   1948  C  CA    . PRO B 1  27   ? 3.934   27.120  111.868 1.00 38.88  ? 27   PRO B CA    1 
ATOM   1949  C  C     . PRO B 1  27   ? 4.283   26.335  113.128 1.00 44.82  ? 27   PRO B C     1 
ATOM   1950  O  O     . PRO B 1  27   ? 4.739   26.918  114.113 1.00 46.51  ? 27   PRO B O     1 
ATOM   1951  C  CB    . PRO B 1  27   ? 5.178   27.245  110.993 1.00 41.37  ? 27   PRO B CB    1 
ATOM   1952  C  CG    . PRO B 1  27   ? 5.856   28.449  111.519 1.00 43.90  ? 27   PRO B CG    1 
ATOM   1953  C  CD    . PRO B 1  27   ? 4.748   29.407  111.881 1.00 49.57  ? 27   PRO B CD    1 
ATOM   1954  N  N     . LEU B 1  28   ? 4.088   25.022  113.086 1.00 39.80  ? 28   LEU B N     1 
ATOM   1955  C  CA    . LEU B 1  28   ? 4.490   24.151  114.182 1.00 35.10  ? 28   LEU B CA    1 
ATOM   1956  C  C     . LEU B 1  28   ? 5.471   23.111  113.667 1.00 35.21  ? 28   LEU B C     1 
ATOM   1957  O  O     . LEU B 1  28   ? 5.451   22.770  112.486 1.00 35.18  ? 28   LEU B O     1 
ATOM   1958  C  CB    . LEU B 1  28   ? 3.273   23.460  114.798 1.00 37.10  ? 28   LEU B CB    1 
ATOM   1959  C  CG    . LEU B 1  28   ? 2.383   24.287  115.727 1.00 31.90  ? 28   LEU B CG    1 
ATOM   1960  C  CD1   . LEU B 1  28   ? 1.082   23.556  116.010 1.00 28.23  ? 28   LEU B CD1   1 
ATOM   1961  C  CD2   . LEU B 1  28   ? 3.113   24.595  117.023 1.00 34.87  ? 28   LEU B CD2   1 
ATOM   1962  N  N     . GLU B 1  29   ? 6.324   22.606  114.555 1.00 38.34  ? 29   GLU B N     1 
ATOM   1963  C  CA    . GLU B 1  29   ? 7.278   21.565  114.189 1.00 39.17  ? 29   GLU B CA    1 
ATOM   1964  C  C     . GLU B 1  29   ? 6.497   20.320  113.785 1.00 39.62  ? 29   GLU B C     1 
ATOM   1965  O  O     . GLU B 1  29   ? 5.354   20.149  114.202 1.00 49.75  ? 29   GLU B O     1 
ATOM   1966  C  CB    . GLU B 1  29   ? 8.216   21.265  115.362 1.00 42.22  ? 29   GLU B CB    1 
ATOM   1967  C  CG    . GLU B 1  29   ? 9.380   20.336  115.031 1.00 56.26  ? 29   GLU B CG    1 
ATOM   1968  C  CD    . GLU B 1  29   ? 10.337  20.924  114.008 1.00 64.97  ? 29   GLU B CD    1 
ATOM   1969  O  OE1   . GLU B 1  29   ? 10.102  20.741  112.792 1.00 58.99  ? 29   GLU B OE1   1 
ATOM   1970  O  OE2   . GLU B 1  29   ? 11.328  21.562  114.422 1.00 68.92  ? 29   GLU B OE2   1 
ATOM   1971  N  N     . ARG B 1  30   ? 7.103   19.460  112.971 1.00 36.58  ? 30   ARG B N     1 
ATOM   1972  C  CA    . ARG B 1  30   ? 6.388   18.333  112.383 1.00 32.76  ? 30   ARG B CA    1 
ATOM   1973  C  C     . ARG B 1  30   ? 5.733   17.437  113.429 1.00 33.39  ? 30   ARG B C     1 
ATOM   1974  O  O     . ARG B 1  30   ? 6.396   16.934  114.333 1.00 36.42  ? 30   ARG B O     1 
ATOM   1975  C  CB    . ARG B 1  30   ? 7.332   17.499  111.518 1.00 38.39  ? 30   ARG B CB    1 
ATOM   1976  C  CG    . ARG B 1  30   ? 6.629   16.432  110.698 1.00 41.87  ? 30   ARG B CG    1 
ATOM   1977  C  CD    . ARG B 1  30   ? 7.619   15.626  109.878 1.00 42.50  ? 30   ARG B CD    1 
ATOM   1978  N  NE    . ARG B 1  30   ? 8.233   14.547  110.646 1.00 38.30  ? 30   ARG B NE    1 
ATOM   1979  C  CZ    . ARG B 1  30   ? 9.465   14.092  110.440 1.00 38.64  ? 30   ARG B CZ    1 
ATOM   1980  N  NH1   . ARG B 1  30   ? 10.227  14.635  109.499 1.00 48.36  ? 30   ARG B NH1   1 
ATOM   1981  N  NH2   . ARG B 1  30   ? 9.942   13.103  111.180 1.00 36.70  ? 30   ARG B NH2   1 
ATOM   1982  N  N     . GLY B 1  31   ? 4.425   17.241  113.291 1.00 29.59  ? 31   GLY B N     1 
ATOM   1983  C  CA    . GLY B 1  31   ? 3.690   16.345  114.164 1.00 34.38  ? 31   GLY B CA    1 
ATOM   1984  C  C     . GLY B 1  31   ? 3.020   17.003  115.355 1.00 33.24  ? 31   GLY B C     1 
ATOM   1985  O  O     . GLY B 1  31   ? 2.184   16.393  116.020 1.00 34.14  ? 31   GLY B O     1 
ATOM   1986  N  N     . PHE B 1  32   ? 3.377   18.250  115.631 1.00 35.67  ? 32   PHE B N     1 
ATOM   1987  C  CA    . PHE B 1  32   ? 2.848   18.932  116.808 1.00 34.49  ? 32   PHE B CA    1 
ATOM   1988  C  C     . PHE B 1  32   ? 1.431   19.459  116.616 1.00 29.26  ? 32   PHE B C     1 
ATOM   1989  O  O     . PHE B 1  32   ? 0.781   19.866  117.577 1.00 33.87  ? 32   PHE B O     1 
ATOM   1990  C  CB    . PHE B 1  32   ? 3.788   20.052  117.256 1.00 34.17  ? 32   PHE B CB    1 
ATOM   1991  C  CG    . PHE B 1  32   ? 4.969   19.564  118.038 1.00 35.40  ? 32   PHE B CG    1 
ATOM   1992  C  CD1   . PHE B 1  32   ? 6.099   19.095  117.391 1.00 30.97  ? 32   PHE B CD1   1 
ATOM   1993  C  CD2   . PHE B 1  32   ? 4.944   19.562  119.423 1.00 38.07  ? 32   PHE B CD2   1 
ATOM   1994  C  CE1   . PHE B 1  32   ? 7.185   18.641  118.108 1.00 30.51  ? 32   PHE B CE1   1 
ATOM   1995  C  CE2   . PHE B 1  32   ? 6.028   19.109  120.147 1.00 38.81  ? 32   PHE B CE2   1 
ATOM   1996  C  CZ    . PHE B 1  32   ? 7.150   18.648  119.488 1.00 37.09  ? 32   PHE B CZ    1 
ATOM   1997  N  N     . GLY B 1  33   ? 0.953   19.446  115.378 1.00 26.38  ? 33   GLY B N     1 
ATOM   1998  C  CA    . GLY B 1  33   ? -0.406  19.861  115.098 1.00 27.96  ? 33   GLY B CA    1 
ATOM   1999  C  C     . GLY B 1  33   ? -1.399  18.925  115.756 1.00 28.08  ? 33   GLY B C     1 
ATOM   2000  O  O     . GLY B 1  33   ? -2.362  19.361  116.387 1.00 29.70  ? 33   GLY B O     1 
ATOM   2001  N  N     . VAL B 1  34   ? -1.159  17.627  115.606 1.00 26.88  ? 34   VAL B N     1 
ATOM   2002  C  CA    . VAL B 1  34   ? -2.014  16.617  116.213 1.00 27.85  ? 34   VAL B CA    1 
ATOM   2003  C  C     . VAL B 1  34   ? -1.682  16.457  117.699 1.00 27.28  ? 34   VAL B C     1 
ATOM   2004  O  O     . VAL B 1  34   ? -2.575  16.244  118.525 1.00 27.64  ? 34   VAL B O     1 
ATOM   2005  C  CB    . VAL B 1  34   ? -1.915  15.270  115.450 1.00 31.04  ? 34   VAL B CB    1 
ATOM   2006  C  CG1   . VAL B 1  34   ? -0.482  14.975  115.076 1.00 36.25  ? 34   VAL B CG1   1 
ATOM   2007  C  CG2   . VAL B 1  34   ? -2.508  14.128  116.256 1.00 34.41  ? 34   VAL B CG2   1 
ATOM   2008  N  N     . THR B 1  35   ? -0.399  16.589  118.033 1.00 26.50  ? 35   THR B N     1 
ATOM   2009  C  CA    . THR B 1  35   ? 0.060   16.536  119.422 1.00 26.46  ? 35   THR B CA    1 
ATOM   2010  C  C     . THR B 1  35   ? -0.644  17.573  120.301 1.00 24.00  ? 35   THR B C     1 
ATOM   2011  O  O     . THR B 1  35   ? -1.064  17.270  121.412 1.00 23.46  ? 35   THR B O     1 
ATOM   2012  C  CB    . THR B 1  35   ? 1.591   16.732  119.527 1.00 26.33  ? 35   THR B CB    1 
ATOM   2013  O  OG1   . THR B 1  35   ? 2.262   15.594  118.972 1.00 26.63  ? 35   THR B OG1   1 
ATOM   2014  C  CG2   . THR B 1  35   ? 2.016   16.894  120.975 1.00 23.91  ? 35   THR B CG2   1 
ATOM   2015  N  N     . LEU B 1  36   ? -0.764  18.798  119.800 1.00 28.76  ? 36   LEU B N     1 
ATOM   2016  C  CA    . LEU B 1  36   ? -1.507  19.840  120.503 1.00 22.80  ? 36   LEU B CA    1 
ATOM   2017  C  C     . LEU B 1  36   ? -3.009  19.689  120.297 1.00 25.36  ? 36   LEU B C     1 
ATOM   2018  O  O     . LEU B 1  36   ? -3.799  19.978  121.191 1.00 30.18  ? 36   LEU B O     1 
ATOM   2019  C  CB    . LEU B 1  36   ? -1.054  21.226  120.045 1.00 19.81  ? 36   LEU B CB    1 
ATOM   2020  C  CG    . LEU B 1  36   ? -0.032  21.954  120.919 1.00 25.75  ? 36   LEU B CG    1 
ATOM   2021  C  CD1   . LEU B 1  36   ? 0.800   20.978  121.738 1.00 30.14  ? 36   LEU B CD1   1 
ATOM   2022  C  CD2   . LEU B 1  36   ? 0.858   22.849  120.067 1.00 28.26  ? 36   LEU B CD2   1 
ATOM   2023  N  N     . GLY B 1  37   ? -3.398  19.230  119.113 1.00 29.07  ? 37   GLY B N     1 
ATOM   2024  C  CA    . GLY B 1  37   ? -4.800  19.147  118.745 1.00 30.05  ? 37   GLY B CA    1 
ATOM   2025  C  C     . GLY B 1  37   ? -5.647  18.153  119.522 1.00 26.38  ? 37   GLY B C     1 
ATOM   2026  O  O     . GLY B 1  37   ? -6.731  18.496  119.988 1.00 24.60  ? 37   GLY B O     1 
ATOM   2027  N  N     . ASN B 1  38   ? -5.168  16.919  119.655 1.00 23.97  ? 38   ASN B N     1 
ATOM   2028  C  CA    . ASN B 1  38   ? -5.966  15.872  120.296 1.00 24.22  ? 38   ASN B CA    1 
ATOM   2029  C  C     . ASN B 1  38   ? -6.295  16.056  121.785 1.00 31.63  ? 38   ASN B C     1 
ATOM   2030  O  O     . ASN B 1  38   ? -7.467  15.973  122.161 1.00 35.46  ? 38   ASN B O     1 
ATOM   2031  C  CB    . ASN B 1  38   ? -5.394  14.478  120.022 1.00 24.96  ? 38   ASN B CB    1 
ATOM   2032  C  CG    . ASN B 1  38   ? -5.920  13.883  118.737 1.00 36.88  ? 38   ASN B CG    1 
ATOM   2033  O  OD1   . ASN B 1  38   ? -5.169  13.310  117.949 1.00 36.44  ? 38   ASN B OD1   1 
ATOM   2034  N  ND2   . ASN B 1  38   ? -7.223  14.022  118.514 1.00 42.10  ? 38   ASN B ND2   1 
ATOM   2035  N  N     . PRO B 1  39   ? -5.279  16.302  122.636 1.00 28.49  ? 39   PRO B N     1 
ATOM   2036  C  CA    . PRO B 1  39   ? -5.562  16.478  124.066 1.00 29.43  ? 39   PRO B CA    1 
ATOM   2037  C  C     . PRO B 1  39   ? -6.510  17.640  124.326 1.00 28.39  ? 39   PRO B C     1 
ATOM   2038  O  O     . PRO B 1  39   ? -7.474  17.489  125.078 1.00 29.38  ? 39   PRO B O     1 
ATOM   2039  C  CB    . PRO B 1  39   ? -4.192  16.819  124.656 1.00 24.20  ? 39   PRO B CB    1 
ATOM   2040  C  CG    . PRO B 1  39   ? -3.230  16.300  123.698 1.00 24.03  ? 39   PRO B CG    1 
ATOM   2041  C  CD    . PRO B 1  39   ? -3.840  16.416  122.355 1.00 25.95  ? 39   PRO B CD    1 
ATOM   2042  N  N     . LEU B 1  40   ? -6.239  18.779  123.699 1.00 22.26  ? 40   LEU B N     1 
ATOM   2043  C  CA    . LEU B 1  40   ? -7.094  19.946  123.840 1.00 24.42  ? 40   LEU B CA    1 
ATOM   2044  C  C     . LEU B 1  40   ? -8.528  19.608  123.462 1.00 26.94  ? 40   LEU B C     1 
ATOM   2045  O  O     . LEU B 1  40   ? -9.471  20.090  124.086 1.00 29.61  ? 40   LEU B O     1 
ATOM   2046  C  CB    . LEU B 1  40   ? -6.575  21.106  122.991 1.00 25.35  ? 40   LEU B CB    1 
ATOM   2047  C  CG    . LEU B 1  40   ? -5.262  21.730  123.465 1.00 23.14  ? 40   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B 1  40   ? -4.885  22.913  122.595 1.00 22.08  ? 40   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B 1  40   ? -5.366  22.142  124.924 1.00 28.96  ? 40   LEU B CD2   1 
ATOM   2050  N  N     . ARG B 1  41   ? -8.693  18.762  122.452 1.00 26.64  ? 41   ARG B N     1 
ATOM   2051  C  CA    . ARG B 1  41   ? -10.028 18.353  122.046 1.00 27.58  ? 41   ARG B CA    1 
ATOM   2052  C  C     . ARG B 1  41   ? -10.671 17.449  123.093 1.00 25.16  ? 41   ARG B C     1 
ATOM   2053  O  O     . ARG B 1  41   ? -11.859 17.579  123.383 1.00 26.33  ? 41   ARG B O     1 
ATOM   2054  C  CB    . ARG B 1  41   ? -10.014 17.659  120.685 1.00 22.45  ? 41   ARG B CB    1 
ATOM   2055  C  CG    . ARG B 1  41   ? -11.404 17.272  120.230 1.00 24.03  ? 41   ARG B CG    1 
ATOM   2056  C  CD    . ARG B 1  41   ? -11.402 16.463  118.958 1.00 29.91  ? 41   ARG B CD    1 
ATOM   2057  N  NE    . ARG B 1  41   ? -12.660 15.738  118.814 1.00 30.26  ? 41   ARG B NE    1 
ATOM   2058  C  CZ    . ARG B 1  41   ? -12.874 14.524  119.310 1.00 26.50  ? 41   ARG B CZ    1 
ATOM   2059  N  NH1   . ARG B 1  41   ? -14.049 13.933  119.140 1.00 30.92  ? 41   ARG B NH1   1 
ATOM   2060  N  NH2   . ARG B 1  41   ? -11.908 13.903  119.975 1.00 20.55  ? 41   ARG B NH2   1 
ATOM   2061  N  N     . ARG B 1  42   ? -9.887  16.534  123.655 1.00 23.03  ? 42   ARG B N     1 
ATOM   2062  C  CA    . ARG B 1  42   ? -10.391 15.644  124.697 1.00 27.04  ? 42   ARG B CA    1 
ATOM   2063  C  C     . ARG B 1  42   ? -10.839 16.455  125.908 1.00 27.98  ? 42   ARG B C     1 
ATOM   2064  O  O     . ARG B 1  42   ? -11.939 16.265  126.428 1.00 24.53  ? 42   ARG B O     1 
ATOM   2065  C  CB    . ARG B 1  42   ? -9.323  14.625  125.109 1.00 27.18  ? 42   ARG B CB    1 
ATOM   2066  C  CG    . ARG B 1  42   ? -8.970  13.621  124.026 1.00 25.56  ? 42   ARG B CG    1 
ATOM   2067  C  CD    . ARG B 1  42   ? -7.886  12.647  124.481 1.00 23.10  ? 42   ARG B CD    1 
ATOM   2068  N  NE    . ARG B 1  42   ? -8.373  11.688  125.466 1.00 21.05  ? 42   ARG B NE    1 
ATOM   2069  C  CZ    . ARG B 1  42   ? -9.074  10.600  125.165 1.00 26.36  ? 42   ARG B CZ    1 
ATOM   2070  N  NH1   . ARG B 1  42   ? -9.370  10.326  123.903 1.00 26.23  ? 42   ARG B NH1   1 
ATOM   2071  N  NH2   . ARG B 1  42   ? -9.474  9.778   126.126 1.00 30.17  ? 42   ARG B NH2   1 
ATOM   2072  N  N     . ILE B 1  43   ? -9.974  17.366  126.339 1.00 28.68  ? 43   ILE B N     1 
ATOM   2073  C  CA    . ILE B 1  43   ? -10.251 18.243  127.468 1.00 25.62  ? 43   ILE B CA    1 
ATOM   2074  C  C     . ILE B 1  43   ? -11.489 19.107  127.237 1.00 27.34  ? 43   ILE B C     1 
ATOM   2075  O  O     . ILE B 1  43   ? -12.406 19.116  128.057 1.00 30.32  ? 43   ILE B O     1 
ATOM   2076  C  CB    . ILE B 1  43   ? -9.044  19.146  127.764 1.00 22.56  ? 43   ILE B CB    1 
ATOM   2077  C  CG1   . ILE B 1  43   ? -7.875  18.303  128.275 1.00 21.62  ? 43   ILE B CG1   1 
ATOM   2078  C  CG2   . ILE B 1  43   ? -9.411  20.222  128.766 1.00 22.39  ? 43   ILE B CG2   1 
ATOM   2079  C  CD1   . ILE B 1  43   ? -6.579  19.068  128.397 1.00 22.75  ? 43   ILE B CD1   1 
ATOM   2080  N  N     . LEU B 1  44   ? -11.512 19.820  126.114 1.00 23.68  ? 44   LEU B N     1 
ATOM   2081  C  CA    . LEU B 1  44   ? -12.624 20.709  125.781 1.00 26.20  ? 44   LEU B CA    1 
ATOM   2082  C  C     . LEU B 1  44   ? -13.985 20.022  125.876 1.00 28.19  ? 44   LEU B C     1 
ATOM   2083  O  O     . LEU B 1  44   ? -14.970 20.636  126.279 1.00 34.35  ? 44   LEU B O     1 
ATOM   2084  C  CB    . LEU B 1  44   ? -12.433 21.311  124.388 1.00 23.85  ? 44   LEU B CB    1 
ATOM   2085  C  CG    . LEU B 1  44   ? -11.469 22.495  124.297 1.00 25.34  ? 44   LEU B CG    1 
ATOM   2086  C  CD1   . LEU B 1  44   ? -11.164 22.830  122.850 1.00 28.02  ? 44   LEU B CD1   1 
ATOM   2087  C  CD2   . LEU B 1  44   ? -12.048 23.699  125.013 1.00 28.43  ? 44   LEU B CD2   1 
ATOM   2088  N  N     . LEU B 1  45   ? -14.034 18.753  125.493 1.00 25.22  ? 45   LEU B N     1 
ATOM   2089  C  CA    . LEU B 1  45   ? -15.269 17.986  125.563 1.00 25.22  ? 45   LEU B CA    1 
ATOM   2090  C  C     . LEU B 1  45   ? -15.553 17.425  126.958 1.00 31.79  ? 45   LEU B C     1 
ATOM   2091  O  O     . LEU B 1  45   ? -16.690 17.460  127.425 1.00 35.39  ? 45   LEU B O     1 
ATOM   2092  C  CB    . LEU B 1  45   ? -15.241 16.855  124.536 1.00 28.22  ? 45   LEU B CB    1 
ATOM   2093  C  CG    . LEU B 1  45   ? -15.209 17.287  123.069 1.00 25.86  ? 45   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B 1  45   ? -14.700 16.155  122.193 1.00 28.96  ? 45   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B 1  45   ? -16.590 17.731  122.617 1.00 29.71  ? 45   LEU B CD2   1 
ATOM   2096  N  N     . SER B 1  46   ? -14.529 16.869  127.599 1.00 29.60  ? 46   SER B N     1 
ATOM   2097  C  CA    . SER B 1  46   ? -14.687 16.278  128.932 1.00 33.90  ? 46   SER B CA    1 
ATOM   2098  C  C     . SER B 1  46   ? -14.625 17.222  130.147 1.00 35.62  ? 46   SER B C     1 
ATOM   2099  O  O     . SER B 1  46   ? -15.479 17.163  131.030 1.00 38.56  ? 46   SER B O     1 
ATOM   2100  C  CB    . SER B 1  46   ? -13.685 15.135  129.124 1.00 35.43  ? 46   SER B CB    1 
ATOM   2101  O  OG    . SER B 1  46   ? -12.353 15.616  129.116 1.00 37.11  ? 46   SER B OG    1 
ATOM   2102  N  N     . SER B 1  47   ? -13.603 18.070  130.198 1.00 29.16  ? 47   SER B N     1 
ATOM   2103  C  CA    . SER B 1  47   ? -13.234 18.727  131.454 1.00 30.53  ? 47   SER B CA    1 
ATOM   2104  C  C     . SER B 1  47   ? -13.693 20.163  131.703 1.00 32.52  ? 47   SER B C     1 
ATOM   2105  O  O     . SER B 1  47   ? -13.456 20.697  132.786 1.00 34.33  ? 47   SER B O     1 
ATOM   2106  C  CB    . SER B 1  47   ? -11.721 18.647  131.655 1.00 34.44  ? 47   SER B CB    1 
ATOM   2107  O  OG    . SER B 1  47   ? -11.305 17.299  131.725 1.00 38.76  ? 47   SER B OG    1 
ATOM   2108  N  N     . ILE B 1  48   ? -14.335 20.796  130.730 1.00 34.71  ? 48   ILE B N     1 
ATOM   2109  C  CA    . ILE B 1  48   ? -14.727 22.191  130.917 1.00 34.47  ? 48   ILE B CA    1 
ATOM   2110  C  C     . ILE B 1  48   ? -16.059 22.268  131.667 1.00 42.65  ? 48   ILE B C     1 
ATOM   2111  O  O     . ILE B 1  48   ? -17.060 21.703  131.221 1.00 45.38  ? 48   ILE B O     1 
ATOM   2112  C  CB    . ILE B 1  48   ? -14.772 22.986  129.589 1.00 34.28  ? 48   ILE B CB    1 
ATOM   2113  C  CG1   . ILE B 1  48   ? -13.385 23.527  129.223 1.00 30.41  ? 48   ILE B CG1   1 
ATOM   2114  C  CG2   . ILE B 1  48   ? -15.676 24.181  129.727 1.00 36.02  ? 48   ILE B CG2   1 
ATOM   2115  C  CD1   . ILE B 1  48   ? -12.350 22.485  128.897 1.00 27.32  ? 48   ILE B CD1   1 
ATOM   2116  N  N     . PRO B 1  49   ? -16.062 22.961  132.821 1.00 43.70  ? 49   PRO B N     1 
ATOM   2117  C  CA    . PRO B 1  49   ? -17.179 23.010  133.775 1.00 32.59  ? 49   PRO B CA    1 
ATOM   2118  C  C     . PRO B 1  49   ? -18.386 23.782  133.258 1.00 42.28  ? 49   PRO B C     1 
ATOM   2119  O  O     . PRO B 1  49   ? -18.228 24.829  132.628 1.00 43.35  ? 49   PRO B O     1 
ATOM   2120  C  CB    . PRO B 1  49   ? -16.573 23.741  134.973 1.00 36.46  ? 49   PRO B CB    1 
ATOM   2121  C  CG    . PRO B 1  49   ? -15.513 24.600  134.382 1.00 43.03  ? 49   PRO B CG    1 
ATOM   2122  C  CD    . PRO B 1  49   ? -14.928 23.793  133.264 1.00 42.73  ? 49   PRO B CD    1 
ATOM   2123  N  N     . GLY B 1  50   ? -19.581 23.272  133.545 1.00 41.37  ? 50   GLY B N     1 
ATOM   2124  C  CA    . GLY B 1  50   ? -20.807 23.871  133.050 1.00 38.74  ? 50   GLY B CA    1 
ATOM   2125  C  C     . GLY B 1  50   ? -22.022 23.505  133.879 1.00 43.46  ? 50   GLY B C     1 
ATOM   2126  O  O     . GLY B 1  50   ? -21.901 22.898  134.942 1.00 49.22  ? 50   GLY B O     1 
ATOM   2127  N  N     . THR B 1  51   ? -23.200 23.882  133.390 1.00 42.28  ? 51   THR B N     1 
ATOM   2128  C  CA    . THR B 1  51   ? -24.445 23.656  134.115 1.00 41.63  ? 51   THR B CA    1 
ATOM   2129  C  C     . THR B 1  51   ? -25.416 22.796  133.312 1.00 44.49  ? 51   THR B C     1 
ATOM   2130  O  O     . THR B 1  51   ? -25.546 22.959  132.098 1.00 55.06  ? 51   THR B O     1 
ATOM   2131  C  CB    . THR B 1  51   ? -25.140 24.986  134.429 1.00 46.51  ? 51   THR B CB    1 
ATOM   2132  O  OG1   . THR B 1  51   ? -25.689 25.531  133.223 1.00 53.75  ? 51   THR B OG1   1 
ATOM   2133  C  CG2   . THR B 1  51   ? -24.148 25.975  135.026 1.00 47.23  ? 51   THR B CG2   1 
ATOM   2134  N  N     . ALA B 1  52   ? -26.108 21.890  133.996 1.00 43.65  ? 52   ALA B N     1 
ATOM   2135  C  CA    . ALA B 1  52   ? -27.059 20.998  133.338 1.00 47.95  ? 52   ALA B CA    1 
ATOM   2136  C  C     . ALA B 1  52   ? -28.292 20.746  134.195 1.00 43.40  ? 52   ALA B C     1 
ATOM   2137  O  O     . ALA B 1  52   ? -28.275 20.975  135.402 1.00 46.20  ? 52   ALA B O     1 
ATOM   2138  C  CB    . ALA B 1  52   ? -26.390 19.680  132.993 1.00 45.13  ? 52   ALA B CB    1 
ATOM   2139  N  N     . VAL B 1  53   ? -29.356 20.256  133.565 1.00 40.28  ? 53   VAL B N     1 
ATOM   2140  C  CA    . VAL B 1  53   ? -30.569 19.899  134.285 1.00 41.75  ? 53   VAL B CA    1 
ATOM   2141  C  C     . VAL B 1  53   ? -30.513 18.420  134.646 1.00 47.08  ? 53   VAL B C     1 
ATOM   2142  O  O     . VAL B 1  53   ? -30.631 17.556  133.777 1.00 54.43  ? 53   VAL B O     1 
ATOM   2143  C  CB    . VAL B 1  53   ? -31.816 20.156  133.421 1.00 35.29  ? 53   VAL B CB    1 
ATOM   2144  C  CG1   . VAL B 1  53   ? -33.067 19.658  134.125 1.00 50.18  ? 53   VAL B CG1   1 
ATOM   2145  C  CG2   . VAL B 1  53   ? -31.934 21.633  133.087 1.00 34.44  ? 53   VAL B CG2   1 
ATOM   2146  N  N     . THR B 1  54   ? -30.327 18.135  135.930 1.00 44.35  ? 54   THR B N     1 
ATOM   2147  C  CA    . THR B 1  54   ? -30.156 16.759  136.386 1.00 49.86  ? 54   THR B CA    1 
ATOM   2148  C  C     . THR B 1  54   ? -31.426 16.055  136.884 1.00 55.26  ? 54   THR B C     1 
ATOM   2149  O  O     . THR B 1  54   ? -31.432 14.835  137.048 1.00 53.91  ? 54   THR B O     1 
ATOM   2150  C  CB    . THR B 1  54   ? -29.074 16.684  137.479 1.00 50.84  ? 54   THR B CB    1 
ATOM   2151  O  OG1   . THR B 1  54   ? -29.331 17.683  138.472 1.00 52.68  ? 54   THR B OG1   1 
ATOM   2152  C  CG2   . THR B 1  54   ? -27.702 16.935  136.882 1.00 54.05  ? 54   THR B CG2   1 
ATOM   2153  N  N     . SER B 1  55   ? -32.497 16.812  137.110 1.00 62.85  ? 55   SER B N     1 
ATOM   2154  C  CA    . SER B 1  55   ? -33.752 16.236  137.601 1.00 59.86  ? 55   SER B CA    1 
ATOM   2155  C  C     . SER B 1  55   ? -34.966 17.083  137.241 1.00 56.36  ? 55   SER B C     1 
ATOM   2156  O  O     . SER B 1  55   ? -34.857 18.295  137.070 1.00 54.38  ? 55   SER B O     1 
ATOM   2157  C  CB    . SER B 1  55   ? -33.706 16.027  139.118 1.00 61.48  ? 55   SER B CB    1 
ATOM   2158  O  OG    . SER B 1  55   ? -33.129 14.776  139.449 1.00 65.73  ? 55   SER B OG    1 
ATOM   2159  N  N     . VAL B 1  56   ? -36.124 16.439  137.137 1.00 55.99  ? 56   VAL B N     1 
ATOM   2160  C  CA    . VAL B 1  56   ? -37.373 17.132  136.843 1.00 54.40  ? 56   VAL B CA    1 
ATOM   2161  C  C     . VAL B 1  56   ? -38.520 16.527  137.640 1.00 59.45  ? 56   VAL B C     1 
ATOM   2162  O  O     . VAL B 1  56   ? -38.683 15.309  137.671 1.00 61.91  ? 56   VAL B O     1 
ATOM   2163  C  CB    . VAL B 1  56   ? -37.729 17.047  135.340 1.00 54.54  ? 56   VAL B CB    1 
ATOM   2164  C  CG1   . VAL B 1  56   ? -39.137 17.561  135.089 1.00 55.33  ? 56   VAL B CG1   1 
ATOM   2165  C  CG2   . VAL B 1  56   ? -36.730 17.822  134.503 1.00 59.11  ? 56   VAL B CG2   1 
ATOM   2166  N  N     . TYR B 1  57   ? -39.313 17.374  138.288 1.00 60.87  ? 57   TYR B N     1 
ATOM   2167  C  CA    . TYR B 1  57   ? -40.555 16.921  138.905 1.00 65.77  ? 57   TYR B CA    1 
ATOM   2168  C  C     . TYR B 1  57   ? -41.742 17.650  138.293 1.00 59.25  ? 57   TYR B C     1 
ATOM   2169  O  O     . TYR B 1  57   ? -41.794 18.876  138.304 1.00 50.96  ? 57   TYR B O     1 
ATOM   2170  C  CB    . TYR B 1  57   ? -40.536 17.125  140.423 1.00 75.07  ? 57   TYR B CB    1 
ATOM   2171  C  CG    . TYR B 1  57   ? -41.899 16.969  141.073 1.00 71.14  ? 57   TYR B CG    1 
ATOM   2172  C  CD1   . TYR B 1  57   ? -42.492 15.718  141.202 1.00 68.35  ? 57   TYR B CD1   1 
ATOM   2173  C  CD2   . TYR B 1  57   ? -42.591 18.074  141.556 1.00 67.38  ? 57   TYR B CD2   1 
ATOM   2174  C  CE1   . TYR B 1  57   ? -43.737 15.572  141.792 1.00 61.19  ? 57   TYR B CE1   1 
ATOM   2175  C  CE2   . TYR B 1  57   ? -43.834 17.938  142.148 1.00 66.18  ? 57   TYR B CE2   1 
ATOM   2176  C  CZ    . TYR B 1  57   ? -44.402 16.685  142.263 1.00 72.17  ? 57   TYR B CZ    1 
ATOM   2177  O  OH    . TYR B 1  57   ? -45.640 16.549  142.851 1.00 75.64  ? 57   TYR B OH    1 
ATOM   2178  N  N     . ILE B 1  58   ? -42.685 16.888  137.750 1.00 59.60  ? 58   ILE B N     1 
ATOM   2179  C  CA    . ILE B 1  58   ? -43.915 17.457  137.212 1.00 70.26  ? 58   ILE B CA    1 
ATOM   2180  C  C     . ILE B 1  58   ? -45.116 16.835  137.908 1.00 73.26  ? 58   ILE B C     1 
ATOM   2181  O  O     . ILE B 1  58   ? -45.260 15.611  137.935 1.00 65.67  ? 58   ILE B O     1 
ATOM   2182  C  CB    . ILE B 1  58   ? -44.040 17.238  135.694 1.00 70.68  ? 58   ILE B CB    1 
ATOM   2183  C  CG1   . ILE B 1  58   ? -42.929 17.981  134.952 1.00 66.15  ? 58   ILE B CG1   1 
ATOM   2184  C  CG2   . ILE B 1  58   ? -45.393 17.717  135.201 1.00 72.84  ? 58   ILE B CG2   1 
ATOM   2185  C  CD1   . ILE B 1  58   ? -42.999 17.828  133.450 1.00 62.49  ? 58   ILE B CD1   1 
ATOM   2186  N  N     . GLU B 1  59   ? -45.970 17.689  138.468 1.00 77.10  ? 59   GLU B N     1 
ATOM   2187  C  CA    . GLU B 1  59   ? -47.117 17.246  139.254 1.00 81.32  ? 59   GLU B CA    1 
ATOM   2188  C  C     . GLU B 1  59   ? -48.071 16.376  138.437 1.00 82.76  ? 59   GLU B C     1 
ATOM   2189  O  O     . GLU B 1  59   ? -48.252 16.593  137.236 1.00 73.33  ? 59   GLU B O     1 
ATOM   2190  C  CB    . GLU B 1  59   ? -47.863 18.452  139.838 1.00 84.36  ? 59   GLU B CB    1 
ATOM   2191  C  CG    . GLU B 1  59   ? -48.969 18.092  140.825 1.00 89.39  ? 59   GLU B CG    1 
ATOM   2192  C  CD    . GLU B 1  59   ? -49.761 19.302  141.292 1.00 79.97  ? 59   GLU B CD    1 
ATOM   2193  O  OE1   . GLU B 1  59   ? -49.326 20.442  141.023 1.00 73.23  ? 59   GLU B OE1   1 
ATOM   2194  O  OE2   . GLU B 1  59   ? -50.821 19.109  141.925 1.00 65.41  ? 59   GLU B OE2   1 
ATOM   2195  N  N     . ASP B 1  60   ? -48.656 15.383  139.104 1.00 86.98  ? 60   ASP B N     1 
ATOM   2196  C  CA    . ASP B 1  60   ? -49.622 14.464  138.500 1.00 89.82  ? 60   ASP B CA    1 
ATOM   2197  C  C     . ASP B 1  60   ? -49.035 13.674  137.327 1.00 83.14  ? 60   ASP B C     1 
ATOM   2198  O  O     . ASP B 1  60   ? -49.765 13.205  136.453 1.00 83.60  ? 60   ASP B O     1 
ATOM   2199  C  CB    . ASP B 1  60   ? -50.894 15.211  138.075 1.00 95.66  ? 60   ASP B CB    1 
ATOM   2200  C  CG    . ASP B 1  60   ? -51.521 15.996  139.217 1.00 88.58  ? 60   ASP B CG    1 
ATOM   2201  O  OD1   . ASP B 1  60   ? -51.441 15.536  140.376 1.00 83.86  ? 60   ASP B OD1   1 
ATOM   2202  O  OD2   . ASP B 1  60   ? -52.092 17.076  138.955 1.00 80.63  ? 60   ASP B OD2   1 
ATOM   2203  N  N     . VAL B 1  61   ? -47.714 13.522  137.325 1.00 78.92  ? 61   VAL B N     1 
ATOM   2204  C  CA    . VAL B 1  61   ? -47.024 12.763  136.289 1.00 75.69  ? 61   VAL B CA    1 
ATOM   2205  C  C     . VAL B 1  61   ? -46.089 11.735  136.917 1.00 71.45  ? 61   VAL B C     1 
ATOM   2206  O  O     . VAL B 1  61   ? -45.148 12.091  137.628 1.00 63.36  ? 61   VAL B O     1 
ATOM   2207  C  CB    . VAL B 1  61   ? -46.218 13.681  135.351 1.00 77.23  ? 61   VAL B CB    1 
ATOM   2208  C  CG1   . VAL B 1  61   ? -45.417 12.853  134.363 1.00 80.39  ? 61   VAL B CG1   1 
ATOM   2209  C  CG2   . VAL B 1  61   ? -47.145 14.636  134.617 1.00 81.76  ? 61   VAL B CG2   1 
ATOM   2210  N  N     . LEU B 1  62   ? -46.352 10.462  136.643 1.00 73.69  ? 62   LEU B N     1 
ATOM   2211  C  CA    . LEU B 1  62   ? -45.621 9.366   137.273 1.00 78.54  ? 62   LEU B CA    1 
ATOM   2212  C  C     . LEU B 1  62   ? -44.219 9.163   136.699 1.00 78.65  ? 62   LEU B C     1 
ATOM   2213  O  O     . LEU B 1  62   ? -43.224 9.313   137.410 1.00 65.41  ? 62   LEU B O     1 
ATOM   2214  C  CB    . LEU B 1  62   ? -46.423 8.065   137.186 1.00 80.88  ? 62   LEU B CB    1 
ATOM   2215  C  CG    . LEU B 1  62   ? -47.755 8.051   137.941 1.00 85.77  ? 62   LEU B CG    1 
ATOM   2216  C  CD1   . LEU B 1  62   ? -48.417 6.683   137.851 1.00 78.11  ? 62   LEU B CD1   1 
ATOM   2217  C  CD2   . LEU B 1  62   ? -47.556 8.462   139.394 1.00 74.37  ? 62   LEU B CD2   1 
ATOM   2218  N  N     . HIS B 1  63   ? -44.145 8.813   135.418 1.00 87.64  ? 63   HIS B N     1 
ATOM   2219  C  CA    . HIS B 1  63   ? -42.864 8.521   134.777 1.00 83.40  ? 63   HIS B CA    1 
ATOM   2220  C  C     . HIS B 1  63   ? -42.669 9.263   133.455 1.00 76.69  ? 63   HIS B C     1 
ATOM   2221  O  O     . HIS B 1  63   ? -43.605 9.854   132.918 1.00 79.36  ? 63   HIS B O     1 
ATOM   2222  C  CB    . HIS B 1  63   ? -42.681 7.012   134.581 1.00 77.43  ? 63   HIS B CB    1 
ATOM   2223  C  CG    . HIS B 1  63   ? -43.777 6.363   133.796 1.00 81.85  ? 63   HIS B CG    1 
ATOM   2224  N  ND1   . HIS B 1  63   ? -45.019 6.094   134.332 1.00 88.64  ? 63   HIS B ND1   1 
ATOM   2225  C  CD2   . HIS B 1  63   ? -43.816 5.916   132.519 1.00 89.43  ? 63   HIS B CD2   1 
ATOM   2226  C  CE1   . HIS B 1  63   ? -45.776 5.516   133.418 1.00 91.16  ? 63   HIS B CE1   1 
ATOM   2227  N  NE2   . HIS B 1  63   ? -45.070 5.397   132.307 1.00 95.28  ? 63   HIS B NE2   1 
ATOM   2228  N  N     . GLU B 1  64   ? -41.438 9.227   132.952 1.00 73.99  ? 64   GLU B N     1 
ATOM   2229  C  CA    . GLU B 1  64   ? -41.032 9.966   131.756 1.00 79.87  ? 64   GLU B CA    1 
ATOM   2230  C  C     . GLU B 1  64   ? -41.879 9.663   130.518 1.00 79.06  ? 64   GLU B C     1 
ATOM   2231  O  O     . GLU B 1  64   ? -42.044 10.512  129.641 1.00 74.85  ? 64   GLU B O     1 
ATOM   2232  C  CB    . GLU B 1  64   ? -39.554 9.682   131.457 1.00 83.77  ? 64   GLU B CB    1 
ATOM   2233  C  CG    . GLU B 1  64   ? -38.947 10.528  130.344 1.00 82.46  ? 64   GLU B CG    1 
ATOM   2234  C  CD    . GLU B 1  64   ? -37.492 10.181  130.072 1.00 82.41  ? 64   GLU B CD    1 
ATOM   2235  O  OE1   . GLU B 1  64   ? -36.986 9.210   130.675 1.00 78.14  ? 64   GLU B OE1   1 
ATOM   2236  O  OE2   . GLU B 1  64   ? -36.855 10.879  129.254 1.00 76.59  ? 64   GLU B OE2   1 
ATOM   2237  N  N     . PHE B 1  65   ? -42.418 8.451   130.452 1.00 85.10  ? 65   PHE B N     1 
ATOM   2238  C  CA    . PHE B 1  65   ? -43.151 8.007   129.271 1.00 87.26  ? 65   PHE B CA    1 
ATOM   2239  C  C     . PHE B 1  65   ? -44.662 8.222   129.377 1.00 90.78  ? 65   PHE B C     1 
ATOM   2240  O  O     . PHE B 1  65   ? -45.418 7.824   128.490 1.00 85.79  ? 65   PHE B O     1 
ATOM   2241  C  CB    . PHE B 1  65   ? -42.814 6.548   128.963 1.00 82.34  ? 65   PHE B CB    1 
ATOM   2242  C  CG    . PHE B 1  65   ? -41.338 6.282   128.890 1.00 84.34  ? 65   PHE B CG    1 
ATOM   2243  C  CD1   . PHE B 1  65   ? -40.660 5.755   129.978 1.00 92.51  ? 65   PHE B CD1   1 
ATOM   2244  C  CD2   . PHE B 1  65   ? -40.622 6.585   127.744 1.00 77.60  ? 65   PHE B CD2   1 
ATOM   2245  C  CE1   . PHE B 1  65   ? -39.298 5.519   129.918 1.00 88.68  ? 65   PHE B CE1   1 
ATOM   2246  C  CE2   . PHE B 1  65   ? -39.261 6.352   127.677 1.00 75.50  ? 65   PHE B CE2   1 
ATOM   2247  C  CZ    . PHE B 1  65   ? -38.598 5.818   128.766 1.00 79.90  ? 65   PHE B CZ    1 
ATOM   2248  N  N     . SER B 1  66   ? -45.095 8.850   130.466 1.00 95.44  ? 66   SER B N     1 
ATOM   2249  C  CA    . SER B 1  66   ? -46.502 9.199   130.638 1.00 94.95  ? 66   SER B CA    1 
ATOM   2250  C  C     . SER B 1  66   ? -46.872 10.380  129.749 1.00 95.72  ? 66   SER B C     1 
ATOM   2251  O  O     . SER B 1  66   ? -46.031 10.917  129.026 1.00 85.61  ? 66   SER B O     1 
ATOM   2252  C  CB    . SER B 1  66   ? -46.803 9.539   132.100 1.00 96.14  ? 66   SER B CB    1 
ATOM   2253  O  OG    . SER B 1  66   ? -46.617 8.417   132.944 1.00 97.88  ? 66   SER B OG    1 
ATOM   2254  N  N     . THR B 1  67   ? -48.137 10.783  129.811 1.00 100.37 ? 67   THR B N     1 
ATOM   2255  C  CA    . THR B 1  67   ? -48.611 11.929  129.046 1.00 102.51 ? 67   THR B CA    1 
ATOM   2256  C  C     . THR B 1  67   ? -49.139 13.012  129.978 1.00 93.32  ? 67   THR B C     1 
ATOM   2257  O  O     . THR B 1  67   ? -49.602 12.723  131.082 1.00 92.88  ? 67   THR B O     1 
ATOM   2258  C  CB    . THR B 1  67   ? -49.714 11.529  128.044 1.00 102.51 ? 67   THR B CB    1 
ATOM   2259  O  OG1   . THR B 1  67   ? -50.195 12.697  127.367 1.00 107.19 ? 67   THR B OG1   1 
ATOM   2260  C  CG2   . THR B 1  67   ? -50.873 10.851  128.761 1.00 88.16  ? 67   THR B CG2   1 
ATOM   2261  N  N     . ILE B 1  68   ? -49.057 14.262  129.535 1.00 83.92  ? 68   ILE B N     1 
ATOM   2262  C  CA    . ILE B 1  68   ? -49.576 15.374  130.318 1.00 84.62  ? 68   ILE B CA    1 
ATOM   2263  C  C     . ILE B 1  68   ? -50.845 15.931  129.686 1.00 94.69  ? 68   ILE B C     1 
ATOM   2264  O  O     . ILE B 1  68   ? -50.809 16.466  128.577 1.00 97.22  ? 68   ILE B O     1 
ATOM   2265  C  CB    . ILE B 1  68   ? -48.542 16.502  130.463 1.00 82.96  ? 68   ILE B CB    1 
ATOM   2266  C  CG1   . ILE B 1  68   ? -47.230 15.951  131.019 1.00 81.03  ? 68   ILE B CG1   1 
ATOM   2267  C  CG2   . ILE B 1  68   ? -49.077 17.598  131.369 1.00 86.17  ? 68   ILE B CG2   1 
ATOM   2268  C  CD1   . ILE B 1  68   ? -46.158 17.000  131.199 1.00 77.14  ? 68   ILE B CD1   1 
ATOM   2269  N  N     . PRO B 1  69   ? -51.978 15.796  130.393 1.00 95.63  ? 69   PRO B N     1 
ATOM   2270  C  CA    . PRO B 1  69   ? -53.277 16.299  129.935 1.00 91.89  ? 69   PRO B CA    1 
ATOM   2271  C  C     . PRO B 1  69   ? -53.275 17.817  129.778 1.00 89.87  ? 69   PRO B C     1 
ATOM   2272  O  O     . PRO B 1  69   ? -52.784 18.527  130.658 1.00 84.34  ? 69   PRO B O     1 
ATOM   2273  C  CB    . PRO B 1  69   ? -54.227 15.895  131.069 1.00 90.93  ? 69   PRO B CB    1 
ATOM   2274  C  CG    . PRO B 1  69   ? -53.546 14.760  131.755 1.00 82.69  ? 69   PRO B CG    1 
ATOM   2275  C  CD    . PRO B 1  69   ? -52.088 15.072  131.671 1.00 89.99  ? 69   PRO B CD    1 
ATOM   2276  N  N     . GLY B 1  70   ? -53.817 18.302  128.665 1.00 86.92  ? 70   GLY B N     1 
ATOM   2277  C  CA    . GLY B 1  70   ? -53.910 19.730  128.417 1.00 90.23  ? 70   GLY B CA    1 
ATOM   2278  C  C     . GLY B 1  70   ? -52.644 20.324  127.831 1.00 89.88  ? 70   GLY B C     1 
ATOM   2279  O  O     . GLY B 1  70   ? -52.531 21.542  127.680 1.00 84.40  ? 70   GLY B O     1 
ATOM   2280  N  N     . VAL B 1  71   ? -51.687 19.461  127.503 1.00 93.87  ? 71   VAL B N     1 
ATOM   2281  C  CA    . VAL B 1  71   ? -50.429 19.895  126.906 1.00 92.09  ? 71   VAL B CA    1 
ATOM   2282  C  C     . VAL B 1  71   ? -50.169 19.134  125.609 1.00 90.84  ? 71   VAL B C     1 
ATOM   2283  O  O     . VAL B 1  71   ? -50.330 17.913  125.556 1.00 88.37  ? 71   VAL B O     1 
ATOM   2284  C  CB    . VAL B 1  71   ? -49.243 19.690  127.870 1.00 88.13  ? 71   VAL B CB    1 
ATOM   2285  C  CG1   . VAL B 1  71   ? -47.951 20.180  127.239 1.00 87.32  ? 71   VAL B CG1   1 
ATOM   2286  C  CG2   . VAL B 1  71   ? -49.497 20.412  129.183 1.00 87.66  ? 71   VAL B CG2   1 
ATOM   2287  N  N     . LYS B 1  72   ? -49.781 19.865  124.566 1.00 87.19  ? 72   LYS B N     1 
ATOM   2288  C  CA    . LYS B 1  72   ? -49.529 19.278  123.251 1.00 86.42  ? 72   LYS B CA    1 
ATOM   2289  C  C     . LYS B 1  72   ? -48.472 18.177  123.281 1.00 83.48  ? 72   LYS B C     1 
ATOM   2290  O  O     . LYS B 1  72   ? -48.783 17.004  123.076 1.00 83.70  ? 72   LYS B O     1 
ATOM   2291  C  CB    . LYS B 1  72   ? -49.118 20.359  122.246 1.00 93.10  ? 72   LYS B CB    1 
ATOM   2292  C  CG    . LYS B 1  72   ? -48.745 19.813  120.873 1.00 98.91  ? 72   LYS B CG    1 
ATOM   2293  C  CD    . LYS B 1  72   ? -48.042 20.855  120.017 1.00 93.52  ? 72   LYS B CD    1 
ATOM   2294  C  CE    . LYS B 1  72   ? -47.571 20.251  118.701 1.00 93.47  ? 72   LYS B CE    1 
ATOM   2295  N  NZ    . LYS B 1  72   ? -46.803 21.218  117.869 1.00 88.68  ? 72   LYS B NZ    1 
ATOM   2296  N  N     . GLU B 1  73   ? -47.225 18.559  123.535 1.00 76.80  ? 73   GLU B N     1 
ATOM   2297  C  CA    . GLU B 1  73   ? -46.121 17.605  123.506 1.00 75.58  ? 73   GLU B CA    1 
ATOM   2298  C  C     . GLU B 1  73   ? -46.130 16.677  124.712 1.00 74.27  ? 73   GLU B C     1 
ATOM   2299  O  O     . GLU B 1  73   ? -46.719 16.988  125.747 1.00 73.06  ? 73   GLU B O     1 
ATOM   2300  C  CB    . GLU B 1  73   ? -44.772 18.323  123.403 1.00 75.09  ? 73   GLU B CB    1 
ATOM   2301  C  CG    . GLU B 1  73   ? -44.502 19.335  124.504 1.00 67.85  ? 73   GLU B CG    1 
ATOM   2302  C  CD    . GLU B 1  73   ? -45.083 20.699  124.194 1.00 74.82  ? 73   GLU B CD    1 
ATOM   2303  O  OE1   . GLU B 1  73   ? -46.316 20.793  124.020 1.00 85.15  ? 73   GLU B OE1   1 
ATOM   2304  O  OE2   . GLU B 1  73   ? -44.308 21.676  124.116 1.00 67.16  ? 73   GLU B OE2   1 
ATOM   2305  N  N     . ASP B 1  74   ? -45.473 15.532  124.563 1.00 76.31  ? 74   ASP B N     1 
ATOM   2306  C  CA    . ASP B 1  74   ? -45.362 14.559  125.641 1.00 68.89  ? 74   ASP B CA    1 
ATOM   2307  C  C     . ASP B 1  74   ? -44.302 14.994  126.643 1.00 62.65  ? 74   ASP B C     1 
ATOM   2308  O  O     . ASP B 1  74   ? -43.675 16.042  126.484 1.00 60.59  ? 74   ASP B O     1 
ATOM   2309  C  CB    . ASP B 1  74   ? -45.027 13.176  125.080 1.00 69.02  ? 74   ASP B CB    1 
ATOM   2310  C  CG    . ASP B 1  74   ? -43.823 13.197  124.158 1.00 69.71  ? 74   ASP B CG    1 
ATOM   2311  O  OD1   . ASP B 1  74   ? -42.704 12.914  124.632 1.00 62.79  ? 74   ASP B OD1   1 
ATOM   2312  O  OD2   . ASP B 1  74   ? -43.994 13.499  122.958 1.00 76.35  ? 74   ASP B OD2   1 
ATOM   2313  N  N     . VAL B 1  75   ? -44.105 14.183  127.675 1.00 62.75  ? 75   VAL B N     1 
ATOM   2314  C  CA    . VAL B 1  75   ? -43.146 14.502  128.722 1.00 63.67  ? 75   VAL B CA    1 
ATOM   2315  C  C     . VAL B 1  75   ? -41.723 14.518  128.175 1.00 59.14  ? 75   VAL B C     1 
ATOM   2316  O  O     . VAL B 1  75   ? -40.951 15.434  128.461 1.00 53.63  ? 75   VAL B O     1 
ATOM   2317  C  CB    . VAL B 1  75   ? -43.232 13.499  129.883 1.00 72.43  ? 75   VAL B CB    1 
ATOM   2318  C  CG1   . VAL B 1  75   ? -42.220 13.847  130.964 1.00 70.65  ? 75   VAL B CG1   1 
ATOM   2319  C  CG2   . VAL B 1  75   ? -44.639 13.471  130.455 1.00 75.97  ? 75   VAL B CG2   1 
ATOM   2320  N  N     . VAL B 1  76   ? -41.392 13.505  127.379 1.00 60.32  ? 76   VAL B N     1 
ATOM   2321  C  CA    . VAL B 1  76   ? -40.046 13.350  126.835 1.00 54.09  ? 76   VAL B CA    1 
ATOM   2322  C  C     . VAL B 1  76   ? -39.593 14.571  126.037 1.00 51.11  ? 76   VAL B C     1 
ATOM   2323  O  O     . VAL B 1  76   ? -38.431 14.957  126.100 1.00 53.42  ? 76   VAL B O     1 
ATOM   2324  C  CB    . VAL B 1  76   ? -39.931 12.094  125.950 1.00 50.81  ? 76   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B 1  76   ? -38.473 11.790  125.650 1.00 43.61  ? 76   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B 1  76   ? -40.591 10.907  126.629 1.00 64.53  ? 76   VAL B CG2   1 
ATOM   2327  N  N     . GLU B 1  77   ? -40.512 15.180  125.294 1.00 50.89  ? 77   GLU B N     1 
ATOM   2328  C  CA    . GLU B 1  77   ? -40.187 16.373  124.518 1.00 53.54  ? 77   GLU B CA    1 
ATOM   2329  C  C     . GLU B 1  77   ? -39.813 17.530  125.438 1.00 54.84  ? 77   GLU B C     1 
ATOM   2330  O  O     . GLU B 1  77   ? -38.910 18.314  125.136 1.00 59.02  ? 77   GLU B O     1 
ATOM   2331  C  CB    . GLU B 1  77   ? -41.361 16.772  123.622 1.00 68.74  ? 77   GLU B CB    1 
ATOM   2332  C  CG    . GLU B 1  77   ? -41.085 17.974  122.724 1.00 72.96  ? 77   GLU B CG    1 
ATOM   2333  C  CD    . GLU B 1  77   ? -40.118 17.662  121.593 1.00 73.74  ? 77   GLU B CD    1 
ATOM   2334  O  OE1   . GLU B 1  77   ? -39.436 18.597  121.120 1.00 64.15  ? 77   GLU B OE1   1 
ATOM   2335  O  OE2   . GLU B 1  77   ? -40.047 16.487  121.171 1.00 74.13  ? 77   GLU B OE2   1 
ATOM   2336  N  N     . ILE B 1  78   ? -40.508 17.627  126.566 1.00 56.17  ? 78   ILE B N     1 
ATOM   2337  C  CA    . ILE B 1  78   ? -40.215 18.660  127.551 1.00 56.20  ? 78   ILE B CA    1 
ATOM   2338  C  C     . ILE B 1  78   ? -38.871 18.381  128.217 1.00 51.48  ? 78   ILE B C     1 
ATOM   2339  O  O     . ILE B 1  78   ? -38.117 19.304  128.527 1.00 44.32  ? 78   ILE B O     1 
ATOM   2340  C  CB    . ILE B 1  78   ? -41.316 18.749  128.623 1.00 58.65  ? 78   ILE B CB    1 
ATOM   2341  C  CG1   . ILE B 1  78   ? -42.697 18.742  127.966 1.00 62.50  ? 78   ILE B CG1   1 
ATOM   2342  C  CG2   . ILE B 1  78   ? -41.133 19.997  129.474 1.00 54.89  ? 78   ILE B CG2   1 
ATOM   2343  C  CD1   . ILE B 1  78   ? -43.839 18.799  128.952 1.00 66.65  ? 78   ILE B CD1   1 
ATOM   2344  N  N     . ILE B 1  79   ? -38.582 17.100  128.430 1.00 50.85  ? 79   ILE B N     1 
ATOM   2345  C  CA    . ILE B 1  79   ? -37.292 16.675  128.962 1.00 48.65  ? 79   ILE B CA    1 
ATOM   2346  C  C     . ILE B 1  79   ? -36.174 17.123  128.028 1.00 50.82  ? 79   ILE B C     1 
ATOM   2347  O  O     . ILE B 1  79   ? -35.174 17.695  128.467 1.00 50.77  ? 79   ILE B O     1 
ATOM   2348  C  CB    . ILE B 1  79   ? -37.229 15.143  129.129 1.00 49.68  ? 79   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B 1  79   ? -38.204 14.679  130.212 1.00 49.67  ? 79   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B 1  79   ? -35.818 14.698  129.472 1.00 54.26  ? 79   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B 1  79   ? -37.861 15.181  131.593 1.00 47.51  ? 79   ILE B CD1   1 
ATOM   2352  N  N     . LEU B 1  80   ? -36.361 16.864  126.737 1.00 47.26  ? 80   LEU B N     1 
ATOM   2353  C  CA    . LEU B 1  80   ? -35.405 17.265  125.714 1.00 36.88  ? 80   LEU B CA    1 
ATOM   2354  C  C     . LEU B 1  80   ? -35.195 18.769  125.740 1.00 39.33  ? 80   LEU B C     1 
ATOM   2355  O  O     . LEU B 1  80   ? -34.063 19.242  125.841 1.00 39.48  ? 80   LEU B O     1 
ATOM   2356  C  CB    . LEU B 1  80   ? -35.895 16.839  124.330 1.00 38.93  ? 80   LEU B CB    1 
ATOM   2357  C  CG    . LEU B 1  80   ? -36.017 15.339  124.071 1.00 37.81  ? 80   LEU B CG    1 
ATOM   2358  C  CD1   . LEU B 1  80   ? -36.574 15.073  122.681 1.00 44.74  ? 80   LEU B CD1   1 
ATOM   2359  C  CD2   . LEU B 1  80   ? -34.672 14.665  124.249 1.00 40.30  ? 80   LEU B CD2   1 
ATOM   2360  N  N     . ASN B 1  81   ? -36.295 19.515  125.660 1.00 44.01  ? 81   ASN B N     1 
ATOM   2361  C  CA    . ASN B 1  81   ? -36.241 20.975  125.662 1.00 46.12  ? 81   ASN B CA    1 
ATOM   2362  C  C     . ASN B 1  81   ? -35.466 21.532  126.850 1.00 40.46  ? 81   ASN B C     1 
ATOM   2363  O  O     . ASN B 1  81   ? -34.823 22.577  126.749 1.00 34.40  ? 81   ASN B O     1 
ATOM   2364  C  CB    . ASN B 1  81   ? -37.653 21.566  125.631 1.00 46.21  ? 81   ASN B CB    1 
ATOM   2365  C  CG    . ASN B 1  81   ? -38.280 21.513  124.250 1.00 55.90  ? 81   ASN B CG    1 
ATOM   2366  O  OD1   . ASN B 1  81   ? -37.601 21.703  123.240 1.00 63.30  ? 81   ASN B OD1   1 
ATOM   2367  N  ND2   . ASN B 1  81   ? -39.583 21.256  124.200 1.00 49.66  ? 81   ASN B ND2   1 
ATOM   2368  N  N     . LEU B 1  82   ? -35.524 20.817  127.969 1.00 46.57  ? 82   LEU B N     1 
ATOM   2369  C  CA    . LEU B 1  82   ? -34.829 21.225  129.186 1.00 51.91  ? 82   LEU B CA    1 
ATOM   2370  C  C     . LEU B 1  82   ? -33.332 20.949  129.107 1.00 44.82  ? 82   LEU B C     1 
ATOM   2371  O  O     . LEU B 1  82   ? -32.539 21.578  129.808 1.00 43.08  ? 82   LEU B O     1 
ATOM   2372  C  CB    . LEU B 1  82   ? -35.433 20.530  130.409 1.00 50.42  ? 82   LEU B CB    1 
ATOM   2373  C  CG    . LEU B 1  82   ? -36.775 21.085  130.888 1.00 45.28  ? 82   LEU B CG    1 
ATOM   2374  C  CD1   . LEU B 1  82   ? -37.408 20.148  131.892 1.00 50.51  ? 82   LEU B CD1   1 
ATOM   2375  C  CD2   . LEU B 1  82   ? -36.591 22.466  131.490 1.00 40.62  ? 82   LEU B CD2   1 
ATOM   2376  N  N     . LYS B 1  83   ? -32.947 20.005  128.255 1.00 40.24  ? 83   LYS B N     1 
ATOM   2377  C  CA    . LYS B 1  83   ? -31.535 19.713  128.057 1.00 38.80  ? 83   LYS B CA    1 
ATOM   2378  C  C     . LYS B 1  83   ? -30.880 20.794  127.208 1.00 44.32  ? 83   LYS B C     1 
ATOM   2379  O  O     . LYS B 1  83   ? -29.693 21.088  127.365 1.00 41.58  ? 83   LYS B O     1 
ATOM   2380  C  CB    . LYS B 1  83   ? -31.345 18.334  127.429 1.00 26.61  ? 83   LYS B CB    1 
ATOM   2381  C  CG    . LYS B 1  83   ? -31.572 17.205  128.406 1.00 32.22  ? 83   LYS B CG    1 
ATOM   2382  C  CD    . LYS B 1  83   ? -31.162 15.863  127.836 1.00 39.33  ? 83   LYS B CD    1 
ATOM   2383  C  CE    . LYS B 1  83   ? -32.229 15.297  126.924 1.00 36.29  ? 83   LYS B CE    1 
ATOM   2384  N  NZ    . LYS B 1  83   ? -31.912 13.895  126.539 1.00 38.45  ? 83   LYS B NZ    1 
ATOM   2385  N  N     . GLU B 1  84   ? -31.664 21.399  126.324 1.00 39.57  ? 84   GLU B N     1 
ATOM   2386  C  CA    . GLU B 1  84   ? -31.152 22.452  125.459 1.00 48.08  ? 84   GLU B CA    1 
ATOM   2387  C  C     . GLU B 1  84   ? -31.142 23.799  126.176 1.00 48.35  ? 84   GLU B C     1 
ATOM   2388  O  O     . GLU B 1  84   ? -30.680 24.801  125.632 1.00 57.14  ? 84   GLU B O     1 
ATOM   2389  C  CB    . GLU B 1  84   ? -31.953 22.524  124.154 1.00 58.42  ? 84   GLU B CB    1 
ATOM   2390  C  CG    . GLU B 1  84   ? -31.709 21.342  123.218 1.00 61.41  ? 84   GLU B CG    1 
ATOM   2391  C  CD    . GLU B 1  84   ? -32.531 21.408  121.940 1.00 66.48  ? 84   GLU B CD    1 
ATOM   2392  O  OE1   . GLU B 1  84   ? -33.371 22.325  121.814 1.00 72.14  ? 84   GLU B OE1   1 
ATOM   2393  O  OE2   . GLU B 1  84   ? -32.337 20.541  121.060 1.00 56.83  ? 84   GLU B OE2   1 
ATOM   2394  N  N     . LEU B 1  85   ? -31.645 23.816  127.405 1.00 48.50  ? 85   LEU B N     1 
ATOM   2395  C  CA    . LEU B 1  85   ? -31.595 25.016  128.229 1.00 50.27  ? 85   LEU B CA    1 
ATOM   2396  C  C     . LEU B 1  85   ? -30.173 25.261  128.715 1.00 50.40  ? 85   LEU B C     1 
ATOM   2397  O  O     . LEU B 1  85   ? -29.551 24.381  129.312 1.00 56.20  ? 85   LEU B O     1 
ATOM   2398  C  CB    . LEU B 1  85   ? -32.540 24.885  129.425 1.00 47.89  ? 85   LEU B CB    1 
ATOM   2399  C  CG    . LEU B 1  85   ? -32.428 25.956  130.515 1.00 51.73  ? 85   LEU B CG    1 
ATOM   2400  C  CD1   . LEU B 1  85   ? -32.752 27.334  129.960 1.00 59.18  ? 85   LEU B CD1   1 
ATOM   2401  C  CD2   . LEU B 1  85   ? -33.328 25.626  131.700 1.00 47.75  ? 85   LEU B CD2   1 
ATOM   2402  N  N     . VAL B 1  86   ? -29.655 26.456  128.452 1.00 46.89  ? 86   VAL B N     1 
ATOM   2403  C  CA    . VAL B 1  86   ? -28.342 26.831  128.959 1.00 55.16  ? 86   VAL B CA    1 
ATOM   2404  C  C     . VAL B 1  86   ? -28.456 27.955  129.986 1.00 61.67  ? 86   VAL B C     1 
ATOM   2405  O  O     . VAL B 1  86   ? -28.778 29.095  129.646 1.00 61.63  ? 86   VAL B O     1 
ATOM   2406  C  CB    . VAL B 1  86   ? -27.367 27.232  127.818 1.00 59.53  ? 86   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B 1  86   ? -28.064 28.100  126.782 1.00 58.41  ? 86   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B 1  86   ? -26.134 27.931  128.376 1.00 55.66  ? 86   VAL B CG2   1 
ATOM   2409  N  N     . VAL B 1  87   ? -28.210 27.620  131.249 1.00 62.27  ? 87   VAL B N     1 
ATOM   2410  C  CA    . VAL B 1  87   ? -28.183 28.621  132.307 1.00 54.84  ? 87   VAL B CA    1 
ATOM   2411  C  C     . VAL B 1  87   ? -26.741 28.892  132.721 1.00 56.64  ? 87   VAL B C     1 
ATOM   2412  O  O     . VAL B 1  87   ? -25.814 28.254  132.222 1.00 66.16  ? 87   VAL B O     1 
ATOM   2413  C  CB    . VAL B 1  87   ? -29.007 28.187  133.531 1.00 50.14  ? 87   VAL B CB    1 
ATOM   2414  C  CG1   . VAL B 1  87   ? -30.421 27.813  133.111 1.00 46.43  ? 87   VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B 1  87   ? -28.336 27.028  134.233 1.00 51.72  ? 87   VAL B CG2   1 
ATOM   2416  N  N     . ARG B 1  88   ? -26.557 29.830  133.640 1.00 56.85  ? 88   ARG B N     1 
ATOM   2417  C  CA    . ARG B 1  88   ? -25.222 30.277  134.010 1.00 56.53  ? 88   ARG B CA    1 
ATOM   2418  C  C     . ARG B 1  88   ? -25.148 30.630  135.491 1.00 66.10  ? 88   ARG B C     1 
ATOM   2419  O  O     . ARG B 1  88   ? -26.045 31.280  136.028 1.00 68.45  ? 88   ARG B O     1 
ATOM   2420  C  CB    . ARG B 1  88   ? -24.837 31.486  133.161 1.00 57.50  ? 88   ARG B CB    1 
ATOM   2421  C  CG    . ARG B 1  88   ? -23.396 31.924  133.289 1.00 54.92  ? 88   ARG B CG    1 
ATOM   2422  C  CD    . ARG B 1  88   ? -23.119 33.068  132.333 1.00 56.38  ? 88   ARG B CD    1 
ATOM   2423  N  NE    . ARG B 1  88   ? -21.720 33.474  132.344 1.00 61.98  ? 88   ARG B NE    1 
ATOM   2424  C  CZ    . ARG B 1  88   ? -21.232 34.472  131.616 1.00 72.96  ? 88   ARG B CZ    1 
ATOM   2425  N  NH1   . ARG B 1  88   ? -22.035 35.164  130.817 1.00 66.72  ? 88   ARG B NH1   1 
ATOM   2426  N  NH2   . ARG B 1  88   ? -19.943 34.778  131.684 1.00 77.81  ? 88   ARG B NH2   1 
ATOM   2427  N  N     . PHE B 1  89   ? -24.077 30.204  136.150 1.00 68.43  ? 89   PHE B N     1 
ATOM   2428  C  CA    . PHE B 1  89   ? -23.891 30.531  137.557 1.00 61.06  ? 89   PHE B CA    1 
ATOM   2429  C  C     . PHE B 1  89   ? -22.932 31.706  137.704 1.00 67.85  ? 89   PHE B C     1 
ATOM   2430  O  O     . PHE B 1  89   ? -21.741 31.587  137.422 1.00 68.70  ? 89   PHE B O     1 
ATOM   2431  C  CB    . PHE B 1  89   ? -23.380 29.318  138.337 1.00 55.82  ? 89   PHE B CB    1 
ATOM   2432  C  CG    . PHE B 1  89   ? -24.384 28.204  138.457 1.00 53.15  ? 89   PHE B CG    1 
ATOM   2433  C  CD1   . PHE B 1  89   ? -25.702 28.390  138.066 1.00 47.65  ? 89   PHE B CD1   1 
ATOM   2434  C  CD2   . PHE B 1  89   ? -24.012 26.971  138.969 1.00 54.02  ? 89   PHE B CD2   1 
ATOM   2435  C  CE1   . PHE B 1  89   ? -26.627 27.368  138.175 1.00 44.03  ? 89   PHE B CE1   1 
ATOM   2436  C  CE2   . PHE B 1  89   ? -24.934 25.943  139.083 1.00 57.80  ? 89   PHE B CE2   1 
ATOM   2437  C  CZ    . PHE B 1  89   ? -26.243 26.143  138.686 1.00 49.44  ? 89   PHE B CZ    1 
ATOM   2438  N  N     . LEU B 1  90   ? -23.465 32.840  138.148 1.00 72.73  ? 90   LEU B N     1 
ATOM   2439  C  CA    . LEU B 1  90   ? -22.671 34.050  138.315 1.00 71.89  ? 90   LEU B CA    1 
ATOM   2440  C  C     . LEU B 1  90   ? -21.786 33.952  139.549 1.00 76.14  ? 90   LEU B C     1 
ATOM   2441  O  O     . LEU B 1  90   ? -20.702 34.532  139.595 1.00 79.08  ? 90   LEU B O     1 
ATOM   2442  C  CB    . LEU B 1  90   ? -23.582 35.273  138.422 1.00 78.30  ? 90   LEU B CB    1 
ATOM   2443  C  CG    . LEU B 1  90   ? -24.393 35.624  137.175 1.00 79.00  ? 90   LEU B CG    1 
ATOM   2444  C  CD1   . LEU B 1  90   ? -25.394 36.722  137.486 1.00 86.88  ? 90   LEU B CD1   1 
ATOM   2445  C  CD2   . LEU B 1  90   ? -23.471 36.045  136.039 1.00 73.45  ? 90   LEU B CD2   1 
ATOM   2446  N  N     . ASN B 1  91   ? -22.258 33.218  140.550 1.00 76.47  ? 91   ASN B N     1 
ATOM   2447  C  CA    . ASN B 1  91   ? -21.500 33.039  141.780 1.00 78.75  ? 91   ASN B CA    1 
ATOM   2448  C  C     . ASN B 1  91   ? -20.779 31.698  141.796 1.00 76.20  ? 91   ASN B C     1 
ATOM   2449  O  O     . ASN B 1  91   ? -21.414 30.646  141.716 1.00 70.59  ? 91   ASN B O     1 
ATOM   2450  C  CB    . ASN B 1  91   ? -22.415 33.160  142.997 1.00 86.25  ? 91   ASN B CB    1 
ATOM   2451  C  CG    . ASN B 1  91   ? -21.678 33.632  144.231 1.00 90.06  ? 91   ASN B CG    1 
ATOM   2452  O  OD1   . ASN B 1  91   ? -20.982 32.858  144.886 1.00 88.29  ? 91   ASN B OD1   1 
ATOM   2453  N  ND2   . ASN B 1  91   ? -21.827 34.912  144.556 1.00 90.31  ? 91   ASN B ND2   1 
ATOM   2454  N  N     . PRO B 1  92   ? -19.443 31.735  141.912 1.00 76.41  ? 92   PRO B N     1 
ATOM   2455  C  CA    . PRO B 1  92   ? -18.580 30.548  141.876 1.00 74.50  ? 92   PRO B CA    1 
ATOM   2456  C  C     . PRO B 1  92   ? -18.859 29.593  143.031 1.00 70.27  ? 92   PRO B C     1 
ATOM   2457  O  O     . PRO B 1  92   ? -18.465 28.427  142.989 1.00 67.05  ? 92   PRO B O     1 
ATOM   2458  C  CB    . PRO B 1  92   ? -17.173 31.138  142.014 1.00 67.00  ? 92   PRO B CB    1 
ATOM   2459  C  CG    . PRO B 1  92   ? -17.377 32.447  142.697 1.00 71.37  ? 92   PRO B CG    1 
ATOM   2460  C  CD    . PRO B 1  92   ? -18.675 32.966  142.167 1.00 70.81  ? 92   PRO B CD    1 
ATOM   2461  N  N     . SER B 1  93   ? -19.539 30.097  144.053 1.00 74.29  ? 93   SER B N     1 
ATOM   2462  C  CA    . SER B 1  93   ? -19.832 29.317  145.243 1.00 75.93  ? 93   SER B CA    1 
ATOM   2463  C  C     . SER B 1  93   ? -20.960 28.317  145.003 1.00 72.81  ? 93   SER B C     1 
ATOM   2464  O  O     . SER B 1  93   ? -21.054 27.297  145.689 1.00 69.50  ? 93   SER B O     1 
ATOM   2465  C  CB    . SER B 1  93   ? -20.213 30.254  146.392 1.00 79.17  ? 93   SER B CB    1 
ATOM   2466  O  OG    . SER B 1  93   ? -19.265 31.298  146.540 1.00 71.45  ? 93   SER B OG    1 
ATOM   2467  N  N     . LEU B 1  94   ? -21.800 28.601  144.013 1.00 66.89  ? 94   LEU B N     1 
ATOM   2468  C  CA    . LEU B 1  94   ? -23.058 27.881  143.851 1.00 62.29  ? 94   LEU B CA    1 
ATOM   2469  C  C     . LEU B 1  94   ? -22.870 26.520  143.182 1.00 55.14  ? 94   LEU B C     1 
ATOM   2470  O  O     . LEU B 1  94   ? -22.483 26.442  142.018 1.00 61.73  ? 94   LEU B O     1 
ATOM   2471  C  CB    . LEU B 1  94   ? -23.996 28.747  143.009 1.00 58.28  ? 94   LEU B CB    1 
ATOM   2472  C  CG    . LEU B 1  94   ? -25.342 28.186  142.571 1.00 54.21  ? 94   LEU B CG    1 
ATOM   2473  C  CD1   . LEU B 1  94   ? -26.149 27.836  143.783 1.00 63.61  ? 94   LEU B CD1   1 
ATOM   2474  C  CD2   . LEU B 1  94   ? -26.074 29.211  141.726 1.00 60.84  ? 94   LEU B CD2   1 
ATOM   2475  N  N     . GLN B 1  95   ? -23.144 25.448  143.922 1.00 54.60  ? 95   GLN B N     1 
ATOM   2476  C  CA    . GLN B 1  95   ? -23.039 24.099  143.365 1.00 62.98  ? 95   GLN B CA    1 
ATOM   2477  C  C     . GLN B 1  95   ? -24.338 23.513  142.808 1.00 63.36  ? 95   GLN B C     1 
ATOM   2478  O  O     . GLN B 1  95   ? -24.302 22.559  142.029 1.00 63.43  ? 95   GLN B O     1 
ATOM   2479  C  CB    . GLN B 1  95   ? -22.455 23.136  144.407 1.00 61.78  ? 95   GLN B CB    1 
ATOM   2480  C  CG    . GLN B 1  95   ? -21.079 23.525  144.930 1.00 60.06  ? 95   GLN B CG    1 
ATOM   2481  C  CD    . GLN B 1  95   ? -19.997 23.423  143.871 1.00 76.90  ? 95   GLN B CD    1 
ATOM   2482  O  OE1   . GLN B 1  95   ? -20.150 22.720  142.872 1.00 78.77  ? 95   GLN B OE1   1 
ATOM   2483  N  NE2   . GLN B 1  95   ? -18.894 24.130  144.087 1.00 78.46  ? 95   GLN B NE2   1 
ATOM   2484  N  N     . THR B 1  96   ? -25.478 24.071  143.207 1.00 59.75  ? 96   THR B N     1 
ATOM   2485  C  CA    . THR B 1  96   ? -26.769 23.524  142.785 1.00 56.33  ? 96   THR B CA    1 
ATOM   2486  C  C     . THR B 1  96   ? -27.924 24.502  142.959 1.00 52.29  ? 96   THR B C     1 
ATOM   2487  O  O     . THR B 1  96   ? -27.861 25.405  143.782 1.00 53.28  ? 96   THR B O     1 
ATOM   2488  C  CB    . THR B 1  96   ? -27.105 22.225  143.544 1.00 54.29  ? 96   THR B CB    1 
ATOM   2489  O  OG1   . THR B 1  96   ? -28.422 21.788  143.186 1.00 47.72  ? 96   THR B OG1   1 
ATOM   2490  C  CG2   . THR B 1  96   ? -27.044 22.454  145.045 1.00 73.27  ? 96   THR B CG2   1 
ATOM   2491  N  N     . VAL B 1  97   ? -29.003 24.283  142.217 1.00 55.17  ? 97   VAL B N     1 
ATOM   2492  C  CA    . VAL B 1  97   ? -30.166 25.158  142.287 1.00 56.05  ? 97   VAL B CA    1 
ATOM   2493  C  C     . VAL B 1  97   ? -31.436 24.411  141.871 1.00 53.25  ? 97   VAL B C     1 
ATOM   2494  O  O     . VAL B 1  97   ? -31.367 23.415  141.150 1.00 50.59  ? 97   VAL B O     1 
ATOM   2495  C  CB    . VAL B 1  97   ? -29.959 26.431  141.424 1.00 47.84  ? 97   VAL B CB    1 
ATOM   2496  C  CG1   . VAL B 1  97   ? -30.711 26.329  140.106 1.00 43.33  ? 97   VAL B CG1   1 
ATOM   2497  C  CG2   . VAL B 1  97   ? -30.381 27.670  142.192 1.00 48.77  ? 97   VAL B CG2   1 
ATOM   2498  N  N     . THR B 1  98   ? -32.589 24.871  142.350 1.00 57.06  ? 98   THR B N     1 
ATOM   2499  C  CA    . THR B 1  98   ? -33.869 24.317  141.910 1.00 61.82  ? 98   THR B CA    1 
ATOM   2500  C  C     . THR B 1  98   ? -34.761 25.399  141.300 1.00 54.35  ? 98   THR B C     1 
ATOM   2501  O  O     . THR B 1  98   ? -35.221 26.304  141.993 1.00 53.84  ? 98   THR B O     1 
ATOM   2502  C  CB    . THR B 1  98   ? -34.625 23.598  143.054 1.00 60.68  ? 98   THR B CB    1 
ATOM   2503  O  OG1   . THR B 1  98   ? -33.843 22.496  143.532 1.00 66.83  ? 98   THR B OG1   1 
ATOM   2504  C  CG2   . THR B 1  98   ? -35.968 23.073  142.561 1.00 55.22  ? 98   THR B CG2   1 
ATOM   2505  N  N     . LEU B 1  99   ? -34.996 25.295  139.997 1.00 54.56  ? 99   LEU B N     1 
ATOM   2506  C  CA    . LEU B 1  99   ? -35.847 26.238  139.284 1.00 57.01  ? 99   LEU B CA    1 
ATOM   2507  C  C     . LEU B 1  99   ? -37.303 25.803  139.346 1.00 64.10  ? 99   LEU B C     1 
ATOM   2508  O  O     . LEU B 1  99   ? -37.635 24.656  139.040 1.00 62.75  ? 99   LEU B O     1 
ATOM   2509  C  CB    . LEU B 1  99   ? -35.407 26.355  137.824 1.00 57.55  ? 99   LEU B CB    1 
ATOM   2510  C  CG    . LEU B 1  99   ? -34.631 27.606  137.413 1.00 58.25  ? 99   LEU B CG    1 
ATOM   2511  C  CD1   . LEU B 1  99   ? -33.449 27.836  138.336 1.00 51.63  ? 99   LEU B CD1   1 
ATOM   2512  C  CD2   . LEU B 1  99   ? -34.174 27.492  135.966 1.00 51.17  ? 99   LEU B CD2   1 
ATOM   2513  N  N     . LEU B 1  100  ? -38.171 26.725  139.747 1.00 70.67  ? 100  LEU B N     1 
ATOM   2514  C  CA    . LEU B 1  100  ? -39.597 26.447  139.812 1.00 66.47  ? 100  LEU B CA    1 
ATOM   2515  C  C     . LEU B 1  100  ? -40.332 27.163  138.688 1.00 62.26  ? 100  LEU B C     1 
ATOM   2516  O  O     . LEU B 1  100  ? -40.066 28.332  138.402 1.00 58.81  ? 100  LEU B O     1 
ATOM   2517  C  CB    . LEU B 1  100  ? -40.178 26.852  141.172 1.00 69.50  ? 100  LEU B CB    1 
ATOM   2518  C  CG    . LEU B 1  100  ? -39.737 26.058  142.407 1.00 72.05  ? 100  LEU B CG    1 
ATOM   2519  C  CD1   . LEU B 1  100  ? -38.490 26.664  143.041 1.00 68.80  ? 100  LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B 1  100  ? -40.868 25.958  143.423 1.00 71.56  ? 100  LEU B CD2   1 
ATOM   2521  N  N     . LEU B 1  101  ? -41.244 26.445  138.043 1.00 60.86  ? 101  LEU B N     1 
ATOM   2522  C  CA    . LEU B 1  101  ? -42.062 27.016  136.982 1.00 69.37  ? 101  LEU B CA    1 
ATOM   2523  C  C     . LEU B 1  101  ? -43.498 26.509  137.063 1.00 74.01  ? 101  LEU B C     1 
ATOM   2524  O  O     . LEU B 1  101  ? -43.735 25.304  137.096 1.00 73.35  ? 101  LEU B O     1 
ATOM   2525  C  CB    . LEU B 1  101  ? -41.459 26.679  135.619 1.00 74.05  ? 101  LEU B CB    1 
ATOM   2526  C  CG    . LEU B 1  101  ? -42.257 27.014  134.360 1.00 69.50  ? 101  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B 1  101  ? -42.653 28.478  134.344 1.00 74.13  ? 101  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B 1  101  ? -41.437 26.664  133.134 1.00 62.30  ? 101  LEU B CD2   1 
ATOM   2529  N  N     . LYS B 1  102  ? -44.454 27.431  137.092 1.00 76.22  ? 102  LYS B N     1 
ATOM   2530  C  CA    . LYS B 1  102  ? -45.861 27.053  137.074 1.00 76.39  ? 102  LYS B CA    1 
ATOM   2531  C  C     . LYS B 1  102  ? -46.674 28.003  136.206 1.00 77.43  ? 102  LYS B C     1 
ATOM   2532  O  O     . LYS B 1  102  ? -46.560 29.223  136.326 1.00 76.86  ? 102  LYS B O     1 
ATOM   2533  C  CB    . LYS B 1  102  ? -46.442 27.008  138.487 1.00 81.58  ? 102  LYS B CB    1 
ATOM   2534  C  CG    . LYS B 1  102  ? -47.820 26.364  138.557 1.00 83.21  ? 102  LYS B CG    1 
ATOM   2535  C  CD    . LYS B 1  102  ? -48.470 26.569  139.915 1.00 89.90  ? 102  LYS B CD    1 
ATOM   2536  C  CE    . LYS B 1  102  ? -48.795 28.036  140.155 1.00 97.97  ? 102  LYS B CE    1 
ATOM   2537  N  NZ    . LYS B 1  102  ? -49.753 28.568  139.145 1.00 96.54  ? 102  LYS B NZ    1 
ATOM   2538  N  N     . ALA B 1  103  ? -47.495 27.432  135.332 1.00 77.51  ? 103  ALA B N     1 
ATOM   2539  C  CA    . ALA B 1  103  ? -48.347 28.221  134.453 1.00 74.95  ? 103  ALA B CA    1 
ATOM   2540  C  C     . ALA B 1  103  ? -49.538 27.393  133.989 1.00 80.82  ? 103  ALA B C     1 
ATOM   2541  O  O     . ALA B 1  103  ? -49.530 26.166  134.091 1.00 79.37  ? 103  ALA B O     1 
ATOM   2542  C  CB    . ALA B 1  103  ? -47.552 28.733  133.261 1.00 70.37  ? 103  ALA B CB    1 
ATOM   2543  N  N     . GLU B 1  104  ? -50.563 28.070  133.485 1.00 87.88  ? 104  GLU B N     1 
ATOM   2544  C  CA    . GLU B 1  104  ? -51.749 27.390  132.977 1.00 92.96  ? 104  GLU B CA    1 
ATOM   2545  C  C     . GLU B 1  104  ? -52.422 28.202  131.875 1.00 96.48  ? 104  GLU B C     1 
ATOM   2546  O  O     . GLU B 1  104  ? -51.909 29.240  131.454 1.00 90.30  ? 104  GLU B O     1 
ATOM   2547  C  CB    . GLU B 1  104  ? -52.738 27.112  134.113 1.00 99.29  ? 104  GLU B CB    1 
ATOM   2548  C  CG    . GLU B 1  104  ? -53.165 28.350  134.889 1.00 93.39  ? 104  GLU B CG    1 
ATOM   2549  C  CD    . GLU B 1  104  ? -54.148 28.030  136.000 1.00 99.61  ? 104  GLU B CD    1 
ATOM   2550  O  OE1   . GLU B 1  104  ? -54.453 28.935  136.805 1.00 106.21 ? 104  GLU B OE1   1 
ATOM   2551  O  OE2   . GLU B 1  104  ? -54.617 26.873  136.067 1.00 97.69  ? 104  GLU B OE2   1 
ATOM   2552  N  N     . GLY B 1  105  ? -53.570 27.720  131.409 1.00 96.78  ? 105  GLY B N     1 
ATOM   2553  C  CA    . GLY B 1  105  ? -54.325 28.411  130.380 1.00 96.02  ? 105  GLY B CA    1 
ATOM   2554  C  C     . GLY B 1  105  ? -53.683 28.300  129.012 1.00 97.44  ? 105  GLY B C     1 
ATOM   2555  O  O     . GLY B 1  105  ? -52.700 27.582  128.844 1.00 101.35 ? 105  GLY B O     1 
ATOM   2556  N  N     . PRO B 1  106  ? -54.239 29.015  128.022 1.00 100.78 ? 106  PRO B N     1 
ATOM   2557  C  CA    . PRO B 1  106  ? -53.768 28.999  126.631 1.00 104.14 ? 106  PRO B CA    1 
ATOM   2558  C  C     . PRO B 1  106  ? -52.499 29.826  126.421 1.00 105.74 ? 106  PRO B C     1 
ATOM   2559  O  O     . PRO B 1  106  ? -52.582 30.978  125.993 1.00 107.08 ? 106  PRO B O     1 
ATOM   2560  C  CB    . PRO B 1  106  ? -54.937 29.621  125.865 1.00 102.85 ? 106  PRO B CB    1 
ATOM   2561  C  CG    . PRO B 1  106  ? -55.583 30.529  126.853 1.00 112.64 ? 106  PRO B CG    1 
ATOM   2562  C  CD    . PRO B 1  106  ? -55.433 29.862  128.193 1.00 103.74 ? 106  PRO B CD    1 
ATOM   2563  N  N     . LYS B 1  107  ? -51.339 29.247  126.716 1.00 97.35  ? 107  LYS B N     1 
ATOM   2564  C  CA    . LYS B 1  107  ? -50.083 29.983  126.589 1.00 93.14  ? 107  LYS B CA    1 
ATOM   2565  C  C     . LYS B 1  107  ? -48.914 29.063  126.250 1.00 90.14  ? 107  LYS B C     1 
ATOM   2566  O  O     . LYS B 1  107  ? -48.900 27.900  126.646 1.00 85.67  ? 107  LYS B O     1 
ATOM   2567  C  CB    . LYS B 1  107  ? -49.781 30.753  127.879 1.00 96.20  ? 107  LYS B CB    1 
ATOM   2568  C  CG    . LYS B 1  107  ? -48.579 31.685  127.785 1.00 88.44  ? 107  LYS B CG    1 
ATOM   2569  C  CD    . LYS B 1  107  ? -48.003 32.001  129.154 1.00 84.15  ? 107  LYS B CD    1 
ATOM   2570  C  CE    . LYS B 1  107  ? -46.706 32.783  129.031 1.00 71.80  ? 107  LYS B CE    1 
ATOM   2571  N  NZ    . LYS B 1  107  ? -46.058 33.000  130.353 1.00 73.26  ? 107  LYS B NZ    1 
ATOM   2572  N  N     . GLU B 1  108  ? -47.932 29.592  125.525 1.00 89.84  ? 108  GLU B N     1 
ATOM   2573  C  CA    . GLU B 1  108  ? -46.736 28.828  125.190 1.00 85.25  ? 108  GLU B CA    1 
ATOM   2574  C  C     . GLU B 1  108  ? -45.592 29.218  126.118 1.00 77.39  ? 108  GLU B C     1 
ATOM   2575  O  O     . GLU B 1  108  ? -45.023 30.304  126.005 1.00 70.85  ? 108  GLU B O     1 
ATOM   2576  C  CB    . GLU B 1  108  ? -46.335 29.075  123.735 1.00 85.80  ? 108  GLU B CB    1 
ATOM   2577  C  CG    . GLU B 1  108  ? -47.409 28.702  122.726 1.00 94.39  ? 108  GLU B CG    1 
ATOM   2578  C  CD    . GLU B 1  108  ? -47.048 29.109  121.310 1.00 93.44  ? 108  GLU B CD    1 
ATOM   2579  O  OE1   . GLU B 1  108  ? -45.993 29.753  121.124 1.00 85.97  ? 108  GLU B OE1   1 
ATOM   2580  O  OE2   . GLU B 1  108  ? -47.821 28.785  120.384 1.00 91.73  ? 108  GLU B OE2   1 
ATOM   2581  N  N     . VAL B 1  109  ? -45.249 28.308  127.023 1.00 77.19  ? 109  VAL B N     1 
ATOM   2582  C  CA    . VAL B 1  109  ? -44.244 28.572  128.041 1.00 67.80  ? 109  VAL B CA    1 
ATOM   2583  C  C     . VAL B 1  109  ? -42.832 28.499  127.484 1.00 66.56  ? 109  VAL B C     1 
ATOM   2584  O  O     . VAL B 1  109  ? -42.414 27.462  126.950 1.00 71.71  ? 109  VAL B O     1 
ATOM   2585  C  CB    . VAL B 1  109  ? -44.364 27.580  129.213 1.00 67.12  ? 109  VAL B CB    1 
ATOM   2586  C  CG1   . VAL B 1  109  ? -43.204 27.756  130.177 1.00 62.19  ? 109  VAL B CG1   1 
ATOM   2587  C  CG2   . VAL B 1  109  ? -45.693 27.763  129.926 1.00 76.16  ? 109  VAL B CG2   1 
ATOM   2588  N  N     . LYS B 1  110  ? -42.109 29.608  127.626 1.00 62.85  ? 110  LYS B N     1 
ATOM   2589  C  CA    . LYS B 1  110  ? -40.700 29.696  127.257 1.00 62.04  ? 110  LYS B CA    1 
ATOM   2590  C  C     . LYS B 1  110  ? -39.813 29.661  128.499 1.00 58.30  ? 110  LYS B C     1 
ATOM   2591  O  O     . LYS B 1  110  ? -40.304 29.520  129.617 1.00 59.17  ? 110  LYS B O     1 
ATOM   2592  C  CB    . LYS B 1  110  ? -40.427 30.965  126.447 1.00 61.69  ? 110  LYS B CB    1 
ATOM   2593  C  CG    . LYS B 1  110  ? -41.005 30.938  125.040 1.00 68.38  ? 110  LYS B CG    1 
ATOM   2594  C  CD    . LYS B 1  110  ? -40.524 32.128  124.223 1.00 74.69  ? 110  LYS B CD    1 
ATOM   2595  C  CE    . LYS B 1  110  ? -40.970 32.023  122.774 1.00 75.85  ? 110  LYS B CE    1 
ATOM   2596  N  NZ    . LYS B 1  110  ? -40.465 33.163  121.957 1.00 84.57  ? 110  LYS B NZ    1 
ATOM   2597  N  N     . ALA B 1  111  ? -38.506 29.797  128.297 1.00 59.87  ? 111  ALA B N     1 
ATOM   2598  C  CA    . ALA B 1  111  ? -37.544 29.645  129.385 1.00 66.82  ? 111  ALA B CA    1 
ATOM   2599  C  C     . ALA B 1  111  ? -37.486 30.848  130.324 1.00 72.09  ? 111  ALA B C     1 
ATOM   2600  O  O     . ALA B 1  111  ? -37.014 30.736  131.456 1.00 75.17  ? 111  ALA B O     1 
ATOM   2601  C  CB    . ALA B 1  111  ? -36.161 29.333  128.832 1.00 66.73  ? 111  ALA B CB    1 
ATOM   2602  N  N     . ARG B 1  112  ? -37.966 31.994  129.855 1.00 72.55  ? 112  ARG B N     1 
ATOM   2603  C  CA    . ARG B 1  112  ? -37.998 33.195  130.684 1.00 77.14  ? 112  ARG B CA    1 
ATOM   2604  C  C     . ARG B 1  112  ? -39.039 33.054  131.793 1.00 76.61  ? 112  ARG B C     1 
ATOM   2605  O  O     . ARG B 1  112  ? -38.972 33.741  132.813 1.00 70.02  ? 112  ARG B O     1 
ATOM   2606  C  CB    . ARG B 1  112  ? -38.294 34.431  129.831 1.00 74.84  ? 112  ARG B CB    1 
ATOM   2607  C  CG    . ARG B 1  112  ? -39.726 34.512  129.319 1.00 75.88  ? 112  ARG B CG    1 
ATOM   2608  C  CD    . ARG B 1  112  ? -39.887 35.625  128.297 1.00 82.11  ? 112  ARG B CD    1 
ATOM   2609  N  NE    . ARG B 1  112  ? -39.307 35.269  127.005 1.00 78.39  ? 112  ARG B NE    1 
ATOM   2610  C  CZ    . ARG B 1  112  ? -39.162 36.117  125.991 1.00 83.89  ? 112  ARG B CZ    1 
ATOM   2611  N  NH1   . ARG B 1  112  ? -39.547 37.379  126.119 1.00 100.36 ? 112  ARG B NH1   1 
ATOM   2612  N  NH2   . ARG B 1  112  ? -38.627 35.705  124.850 1.00 76.70  ? 112  ARG B NH2   1 
ATOM   2613  N  N     . ASP B 1  113  ? -39.991 32.147  131.585 1.00 77.41  ? 113  ASP B N     1 
ATOM   2614  C  CA    . ASP B 1  113  ? -41.098 31.940  132.514 1.00 69.35  ? 113  ASP B CA    1 
ATOM   2615  C  C     . ASP B 1  113  ? -40.652 31.345  133.844 1.00 71.99  ? 113  ASP B C     1 
ATOM   2616  O  O     . ASP B 1  113  ? -41.390 31.393  134.827 1.00 79.57  ? 113  ASP B O     1 
ATOM   2617  C  CB    . ASP B 1  113  ? -42.169 31.051  131.877 1.00 68.26  ? 113  ASP B CB    1 
ATOM   2618  C  CG    . ASP B 1  113  ? -42.910 31.745  130.752 1.00 78.30  ? 113  ASP B CG    1 
ATOM   2619  O  OD1   . ASP B 1  113  ? -42.375 32.735  130.205 1.00 76.52  ? 113  ASP B OD1   1 
ATOM   2620  O  OD2   . ASP B 1  113  ? -44.029 31.301  130.413 1.00 74.71  ? 113  ASP B OD2   1 
ATOM   2621  N  N     . PHE B 1  114  ? -39.450 30.777  133.868 1.00 73.64  ? 114  PHE B N     1 
ATOM   2622  C  CA    . PHE B 1  114  ? -38.877 30.259  135.106 1.00 79.32  ? 114  PHE B CA    1 
ATOM   2623  C  C     . PHE B 1  114  ? -38.715 31.374  136.135 1.00 85.21  ? 114  PHE B C     1 
ATOM   2624  O  O     . PHE B 1  114  ? -38.318 32.490  135.794 1.00 85.15  ? 114  PHE B O     1 
ATOM   2625  C  CB    . PHE B 1  114  ? -37.518 29.605  134.843 1.00 74.39  ? 114  PHE B CB    1 
ATOM   2626  C  CG    . PHE B 1  114  ? -37.605 28.161  134.441 1.00 65.44  ? 114  PHE B CG    1 
ATOM   2627  C  CD1   . PHE B 1  114  ? -38.029 27.203  135.345 1.00 65.40  ? 114  PHE B CD1   1 
ATOM   2628  C  CD2   . PHE B 1  114  ? -37.241 27.758  133.169 1.00 64.27  ? 114  PHE B CD2   1 
ATOM   2629  C  CE1   . PHE B 1  114  ? -38.104 25.872  134.982 1.00 63.69  ? 114  PHE B CE1   1 
ATOM   2630  C  CE2   . PHE B 1  114  ? -37.310 26.429  132.805 1.00 58.64  ? 114  PHE B CE2   1 
ATOM   2631  C  CZ    . PHE B 1  114  ? -37.746 25.485  133.711 1.00 58.45  ? 114  PHE B CZ    1 
ATOM   2632  N  N     . LEU B 1  115  ? -39.027 31.070  137.391 1.00 75.85  ? 115  LEU B N     1 
ATOM   2633  C  CA    . LEU B 1  115  ? -38.873 32.044  138.465 1.00 77.26  ? 115  LEU B CA    1 
ATOM   2634  C  C     . LEU B 1  115  ? -37.398 32.239  138.807 1.00 78.01  ? 115  LEU B C     1 
ATOM   2635  O  O     . LEU B 1  115  ? -36.724 31.295  139.223 1.00 70.98  ? 115  LEU B O     1 
ATOM   2636  C  CB    . LEU B 1  115  ? -39.666 31.616  139.701 1.00 79.52  ? 115  LEU B CB    1 
ATOM   2637  C  CG    . LEU B 1  115  ? -41.186 31.607  139.529 1.00 76.65  ? 115  LEU B CG    1 
ATOM   2638  C  CD1   . LEU B 1  115  ? -41.873 31.167  140.812 1.00 70.62  ? 115  LEU B CD1   1 
ATOM   2639  C  CD2   . LEU B 1  115  ? -41.685 32.976  139.091 1.00 66.03  ? 115  LEU B CD2   1 
ATOM   2640  N  N     . PRO B 1  116  ? -36.898 33.473  138.626 1.00 78.82  ? 116  PRO B N     1 
ATOM   2641  C  CA    . PRO B 1  116  ? -35.486 33.844  138.795 1.00 75.78  ? 116  PRO B CA    1 
ATOM   2642  C  C     . PRO B 1  116  ? -34.909 33.458  140.157 1.00 64.11  ? 116  PRO B C     1 
ATOM   2643  O  O     . PRO B 1  116  ? -35.631 33.435  141.152 1.00 70.42  ? 116  PRO B O     1 
ATOM   2644  C  CB    . PRO B 1  116  ? -35.507 35.368  138.643 1.00 69.07  ? 116  PRO B CB    1 
ATOM   2645  C  CG    . PRO B 1  116  ? -36.690 35.636  137.776 1.00 61.14  ? 116  PRO B CG    1 
ATOM   2646  C  CD    . PRO B 1  116  ? -37.716 34.620  138.189 1.00 66.09  ? 116  PRO B CD    1 
ATOM   2647  N  N     . VAL B 1  117  ? -33.616 33.146  140.183 1.00 57.44  ? 117  VAL B N     1 
ATOM   2648  C  CA    . VAL B 1  117  ? -32.923 32.780  141.414 1.00 58.53  ? 117  VAL B CA    1 
ATOM   2649  C  C     . VAL B 1  117  ? -31.652 33.624  141.547 1.00 63.54  ? 117  VAL B C     1 
ATOM   2650  O  O     . VAL B 1  117  ? -31.124 34.118  140.550 1.00 58.00  ? 117  VAL B O     1 
ATOM   2651  C  CB    . VAL B 1  117  ? -32.573 31.269  141.442 1.00 58.27  ? 117  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B 1  117  ? -32.091 30.842  142.822 1.00 56.63  ? 117  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B 1  117  ? -33.780 30.433  141.037 1.00 63.38  ? 117  VAL B CG2   1 
ATOM   2654  N  N     . ALA B 1  118  ? -31.178 33.801  142.778 1.00 76.16  ? 118  ALA B N     1 
ATOM   2655  C  CA    . ALA B 1  118  ? -29.993 34.612  143.053 1.00 84.66  ? 118  ALA B CA    1 
ATOM   2656  C  C     . ALA B 1  118  ? -28.738 34.070  142.375 1.00 90.71  ? 118  ALA B C     1 
ATOM   2657  O  O     . ALA B 1  118  ? -28.400 32.894  142.525 1.00 93.05  ? 118  ALA B O     1 
ATOM   2658  C  CB    . ALA B 1  118  ? -29.772 34.728  144.556 1.00 88.31  ? 118  ALA B CB    1 
ATOM   2659  N  N     . ASP B 1  119  ? -28.055 34.944  141.637 1.00 92.55  ? 119  ASP B N     1 
ATOM   2660  C  CA    . ASP B 1  119  ? -26.822 34.600  140.927 1.00 95.47  ? 119  ASP B CA    1 
ATOM   2661  C  C     . ASP B 1  119  ? -27.015 33.475  139.905 1.00 84.00  ? 119  ASP B C     1 
ATOM   2662  O  O     . ASP B 1  119  ? -26.155 32.606  139.750 1.00 75.18  ? 119  ASP B O     1 
ATOM   2663  C  CB    . ASP B 1  119  ? -25.694 34.259  141.912 1.00 105.59 ? 119  ASP B CB    1 
ATOM   2664  C  CG    . ASP B 1  119  ? -25.269 35.452  142.757 1.00 104.03 ? 119  ASP B CG    1 
ATOM   2665  O  OD1   . ASP B 1  119  ? -25.345 36.595  142.256 1.00 102.59 ? 119  ASP B OD1   1 
ATOM   2666  O  OD2   . ASP B 1  119  ? -24.857 35.246  143.920 1.00 88.08  ? 119  ASP B OD2   1 
ATOM   2667  N  N     . VAL B 1  120  ? -28.153 33.500  139.218 1.00 85.39  ? 120  VAL B N     1 
ATOM   2668  C  CA    . VAL B 1  120  ? -28.447 32.542  138.156 1.00 74.96  ? 120  VAL B CA    1 
ATOM   2669  C  C     . VAL B 1  120  ? -28.967 33.272  136.922 1.00 71.43  ? 120  VAL B C     1 
ATOM   2670  O  O     . VAL B 1  120  ? -30.019 33.909  136.966 1.00 68.50  ? 120  VAL B O     1 
ATOM   2671  C  CB    . VAL B 1  120  ? -29.492 31.497  138.601 1.00 64.63  ? 120  VAL B CB    1 
ATOM   2672  C  CG1   . VAL B 1  120  ? -29.979 30.690  137.409 1.00 59.69  ? 120  VAL B CG1   1 
ATOM   2673  C  CG2   . VAL B 1  120  ? -28.914 30.582  139.673 1.00 58.97  ? 120  VAL B CG2   1 
ATOM   2674  N  N     . GLU B 1  121  ? -28.227 33.174  135.822 1.00 72.85  ? 121  GLU B N     1 
ATOM   2675  C  CA    . GLU B 1  121  ? -28.582 33.875  134.591 1.00 69.76  ? 121  GLU B CA    1 
ATOM   2676  C  C     . GLU B 1  121  ? -28.970 32.913  133.472 1.00 64.10  ? 121  GLU B C     1 
ATOM   2677  O  O     . GLU B 1  121  ? -28.143 32.138  133.000 1.00 56.99  ? 121  GLU B O     1 
ATOM   2678  C  CB    . GLU B 1  121  ? -27.417 34.752  134.126 1.00 69.22  ? 121  GLU B CB    1 
ATOM   2679  C  CG    . GLU B 1  121  ? -27.603 35.350  132.738 1.00 72.37  ? 121  GLU B CG    1 
ATOM   2680  C  CD    . GLU B 1  121  ? -26.344 36.016  132.210 1.00 80.45  ? 121  GLU B CD    1 
ATOM   2681  O  OE1   . GLU B 1  121  ? -25.306 35.969  132.906 1.00 79.77  ? 121  GLU B OE1   1 
ATOM   2682  O  OE2   . GLU B 1  121  ? -26.392 36.584  131.097 1.00 72.93  ? 121  GLU B OE2   1 
ATOM   2683  N  N     . ILE B 1  122  ? -30.227 32.971  133.043 1.00 64.37  ? 122  ILE B N     1 
ATOM   2684  C  CA    . ILE B 1  122  ? -30.669 32.158  131.916 1.00 61.74  ? 122  ILE B CA    1 
ATOM   2685  C  C     . ILE B 1  122  ? -30.258 32.813  130.600 1.00 66.82  ? 122  ILE B C     1 
ATOM   2686  O  O     . ILE B 1  122  ? -30.673 33.932  130.295 1.00 59.85  ? 122  ILE B O     1 
ATOM   2687  C  CB    . ILE B 1  122  ? -32.188 31.927  131.941 1.00 56.77  ? 122  ILE B CB    1 
ATOM   2688  C  CG1   . ILE B 1  122  ? -32.565 31.056  133.141 1.00 49.49  ? 122  ILE B CG1   1 
ATOM   2689  C  CG2   . ILE B 1  122  ? -32.648 31.275  130.645 1.00 62.67  ? 122  ILE B CG2   1 
ATOM   2690  C  CD1   . ILE B 1  122  ? -34.038 30.720  133.217 1.00 60.00  ? 122  ILE B CD1   1 
ATOM   2691  N  N     . MET B 1  123  ? -29.444 32.101  129.825 1.00 71.09  ? 123  MET B N     1 
ATOM   2692  C  CA    . MET B 1  123  ? -28.860 32.641  128.601 1.00 61.42  ? 123  MET B CA    1 
ATOM   2693  C  C     . MET B 1  123  ? -29.845 32.637  127.438 1.00 70.33  ? 123  MET B C     1 
ATOM   2694  O  O     . MET B 1  123  ? -29.742 33.458  126.528 1.00 73.64  ? 123  MET B O     1 
ATOM   2695  C  CB    . MET B 1  123  ? -27.610 31.850  128.213 1.00 56.97  ? 123  MET B CB    1 
ATOM   2696  C  CG    . MET B 1  123  ? -26.546 31.784  129.299 1.00 67.44  ? 123  MET B CG    1 
ATOM   2697  S  SD    . MET B 1  123  ? -25.714 33.359  129.587 1.00 71.23  ? 123  MET B SD    1 
ATOM   2698  C  CE    . MET B 1  123  ? -24.979 33.652  127.980 1.00 66.69  ? 123  MET B CE    1 
ATOM   2699  N  N     . ASN B 1  124  ? -30.799 31.712  127.471 1.00 70.31  ? 124  ASN B N     1 
ATOM   2700  C  CA    . ASN B 1  124  ? -31.757 31.568  126.379 1.00 65.09  ? 124  ASN B CA    1 
ATOM   2701  C  C     . ASN B 1  124  ? -33.212 31.638  126.832 1.00 69.01  ? 124  ASN B C     1 
ATOM   2702  O  O     . ASN B 1  124  ? -33.867 30.609  126.983 1.00 69.43  ? 124  ASN B O     1 
ATOM   2703  C  CB    . ASN B 1  124  ? -31.506 30.258  125.629 1.00 64.81  ? 124  ASN B CB    1 
ATOM   2704  C  CG    . ASN B 1  124  ? -31.362 29.073  126.562 1.00 63.51  ? 124  ASN B CG    1 
ATOM   2705  O  OD1   . ASN B 1  124  ? -30.950 29.224  127.712 1.00 69.50  ? 124  ASN B OD1   1 
ATOM   2706  N  ND2   . ASN B 1  124  ? -31.701 27.887  126.073 1.00 57.01  ? 124  ASN B ND2   1 
ATOM   2707  N  N     . PRO B 1  125  ? -33.723 32.861  127.048 1.00 75.10  ? 125  PRO B N     1 
ATOM   2708  C  CA    . PRO B 1  125  ? -35.118 33.072  127.454 1.00 78.04  ? 125  PRO B CA    1 
ATOM   2709  C  C     . PRO B 1  125  ? -36.111 32.691  126.357 1.00 72.57  ? 125  PRO B C     1 
ATOM   2710  O  O     . PRO B 1  125  ? -37.196 32.193  126.661 1.00 69.82  ? 125  PRO B O     1 
ATOM   2711  C  CB    . PRO B 1  125  ? -35.183 34.583  127.714 1.00 78.75  ? 125  PRO B CB    1 
ATOM   2712  C  CG    . PRO B 1  125  ? -33.765 35.007  127.914 1.00 71.21  ? 125  PRO B CG    1 
ATOM   2713  C  CD    . PRO B 1  125  ? -32.969 34.124  127.009 1.00 74.70  ? 125  PRO B CD    1 
ATOM   2714  N  N     . ASP B 1  126  ? -35.738 32.921  125.101 1.00 67.00  ? 126  ASP B N     1 
ATOM   2715  C  CA    . ASP B 1  126  ? -36.634 32.677  123.972 1.00 71.17  ? 126  ASP B CA    1 
ATOM   2716  C  C     . ASP B 1  126  ? -36.850 31.194  123.674 1.00 70.53  ? 126  ASP B C     1 
ATOM   2717  O  O     . ASP B 1  126  ? -37.679 30.841  122.833 1.00 70.28  ? 126  ASP B O     1 
ATOM   2718  C  CB    . ASP B 1  126  ? -36.129 33.393  122.714 1.00 89.05  ? 126  ASP B CB    1 
ATOM   2719  C  CG    . ASP B 1  126  ? -36.508 34.864  122.686 1.00 103.11 ? 126  ASP B CG    1 
ATOM   2720  O  OD1   . ASP B 1  126  ? -37.621 35.184  122.213 1.00 99.09  ? 126  ASP B OD1   1 
ATOM   2721  O  OD2   . ASP B 1  126  ? -35.693 35.701  123.132 1.00 99.36  ? 126  ASP B OD2   1 
ATOM   2722  N  N     . LEU B 1  127  ? -36.103 30.331  124.357 1.00 71.74  ? 127  LEU B N     1 
ATOM   2723  C  CA    . LEU B 1  127  ? -36.223 28.889  124.159 1.00 68.10  ? 127  LEU B CA    1 
ATOM   2724  C  C     . LEU B 1  127  ? -37.620 28.382  124.498 1.00 57.66  ? 127  LEU B C     1 
ATOM   2725  O  O     . LEU B 1  127  ? -38.124 28.616  125.594 1.00 65.15  ? 127  LEU B O     1 
ATOM   2726  C  CB    . LEU B 1  127  ? -35.189 28.141  125.005 1.00 64.85  ? 127  LEU B CB    1 
ATOM   2727  C  CG    . LEU B 1  127  ? -35.373 26.622  125.067 1.00 57.11  ? 127  LEU B CG    1 
ATOM   2728  C  CD1   . LEU B 1  127  ? -35.179 26.000  123.692 1.00 70.13  ? 127  LEU B CD1   1 
ATOM   2729  C  CD2   . LEU B 1  127  ? -34.433 25.995  126.083 1.00 46.96  ? 127  LEU B CD2   1 
ATOM   2730  N  N     . HIS B 1  128  ? -38.239 27.680  123.556 1.00 51.15  ? 128  HIS B N     1 
ATOM   2731  C  CA    . HIS B 1  128  ? -39.554 27.102  123.790 1.00 52.14  ? 128  HIS B CA    1 
ATOM   2732  C  C     . HIS B 1  128  ? -39.443 25.919  124.742 1.00 53.90  ? 128  HIS B C     1 
ATOM   2733  O  O     . HIS B 1  128  ? -38.507 25.125  124.654 1.00 50.84  ? 128  HIS B O     1 
ATOM   2734  C  CB    . HIS B 1  128  ? -40.193 26.662  122.473 1.00 53.33  ? 128  HIS B CB    1 
ATOM   2735  C  CG    . HIS B 1  128  ? -41.536 26.021  122.636 1.00 59.39  ? 128  HIS B CG    1 
ATOM   2736  N  ND1   . HIS B 1  128  ? -41.699 24.661  122.788 1.00 64.37  ? 128  HIS B ND1   1 
ATOM   2737  C  CD2   . HIS B 1  128  ? -42.780 26.554  122.670 1.00 62.02  ? 128  HIS B CD2   1 
ATOM   2738  C  CE1   . HIS B 1  128  ? -42.985 24.382  122.908 1.00 56.88  ? 128  HIS B CE1   1 
ATOM   2739  N  NE2   . HIS B 1  128  ? -43.663 25.515  122.840 1.00 65.31  ? 128  HIS B NE2   1 
ATOM   2740  N  N     . ILE B 1  129  ? -40.398 25.817  125.660 1.00 62.62  ? 129  ILE B N     1 
ATOM   2741  C  CA    . ILE B 1  129  ? -40.439 24.717  126.618 1.00 58.63  ? 129  ILE B CA    1 
ATOM   2742  C  C     . ILE B 1  129  ? -41.716 23.899  126.475 1.00 61.11  ? 129  ILE B C     1 
ATOM   2743  O  O     . ILE B 1  129  ? -41.664 22.705  126.179 1.00 60.63  ? 129  ILE B O     1 
ATOM   2744  C  CB    . ILE B 1  129  ? -40.301 25.204  128.069 1.00 52.43  ? 129  ILE B CB    1 
ATOM   2745  C  CG1   . ILE B 1  129  ? -38.939 25.862  128.273 1.00 51.87  ? 129  ILE B CG1   1 
ATOM   2746  C  CG2   . ILE B 1  129  ? -40.478 24.046  129.041 1.00 47.62  ? 129  ILE B CG2   1 
ATOM   2747  C  CD1   . ILE B 1  129  ? -38.665 26.234  129.696 1.00 54.92  ? 129  ILE B CD1   1 
ATOM   2748  N  N     . ALA B 1  130  ? -42.863 24.531  126.703 1.00 64.68  ? 130  ALA B N     1 
ATOM   2749  C  CA    . ALA B 1  130  ? -44.122 23.796  126.616 1.00 66.98  ? 130  ALA B CA    1 
ATOM   2750  C  C     . ALA B 1  130  ? -45.225 24.560  125.891 1.00 71.15  ? 130  ALA B C     1 
ATOM   2751  O  O     . ALA B 1  130  ? -45.127 25.765  125.684 1.00 69.63  ? 130  ALA B O     1 
ATOM   2752  C  CB    . ALA B 1  130  ? -44.587 23.376  128.002 1.00 69.86  ? 130  ALA B CB    1 
ATOM   2753  N  N     . THR B 1  131  ? -46.268 23.838  125.493 1.00 78.20  ? 131  THR B N     1 
ATOM   2754  C  CA    . THR B 1  131  ? -47.459 24.455  124.921 1.00 81.45  ? 131  THR B CA    1 
ATOM   2755  C  C     . THR B 1  131  ? -48.686 24.068  125.736 1.00 85.73  ? 131  THR B C     1 
ATOM   2756  O  O     . THR B 1  131  ? -49.067 22.898  125.796 1.00 77.77  ? 131  THR B O     1 
ATOM   2757  C  CB    . THR B 1  131  ? -47.672 24.060  123.444 1.00 90.24  ? 131  THR B CB    1 
ATOM   2758  O  OG1   . THR B 1  131  ? -47.222 22.717  123.235 1.00 98.75  ? 131  THR B OG1   1 
ATOM   2759  C  CG2   . THR B 1  131  ? -46.902 24.992  122.522 1.00 81.21  ? 131  THR B CG2   1 
ATOM   2760  N  N     . LEU B 1  132  ? -49.297 25.065  126.364 1.00 87.21  ? 132  LEU B N     1 
ATOM   2761  C  CA    . LEU B 1  132  ? -50.438 24.841  127.237 1.00 85.38  ? 132  LEU B CA    1 
ATOM   2762  C  C     . LEU B 1  132  ? -51.736 25.277  126.571 1.00 90.99  ? 132  LEU B C     1 
ATOM   2763  O  O     . LEU B 1  132  ? -51.862 26.416  126.106 1.00 91.10  ? 132  LEU B O     1 
ATOM   2764  C  CB    . LEU B 1  132  ? -50.252 25.591  128.556 1.00 88.13  ? 132  LEU B CB    1 
ATOM   2765  C  CG    . LEU B 1  132  ? -48.937 25.363  129.300 1.00 84.26  ? 132  LEU B CG    1 
ATOM   2766  C  CD1   . LEU B 1  132  ? -48.918 26.160  130.592 1.00 93.75  ? 132  LEU B CD1   1 
ATOM   2767  C  CD2   . LEU B 1  132  ? -48.729 23.886  129.578 1.00 87.09  ? 132  LEU B CD2   1 
ATOM   2768  N  N     . GLU B 1  133  ? -52.696 24.358  126.540 1.00 88.27  ? 133  GLU B N     1 
ATOM   2769  C  CA    . GLU B 1  133  ? -54.007 24.598  125.951 1.00 89.83  ? 133  GLU B CA    1 
ATOM   2770  C  C     . GLU B 1  133  ? -54.974 25.128  127.002 1.00 89.38  ? 133  GLU B C     1 
ATOM   2771  O  O     . GLU B 1  133  ? -54.572 25.488  128.108 1.00 88.88  ? 133  GLU B O     1 
ATOM   2772  C  CB    . GLU B 1  133  ? -54.557 23.296  125.372 1.00 88.10  ? 133  GLU B CB    1 
ATOM   2773  C  CG    . GLU B 1  133  ? -53.530 22.473  124.618 1.00 90.83  ? 133  GLU B CG    1 
ATOM   2774  C  CD    . GLU B 1  133  ? -53.857 20.993  124.624 1.00 95.82  ? 133  GLU B CD    1 
ATOM   2775  O  OE1   . GLU B 1  133  ? -54.768 20.587  125.376 1.00 89.72  ? 133  GLU B OE1   1 
ATOM   2776  O  OE2   . GLU B 1  133  ? -53.201 20.235  123.878 1.00 97.02  ? 133  GLU B OE2   1 
ATOM   2777  N  N     . GLU B 1  134  ? -56.255 25.173  126.654 1.00 85.71  ? 134  GLU B N     1 
ATOM   2778  C  CA    . GLU B 1  134  ? -57.279 25.572  127.606 1.00 88.94  ? 134  GLU B CA    1 
ATOM   2779  C  C     . GLU B 1  134  ? -57.511 24.449  128.609 1.00 98.14  ? 134  GLU B C     1 
ATOM   2780  O  O     . GLU B 1  134  ? -57.842 23.325  128.229 1.00 101.24 ? 134  GLU B O     1 
ATOM   2781  C  CB    . GLU B 1  134  ? -58.587 25.890  126.880 1.00 93.17  ? 134  GLU B CB    1 
ATOM   2782  C  CG    . GLU B 1  134  ? -58.531 27.115  125.983 1.00 100.71 ? 134  GLU B CG    1 
ATOM   2783  C  CD    . GLU B 1  134  ? -58.664 28.415  126.755 1.00 99.79  ? 134  GLU B CD    1 
ATOM   2784  O  OE1   . GLU B 1  134  ? -58.751 28.367  128.001 1.00 100.15 ? 134  GLU B OE1   1 
ATOM   2785  O  OE2   . GLU B 1  134  ? -58.687 29.486  126.113 1.00 97.03  ? 134  GLU B OE2   1 
ATOM   2786  N  N     . GLY B 1  135  ? -57.338 24.757  129.890 1.00 97.60  ? 135  GLY B N     1 
ATOM   2787  C  CA    . GLY B 1  135  ? -57.526 23.772  130.938 1.00 94.57  ? 135  GLY B CA    1 
ATOM   2788  C  C     . GLY B 1  135  ? -56.265 22.983  131.232 1.00 88.66  ? 135  GLY B C     1 
ATOM   2789  O  O     . GLY B 1  135  ? -56.264 22.085  132.074 1.00 83.12  ? 135  GLY B O     1 
ATOM   2790  N  N     . GLY B 1  136  ? -55.188 23.312  130.527 1.00 90.27  ? 136  GLY B N     1 
ATOM   2791  C  CA    . GLY B 1  136  ? -53.911 22.665  130.757 1.00 88.86  ? 136  GLY B CA    1 
ATOM   2792  C  C     . GLY B 1  136  ? -53.170 23.298  131.916 1.00 89.31  ? 136  GLY B C     1 
ATOM   2793  O  O     . GLY B 1  136  ? -53.213 24.515  132.101 1.00 82.59  ? 136  GLY B O     1 
ATOM   2794  N  N     . ARG B 1  137  ? -52.479 22.471  132.693 1.00 97.16  ? 137  ARG B N     1 
ATOM   2795  C  CA    . ARG B 1  137  ? -51.719 22.958  133.838 1.00 97.33  ? 137  ARG B CA    1 
ATOM   2796  C  C     . ARG B 1  137  ? -50.308 22.383  133.874 1.00 91.00  ? 137  ARG B C     1 
ATOM   2797  O  O     . ARG B 1  137  ? -50.116 21.166  133.818 1.00 81.35  ? 137  ARG B O     1 
ATOM   2798  C  CB    . ARG B 1  137  ? -52.446 22.657  135.153 1.00 97.20  ? 137  ARG B CB    1 
ATOM   2799  C  CG    . ARG B 1  137  ? -53.517 23.674  135.515 1.00 103.83 ? 137  ARG B CG    1 
ATOM   2800  C  CD    . ARG B 1  137  ? -53.886 23.591  136.989 1.00 110.45 ? 137  ARG B CD    1 
ATOM   2801  N  NE    . ARG B 1  137  ? -54.758 24.690  137.396 1.00 115.29 ? 137  ARG B NE    1 
ATOM   2802  C  CZ    . ARG B 1  137  ? -55.166 24.899  138.644 1.00 116.83 ? 137  ARG B CZ    1 
ATOM   2803  N  NH1   . ARG B 1  137  ? -54.780 24.084  139.616 1.00 114.87 ? 137  ARG B NH1   1 
ATOM   2804  N  NH2   . ARG B 1  137  ? -55.959 25.926  138.921 1.00 109.42 ? 137  ARG B NH2   1 
ATOM   2805  N  N     . LEU B 1  138  ? -49.327 23.273  133.968 1.00 80.52  ? 138  LEU B N     1 
ATOM   2806  C  CA    . LEU B 1  138  ? -47.933 22.868  134.051 1.00 75.46  ? 138  LEU B CA    1 
ATOM   2807  C  C     . LEU B 1  138  ? -47.299 23.348  135.351 1.00 77.58  ? 138  LEU B C     1 
ATOM   2808  O  O     . LEU B 1  138  ? -47.129 24.549  135.567 1.00 77.39  ? 138  LEU B O     1 
ATOM   2809  C  CB    . LEU B 1  138  ? -47.148 23.411  132.857 1.00 78.41  ? 138  LEU B CB    1 
ATOM   2810  C  CG    . LEU B 1  138  ? -45.673 23.013  132.790 1.00 76.65  ? 138  LEU B CG    1 
ATOM   2811  C  CD1   . LEU B 1  138  ? -45.530 21.520  132.526 1.00 65.67  ? 138  LEU B CD1   1 
ATOM   2812  C  CD2   . LEU B 1  138  ? -44.946 23.826  131.733 1.00 74.24  ? 138  LEU B CD2   1 
ATOM   2813  N  N     . ASN B 1  139  ? -46.957 22.399  136.216 1.00 76.19  ? 139  ASN B N     1 
ATOM   2814  C  CA    . ASN B 1  139  ? -46.233 22.696  137.442 1.00 76.11  ? 139  ASN B CA    1 
ATOM   2815  C  C     . ASN B 1  139  ? -44.991 21.817  137.508 1.00 77.01  ? 139  ASN B C     1 
ATOM   2816  O  O     . ASN B 1  139  ? -45.093 20.596  137.637 1.00 71.16  ? 139  ASN B O     1 
ATOM   2817  C  CB    . ASN B 1  139  ? -47.124 22.451  138.662 1.00 81.28  ? 139  ASN B CB    1 
ATOM   2818  C  CG    . ASN B 1  139  ? -46.443 22.816  139.970 1.00 83.54  ? 139  ASN B CG    1 
ATOM   2819  O  OD1   . ASN B 1  139  ? -45.589 23.702  140.014 1.00 85.93  ? 139  ASN B OD1   1 
ATOM   2820  N  ND2   . ASN B 1  139  ? -46.821 22.131  141.045 1.00 71.79  ? 139  ASN B ND2   1 
ATOM   2821  N  N     . MET B 1  140  ? -43.820 22.440  137.418 1.00 75.13  ? 140  MET B N     1 
ATOM   2822  C  CA    . MET B 1  140  ? -42.570 21.690  137.360 1.00 71.92  ? 140  MET B CA    1 
ATOM   2823  C  C     . MET B 1  140  ? -41.423 22.326  138.139 1.00 61.59  ? 140  MET B C     1 
ATOM   2824  O  O     . MET B 1  140  ? -41.321 23.549  138.246 1.00 55.07  ? 140  MET B O     1 
ATOM   2825  C  CB    . MET B 1  140  ? -42.142 21.461  135.908 1.00 78.40  ? 140  MET B CB    1 
ATOM   2826  C  CG    . MET B 1  140  ? -41.854 22.738  135.134 1.00 78.90  ? 140  MET B CG    1 
ATOM   2827  S  SD    . MET B 1  140  ? -40.875 22.437  133.650 1.00 60.77  ? 140  MET B SD    1 
ATOM   2828  C  CE    . MET B 1  140  ? -41.869 21.187  132.843 1.00 66.09  ? 140  MET B CE    1 
ATOM   2829  N  N     . GLU B 1  141  ? -40.560 21.471  138.677 1.00 60.22  ? 141  GLU B N     1 
ATOM   2830  C  CA    . GLU B 1  141  ? -39.371 21.909  139.393 1.00 70.93  ? 141  GLU B CA    1 
ATOM   2831  C  C     . GLU B 1  141  ? -38.163 21.150  138.857 1.00 69.86  ? 141  GLU B C     1 
ATOM   2832  O  O     . GLU B 1  141  ? -38.106 19.922  138.945 1.00 66.64  ? 141  GLU B O     1 
ATOM   2833  C  CB    . GLU B 1  141  ? -39.527 21.651  140.894 1.00 81.34  ? 141  GLU B CB    1 
ATOM   2834  C  CG    . GLU B 1  141  ? -40.788 22.253  141.504 1.00 92.25  ? 141  GLU B CG    1 
ATOM   2835  C  CD    . GLU B 1  141  ? -41.020 21.808  142.936 1.00 87.91  ? 141  GLU B CD    1 
ATOM   2836  O  OE1   . GLU B 1  141  ? -40.070 21.282  143.557 1.00 87.65  ? 141  GLU B OE1   1 
ATOM   2837  O  OE2   . GLU B 1  141  ? -42.153 21.981  143.438 1.00 65.92  ? 141  GLU B OE2   1 
ATOM   2838  N  N     . VAL B 1  142  ? -37.202 21.879  138.296 1.00 60.73  ? 142  VAL B N     1 
ATOM   2839  C  CA    . VAL B 1  142  ? -36.018 21.248  137.718 1.00 60.40  ? 142  VAL B CA    1 
ATOM   2840  C  C     . VAL B 1  142  ? -34.760 21.509  138.550 1.00 57.35  ? 142  VAL B C     1 
ATOM   2841  O  O     . VAL B 1  142  ? -34.582 22.593  139.102 1.00 51.91  ? 142  VAL B O     1 
ATOM   2842  C  CB    . VAL B 1  142  ? -35.794 21.677  136.244 1.00 57.58  ? 142  VAL B CB    1 
ATOM   2843  C  CG1   . VAL B 1  142  ? -37.028 21.372  135.411 1.00 55.19  ? 142  VAL B CG1   1 
ATOM   2844  C  CG2   . VAL B 1  142  ? -35.446 23.153  136.149 1.00 50.31  ? 142  VAL B CG2   1 
ATOM   2845  N  N     . ARG B 1  143  ? -33.893 20.506  138.649 1.00 55.67  ? 143  ARG B N     1 
ATOM   2846  C  CA    . ARG B 1  143  ? -32.668 20.641  139.428 1.00 57.09  ? 143  ARG B CA    1 
ATOM   2847  C  C     . ARG B 1  143  ? -31.463 20.895  138.528 1.00 57.75  ? 143  ARG B C     1 
ATOM   2848  O  O     . ARG B 1  143  ? -31.033 20.016  137.782 1.00 60.21  ? 143  ARG B O     1 
ATOM   2849  C  CB    . ARG B 1  143  ? -32.430 19.402  140.298 1.00 53.54  ? 143  ARG B CB    1 
ATOM   2850  C  CG    . ARG B 1  143  ? -31.143 19.467  141.108 1.00 54.67  ? 143  ARG B CG    1 
ATOM   2851  C  CD    . ARG B 1  143  ? -30.999 18.287  142.060 1.00 57.56  ? 143  ARG B CD    1 
ATOM   2852  N  NE    . ARG B 1  143  ? -29.701 18.297  142.733 1.00 59.53  ? 143  ARG B NE    1 
ATOM   2853  C  CZ    . ARG B 1  143  ? -29.370 17.497  143.744 1.00 64.96  ? 143  ARG B CZ    1 
ATOM   2854  N  NH1   . ARG B 1  143  ? -30.244 16.616  144.214 1.00 65.65  ? 143  ARG B NH1   1 
ATOM   2855  N  NH2   . ARG B 1  143  ? -28.164 17.584  144.290 1.00 55.91  ? 143  ARG B NH2   1 
ATOM   2856  N  N     . VAL B 1  144  ? -30.923 22.106  138.609 1.00 53.10  ? 144  VAL B N     1 
ATOM   2857  C  CA    . VAL B 1  144  ? -29.755 22.486  137.828 1.00 47.44  ? 144  VAL B CA    1 
ATOM   2858  C  C     . VAL B 1  144  ? -28.492 22.394  138.675 1.00 53.09  ? 144  VAL B C     1 
ATOM   2859  O  O     . VAL B 1  144  ? -28.362 23.085  139.680 1.00 57.05  ? 144  VAL B O     1 
ATOM   2860  C  CB    . VAL B 1  144  ? -29.887 23.924  137.296 1.00 41.19  ? 144  VAL B CB    1 
ATOM   2861  C  CG1   . VAL B 1  144  ? -28.590 24.369  136.649 1.00 40.87  ? 144  VAL B CG1   1 
ATOM   2862  C  CG2   . VAL B 1  144  ? -31.044 24.024  136.320 1.00 41.54  ? 144  VAL B CG2   1 
ATOM   2863  N  N     . ASP B 1  145  ? -27.555 21.546  138.267 1.00 54.24  ? 145  ASP B N     1 
ATOM   2864  C  CA    . ASP B 1  145  ? -26.316 21.386  139.018 1.00 55.48  ? 145  ASP B CA    1 
ATOM   2865  C  C     . ASP B 1  145  ? -25.106 21.906  138.257 1.00 49.24  ? 145  ASP B C     1 
ATOM   2866  O  O     . ASP B 1  145  ? -25.223 22.416  137.144 1.00 47.20  ? 145  ASP B O     1 
ATOM   2867  C  CB    . ASP B 1  145  ? -26.099 19.920  139.400 1.00 58.66  ? 145  ASP B CB    1 
ATOM   2868  C  CG    . ASP B 1  145  ? -26.771 19.552  140.709 1.00 71.15  ? 145  ASP B CG    1 
ATOM   2869  O  OD1   . ASP B 1  145  ? -26.133 19.716  141.773 1.00 74.72  ? 145  ASP B OD1   1 
ATOM   2870  O  OD2   . ASP B 1  145  ? -27.933 19.096  140.675 1.00 68.36  ? 145  ASP B OD2   1 
ATOM   2871  N  N     . ARG B 1  146  ? -23.941 21.780  138.879 1.00 53.68  ? 146  ARG B N     1 
ATOM   2872  C  CA    . ARG B 1  146  ? -22.682 22.131  138.242 1.00 51.37  ? 146  ARG B CA    1 
ATOM   2873  C  C     . ARG B 1  146  ? -21.818 20.883  138.123 1.00 51.09  ? 146  ARG B C     1 
ATOM   2874  O  O     . ARG B 1  146  ? -21.624 20.153  139.096 1.00 45.61  ? 146  ARG B O     1 
ATOM   2875  C  CB    . ARG B 1  146  ? -21.952 23.209  139.044 1.00 54.18  ? 146  ARG B CB    1 
ATOM   2876  C  CG    . ARG B 1  146  ? -20.487 23.369  138.678 1.00 51.04  ? 146  ARG B CG    1 
ATOM   2877  C  CD    . ARG B 1  146  ? -19.831 24.439  139.525 1.00 52.19  ? 146  ARG B CD    1 
ATOM   2878  N  NE    . ARG B 1  146  ? -20.376 25.761  139.238 1.00 56.51  ? 146  ARG B NE    1 
ATOM   2879  C  CZ    . ARG B 1  146  ? -19.971 26.880  139.829 1.00 63.08  ? 146  ARG B CZ    1 
ATOM   2880  N  NH1   . ARG B 1  146  ? -19.016 26.838  140.748 1.00 71.64  ? 146  ARG B NH1   1 
ATOM   2881  N  NH2   . ARG B 1  146  ? -20.522 28.041  139.502 1.00 59.14  ? 146  ARG B NH2   1 
ATOM   2882  N  N     . GLY B 1  147  ? -21.309 20.638  136.921 1.00 49.52  ? 147  GLY B N     1 
ATOM   2883  C  CA    . GLY B 1  147  ? -20.490 19.471  136.666 1.00 45.81  ? 147  GLY B CA    1 
ATOM   2884  C  C     . GLY B 1  147  ? -19.702 19.609  135.381 1.00 48.05  ? 147  GLY B C     1 
ATOM   2885  O  O     . GLY B 1  147  ? -19.670 20.680  134.767 1.00 42.70  ? 147  GLY B O     1 
ATOM   2886  N  N     . VAL B 1  148  ? -19.060 18.520  134.973 1.00 44.11  ? 148  VAL B N     1 
ATOM   2887  C  CA    . VAL B 1  148  ? -18.247 18.524  133.765 1.00 39.54  ? 148  VAL B CA    1 
ATOM   2888  C  C     . VAL B 1  148  ? -18.649 17.390  132.829 1.00 43.99  ? 148  VAL B C     1 
ATOM   2889  O  O     . VAL B 1  148  ? -19.128 16.345  133.274 1.00 44.21  ? 148  VAL B O     1 
ATOM   2890  C  CB    . VAL B 1  148  ? -16.747 18.398  134.097 1.00 34.09  ? 148  VAL B CB    1 
ATOM   2891  C  CG1   . VAL B 1  148  ? -16.269 19.609  134.883 1.00 34.18  ? 148  VAL B CG1   1 
ATOM   2892  C  CG2   . VAL B 1  148  ? -16.479 17.117  134.871 1.00 37.38  ? 148  VAL B CG2   1 
ATOM   2893  N  N     . GLY B 1  149  ? -18.461 17.608  131.530 1.00 40.16  ? 149  GLY B N     1 
ATOM   2894  C  CA    . GLY B 1  149  ? -18.677 16.573  130.536 1.00 35.47  ? 149  GLY B CA    1 
ATOM   2895  C  C     . GLY B 1  149  ? -20.117 16.128  130.366 1.00 30.85  ? 149  GLY B C     1 
ATOM   2896  O  O     . GLY B 1  149  ? -21.030 16.949  130.296 1.00 32.81  ? 149  GLY B O     1 
ATOM   2897  N  N     . TYR B 1  150  ? -20.316 14.817  130.292 1.00 25.29  ? 150  TYR B N     1 
ATOM   2898  C  CA    . TYR B 1  150  ? -21.638 14.259  130.042 1.00 28.85  ? 150  TYR B CA    1 
ATOM   2899  C  C     . TYR B 1  150  ? -21.914 13.066  130.953 1.00 35.44  ? 150  TYR B C     1 
ATOM   2900  O  O     . TYR B 1  150  ? -21.159 12.093  130.968 1.00 37.48  ? 150  TYR B O     1 
ATOM   2901  C  CB    . TYR B 1  150  ? -21.749 13.845  128.574 1.00 31.89  ? 150  TYR B CB    1 
ATOM   2902  C  CG    . TYR B 1  150  ? -23.123 13.391  128.132 1.00 27.29  ? 150  TYR B CG    1 
ATOM   2903  C  CD1   . TYR B 1  150  ? -24.070 14.306  127.698 1.00 26.56  ? 150  TYR B CD1   1 
ATOM   2904  C  CD2   . TYR B 1  150  ? -23.463 12.044  128.123 1.00 26.25  ? 150  TYR B CD2   1 
ATOM   2905  C  CE1   . TYR B 1  150  ? -25.320 13.897  127.281 1.00 24.10  ? 150  TYR B CE1   1 
ATOM   2906  C  CE2   . TYR B 1  150  ? -24.713 11.626  127.708 1.00 24.05  ? 150  TYR B CE2   1 
ATOM   2907  C  CZ    . TYR B 1  150  ? -25.636 12.558  127.289 1.00 20.63  ? 150  TYR B CZ    1 
ATOM   2908  O  OH    . TYR B 1  150  ? -26.881 12.153  126.871 1.00 25.03  ? 150  TYR B OH    1 
ATOM   2909  N  N     . VAL B 1  151  ? -22.988 13.164  131.730 1.00 35.22  ? 151  VAL B N     1 
ATOM   2910  C  CA    . VAL B 1  151  ? -23.434 12.073  132.587 1.00 30.57  ? 151  VAL B CA    1 
ATOM   2911  C  C     . VAL B 1  151  ? -24.834 11.596  132.203 1.00 32.04  ? 151  VAL B C     1 
ATOM   2912  O  O     . VAL B 1  151  ? -25.796 12.362  132.296 1.00 33.32  ? 151  VAL B O     1 
ATOM   2913  C  CB    . VAL B 1  151  ? -23.427 12.483  134.069 1.00 33.71  ? 151  VAL B CB    1 
ATOM   2914  C  CG1   . VAL B 1  151  ? -23.960 11.353  134.932 1.00 35.65  ? 151  VAL B CG1   1 
ATOM   2915  C  CG2   . VAL B 1  151  ? -22.022 12.878  134.501 1.00 30.79  ? 151  VAL B CG2   1 
ATOM   2916  N  N     . PRO B 1  152  ? -24.949 10.332  131.762 1.00 31.50  ? 152  PRO B N     1 
ATOM   2917  C  CA    . PRO B 1  152  ? -26.241 9.723   131.424 1.00 37.41  ? 152  PRO B CA    1 
ATOM   2918  C  C     . PRO B 1  152  ? -27.219 9.803   132.590 1.00 43.37  ? 152  PRO B C     1 
ATOM   2919  O  O     . PRO B 1  152  ? -26.789 9.809   133.743 1.00 46.95  ? 152  PRO B O     1 
ATOM   2920  C  CB    . PRO B 1  152  ? -25.877 8.261   131.155 1.00 32.98  ? 152  PRO B CB    1 
ATOM   2921  C  CG    . PRO B 1  152  ? -24.467 8.305   130.717 1.00 32.35  ? 152  PRO B CG    1 
ATOM   2922  C  CD    . PRO B 1  152  ? -23.824 9.420   131.494 1.00 31.85  ? 152  PRO B CD    1 
ATOM   2923  N  N     . ALA B 1  153  ? -28.514 9.862   132.288 1.00 47.52  ? 153  ALA B N     1 
ATOM   2924  C  CA    . ALA B 1  153  ? -29.549 9.987   133.314 1.00 51.54  ? 153  ALA B CA    1 
ATOM   2925  C  C     . ALA B 1  153  ? -29.513 8.846   134.328 1.00 48.61  ? 153  ALA B C     1 
ATOM   2926  O  O     . ALA B 1  153  ? -29.640 9.066   135.532 1.00 43.15  ? 153  ALA B O     1 
ATOM   2927  C  CB    . ALA B 1  153  ? -30.926 10.066  132.667 1.00 54.70  ? 153  ALA B CB    1 
ATOM   2928  N  N     . GLU B 1  154  ? -29.337 7.630   133.825 1.00 53.05  ? 154  GLU B N     1 
ATOM   2929  C  CA    . GLU B 1  154  ? -29.390 6.435   134.655 1.00 47.84  ? 154  GLU B CA    1 
ATOM   2930  C  C     . GLU B 1  154  ? -28.208 6.329   135.618 1.00 47.41  ? 154  GLU B C     1 
ATOM   2931  O  O     . GLU B 1  154  ? -28.319 5.709   136.674 1.00 51.91  ? 154  GLU B O     1 
ATOM   2932  C  CB    . GLU B 1  154  ? -29.466 5.181   133.776 1.00 47.42  ? 154  GLU B CB    1 
ATOM   2933  C  CG    . GLU B 1  154  ? -30.693 5.116   132.865 1.00 61.32  ? 154  GLU B CG    1 
ATOM   2934  C  CD    . GLU B 1  154  ? -30.508 5.870   131.553 1.00 67.95  ? 154  GLU B CD    1 
ATOM   2935  O  OE1   . GLU B 1  154  ? -29.350 6.189   131.204 1.00 60.79  ? 154  GLU B OE1   1 
ATOM   2936  O  OE2   . GLU B 1  154  ? -31.522 6.142   130.871 1.00 63.75  ? 154  GLU B OE2   1 
ATOM   2937  N  N     . LYS B 1  155  ? -27.081 6.930   135.254 1.00 49.05  ? 155  LYS B N     1 
ATOM   2938  C  CA    . LYS B 1  155  ? -25.849 6.770   136.028 1.00 53.99  ? 155  LYS B CA    1 
ATOM   2939  C  C     . LYS B 1  155  ? -25.704 7.655   137.277 1.00 52.51  ? 155  LYS B C     1 
ATOM   2940  O  O     . LYS B 1  155  ? -25.185 7.198   138.294 1.00 61.49  ? 155  LYS B O     1 
ATOM   2941  C  CB    . LYS B 1  155  ? -24.619 6.862   135.118 1.00 52.29  ? 155  LYS B CB    1 
ATOM   2942  C  CG    . LYS B 1  155  ? -24.502 5.677   134.165 1.00 45.68  ? 155  LYS B CG    1 
ATOM   2943  C  CD    . LYS B 1  155  ? -23.355 5.835   133.183 1.00 59.58  ? 155  LYS B CD    1 
ATOM   2944  C  CE    . LYS B 1  155  ? -23.343 4.696   132.171 1.00 51.01  ? 155  LYS B CE    1 
ATOM   2945  N  NZ    . LYS B 1  155  ? -22.301 4.885   131.126 1.00 30.55  ? 155  LYS B NZ    1 
ATOM   2946  N  N     . HIS B 1  156  ? -26.139 8.911   137.205 1.00 50.38  ? 156  HIS B N     1 
ATOM   2947  C  CA    . HIS B 1  156  ? -26.117 9.774   138.390 1.00 50.87  ? 156  HIS B CA    1 
ATOM   2948  C  C     . HIS B 1  156  ? -27.319 9.506   139.305 1.00 59.60  ? 156  HIS B C     1 
ATOM   2949  O  O     . HIS B 1  156  ? -27.180 9.470   140.530 1.00 51.71  ? 156  HIS B O     1 
ATOM   2950  C  CB    . HIS B 1  156  ? -26.028 11.256  138.007 1.00 43.36  ? 156  HIS B CB    1 
ATOM   2951  C  CG    . HIS B 1  156  ? -27.289 11.813  137.424 1.00 46.43  ? 156  HIS B CG    1 
ATOM   2952  N  ND1   . HIS B 1  156  ? -27.703 11.533  136.140 1.00 50.33  ? 156  HIS B ND1   1 
ATOM   2953  C  CD2   . HIS B 1  156  ? -28.225 12.639  137.948 1.00 56.83  ? 156  HIS B CD2   1 
ATOM   2954  C  CE1   . HIS B 1  156  ? -28.841 12.160  135.899 1.00 50.51  ? 156  HIS B CE1   1 
ATOM   2955  N  NE2   . HIS B 1  156  ? -29.179 12.838  136.982 1.00 52.04  ? 156  HIS B NE2   1 
ATOM   2956  N  N     . GLY B 1  157  ? -28.489 9.329   138.692 1.00 66.60  ? 157  GLY B N     1 
ATOM   2957  C  CA    . GLY B 1  157  ? -29.700 8.897   139.375 1.00 59.75  ? 157  GLY B CA    1 
ATOM   2958  C  C     . GLY B 1  157  ? -30.087 9.637   140.642 1.00 63.42  ? 157  GLY B C     1 
ATOM   2959  O  O     . GLY B 1  157  ? -30.381 9.010   141.660 1.00 65.50  ? 157  GLY B O     1 
ATOM   2960  N  N     . ILE B 1  158  ? -30.092 10.965  140.589 1.00 60.87  ? 158  ILE B N     1 
ATOM   2961  C  CA    . ILE B 1  158  ? -30.392 11.760  141.778 1.00 68.85  ? 158  ILE B CA    1 
ATOM   2962  C  C     . ILE B 1  158  ? -31.887 12.038  141.952 1.00 67.81  ? 158  ILE B C     1 
ATOM   2963  O  O     . ILE B 1  158  ? -32.612 12.235  140.975 1.00 55.57  ? 158  ILE B O     1 
ATOM   2964  C  CB    . ILE B 1  158  ? -29.584 13.074  141.816 1.00 58.46  ? 158  ILE B CB    1 
ATOM   2965  C  CG1   . ILE B 1  158  ? -30.056 14.039  140.735 1.00 43.97  ? 158  ILE B CG1   1 
ATOM   2966  C  CG2   . ILE B 1  158  ? -28.094 12.789  141.668 1.00 55.40  ? 158  ILE B CG2   1 
ATOM   2967  C  CD1   . ILE B 1  158  ? -29.342 15.361  140.785 1.00 54.03  ? 158  ILE B CD1   1 
ATOM   2968  N  N     . LYS B 1  159  ? -32.336 12.040  143.206 1.00 71.63  ? 159  LYS B N     1 
ATOM   2969  C  CA    . LYS B 1  159  ? -33.751 12.207  143.524 1.00 64.83  ? 159  LYS B CA    1 
ATOM   2970  C  C     . LYS B 1  159  ? -34.002 13.225  144.634 1.00 71.74  ? 159  LYS B C     1 
ATOM   2971  O  O     . LYS B 1  159  ? -33.201 13.369  145.560 1.00 74.16  ? 159  LYS B O     1 
ATOM   2972  C  CB    . LYS B 1  159  ? -34.366 10.868  143.934 1.00 59.79  ? 159  LYS B CB    1 
ATOM   2973  C  CG    . LYS B 1  159  ? -34.487 9.852   142.817 1.00 55.78  ? 159  LYS B CG    1 
ATOM   2974  C  CD    . LYS B 1  159  ? -35.463 10.312  141.754 1.00 53.47  ? 159  LYS B CD    1 
ATOM   2975  C  CE    . LYS B 1  159  ? -35.786 9.179   140.796 1.00 53.73  ? 159  LYS B CE    1 
ATOM   2976  N  NZ    . LYS B 1  159  ? -36.549 8.096   141.471 1.00 50.58  ? 159  LYS B NZ    1 
ATOM   2977  N  N     . ASP B 1  160  ? -35.125 13.926  144.523 1.00 72.11  ? 160  ASP B N     1 
ATOM   2978  C  CA    . ASP B 1  160  ? -35.622 14.795  145.584 1.00 68.20  ? 160  ASP B CA    1 
ATOM   2979  C  C     . ASP B 1  160  ? -36.950 14.233  146.074 1.00 62.17  ? 160  ASP B C     1 
ATOM   2980  O  O     . ASP B 1  160  ? -37.089 13.863  147.239 1.00 65.01  ? 160  ASP B O     1 
ATOM   2981  C  CB    . ASP B 1  160  ? -35.802 16.228  145.082 1.00 68.02  ? 160  ASP B CB    1 
ATOM   2982  C  CG    . ASP B 1  160  ? -34.487 16.883  144.703 1.00 80.79  ? 160  ASP B CG    1 
ATOM   2983  O  OD1   . ASP B 1  160  ? -33.440 16.493  145.266 1.00 80.12  ? 160  ASP B OD1   1 
ATOM   2984  O  OD2   . ASP B 1  160  ? -34.502 17.791  143.844 1.00 82.75  ? 160  ASP B OD2   1 
ATOM   2985  N  N     . ARG B 1  161  ? -37.928 14.191  145.175 1.00 62.13  ? 161  ARG B N     1 
ATOM   2986  C  CA    . ARG B 1  161  ? -39.202 13.535  145.442 1.00 60.59  ? 161  ARG B CA    1 
ATOM   2987  C  C     . ARG B 1  161  ? -39.187 12.112  144.895 1.00 58.99  ? 161  ARG B C     1 
ATOM   2988  O  O     . ARG B 1  161  ? -38.160 11.634  144.417 1.00 62.29  ? 161  ARG B O     1 
ATOM   2989  C  CB    . ARG B 1  161  ? -40.348 14.317  144.804 1.00 56.89  ? 161  ARG B CB    1 
ATOM   2990  C  CG    . ARG B 1  161  ? -40.501 15.721  145.345 1.00 59.09  ? 161  ARG B CG    1 
ATOM   2991  C  CD    . ARG B 1  161  ? -41.680 16.432  144.711 1.00 63.09  ? 161  ARG B CD    1 
ATOM   2992  N  NE    . ARG B 1  161  ? -41.899 17.741  145.315 1.00 60.38  ? 161  ARG B NE    1 
ATOM   2993  C  CZ    . ARG B 1  161  ? -41.211 18.833  144.997 1.00 76.21  ? 161  ARG B CZ    1 
ATOM   2994  N  NH1   . ARG B 1  161  ? -41.476 19.984  145.600 1.00 80.75  ? 161  ARG B NH1   1 
ATOM   2995  N  NH2   . ARG B 1  161  ? -40.254 18.774  144.079 1.00 72.69  ? 161  ARG B NH2   1 
ATOM   2996  N  N     . ILE B 1  162  ? -40.325 11.434  144.979 1.00 54.10  ? 162  ILE B N     1 
ATOM   2997  C  CA    . ILE B 1  162  ? -40.465 10.112  144.383 1.00 54.67  ? 162  ILE B CA    1 
ATOM   2998  C  C     . ILE B 1  162  ? -40.730 10.239  142.890 1.00 65.10  ? 162  ILE B C     1 
ATOM   2999  O  O     . ILE B 1  162  ? -40.204 9.473   142.082 1.00 66.50  ? 162  ILE B O     1 
ATOM   3000  C  CB    . ILE B 1  162  ? -41.612 9.316   145.029 1.00 54.95  ? 162  ILE B CB    1 
ATOM   3001  C  CG1   . ILE B 1  162  ? -41.320 9.072   146.509 1.00 54.01  ? 162  ILE B CG1   1 
ATOM   3002  C  CG2   . ILE B 1  162  ? -41.823 7.993   144.306 1.00 47.81  ? 162  ILE B CG2   1 
ATOM   3003  C  CD1   . ILE B 1  162  ? -42.379 8.251   147.214 1.00 49.44  ? 162  ILE B CD1   1 
ATOM   3004  N  N     . ASN B 1  163  ? -41.539 11.230  142.532 1.00 70.31  ? 163  ASN B N     1 
ATOM   3005  C  CA    . ASN B 1  163  ? -41.975 11.404  141.152 1.00 71.67  ? 163  ASN B CA    1 
ATOM   3006  C  C     . ASN B 1  163  ? -40.986 12.191  140.302 1.00 69.35  ? 163  ASN B C     1 
ATOM   3007  O  O     . ASN B 1  163  ? -41.237 12.449  139.124 1.00 66.27  ? 163  ASN B O     1 
ATOM   3008  C  CB    . ASN B 1  163  ? -43.353 12.062  141.111 1.00 72.53  ? 163  ASN B CB    1 
ATOM   3009  C  CG    . ASN B 1  163  ? -44.390 11.276  141.882 1.00 72.23  ? 163  ASN B CG    1 
ATOM   3010  O  OD1   . ASN B 1  163  ? -44.920 10.280  141.391 1.00 68.18  ? 163  ASN B OD1   1 
ATOM   3011  N  ND2   . ASN B 1  163  ? -44.681 11.717  143.101 1.00 76.57  ? 163  ASN B ND2   1 
ATOM   3012  N  N     . ALA B 1  164  ? -39.867 12.577  140.906 1.00 65.99  ? 164  ALA B N     1 
ATOM   3013  C  CA    . ALA B 1  164  ? -38.806 13.255  140.174 1.00 67.62  ? 164  ALA B CA    1 
ATOM   3014  C  C     . ALA B 1  164  ? -38.155 12.296  139.181 1.00 69.52  ? 164  ALA B C     1 
ATOM   3015  O  O     . ALA B 1  164  ? -37.824 11.164  139.530 1.00 67.53  ? 164  ALA B O     1 
ATOM   3016  C  CB    . ALA B 1  164  ? -37.768 13.815  141.137 1.00 59.98  ? 164  ALA B CB    1 
ATOM   3017  N  N     . ILE B 1  165  ? -37.997 12.743  137.939 1.00 67.17  ? 165  ILE B N     1 
ATOM   3018  C  CA    . ILE B 1  165  ? -37.315 11.953  136.915 1.00 64.74  ? 165  ILE B CA    1 
ATOM   3019  C  C     . ILE B 1  165  ? -35.938 12.521  136.570 1.00 65.70  ? 165  ILE B C     1 
ATOM   3020  O  O     . ILE B 1  165  ? -35.813 13.702  136.241 1.00 61.96  ? 165  ILE B O     1 
ATOM   3021  C  CB    . ILE B 1  165  ? -38.159 11.819  135.634 1.00 55.92  ? 165  ILE B CB    1 
ATOM   3022  C  CG1   . ILE B 1  165  ? -38.887 13.131  135.336 1.00 59.36  ? 165  ILE B CG1   1 
ATOM   3023  C  CG2   . ILE B 1  165  ? -39.156 10.682  135.773 1.00 64.38  ? 165  ILE B CG2   1 
ATOM   3024  C  CD1   . ILE B 1  165  ? -39.842 13.049  134.167 1.00 68.71  ? 165  ILE B CD1   1 
ATOM   3025  N  N     . PRO B 1  166  ? -34.895 11.679  136.659 1.00 64.68  ? 166  PRO B N     1 
ATOM   3026  C  CA    . PRO B 1  166  ? -33.529 12.098  136.327 1.00 60.93  ? 166  PRO B CA    1 
ATOM   3027  C  C     . PRO B 1  166  ? -33.350 12.332  134.827 1.00 62.84  ? 166  PRO B C     1 
ATOM   3028  O  O     . PRO B 1  166  ? -33.860 11.563  134.010 1.00 61.27  ? 166  PRO B O     1 
ATOM   3029  C  CB    . PRO B 1  166  ? -32.681 10.910  136.789 1.00 55.59  ? 166  PRO B CB    1 
ATOM   3030  C  CG    . PRO B 1  166  ? -33.601 9.742   136.709 1.00 50.87  ? 166  PRO B CG    1 
ATOM   3031  C  CD    . PRO B 1  166  ? -34.956 10.268  137.079 1.00 57.32  ? 166  PRO B CD    1 
ATOM   3032  N  N     . VAL B 1  167  ? -32.625 13.390  134.477 1.00 58.98  ? 167  VAL B N     1 
ATOM   3033  C  CA    . VAL B 1  167  ? -32.399 13.748  133.082 1.00 54.94  ? 167  VAL B CA    1 
ATOM   3034  C  C     . VAL B 1  167  ? -30.926 13.565  132.743 1.00 53.87  ? 167  VAL B C     1 
ATOM   3035  O  O     . VAL B 1  167  ? -30.064 13.812  133.586 1.00 53.82  ? 167  VAL B O     1 
ATOM   3036  C  CB    . VAL B 1  167  ? -32.799 15.214  132.818 1.00 48.31  ? 167  VAL B CB    1 
ATOM   3037  C  CG1   . VAL B 1  167  ? -32.746 15.527  131.336 1.00 46.43  ? 167  VAL B CG1   1 
ATOM   3038  C  CG2   . VAL B 1  167  ? -34.187 15.484  133.360 1.00 56.32  ? 167  VAL B CG2   1 
ATOM   3039  N  N     . ASP B 1  168  ? -30.636 13.119  131.522 1.00 56.07  ? 168  ASP B N     1 
ATOM   3040  C  CA    . ASP B 1  168  ? -29.255 12.993  131.077 1.00 39.22  ? 168  ASP B CA    1 
ATOM   3041  C  C     . ASP B 1  168  ? -28.644 14.385  131.130 1.00 36.36  ? 168  ASP B C     1 
ATOM   3042  O  O     . ASP B 1  168  ? -29.153 15.318  130.513 1.00 38.30  ? 168  ASP B O     1 
ATOM   3043  C  CB    . ASP B 1  168  ? -29.201 12.444  129.650 1.00 39.54  ? 168  ASP B CB    1 
ATOM   3044  C  CG    . ASP B 1  168  ? -30.126 11.252  129.441 1.00 49.98  ? 168  ASP B CG    1 
ATOM   3045  O  OD1   . ASP B 1  168  ? -31.305 11.468  129.083 1.00 52.10  ? 168  ASP B OD1   1 
ATOM   3046  O  OD2   . ASP B 1  168  ? -29.675 10.100  129.626 1.00 47.45  ? 168  ASP B OD2   1 
ATOM   3047  N  N     . ALA B 1  169  ? -27.551 14.527  131.868 1.00 33.01  ? 169  ALA B N     1 
ATOM   3048  C  CA    . ALA B 1  169  ? -27.021 15.851  132.167 1.00 35.34  ? 169  ALA B CA    1 
ATOM   3049  C  C     . ALA B 1  169  ? -25.927 16.255  131.197 1.00 35.42  ? 169  ALA B C     1 
ATOM   3050  O  O     . ALA B 1  169  ? -24.877 15.619  131.149 1.00 41.58  ? 169  ALA B O     1 
ATOM   3051  C  CB    . ALA B 1  169  ? -26.499 15.899  133.592 1.00 37.29  ? 169  ALA B CB    1 
ATOM   3052  N  N     . VAL B 1  170  ? -26.160 17.317  130.431 1.00 32.77  ? 170  VAL B N     1 
ATOM   3053  C  CA    . VAL B 1  170  ? -25.117 17.802  129.545 1.00 26.69  ? 170  VAL B CA    1 
ATOM   3054  C  C     . VAL B 1  170  ? -24.483 19.012  130.194 1.00 29.46  ? 170  VAL B C     1 
ATOM   3055  O  O     . VAL B 1  170  ? -25.003 20.125  130.108 1.00 32.21  ? 170  VAL B O     1 
ATOM   3056  C  CB    . VAL B 1  170  ? -25.709 18.253  128.204 1.00 29.62  ? 170  VAL B CB    1 
ATOM   3057  C  CG1   . VAL B 1  170  ? -24.599 18.615  127.230 1.00 40.49  ? 170  VAL B CG1   1 
ATOM   3058  C  CG2   . VAL B 1  170  ? -26.610 17.169  127.628 1.00 34.63  ? 170  VAL B CG2   1 
ATOM   3059  N  N     . PHE B 1  171  ? -23.320 18.794  130.797 1.00 33.01  ? 171  PHE B N     1 
ATOM   3060  C  CA    . PHE B 1  171  ? -22.632 19.852  131.519 1.00 39.94  ? 171  PHE B CA    1 
ATOM   3061  C  C     . PHE B 1  171  ? -21.802 20.702  130.584 1.00 40.89  ? 171  PHE B C     1 
ATOM   3062  O  O     . PHE B 1  171  ? -21.805 21.930  130.675 1.00 44.24  ? 171  PHE B O     1 
ATOM   3063  C  CB    . PHE B 1  171  ? -21.757 19.272  132.632 1.00 38.73  ? 171  PHE B CB    1 
ATOM   3064  C  CG    . PHE B 1  171  ? -22.540 18.665  133.757 1.00 40.10  ? 171  PHE B CG    1 
ATOM   3065  C  CD1   . PHE B 1  171  ? -23.299 19.463  134.596 1.00 36.45  ? 171  PHE B CD1   1 
ATOM   3066  C  CD2   . PHE B 1  171  ? -22.520 17.298  133.976 1.00 38.18  ? 171  PHE B CD2   1 
ATOM   3067  C  CE1   . PHE B 1  171  ? -24.024 18.910  135.630 1.00 43.73  ? 171  PHE B CE1   1 
ATOM   3068  C  CE2   . PHE B 1  171  ? -23.244 16.738  135.011 1.00 41.05  ? 171  PHE B CE2   1 
ATOM   3069  C  CZ    . PHE B 1  171  ? -23.997 17.545  135.839 1.00 40.73  ? 171  PHE B CZ    1 
ATOM   3070  N  N     . SER B 1  172  ? -21.108 20.026  129.674 1.00 40.29  ? 172  SER B N     1 
ATOM   3071  C  CA    . SER B 1  172  ? -20.128 20.670  128.820 1.00 38.86  ? 172  SER B CA    1 
ATOM   3072  C  C     . SER B 1  172  ? -20.777 21.795  128.035 1.00 41.90  ? 172  SER B C     1 
ATOM   3073  O  O     . SER B 1  172  ? -21.691 21.562  127.243 1.00 44.08  ? 172  SER B O     1 
ATOM   3074  C  CB    . SER B 1  172  ? -19.501 19.648  127.870 1.00 38.19  ? 172  SER B CB    1 
ATOM   3075  O  OG    . SER B 1  172  ? -18.452 20.227  127.114 1.00 38.50  ? 172  SER B OG    1 
ATOM   3076  N  N     . PRO B 1  173  ? -20.314 23.030  128.272 1.00 40.29  ? 173  PRO B N     1 
ATOM   3077  C  CA    . PRO B 1  173  ? -20.798 24.185  127.517 1.00 45.32  ? 173  PRO B CA    1 
ATOM   3078  C  C     . PRO B 1  173  ? -20.333 24.081  126.076 1.00 44.58  ? 173  PRO B C     1 
ATOM   3079  O  O     . PRO B 1  173  ? -20.958 24.649  125.184 1.00 49.97  ? 173  PRO B O     1 
ATOM   3080  C  CB    . PRO B 1  173  ? -20.118 25.364  128.211 1.00 49.00  ? 173  PRO B CB    1 
ATOM   3081  C  CG    . PRO B 1  173  ? -18.914 24.791  128.831 1.00 40.31  ? 173  PRO B CG    1 
ATOM   3082  C  CD    . PRO B 1  173  ? -19.281 23.404  129.251 1.00 33.86  ? 173  PRO B CD    1 
ATOM   3083  N  N     . VAL B 1  174  ? -19.250 23.341  125.856 1.00 39.96  ? 174  VAL B N     1 
ATOM   3084  C  CA    . VAL B 1  174  ? -18.759 23.094  124.511 1.00 38.86  ? 174  VAL B CA    1 
ATOM   3085  C  C     . VAL B 1  174  ? -19.664 22.077  123.828 1.00 37.72  ? 174  VAL B C     1 
ATOM   3086  O  O     . VAL B 1  174  ? -19.818 20.952  124.305 1.00 40.19  ? 174  VAL B O     1 
ATOM   3087  C  CB    . VAL B 1  174  ? -17.321 22.547  124.545 1.00 32.34  ? 174  VAL B CB    1 
ATOM   3088  C  CG1   . VAL B 1  174  ? -16.943 21.958  123.202 1.00 31.30  ? 174  VAL B CG1   1 
ATOM   3089  C  CG2   . VAL B 1  174  ? -16.345 23.641  124.955 1.00 30.64  ? 174  VAL B CG2   1 
ATOM   3090  N  N     . ARG B 1  175  ? -20.275 22.483  122.718 1.00 33.44  ? 175  ARG B N     1 
ATOM   3091  C  CA    . ARG B 1  175  ? -21.132 21.588  121.951 1.00 32.00  ? 175  ARG B CA    1 
ATOM   3092  C  C     . ARG B 1  175  ? -20.296 20.704  121.030 1.00 40.30  ? 175  ARG B C     1 
ATOM   3093  O  O     . ARG B 1  175  ? -20.580 19.515  120.870 1.00 38.91  ? 175  ARG B O     1 
ATOM   3094  C  CB    . ARG B 1  175  ? -22.168 22.369  121.135 1.00 34.32  ? 175  ARG B CB    1 
ATOM   3095  C  CG    . ARG B 1  175  ? -22.814 23.540  121.865 1.00 43.28  ? 175  ARG B CG    1 
ATOM   3096  C  CD    . ARG B 1  175  ? -23.475 23.119  123.170 1.00 53.37  ? 175  ARG B CD    1 
ATOM   3097  N  NE    . ARG B 1  175  ? -24.711 22.370  122.968 1.00 68.67  ? 175  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B 1  175  ? -25.479 21.921  123.957 1.00 68.07  ? 175  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B 1  175  ? -25.134 22.147  125.219 1.00 43.61  ? 175  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B 1  175  ? -26.589 21.246  123.686 1.00 65.90  ? 175  ARG B NH2   1 
ATOM   3101  N  N     . ARG B 1  176  ? -19.274 21.286  120.406 1.00 35.49  ? 176  ARG B N     1 
ATOM   3102  C  CA    . ARG B 1  176  ? -18.481 20.515  119.447 1.00 27.87  ? 176  ARG B CA    1 
ATOM   3103  C  C     . ARG B 1  176  ? -17.048 21.027  119.279 1.00 27.96  ? 176  ARG B C     1 
ATOM   3104  O  O     . ARG B 1  176  ? -16.793 22.219  119.389 1.00 28.73  ? 176  ARG B O     1 
ATOM   3105  C  CB    . ARG B 1  176  ? -19.206 20.484  118.098 1.00 32.28  ? 176  ARG B CB    1 
ATOM   3106  C  CG    . ARG B 1  176  ? -18.476 19.767  116.977 1.00 28.35  ? 176  ARG B CG    1 
ATOM   3107  C  CD    . ARG B 1  176  ? -19.221 19.964  115.675 1.00 29.28  ? 176  ARG B CD    1 
ATOM   3108  N  NE    . ARG B 1  176  ? -18.392 19.675  114.512 1.00 33.47  ? 176  ARG B NE    1 
ATOM   3109  C  CZ    . ARG B 1  176  ? -18.793 19.848  113.258 1.00 33.23  ? 176  ARG B CZ    1 
ATOM   3110  N  NH1   . ARG B 1  176  ? -17.976 19.560  112.251 1.00 39.67  ? 176  ARG B NH1   1 
ATOM   3111  N  NH2   . ARG B 1  176  ? -20.013 20.310  113.012 1.00 18.40  ? 176  ARG B NH2   1 
ATOM   3112  N  N     . VAL B 1  177  ? -16.115 20.119  119.011 1.00 26.74  ? 177  VAL B N     1 
ATOM   3113  C  CA    . VAL B 1  177  ? -14.744 20.507  118.696 1.00 24.26  ? 177  VAL B CA    1 
ATOM   3114  C  C     . VAL B 1  177  ? -14.246 19.747  117.476 1.00 28.81  ? 177  VAL B C     1 
ATOM   3115  O  O     . VAL B 1  177  ? -14.351 18.523  117.412 1.00 39.80  ? 177  VAL B O     1 
ATOM   3116  C  CB    . VAL B 1  177  ? -13.778 20.233  119.863 1.00 31.08  ? 177  VAL B CB    1 
ATOM   3117  C  CG1   . VAL B 1  177  ? -12.360 20.597  119.465 1.00 32.51  ? 177  VAL B CG1   1 
ATOM   3118  C  CG2   . VAL B 1  177  ? -14.187 21.010  121.097 1.00 31.14  ? 177  VAL B CG2   1 
ATOM   3119  N  N     . ALA B 1  178  ? -13.710 20.473  116.503 1.00 30.94  ? 178  ALA B N     1 
ATOM   3120  C  CA    . ALA B 1  178  ? -13.156 19.839  115.314 1.00 28.20  ? 178  ALA B CA    1 
ATOM   3121  C  C     . ALA B 1  178  ? -11.843 20.501  114.939 1.00 28.77  ? 178  ALA B C     1 
ATOM   3122  O  O     . ALA B 1  178  ? -11.795 21.710  114.762 1.00 36.29  ? 178  ALA B O     1 
ATOM   3123  C  CB    . ALA B 1  178  ? -14.140 19.929  114.163 1.00 32.45  ? 178  ALA B CB    1 
ATOM   3124  N  N     . PHE B 1  179  ? -10.778 19.717  114.818 1.00 30.75  ? 179  PHE B N     1 
ATOM   3125  C  CA    . PHE B 1  179  ? -9.486  20.284  114.438 1.00 34.07  ? 179  PHE B CA    1 
ATOM   3126  C  C     . PHE B 1  179  ? -8.879  19.626  113.203 1.00 35.89  ? 179  PHE B C     1 
ATOM   3127  O  O     . PHE B 1  179  ? -8.878  18.401  113.067 1.00 36.27  ? 179  PHE B O     1 
ATOM   3128  C  CB    . PHE B 1  179  ? -8.495  20.259  115.610 1.00 37.04  ? 179  PHE B CB    1 
ATOM   3129  C  CG    . PHE B 1  179  ? -7.852  18.920  115.846 1.00 35.15  ? 179  PHE B CG    1 
ATOM   3130  C  CD1   . PHE B 1  179  ? -6.564  18.670  115.401 1.00 30.75  ? 179  PHE B CD1   1 
ATOM   3131  C  CD2   . PHE B 1  179  ? -8.530  17.919  116.522 1.00 28.80  ? 179  PHE B CD2   1 
ATOM   3132  C  CE1   . PHE B 1  179  ? -5.967  17.443  115.621 1.00 30.90  ? 179  PHE B CE1   1 
ATOM   3133  C  CE2   . PHE B 1  179  ? -7.939  16.691  116.745 1.00 26.88  ? 179  PHE B CE2   1 
ATOM   3134  C  CZ    . PHE B 1  179  ? -6.656  16.452  116.293 1.00 32.17  ? 179  PHE B CZ    1 
ATOM   3135  N  N     . GLN B 1  180  ? -8.367  20.460  112.304 1.00 37.94  ? 180  GLN B N     1 
ATOM   3136  C  CA    . GLN B 1  180  ? -7.709  19.990  111.095 1.00 40.98  ? 180  GLN B CA    1 
ATOM   3137  C  C     . GLN B 1  180  ? -6.269  20.499  111.052 1.00 40.91  ? 180  GLN B C     1 
ATOM   3138  O  O     . GLN B 1  180  ? -6.008  21.693  111.246 1.00 37.49  ? 180  GLN B O     1 
ATOM   3139  C  CB    . GLN B 1  180  ? -8.476  20.455  109.855 1.00 42.87  ? 180  GLN B CB    1 
ATOM   3140  C  CG    . GLN B 1  180  ? -8.405  19.494  108.676 1.00 55.14  ? 180  GLN B CG    1 
ATOM   3141  C  CD    . GLN B 1  180  ? -9.168  19.999  107.462 1.00 69.60  ? 180  GLN B CD    1 
ATOM   3142  O  OE1   . GLN B 1  180  ? -8.940  21.115  106.992 1.00 73.84  ? 180  GLN B OE1   1 
ATOM   3143  N  NE2   . GLN B 1  180  ? -10.086 19.181  106.952 1.00 46.79  ? 180  GLN B NE2   1 
ATOM   3144  N  N     . VAL B 1  181  ? -5.337  19.581  110.817 1.00 43.73  ? 181  VAL B N     1 
ATOM   3145  C  CA    . VAL B 1  181  ? -3.928  19.927  110.677 1.00 40.37  ? 181  VAL B CA    1 
ATOM   3146  C  C     . VAL B 1  181  ? -3.510  19.798  109.222 1.00 40.73  ? 181  VAL B C     1 
ATOM   3147  O  O     . VAL B 1  181  ? -3.739  18.765  108.595 1.00 39.03  ? 181  VAL B O     1 
ATOM   3148  C  CB    . VAL B 1  181  ? -3.033  19.008  111.520 1.00 30.27  ? 181  VAL B CB    1 
ATOM   3149  C  CG1   . VAL B 1  181  ? -1.571  19.390  111.345 1.00 31.49  ? 181  VAL B CG1   1 
ATOM   3150  C  CG2   . VAL B 1  181  ? -3.434  19.080  112.979 1.00 42.66  ? 181  VAL B CG2   1 
ATOM   3151  N  N     . GLU B 1  182  ? -2.901  20.846  108.680 1.00 42.14  ? 182  GLU B N     1 
ATOM   3152  C  CA    . GLU B 1  182  ? -2.449  20.784  107.293 1.00 43.71  ? 182  GLU B CA    1 
ATOM   3153  C  C     . GLU B 1  182  ? -1.004  21.239  107.136 1.00 46.00  ? 182  GLU B C     1 
ATOM   3154  O  O     . GLU B 1  182  ? -0.571  22.200  107.771 1.00 50.05  ? 182  GLU B O     1 
ATOM   3155  C  CB    . GLU B 1  182  ? -3.391  21.559  106.364 1.00 46.85  ? 182  GLU B CB    1 
ATOM   3156  C  CG    . GLU B 1  182  ? -3.778  22.945  106.850 1.00 54.05  ? 182  GLU B CG    1 
ATOM   3157  C  CD    . GLU B 1  182  ? -5.009  23.484  106.142 1.00 64.33  ? 182  GLU B CD    1 
ATOM   3158  O  OE1   . GLU B 1  182  ? -5.725  22.685  105.501 1.00 71.49  ? 182  GLU B OE1   1 
ATOM   3159  O  OE2   . GLU B 1  182  ? -5.263  24.705  106.227 1.00 68.63  ? 182  GLU B OE2   1 
ATOM   3160  N  N     . ASP B 1  183  ? -0.259  20.528  106.295 1.00 50.69  ? 183  ASP B N     1 
ATOM   3161  C  CA    . ASP B 1  183  ? 1.161   20.798  106.115 1.00 54.03  ? 183  ASP B CA    1 
ATOM   3162  C  C     . ASP B 1  183  ? 1.407   22.202  105.578 1.00 49.63  ? 183  ASP B C     1 
ATOM   3163  O  O     . ASP B 1  183  ? 0.603   22.738  104.816 1.00 44.66  ? 183  ASP B O     1 
ATOM   3164  C  CB    . ASP B 1  183  ? 1.804   19.746  105.208 1.00 60.93  ? 183  ASP B CB    1 
ATOM   3165  C  CG    . ASP B 1  183  ? 1.879   18.377  105.865 1.00 71.94  ? 183  ASP B CG    1 
ATOM   3166  O  OD1   . ASP B 1  183  ? 2.865   17.649  105.618 1.00 75.71  ? 183  ASP B OD1   1 
ATOM   3167  O  OD2   . ASP B 1  183  ? 0.955   18.030  106.632 1.00 65.69  ? 183  ASP B OD2   1 
ATOM   3168  N  N     . THR B 1  184  ? 2.519   22.797  105.995 1.00 50.15  ? 184  THR B N     1 
ATOM   3169  C  CA    . THR B 1  184  ? 2.847   24.159  105.600 1.00 52.65  ? 184  THR B CA    1 
ATOM   3170  C  C     . THR B 1  184  ? 4.358   24.361  105.523 1.00 58.49  ? 184  THR B C     1 
ATOM   3171  O  O     . THR B 1  184  ? 5.133   23.569  106.074 1.00 58.81  ? 184  THR B O     1 
ATOM   3172  C  CB    . THR B 1  184  ? 2.235   25.185  106.569 1.00 47.65  ? 184  THR B CB    1 
ATOM   3173  O  OG1   . THR B 1  184  ? 2.296   26.493  105.988 1.00 62.10  ? 184  THR B OG1   1 
ATOM   3174  C  CG2   . THR B 1  184  ? 2.979   25.178  107.896 1.00 42.72  ? 184  THR B CG2   1 
ATOM   3175  N  N     . ARG B 1  185  ? 4.767   25.426  104.837 1.00 64.45  ? 185  ARG B N     1 
ATOM   3176  C  CA    . ARG B 1  185  ? 6.180   25.684  104.573 1.00 69.62  ? 185  ARG B CA    1 
ATOM   3177  C  C     . ARG B 1  185  ? 6.676   27.012  105.141 1.00 66.50  ? 185  ARG B C     1 
ATOM   3178  O  O     . ARG B 1  185  ? 6.055   28.057  104.946 1.00 67.83  ? 185  ARG B O     1 
ATOM   3179  C  CB    . ARG B 1  185  ? 6.459   25.643  103.066 1.00 78.84  ? 185  ARG B CB    1 
ATOM   3180  C  CG    . ARG B 1  185  ? 7.926   25.860  102.698 1.00 81.65  ? 185  ARG B CG    1 
ATOM   3181  C  CD    . ARG B 1  185  ? 8.149   25.891  101.187 1.00 84.68  ? 185  ARG B CD    1 
ATOM   3182  N  NE    . ARG B 1  185  ? 7.846   27.192  100.593 1.00 77.95  ? 185  ARG B NE    1 
ATOM   3183  C  CZ    . ARG B 1  185  ? 6.682   27.511  100.033 1.00 74.99  ? 185  ARG B CZ    1 
ATOM   3184  N  NH1   . ARG B 1  185  ? 6.502   28.720  99.516  1.00 65.14  ? 185  ARG B NH1   1 
ATOM   3185  N  NH2   . ARG B 1  185  ? 5.698   26.623  99.987  1.00 61.20  ? 185  ARG B NH2   1 
ATOM   3186  N  N     . LEU B 1  186  ? 7.802   26.956  105.844 1.00 63.26  ? 186  LEU B N     1 
ATOM   3187  C  CA    . LEU B 1  186  ? 8.520   28.155  106.249 1.00 69.45  ? 186  LEU B CA    1 
ATOM   3188  C  C     . LEU B 1  186  ? 9.965   28.009  105.784 1.00 76.03  ? 186  LEU B C     1 
ATOM   3189  O  O     . LEU B 1  186  ? 10.694  27.137  106.259 1.00 70.37  ? 186  LEU B O     1 
ATOM   3190  C  CB    . LEU B 1  186  ? 8.446   28.351  107.768 1.00 68.42  ? 186  LEU B CB    1 
ATOM   3191  C  CG    . LEU B 1  186  ? 8.921   29.680  108.374 1.00 66.02  ? 186  LEU B CG    1 
ATOM   3192  C  CD1   . LEU B 1  186  ? 10.400  29.642  108.755 1.00 51.14  ? 186  LEU B CD1   1 
ATOM   3193  C  CD2   . LEU B 1  186  ? 8.638   30.842  107.427 1.00 65.66  ? 186  LEU B CD2   1 
ATOM   3194  N  N     . GLY B 1  187  ? 10.371  28.865  104.852 1.00 77.49  ? 187  GLY B N     1 
ATOM   3195  C  CA    . GLY B 1  187  ? 11.679  28.754  104.235 1.00 75.38  ? 187  GLY B CA    1 
ATOM   3196  C  C     . GLY B 1  187  ? 11.777  27.535  103.335 1.00 80.95  ? 187  GLY B C     1 
ATOM   3197  O  O     . GLY B 1  187  ? 10.933  27.328  102.462 1.00 77.16  ? 187  GLY B O     1 
ATOM   3198  N  N     . GLN B 1  188  ? 12.809  26.726  103.551 1.00 87.28  ? 188  GLN B N     1 
ATOM   3199  C  CA    . GLN B 1  188  ? 13.039  25.534  102.739 1.00 96.21  ? 188  GLN B CA    1 
ATOM   3200  C  C     . GLN B 1  188  ? 12.417  24.284  103.373 1.00 100.29 ? 188  GLN B C     1 
ATOM   3201  O  O     . GLN B 1  188  ? 12.577  23.172  102.866 1.00 95.41  ? 188  GLN B O     1 
ATOM   3202  C  CB    . GLN B 1  188  ? 14.539  25.332  102.504 1.00 101.30 ? 188  GLN B CB    1 
ATOM   3203  C  CG    . GLN B 1  188  ? 14.877  24.496  101.276 1.00 111.64 ? 188  GLN B CG    1 
ATOM   3204  C  CD    . GLN B 1  188  ? 16.370  24.295  101.098 1.00 121.01 ? 188  GLN B CD    1 
ATOM   3205  O  OE1   . GLN B 1  188  ? 17.178  25.054  101.633 1.00 117.63 ? 188  GLN B OE1   1 
ATOM   3206  N  NE2   . GLN B 1  188  ? 16.742  23.265  100.345 1.00 118.70 ? 188  GLN B NE2   1 
ATOM   3207  N  N     . ARG B 1  189  ? 11.708  24.473  104.483 1.00 96.33  ? 189  ARG B N     1 
ATOM   3208  C  CA    . ARG B 1  189  ? 11.084  23.360  105.193 1.00 81.65  ? 189  ARG B CA    1 
ATOM   3209  C  C     . ARG B 1  189  ? 9.587   23.303  104.890 1.00 78.56  ? 189  ARG B C     1 
ATOM   3210  O  O     . ARG B 1  189  ? 8.825   24.146  105.357 1.00 75.44  ? 189  ARG B O     1 
ATOM   3211  C  CB    . ARG B 1  189  ? 11.308  23.528  106.697 1.00 63.48  ? 189  ARG B CB    1 
ATOM   3212  C  CG    . ARG B 1  189  ? 12.692  24.056  107.046 1.00 68.05  ? 189  ARG B CG    1 
ATOM   3213  C  CD    . ARG B 1  189  ? 12.766  24.595  108.471 1.00 75.83  ? 189  ARG B CD    1 
ATOM   3214  N  NE    . ARG B 1  189  ? 12.795  23.535  109.476 1.00 86.13  ? 189  ARG B NE    1 
ATOM   3215  C  CZ    . ARG B 1  189  ? 13.058  23.734  110.765 1.00 82.49  ? 189  ARG B CZ    1 
ATOM   3216  N  NH1   . ARG B 1  189  ? 13.064  22.712  111.610 1.00 72.89  ? 189  ARG B NH1   1 
ATOM   3217  N  NH2   . ARG B 1  189  ? 13.320  24.957  111.209 1.00 76.45  ? 189  ARG B NH2   1 
ATOM   3218  N  N     . THR B 1  190  ? 9.172   22.307  104.109 1.00 78.84  ? 190  THR B N     1 
ATOM   3219  C  CA    . THR B 1  190  ? 7.775   22.180  103.677 1.00 84.03  ? 190  THR B CA    1 
ATOM   3220  C  C     . THR B 1  190  ? 6.959   21.183  104.515 1.00 79.93  ? 190  THR B C     1 
ATOM   3221  O  O     . THR B 1  190  ? 5.775   20.951  104.252 1.00 67.84  ? 190  THR B O     1 
ATOM   3222  C  CB    . THR B 1  190  ? 7.684   21.797  102.180 1.00 82.67  ? 190  THR B CB    1 
ATOM   3223  O  OG1   . THR B 1  190  ? 8.803   22.347  101.475 1.00 92.41  ? 190  THR B OG1   1 
ATOM   3224  C  CG2   . THR B 1  190  ? 6.391   22.320  101.558 1.00 67.24  ? 190  THR B CG2   1 
ATOM   3225  N  N     . ASP B 1  191  ? 7.593   20.595  105.523 1.00 71.96  ? 191  ASP B N     1 
ATOM   3226  C  CA    . ASP B 1  191  ? 6.956   19.543  106.310 1.00 66.32  ? 191  ASP B CA    1 
ATOM   3227  C  C     . ASP B 1  191  ? 6.242   20.054  107.560 1.00 62.27  ? 191  ASP B C     1 
ATOM   3228  O  O     . ASP B 1  191  ? 5.737   19.257  108.354 1.00 51.93  ? 191  ASP B O     1 
ATOM   3229  C  CB    . ASP B 1  191  ? 7.986   18.482  106.708 1.00 73.85  ? 191  ASP B CB    1 
ATOM   3230  C  CG    . ASP B 1  191  ? 9.135   19.059  107.518 1.00 77.31  ? 191  ASP B CG    1 
ATOM   3231  O  OD1   . ASP B 1  191  ? 9.505   20.229  107.279 1.00 73.01  ? 191  ASP B OD1   1 
ATOM   3232  O  OD2   . ASP B 1  191  ? 9.668   18.342  108.393 1.00 74.95  ? 191  ASP B OD2   1 
ATOM   3233  N  N     . LEU B 1  192  ? 6.191   21.374  107.734 1.00 62.00  ? 192  LEU B N     1 
ATOM   3234  C  CA    . LEU B 1  192  ? 5.720   21.938  108.996 1.00 49.67  ? 192  LEU B CA    1 
ATOM   3235  C  C     . LEU B 1  192  ? 4.212   21.798  109.175 1.00 45.31  ? 192  LEU B C     1 
ATOM   3236  O  O     . LEU B 1  192  ? 3.516   21.320  108.281 1.00 49.32  ? 192  LEU B O     1 
ATOM   3237  C  CB    . LEU B 1  192  ? 6.144   23.401  109.122 1.00 46.90  ? 192  LEU B CB    1 
ATOM   3238  C  CG    . LEU B 1  192  ? 7.653   23.633  109.037 1.00 44.64  ? 192  LEU B CG    1 
ATOM   3239  C  CD1   . LEU B 1  192  ? 7.984   25.087  109.313 1.00 51.92  ? 192  LEU B CD1   1 
ATOM   3240  C  CD2   . LEU B 1  192  ? 8.398   22.713  109.996 1.00 47.33  ? 192  LEU B CD2   1 
ATOM   3241  N  N     . ASP B 1  193  ? 3.713   22.227  110.332 1.00 39.80  ? 193  ASP B N     1 
ATOM   3242  C  CA    . ASP B 1  193  ? 2.322   21.981  110.703 1.00 39.83  ? 193  ASP B CA    1 
ATOM   3243  C  C     . ASP B 1  193  ? 1.517   23.258  110.924 1.00 41.77  ? 193  ASP B C     1 
ATOM   3244  O  O     . ASP B 1  193  ? 1.944   24.158  111.649 1.00 41.26  ? 193  ASP B O     1 
ATOM   3245  C  CB    . ASP B 1  193  ? 2.250   21.112  111.964 1.00 31.88  ? 193  ASP B CB    1 
ATOM   3246  C  CG    . ASP B 1  193  ? 2.531   19.644  111.686 1.00 51.73  ? 193  ASP B CG    1 
ATOM   3247  O  OD1   . ASP B 1  193  ? 3.226   19.342  110.691 1.00 67.52  ? 193  ASP B OD1   1 
ATOM   3248  O  OD2   . ASP B 1  193  ? 2.058   18.789  112.466 1.00 50.22  ? 193  ASP B OD2   1 
ATOM   3249  N  N     . LYS B 1  194  ? 0.350   23.328  110.291 1.00 37.39  ? 194  LYS B N     1 
ATOM   3250  C  CA    . LYS B 1  194  ? -0.607  24.390  110.567 1.00 35.28  ? 194  LYS B CA    1 
ATOM   3251  C  C     . LYS B 1  194  ? -1.789  23.791  111.312 1.00 38.29  ? 194  LYS B C     1 
ATOM   3252  O  O     . LYS B 1  194  ? -2.428  22.850  110.819 1.00 41.04  ? 194  LYS B O     1 
ATOM   3253  C  CB    . LYS B 1  194  ? -1.087  25.054  109.275 1.00 36.17  ? 194  LYS B CB    1 
ATOM   3254  C  CG    . LYS B 1  194  ? -2.161  26.111  109.499 1.00 38.40  ? 194  LYS B CG    1 
ATOM   3255  C  CD    . LYS B 1  194  ? -2.840  26.526  108.202 1.00 47.99  ? 194  LYS B CD    1 
ATOM   3256  C  CE    . LYS B 1  194  ? -3.972  27.513  108.471 1.00 45.07  ? 194  LYS B CE    1 
ATOM   3257  N  NZ    . LYS B 1  194  ? -4.785  27.802  107.258 1.00 33.48  ? 194  LYS B NZ    1 
ATOM   3258  N  N     . LEU B 1  195  ? -2.075  24.331  112.497 1.00 33.80  ? 195  LEU B N     1 
ATOM   3259  C  CA    . LEU B 1  195  ? -3.164  23.812  113.322 1.00 36.20  ? 195  LEU B CA    1 
ATOM   3260  C  C     . LEU B 1  195  ? -4.408  24.699  113.301 1.00 37.01  ? 195  LEU B C     1 
ATOM   3261  O  O     . LEU B 1  195  ? -4.386  25.819  113.806 1.00 35.08  ? 195  LEU B O     1 
ATOM   3262  C  CB    . LEU B 1  195  ? -2.700  23.610  114.767 1.00 32.82  ? 195  LEU B CB    1 
ATOM   3263  C  CG    . LEU B 1  195  ? -3.800  23.200  115.752 1.00 27.65  ? 195  LEU B CG    1 
ATOM   3264  C  CD1   . LEU B 1  195  ? -4.390  21.849  115.377 1.00 32.74  ? 195  LEU B CD1   1 
ATOM   3265  C  CD2   . LEU B 1  195  ? -3.274  23.180  117.175 1.00 24.90  ? 195  LEU B CD2   1 
ATOM   3266  N  N     . THR B 1  196  ? -5.491  24.186  112.722 1.00 39.98  ? 196  THR B N     1 
ATOM   3267  C  CA    . THR B 1  196  ? -6.770  24.890  112.734 1.00 30.25  ? 196  THR B CA    1 
ATOM   3268  C  C     . THR B 1  196  ? -7.731  24.198  113.691 1.00 31.70  ? 196  THR B C     1 
ATOM   3269  O  O     . THR B 1  196  ? -7.921  22.989  113.620 1.00 38.37  ? 196  THR B O     1 
ATOM   3270  C  CB    . THR B 1  196  ? -7.398  24.956  111.328 1.00 37.40  ? 196  THR B CB    1 
ATOM   3271  O  OG1   . THR B 1  196  ? -6.586  25.777  110.477 1.00 51.55  ? 196  THR B OG1   1 
ATOM   3272  C  CG2   . THR B 1  196  ? -8.801  25.538  111.390 1.00 33.83  ? 196  THR B CG2   1 
ATOM   3273  N  N     . LEU B 1  197  ? -8.329  24.969  114.590 1.00 39.47  ? 197  LEU B N     1 
ATOM   3274  C  CA    . LEU B 1  197  ? -9.222  24.426  115.606 1.00 34.29  ? 197  LEU B CA    1 
ATOM   3275  C  C     . LEU B 1  197  ? -10.558 25.161  115.578 1.00 33.98  ? 197  LEU B C     1 
ATOM   3276  O  O     . LEU B 1  197  ? -10.596 26.377  115.451 1.00 35.93  ? 197  LEU B O     1 
ATOM   3277  C  CB    . LEU B 1  197  ? -8.570  24.540  116.984 1.00 26.00  ? 197  LEU B CB    1 
ATOM   3278  C  CG    . LEU B 1  197  ? -9.337  23.981  118.179 1.00 34.05  ? 197  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B 1  197  ? -9.904  22.617  117.851 1.00 35.99  ? 197  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B 1  197  ? -8.439  23.916  119.408 1.00 27.75  ? 197  LEU B CD2   1 
ATOM   3281  N  N     . ARG B 1  198  ? -11.654 24.419  115.684 1.00 29.52  ? 198  ARG B N     1 
ATOM   3282  C  CA    . ARG B 1  198  ? -12.985 25.008  115.608 1.00 28.37  ? 198  ARG B CA    1 
ATOM   3283  C  C     . ARG B 1  198  ? -13.842 24.552  116.781 1.00 30.06  ? 198  ARG B C     1 
ATOM   3284  O  O     . ARG B 1  198  ? -13.983 23.352  117.028 1.00 34.34  ? 198  ARG B O     1 
ATOM   3285  C  CB    . ARG B 1  198  ? -13.653 24.651  114.281 1.00 34.79  ? 198  ARG B CB    1 
ATOM   3286  C  CG    . ARG B 1  198  ? -12.865 25.100  113.059 1.00 38.03  ? 198  ARG B CG    1 
ATOM   3287  C  CD    . ARG B 1  198  ? -13.612 24.811  111.766 1.00 46.89  ? 198  ARG B CD    1 
ATOM   3288  N  NE    . ARG B 1  198  ? -13.754 23.381  111.509 1.00 48.54  ? 198  ARG B NE    1 
ATOM   3289  C  CZ    . ARG B 1  198  ? -14.880 22.805  111.097 1.00 45.81  ? 198  ARG B CZ    1 
ATOM   3290  N  NH1   . ARG B 1  198  ? -14.918 21.495  110.885 1.00 40.69  ? 198  ARG B NH1   1 
ATOM   3291  N  NH2   . ARG B 1  198  ? -15.968 23.540  110.897 1.00 32.05  ? 198  ARG B NH2   1 
ATOM   3292  N  N     . ILE B 1  199  ? -14.410 25.520  117.498 1.00 35.85  ? 199  ILE B N     1 
ATOM   3293  C  CA    . ILE B 1  199  ? -15.117 25.245  118.747 1.00 27.34  ? 199  ILE B CA    1 
ATOM   3294  C  C     . ILE B 1  199  ? -16.524 25.840  118.787 1.00 26.80  ? 199  ILE B C     1 
ATOM   3295  O  O     . ILE B 1  199  ? -16.711 27.042  118.588 1.00 35.48  ? 199  ILE B O     1 
ATOM   3296  C  CB    . ILE B 1  199  ? -14.331 25.779  119.959 1.00 27.80  ? 199  ILE B CB    1 
ATOM   3297  C  CG1   . ILE B 1  199  ? -12.888 25.270  119.928 1.00 29.77  ? 199  ILE B CG1   1 
ATOM   3298  C  CG2   . ILE B 1  199  ? -15.017 25.385  121.253 1.00 25.95  ? 199  ILE B CG2   1 
ATOM   3299  C  CD1   . ILE B 1  199  ? -12.014 25.843  121.013 1.00 32.26  ? 199  ILE B CD1   1 
ATOM   3300  N  N     . TRP B 1  200  ? -17.501 24.978  119.050 1.00 29.13  ? 200  TRP B N     1 
ATOM   3301  C  CA    . TRP B 1  200  ? -18.900 25.364  119.194 1.00 31.59  ? 200  TRP B CA    1 
ATOM   3302  C  C     . TRP B 1  200  ? -19.314 25.253  120.658 1.00 39.65  ? 200  TRP B C     1 
ATOM   3303  O  O     . TRP B 1  200  ? -19.243 24.164  121.252 1.00 37.66  ? 200  TRP B O     1 
ATOM   3304  C  CB    . TRP B 1  200  ? -19.804 24.448  118.364 1.00 29.78  ? 200  TRP B CB    1 
ATOM   3305  C  CG    . TRP B 1  200  ? -19.642 24.554  116.880 1.00 31.95  ? 200  TRP B CG    1 
ATOM   3306  C  CD1   . TRP B 1  200  ? -20.478 25.190  116.010 1.00 34.61  ? 200  TRP B CD1   1 
ATOM   3307  C  CD2   . TRP B 1  200  ? -18.595 23.988  116.084 1.00 35.06  ? 200  TRP B CD2   1 
ATOM   3308  N  NE1   . TRP B 1  200  ? -20.013 25.062  114.725 1.00 35.11  ? 200  TRP B NE1   1 
ATOM   3309  C  CE2   . TRP B 1  200  ? -18.854 24.326  114.743 1.00 32.69  ? 200  TRP B CE2   1 
ATOM   3310  C  CE3   . TRP B 1  200  ? -17.456 23.227  116.375 1.00 32.15  ? 200  TRP B CE3   1 
ATOM   3311  C  CZ2   . TRP B 1  200  ? -18.023 23.938  113.699 1.00 37.30  ? 200  TRP B CZ2   1 
ATOM   3312  C  CZ3   . TRP B 1  200  ? -16.631 22.843  115.337 1.00 28.93  ? 200  TRP B CZ3   1 
ATOM   3313  C  CH2   . TRP B 1  200  ? -16.918 23.197  114.017 1.00 32.00  ? 200  TRP B CH2   1 
ATOM   3314  N  N     . THR B 1  201  ? -19.767 26.379  121.213 1.00 45.51  ? 201  THR B N     1 
ATOM   3315  C  CA    . THR B 1  201  ? -20.185 26.493  122.609 1.00 39.13  ? 201  THR B CA    1 
ATOM   3316  C  C     . THR B 1  201  ? -21.645 26.948  122.670 1.00 43.39  ? 201  THR B C     1 
ATOM   3317  O  O     . THR B 1  201  ? -22.169 27.478  121.692 1.00 45.27  ? 201  THR B O     1 
ATOM   3318  C  CB    . THR B 1  201  ? -19.327 27.534  123.361 1.00 38.32  ? 201  THR B CB    1 
ATOM   3319  O  OG1   . THR B 1  201  ? -17.986 27.518  122.859 1.00 38.92  ? 201  THR B OG1   1 
ATOM   3320  C  CG2   . THR B 1  201  ? -19.302 27.244  124.844 1.00 48.42  ? 201  THR B CG2   1 
ATOM   3321  N  N     . ASP B 1  202  ? -22.302 26.742  123.811 1.00 50.46  ? 202  ASP B N     1 
ATOM   3322  C  CA    . ASP B 1  202  ? -23.692 27.176  123.973 1.00 53.99  ? 202  ASP B CA    1 
ATOM   3323  C  C     . ASP B 1  202  ? -23.807 28.635  124.415 1.00 54.84  ? 202  ASP B C     1 
ATOM   3324  O  O     . ASP B 1  202  ? -24.910 29.168  124.546 1.00 52.78  ? 202  ASP B O     1 
ATOM   3325  C  CB    . ASP B 1  202  ? -24.475 26.253  124.924 1.00 53.95  ? 202  ASP B CB    1 
ATOM   3326  C  CG    . ASP B 1  202  ? -23.852 26.153  126.312 1.00 58.46  ? 202  ASP B CG    1 
ATOM   3327  O  OD1   . ASP B 1  202  ? -23.085 27.056  126.710 1.00 64.71  ? 202  ASP B OD1   1 
ATOM   3328  O  OD2   . ASP B 1  202  ? -24.141 25.162  127.017 1.00 58.29  ? 202  ASP B OD2   1 
ATOM   3329  N  N     . GLY B 1  203  ? -22.662 29.270  124.648 1.00 54.58  ? 203  GLY B N     1 
ATOM   3330  C  CA    . GLY B 1  203  ? -22.629 30.678  125.000 1.00 59.99  ? 203  GLY B CA    1 
ATOM   3331  C  C     . GLY B 1  203  ? -22.362 30.953  126.468 1.00 60.23  ? 203  GLY B C     1 
ATOM   3332  O  O     . GLY B 1  203  ? -21.987 32.068  126.836 1.00 55.48  ? 203  GLY B O     1 
ATOM   3333  N  N     . SER B 1  204  ? -22.558 29.940  127.307 1.00 52.98  ? 204  SER B N     1 
ATOM   3334  C  CA    . SER B 1  204  ? -22.320 30.080  128.740 1.00 55.71  ? 204  SER B CA    1 
ATOM   3335  C  C     . SER B 1  204  ? -20.862 30.439  129.013 1.00 61.47  ? 204  SER B C     1 
ATOM   3336  O  O     . SER B 1  204  ? -20.565 31.247  129.894 1.00 65.68  ? 204  SER B O     1 
ATOM   3337  C  CB    . SER B 1  204  ? -22.712 28.802  129.482 1.00 51.87  ? 204  SER B CB    1 
ATOM   3338  O  OG    . SER B 1  204  ? -22.101 27.669  128.898 1.00 49.25  ? 204  SER B OG    1 
ATOM   3339  N  N     . VAL B 1  205  ? -19.957 29.831  128.254 1.00 61.58  ? 205  VAL B N     1 
ATOM   3340  C  CA    . VAL B 1  205  ? -18.558 30.239  128.259 1.00 54.76  ? 205  VAL B CA    1 
ATOM   3341  C  C     . VAL B 1  205  ? -18.151 30.569  126.827 1.00 49.36  ? 205  VAL B C     1 
ATOM   3342  O  O     . VAL B 1  205  ? -18.821 30.171  125.877 1.00 49.69  ? 205  VAL B O     1 
ATOM   3343  C  CB    . VAL B 1  205  ? -17.626 29.150  128.842 1.00 50.16  ? 205  VAL B CB    1 
ATOM   3344  C  CG1   . VAL B 1  205  ? -18.155 28.653  130.181 1.00 48.62  ? 205  VAL B CG1   1 
ATOM   3345  C  CG2   . VAL B 1  205  ? -17.475 27.998  127.874 1.00 51.94  ? 205  VAL B CG2   1 
ATOM   3346  N  N     . THR B 1  206  ? -17.067 31.317  126.674 1.00 53.23  ? 206  THR B N     1 
ATOM   3347  C  CA    . THR B 1  206  ? -16.604 31.725  125.352 1.00 49.75  ? 206  THR B CA    1 
ATOM   3348  C  C     . THR B 1  206  ? -15.638 30.692  124.766 1.00 51.08  ? 206  THR B C     1 
ATOM   3349  O  O     . THR B 1  206  ? -14.860 30.086  125.505 1.00 53.95  ? 206  THR B O     1 
ATOM   3350  C  CB    . THR B 1  206  ? -15.991 33.149  125.402 1.00 47.97  ? 206  THR B CB    1 
ATOM   3351  O  OG1   . THR B 1  206  ? -16.987 34.106  125.025 1.00 51.45  ? 206  THR B OG1   1 
ATOM   3352  C  CG2   . THR B 1  206  ? -14.791 33.291  124.478 1.00 51.53  ? 206  THR B CG2   1 
ATOM   3353  N  N     . PRO B 1  207  ? -15.710 30.463  123.442 1.00 47.64  ? 207  PRO B N     1 
ATOM   3354  C  CA    . PRO B 1  207  ? -14.831 29.512  122.755 1.00 42.10  ? 207  PRO B CA    1 
ATOM   3355  C  C     . PRO B 1  207  ? -13.360 29.756  123.075 1.00 45.39  ? 207  PRO B C     1 
ATOM   3356  O  O     . PRO B 1  207  ? -12.634 28.804  123.365 1.00 44.52  ? 207  PRO B O     1 
ATOM   3357  C  CB    . PRO B 1  207  ? -15.100 29.804  121.280 1.00 45.79  ? 207  PRO B CB    1 
ATOM   3358  C  CG    . PRO B 1  207  ? -16.507 30.278  121.257 1.00 44.05  ? 207  PRO B CG    1 
ATOM   3359  C  CD    . PRO B 1  207  ? -16.690 31.066  122.519 1.00 49.07  ? 207  PRO B CD    1 
ATOM   3360  N  N     . LEU B 1  208  ? -12.936 31.016  123.037 1.00 42.04  ? 208  LEU B N     1 
ATOM   3361  C  CA    . LEU B 1  208  ? -11.572 31.382  123.407 1.00 41.43  ? 208  LEU B CA    1 
ATOM   3362  C  C     . LEU B 1  208  ? -11.320 31.105  124.887 1.00 41.09  ? 208  LEU B C     1 
ATOM   3363  O  O     . LEU B 1  208  ? -10.271 30.574  125.265 1.00 42.23  ? 208  LEU B O     1 
ATOM   3364  C  CB    . LEU B 1  208  ? -11.307 32.855  123.089 1.00 36.38  ? 208  LEU B CB    1 
ATOM   3365  C  CG    . LEU B 1  208  ? -9.935  33.414  123.467 1.00 33.07  ? 208  LEU B CG    1 
ATOM   3366  C  CD1   . LEU B 1  208  ? -8.821  32.530  122.935 1.00 39.25  ? 208  LEU B CD1   1 
ATOM   3367  C  CD2   . LEU B 1  208  ? -9.784  34.829  122.939 1.00 36.12  ? 208  LEU B CD2   1 
ATOM   3368  N  N     . GLU B 1  209  ? -12.291 31.470  125.718 1.00 40.91  ? 209  GLU B N     1 
ATOM   3369  C  CA    . GLU B 1  209  ? -12.228 31.176  127.141 1.00 45.52  ? 209  GLU B CA    1 
ATOM   3370  C  C     . GLU B 1  209  ? -12.135 29.673  127.351 1.00 46.56  ? 209  GLU B C     1 
ATOM   3371  O  O     . GLU B 1  209  ? -11.346 29.204  128.171 1.00 50.20  ? 209  GLU B O     1 
ATOM   3372  C  CB    . GLU B 1  209  ? -13.457 31.730  127.867 1.00 54.94  ? 209  GLU B CB    1 
ATOM   3373  C  CG    . GLU B 1  209  ? -13.493 33.247  127.978 1.00 60.84  ? 209  GLU B CG    1 
ATOM   3374  C  CD    . GLU B 1  209  ? -14.762 33.749  128.641 1.00 58.60  ? 209  GLU B CD    1 
ATOM   3375  O  OE1   . GLU B 1  209  ? -14.849 34.965  128.915 1.00 60.58  ? 209  GLU B OE1   1 
ATOM   3376  O  OE2   . GLU B 1  209  ? -15.674 32.928  128.884 1.00 51.06  ? 209  GLU B OE2   1 
ATOM   3377  N  N     . ALA B 1  210  ? -12.938 28.927  126.596 1.00 45.65  ? 210  ALA B N     1 
ATOM   3378  C  CA    . ALA B 1  210  ? -12.949 27.470  126.675 1.00 40.80  ? 210  ALA B CA    1 
ATOM   3379  C  C     . ALA B 1  210  ? -11.573 26.886  126.353 1.00 43.02  ? 210  ALA B C     1 
ATOM   3380  O  O     . ALA B 1  210  ? -11.053 26.042  127.093 1.00 37.93  ? 210  ALA B O     1 
ATOM   3381  C  CB    . ALA B 1  210  ? -14.005 26.901  125.742 1.00 30.86  ? 210  ALA B CB    1 
ATOM   3382  N  N     . LEU B 1  211  ? -10.989 27.350  125.251 1.00 38.12  ? 211  LEU B N     1 
ATOM   3383  C  CA    . LEU B 1  211  ? -9.657  26.920  124.837 1.00 39.15  ? 211  LEU B CA    1 
ATOM   3384  C  C     . LEU B 1  211  ? -8.621  27.229  125.914 1.00 42.13  ? 211  LEU B C     1 
ATOM   3385  O  O     . LEU B 1  211  ? -7.757  26.400  126.219 1.00 39.41  ? 211  LEU B O     1 
ATOM   3386  C  CB    . LEU B 1  211  ? -9.267  27.585  123.512 1.00 41.11  ? 211  LEU B CB    1 
ATOM   3387  C  CG    . LEU B 1  211  ? -7.872  27.299  122.941 1.00 45.77  ? 211  LEU B CG    1 
ATOM   3388  C  CD1   . LEU B 1  211  ? -7.659  25.807  122.714 1.00 32.13  ? 211  LEU B CD1   1 
ATOM   3389  C  CD2   . LEU B 1  211  ? -7.640  28.080  121.649 1.00 39.72  ? 211  LEU B CD2   1 
ATOM   3390  N  N     . ASN B 1  212  ? -8.717  28.421  126.495 1.00 43.95  ? 212  ASN B N     1 
ATOM   3391  C  CA    . ASN B 1  212  ? -7.790  28.826  127.550 1.00 45.03  ? 212  ASN B CA    1 
ATOM   3392  C  C     . ASN B 1  212  ? -7.913  27.976  128.817 1.00 40.69  ? 212  ASN B C     1 
ATOM   3393  O  O     . ASN B 1  212  ? -6.909  27.637  129.453 1.00 36.75  ? 212  ASN B O     1 
ATOM   3394  C  CB    . ASN B 1  212  ? -7.944  30.316  127.859 1.00 37.73  ? 212  ASN B CB    1 
ATOM   3395  C  CG    . ASN B 1  212  ? -7.343  31.195  126.778 1.00 43.57  ? 212  ASN B CG    1 
ATOM   3396  O  OD1   . ASN B 1  212  ? -6.194  31.003  126.375 1.00 44.65  ? 212  ASN B OD1   1 
ATOM   3397  N  ND2   . ASN B 1  212  ? -8.121  32.156  126.292 1.00 41.06  ? 212  ASN B ND2   1 
ATOM   3398  N  N     . GLN B 1  213  ? -9.143  27.622  129.175 1.00 33.77  ? 213  GLN B N     1 
ATOM   3399  C  CA    . GLN B 1  213  ? -9.366  26.732  130.306 1.00 35.57  ? 213  GLN B CA    1 
ATOM   3400  C  C     . GLN B 1  213  ? -8.787  25.357  129.992 1.00 36.76  ? 213  GLN B C     1 
ATOM   3401  O  O     . GLN B 1  213  ? -8.247  24.681  130.873 1.00 33.43  ? 213  GLN B O     1 
ATOM   3402  C  CB    . GLN B 1  213  ? -10.857 26.634  130.639 1.00 34.44  ? 213  GLN B CB    1 
ATOM   3403  C  CG    . GLN B 1  213  ? -11.470 27.940  131.128 1.00 38.23  ? 213  GLN B CG    1 
ATOM   3404  C  CD    . GLN B 1  213  ? -12.949 27.816  131.451 1.00 40.36  ? 213  GLN B CD    1 
ATOM   3405  O  OE1   . GLN B 1  213  ? -13.448 26.725  131.725 1.00 45.66  ? 213  GLN B OE1   1 
ATOM   3406  N  NE2   . GLN B 1  213  ? -13.660 28.940  131.419 1.00 36.64  ? 213  GLN B NE2   1 
ATOM   3407  N  N     . ALA B 1  214  ? -8.886  24.956  128.727 1.00 34.39  ? 214  ALA B N     1 
ATOM   3408  C  CA    . ALA B 1  214  ? -8.326  23.683  128.289 1.00 32.61  ? 214  ALA B CA    1 
ATOM   3409  C  C     . ALA B 1  214  ? -6.806  23.650  128.446 1.00 34.16  ? 214  ALA B C     1 
ATOM   3410  O  O     . ALA B 1  214  ? -6.262  22.743  129.092 1.00 33.04  ? 214  ALA B O     1 
ATOM   3411  C  CB    . ALA B 1  214  ? -8.722  23.394  126.853 1.00 34.97  ? 214  ALA B CB    1 
ATOM   3412  N  N     . VAL B 1  215  ? -6.123  24.639  127.867 1.00 31.53  ? 215  VAL B N     1 
ATOM   3413  C  CA    . VAL B 1  215  ? -4.665  24.703  127.973 1.00 34.17  ? 215  VAL B CA    1 
ATOM   3414  C  C     . VAL B 1  215  ? -4.221  24.840  129.430 1.00 36.35  ? 215  VAL B C     1 
ATOM   3415  O  O     . VAL B 1  215  ? -3.174  24.313  129.822 1.00 32.24  ? 215  VAL B O     1 
ATOM   3416  C  CB    . VAL B 1  215  ? -4.033  25.830  127.099 1.00 24.87  ? 215  VAL B CB    1 
ATOM   3417  C  CG1   . VAL B 1  215  ? -4.301  25.584  125.629 1.00 32.72  ? 215  VAL B CG1   1 
ATOM   3418  C  CG2   . VAL B 1  215  ? -4.543  27.193  127.503 1.00 37.02  ? 215  VAL B CG2   1 
ATOM   3419  N  N     . GLU B 1  216  ? -5.029  25.529  130.232 1.00 34.27  ? 216  GLU B N     1 
ATOM   3420  C  CA    . GLU B 1  216  ? -4.734  25.673  131.650 1.00 32.16  ? 216  GLU B CA    1 
ATOM   3421  C  C     . GLU B 1  216  ? -4.762  24.320  132.355 1.00 38.14  ? 216  GLU B C     1 
ATOM   3422  O  O     . GLU B 1  216  ? -3.799  23.945  133.038 1.00 44.81  ? 216  GLU B O     1 
ATOM   3423  C  CB    . GLU B 1  216  ? -5.706  26.649  132.315 1.00 34.39  ? 216  GLU B CB    1 
ATOM   3424  C  CG    . GLU B 1  216  ? -5.509  26.803  133.818 1.00 42.93  ? 216  GLU B CG    1 
ATOM   3425  C  CD    . GLU B 1  216  ? -4.084  27.189  134.199 1.00 59.34  ? 216  GLU B CD    1 
ATOM   3426  O  OE1   . GLU B 1  216  ? -3.389  27.842  133.389 1.00 56.97  ? 216  GLU B OE1   1 
ATOM   3427  O  OE2   . GLU B 1  216  ? -3.656  26.836  135.319 1.00 61.70  ? 216  GLU B OE2   1 
ATOM   3428  N  N     . ILE B 1  217  ? -5.865  23.592  132.180 1.00 35.14  ? 217  ILE B N     1 
ATOM   3429  C  CA    . ILE B 1  217  ? -5.997  22.249  132.737 1.00 31.71  ? 217  ILE B CA    1 
ATOM   3430  C  C     . ILE B 1  217  ? -4.802  21.399  132.333 1.00 35.80  ? 217  ILE B C     1 
ATOM   3431  O  O     . ILE B 1  217  ? -4.207  20.704  133.161 1.00 40.48  ? 217  ILE B O     1 
ATOM   3432  C  CB    . ILE B 1  217  ? -7.280  21.550  132.247 1.00 23.56  ? 217  ILE B CB    1 
ATOM   3433  C  CG1   . ILE B 1  217  ? -8.519  22.243  132.808 1.00 23.37  ? 217  ILE B CG1   1 
ATOM   3434  C  CG2   . ILE B 1  217  ? -7.282  20.086  132.655 1.00 24.50  ? 217  ILE B CG2   1 
ATOM   3435  C  CD1   . ILE B 1  217  ? -9.814  21.610  132.367 1.00 21.18  ? 217  ILE B CD1   1 
ATOM   3436  N  N     . LEU B 1  218  ? -4.445  21.482  131.054 1.00 36.72  ? 218  LEU B N     1 
ATOM   3437  C  CA    . LEU B 1  218  ? -3.334  20.702  130.522 1.00 33.50  ? 218  LEU B CA    1 
ATOM   3438  C  C     . LEU B 1  218  ? -2.020  21.017  131.235 1.00 38.21  ? 218  LEU B C     1 
ATOM   3439  O  O     . LEU B 1  218  ? -1.318  20.109  131.690 1.00 35.48  ? 218  LEU B O     1 
ATOM   3440  C  CB    . LEU B 1  218  ? -3.195  20.933  129.017 1.00 32.84  ? 218  LEU B CB    1 
ATOM   3441  C  CG    . LEU B 1  218  ? -2.239  19.998  128.277 1.00 31.12  ? 218  LEU B CG    1 
ATOM   3442  C  CD1   . LEU B 1  218  ? -2.573  18.551  128.590 1.00 31.34  ? 218  LEU B CD1   1 
ATOM   3443  C  CD2   . LEU B 1  218  ? -2.307  20.252  126.782 1.00 32.41  ? 218  LEU B CD2   1 
ATOM   3444  N  N     . ARG B 1  219  ? -1.698  22.304  131.338 1.00 38.53  ? 219  ARG B N     1 
ATOM   3445  C  CA    . ARG B 1  219  ? -0.463  22.730  131.988 1.00 37.06  ? 219  ARG B CA    1 
ATOM   3446  C  C     . ARG B 1  219  ? -0.414  22.271  133.445 1.00 42.33  ? 219  ARG B C     1 
ATOM   3447  O  O     . ARG B 1  219  ? 0.614   21.763  133.920 1.00 41.64  ? 219  ARG B O     1 
ATOM   3448  C  CB    . ARG B 1  219  ? -0.317  24.248  131.912 1.00 34.31  ? 219  ARG B CB    1 
ATOM   3449  C  CG    . ARG B 1  219  ? 1.001   24.765  132.457 1.00 48.92  ? 219  ARG B CG    1 
ATOM   3450  C  CD    . ARG B 1  219  ? 0.909   26.245  132.766 1.00 54.74  ? 219  ARG B CD    1 
ATOM   3451  N  NE    . ARG B 1  219  ? -0.246  26.534  133.612 1.00 58.35  ? 219  ARG B NE    1 
ATOM   3452  C  CZ    . ARG B 1  219  ? -0.239  26.454  134.938 1.00 57.10  ? 219  ARG B CZ    1 
ATOM   3453  N  NH1   . ARG B 1  219  ? 0.866   26.096  135.580 1.00 48.76  ? 219  ARG B NH1   1 
ATOM   3454  N  NH2   . ARG B 1  219  ? -1.338  26.733  135.625 1.00 53.34  ? 219  ARG B NH2   1 
ATOM   3455  N  N     . GLU B 1  220  ? -1.532  22.442  134.147 1.00 42.28  ? 220  GLU B N     1 
ATOM   3456  C  CA    . GLU B 1  220  ? -1.617  22.009  135.537 1.00 41.76  ? 220  GLU B CA    1 
ATOM   3457  C  C     . GLU B 1  220  ? -1.390  20.505  135.658 1.00 42.18  ? 220  GLU B C     1 
ATOM   3458  O  O     . GLU B 1  220  ? -0.745  20.040  136.600 1.00 42.69  ? 220  GLU B O     1 
ATOM   3459  C  CB    . GLU B 1  220  ? -2.961  22.389  136.158 1.00 49.71  ? 220  GLU B CB    1 
ATOM   3460  C  CG    . GLU B 1  220  ? -3.036  22.090  137.649 1.00 54.10  ? 220  GLU B CG    1 
ATOM   3461  C  CD    . GLU B 1  220  ? -4.437  22.223  138.208 1.00 67.88  ? 220  GLU B CD    1 
ATOM   3462  O  OE1   . GLU B 1  220  ? -5.356  22.580  137.439 1.00 69.45  ? 220  GLU B OE1   1 
ATOM   3463  O  OE2   . GLU B 1  220  ? -4.616  21.967  139.418 1.00 74.44  ? 220  GLU B OE2   1 
ATOM   3464  N  N     . HIS B 1  221  ? -1.916  19.746  134.701 1.00 40.15  ? 221  HIS B N     1 
ATOM   3465  C  CA    . HIS B 1  221  ? -1.687  18.306  134.681 1.00 40.46  ? 221  HIS B CA    1 
ATOM   3466  C  C     . HIS B 1  221  ? -0.235  17.971  134.359 1.00 42.75  ? 221  HIS B C     1 
ATOM   3467  O  O     . HIS B 1  221  ? 0.262   16.908  134.734 1.00 41.02  ? 221  HIS B O     1 
ATOM   3468  C  CB    . HIS B 1  221  ? -2.630  17.608  133.703 1.00 36.11  ? 221  HIS B CB    1 
ATOM   3469  C  CG    . HIS B 1  221  ? -3.947  17.236  134.306 1.00 33.72  ? 221  HIS B CG    1 
ATOM   3470  N  ND1   . HIS B 1  221  ? -4.992  18.127  134.417 1.00 37.18  ? 221  HIS B ND1   1 
ATOM   3471  C  CD2   . HIS B 1  221  ? -4.383  16.073  134.844 1.00 38.96  ? 221  HIS B CD2   1 
ATOM   3472  C  CE1   . HIS B 1  221  ? -6.019  17.527  134.994 1.00 48.93  ? 221  HIS B CE1   1 
ATOM   3473  N  NE2   . HIS B 1  221  ? -5.676  16.280  135.262 1.00 50.52  ? 221  HIS B NE2   1 
ATOM   3474  N  N     . LEU B 1  222  ? 0.442   18.878  133.662 1.00 41.86  ? 222  LEU B N     1 
ATOM   3475  C  CA    . LEU B 1  222  ? 1.867   18.714  133.402 1.00 43.56  ? 222  LEU B CA    1 
ATOM   3476  C  C     . LEU B 1  222  ? 2.680   18.975  134.666 1.00 42.49  ? 222  LEU B C     1 
ATOM   3477  O  O     . LEU B 1  222  ? 3.774   18.434  134.832 1.00 42.68  ? 222  LEU B O     1 
ATOM   3478  C  CB    . LEU B 1  222  ? 2.330   19.633  132.269 1.00 47.48  ? 222  LEU B CB    1 
ATOM   3479  C  CG    . LEU B 1  222  ? 1.825   19.265  130.872 1.00 41.76  ? 222  LEU B CG    1 
ATOM   3480  C  CD1   . LEU B 1  222  ? 2.398   20.208  129.831 1.00 28.29  ? 222  LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B 1  222  ? 2.172   17.819  130.546 1.00 35.68  ? 222  LEU B CD2   1 
ATOM   3482  N  N     . THR B 1  223  ? 2.138   19.799  135.561 1.00 46.09  ? 223  THR B N     1 
ATOM   3483  C  CA    . THR B 1  223  ? 2.796   20.063  136.842 1.00 46.82  ? 223  THR B CA    1 
ATOM   3484  C  C     . THR B 1  223  ? 2.864   18.818  137.734 1.00 52.46  ? 223  THR B C     1 
ATOM   3485  O  O     . THR B 1  223  ? 3.626   18.775  138.700 1.00 55.59  ? 223  THR B O     1 
ATOM   3486  C  CB    . THR B 1  223  ? 2.080   21.177  137.626 1.00 40.83  ? 223  THR B CB    1 
ATOM   3487  O  OG1   . THR B 1  223  ? 1.487   22.104  136.711 1.00 52.92  ? 223  THR B OG1   1 
ATOM   3488  C  CG2   . THR B 1  223  ? 3.058   21.913  138.534 1.00 49.56  ? 223  THR B CG2   1 
ATOM   3489  N  N     . TYR B 1  224  ? 2.071   17.805  137.398 1.00 43.47  ? 224  TYR B N     1 
ATOM   3490  C  CA    . TYR B 1  224  ? 1.946   16.609  138.228 1.00 39.70  ? 224  TYR B CA    1 
ATOM   3491  C  C     . TYR B 1  224  ? 3.170   15.699  138.190 1.00 46.45  ? 224  TYR B C     1 
ATOM   3492  O  O     . TYR B 1  224  ? 3.231   14.702  138.908 1.00 51.91  ? 224  TYR B O     1 
ATOM   3493  C  CB    . TYR B 1  224  ? 0.697   15.819  137.838 1.00 40.57  ? 224  TYR B CB    1 
ATOM   3494  C  CG    . TYR B 1  224  ? -0.599  16.552  138.110 1.00 48.38  ? 224  TYR B CG    1 
ATOM   3495  C  CD1   . TYR B 1  224  ? -0.635  17.651  138.961 1.00 49.20  ? 224  TYR B CD1   1 
ATOM   3496  C  CD2   . TYR B 1  224  ? -1.787  16.144  137.518 1.00 49.64  ? 224  TYR B CD2   1 
ATOM   3497  C  CE1   . TYR B 1  224  ? -1.818  18.324  139.213 1.00 48.55  ? 224  TYR B CE1   1 
ATOM   3498  C  CE2   . TYR B 1  224  ? -2.975  16.808  137.767 1.00 49.29  ? 224  TYR B CE2   1 
ATOM   3499  C  CZ    . TYR B 1  224  ? -2.985  17.897  138.613 1.00 50.40  ? 224  TYR B CZ    1 
ATOM   3500  O  OH    . TYR B 1  224  ? -4.168  18.558  138.857 1.00 55.07  ? 224  TYR B OH    1 
ATOM   3501  N  N     . PHE B 1  225  ? 4.134   16.035  137.342 1.00 54.46  ? 225  PHE B N     1 
ATOM   3502  C  CA    . PHE B 1  225  ? 5.361   15.252  137.214 1.00 56.64  ? 225  PHE B CA    1 
ATOM   3503  C  C     . PHE B 1  225  ? 6.500   15.779  138.092 1.00 67.06  ? 225  PHE B C     1 
ATOM   3504  O  O     . PHE B 1  225  ? 7.641   15.332  137.978 1.00 66.33  ? 225  PHE B O     1 
ATOM   3505  C  CB    . PHE B 1  225  ? 5.792   15.161  135.747 1.00 49.57  ? 225  PHE B CB    1 
ATOM   3506  C  CG    . PHE B 1  225  ? 4.806   14.433  134.875 1.00 46.16  ? 225  PHE B CG    1 
ATOM   3507  C  CD1   . PHE B 1  225  ? 3.825   15.126  134.184 1.00 39.42  ? 225  PHE B CD1   1 
ATOM   3508  C  CD2   . PHE B 1  225  ? 4.851   13.053  134.758 1.00 44.58  ? 225  PHE B CD2   1 
ATOM   3509  C  CE1   . PHE B 1  225  ? 2.914   14.456  133.387 1.00 39.21  ? 225  PHE B CE1   1 
ATOM   3510  C  CE2   . PHE B 1  225  ? 3.940   12.378  133.962 1.00 34.27  ? 225  PHE B CE2   1 
ATOM   3511  C  CZ    . PHE B 1  225  ? 2.972   13.080  133.276 1.00 29.59  ? 225  PHE B CZ    1 
ATOM   3512  N  N     . SER B 1  226  ? 6.186   16.753  138.942 1.00 74.19  ? 226  SER B N     1 
ATOM   3513  C  CA    . SER B 1  226  ? 7.194   17.423  139.767 1.00 72.25  ? 226  SER B CA    1 
ATOM   3514  C  C     . SER B 1  226  ? 7.639   16.698  141.051 1.00 76.39  ? 226  SER B C     1 
ATOM   3515  O  O     . SER B 1  226  ? 8.823   16.709  141.385 1.00 84.61  ? 226  SER B O     1 
ATOM   3516  C  CB    . SER B 1  226  ? 6.738   18.850  140.104 1.00 75.20  ? 226  SER B CB    1 
ATOM   3517  O  OG    . SER B 1  226  ? 5.481   18.852  140.759 1.00 66.97  ? 226  SER B OG    1 
ATOM   3518  N  N     . ASN B 1  227  ? 6.706   16.074  141.767 1.00 73.98  ? 227  ASN B N     1 
ATOM   3519  C  CA    . ASN B 1  227  ? 6.994   15.600  143.127 1.00 76.29  ? 227  ASN B CA    1 
ATOM   3520  C  C     . ASN B 1  227  ? 6.743   14.118  143.417 1.00 65.57  ? 227  ASN B C     1 
ATOM   3521  O  O     . ASN B 1  227  ? 5.624   13.728  143.749 1.00 71.47  ? 227  ASN B O     1 
ATOM   3522  C  CB    . ASN B 1  227  ? 6.253   16.455  144.162 1.00 80.56  ? 227  ASN B CB    1 
ATOM   3523  C  CG    . ASN B 1  227  ? 6.827   17.852  144.283 1.00 80.89  ? 227  ASN B CG    1 
ATOM   3524  O  OD1   . ASN B 1  227  ? 8.022   18.067  144.073 1.00 78.00  ? 227  ASN B OD1   1 
ATOM   3525  N  ND2   . ASN B 1  227  ? 5.977   18.812  144.628 1.00 75.49  ? 227  ASN B ND2   1 
ATOM   3526  N  N     . PRO B 1  228  ? 7.788   13.287  143.291 1.00 61.34  ? 228  PRO B N     1 
ATOM   3527  C  CA    . PRO B 1  228  ? 7.698   11.874  143.681 1.00 59.36  ? 228  PRO B CA    1 
ATOM   3528  C  C     . PRO B 1  228  ? 7.492   11.713  145.187 1.00 48.54  ? 228  PRO B C     1 
ATOM   3529  O  O     . PRO B 1  228  ? 7.011   10.669  145.634 1.00 38.20  ? 228  PRO B O     1 
ATOM   3530  C  CB    . PRO B 1  228  ? 9.065   11.309  143.275 1.00 53.13  ? 228  PRO B CB    1 
ATOM   3531  C  CG    . PRO B 1  228  ? 9.593   12.268  142.253 1.00 59.72  ? 228  PRO B CG    1 
ATOM   3532  C  CD    . PRO B 1  228  ? 9.087   13.610  142.680 1.00 57.73  ? 228  PRO B CD    1 
ATOM   3533  N  N     . MET C 2  1    ? 18.127  -17.909 116.035 1.00 72.67  ? 1    MET C N     1 
ATOM   3534  C  CA    . MET C 2  1    ? 17.228  -17.920 114.887 1.00 73.37  ? 1    MET C CA    1 
ATOM   3535  C  C     . MET C 2  1    ? 17.189  -19.304 114.236 1.00 78.71  ? 1    MET C C     1 
ATOM   3536  O  O     . MET C 2  1    ? 17.744  -19.509 113.154 1.00 77.66  ? 1    MET C O     1 
ATOM   3537  C  CB    . MET C 2  1    ? 17.653  -16.858 113.869 1.00 69.97  ? 1    MET C CB    1 
ATOM   3538  C  CG    . MET C 2  1    ? 16.655  -16.623 112.744 1.00 61.25  ? 1    MET C CG    1 
ATOM   3539  S  SD    . MET C 2  1    ? 17.421  -16.752 111.115 1.00 91.32  ? 1    MET C SD    1 
ATOM   3540  C  CE    . MET C 2  1    ? 18.570  -15.375 111.152 1.00 54.73  ? 1    MET C CE    1 
ATOM   3541  N  N     . GLU C 2  2    ? 16.543  -20.253 114.908 1.00 75.05  ? 2    GLU C N     1 
ATOM   3542  C  CA    . GLU C 2  2    ? 16.397  -21.608 114.378 1.00 73.50  ? 2    GLU C CA    1 
ATOM   3543  C  C     . GLU C 2  2    ? 15.324  -21.664 113.292 1.00 63.40  ? 2    GLU C C     1 
ATOM   3544  O  O     . GLU C 2  2    ? 14.414  -20.833 113.266 1.00 55.34  ? 2    GLU C O     1 
ATOM   3545  C  CB    . GLU C 2  2    ? 16.067  -22.594 115.501 1.00 63.56  ? 2    GLU C CB    1 
ATOM   3546  C  CG    . GLU C 2  2    ? 14.839  -22.220 116.313 1.00 64.18  ? 2    GLU C CG    1 
ATOM   3547  C  CD    . GLU C 2  2    ? 14.432  -23.305 117.289 1.00 78.84  ? 2    GLU C CD    1 
ATOM   3548  O  OE1   . GLU C 2  2    ? 14.885  -24.458 117.121 1.00 84.48  ? 2    GLU C OE1   1 
ATOM   3549  O  OE2   . GLU C 2  2    ? 13.661  -23.005 118.226 1.00 83.18  ? 2    GLU C OE2   1 
ATOM   3550  N  N     . ILE C 2  3    ? 15.432  -22.645 112.401 1.00 57.65  ? 3    ILE C N     1 
ATOM   3551  C  CA    . ILE C 2  3    ? 14.491  -22.780 111.292 1.00 47.34  ? 3    ILE C CA    1 
ATOM   3552  C  C     . ILE C 2  3    ? 13.674  -24.064 111.393 1.00 42.63  ? 3    ILE C C     1 
ATOM   3553  O  O     . ILE C 2  3    ? 14.218  -25.159 111.252 1.00 43.05  ? 3    ILE C O     1 
ATOM   3554  C  CB    . ILE C 2  3    ? 15.215  -22.779 109.928 1.00 40.88  ? 3    ILE C CB    1 
ATOM   3555  C  CG1   . ILE C 2  3    ? 15.970  -21.464 109.708 1.00 51.52  ? 3    ILE C CG1   1 
ATOM   3556  C  CG2   . ILE C 2  3    ? 14.225  -23.015 108.805 1.00 31.27  ? 3    ILE C CG2   1 
ATOM   3557  C  CD1   . ILE C 2  3    ? 17.431  -21.507 110.119 1.00 63.16  ? 3    ILE C CD1   1 
ATOM   3558  N  N     . LYS C 2  4    ? 12.369  -23.932 111.623 1.00 38.95  ? 4    LYS C N     1 
ATOM   3559  C  CA    . LYS C 2  4    ? 11.498  -25.106 111.684 1.00 41.59  ? 4    LYS C CA    1 
ATOM   3560  C  C     . LYS C 2  4    ? 10.819  -25.381 110.343 1.00 38.00  ? 4    LYS C C     1 
ATOM   3561  O  O     . LYS C 2  4    ? 10.243  -24.481 109.737 1.00 36.97  ? 4    LYS C O     1 
ATOM   3562  C  CB    . LYS C 2  4    ? 10.436  -24.961 112.777 1.00 36.12  ? 4    LYS C CB    1 
ATOM   3563  C  CG    . LYS C 2  4    ? 9.479   -26.147 112.823 1.00 45.90  ? 4    LYS C CG    1 
ATOM   3564  C  CD    . LYS C 2  4    ? 8.247   -25.888 113.673 1.00 53.91  ? 4    LYS C CD    1 
ATOM   3565  C  CE    . LYS C 2  4    ? 7.278   -27.063 113.573 1.00 49.92  ? 4    LYS C CE    1 
ATOM   3566  N  NZ    . LYS C 2  4    ? 6.033   -26.858 114.367 1.00 53.49  ? 4    LYS C NZ    1 
ATOM   3567  N  N     . ARG C 2  5    ? 10.867  -26.630 109.891 1.00 32.50  ? 5    ARG C N     1 
ATOM   3568  C  CA    . ARG C 2  5    ? 10.277  -26.984 108.605 1.00 32.78  ? 5    ARG C CA    1 
ATOM   3569  C  C     . ARG C 2  5    ? 9.021   -27.830 108.773 1.00 31.39  ? 5    ARG C C     1 
ATOM   3570  O  O     . ARG C 2  5    ? 8.891   -28.573 109.745 1.00 42.78  ? 5    ARG C O     1 
ATOM   3571  C  CB    . ARG C 2  5    ? 11.291  -27.713 107.722 1.00 33.63  ? 5    ARG C CB    1 
ATOM   3572  C  CG    . ARG C 2  5    ? 11.567  -29.147 108.129 1.00 48.70  ? 5    ARG C CG    1 
ATOM   3573  C  CD    . ARG C 2  5    ? 12.629  -29.779 107.243 1.00 57.15  ? 5    ARG C CD    1 
ATOM   3574  N  NE    . ARG C 2  5    ? 12.386  -29.526 105.826 1.00 60.00  ? 5    ARG C NE    1 
ATOM   3575  C  CZ    . ARG C 2  5    ? 13.120  -28.707 105.077 1.00 61.59  ? 5    ARG C CZ    1 
ATOM   3576  N  NH1   . ARG C 2  5    ? 14.150  -28.062 105.612 1.00 50.25  ? 5    ARG C NH1   1 
ATOM   3577  N  NH2   . ARG C 2  5    ? 12.824  -28.537 103.795 1.00 49.42  ? 5    ARG C NH2   1 
ATOM   3578  N  N     . PHE C 2  6    ? 8.093   -27.699 107.831 1.00 24.20  ? 6    PHE C N     1 
ATOM   3579  C  CA    . PHE C 2  6    ? 6.860   -28.472 107.868 1.00 27.13  ? 6    PHE C CA    1 
ATOM   3580  C  C     . PHE C 2  6    ? 6.793   -29.467 106.714 1.00 43.88  ? 6    PHE C C     1 
ATOM   3581  O  O     . PHE C 2  6    ? 7.689   -29.528 105.869 1.00 48.26  ? 6    PHE C O     1 
ATOM   3582  C  CB    . PHE C 2  6    ? 5.644   -27.550 107.779 1.00 28.04  ? 6    PHE C CB    1 
ATOM   3583  C  CG    . PHE C 2  6    ? 5.615   -26.465 108.816 1.00 29.27  ? 6    PHE C CG    1 
ATOM   3584  C  CD1   . PHE C 2  6    ? 5.122   -26.713 110.084 1.00 30.46  ? 6    PHE C CD1   1 
ATOM   3585  C  CD2   . PHE C 2  6    ? 6.055   -25.187 108.512 1.00 33.13  ? 6    PHE C CD2   1 
ATOM   3586  C  CE1   . PHE C 2  6    ? 5.086   -25.712 111.035 1.00 32.25  ? 6    PHE C CE1   1 
ATOM   3587  C  CE2   . PHE C 2  6    ? 6.018   -24.180 109.459 1.00 26.98  ? 6    PHE C CE2   1 
ATOM   3588  C  CZ    . PHE C 2  6    ? 5.534   -24.444 110.721 1.00 27.33  ? 6    PHE C CZ    1 
ATOM   3589  N  N     . GLY C 2  7    ? 5.711   -30.240 106.691 1.00 52.88  ? 7    GLY C N     1 
ATOM   3590  C  CA    . GLY C 2  7    ? 5.390   -31.129 105.588 1.00 57.13  ? 7    GLY C CA    1 
ATOM   3591  C  C     . GLY C 2  7    ? 5.803   -32.580 105.755 1.00 64.27  ? 7    GLY C C     1 
ATOM   3592  O  O     . GLY C 2  7    ? 6.836   -32.889 106.349 1.00 66.87  ? 7    GLY C O     1 
ATOM   3593  N  N     . ARG C 2  8    ? 4.983   -33.470 105.206 1.00 69.25  ? 8    ARG C N     1 
ATOM   3594  C  CA    . ARG C 2  8    ? 5.232   -34.907 105.246 1.00 74.27  ? 8    ARG C CA    1 
ATOM   3595  C  C     . ARG C 2  8    ? 6.211   -35.374 104.168 1.00 78.24  ? 8    ARG C C     1 
ATOM   3596  O  O     . ARG C 2  8    ? 7.094   -36.193 104.431 1.00 87.48  ? 8    ARG C O     1 
ATOM   3597  C  CB    . ARG C 2  8    ? 3.912   -35.674 105.108 1.00 82.69  ? 8    ARG C CB    1 
ATOM   3598  C  CG    . ARG C 2  8    ? 2.797   -35.192 106.029 1.00 81.07  ? 8    ARG C CG    1 
ATOM   3599  C  CD    . ARG C 2  8    ? 3.136   -35.424 107.495 1.00 102.98 ? 8    ARG C CD    1 
ATOM   3600  N  NE    . ARG C 2  8    ? 2.086   -34.932 108.386 1.00 108.94 ? 8    ARG C NE    1 
ATOM   3601  C  CZ    . ARG C 2  8    ? 2.157   -34.958 109.713 1.00 101.34 ? 8    ARG C CZ    1 
ATOM   3602  N  NH1   . ARG C 2  8    ? 3.232   -35.455 110.312 1.00 100.60 ? 8    ARG C NH1   1 
ATOM   3603  N  NH2   . ARG C 2  8    ? 1.155   -34.487 110.444 1.00 92.02  ? 8    ARG C NH2   1 
ATOM   3604  N  N     . ILE C 2  9    ? 6.045   -34.840 102.960 1.00 73.21  ? 9    ILE C N     1 
ATOM   3605  C  CA    . ILE C 2  9    ? 6.713   -35.358 101.762 1.00 82.09  ? 9    ILE C CA    1 
ATOM   3606  C  C     . ILE C 2  9    ? 8.244   -35.288 101.805 1.00 89.07  ? 9    ILE C C     1 
ATOM   3607  O  O     . ILE C 2  9    ? 8.824   -34.275 102.200 1.00 79.97  ? 9    ILE C O     1 
ATOM   3608  C  CB    . ILE C 2  9    ? 6.194   -34.657 100.475 1.00 78.60  ? 9    ILE C CB    1 
ATOM   3609  C  CG1   . ILE C 2  9    ? 4.666   -34.719 100.403 1.00 72.33  ? 9    ILE C CG1   1 
ATOM   3610  C  CG2   . ILE C 2  9    ? 6.805   -35.282 99.225  1.00 69.05  ? 9    ILE C CG2   1 
ATOM   3611  C  CD1   . ILE C 2  9    ? 4.087   -34.166 99.111  1.00 49.83  ? 9    ILE C CD1   1 
ATOM   3612  N  N     . ARG C 2  10   ? 8.882   -36.383 101.396 1.00 89.47  ? 10   ARG C N     1 
ATOM   3613  C  CA    . ARG C 2  10   ? 10.336  -36.468 101.315 1.00 86.39  ? 10   ARG C CA    1 
ATOM   3614  C  C     . ARG C 2  10   ? 10.740  -36.685 99.857  1.00 81.02  ? 10   ARG C C     1 
ATOM   3615  O  O     . ARG C 2  10   ? 10.239  -37.599 99.201  1.00 77.52  ? 10   ARG C O     1 
ATOM   3616  C  CB    . ARG C 2  10   ? 10.838  -37.627 102.177 1.00 83.41  ? 10   ARG C CB    1 
ATOM   3617  C  CG    . ARG C 2  10   ? 10.083  -37.783 103.491 1.00 93.96  ? 10   ARG C CG    1 
ATOM   3618  C  CD    . ARG C 2  10   ? 10.138  -39.218 103.998 1.00 113.89 ? 10   ARG C CD    1 
ATOM   3619  N  NE    . ARG C 2  10   ? 8.994   -39.539 104.849 1.00 121.00 ? 10   ARG C NE    1 
ATOM   3620  C  CZ    . ARG C 2  10   ? 8.722   -40.756 105.313 1.00 110.90 ? 10   ARG C CZ    1 
ATOM   3621  N  NH1   . ARG C 2  10   ? 9.514   -41.776 105.010 1.00 109.43 ? 10   ARG C NH1   1 
ATOM   3622  N  NH2   . ARG C 2  10   ? 7.657   -40.954 106.078 1.00 93.06  ? 10   ARG C NH2   1 
ATOM   3623  N  N     . GLU C 2  11   ? 11.646  -35.852 99.353  1.00 77.24  ? 11   GLU C N     1 
ATOM   3624  C  CA    . GLU C 2  11   ? 12.010  -35.896 97.937  1.00 66.53  ? 11   GLU C CA    1 
ATOM   3625  C  C     . GLU C 2  11   ? 13.159  -36.856 97.636  1.00 58.10  ? 11   GLU C C     1 
ATOM   3626  O  O     . GLU C 2  11   ? 14.283  -36.672 98.102  1.00 45.59  ? 11   GLU C O     1 
ATOM   3627  C  CB    . GLU C 2  11   ? 12.338  -34.495 97.413  1.00 61.15  ? 11   GLU C CB    1 
ATOM   3628  C  CG    . GLU C 2  11   ? 11.111  -33.649 97.104  1.00 61.78  ? 11   GLU C CG    1 
ATOM   3629  C  CD    . GLU C 2  11   ? 10.831  -32.600 98.164  1.00 65.80  ? 11   GLU C CD    1 
ATOM   3630  O  OE1   . GLU C 2  11   ? 11.792  -32.155 98.830  1.00 67.43  ? 11   GLU C OE1   1 
ATOM   3631  O  OE2   . GLU C 2  11   ? 9.651   -32.217 98.327  1.00 52.66  ? 11   GLU C OE2   1 
ATOM   3632  N  N     . VAL C 2  12   ? 12.862  -37.869 96.829  1.00 61.67  ? 12   VAL C N     1 
ATOM   3633  C  CA    . VAL C 2  12   ? 13.814  -38.932 96.526  1.00 57.51  ? 12   VAL C CA    1 
ATOM   3634  C  C     . VAL C 2  12   ? 14.992  -38.454 95.684  1.00 57.24  ? 12   VAL C C     1 
ATOM   3635  O  O     . VAL C 2  12   ? 16.046  -39.090 95.665  1.00 62.08  ? 12   VAL C O     1 
ATOM   3636  C  CB    . VAL C 2  12   ? 13.125  -40.110 95.807  1.00 51.75  ? 12   VAL C CB    1 
ATOM   3637  C  CG1   . VAL C 2  12   ? 12.067  -40.729 96.704  1.00 66.00  ? 12   VAL C CG1   1 
ATOM   3638  C  CG2   . VAL C 2  12   ? 12.507  -39.648 94.496  1.00 44.62  ? 12   VAL C CG2   1 
ATOM   3639  N  N     . ILE C 2  13   ? 14.812  -37.338 94.985  1.00 53.52  ? 13   ILE C N     1 
ATOM   3640  C  CA    . ILE C 2  13   ? 15.856  -36.807 94.118  1.00 47.47  ? 13   ILE C CA    1 
ATOM   3641  C  C     . ILE C 2  13   ? 15.946  -35.288 94.277  1.00 40.54  ? 13   ILE C C     1 
ATOM   3642  O  O     . ILE C 2  13   ? 14.925  -34.616 94.398  1.00 46.25  ? 13   ILE C O     1 
ATOM   3643  C  CB    . ILE C 2  13   ? 15.569  -37.200 92.640  1.00 38.80  ? 13   ILE C CB    1 
ATOM   3644  C  CG1   . ILE C 2  13   ? 16.513  -36.494 91.663  1.00 46.46  ? 13   ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C 2  13   ? 14.121  -36.915 92.279  1.00 36.84  ? 13   ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C 2  13   ? 17.787  -37.261 91.367  1.00 55.43  ? 13   ILE C CD1   1 
ATOM   3647  N  N     . PRO C 2  14   ? 17.173  -34.740 94.290  1.00 36.28  ? 14   PRO C N     1 
ATOM   3648  C  CA    . PRO C 2  14   ? 17.358  -33.286 94.320  1.00 33.91  ? 14   PRO C CA    1 
ATOM   3649  C  C     . PRO C 2  14   ? 17.086  -32.669 92.955  1.00 37.43  ? 14   PRO C C     1 
ATOM   3650  O  O     . PRO C 2  14   ? 17.083  -33.384 91.954  1.00 40.48  ? 14   PRO C O     1 
ATOM   3651  C  CB    . PRO C 2  14   ? 18.838  -33.132 94.679  1.00 27.50  ? 14   PRO C CB    1 
ATOM   3652  C  CG    . PRO C 2  14   ? 19.469  -34.374 94.181  1.00 29.98  ? 14   PRO C CG    1 
ATOM   3653  C  CD    . PRO C 2  14   ? 18.455  -35.455 94.417  1.00 40.52  ? 14   PRO C CD    1 
ATOM   3654  N  N     . LEU C 2  15   ? 16.856  -31.362 92.917  1.00 34.38  ? 15   LEU C N     1 
ATOM   3655  C  CA    . LEU C 2  15   ? 16.706  -30.659 91.650  1.00 32.31  ? 15   LEU C CA    1 
ATOM   3656  C  C     . LEU C 2  15   ? 18.007  -30.762 90.859  1.00 30.55  ? 15   LEU C C     1 
ATOM   3657  O  O     . LEU C 2  15   ? 19.094  -30.698 91.436  1.00 31.55  ? 15   LEU C O     1 
ATOM   3658  C  CB    . LEU C 2  15   ? 16.357  -29.184 91.882  1.00 36.17  ? 15   LEU C CB    1 
ATOM   3659  C  CG    . LEU C 2  15   ? 14.956  -28.795 92.362  1.00 28.59  ? 15   LEU C CG    1 
ATOM   3660  C  CD1   . LEU C 2  15   ? 14.722  -29.188 93.812  1.00 36.15  ? 15   LEU C CD1   1 
ATOM   3661  C  CD2   . LEU C 2  15   ? 14.743  -27.307 92.177  1.00 20.55  ? 15   LEU C CD2   1 
ATOM   3662  N  N     . PRO C 2  16   ? 17.903  -30.926 89.532  1.00 24.47  ? 16   PRO C N     1 
ATOM   3663  C  CA    . PRO C 2  16   ? 19.091  -30.985 88.674  1.00 30.20  ? 16   PRO C CA    1 
ATOM   3664  C  C     . PRO C 2  16   ? 19.805  -29.645 88.709  1.00 32.64  ? 16   PRO C C     1 
ATOM   3665  O  O     . PRO C 2  16   ? 19.200  -28.673 89.160  1.00 38.19  ? 16   PRO C O     1 
ATOM   3666  C  CB    . PRO C 2  16   ? 18.504  -31.225 87.278  1.00 31.69  ? 16   PRO C CB    1 
ATOM   3667  C  CG    . PRO C 2  16   ? 17.152  -31.808 87.521  1.00 27.47  ? 16   PRO C CG    1 
ATOM   3668  C  CD    . PRO C 2  16   ? 16.662  -31.149 88.774  1.00 28.12  ? 16   PRO C CD    1 
ATOM   3669  N  N     . PRO C 2  17   ? 21.075  -29.591 88.279  1.00 34.53  ? 17   PRO C N     1 
ATOM   3670  C  CA    . PRO C 2  17   ? 21.723  -28.278 88.185  1.00 36.91  ? 17   PRO C CA    1 
ATOM   3671  C  C     . PRO C 2  17   ? 20.861  -27.370 87.317  1.00 34.57  ? 17   PRO C C     1 
ATOM   3672  O  O     . PRO C 2  17   ? 20.455  -27.773 86.230  1.00 31.16  ? 17   PRO C O     1 
ATOM   3673  C  CB    . PRO C 2  17   ? 23.046  -28.595 87.489  1.00 34.43  ? 17   PRO C CB    1 
ATOM   3674  C  CG    . PRO C 2  17   ? 23.323  -30.012 87.856  1.00 32.34  ? 17   PRO C CG    1 
ATOM   3675  C  CD    . PRO C 2  17   ? 21.982  -30.688 87.903  1.00 28.58  ? 17   PRO C CD    1 
ATOM   3676  N  N     . LEU C 2  18   ? 20.568  -26.169 87.799  1.00 31.57  ? 18   LEU C N     1 
ATOM   3677  C  CA    . LEU C 2  18   ? 19.534  -25.348 87.177  1.00 26.39  ? 18   LEU C CA    1 
ATOM   3678  C  C     . LEU C 2  18   ? 19.992  -24.676 85.885  1.00 28.08  ? 18   LEU C C     1 
ATOM   3679  O  O     . LEU C 2  18   ? 19.173  -24.332 85.034  1.00 30.77  ? 18   LEU C O     1 
ATOM   3680  C  CB    . LEU C 2  18   ? 18.990  -24.330 88.179  1.00 24.69  ? 18   LEU C CB    1 
ATOM   3681  C  CG    . LEU C 2  18   ? 18.306  -24.988 89.383  1.00 25.55  ? 18   LEU C CG    1 
ATOM   3682  C  CD1   . LEU C 2  18   ? 17.978  -23.979 90.474  1.00 13.82  ? 18   LEU C CD1   1 
ATOM   3683  C  CD2   . LEU C 2  18   ? 17.053  -25.737 88.940  1.00 28.45  ? 18   LEU C CD2   1 
ATOM   3684  N  N     . THR C 2  19   ? 21.300  -24.505 85.739  1.00 26.86  ? 19   THR C N     1 
ATOM   3685  C  CA    . THR C 2  19   ? 21.864  -23.946 84.517  1.00 23.21  ? 19   THR C CA    1 
ATOM   3686  C  C     . THR C 2  19   ? 22.279  -25.044 83.542  1.00 24.51  ? 19   THR C C     1 
ATOM   3687  O  O     . THR C 2  19   ? 22.855  -24.759 82.493  1.00 22.03  ? 19   THR C O     1 
ATOM   3688  C  CB    . THR C 2  19   ? 23.071  -23.038 84.809  1.00 23.60  ? 19   THR C CB    1 
ATOM   3689  O  OG1   . THR C 2  19   ? 24.084  -23.788 85.489  1.00 29.49  ? 19   THR C OG1   1 
ATOM   3690  C  CG2   . THR C 2  19   ? 22.650  -21.862 85.677  1.00 31.38  ? 19   THR C CG2   1 
ATOM   3691  N  N     . GLU C 2  20   ? 21.997  -26.297 83.897  1.00 27.00  ? 20   GLU C N     1 
ATOM   3692  C  CA    . GLU C 2  20   ? 22.476  -27.440 83.117  1.00 28.68  ? 20   GLU C CA    1 
ATOM   3693  C  C     . GLU C 2  20   ? 21.997  -27.438 81.670  1.00 24.96  ? 20   GLU C C     1 
ATOM   3694  O  O     . GLU C 2  20   ? 22.657  -28.001 80.800  1.00 28.09  ? 20   GLU C O     1 
ATOM   3695  C  CB    . GLU C 2  20   ? 22.101  -28.772 83.773  1.00 29.49  ? 20   GLU C CB    1 
ATOM   3696  C  CG    . GLU C 2  20   ? 20.694  -29.250 83.447  1.00 37.23  ? 20   GLU C CG    1 
ATOM   3697  C  CD    . GLU C 2  20   ? 20.545  -30.755 83.551  1.00 38.60  ? 20   GLU C CD    1 
ATOM   3698  O  OE1   . GLU C 2  20   ? 21.571  -31.462 83.468  1.00 35.15  ? 20   GLU C OE1   1 
ATOM   3699  O  OE2   . GLU C 2  20   ? 19.401  -31.229 83.713  1.00 39.06  ? 20   GLU C OE2   1 
ATOM   3700  N  N     . ILE C 2  21   ? 20.852  -26.819 81.410  1.00 20.84  ? 21   ILE C N     1 
ATOM   3701  C  CA    . ILE C 2  21   ? 20.350  -26.752 80.044  1.00 19.51  ? 21   ILE C CA    1 
ATOM   3702  C  C     . ILE C 2  21   ? 21.367  -26.030 79.150  1.00 22.97  ? 21   ILE C C     1 
ATOM   3703  O  O     . ILE C 2  21   ? 21.882  -26.610 78.186  1.00 29.33  ? 21   ILE C O     1 
ATOM   3704  C  CB    . ILE C 2  21   ? 18.928  -26.122 79.984  1.00 17.21  ? 21   ILE C CB    1 
ATOM   3705  C  CG1   . ILE C 2  21   ? 18.488  -25.894 78.541  1.00 12.07  ? 21   ILE C CG1   1 
ATOM   3706  C  CG2   . ILE C 2  21   ? 18.850  -24.832 80.796  1.00 18.79  ? 21   ILE C CG2   1 
ATOM   3707  C  CD1   . ILE C 2  21   ? 16.990  -25.772 78.393  1.00 12.57  ? 21   ILE C CD1   1 
ATOM   3708  N  N     . GLN C 2  22   ? 21.704  -24.799 79.525  1.00 20.27  ? 22   GLN C N     1 
ATOM   3709  C  CA    . GLN C 2  22   ? 22.683  -23.990 78.811  1.00 18.49  ? 22   GLN C CA    1 
ATOM   3710  C  C     . GLN C 2  22   ? 24.054  -24.662 78.758  1.00 23.06  ? 22   GLN C C     1 
ATOM   3711  O  O     . GLN C 2  22   ? 24.598  -24.927 77.672  1.00 22.78  ? 22   GLN C O     1 
ATOM   3712  C  CB    . GLN C 2  22   ? 22.829  -22.638 79.513  1.00 17.22  ? 22   GLN C CB    1 
ATOM   3713  C  CG    . GLN C 2  22   ? 21.532  -21.873 79.685  1.00 11.56  ? 22   GLN C CG    1 
ATOM   3714  C  CD    . GLN C 2  22   ? 21.120  -21.161 78.420  1.00 15.14  ? 22   GLN C CD    1 
ATOM   3715  O  OE1   . GLN C 2  22   ? 21.908  -21.036 77.482  1.00 14.84  ? 22   GLN C OE1   1 
ATOM   3716  N  NE2   . GLN C 2  22   ? 19.878  -20.689 78.383  1.00 17.00  ? 22   GLN C NE2   1 
ATOM   3717  N  N     . VAL C 2  23   ? 24.594  -24.950 79.941  1.00 19.79  ? 23   VAL C N     1 
ATOM   3718  C  CA    . VAL C 2  23   ? 25.949  -25.470 80.076  1.00 16.34  ? 23   VAL C CA    1 
ATOM   3719  C  C     . VAL C 2  23   ? 26.148  -26.769 79.314  1.00 19.56  ? 23   VAL C C     1 
ATOM   3720  O  O     . VAL C 2  23   ? 27.083  -26.894 78.525  1.00 20.71  ? 23   VAL C O     1 
ATOM   3721  C  CB    . VAL C 2  23   ? 26.324  -25.690 81.547  1.00 14.99  ? 23   VAL C CB    1 
ATOM   3722  C  CG1   . VAL C 2  23   ? 27.663  -26.393 81.647  1.00 28.52  ? 23   VAL C CG1   1 
ATOM   3723  C  CG2   . VAL C 2  23   ? 26.366  -24.366 82.283  1.00 23.82  ? 23   VAL C CG2   1 
ATOM   3724  N  N     . GLU C 2  24   ? 25.259  -27.730 79.537  1.00 21.80  ? 24   GLU C N     1 
ATOM   3725  C  CA    . GLU C 2  24   ? 25.388  -29.023 78.881  1.00 22.80  ? 24   GLU C CA    1 
ATOM   3726  C  C     . GLU C 2  24   ? 25.096  -28.933 77.386  1.00 22.53  ? 24   GLU C C     1 
ATOM   3727  O  O     . GLU C 2  24   ? 25.721  -29.641 76.593  1.00 22.30  ? 24   GLU C O     1 
ATOM   3728  C  CB    . GLU C 2  24   ? 24.506  -30.079 79.553  1.00 26.00  ? 24   GLU C CB    1 
ATOM   3729  C  CG    . GLU C 2  24   ? 25.159  -31.450 79.648  1.00 42.13  ? 24   GLU C CG    1 
ATOM   3730  C  CD    . GLU C 2  24   ? 26.507  -31.409 80.352  1.00 46.61  ? 24   GLU C CD    1 
ATOM   3731  O  OE1   . GLU C 2  24   ? 26.619  -30.718 81.389  1.00 46.03  ? 24   GLU C OE1   1 
ATOM   3732  O  OE2   . GLU C 2  24   ? 27.457  -32.060 79.866  1.00 40.84  ? 24   GLU C OE2   1 
ATOM   3733  N  N     . SER C 2  25   ? 24.162  -28.065 76.995  1.00 25.65  ? 25   SER C N     1 
ATOM   3734  C  CA    . SER C 2  25   ? 23.903  -27.862 75.568  1.00 23.20  ? 25   SER C CA    1 
ATOM   3735  C  C     . SER C 2  25   ? 25.162  -27.388 74.850  1.00 19.79  ? 25   SER C C     1 
ATOM   3736  O  O     . SER C 2  25   ? 25.588  -27.978 73.847  1.00 16.24  ? 25   SER C O     1 
ATOM   3737  C  CB    . SER C 2  25   ? 22.773  -26.855 75.345  1.00 23.33  ? 25   SER C CB    1 
ATOM   3738  O  OG    . SER C 2  25   ? 22.518  -26.666 73.965  1.00 26.26  ? 25   SER C OG    1 
ATOM   3739  N  N     . TYR C 2  26   ? 25.764  -26.325 75.374  1.00 22.29  ? 26   TYR C N     1 
ATOM   3740  C  CA    . TYR C 2  26   ? 26.944  -25.759 74.734  1.00 19.51  ? 26   TYR C CA    1 
ATOM   3741  C  C     . TYR C 2  26   ? 28.129  -26.714 74.803  1.00 22.57  ? 26   TYR C C     1 
ATOM   3742  O  O     . TYR C 2  26   ? 28.922  -26.804 73.864  1.00 23.51  ? 26   TYR C O     1 
ATOM   3743  C  CB    . TYR C 2  26   ? 27.311  -24.417 75.358  1.00 17.36  ? 26   TYR C CB    1 
ATOM   3744  C  CG    . TYR C 2  26   ? 27.980  -23.487 74.381  1.00 17.55  ? 26   TYR C CG    1 
ATOM   3745  C  CD1   . TYR C 2  26   ? 27.327  -23.091 73.223  1.00 14.39  ? 26   TYR C CD1   1 
ATOM   3746  C  CD2   . TYR C 2  26   ? 29.263  -23.008 74.609  1.00 17.54  ? 26   TYR C CD2   1 
ATOM   3747  C  CE1   . TYR C 2  26   ? 27.928  -22.244 72.320  1.00 13.37  ? 26   TYR C CE1   1 
ATOM   3748  C  CE2   . TYR C 2  26   ? 29.874  -22.158 73.709  1.00 14.48  ? 26   TYR C CE2   1 
ATOM   3749  C  CZ    . TYR C 2  26   ? 29.199  -21.780 72.568  1.00 12.38  ? 26   TYR C CZ    1 
ATOM   3750  O  OH    . TYR C 2  26   ? 29.794  -20.933 71.666  1.00 14.06  ? 26   TYR C OH    1 
ATOM   3751  N  N     . ARG C 2  27   ? 28.242  -27.428 75.917  1.00 27.15  ? 27   ARG C N     1 
ATOM   3752  C  CA    . ARG C 2  27   ? 29.310  -28.402 76.086  1.00 22.93  ? 27   ARG C CA    1 
ATOM   3753  C  C     . ARG C 2  27   ? 29.194  -29.495 75.030  1.00 20.79  ? 27   ARG C C     1 
ATOM   3754  O  O     . ARG C 2  27   ? 30.194  -29.917 74.456  1.00 25.64  ? 27   ARG C O     1 
ATOM   3755  C  CB    . ARG C 2  27   ? 29.271  -29.005 77.490  1.00 28.00  ? 27   ARG C CB    1 
ATOM   3756  C  CG    . ARG C 2  27   ? 30.501  -29.813 77.850  1.00 34.86  ? 27   ARG C CG    1 
ATOM   3757  C  CD    . ARG C 2  27   ? 30.272  -30.618 79.115  1.00 44.45  ? 27   ARG C CD    1 
ATOM   3758  N  NE    . ARG C 2  27   ? 30.853  -31.952 79.006  1.00 70.06  ? 27   ARG C NE    1 
ATOM   3759  C  CZ    . ARG C 2  27   ? 30.257  -32.981 78.409  1.00 70.91  ? 27   ARG C CZ    1 
ATOM   3760  N  NH1   . ARG C 2  27   ? 29.056  -32.833 77.862  1.00 39.80  ? 27   ARG C NH1   1 
ATOM   3761  N  NH2   . ARG C 2  27   ? 30.864  -34.161 78.356  1.00 77.60  ? 27   ARG C NH2   1 
ATOM   3762  N  N     . ARG C 2  28   ? 27.970  -29.941 74.766  1.00 20.62  ? 28   ARG C N     1 
ATOM   3763  C  CA    . ARG C 2  28   ? 27.742  -30.929 73.716  1.00 22.77  ? 28   ARG C CA    1 
ATOM   3764  C  C     . ARG C 2  28   ? 28.039  -30.351 72.336  1.00 27.38  ? 28   ARG C C     1 
ATOM   3765  O  O     . ARG C 2  28   ? 28.557  -31.047 71.461  1.00 27.59  ? 28   ARG C O     1 
ATOM   3766  C  CB    . ARG C 2  28   ? 26.307  -31.457 73.752  1.00 25.58  ? 28   ARG C CB    1 
ATOM   3767  C  CG    . ARG C 2  28   ? 26.159  -32.835 74.371  1.00 39.14  ? 28   ARG C CG    1 
ATOM   3768  C  CD    . ARG C 2  28   ? 24.846  -33.476 73.949  1.00 53.91  ? 28   ARG C CD    1 
ATOM   3769  N  NE    . ARG C 2  28   ? 24.772  -33.646 72.500  1.00 68.58  ? 28   ARG C NE    1 
ATOM   3770  C  CZ    . ARG C 2  28   ? 23.705  -34.104 71.851  1.00 71.28  ? 28   ARG C CZ    1 
ATOM   3771  N  NH1   . ARG C 2  28   ? 23.732  -34.226 70.529  1.00 50.50  ? 28   ARG C NH1   1 
ATOM   3772  N  NH2   . ARG C 2  28   ? 22.610  -34.440 72.521  1.00 63.83  ? 28   ARG C NH2   1 
ATOM   3773  N  N     . ALA C 2  29   ? 27.705  -29.079 72.141  1.00 26.88  ? 29   ALA C N     1 
ATOM   3774  C  CA    . ALA C 2  29   ? 27.925  -28.440 70.846  1.00 20.52  ? 29   ALA C CA    1 
ATOM   3775  C  C     . ALA C 2  29   ? 29.406  -28.268 70.503  1.00 26.30  ? 29   ALA C C     1 
ATOM   3776  O  O     . ALA C 2  29   ? 29.806  -28.467 69.356  1.00 28.95  ? 29   ALA C O     1 
ATOM   3777  C  CB    . ALA C 2  29   ? 27.215  -27.103 70.789  1.00 25.12  ? 29   ALA C CB    1 
ATOM   3778  N  N     . LEU C 2  30   ? 30.213  -27.885 71.490  1.00 27.42  ? 30   LEU C N     1 
ATOM   3779  C  CA    . LEU C 2  30   ? 31.635  -27.632 71.249  1.00 24.56  ? 30   LEU C CA    1 
ATOM   3780  C  C     . LEU C 2  30   ? 32.499  -28.888 71.173  1.00 23.40  ? 30   LEU C C     1 
ATOM   3781  O  O     . LEU C 2  30   ? 33.356  -28.998 70.296  1.00 24.89  ? 30   LEU C O     1 
ATOM   3782  C  CB    . LEU C 2  30   ? 32.213  -26.694 72.312  1.00 26.61  ? 30   LEU C CB    1 
ATOM   3783  C  CG    . LEU C 2  30   ? 31.787  -25.227 72.303  1.00 21.50  ? 30   LEU C CG    1 
ATOM   3784  C  CD1   . LEU C 2  30   ? 32.600  -24.451 73.327  1.00 24.61  ? 30   LEU C CD1   1 
ATOM   3785  C  CD2   . LEU C 2  30   ? 31.934  -24.617 70.921  1.00 12.97  ? 30   LEU C CD2   1 
ATOM   3786  N  N     . GLN C 2  31   ? 32.270  -29.827 72.090  1.00 26.06  ? 31   GLN C N     1 
ATOM   3787  C  CA    . GLN C 2  31   ? 33.147  -30.989 72.255  1.00 30.01  ? 31   GLN C CA    1 
ATOM   3788  C  C     . GLN C 2  31   ? 34.608  -30.561 72.406  1.00 28.46  ? 31   GLN C C     1 
ATOM   3789  O  O     . GLN C 2  31   ? 35.497  -31.138 71.783  1.00 28.88  ? 31   GLN C O     1 
ATOM   3790  C  CB    . GLN C 2  31   ? 33.012  -31.958 71.076  1.00 23.06  ? 31   GLN C CB    1 
ATOM   3791  C  CG    . GLN C 2  31   ? 31.645  -32.592 70.916  1.00 19.38  ? 31   GLN C CG    1 
ATOM   3792  C  CD    . GLN C 2  31   ? 31.628  -33.639 69.819  1.00 26.96  ? 31   GLN C CD    1 
ATOM   3793  O  OE1   . GLN C 2  31   ? 31.670  -34.840 70.090  1.00 31.89  ? 31   GLN C OE1   1 
ATOM   3794  N  NE2   . GLN C 2  31   ? 31.577  -33.188 68.571  1.00 28.86  ? 31   GLN C NE2   1 
ATOM   3795  N  N     . ALA C 2  32   ? 34.847  -29.542 73.225  1.00 24.99  ? 32   ALA C N     1 
ATOM   3796  C  CA    . ALA C 2  32   ? 36.179  -28.959 73.357  1.00 26.87  ? 32   ALA C CA    1 
ATOM   3797  C  C     . ALA C 2  32   ? 37.118  -29.776 74.242  1.00 31.80  ? 32   ALA C C     1 
ATOM   3798  O  O     . ALA C 2  32   ? 38.338  -29.696 74.104  1.00 36.39  ? 32   ALA C O     1 
ATOM   3799  C  CB    . ALA C 2  32   ? 36.080  -27.529 73.869  1.00 33.08  ? 32   ALA C CB    1 
ATOM   3800  N  N     . ASP C 2  33   ? 36.545  -30.550 75.157  1.00 33.86  ? 33   ASP C N     1 
ATOM   3801  C  CA    . ASP C 2  33   ? 37.332  -31.355 76.088  1.00 36.06  ? 33   ASP C CA    1 
ATOM   3802  C  C     . ASP C 2  33   ? 37.541  -32.775 75.568  1.00 40.66  ? 33   ASP C C     1 
ATOM   3803  O  O     . ASP C 2  33   ? 38.110  -33.623 76.256  1.00 44.50  ? 33   ASP C O     1 
ATOM   3804  C  CB    . ASP C 2  33   ? 36.674  -31.379 77.468  1.00 44.02  ? 33   ASP C CB    1 
ATOM   3805  C  CG    . ASP C 2  33   ? 36.460  -29.986 78.035  1.00 53.98  ? 33   ASP C CG    1 
ATOM   3806  O  OD1   . ASP C 2  33   ? 37.175  -29.052 77.604  1.00 45.84  ? 33   ASP C OD1   1 
ATOM   3807  O  OD2   . ASP C 2  33   ? 35.580  -29.825 78.909  1.00 54.64  ? 33   ASP C OD2   1 
ATOM   3808  N  N     . VAL C 2  34   ? 37.060  -33.028 74.356  1.00 38.22  ? 34   VAL C N     1 
ATOM   3809  C  CA    . VAL C 2  34   ? 37.190  -34.333 73.719  1.00 29.06  ? 34   VAL C CA    1 
ATOM   3810  C  C     . VAL C 2  34   ? 38.344  -34.342 72.719  1.00 33.31  ? 34   VAL C C     1 
ATOM   3811  O  O     . VAL C 2  34   ? 38.442  -33.448 71.872  1.00 32.94  ? 34   VAL C O     1 
ATOM   3812  C  CB    . VAL C 2  34   ? 35.889  -34.725 72.987  1.00 23.55  ? 34   VAL C CB    1 
ATOM   3813  C  CG1   . VAL C 2  34   ? 36.046  -36.064 72.290  1.00 25.30  ? 34   VAL C CG1   1 
ATOM   3814  C  CG2   . VAL C 2  34   ? 34.727  -34.760 73.959  1.00 23.64  ? 34   VAL C CG2   1 
ATOM   3815  N  N     . PRO C 2  35   ? 39.236  -35.341 72.828  1.00 31.19  ? 35   PRO C N     1 
ATOM   3816  C  CA    . PRO C 2  35   ? 40.284  -35.547 71.823  1.00 29.43  ? 35   PRO C CA    1 
ATOM   3817  C  C     . PRO C 2  35   ? 39.656  -35.834 70.464  1.00 28.02  ? 35   PRO C C     1 
ATOM   3818  O  O     . PRO C 2  35   ? 38.766  -36.677 70.378  1.00 29.35  ? 35   PRO C O     1 
ATOM   3819  C  CB    . PRO C 2  35   ? 41.038  -36.773 72.345  1.00 26.53  ? 35   PRO C CB    1 
ATOM   3820  C  CG    . PRO C 2  35   ? 40.108  -37.429 73.294  1.00 28.87  ? 35   PRO C CG    1 
ATOM   3821  C  CD    . PRO C 2  35   ? 39.314  -36.331 73.912  1.00 29.93  ? 35   PRO C CD    1 
ATOM   3822  N  N     . PRO C 2  36   ? 40.136  -35.152 69.413  1.00 26.36  ? 36   PRO C N     1 
ATOM   3823  C  CA    . PRO C 2  36   ? 39.495  -35.043 68.097  1.00 34.55  ? 36   PRO C CA    1 
ATOM   3824  C  C     . PRO C 2  36   ? 38.997  -36.356 67.490  1.00 40.14  ? 36   PRO C C     1 
ATOM   3825  O  O     . PRO C 2  36   ? 37.901  -36.381 66.928  1.00 39.77  ? 36   PRO C O     1 
ATOM   3826  C  CB    . PRO C 2  36   ? 40.612  -34.458 67.230  1.00 32.32  ? 36   PRO C CB    1 
ATOM   3827  C  CG    . PRO C 2  36   ? 41.383  -33.616 68.171  1.00 26.19  ? 36   PRO C CG    1 
ATOM   3828  C  CD    . PRO C 2  36   ? 41.374  -34.358 69.480  1.00 28.80  ? 36   PRO C CD    1 
ATOM   3829  N  N     . GLU C 2  37   ? 39.774  -37.427 67.607  1.00 46.95  ? 37   GLU C N     1 
ATOM   3830  C  CA    . GLU C 2  37   ? 39.396  -38.704 67.008  1.00 43.20  ? 37   GLU C CA    1 
ATOM   3831  C  C     . GLU C 2  37   ? 38.150  -39.306 67.667  1.00 41.18  ? 37   GLU C C     1 
ATOM   3832  O  O     . GLU C 2  37   ? 37.465  -40.140 67.074  1.00 41.03  ? 37   GLU C O     1 
ATOM   3833  C  CB    . GLU C 2  37   ? 40.563  -39.693 67.074  1.00 37.28  ? 37   GLU C CB    1 
ATOM   3834  C  CG    . GLU C 2  37   ? 41.003  -40.051 68.491  1.00 43.65  ? 37   GLU C CG    1 
ATOM   3835  C  CD    . GLU C 2  37   ? 41.925  -39.017 69.107  1.00 46.32  ? 37   GLU C CD    1 
ATOM   3836  O  OE1   . GLU C 2  37   ? 42.436  -38.152 68.363  1.00 42.66  ? 37   GLU C OE1   1 
ATOM   3837  O  OE2   . GLU C 2  37   ? 42.137  -39.075 70.338  1.00 44.42  ? 37   GLU C OE2   1 
ATOM   3838  N  N     . LYS C 2  38   ? 37.860  -38.872 68.889  1.00 34.06  ? 38   LYS C N     1 
ATOM   3839  C  CA    . LYS C 2  38   ? 36.734  -39.402 69.648  1.00 32.83  ? 38   LYS C CA    1 
ATOM   3840  C  C     . LYS C 2  38   ? 35.458  -38.568 69.503  1.00 37.39  ? 38   LYS C C     1 
ATOM   3841  O  O     . LYS C 2  38   ? 34.442  -38.869 70.133  1.00 38.11  ? 38   LYS C O     1 
ATOM   3842  C  CB    . LYS C 2  38   ? 37.100  -39.513 71.128  1.00 35.17  ? 38   LYS C CB    1 
ATOM   3843  C  CG    . LYS C 2  38   ? 38.270  -40.430 71.433  1.00 27.97  ? 38   LYS C CG    1 
ATOM   3844  C  CD    . LYS C 2  38   ? 38.450  -40.545 72.936  1.00 23.56  ? 38   LYS C CD    1 
ATOM   3845  C  CE    . LYS C 2  38   ? 39.665  -41.364 73.307  1.00 25.80  ? 38   LYS C CE    1 
ATOM   3846  N  NZ    . LYS C 2  38   ? 39.923  -41.283 74.772  1.00 34.24  ? 38   LYS C NZ    1 
ATOM   3847  N  N     . ARG C 2  39   ? 35.510  -37.517 68.689  1.00 36.87  ? 39   ARG C N     1 
ATOM   3848  C  CA    . ARG C 2  39   ? 34.363  -36.622 68.552  1.00 36.97  ? 39   ARG C CA    1 
ATOM   3849  C  C     . ARG C 2  39   ? 33.173  -37.313 67.889  1.00 37.91  ? 39   ARG C C     1 
ATOM   3850  O  O     . ARG C 2  39   ? 33.343  -38.255 67.115  1.00 33.21  ? 39   ARG C O     1 
ATOM   3851  C  CB    . ARG C 2  39   ? 34.742  -35.330 67.823  1.00 31.21  ? 39   ARG C CB    1 
ATOM   3852  C  CG    . ARG C 2  39   ? 35.608  -34.393 68.654  1.00 25.61  ? 39   ARG C CG    1 
ATOM   3853  C  CD    . ARG C 2  39   ? 35.493  -32.954 68.174  1.00 30.52  ? 39   ARG C CD    1 
ATOM   3854  N  NE    . ARG C 2  39   ? 36.229  -32.026 69.029  1.00 25.09  ? 39   ARG C NE    1 
ATOM   3855  C  CZ    . ARG C 2  39   ? 37.368  -31.435 68.682  1.00 26.77  ? 39   ARG C CZ    1 
ATOM   3856  N  NH1   . ARG C 2  39   ? 37.899  -31.664 67.488  1.00 27.93  ? 39   ARG C NH1   1 
ATOM   3857  N  NH2   . ARG C 2  39   ? 37.969  -30.607 69.525  1.00 28.01  ? 39   ARG C NH2   1 
ATOM   3858  N  N     . GLU C 2  40   ? 31.973  -36.827 68.196  1.00 38.93  ? 40   GLU C N     1 
ATOM   3859  C  CA    . GLU C 2  40   ? 30.737  -37.557 67.917  1.00 36.85  ? 40   GLU C CA    1 
ATOM   3860  C  C     . GLU C 2  40   ? 30.012  -37.233 66.612  1.00 40.43  ? 40   GLU C C     1 
ATOM   3861  O  O     . GLU C 2  40   ? 28.979  -37.841 66.325  1.00 54.06  ? 40   GLU C O     1 
ATOM   3862  C  CB    . GLU C 2  40   ? 29.761  -37.367 69.079  1.00 36.62  ? 40   GLU C CB    1 
ATOM   3863  C  CG    . GLU C 2  40   ? 30.002  -38.290 70.254  1.00 52.13  ? 40   GLU C CG    1 
ATOM   3864  C  CD    . GLU C 2  40   ? 28.974  -39.400 70.324  1.00 65.45  ? 40   GLU C CD    1 
ATOM   3865  O  OE1   . GLU C 2  40   ? 28.020  -39.377 69.516  1.00 51.73  ? 40   GLU C OE1   1 
ATOM   3866  O  OE2   . GLU C 2  40   ? 29.119  -40.292 71.188  1.00 77.30  ? 40   GLU C OE2   1 
ATOM   3867  N  N     . ASN C 2  41   ? 30.540  -36.295 65.830  1.00 35.33  ? 41   ASN C N     1 
ATOM   3868  C  CA    . ASN C 2  41   ? 29.828  -35.773 64.656  1.00 41.35  ? 41   ASN C CA    1 
ATOM   3869  C  C     . ASN C 2  41   ? 28.488  -35.152 65.055  1.00 37.78  ? 41   ASN C C     1 
ATOM   3870  O  O     . ASN C 2  41   ? 27.441  -35.439 64.474  1.00 32.42  ? 41   ASN C O     1 
ATOM   3871  C  CB    . ASN C 2  41   ? 29.652  -36.839 63.563  1.00 47.43  ? 41   ASN C CB    1 
ATOM   3872  C  CG    . ASN C 2  41   ? 28.993  -36.289 62.302  1.00 46.02  ? 41   ASN C CG    1 
ATOM   3873  O  OD1   . ASN C 2  41   ? 29.657  -35.733 61.429  1.00 49.05  ? 41   ASN C OD1   1 
ATOM   3874  N  ND2   . ASN C 2  41   ? 27.677  -36.438 62.212  1.00 44.51  ? 41   ASN C ND2   1 
ATOM   3875  N  N     . VAL C 2  42   ? 28.534  -34.314 66.081  1.00 36.87  ? 42   VAL C N     1 
ATOM   3876  C  CA    . VAL C 2  42   ? 27.381  -33.527 66.480  1.00 27.86  ? 42   VAL C CA    1 
ATOM   3877  C  C     . VAL C 2  42   ? 27.843  -32.088 66.645  1.00 29.75  ? 42   VAL C C     1 
ATOM   3878  O  O     . VAL C 2  42   ? 29.021  -31.837 66.902  1.00 35.77  ? 42   VAL C O     1 
ATOM   3879  C  CB    . VAL C 2  42   ? 26.749  -34.049 67.783  1.00 22.46  ? 42   VAL C CB    1 
ATOM   3880  C  CG1   . VAL C 2  42   ? 26.159  -35.434 67.567  1.00 22.37  ? 42   VAL C CG1   1 
ATOM   3881  C  CG2   . VAL C 2  42   ? 27.773  -34.069 68.904  1.00 27.22  ? 42   VAL C CG2   1 
ATOM   3882  N  N     . GLY C 2  43   ? 26.927  -31.144 66.467  1.00 31.46  ? 43   GLY C N     1 
ATOM   3883  C  CA    . GLY C 2  43   ? 27.258  -29.737 66.600  1.00 30.96  ? 43   GLY C CA    1 
ATOM   3884  C  C     . GLY C 2  43   ? 28.288  -29.262 65.590  1.00 30.73  ? 43   GLY C C     1 
ATOM   3885  O  O     . GLY C 2  43   ? 28.114  -29.430 64.381  1.00 36.63  ? 43   GLY C O     1 
ATOM   3886  N  N     . ILE C 2  44   ? 29.368  -28.668 66.093  1.00 29.23  ? 44   ILE C N     1 
ATOM   3887  C  CA    . ILE C 2  44   ? 30.414  -28.109 65.243  1.00 29.11  ? 44   ILE C CA    1 
ATOM   3888  C  C     . ILE C 2  44   ? 31.058  -29.168 64.360  1.00 29.80  ? 44   ILE C C     1 
ATOM   3889  O  O     . ILE C 2  44   ? 31.242  -28.953 63.158  1.00 31.89  ? 44   ILE C O     1 
ATOM   3890  C  CB    . ILE C 2  44   ? 31.498  -27.411 66.074  1.00 28.03  ? 44   ILE C CB    1 
ATOM   3891  C  CG1   . ILE C 2  44   ? 30.900  -26.232 66.833  1.00 22.91  ? 44   ILE C CG1   1 
ATOM   3892  C  CG2   . ILE C 2  44   ? 32.635  -26.929 65.187  1.00 27.04  ? 44   ILE C CG2   1 
ATOM   3893  C  CD1   . ILE C 2  44   ? 31.936  -25.350 67.449  1.00 31.55  ? 44   ILE C CD1   1 
ATOM   3894  N  N     . GLN C 2  45   ? 31.400  -30.305 64.961  1.00 31.87  ? 45   GLN C N     1 
ATOM   3895  C  CA    . GLN C 2  45   ? 31.997  -31.409 64.221  1.00 30.46  ? 45   GLN C CA    1 
ATOM   3896  C  C     . GLN C 2  45   ? 31.056  -31.837 63.106  1.00 33.67  ? 45   GLN C C     1 
ATOM   3897  O  O     . GLN C 2  45   ? 31.489  -32.101 61.982  1.00 41.91  ? 45   GLN C O     1 
ATOM   3898  C  CB    . GLN C 2  45   ? 32.291  -32.592 65.145  1.00 33.71  ? 45   GLN C CB    1 
ATOM   3899  C  CG    . GLN C 2  45   ? 32.986  -33.760 64.458  1.00 32.52  ? 45   GLN C CG    1 
ATOM   3900  C  CD    . GLN C 2  45   ? 34.416  -33.444 64.051  1.00 36.14  ? 45   GLN C CD    1 
ATOM   3901  O  OE1   . GLN C 2  45   ? 35.166  -32.821 64.802  1.00 31.79  ? 45   GLN C OE1   1 
ATOM   3902  N  NE2   . GLN C 2  45   ? 34.801  -33.879 62.856  1.00 44.67  ? 45   GLN C NE2   1 
ATOM   3903  N  N     . ALA C 2  46   ? 29.764  -31.879 63.422  1.00 31.24  ? 46   ALA C N     1 
ATOM   3904  C  CA    . ALA C 2  46   ? 28.743  -32.240 62.444  1.00 33.14  ? 46   ALA C CA    1 
ATOM   3905  C  C     . ALA C 2  46   ? 28.674  -31.247 61.288  1.00 30.30  ? 46   ALA C C     1 
ATOM   3906  O  O     . ALA C 2  46   ? 28.522  -31.646 60.138  1.00 38.78  ? 46   ALA C O     1 
ATOM   3907  C  CB    . ALA C 2  46   ? 27.388  -32.371 63.108  1.00 36.81  ? 46   ALA C CB    1 
ATOM   3908  N  N     . ALA C 2  47   ? 28.781  -29.957 61.594  1.00 32.79  ? 47   ALA C N     1 
ATOM   3909  C  CA    . ALA C 2  47   ? 28.762  -28.931 60.554  1.00 32.22  ? 47   ALA C CA    1 
ATOM   3910  C  C     . ALA C 2  47   ? 29.979  -29.055 59.644  1.00 34.42  ? 47   ALA C C     1 
ATOM   3911  O  O     . ALA C 2  47   ? 29.859  -28.991 58.415  1.00 39.36  ? 47   ALA C O     1 
ATOM   3912  C  CB    . ALA C 2  47   ? 28.700  -27.543 61.173  1.00 32.13  ? 47   ALA C CB    1 
ATOM   3913  N  N     . PHE C 2  48   ? 31.147  -29.237 60.256  1.00 36.54  ? 48   PHE C N     1 
ATOM   3914  C  CA    . PHE C 2  48   ? 32.385  -29.432 59.507  1.00 39.26  ? 48   PHE C CA    1 
ATOM   3915  C  C     . PHE C 2  48   ? 32.291  -30.639 58.576  1.00 43.19  ? 48   PHE C C     1 
ATOM   3916  O  O     . PHE C 2  48   ? 32.654  -30.558 57.400  1.00 39.84  ? 48   PHE C O     1 
ATOM   3917  C  CB    . PHE C 2  48   ? 33.571  -29.612 60.456  1.00 34.72  ? 48   PHE C CB    1 
ATOM   3918  C  CG    . PHE C 2  48   ? 34.273  -28.329 60.815  1.00 32.27  ? 48   PHE C CG    1 
ATOM   3919  C  CD1   . PHE C 2  48   ? 34.367  -27.923 62.136  1.00 26.56  ? 48   PHE C CD1   1 
ATOM   3920  C  CD2   . PHE C 2  48   ? 34.846  -27.535 59.832  1.00 28.49  ? 48   PHE C CD2   1 
ATOM   3921  C  CE1   . PHE C 2  48   ? 35.019  -26.749 62.471  1.00 28.72  ? 48   PHE C CE1   1 
ATOM   3922  C  CE2   . PHE C 2  48   ? 35.499  -26.356 60.160  1.00 23.25  ? 48   PHE C CE2   1 
ATOM   3923  C  CZ    . PHE C 2  48   ? 35.584  -25.963 61.481  1.00 27.17  ? 48   PHE C CZ    1 
ATOM   3924  N  N     . ARG C 2  49   ? 31.796  -31.753 59.109  1.00 40.66  ? 49   ARG C N     1 
ATOM   3925  C  CA    . ARG C 2  49   ? 31.688  -32.985 58.336  1.00 42.29  ? 49   ARG C CA    1 
ATOM   3926  C  C     . ARG C 2  49   ? 30.601  -32.895 57.265  1.00 49.75  ? 49   ARG C C     1 
ATOM   3927  O  O     . ARG C 2  49   ? 30.646  -33.606 56.260  1.00 65.09  ? 49   ARG C O     1 
ATOM   3928  C  CB    . ARG C 2  49   ? 31.409  -34.171 59.257  1.00 35.51  ? 49   ARG C CB    1 
ATOM   3929  C  CG    . ARG C 2  49   ? 31.742  -35.522 58.647  1.00 48.17  ? 49   ARG C CG    1 
ATOM   3930  C  CD    . ARG C 2  49   ? 33.165  -35.927 58.975  1.00 50.39  ? 49   ARG C CD    1 
ATOM   3931  N  NE    . ARG C 2  49   ? 33.412  -35.868 60.415  1.00 64.26  ? 49   ARG C NE    1 
ATOM   3932  C  CZ    . ARG C 2  49   ? 33.064  -36.824 61.272  1.00 63.24  ? 49   ARG C CZ    1 
ATOM   3933  N  NH1   . ARG C 2  49   ? 32.452  -37.915 60.833  1.00 67.27  ? 49   ARG C NH1   1 
ATOM   3934  N  NH2   . ARG C 2  49   ? 33.324  -36.690 62.568  1.00 41.52  ? 49   ARG C NH2   1 
ATOM   3935  N  N     . GLU C 2  50   ? 29.622  -32.026 57.489  1.00 42.88  ? 50   GLU C N     1 
ATOM   3936  C  CA    . GLU C 2  50   ? 28.533  -31.839 56.537  1.00 44.14  ? 50   GLU C CA    1 
ATOM   3937  C  C     . GLU C 2  50   ? 28.957  -30.962 55.362  1.00 54.39  ? 50   GLU C C     1 
ATOM   3938  O  O     . GLU C 2  50   ? 28.605  -31.238 54.215  1.00 62.09  ? 50   GLU C O     1 
ATOM   3939  C  CB    . GLU C 2  50   ? 27.307  -31.242 57.230  1.00 51.14  ? 50   GLU C CB    1 
ATOM   3940  C  CG    . GLU C 2  50   ? 26.064  -31.169 56.358  1.00 67.49  ? 50   GLU C CG    1 
ATOM   3941  C  CD    . GLU C 2  50   ? 24.837  -30.723 57.133  1.00 77.65  ? 50   GLU C CD    1 
ATOM   3942  O  OE1   . GLU C 2  50   ? 24.998  -30.239 58.275  1.00 61.61  ? 50   GLU C OE1   1 
ATOM   3943  O  OE2   . GLU C 2  50   ? 23.713  -30.863 56.605  1.00 87.23  ? 50   GLU C OE2   1 
ATOM   3944  N  N     . THR C 2  51   ? 29.713  -29.905 55.650  1.00 48.88  ? 51   THR C N     1 
ATOM   3945  C  CA    . THR C 2  51   ? 30.176  -28.999 54.601  1.00 49.48  ? 51   THR C CA    1 
ATOM   3946  C  C     . THR C 2  51   ? 31.252  -29.636 53.720  1.00 56.09  ? 51   THR C C     1 
ATOM   3947  O  O     . THR C 2  51   ? 31.170  -29.586 52.490  1.00 56.62  ? 51   THR C O     1 
ATOM   3948  C  CB    . THR C 2  51   ? 30.700  -27.673 55.187  1.00 43.62  ? 51   THR C CB    1 
ATOM   3949  O  OG1   . THR C 2  51   ? 29.624  -26.975 55.824  1.00 46.29  ? 51   THR C OG1   1 
ATOM   3950  C  CG2   . THR C 2  51   ? 31.277  -26.793 54.091  1.00 39.22  ? 51   THR C CG2   1 
ATOM   3951  N  N     . PHE C 2  52   ? 32.258  -30.232 54.356  1.00 54.82  ? 52   PHE C N     1 
ATOM   3952  C  CA    . PHE C 2  52   ? 33.360  -30.879 53.644  1.00 55.96  ? 52   PHE C CA    1 
ATOM   3953  C  C     . PHE C 2  52   ? 33.043  -32.344 53.325  1.00 56.94  ? 52   PHE C C     1 
ATOM   3954  O  O     . PHE C 2  52   ? 32.213  -32.954 53.996  1.00 56.07  ? 52   PHE C O     1 
ATOM   3955  C  CB    . PHE C 2  52   ? 34.640  -30.783 54.475  1.00 44.96  ? 52   PHE C CB    1 
ATOM   3956  C  CG    . PHE C 2  52   ? 35.208  -29.393 54.562  1.00 43.02  ? 52   PHE C CG    1 
ATOM   3957  C  CD1   . PHE C 2  52   ? 35.947  -28.865 53.517  1.00 45.48  ? 52   PHE C CD1   1 
ATOM   3958  C  CD2   . PHE C 2  52   ? 35.013  -28.619 55.694  1.00 43.72  ? 52   PHE C CD2   1 
ATOM   3959  C  CE1   . PHE C 2  52   ? 36.476  -27.588 53.598  1.00 40.85  ? 52   PHE C CE1   1 
ATOM   3960  C  CE2   . PHE C 2  52   ? 35.541  -27.341 55.778  1.00 33.80  ? 52   PHE C CE2   1 
ATOM   3961  C  CZ    . PHE C 2  52   ? 36.273  -26.827 54.729  1.00 28.46  ? 52   PHE C CZ    1 
ATOM   3962  N  N     . PRO C 2  53   ? 33.704  -32.922 52.302  1.00 55.65  ? 53   PRO C N     1 
ATOM   3963  C  CA    . PRO C 2  53   ? 34.722  -32.351 51.409  1.00 54.47  ? 53   PRO C CA    1 
ATOM   3964  C  C     . PRO C 2  53   ? 34.142  -31.431 50.339  1.00 55.88  ? 53   PRO C C     1 
ATOM   3965  O  O     . PRO C 2  53   ? 32.982  -31.577 49.957  1.00 62.09  ? 53   PRO C O     1 
ATOM   3966  C  CB    . PRO C 2  53   ? 35.334  -33.588 50.753  1.00 54.59  ? 53   PRO C CB    1 
ATOM   3967  C  CG    . PRO C 2  53   ? 34.225  -34.565 50.727  1.00 58.68  ? 53   PRO C CG    1 
ATOM   3968  C  CD    . PRO C 2  53   ? 33.456  -34.343 51.998  1.00 52.29  ? 53   PRO C CD    1 
ATOM   3969  N  N     . ILE C 2  54   ? 34.955  -30.492 49.868  1.00 57.70  ? 54   ILE C N     1 
ATOM   3970  C  CA    . ILE C 2  54   ? 34.539  -29.548 48.836  1.00 63.53  ? 54   ILE C CA    1 
ATOM   3971  C  C     . ILE C 2  54   ? 34.996  -30.004 47.449  1.00 77.86  ? 54   ILE C C     1 
ATOM   3972  O  O     . ILE C 2  54   ? 36.194  -30.053 47.161  1.00 73.19  ? 54   ILE C O     1 
ATOM   3973  C  CB    . ILE C 2  54   ? 35.079  -28.137 49.129  1.00 54.17  ? 54   ILE C CB    1 
ATOM   3974  C  CG1   . ILE C 2  54   ? 34.480  -27.608 50.432  1.00 50.86  ? 54   ILE C CG1   1 
ATOM   3975  C  CG2   . ILE C 2  54   ? 34.771  -27.196 47.982  1.00 59.09  ? 54   ILE C CG2   1 
ATOM   3976  C  CD1   . ILE C 2  54   ? 34.891  -26.199 50.764  1.00 41.40  ? 54   ILE C CD1   1 
ATOM   3977  N  N     . GLU C 2  55   ? 34.031  -30.328 46.592  1.00 82.77  ? 55   GLU C N     1 
ATOM   3978  C  CA    . GLU C 2  55   ? 34.315  -30.902 45.280  1.00 81.69  ? 55   GLU C CA    1 
ATOM   3979  C  C     . GLU C 2  55   ? 34.613  -29.851 44.213  1.00 82.29  ? 55   GLU C C     1 
ATOM   3980  O  O     . GLU C 2  55   ? 34.768  -28.667 44.510  1.00 74.11  ? 55   GLU C O     1 
ATOM   3981  C  CB    . GLU C 2  55   ? 33.149  -31.786 44.823  1.00 86.75  ? 55   GLU C CB    1 
ATOM   3982  C  CG    . GLU C 2  55   ? 32.807  -32.919 45.780  1.00 82.80  ? 55   GLU C CG    1 
ATOM   3983  C  CD    . GLU C 2  55   ? 33.900  -33.969 45.866  1.00 87.76  ? 55   GLU C CD    1 
ATOM   3984  O  OE1   . GLU C 2  55   ? 34.714  -34.071 44.923  1.00 91.73  ? 55   GLU C OE1   1 
ATOM   3985  O  OE2   . GLU C 2  55   ? 33.943  -34.697 46.881  1.00 79.53  ? 55   GLU C OE2   1 
ATOM   3986  N  N     . GLU C 2  56   ? 34.696  -30.302 42.965  1.00 89.38  ? 56   GLU C N     1 
ATOM   3987  C  CA    . GLU C 2  56   ? 34.959  -29.413 41.841  1.00 89.16  ? 56   GLU C CA    1 
ATOM   3988  C  C     . GLU C 2  56   ? 34.022  -29.705 40.671  1.00 92.56  ? 56   GLU C C     1 
ATOM   3989  O  O     . GLU C 2  56   ? 32.847  -30.021 40.864  1.00 82.26  ? 56   GLU C O     1 
ATOM   3990  C  CB    . GLU C 2  56   ? 36.418  -29.543 41.395  1.00 84.43  ? 56   GLU C CB    1 
ATOM   3991  C  CG    . GLU C 2  56   ? 36.784  -28.713 40.172  1.00 95.01  ? 56   GLU C CG    1 
ATOM   3992  C  CD    . GLU C 2  56   ? 37.059  -27.255 40.500  1.00 97.97  ? 56   GLU C CD    1 
ATOM   3993  O  OE1   . GLU C 2  56   ? 37.984  -26.678 39.890  1.00 93.95  ? 56   GLU C OE1   1 
ATOM   3994  O  OE2   . GLU C 2  56   ? 36.352  -26.682 41.357  1.00 84.72  ? 56   GLU C OE2   1 
ATOM   3995  N  N     . LEU C 2  64   ? 40.684  -30.711 41.729  1.00 54.68  ? 64   LEU C N     1 
ATOM   3996  C  CA    . LEU C 2  64   ? 41.031  -30.212 43.056  1.00 62.38  ? 64   LEU C CA    1 
ATOM   3997  C  C     . LEU C 2  64   ? 39.981  -30.581 44.100  1.00 71.34  ? 64   LEU C C     1 
ATOM   3998  O  O     . LEU C 2  64   ? 38.783  -30.406 43.877  1.00 79.53  ? 64   LEU C O     1 
ATOM   3999  C  CB    . LEU C 2  64   ? 41.229  -28.694 43.031  1.00 63.60  ? 64   LEU C CB    1 
ATOM   4000  C  CG    . LEU C 2  64   ? 42.668  -28.185 42.915  1.00 66.18  ? 64   LEU C CG    1 
ATOM   4001  C  CD1   . LEU C 2  64   ? 42.722  -26.668 43.010  1.00 58.90  ? 64   LEU C CD1   1 
ATOM   4002  C  CD2   . LEU C 2  64   ? 43.539  -28.813 43.985  1.00 68.04  ? 64   LEU C CD2   1 
ATOM   4003  N  N     . VAL C 2  65   ? 40.443  -31.091 45.240  1.00 65.32  ? 65   VAL C N     1 
ATOM   4004  C  CA    . VAL C 2  65   ? 39.561  -31.470 46.341  1.00 60.89  ? 65   VAL C CA    1 
ATOM   4005  C  C     . VAL C 2  65   ? 40.114  -30.990 47.681  1.00 62.26  ? 65   VAL C C     1 
ATOM   4006  O  O     . VAL C 2  65   ? 41.251  -31.299 48.039  1.00 59.28  ? 65   VAL C O     1 
ATOM   4007  C  CB    . VAL C 2  65   ? 39.357  -33.003 46.411  1.00 47.33  ? 65   VAL C CB    1 
ATOM   4008  C  CG1   . VAL C 2  65   ? 38.681  -33.394 47.712  1.00 43.44  ? 65   VAL C CG1   1 
ATOM   4009  C  CG2   . VAL C 2  65   ? 38.549  -33.495 45.220  1.00 63.53  ? 65   VAL C CG2   1 
ATOM   4010  N  N     . LEU C 2  66   ? 39.307  -30.231 48.418  1.00 65.30  ? 66   LEU C N     1 
ATOM   4011  C  CA    . LEU C 2  66   ? 39.677  -29.802 49.763  1.00 55.06  ? 66   LEU C CA    1 
ATOM   4012  C  C     . LEU C 2  66   ? 38.871  -30.571 50.804  1.00 49.73  ? 66   LEU C C     1 
ATOM   4013  O  O     . LEU C 2  66   ? 37.662  -30.381 50.926  1.00 51.34  ? 66   LEU C O     1 
ATOM   4014  C  CB    . LEU C 2  66   ? 39.448  -28.299 49.929  1.00 43.84  ? 66   LEU C CB    1 
ATOM   4015  C  CG    . LEU C 2  66   ? 39.696  -27.725 51.325  1.00 34.48  ? 66   LEU C CG    1 
ATOM   4016  C  CD1   . LEU C 2  66   ? 41.114  -28.015 51.777  1.00 43.74  ? 66   LEU C CD1   1 
ATOM   4017  C  CD2   . LEU C 2  66   ? 39.426  -26.232 51.345  1.00 38.65  ? 66   LEU C CD2   1 
ATOM   4018  N  N     . ASP C 2  67   ? 39.542  -31.437 51.556  1.00 45.65  ? 67   ASP C N     1 
ATOM   4019  C  CA    . ASP C 2  67   ? 38.857  -32.259 52.544  1.00 43.46  ? 67   ASP C CA    1 
ATOM   4020  C  C     . ASP C 2  67   ? 39.084  -31.716 53.950  1.00 41.99  ? 67   ASP C C     1 
ATOM   4021  O  O     . ASP C 2  67   ? 39.820  -30.749 54.138  1.00 42.12  ? 67   ASP C O     1 
ATOM   4022  C  CB    . ASP C 2  67   ? 39.334  -33.709 52.449  1.00 55.57  ? 67   ASP C CB    1 
ATOM   4023  C  CG    . ASP C 2  67   ? 38.239  -34.706 52.779  1.00 66.29  ? 67   ASP C CG    1 
ATOM   4024  O  OD1   . ASP C 2  67   ? 37.402  -34.407 53.659  1.00 58.00  ? 67   ASP C OD1   1 
ATOM   4025  O  OD2   . ASP C 2  67   ? 38.213  -35.787 52.151  1.00 71.33  ? 67   ASP C OD2   1 
ATOM   4026  N  N     . PHE C 2  68   ? 38.464  -32.356 54.936  1.00 42.29  ? 68   PHE C N     1 
ATOM   4027  C  CA    . PHE C 2  68   ? 38.516  -31.882 56.316  1.00 39.49  ? 68   PHE C CA    1 
ATOM   4028  C  C     . PHE C 2  68   ? 39.058  -32.949 57.251  1.00 37.95  ? 68   PHE C C     1 
ATOM   4029  O  O     . PHE C 2  68   ? 38.452  -34.008 57.415  1.00 38.22  ? 68   PHE C O     1 
ATOM   4030  C  CB    . PHE C 2  68   ? 37.124  -31.444 56.777  1.00 33.42  ? 68   PHE C CB    1 
ATOM   4031  C  CG    . PHE C 2  68   ? 36.965  -31.365 58.274  1.00 32.73  ? 68   PHE C CG    1 
ATOM   4032  C  CD1   . PHE C 2  68   ? 37.417  -30.262 58.976  1.00 29.20  ? 68   PHE C CD1   1 
ATOM   4033  C  CD2   . PHE C 2  68   ? 36.335  -32.384 58.975  1.00 39.14  ? 68   PHE C CD2   1 
ATOM   4034  C  CE1   . PHE C 2  68   ? 37.260  -30.183 60.349  1.00 23.04  ? 68   PHE C CE1   1 
ATOM   4035  C  CE2   . PHE C 2  68   ? 36.179  -32.310 60.347  1.00 31.46  ? 68   PHE C CE2   1 
ATOM   4036  C  CZ    . PHE C 2  68   ? 36.642  -31.208 61.033  1.00 23.62  ? 68   PHE C CZ    1 
ATOM   4037  N  N     . LEU C 2  69   ? 40.201  -32.668 57.865  1.00 31.61  ? 69   LEU C N     1 
ATOM   4038  C  CA    . LEU C 2  69   ? 40.757  -33.583 58.848  1.00 29.06  ? 69   LEU C CA    1 
ATOM   4039  C  C     . LEU C 2  69   ? 40.114  -33.359 60.210  1.00 27.96  ? 69   LEU C C     1 
ATOM   4040  O  O     . LEU C 2  69   ? 39.366  -34.213 60.688  1.00 24.80  ? 69   LEU C O     1 
ATOM   4041  C  CB    . LEU C 2  69   ? 42.278  -33.451 58.936  1.00 34.59  ? 69   LEU C CB    1 
ATOM   4042  C  CG    . LEU C 2  69   ? 43.064  -33.992 57.742  1.00 36.59  ? 69   LEU C CG    1 
ATOM   4043  C  CD1   . LEU C 2  69   ? 44.558  -33.903 58.003  1.00 43.62  ? 69   LEU C CD1   1 
ATOM   4044  C  CD2   . LEU C 2  69   ? 42.647  -35.421 57.444  1.00 38.96  ? 69   LEU C CD2   1 
ATOM   4045  N  N     . GLU C 2  70   ? 40.389  -32.213 60.832  1.00 30.31  ? 70   GLU C N     1 
ATOM   4046  C  CA    . GLU C 2  70   ? 39.851  -31.973 62.177  1.00 25.54  ? 70   GLU C CA    1 
ATOM   4047  C  C     . GLU C 2  70   ? 39.797  -30.501 62.576  1.00 29.67  ? 70   GLU C C     1 
ATOM   4048  O  O     . GLU C 2  70   ? 40.042  -29.617 61.759  1.00 30.13  ? 70   GLU C O     1 
ATOM   4049  C  CB    . GLU C 2  70   ? 40.638  -32.764 63.225  1.00 28.42  ? 70   GLU C CB    1 
ATOM   4050  C  CG    . GLU C 2  70   ? 42.093  -32.344 63.358  1.00 38.01  ? 70   GLU C CG    1 
ATOM   4051  C  CD    . GLU C 2  70   ? 42.810  -33.074 64.479  1.00 48.82  ? 70   GLU C CD    1 
ATOM   4052  O  OE1   . GLU C 2  70   ? 43.571  -32.421 65.227  1.00 52.03  ? 70   GLU C OE1   1 
ATOM   4053  O  OE2   . GLU C 2  70   ? 42.613  -34.300 64.611  1.00 49.05  ? 70   GLU C OE2   1 
ATOM   4054  N  N     . TYR C 2  71   ? 39.453  -30.244 63.836  1.00 27.90  ? 71   TYR C N     1 
ATOM   4055  C  CA    . TYR C 2  71   ? 39.506  -28.889 64.378  1.00 22.00  ? 71   TYR C CA    1 
ATOM   4056  C  C     . TYR C 2  71   ? 39.984  -28.906 65.819  1.00 23.98  ? 71   TYR C C     1 
ATOM   4057  O  O     . TYR C 2  71   ? 39.969  -29.947 66.475  1.00 29.76  ? 71   TYR C O     1 
ATOM   4058  C  CB    . TYR C 2  71   ? 38.145  -28.188 64.285  1.00 22.55  ? 71   TYR C CB    1 
ATOM   4059  C  CG    . TYR C 2  71   ? 37.130  -28.619 65.327  1.00 24.41  ? 71   TYR C CG    1 
ATOM   4060  C  CD1   . TYR C 2  71   ? 37.066  -27.998 66.571  1.00 18.31  ? 71   TYR C CD1   1 
ATOM   4061  C  CD2   . TYR C 2  71   ? 36.222  -29.635 65.057  1.00 29.03  ? 71   TYR C CD2   1 
ATOM   4062  C  CE1   . TYR C 2  71   ? 36.141  -28.388 67.519  1.00 20.43  ? 71   TYR C CE1   1 
ATOM   4063  C  CE2   . TYR C 2  71   ? 35.290  -30.029 65.999  1.00 26.17  ? 71   TYR C CE2   1 
ATOM   4064  C  CZ    . TYR C 2  71   ? 35.253  -29.404 67.226  1.00 25.61  ? 71   TYR C CZ    1 
ATOM   4065  O  OH    . TYR C 2  71   ? 34.324  -29.803 68.161  1.00 26.27  ? 71   TYR C OH    1 
ATOM   4066  N  N     . ARG C 2  72   ? 40.401  -27.744 66.309  1.00 24.01  ? 72   ARG C N     1 
ATOM   4067  C  CA    . ARG C 2  72   ? 40.789  -27.597 67.705  1.00 25.00  ? 72   ARG C CA    1 
ATOM   4068  C  C     . ARG C 2  72   ? 40.499  -26.187 68.206  1.00 21.41  ? 72   ARG C C     1 
ATOM   4069  O  O     . ARG C 2  72   ? 40.546  -25.218 67.441  1.00 22.16  ? 72   ARG C O     1 
ATOM   4070  C  CB    . ARG C 2  72   ? 42.270  -27.928 67.898  1.00 26.81  ? 72   ARG C CB    1 
ATOM   4071  C  CG    . ARG C 2  72   ? 43.217  -26.867 67.376  1.00 20.17  ? 72   ARG C CG    1 
ATOM   4072  C  CD    . ARG C 2  72   ? 44.655  -27.210 67.694  1.00 15.73  ? 72   ARG C CD    1 
ATOM   4073  N  NE    . ARG C 2  72   ? 45.558  -26.136 67.301  1.00 22.43  ? 72   ARG C NE    1 
ATOM   4074  C  CZ    . ARG C 2  72   ? 45.948  -25.159 68.112  1.00 29.38  ? 72   ARG C CZ    1 
ATOM   4075  N  NH1   . ARG C 2  72   ? 45.514  -25.123 69.366  1.00 31.64  ? 72   ARG C NH1   1 
ATOM   4076  N  NH2   . ARG C 2  72   ? 46.773  -24.219 67.673  1.00 35.03  ? 72   ARG C NH2   1 
ATOM   4077  N  N     . LEU C 2  73   ? 40.187  -26.088 69.494  1.00 18.61  ? 73   LEU C N     1 
ATOM   4078  C  CA    . LEU C 2  73   ? 39.960  -24.806 70.143  1.00 17.65  ? 73   LEU C CA    1 
ATOM   4079  C  C     . LEU C 2  73   ? 41.109  -24.502 71.096  1.00 21.56  ? 73   LEU C C     1 
ATOM   4080  O  O     . LEU C 2  73   ? 41.441  -25.314 71.960  1.00 26.79  ? 73   LEU C O     1 
ATOM   4081  C  CB    . LEU C 2  73   ? 38.639  -24.822 70.914  1.00 17.56  ? 73   LEU C CB    1 
ATOM   4082  C  CG    . LEU C 2  73   ? 37.347  -24.860 70.096  1.00 18.83  ? 73   LEU C CG    1 
ATOM   4083  C  CD1   . LEU C 2  73   ? 36.143  -25.110 70.998  1.00 13.23  ? 73   LEU C CD1   1 
ATOM   4084  C  CD2   . LEU C 2  73   ? 37.174  -23.567 69.310  1.00 21.06  ? 73   LEU C CD2   1 
ATOM   4085  N  N     . GLY C 2  74   ? 41.716  -23.331 70.935  1.00 21.34  ? 74   GLY C N     1 
ATOM   4086  C  CA    . GLY C 2  74   ? 42.791  -22.913 71.813  1.00 22.55  ? 74   GLY C CA    1 
ATOM   4087  C  C     . GLY C 2  74   ? 42.239  -22.364 73.112  1.00 24.08  ? 74   GLY C C     1 
ATOM   4088  O  O     . GLY C 2  74   ? 41.040  -22.443 73.368  1.00 26.06  ? 74   GLY C O     1 
ATOM   4089  N  N     . GLU C 2  75   ? 43.118  -21.810 73.938  1.00 26.18  ? 75   GLU C N     1 
ATOM   4090  C  CA    . GLU C 2  75   ? 42.700  -21.185 75.184  1.00 23.67  ? 75   GLU C CA    1 
ATOM   4091  C  C     . GLU C 2  75   ? 42.345  -19.719 74.931  1.00 24.37  ? 75   GLU C C     1 
ATOM   4092  O  O     . GLU C 2  75   ? 42.815  -19.125 73.961  1.00 23.59  ? 75   GLU C O     1 
ATOM   4093  C  CB    . GLU C 2  75   ? 43.808  -21.306 76.233  1.00 27.33  ? 75   GLU C CB    1 
ATOM   4094  C  CG    . GLU C 2  75   ? 44.157  -22.740 76.614  1.00 41.38  ? 75   GLU C CG    1 
ATOM   4095  C  CD    . GLU C 2  75   ? 43.077  -23.417 77.445  1.00 57.20  ? 75   GLU C CD    1 
ATOM   4096  O  OE1   . GLU C 2  75   ? 43.082  -24.666 77.521  1.00 64.70  ? 75   GLU C OE1   1 
ATOM   4097  O  OE2   . GLU C 2  75   ? 42.231  -22.703 78.029  1.00 48.03  ? 75   GLU C OE2   1 
ATOM   4098  N  N     . PRO C 2  76   ? 41.493  -19.138 75.791  1.00 24.57  ? 76   PRO C N     1 
ATOM   4099  C  CA    . PRO C 2  76   ? 41.111  -17.729 75.662  1.00 22.67  ? 76   PRO C CA    1 
ATOM   4100  C  C     . PRO C 2  76   ? 42.313  -16.795 75.734  1.00 27.39  ? 76   PRO C C     1 
ATOM   4101  O  O     . PRO C 2  76   ? 43.186  -16.998 76.576  1.00 33.96  ? 76   PRO C O     1 
ATOM   4102  C  CB    . PRO C 2  76   ? 40.215  -17.503 76.879  1.00 27.91  ? 76   PRO C CB    1 
ATOM   4103  C  CG    . PRO C 2  76   ? 39.646  -18.840 77.176  1.00 25.68  ? 76   PRO C CG    1 
ATOM   4104  C  CD    . PRO C 2  76   ? 40.734  -19.817 76.857  1.00 28.91  ? 76   PRO C CD    1 
ATOM   4105  N  N     . PRO C 2  77   ? 42.361  -15.784 74.853  1.00 26.93  ? 77   PRO C N     1 
ATOM   4106  C  CA    . PRO C 2  77   ? 43.422  -14.772 74.860  1.00 30.58  ? 77   PRO C CA    1 
ATOM   4107  C  C     . PRO C 2  77   ? 43.355  -13.897 76.108  1.00 36.91  ? 77   PRO C C     1 
ATOM   4108  O  O     . PRO C 2  77   ? 44.373  -13.352 76.538  1.00 34.40  ? 77   PRO C O     1 
ATOM   4109  C  CB    . PRO C 2  77   ? 43.110  -13.930 73.618  1.00 30.33  ? 77   PRO C CB    1 
ATOM   4110  C  CG    . PRO C 2  77   ? 42.278  -14.810 72.755  1.00 26.72  ? 77   PRO C CG    1 
ATOM   4111  C  CD    . PRO C 2  77   ? 41.456  -15.614 73.706  1.00 28.48  ? 77   PRO C CD    1 
ATOM   4112  N  N     . PHE C 2  78   ? 42.158  -13.767 76.675  1.00 41.38  ? 78   PHE C N     1 
ATOM   4113  C  CA    . PHE C 2  78   ? 41.951  -12.952 77.867  1.00 36.44  ? 78   PHE C CA    1 
ATOM   4114  C  C     . PHE C 2  78   ? 40.960  -13.620 78.819  1.00 38.94  ? 78   PHE C C     1 
ATOM   4115  O  O     . PHE C 2  78   ? 40.041  -14.310 78.376  1.00 38.11  ? 78   PHE C O     1 
ATOM   4116  C  CB    . PHE C 2  78   ? 41.445  -11.563 77.475  1.00 34.80  ? 78   PHE C CB    1 
ATOM   4117  C  CG    . PHE C 2  78   ? 42.299  -10.875 76.450  1.00 38.10  ? 78   PHE C CG    1 
ATOM   4118  C  CD1   . PHE C 2  78   ? 41.980  -10.943 75.105  1.00 35.09  ? 78   PHE C CD1   1 
ATOM   4119  C  CD2   . PHE C 2  78   ? 43.423  -10.163 76.831  1.00 36.62  ? 78   PHE C CD2   1 
ATOM   4120  C  CE1   . PHE C 2  78   ? 42.762  -10.312 74.163  1.00 34.03  ? 78   PHE C CE1   1 
ATOM   4121  C  CE2   . PHE C 2  78   ? 44.208  -9.532  75.893  1.00 31.97  ? 78   PHE C CE2   1 
ATOM   4122  C  CZ    . PHE C 2  78   ? 43.877  -9.606  74.558  1.00 36.38  ? 78   PHE C CZ    1 
ATOM   4123  N  N     . PRO C 2  79   ? 41.154  -13.426 80.134  1.00 37.20  ? 79   PRO C N     1 
ATOM   4124  C  CA    . PRO C 2  79   ? 40.236  -13.939 81.158  1.00 33.69  ? 79   PRO C CA    1 
ATOM   4125  C  C     . PRO C 2  79   ? 38.941  -13.132 81.197  1.00 36.66  ? 79   PRO C C     1 
ATOM   4126  O  O     . PRO C 2  79   ? 38.908  -12.020 80.674  1.00 38.33  ? 79   PRO C O     1 
ATOM   4127  C  CB    . PRO C 2  79   ? 41.023  -13.747 82.454  1.00 42.41  ? 79   PRO C CB    1 
ATOM   4128  C  CG    . PRO C 2  79   ? 41.924  -12.597 82.169  1.00 45.92  ? 79   PRO C CG    1 
ATOM   4129  C  CD    . PRO C 2  79   ? 42.311  -12.734 80.729  1.00 36.25  ? 79   PRO C CD    1 
ATOM   4130  N  N     . GLN C 2  80   ? 37.901  -13.686 81.815  1.00 36.31  ? 80   GLN C N     1 
ATOM   4131  C  CA    . GLN C 2  80   ? 36.558  -13.099 81.785  1.00 34.72  ? 80   GLN C CA    1 
ATOM   4132  C  C     . GLN C 2  80   ? 36.466  -11.633 82.228  1.00 36.00  ? 80   GLN C C     1 
ATOM   4133  O  O     . GLN C 2  80   ? 35.916  -10.797 81.504  1.00 33.40  ? 80   GLN C O     1 
ATOM   4134  C  CB    . GLN C 2  80   ? 35.581  -13.962 82.591  1.00 32.15  ? 80   GLN C CB    1 
ATOM   4135  C  CG    . GLN C 2  80   ? 35.389  -15.360 82.022  1.00 28.91  ? 80   GLN C CG    1 
ATOM   4136  C  CD    . GLN C 2  80   ? 34.456  -16.217 82.855  1.00 28.11  ? 80   GLN C CD    1 
ATOM   4137  O  OE1   . GLN C 2  80   ? 33.764  -15.725 83.748  1.00 27.17  ? 80   GLN C OE1   1 
ATOM   4138  N  NE2   . GLN C 2  80   ? 34.437  -17.512 82.567  1.00 28.96  ? 80   GLN C NE2   1 
ATOM   4139  N  N     . ASP C 2  81   ? 36.996  -11.325 83.409  1.00 42.83  ? 81   ASP C N     1 
ATOM   4140  C  CA    . ASP C 2  81   ? 36.934  -9.963  83.943  1.00 48.01  ? 81   ASP C CA    1 
ATOM   4141  C  C     . ASP C 2  81   ? 37.632  -8.956  83.027  1.00 47.07  ? 81   ASP C C     1 
ATOM   4142  O  O     . ASP C 2  81   ? 37.137  -7.843  82.808  1.00 49.38  ? 81   ASP C O     1 
ATOM   4143  C  CB    . ASP C 2  81   ? 37.525  -9.902  85.356  1.00 44.10  ? 81   ASP C CB    1 
ATOM   4144  C  CG    . ASP C 2  81   ? 36.537  -10.342 86.426  1.00 60.04  ? 81   ASP C CG    1 
ATOM   4145  O  OD1   . ASP C 2  81   ? 35.625  -11.137 86.113  1.00 59.82  ? 81   ASP C OD1   1 
ATOM   4146  O  OD2   . ASP C 2  81   ? 36.672  -9.890  87.585  1.00 64.72  ? 81   ASP C OD2   1 
ATOM   4147  N  N     . GLU C 2  82   ? 38.776  -9.359  82.487  1.00 42.35  ? 82   GLU C N     1 
ATOM   4148  C  CA    . GLU C 2  82   ? 39.535  -8.510  81.578  1.00 45.06  ? 82   GLU C CA    1 
ATOM   4149  C  C     . GLU C 2  82   ? 38.735  -8.212  80.313  1.00 44.75  ? 82   GLU C C     1 
ATOM   4150  O  O     . GLU C 2  82   ? 38.808  -7.113  79.759  1.00 46.71  ? 82   GLU C O     1 
ATOM   4151  C  CB    . GLU C 2  82   ? 40.867  -9.172  81.229  1.00 45.76  ? 82   GLU C CB    1 
ATOM   4152  C  CG    . GLU C 2  82   ? 41.788  -8.313  80.385  1.00 55.94  ? 82   GLU C CG    1 
ATOM   4153  C  CD    . GLU C 2  82   ? 43.198  -8.863  80.331  1.00 65.14  ? 82   GLU C CD    1 
ATOM   4154  O  OE1   . GLU C 2  82   ? 43.556  -9.664  81.223  1.00 62.84  ? 82   GLU C OE1   1 
ATOM   4155  O  OE2   . GLU C 2  82   ? 43.946  -8.497  79.398  1.00 64.56  ? 82   GLU C OE2   1 
ATOM   4156  N  N     . CYS C 2  83   ? 37.962  -9.197  79.867  1.00 43.59  ? 83   CYS C N     1 
ATOM   4157  C  CA    . CYS C 2  83   ? 37.105  -9.027  78.702  1.00 36.55  ? 83   CYS C CA    1 
ATOM   4158  C  C     . CYS C 2  83   ? 35.958  -8.093  79.036  1.00 38.88  ? 83   CYS C C     1 
ATOM   4159  O  O     . CYS C 2  83   ? 35.540  -7.290  78.203  1.00 40.24  ? 83   CYS C O     1 
ATOM   4160  C  CB    . CYS C 2  83   ? 36.554  -10.372 78.238  1.00 32.57  ? 83   CYS C CB    1 
ATOM   4161  S  SG    . CYS C 2  83   ? 37.821  -11.570 77.803  1.00 39.44  ? 83   CYS C SG    1 
ATOM   4162  N  N     . ARG C 2  84   ? 35.449  -8.208  80.260  1.00 42.17  ? 84   ARG C N     1 
ATOM   4163  C  CA    . ARG C 2  84   ? 34.375  -7.334  80.719  1.00 45.71  ? 84   ARG C CA    1 
ATOM   4164  C  C     . ARG C 2  84   ? 34.834  -5.881  80.739  1.00 49.35  ? 84   ARG C C     1 
ATOM   4165  O  O     . ARG C 2  84   ? 34.090  -4.978  80.343  1.00 41.82  ? 84   ARG C O     1 
ATOM   4166  C  CB    . ARG C 2  84   ? 33.880  -7.756  82.106  1.00 35.54  ? 84   ARG C CB    1 
ATOM   4167  C  CG    . ARG C 2  84   ? 33.170  -9.098  82.124  1.00 34.42  ? 84   ARG C CG    1 
ATOM   4168  C  CD    . ARG C 2  84   ? 32.390  -9.307  83.409  1.00 30.13  ? 84   ARG C CD    1 
ATOM   4169  N  NE    . ARG C 2  84   ? 31.490  -10.454 83.312  1.00 28.02  ? 84   ARG C NE    1 
ATOM   4170  C  CZ    . ARG C 2  84   ? 31.729  -11.645 83.853  1.00 33.26  ? 84   ARG C CZ    1 
ATOM   4171  N  NH1   . ARG C 2  84   ? 32.841  -11.853 84.546  1.00 35.89  ? 84   ARG C NH1   1 
ATOM   4172  N  NH2   . ARG C 2  84   ? 30.851  -12.629 83.707  1.00 35.93  ? 84   ARG C NH2   1 
ATOM   4173  N  N     . GLU C 2  85   ? 36.069  -5.665  81.187  1.00 48.82  ? 85   GLU C N     1 
ATOM   4174  C  CA    . GLU C 2  85   ? 36.610  -4.314  81.302  1.00 46.88  ? 85   GLU C CA    1 
ATOM   4175  C  C     . GLU C 2  85   ? 37.032  -3.719  79.961  1.00 47.23  ? 85   GLU C C     1 
ATOM   4176  O  O     . GLU C 2  85   ? 36.822  -2.532  79.712  1.00 55.71  ? 85   GLU C O     1 
ATOM   4177  C  CB    . GLU C 2  85   ? 37.788  -4.284  82.275  1.00 43.28  ? 85   GLU C CB    1 
ATOM   4178  C  CG    . GLU C 2  85   ? 38.311  -2.884  82.550  1.00 62.63  ? 85   GLU C CG    1 
ATOM   4179  C  CD    . GLU C 2  85   ? 39.473  -2.876  83.525  1.00 84.47  ? 85   GLU C CD    1 
ATOM   4180  O  OE1   . GLU C 2  85   ? 39.275  -2.450  84.683  1.00 74.94  ? 85   GLU C OE1   1 
ATOM   4181  O  OE2   . GLU C 2  85   ? 40.584  -3.293  83.132  1.00 87.33  ? 85   GLU C OE2   1 
ATOM   4182  N  N     . LYS C 2  86   ? 37.612  -4.544  79.094  1.00 46.09  ? 86   LYS C N     1 
ATOM   4183  C  CA    . LYS C 2  86   ? 38.178  -4.054  77.837  1.00 44.05  ? 86   LYS C CA    1 
ATOM   4184  C  C     . LYS C 2  86   ? 37.172  -4.022  76.686  1.00 44.76  ? 86   LYS C C     1 
ATOM   4185  O  O     . LYS C 2  86   ? 37.534  -3.717  75.551  1.00 49.24  ? 86   LYS C O     1 
ATOM   4186  C  CB    . LYS C 2  86   ? 39.411  -4.870  77.439  1.00 45.23  ? 86   LYS C CB    1 
ATOM   4187  C  CG    . LYS C 2  86   ? 40.602  -4.694  78.370  1.00 53.93  ? 86   LYS C CG    1 
ATOM   4188  C  CD    . LYS C 2  86   ? 41.809  -5.485  77.883  1.00 65.95  ? 86   LYS C CD    1 
ATOM   4189  C  CE    . LYS C 2  86   ? 43.033  -5.236  78.755  1.00 64.08  ? 86   LYS C CE    1 
ATOM   4190  N  NZ    . LYS C 2  86   ? 44.234  -5.968  78.255  1.00 53.83  ? 86   LYS C NZ    1 
ATOM   4191  N  N     . ASP C 2  87   ? 35.918  -4.352  76.987  1.00 48.62  ? 87   ASP C N     1 
ATOM   4192  C  CA    . ASP C 2  87   ? 34.833  -4.330  76.001  1.00 43.49  ? 87   ASP C CA    1 
ATOM   4193  C  C     . ASP C 2  87   ? 35.103  -5.209  74.782  1.00 43.41  ? 87   ASP C C     1 
ATOM   4194  O  O     . ASP C 2  87   ? 34.795  -4.832  73.649  1.00 42.30  ? 87   ASP C O     1 
ATOM   4195  C  CB    . ASP C 2  87   ? 34.496  -2.896  75.571  1.00 49.75  ? 87   ASP C CB    1 
ATOM   4196  C  CG    . ASP C 2  87   ? 33.547  -2.201  76.537  1.00 65.17  ? 87   ASP C CG    1 
ATOM   4197  O  OD1   . ASP C 2  87   ? 33.612  -2.489  77.753  1.00 63.59  ? 87   ASP C OD1   1 
ATOM   4198  O  OD2   . ASP C 2  87   ? 32.734  -1.368  76.079  1.00 66.72  ? 87   ASP C OD2   1 
ATOM   4199  N  N     . LEU C 2  88   ? 35.680  -6.381  75.027  1.00 39.97  ? 88   LEU C N     1 
ATOM   4200  C  CA    . LEU C 2  88   ? 35.871  -7.377  73.981  1.00 34.24  ? 88   LEU C CA    1 
ATOM   4201  C  C     . LEU C 2  88   ? 35.191  -8.685  74.375  1.00 28.21  ? 88   LEU C C     1 
ATOM   4202  O  O     . LEU C 2  88   ? 34.602  -8.782  75.448  1.00 29.80  ? 88   LEU C O     1 
ATOM   4203  C  CB    . LEU C 2  88   ? 37.360  -7.580  73.685  1.00 33.91  ? 88   LEU C CB    1 
ATOM   4204  C  CG    . LEU C 2  88   ? 38.319  -7.725  74.867  1.00 31.94  ? 88   LEU C CG    1 
ATOM   4205  C  CD1   . LEU C 2  88   ? 38.484  -9.182  75.247  1.00 33.88  ? 88   LEU C CD1   1 
ATOM   4206  C  CD2   . LEU C 2  88   ? 39.666  -7.101  74.544  1.00 39.12  ? 88   LEU C CD2   1 
ATOM   4207  N  N     . THR C 2  89   ? 35.279  -9.688  73.508  1.00 27.78  ? 89   THR C N     1 
ATOM   4208  C  CA    . THR C 2  89   ? 34.518  -10.923 73.686  1.00 27.09  ? 89   THR C CA    1 
ATOM   4209  C  C     . THR C 2  89   ? 35.340  -12.062 74.299  1.00 24.04  ? 89   THR C C     1 
ATOM   4210  O  O     . THR C 2  89   ? 36.496  -12.264 73.933  1.00 23.89  ? 89   THR C O     1 
ATOM   4211  C  CB    . THR C 2  89   ? 33.903  -11.373 72.341  1.00 21.33  ? 89   THR C CB    1 
ATOM   4212  O  OG1   . THR C 2  89   ? 32.945  -10.398 71.910  1.00 25.24  ? 89   THR C OG1   1 
ATOM   4213  C  CG2   . THR C 2  89   ? 33.216  -12.724 72.468  1.00 18.73  ? 89   THR C CG2   1 
ATOM   4214  N  N     . TYR C 2  90   ? 34.737  -12.802 75.230  1.00 22.12  ? 90   TYR C N     1 
ATOM   4215  C  CA    . TYR C 2  90   ? 35.381  -13.980 75.799  1.00 23.18  ? 90   TYR C CA    1 
ATOM   4216  C  C     . TYR C 2  90   ? 35.211  -15.107 74.791  1.00 20.42  ? 90   TYR C C     1 
ATOM   4217  O  O     . TYR C 2  90   ? 34.093  -15.524 74.489  1.00 16.91  ? 90   TYR C O     1 
ATOM   4218  C  CB    . TYR C 2  90   ? 34.719  -14.346 77.132  1.00 20.14  ? 90   TYR C CB    1 
ATOM   4219  C  CG    . TYR C 2  90   ? 35.386  -15.467 77.903  1.00 20.06  ? 90   TYR C CG    1 
ATOM   4220  C  CD1   . TYR C 2  90   ? 36.713  -15.370 78.301  1.00 24.03  ? 90   TYR C CD1   1 
ATOM   4221  C  CD2   . TYR C 2  90   ? 34.678  -16.608 78.262  1.00 20.40  ? 90   TYR C CD2   1 
ATOM   4222  C  CE1   . TYR C 2  90   ? 37.324  -16.388 79.016  1.00 30.27  ? 90   TYR C CE1   1 
ATOM   4223  C  CE2   . TYR C 2  90   ? 35.278  -17.631 78.977  1.00 23.32  ? 90   TYR C CE2   1 
ATOM   4224  C  CZ    . TYR C 2  90   ? 36.602  -17.515 79.351  1.00 31.47  ? 90   TYR C CZ    1 
ATOM   4225  O  OH    . TYR C 2  90   ? 37.209  -18.527 80.062  1.00 30.40  ? 90   TYR C OH    1 
ATOM   4226  N  N     . GLN C 2  91   ? 36.333  -15.605 74.284  1.00 20.71  ? 91   GLN C N     1 
ATOM   4227  C  CA    . GLN C 2  91   ? 36.315  -16.471 73.114  1.00 19.40  ? 91   GLN C CA    1 
ATOM   4228  C  C     . GLN C 2  91   ? 37.577  -17.316 73.001  1.00 21.33  ? 91   GLN C C     1 
ATOM   4229  O  O     . GLN C 2  91   ? 38.600  -17.002 73.607  1.00 22.19  ? 91   GLN C O     1 
ATOM   4230  C  CB    . GLN C 2  91   ? 36.158  -15.619 71.860  1.00 18.84  ? 91   GLN C CB    1 
ATOM   4231  C  CG    . GLN C 2  91   ? 37.212  -14.535 71.746  1.00 18.50  ? 91   GLN C CG    1 
ATOM   4232  C  CD    . GLN C 2  91   ? 36.893  -13.530 70.666  1.00 20.70  ? 91   GLN C CD    1 
ATOM   4233  O  OE1   . GLN C 2  91   ? 35.814  -13.559 70.074  1.00 25.57  ? 91   GLN C OE1   1 
ATOM   4234  N  NE2   . GLN C 2  91   ? 37.836  -12.635 70.396  1.00 21.37  ? 91   GLN C NE2   1 
ATOM   4235  N  N     . ALA C 2  92   ? 37.505  -18.376 72.204  1.00 20.99  ? 92   ALA C N     1 
ATOM   4236  C  CA    . ALA C 2  92   ? 38.661  -19.228 71.956  1.00 20.83  ? 92   ALA C CA    1 
ATOM   4237  C  C     . ALA C 2  92   ? 38.953  -19.304 70.464  1.00 20.36  ? 92   ALA C C     1 
ATOM   4238  O  O     . ALA C 2  92   ? 38.030  -19.324 69.645  1.00 19.00  ? 92   ALA C O     1 
ATOM   4239  C  CB    . ALA C 2  92   ? 38.423  -20.619 72.518  1.00 20.52  ? 92   ALA C CB    1 
ATOM   4240  N  N     . PRO C 2  93   ? 40.244  -19.340 70.104  1.00 24.61  ? 93   PRO C N     1 
ATOM   4241  C  CA    . PRO C 2  93   ? 40.638  -19.438 68.697  1.00 22.63  ? 93   PRO C CA    1 
ATOM   4242  C  C     . PRO C 2  93   ? 40.255  -20.797 68.131  1.00 21.61  ? 93   PRO C C     1 
ATOM   4243  O  O     . PRO C 2  93   ? 40.397  -21.805 68.821  1.00 21.57  ? 93   PRO C O     1 
ATOM   4244  C  CB    . PRO C 2  93   ? 42.162  -19.285 68.747  1.00 22.61  ? 93   PRO C CB    1 
ATOM   4245  C  CG    . PRO C 2  93   ? 42.544  -19.698 70.124  1.00 23.77  ? 93   PRO C CG    1 
ATOM   4246  C  CD    . PRO C 2  93   ? 41.410  -19.265 71.002  1.00 25.51  ? 93   PRO C CD    1 
ATOM   4247  N  N     . LEU C 2  94   ? 39.759  -20.814 66.899  1.00 20.25  ? 94   LEU C N     1 
ATOM   4248  C  CA    . LEU C 2  94   ? 39.351  -22.056 66.256  1.00 23.93  ? 94   LEU C CA    1 
ATOM   4249  C  C     . LEU C 2  94   ? 40.246  -22.360 65.067  1.00 24.29  ? 94   LEU C C     1 
ATOM   4250  O  O     . LEU C 2  94   ? 40.225  -21.646 64.066  1.00 25.10  ? 94   LEU C O     1 
ATOM   4251  C  CB    . LEU C 2  94   ? 37.890  -21.979 65.803  1.00 27.37  ? 94   LEU C CB    1 
ATOM   4252  C  CG    . LEU C 2  94   ? 37.350  -23.155 64.980  1.00 24.53  ? 94   LEU C CG    1 
ATOM   4253  C  CD1   . LEU C 2  94   ? 37.332  -24.440 65.789  1.00 17.50  ? 94   LEU C CD1   1 
ATOM   4254  C  CD2   . LEU C 2  94   ? 35.964  -22.840 64.448  1.00 27.32  ? 94   LEU C CD2   1 
ATOM   4255  N  N     . TYR C 2  95   ? 41.032  -23.424 65.182  1.00 25.77  ? 95   TYR C N     1 
ATOM   4256  C  CA    . TYR C 2  95   ? 41.901  -23.844 64.094  1.00 23.23  ? 95   TYR C CA    1 
ATOM   4257  C  C     . TYR C 2  95   ? 41.307  -25.082 63.453  1.00 22.89  ? 95   TYR C C     1 
ATOM   4258  O  O     . TYR C 2  95   ? 40.668  -25.883 64.127  1.00 25.89  ? 95   TYR C O     1 
ATOM   4259  C  CB    . TYR C 2  95   ? 43.307  -24.146 64.611  1.00 23.75  ? 95   TYR C CB    1 
ATOM   4260  C  CG    . TYR C 2  95   ? 43.963  -22.989 65.329  1.00 24.55  ? 95   TYR C CG    1 
ATOM   4261  C  CD1   . TYR C 2  95   ? 43.878  -22.867 66.710  1.00 21.42  ? 95   TYR C CD1   1 
ATOM   4262  C  CD2   . TYR C 2  95   ? 44.669  -22.020 64.628  1.00 23.85  ? 95   TYR C CD2   1 
ATOM   4263  C  CE1   . TYR C 2  95   ? 44.476  -21.814 67.373  1.00 24.03  ? 95   TYR C CE1   1 
ATOM   4264  C  CE2   . TYR C 2  95   ? 45.271  -20.962 65.280  1.00 25.88  ? 95   TYR C CE2   1 
ATOM   4265  C  CZ    . TYR C 2  95   ? 45.172  -20.863 66.654  1.00 31.50  ? 95   TYR C CZ    1 
ATOM   4266  O  OH    . TYR C 2  95   ? 45.771  -19.810 67.311  1.00 35.36  ? 95   TYR C OH    1 
ATOM   4267  N  N     . ALA C 2  96   ? 41.496  -25.233 62.149  1.00 22.83  ? 96   ALA C N     1 
ATOM   4268  C  CA    . ALA C 2  96   ? 40.996  -26.413 61.458  1.00 24.29  ? 96   ALA C CA    1 
ATOM   4269  C  C     . ALA C 2  96   ? 42.068  -27.036 60.572  1.00 36.14  ? 96   ALA C C     1 
ATOM   4270  O  O     . ALA C 2  96   ? 42.567  -26.396 59.642  1.00 35.19  ? 96   ALA C O     1 
ATOM   4271  C  CB    . ALA C 2  96   ? 39.763  -26.069 60.642  1.00 22.15  ? 96   ALA C CB    1 
ATOM   4272  N  N     . ARG C 2  97   ? 42.420  -28.285 60.862  1.00 34.57  ? 97   ARG C N     1 
ATOM   4273  C  CA    . ARG C 2  97   ? 43.371  -29.001 60.029  1.00 32.82  ? 97   ARG C CA    1 
ATOM   4274  C  C     . ARG C 2  97   ? 42.663  -29.525 58.793  1.00 26.17  ? 97   ARG C C     1 
ATOM   4275  O  O     . ARG C 2  97   ? 41.727  -30.335 58.885  1.00 24.84  ? 97   ARG C O     1 
ATOM   4276  C  CB    . ARG C 2  97   ? 44.022  -30.152 60.796  1.00 38.65  ? 97   ARG C CB    1 
ATOM   4277  C  CG    . ARG C 2  97   ? 45.148  -30.838 60.031  1.00 49.05  ? 97   ARG C CG    1 
ATOM   4278  C  CD    . ARG C 2  97   ? 46.014  -31.679 60.955  1.00 53.02  ? 97   ARG C CD    1 
ATOM   4279  N  NE    . ARG C 2  97   ? 46.464  -30.908 62.111  1.00 58.82  ? 97   ARG C NE    1 
ATOM   4280  C  CZ    . ARG C 2  97   ? 47.196  -31.404 63.103  1.00 68.10  ? 97   ARG C CZ    1 
ATOM   4281  N  NH1   . ARG C 2  97   ? 47.570  -32.677 63.083  1.00 62.94  ? 97   ARG C NH1   1 
ATOM   4282  N  NH2   . ARG C 2  97   ? 47.555  -30.626 64.117  1.00 67.90  ? 97   ARG C NH2   1 
ATOM   4283  N  N     . LEU C 2  98   ? 43.144  -29.057 57.643  1.00 34.89  ? 98   LEU C N     1 
ATOM   4284  C  CA    . LEU C 2  98   ? 42.565  -29.357 56.342  1.00 40.86  ? 98   LEU C CA    1 
ATOM   4285  C  C     . LEU C 2  98   ? 43.659  -29.818 55.391  1.00 48.92  ? 98   LEU C C     1 
ATOM   4286  O  O     . LEU C 2  98   ? 44.777  -29.301 55.423  1.00 51.61  ? 98   LEU C O     1 
ATOM   4287  C  CB    . LEU C 2  98   ? 41.928  -28.102 55.748  1.00 32.79  ? 98   LEU C CB    1 
ATOM   4288  C  CG    . LEU C 2  98   ? 40.938  -27.295 56.580  1.00 31.06  ? 98   LEU C CG    1 
ATOM   4289  C  CD1   . LEU C 2  98   ? 40.599  -26.004 55.855  1.00 29.78  ? 98   LEU C CD1   1 
ATOM   4290  C  CD2   . LEU C 2  98   ? 39.683  -28.109 56.852  1.00 34.30  ? 98   LEU C CD2   1 
ATOM   4291  N  N     . GLN C 2  99   ? 43.333  -30.777 54.533  1.00 52.89  ? 99   GLN C N     1 
ATOM   4292  C  CA    . GLN C 2  99   ? 44.263  -31.206 53.498  1.00 52.41  ? 99   GLN C CA    1 
ATOM   4293  C  C     . GLN C 2  99   ? 43.719  -30.882 52.111  1.00 45.66  ? 99   GLN C C     1 
ATOM   4294  O  O     . GLN C 2  99   ? 42.572  -31.191 51.793  1.00 47.80  ? 99   GLN C O     1 
ATOM   4295  C  CB    . GLN C 2  99   ? 44.568  -32.701 53.619  1.00 49.88  ? 99   GLN C CB    1 
ATOM   4296  C  CG    . GLN C 2  99   ? 43.345  -33.595 53.534  1.00 57.72  ? 99   GLN C CG    1 
ATOM   4297  C  CD    . GLN C 2  99   ? 43.703  -35.060 53.428  1.00 72.14  ? 99   GLN C CD    1 
ATOM   4298  O  OE1   . GLN C 2  99   ? 42.905  -35.873 52.957  1.00 74.90  ? 99   GLN C OE1   1 
ATOM   4299  N  NE2   . GLN C 2  99   ? 44.908  -35.409 53.869  1.00 65.69  ? 99   GLN C NE2   1 
ATOM   4300  N  N     . LEU C 2  100  ? 44.542  -30.239 51.292  1.00 52.84  ? 100  LEU C N     1 
ATOM   4301  C  CA    . LEU C 2  100  ? 44.176  -29.989 49.907  1.00 60.75  ? 100  LEU C CA    1 
ATOM   4302  C  C     . LEU C 2  100  ? 44.732  -31.099 49.031  1.00 58.06  ? 100  LEU C C     1 
ATOM   4303  O  O     . LEU C 2  100  ? 45.946  -31.229 48.868  1.00 67.14  ? 100  LEU C O     1 
ATOM   4304  C  CB    . LEU C 2  100  ? 44.704  -28.633 49.436  1.00 58.59  ? 100  LEU C CB    1 
ATOM   4305  C  CG    . LEU C 2  100  ? 44.464  -28.310 47.959  1.00 49.95  ? 100  LEU C CG    1 
ATOM   4306  C  CD1   . LEU C 2  100  ? 42.987  -28.425 47.612  1.00 49.13  ? 100  LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C 2  100  ? 44.986  -26.921 47.626  1.00 59.75  ? 100  LEU C CD2   1 
ATOM   4308  N  N     . ILE C 2  101  ? 43.832  -31.902 48.476  1.00 57.07  ? 101  ILE C N     1 
ATOM   4309  C  CA    . ILE C 2  101  ? 44.212  -32.981 47.582  1.00 53.44  ? 101  ILE C CA    1 
ATOM   4310  C  C     . ILE C 2  101  ? 43.962  -32.531 46.155  1.00 71.79  ? 101  ILE C C     1 
ATOM   4311  O  O     . ILE C 2  101  ? 42.837  -32.177 45.805  1.00 78.92  ? 101  ILE C O     1 
ATOM   4312  C  CB    . ILE C 2  101  ? 43.373  -34.248 47.837  1.00 52.93  ? 101  ILE C CB    1 
ATOM   4313  C  CG1   . ILE C 2  101  ? 43.289  -34.553 49.333  1.00 66.79  ? 101  ILE C CG1   1 
ATOM   4314  C  CG2   . ILE C 2  101  ? 43.945  -35.430 47.073  1.00 53.51  ? 101  ILE C CG2   1 
ATOM   4315  C  CD1   . ILE C 2  101  ? 42.402  -35.737 49.664  1.00 66.59  ? 101  ILE C CD1   1 
ATOM   4316  N  N     . HIS C 2  102  ? 45.001  -32.530 45.327  1.00 81.19  ? 102  HIS C N     1 
ATOM   4317  C  CA    . HIS C 2  102  ? 44.800  -32.229 43.919  1.00 82.74  ? 102  HIS C CA    1 
ATOM   4318  C  C     . HIS C 2  102  ? 44.406  -33.520 43.224  1.00 92.42  ? 102  HIS C C     1 
ATOM   4319  O  O     . HIS C 2  102  ? 45.171  -34.484 43.203  1.00 90.55  ? 102  HIS C O     1 
ATOM   4320  C  CB    . HIS C 2  102  ? 46.060  -31.643 43.278  1.00 78.31  ? 102  HIS C CB    1 
ATOM   4321  C  CG    . HIS C 2  102  ? 45.844  -31.136 41.885  1.00 98.39  ? 102  HIS C CG    1 
ATOM   4322  N  ND1   . HIS C 2  102  ? 45.609  -31.974 40.813  1.00 100.28 ? 102  HIS C ND1   1 
ATOM   4323  C  CD2   . HIS C 2  102  ? 45.819  -29.877 41.385  1.00 103.41 ? 102  HIS C CD2   1 
ATOM   4324  C  CE1   . HIS C 2  102  ? 45.454  -31.254 39.718  1.00 95.11  ? 102  HIS C CE1   1 
ATOM   4325  N  NE2   . HIS C 2  102  ? 45.577  -29.976 40.037  1.00 97.72  ? 102  HIS C NE2   1 
ATOM   4326  N  N     . LYS C 2  103  ? 43.203  -33.533 42.660  1.00 101.78 ? 103  LYS C N     1 
ATOM   4327  C  CA    . LYS C 2  103  ? 42.702  -34.709 41.972  1.00 102.43 ? 103  LYS C CA    1 
ATOM   4328  C  C     . LYS C 2  103  ? 43.533  -34.925 40.715  1.00 108.31 ? 103  LYS C C     1 
ATOM   4329  O  O     . LYS C 2  103  ? 43.882  -33.969 40.021  1.00 100.46 ? 103  LYS C O     1 
ATOM   4330  C  CB    . LYS C 2  103  ? 41.214  -34.551 41.645  1.00 88.96  ? 103  LYS C CB    1 
ATOM   4331  C  CG    . LYS C 2  103  ? 40.448  -35.864 41.537  1.00 87.83  ? 103  LYS C CG    1 
ATOM   4332  C  CD    . LYS C 2  103  ? 40.491  -36.436 40.127  1.00 96.59  ? 103  LYS C CD    1 
ATOM   4333  C  CE    . LYS C 2  103  ? 39.133  -36.344 39.445  1.00 76.67  ? 103  LYS C CE    1 
ATOM   4334  N  NZ    . LYS C 2  103  ? 39.235  -36.617 37.981  1.00 62.59  ? 103  LYS C NZ    1 
ATOM   4335  N  N     . ASP C 2  104  ? 43.882  -36.187 40.480  1.00 110.82 ? 104  ASP C N     1 
ATOM   4336  C  CA    . ASP C 2  104  ? 44.690  -36.640 39.343  1.00 108.29 ? 104  ASP C CA    1 
ATOM   4337  C  C     . ASP C 2  104  ? 46.188  -36.338 39.463  1.00 108.42 ? 104  ASP C C     1 
ATOM   4338  O  O     . ASP C 2  104  ? 46.984  -36.909 38.722  1.00 118.14 ? 104  ASP C O     1 
ATOM   4339  C  CB    . ASP C 2  104  ? 44.133  -36.108 38.015  1.00 107.51 ? 104  ASP C CB    1 
ATOM   4340  C  CG    . ASP C 2  104  ? 44.279  -37.096 36.882  1.00 115.25 ? 104  ASP C CG    1 
ATOM   4341  O  OD1   . ASP C 2  104  ? 45.217  -36.943 36.072  1.00 120.33 ? 104  ASP C OD1   1 
ATOM   4342  O  OD2   . ASP C 2  104  ? 43.443  -38.018 36.799  1.00 113.90 ? 104  ASP C OD2   1 
ATOM   4343  N  N     . THR C 2  105  ? 46.578  -35.446 40.371  1.00 102.96 ? 105  THR C N     1 
ATOM   4344  C  CA    . THR C 2  105  ? 47.995  -35.328 40.726  1.00 97.65  ? 105  THR C CA    1 
ATOM   4345  C  C     . THR C 2  105  ? 48.352  -36.230 41.915  1.00 105.94 ? 105  THR C C     1 
ATOM   4346  O  O     . THR C 2  105  ? 49.525  -36.505 42.177  1.00 105.41 ? 105  THR C O     1 
ATOM   4347  C  CB    . THR C 2  105  ? 48.386  -33.851 40.993  1.00 90.52  ? 105  THR C CB    1 
ATOM   4348  O  OG1   . THR C 2  105  ? 47.996  -33.058 39.868  1.00 92.65  ? 105  THR C OG1   1 
ATOM   4349  C  CG2   . THR C 2  105  ? 49.888  -33.688 41.185  1.00 74.69  ? 105  THR C CG2   1 
ATOM   4350  N  N     . GLY C 2  106  ? 47.325  -36.709 42.612  1.00 111.12 ? 106  GLY C N     1 
ATOM   4351  C  CA    . GLY C 2  106  ? 47.502  -37.529 43.801  1.00 102.64 ? 106  GLY C CA    1 
ATOM   4352  C  C     . GLY C 2  106  ? 48.159  -36.814 44.974  1.00 101.30 ? 106  GLY C C     1 
ATOM   4353  O  O     . GLY C 2  106  ? 48.428  -37.424 46.013  1.00 99.95  ? 106  GLY C O     1 
ATOM   4354  N  N     . LEU C 2  107  ? 48.394  -35.514 44.815  1.00 96.76  ? 107  LEU C N     1 
ATOM   4355  C  CA    . LEU C 2  107  ? 49.175  -34.736 45.770  1.00 88.96  ? 107  LEU C CA    1 
ATOM   4356  C  C     . LEU C 2  107  ? 48.326  -34.202 46.917  1.00 80.72  ? 107  LEU C C     1 
ATOM   4357  O  O     . LEU C 2  107  ? 47.191  -33.780 46.718  1.00 79.78  ? 107  LEU C O     1 
ATOM   4358  C  CB    . LEU C 2  107  ? 49.883  -33.585 45.044  1.00 89.46  ? 107  LEU C CB    1 
ATOM   4359  C  CG    . LEU C 2  107  ? 49.781  -32.149 45.578  1.00 84.77  ? 107  LEU C CG    1 
ATOM   4360  C  CD1   . LEU C 2  107  ? 50.757  -31.892 46.721  1.00 81.20  ? 107  LEU C CD1   1 
ATOM   4361  C  CD2   . LEU C 2  107  ? 50.002  -31.156 44.446  1.00 84.63  ? 107  LEU C CD2   1 
ATOM   4362  N  N     . ILE C 2  108  ? 48.888  -34.213 48.120  1.00 77.21  ? 108  ILE C N     1 
ATOM   4363  C  CA    . ILE C 2  108  ? 48.185  -33.702 49.289  1.00 73.62  ? 108  ILE C CA    1 
ATOM   4364  C  C     . ILE C 2  108  ? 49.018  -32.658 50.029  1.00 65.25  ? 108  ILE C C     1 
ATOM   4365  O  O     . ILE C 2  108  ? 50.234  -32.798 50.159  1.00 70.28  ? 108  ILE C O     1 
ATOM   4366  C  CB    . ILE C 2  108  ? 47.781  -34.846 50.250  1.00 73.56  ? 108  ILE C CB    1 
ATOM   4367  C  CG1   . ILE C 2  108  ? 48.996  -35.700 50.617  1.00 85.16  ? 108  ILE C CG1   1 
ATOM   4368  C  CG2   . ILE C 2  108  ? 46.716  -35.724 49.611  1.00 73.27  ? 108  ILE C CG2   1 
ATOM   4369  C  CD1   . ILE C 2  108  ? 48.682  -36.834 51.577  1.00 79.78  ? 108  ILE C CD1   1 
ATOM   4370  N  N     . LYS C 2  109  ? 48.365  -31.589 50.476  1.00 64.03  ? 109  LYS C N     1 
ATOM   4371  C  CA    . LYS C 2  109  ? 49.022  -30.607 51.334  1.00 66.49  ? 109  LYS C CA    1 
ATOM   4372  C  C     . LYS C 2  109  ? 48.194  -30.315 52.584  1.00 59.95  ? 109  LYS C C     1 
ATOM   4373  O  O     . LYS C 2  109  ? 47.110  -29.743 52.497  1.00 62.21  ? 109  LYS C O     1 
ATOM   4374  C  CB    . LYS C 2  109  ? 49.303  -29.314 50.564  1.00 58.05  ? 109  LYS C CB    1 
ATOM   4375  C  CG    . LYS C 2  109  ? 50.307  -29.475 49.435  1.00 64.65  ? 109  LYS C CG    1 
ATOM   4376  C  CD    . LYS C 2  109  ? 50.682  -28.134 48.828  1.00 72.84  ? 109  LYS C CD    1 
ATOM   4377  C  CE    . LYS C 2  109  ? 51.746  -28.295 47.753  1.00 70.91  ? 109  LYS C CE    1 
ATOM   4378  N  NZ    . LYS C 2  109  ? 52.976  -28.957 48.277  1.00 53.86  ? 109  LYS C NZ    1 
ATOM   4379  N  N     . GLU C 2  110  ? 48.716  -30.689 53.746  1.00 52.42  ? 110  GLU C N     1 
ATOM   4380  C  CA    . GLU C 2  110  ? 48.013  -30.450 55.000  1.00 46.80  ? 110  GLU C CA    1 
ATOM   4381  C  C     . GLU C 2  110  ? 48.420  -29.118 55.608  1.00 52.05  ? 110  GLU C C     1 
ATOM   4382  O  O     . GLU C 2  110  ? 49.590  -28.737 55.576  1.00 55.18  ? 110  GLU C O     1 
ATOM   4383  C  CB    . GLU C 2  110  ? 48.277  -31.573 56.004  1.00 54.73  ? 110  GLU C CB    1 
ATOM   4384  C  CG    . GLU C 2  110  ? 47.693  -32.922 55.619  1.00 68.95  ? 110  GLU C CG    1 
ATOM   4385  C  CD    . GLU C 2  110  ? 47.861  -33.957 56.718  1.00 68.27  ? 110  GLU C CD    1 
ATOM   4386  O  OE1   . GLU C 2  110  ? 48.145  -33.558 57.869  1.00 60.04  ? 110  GLU C OE1   1 
ATOM   4387  O  OE2   . GLU C 2  110  ? 47.710  -35.165 56.431  1.00 59.30  ? 110  GLU C OE2   1 
ATOM   4388  N  N     . ASP C 2  111  ? 47.443  -28.405 56.151  1.00 53.61  ? 111  ASP C N     1 
ATOM   4389  C  CA    . ASP C 2  111  ? 47.716  -27.163 56.853  1.00 50.18  ? 111  ASP C CA    1 
ATOM   4390  C  C     . ASP C 2  111  ? 46.654  -26.925 57.925  1.00 45.56  ? 111  ASP C C     1 
ATOM   4391  O  O     . ASP C 2  111  ? 45.496  -27.324 57.766  1.00 42.31  ? 111  ASP C O     1 
ATOM   4392  C  CB    . ASP C 2  111  ? 47.767  -25.998 55.859  1.00 57.38  ? 111  ASP C CB    1 
ATOM   4393  C  CG    . ASP C 2  111  ? 48.487  -24.782 56.415  1.00 63.92  ? 111  ASP C CG    1 
ATOM   4394  O  OD1   . ASP C 2  111  ? 48.384  -23.697 55.802  1.00 53.54  ? 111  ASP C OD1   1 
ATOM   4395  O  OD2   . ASP C 2  111  ? 49.155  -24.912 57.463  1.00 71.62  ? 111  ASP C OD2   1 
ATOM   4396  N  N     . GLU C 2  112  ? 47.051  -26.289 59.022  1.00 46.90  ? 112  GLU C N     1 
ATOM   4397  C  CA    . GLU C 2  112  ? 46.094  -25.887 60.042  1.00 38.92  ? 112  GLU C CA    1 
ATOM   4398  C  C     . GLU C 2  112  ? 45.718  -24.432 59.797  1.00 41.88  ? 112  GLU C C     1 
ATOM   4399  O  O     . GLU C 2  112  ? 46.552  -23.535 59.933  1.00 45.34  ? 112  GLU C O     1 
ATOM   4400  C  CB    . GLU C 2  112  ? 46.675  -26.062 61.447  1.00 33.49  ? 112  GLU C CB    1 
ATOM   4401  C  CG    . GLU C 2  112  ? 45.639  -25.928 62.555  1.00 36.56  ? 112  GLU C CG    1 
ATOM   4402  C  CD    . GLU C 2  112  ? 46.204  -26.175 63.946  1.00 43.54  ? 112  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C 2  112  ? 45.767  -27.148 64.600  1.00 44.24  ? 112  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C 2  112  ? 47.072  -25.393 64.393  1.00 37.00  ? 112  GLU C OE2   1 
ATOM   4405  N  N     . VAL C 2  113  ? 44.460  -24.207 59.429  1.00 34.50  ? 113  VAL C N     1 
ATOM   4406  C  CA    . VAL C 2  113  ? 43.990  -22.876 59.063  1.00 28.66  ? 113  VAL C CA    1 
ATOM   4407  C  C     . VAL C 2  113  ? 43.205  -22.213 60.194  1.00 27.91  ? 113  VAL C C     1 
ATOM   4408  O  O     . VAL C 2  113  ? 42.284  -22.807 60.751  1.00 29.43  ? 113  VAL C O     1 
ATOM   4409  C  CB    . VAL C 2  113  ? 43.112  -22.939 57.805  1.00 24.19  ? 113  VAL C CB    1 
ATOM   4410  C  CG1   . VAL C 2  113  ? 42.672  -21.549 57.394  1.00 32.92  ? 113  VAL C CG1   1 
ATOM   4411  C  CG2   . VAL C 2  113  ? 43.868  -23.618 56.676  1.00 30.54  ? 113  VAL C CG2   1 
ATOM   4412  N  N     . PHE C 2  114  ? 43.577  -20.980 60.529  1.00 33.40  ? 114  PHE C N     1 
ATOM   4413  C  CA    . PHE C 2  114  ? 42.897  -20.228 61.581  1.00 27.57  ? 114  PHE C CA    1 
ATOM   4414  C  C     . PHE C 2  114  ? 41.564  -19.679 61.079  1.00 28.16  ? 114  PHE C C     1 
ATOM   4415  O  O     . PHE C 2  114  ? 41.519  -18.928 60.105  1.00 32.07  ? 114  PHE C O     1 
ATOM   4416  C  CB    . PHE C 2  114  ? 43.793  -19.086 62.061  1.00 24.78  ? 114  PHE C CB    1 
ATOM   4417  C  CG    . PHE C 2  114  ? 43.160  -18.205 63.099  1.00 25.18  ? 114  PHE C CG    1 
ATOM   4418  C  CD1   . PHE C 2  114  ? 42.766  -18.721 64.320  1.00 25.18  ? 114  PHE C CD1   1 
ATOM   4419  C  CD2   . PHE C 2  114  ? 42.983  -16.854 62.864  1.00 28.45  ? 114  PHE C CD2   1 
ATOM   4420  C  CE1   . PHE C 2  114  ? 42.192  -17.909 65.279  1.00 23.11  ? 114  PHE C CE1   1 
ATOM   4421  C  CE2   . PHE C 2  114  ? 42.413  -16.038 63.821  1.00 27.33  ? 114  PHE C CE2   1 
ATOM   4422  C  CZ    . PHE C 2  114  ? 42.018  -16.567 65.030  1.00 20.83  ? 114  PHE C CZ    1 
ATOM   4423  N  N     . LEU C 2  115  ? 40.481  -20.065 61.748  1.00 27.29  ? 115  LEU C N     1 
ATOM   4424  C  CA    . LEU C 2  115  ? 39.130  -19.678 61.340  1.00 27.68  ? 115  LEU C CA    1 
ATOM   4425  C  C     . LEU C 2  115  ? 38.520  -18.480 62.076  1.00 31.01  ? 115  LEU C C     1 
ATOM   4426  O  O     . LEU C 2  115  ? 37.376  -18.113 61.810  1.00 44.87  ? 115  LEU C O     1 
ATOM   4427  C  CB    . LEU C 2  115  ? 38.182  -20.877 61.413  1.00 20.38  ? 115  LEU C CB    1 
ATOM   4428  C  CG    . LEU C 2  115  ? 38.581  -22.064 60.539  1.00 18.93  ? 115  LEU C CG    1 
ATOM   4429  C  CD1   . LEU C 2  115  ? 37.438  -23.056 60.421  1.00 22.77  ? 115  LEU C CD1   1 
ATOM   4430  C  CD2   . LEU C 2  115  ? 39.027  -21.590 59.172  1.00 23.93  ? 115  LEU C CD2   1 
ATOM   4431  N  N     . GLY C 2  116  ? 39.267  -17.872 62.991  1.00 20.41  ? 116  GLY C N     1 
ATOM   4432  C  CA    . GLY C 2  116  ? 38.711  -16.833 63.843  1.00 21.97  ? 116  GLY C CA    1 
ATOM   4433  C  C     . GLY C 2  116  ? 38.315  -17.360 65.211  1.00 22.58  ? 116  GLY C C     1 
ATOM   4434  O  O     . GLY C 2  116  ? 38.768  -18.428 65.615  1.00 30.44  ? 116  GLY C O     1 
ATOM   4435  N  N     . HIS C 2  117  ? 37.477  -16.617 65.931  1.00 18.69  ? 117  HIS C N     1 
ATOM   4436  C  CA    . HIS C 2  117  ? 37.169  -16.955 67.324  1.00 19.22  ? 117  HIS C CA    1 
ATOM   4437  C  C     . HIS C 2  117  ? 35.717  -17.363 67.593  1.00 20.93  ? 117  HIS C C     1 
ATOM   4438  O  O     . HIS C 2  117  ? 34.784  -16.786 67.035  1.00 26.66  ? 117  HIS C O     1 
ATOM   4439  C  CB    . HIS C 2  117  ? 37.538  -15.788 68.240  1.00 19.19  ? 117  HIS C CB    1 
ATOM   4440  C  CG    . HIS C 2  117  ? 39.009  -15.546 68.355  1.00 20.05  ? 117  HIS C CG    1 
ATOM   4441  N  ND1   . HIS C 2  117  ? 39.727  -15.856 69.490  1.00 18.99  ? 117  HIS C ND1   1 
ATOM   4442  C  CD2   . HIS C 2  117  ? 39.898  -15.019 67.480  1.00 21.29  ? 117  HIS C CD2   1 
ATOM   4443  C  CE1   . HIS C 2  117  ? 40.994  -15.534 69.309  1.00 19.10  ? 117  HIS C CE1   1 
ATOM   4444  N  NE2   . HIS C 2  117  ? 41.125  -15.024 68.097  1.00 25.11  ? 117  HIS C NE2   1 
ATOM   4445  N  N     . ILE C 2  118  ? 35.541  -18.364 68.453  1.00 14.38  ? 118  ILE C N     1 
ATOM   4446  C  CA    . ILE C 2  118  ? 34.217  -18.762 68.934  1.00 13.83  ? 118  ILE C CA    1 
ATOM   4447  C  C     . ILE C 2  118  ? 34.003  -18.405 70.409  1.00 17.50  ? 118  ILE C C     1 
ATOM   4448  O  O     . ILE C 2  118  ? 34.798  -18.798 71.262  1.00 16.49  ? 118  ILE C O     1 
ATOM   4449  C  CB    . ILE C 2  118  ? 33.967  -20.264 68.744  1.00 15.22  ? 118  ILE C CB    1 
ATOM   4450  C  CG1   . ILE C 2  118  ? 33.830  -20.595 67.265  1.00 24.72  ? 118  ILE C CG1   1 
ATOM   4451  C  CG2   . ILE C 2  118  ? 32.700  -20.692 69.458  1.00 17.73  ? 118  ILE C CG2   1 
ATOM   4452  C  CD1   . ILE C 2  118  ? 33.342  -21.996 67.024  1.00 26.79  ? 118  ILE C CD1   1 
ATOM   4453  N  N     . PRO C 2  119  ? 32.934  -17.646 70.710  1.00 16.51  ? 119  PRO C N     1 
ATOM   4454  C  CA    . PRO C 2  119  ? 32.581  -17.272 72.086  1.00 15.75  ? 119  PRO C CA    1 
ATOM   4455  C  C     . PRO C 2  119  ? 32.443  -18.477 73.020  1.00 14.30  ? 119  PRO C C     1 
ATOM   4456  O  O     . PRO C 2  119  ? 31.916  -19.513 72.622  1.00 12.02  ? 119  PRO C O     1 
ATOM   4457  C  CB    . PRO C 2  119  ? 31.226  -16.584 71.918  1.00 12.74  ? 119  PRO C CB    1 
ATOM   4458  C  CG    . PRO C 2  119  ? 31.253  -16.052 70.535  1.00 12.72  ? 119  PRO C CG    1 
ATOM   4459  C  CD    . PRO C 2  119  ? 32.004  -17.065 69.729  1.00 13.04  ? 119  PRO C CD    1 
ATOM   4460  N  N     . LEU C 2  120  ? 32.916  -18.332 74.254  1.00 15.38  ? 120  LEU C N     1 
ATOM   4461  C  CA    . LEU C 2  120  ? 32.873  -19.415 75.229  1.00 13.26  ? 120  LEU C CA    1 
ATOM   4462  C  C     . LEU C 2  120  ? 31.898  -19.111 76.352  1.00 16.11  ? 120  LEU C C     1 
ATOM   4463  O  O     . LEU C 2  120  ? 31.906  -18.017 76.914  1.00 20.94  ? 120  LEU C O     1 
ATOM   4464  C  CB    . LEU C 2  120  ? 34.256  -19.645 75.834  1.00 14.06  ? 120  LEU C CB    1 
ATOM   4465  C  CG    . LEU C 2  120  ? 35.372  -20.097 74.900  1.00 17.46  ? 120  LEU C CG    1 
ATOM   4466  C  CD1   . LEU C 2  120  ? 36.656  -20.255 75.691  1.00 20.04  ? 120  LEU C CD1   1 
ATOM   4467  C  CD2   . LEU C 2  120  ? 34.999  -21.395 74.191  1.00 15.86  ? 120  LEU C CD2   1 
ATOM   4468  N  N     . MET C 2  121  ? 31.066  -20.089 76.687  1.00 15.07  ? 121  MET C N     1 
ATOM   4469  C  CA    . MET C 2  121  ? 30.124  -19.939 77.786  1.00 13.92  ? 121  MET C CA    1 
ATOM   4470  C  C     . MET C 2  121  ? 30.866  -19.956 79.120  1.00 11.30  ? 121  MET C C     1 
ATOM   4471  O  O     . MET C 2  121  ? 31.842  -20.680 79.286  1.00 14.34  ? 121  MET C O     1 
ATOM   4472  C  CB    . MET C 2  121  ? 29.073  -21.048 77.729  1.00 14.57  ? 121  MET C CB    1 
ATOM   4473  C  CG    . MET C 2  121  ? 28.055  -21.007 78.845  1.00 16.73  ? 121  MET C CG    1 
ATOM   4474  S  SD    . MET C 2  121  ? 26.807  -22.295 78.684  1.00 15.74  ? 121  MET C SD    1 
ATOM   4475  C  CE    . MET C 2  121  ? 25.902  -21.713 77.257  1.00 18.56  ? 121  MET C CE    1 
ATOM   4476  N  N     . THR C 2  122  ? 30.411  -19.140 80.063  1.00 15.64  ? 122  THR C N     1 
ATOM   4477  C  CA    . THR C 2  122  ? 31.024  -19.079 81.383  1.00 16.99  ? 122  THR C CA    1 
ATOM   4478  C  C     . THR C 2  122  ? 30.419  -20.132 82.305  1.00 19.73  ? 122  THR C C     1 
ATOM   4479  O  O     . THR C 2  122  ? 29.537  -20.889 81.899  1.00 18.94  ? 122  THR C O     1 
ATOM   4480  C  CB    . THR C 2  122  ? 30.865  -17.685 82.011  1.00 16.07  ? 122  THR C CB    1 
ATOM   4481  O  OG1   . THR C 2  122  ? 29.475  -17.403 82.209  1.00 21.06  ? 122  THR C OG1   1 
ATOM   4482  C  CG2   . THR C 2  122  ? 31.458  -16.629 81.099  1.00 15.89  ? 122  THR C CG2   1 
ATOM   4483  N  N     . GLU C 2  123  ? 30.893  -20.172 83.546  1.00 23.18  ? 123  GLU C N     1 
ATOM   4484  C  CA    . GLU C 2  123  ? 30.467  -21.191 84.500  1.00 32.70  ? 123  GLU C CA    1 
ATOM   4485  C  C     . GLU C 2  123  ? 28.956  -21.200 84.708  1.00 27.21  ? 123  GLU C C     1 
ATOM   4486  O  O     . GLU C 2  123  ? 28.338  -22.262 84.765  1.00 29.89  ? 123  GLU C O     1 
ATOM   4487  C  CB    . GLU C 2  123  ? 31.169  -20.993 85.846  1.00 52.42  ? 123  GLU C CB    1 
ATOM   4488  C  CG    . GLU C 2  123  ? 32.690  -21.006 85.777  1.00 62.97  ? 123  GLU C CG    1 
ATOM   4489  C  CD    . GLU C 2  123  ? 33.340  -20.732 87.125  1.00 70.59  ? 123  GLU C CD    1 
ATOM   4490  O  OE1   . GLU C 2  123  ? 32.810  -21.202 88.157  1.00 47.81  ? 123  GLU C OE1   1 
ATOM   4491  O  OE2   . GLU C 2  123  ? 34.379  -20.039 87.152  1.00 84.91  ? 123  GLU C OE2   1 
ATOM   4492  N  N     . ASP C 2  124  ? 28.365  -20.014 84.802  1.00 29.57  ? 124  ASP C N     1 
ATOM   4493  C  CA    . ASP C 2  124  ? 26.951  -19.890 85.140  1.00 30.24  ? 124  ASP C CA    1 
ATOM   4494  C  C     . ASP C 2  124  ? 26.030  -20.052 83.933  1.00 27.73  ? 124  ASP C C     1 
ATOM   4495  O  O     . ASP C 2  124  ? 24.808  -20.044 84.072  1.00 31.88  ? 124  ASP C O     1 
ATOM   4496  C  CB    . ASP C 2  124  ? 26.679  -18.555 85.839  1.00 32.47  ? 124  ASP C CB    1 
ATOM   4497  C  CG    . ASP C 2  124  ? 26.945  -17.359 84.941  1.00 36.49  ? 124  ASP C CG    1 
ATOM   4498  O  OD1   . ASP C 2  124  ? 27.884  -17.421 84.121  1.00 34.34  ? 124  ASP C OD1   1 
ATOM   4499  O  OD2   . ASP C 2  124  ? 26.211  -16.355 85.056  1.00 45.88  ? 124  ASP C OD2   1 
ATOM   4500  N  N     . GLY C 2  125  ? 26.612  -20.200 82.749  1.00 24.13  ? 125  GLY C N     1 
ATOM   4501  C  CA    . GLY C 2  125  ? 25.824  -20.467 81.561  1.00 21.81  ? 125  GLY C CA    1 
ATOM   4502  C  C     . GLY C 2  125  ? 25.580  -19.271 80.659  1.00 23.77  ? 125  GLY C C     1 
ATOM   4503  O  O     . GLY C 2  125  ? 24.799  -19.357 79.713  1.00 21.92  ? 125  GLY C O     1 
ATOM   4504  N  N     . SER C 2  126  ? 26.238  -18.153 80.950  1.00 27.79  ? 126  SER C N     1 
ATOM   4505  C  CA    . SER C 2  126  ? 26.075  -16.944 80.145  1.00 27.59  ? 126  SER C CA    1 
ATOM   4506  C  C     . SER C 2  126  ? 27.274  -16.724 79.232  1.00 21.08  ? 126  SER C C     1 
ATOM   4507  O  O     . SER C 2  126  ? 28.227  -17.497 79.261  1.00 22.92  ? 126  SER C O     1 
ATOM   4508  C  CB    . SER C 2  126  ? 25.871  -15.721 81.045  1.00 28.71  ? 126  SER C CB    1 
ATOM   4509  O  OG    . SER C 2  126  ? 26.988  -15.513 81.893  1.00 24.98  ? 126  SER C OG    1 
ATOM   4510  N  N     . PHE C 2  127  ? 27.227  -15.666 78.427  1.00 21.79  ? 127  PHE C N     1 
ATOM   4511  C  CA    . PHE C 2  127  ? 28.363  -15.298 77.589  1.00 23.12  ? 127  PHE C CA    1 
ATOM   4512  C  C     . PHE C 2  127  ? 28.814  -13.868 77.862  1.00 24.61  ? 127  PHE C C     1 
ATOM   4513  O  O     . PHE C 2  127  ? 28.181  -13.139 78.630  1.00 26.07  ? 127  PHE C O     1 
ATOM   4514  C  CB    . PHE C 2  127  ? 27.993  -15.414 76.109  1.00 19.75  ? 127  PHE C CB    1 
ATOM   4515  C  CG    . PHE C 2  127  ? 27.762  -16.822 75.644  1.00 22.99  ? 127  PHE C CG    1 
ATOM   4516  C  CD1   . PHE C 2  127  ? 26.554  -17.458 75.883  1.00 23.65  ? 127  PHE C CD1   1 
ATOM   4517  C  CD2   . PHE C 2  127  ? 28.747  -17.505 74.947  1.00 19.83  ? 127  PHE C CD2   1 
ATOM   4518  C  CE1   . PHE C 2  127  ? 26.338  -18.752 75.446  1.00 21.11  ? 127  PHE C CE1   1 
ATOM   4519  C  CE2   . PHE C 2  127  ? 28.536  -18.801 74.511  1.00 16.87  ? 127  PHE C CE2   1 
ATOM   4520  C  CZ    . PHE C 2  127  ? 27.331  -19.424 74.761  1.00 16.43  ? 127  PHE C CZ    1 
ATOM   4521  N  N     . ILE C 2  128  ? 29.900  -13.471 77.204  1.00 21.85  ? 128  ILE C N     1 
ATOM   4522  C  CA    . ILE C 2  128  ? 30.383  -12.096 77.234  1.00 20.45  ? 128  ILE C CA    1 
ATOM   4523  C  C     . ILE C 2  128  ? 30.625  -11.644 75.801  1.00 22.93  ? 128  ILE C C     1 
ATOM   4524  O  O     . ILE C 2  128  ? 31.505  -12.169 75.124  1.00 23.19  ? 128  ILE C O     1 
ATOM   4525  C  CB    . ILE C 2  128  ? 31.700  -11.975 78.026  1.00 17.94  ? 128  ILE C CB    1 
ATOM   4526  C  CG1   . ILE C 2  128  ? 31.498  -12.418 79.477  1.00 18.02  ? 128  ILE C CG1   1 
ATOM   4527  C  CG2   . ILE C 2  128  ? 32.230  -10.552 77.967  1.00 19.43  ? 128  ILE C CG2   1 
ATOM   4528  C  CD1   . ILE C 2  128  ? 32.776  -12.494 80.275  1.00 17.50  ? 128  ILE C CD1   1 
ATOM   4529  N  N     . ILE C 2  129  ? 29.852  -10.670 75.339  1.00 24.62  ? 129  ILE C N     1 
ATOM   4530  C  CA    . ILE C 2  129  ? 29.967  -10.208 73.961  1.00 24.93  ? 129  ILE C CA    1 
ATOM   4531  C  C     . ILE C 2  129  ? 30.215  -8.709  73.938  1.00 34.30  ? 129  ILE C C     1 
ATOM   4532  O  O     . ILE C 2  129  ? 29.360  -7.927  74.358  1.00 43.56  ? 129  ILE C O     1 
ATOM   4533  C  CB    . ILE C 2  129  ? 28.692  -10.517 73.148  1.00 23.77  ? 129  ILE C CB    1 
ATOM   4534  C  CG1   . ILE C 2  129  ? 28.373  -12.016 73.182  1.00 21.75  ? 129  ILE C CG1   1 
ATOM   4535  C  CG2   . ILE C 2  129  ? 28.845  -10.033 71.717  1.00 27.34  ? 129  ILE C CG2   1 
ATOM   4536  C  CD1   . ILE C 2  129  ? 29.392  -12.883 72.479  1.00 18.62  ? 129  ILE C CD1   1 
ATOM   4537  N  N     . ASN C 2  130  ? 31.387  -8.316  73.447  1.00 30.51  ? 130  ASN C N     1 
ATOM   4538  C  CA    . ASN C 2  130  ? 31.795  -6.914  73.434  1.00 31.98  ? 130  ASN C CA    1 
ATOM   4539  C  C     . ASN C 2  130  ? 31.727  -6.267  74.817  1.00 32.96  ? 130  ASN C C     1 
ATOM   4540  O  O     . ASN C 2  130  ? 31.441  -5.076  74.940  1.00 41.02  ? 130  ASN C O     1 
ATOM   4541  C  CB    . ASN C 2  130  ? 30.970  -6.111  72.425  1.00 34.25  ? 130  ASN C CB    1 
ATOM   4542  C  CG    . ASN C 2  130  ? 31.047  -6.684  71.023  1.00 40.83  ? 130  ASN C CG    1 
ATOM   4543  O  OD1   . ASN C 2  130  ? 30.023  -6.924  70.380  1.00 37.42  ? 130  ASN C OD1   1 
ATOM   4544  N  ND2   . ASN C 2  130  ? 32.266  -6.908  70.541  1.00 40.13  ? 130  ASN C ND2   1 
ATOM   4545  N  N     . GLY C 2  131  ? 31.984  -7.062  75.851  1.00 29.18  ? 131  GLY C N     1 
ATOM   4546  C  CA    . GLY C 2  131  ? 32.061  -6.559  77.209  1.00 32.77  ? 131  GLY C CA    1 
ATOM   4547  C  C     . GLY C 2  131  ? 30.802  -6.772  78.026  1.00 35.64  ? 131  GLY C C     1 
ATOM   4548  O  O     . GLY C 2  131  ? 30.839  -6.741  79.258  1.00 36.51  ? 131  GLY C O     1 
ATOM   4549  N  N     . ALA C 2  132  ? 29.684  -6.991  77.342  1.00 27.49  ? 132  ALA C N     1 
ATOM   4550  C  CA    . ALA C 2  132  ? 28.400  -7.141  78.018  1.00 28.38  ? 132  ALA C CA    1 
ATOM   4551  C  C     . ALA C 2  132  ? 27.985  -8.603  78.153  1.00 27.90  ? 132  ALA C C     1 
ATOM   4552  O  O     . ALA C 2  132  ? 28.102  -9.382  77.205  1.00 22.03  ? 132  ALA C O     1 
ATOM   4553  C  CB    . ALA C 2  132  ? 27.326  -6.351  77.287  1.00 31.80  ? 132  ALA C CB    1 
ATOM   4554  N  N     . ASP C 2  133  ? 27.501  -8.965  79.338  1.00 25.46  ? 133  ASP C N     1 
ATOM   4555  C  CA    . ASP C 2  133  ? 27.004  -10.313 79.590  1.00 21.12  ? 133  ASP C CA    1 
ATOM   4556  C  C     . ASP C 2  133  ? 25.738  -10.573 78.787  1.00 19.17  ? 133  ASP C C     1 
ATOM   4557  O  O     . ASP C 2  133  ? 24.851  -9.726  78.735  1.00 21.65  ? 133  ASP C O     1 
ATOM   4558  C  CB    . ASP C 2  133  ? 26.721  -10.514 81.080  1.00 28.92  ? 133  ASP C CB    1 
ATOM   4559  C  CG    . ASP C 2  133  ? 27.977  -10.811 81.881  1.00 42.07  ? 133  ASP C CG    1 
ATOM   4560  O  OD1   . ASP C 2  133  ? 28.276  -12.007 82.097  1.00 40.13  ? 133  ASP C OD1   1 
ATOM   4561  O  OD2   . ASP C 2  133  ? 28.661  -9.852  82.299  1.00 46.85  ? 133  ASP C OD2   1 
ATOM   4562  N  N     . ARG C 2  134  ? 25.655  -11.742 78.161  1.00 21.06  ? 134  ARG C N     1 
ATOM   4563  C  CA    . ARG C 2  134  ? 24.474  -12.091 77.371  1.00 18.41  ? 134  ARG C CA    1 
ATOM   4564  C  C     . ARG C 2  134  ? 23.983  -13.509 77.636  1.00 18.52  ? 134  ARG C C     1 
ATOM   4565  O  O     . ARG C 2  134  ? 24.689  -14.324 78.222  1.00 23.00  ? 134  ARG C O     1 
ATOM   4566  C  CB    . ARG C 2  134  ? 24.736  -11.894 75.878  1.00 17.38  ? 134  ARG C CB    1 
ATOM   4567  C  CG    . ARG C 2  134  ? 24.721  -10.442 75.448  1.00 21.74  ? 134  ARG C CG    1 
ATOM   4568  C  CD    . ARG C 2  134  ? 24.885  -10.297 73.947  1.00 23.73  ? 134  ARG C CD    1 
ATOM   4569  N  NE    . ARG C 2  134  ? 24.389  -9.003  73.489  1.00 24.76  ? 134  ARG C NE    1 
ATOM   4570  C  CZ    . ARG C 2  134  ? 23.137  -8.785  73.103  1.00 22.59  ? 134  ARG C CZ    1 
ATOM   4571  N  NH1   . ARG C 2  134  ? 22.258  -9.777  73.109  1.00 18.35  ? 134  ARG C NH1   1 
ATOM   4572  N  NH2   . ARG C 2  134  ? 22.764  -7.576  72.705  1.00 38.49  ? 134  ARG C NH2   1 
ATOM   4573  N  N     . VAL C 2  135  ? 22.759  -13.787 77.203  1.00 14.34  ? 135  VAL C N     1 
ATOM   4574  C  CA    . VAL C 2  135  ? 22.126  -15.080 77.426  1.00 12.64  ? 135  VAL C CA    1 
ATOM   4575  C  C     . VAL C 2  135  ? 21.415  -15.545 76.165  1.00 12.88  ? 135  VAL C C     1 
ATOM   4576  O  O     . VAL C 2  135  ? 20.577  -14.829 75.618  1.00 15.74  ? 135  VAL C O     1 
ATOM   4577  C  CB    . VAL C 2  135  ? 21.103  -15.012 78.582  1.00 12.26  ? 135  VAL C CB    1 
ATOM   4578  C  CG1   . VAL C 2  135  ? 20.143  -16.187 78.524  1.00 15.02  ? 135  VAL C CG1   1 
ATOM   4579  C  CG2   . VAL C 2  135  ? 21.814  -14.961 79.929  1.00 15.50  ? 135  VAL C CG2   1 
ATOM   4580  N  N     . ILE C 2  136  ? 21.757  -16.740 75.694  1.00 13.34  ? 136  ILE C N     1 
ATOM   4581  C  CA    . ILE C 2  136  ? 21.041  -17.323 74.568  1.00 15.85  ? 136  ILE C CA    1 
ATOM   4582  C  C     . ILE C 2  136  ? 19.808  -18.049 75.088  1.00 13.47  ? 136  ILE C C     1 
ATOM   4583  O  O     . ILE C 2  136  ? 19.908  -18.942 75.927  1.00 11.62  ? 136  ILE C O     1 
ATOM   4584  C  CB    . ILE C 2  136  ? 21.916  -18.294 73.759  1.00 15.05  ? 136  ILE C CB    1 
ATOM   4585  C  CG1   . ILE C 2  136  ? 23.175  -17.589 73.252  1.00 16.90  ? 136  ILE C CG1   1 
ATOM   4586  C  CG2   . ILE C 2  136  ? 21.135  -18.859 72.587  1.00 15.71  ? 136  ILE C CG2   1 
ATOM   4587  C  CD1   . ILE C 2  136  ? 22.897  -16.505 72.239  1.00 17.06  ? 136  ILE C CD1   1 
ATOM   4588  N  N     . VAL C 2  137  ? 18.643  -17.647 74.598  1.00 13.72  ? 137  VAL C N     1 
ATOM   4589  C  CA    . VAL C 2  137  ? 17.389  -18.199 75.083  1.00 14.00  ? 137  VAL C CA    1 
ATOM   4590  C  C     . VAL C 2  137  ? 16.946  -19.369 74.223  1.00 14.24  ? 137  VAL C C     1 
ATOM   4591  O  O     . VAL C 2  137  ? 16.933  -19.279 72.997  1.00 18.35  ? 137  VAL C O     1 
ATOM   4592  C  CB    . VAL C 2  137  ? 16.286  -17.128 75.126  1.00 13.86  ? 137  VAL C CB    1 
ATOM   4593  C  CG1   . VAL C 2  137  ? 14.939  -17.753 75.468  1.00 11.92  ? 137  VAL C CG1   1 
ATOM   4594  C  CG2   . VAL C 2  137  ? 16.651  -16.048 76.130  1.00 11.99  ? 137  VAL C CG2   1 
ATOM   4595  N  N     . SER C 2  138  ? 16.596  -20.469 74.879  1.00 14.02  ? 138  SER C N     1 
ATOM   4596  C  CA    . SER C 2  138  ? 16.129  -21.667 74.196  1.00 15.18  ? 138  SER C CA    1 
ATOM   4597  C  C     . SER C 2  138  ? 14.853  -21.374 73.416  1.00 16.12  ? 138  SER C C     1 
ATOM   4598  O  O     . SER C 2  138  ? 13.943  -20.715 73.917  1.00 17.89  ? 138  SER C O     1 
ATOM   4599  C  CB    . SER C 2  138  ? 15.873  -22.779 75.214  1.00 16.04  ? 138  SER C CB    1 
ATOM   4600  O  OG    . SER C 2  138  ? 16.794  -22.702 76.288  1.00 18.51  ? 138  SER C OG    1 
ATOM   4601  N  N     . GLN C 2  139  ? 14.786  -21.862 72.185  1.00 16.90  ? 139  GLN C N     1 
ATOM   4602  C  CA    . GLN C 2  139  ? 13.603  -21.649 71.367  1.00 17.87  ? 139  GLN C CA    1 
ATOM   4603  C  C     . GLN C 2  139  ? 12.725  -22.892 71.368  1.00 18.13  ? 139  GLN C C     1 
ATOM   4604  O  O     . GLN C 2  139  ? 13.225  -24.002 71.289  1.00 17.18  ? 139  GLN C O     1 
ATOM   4605  C  CB    . GLN C 2  139  ? 14.002  -21.293 69.938  1.00 18.61  ? 139  GLN C CB    1 
ATOM   4606  C  CG    . GLN C 2  139  ? 12.838  -20.874 69.066  1.00 22.89  ? 139  GLN C CG    1 
ATOM   4607  C  CD    . GLN C 2  139  ? 13.260  -20.587 67.644  1.00 35.43  ? 139  GLN C CD    1 
ATOM   4608  O  OE1   . GLN C 2  139  ? 12.848  -19.589 67.052  1.00 41.46  ? 139  GLN C OE1   1 
ATOM   4609  N  NE2   . GLN C 2  139  ? 14.085  -21.465 67.083  1.00 35.23  ? 139  GLN C NE2   1 
ATOM   4610  N  N     . ILE C 2  140  ? 11.414  -22.708 71.471  1.00 23.83  ? 140  ILE C N     1 
ATOM   4611  C  CA    . ILE C 2  140  ? 10.489  -23.832 71.361  1.00 17.68  ? 140  ILE C CA    1 
ATOM   4612  C  C     . ILE C 2  140  ? 9.867   -23.835 69.965  1.00 18.29  ? 140  ILE C C     1 
ATOM   4613  O  O     . ILE C 2  140  ? 9.524   -22.779 69.423  1.00 14.74  ? 140  ILE C O     1 
ATOM   4614  C  CB    . ILE C 2  140  ? 9.414   -23.814 72.482  1.00 14.17  ? 140  ILE C CB    1 
ATOM   4615  C  CG1   . ILE C 2  140  ? 8.652   -25.137 72.540  1.00 17.06  ? 140  ILE C CG1   1 
ATOM   4616  C  CG2   . ILE C 2  140  ? 8.455   -22.656 72.316  1.00 15.66  ? 140  ILE C CG2   1 
ATOM   4617  C  CD1   . ILE C 2  140  ? 7.790   -25.275 73.781  1.00 15.28  ? 140  ILE C CD1   1 
ATOM   4618  N  N     . HIS C 2  141  ? 9.761   -25.015 69.361  1.00 18.51  ? 141  HIS C N     1 
ATOM   4619  C  CA    . HIS C 2  141  ? 9.229   -25.093 68.004  1.00 15.57  ? 141  HIS C CA    1 
ATOM   4620  C  C     . HIS C 2  141  ? 8.621   -26.449 67.699  1.00 18.28  ? 141  HIS C C     1 
ATOM   4621  O  O     . HIS C 2  141  ? 8.831   -27.405 68.439  1.00 19.61  ? 141  HIS C O     1 
ATOM   4622  C  CB    . HIS C 2  141  ? 10.303  -24.755 66.972  1.00 12.77  ? 141  HIS C CB    1 
ATOM   4623  C  CG    . HIS C 2  141  ? 11.268  -25.869 66.715  1.00 17.46  ? 141  HIS C CG    1 
ATOM   4624  N  ND1   . HIS C 2  141  ? 11.669  -26.225 65.446  1.00 19.62  ? 141  HIS C ND1   1 
ATOM   4625  C  CD2   . HIS C 2  141  ? 11.919  -26.700 67.563  1.00 20.74  ? 141  HIS C CD2   1 
ATOM   4626  C  CE1   . HIS C 2  141  ? 12.525  -27.230 65.522  1.00 21.99  ? 141  HIS C CE1   1 
ATOM   4627  N  NE2   . HIS C 2  141  ? 12.693  -27.535 66.796  1.00 24.56  ? 141  HIS C NE2   1 
ATOM   4628  N  N     . ARG C 2  142  ? 7.842   -26.516 66.623  1.00 20.24  ? 142  ARG C N     1 
ATOM   4629  C  CA    . ARG C 2  142  ? 7.284   -27.783 66.171  1.00 20.65  ? 142  ARG C CA    1 
ATOM   4630  C  C     . ARG C 2  142  ? 8.396   -28.744 65.782  1.00 27.81  ? 142  ARG C C     1 
ATOM   4631  O  O     . ARG C 2  142  ? 9.251   -28.421 64.952  1.00 22.40  ? 142  ARG C O     1 
ATOM   4632  C  CB    . ARG C 2  142  ? 6.362   -27.574 64.974  1.00 21.48  ? 142  ARG C CB    1 
ATOM   4633  C  CG    . ARG C 2  142  ? 5.054   -26.895 65.304  1.00 34.98  ? 142  ARG C CG    1 
ATOM   4634  C  CD    . ARG C 2  142  ? 4.137   -26.898 64.095  1.00 44.88  ? 142  ARG C CD    1 
ATOM   4635  N  NE    . ARG C 2  142  ? 3.767   -28.253 63.697  1.00 44.29  ? 142  ARG C NE    1 
ATOM   4636  C  CZ    . ARG C 2  142  ? 3.011   -28.537 62.643  1.00 43.64  ? 142  ARG C CZ    1 
ATOM   4637  N  NH1   . ARG C 2  142  ? 2.550   -27.559 61.876  1.00 45.72  ? 142  ARG C NH1   1 
ATOM   4638  N  NH2   . ARG C 2  142  ? 2.720   -29.798 62.352  1.00 38.12  ? 142  ARG C NH2   1 
ATOM   4639  N  N     . SER C 2  143  ? 8.367   -29.931 66.379  1.00 31.20  ? 143  SER C N     1 
ATOM   4640  C  CA    . SER C 2  143  ? 9.355   -30.961 66.102  1.00 26.33  ? 143  SER C CA    1 
ATOM   4641  C  C     . SER C 2  143  ? 9.238   -31.443 64.669  1.00 28.04  ? 143  SER C C     1 
ATOM   4642  O  O     . SER C 2  143  ? 8.136   -31.569 64.141  1.00 28.82  ? 143  SER C O     1 
ATOM   4643  C  CB    . SER C 2  143  ? 9.175   -32.144 67.053  1.00 28.48  ? 143  SER C CB    1 
ATOM   4644  O  OG    . SER C 2  143  ? 9.857   -33.289 66.573  1.00 28.13  ? 143  SER C OG    1 
ATOM   4645  N  N     . PRO C 2  144  ? 10.382  -31.705 64.030  1.00 29.32  ? 144  PRO C N     1 
ATOM   4646  C  CA    . PRO C 2  144  ? 10.368  -32.326 62.705  1.00 35.11  ? 144  PRO C CA    1 
ATOM   4647  C  C     . PRO C 2  144  ? 9.742   -33.717 62.778  1.00 38.68  ? 144  PRO C C     1 
ATOM   4648  O  O     . PRO C 2  144  ? 9.751   -34.341 63.840  1.00 44.85  ? 144  PRO C O     1 
ATOM   4649  C  CB    . PRO C 2  144  ? 11.855  -32.434 62.357  1.00 37.90  ? 144  PRO C CB    1 
ATOM   4650  C  CG    . PRO C 2  144  ? 12.520  -31.399 63.199  1.00 33.80  ? 144  PRO C CG    1 
ATOM   4651  C  CD    . PRO C 2  144  ? 11.743  -31.363 64.471  1.00 22.78  ? 144  PRO C CD    1 
ATOM   4652  N  N     . GLY C 2  145  ? 9.191   -34.189 61.667  1.00 33.81  ? 145  GLY C N     1 
ATOM   4653  C  CA    . GLY C 2  145  ? 8.570   -35.497 61.622  1.00 36.44  ? 145  GLY C CA    1 
ATOM   4654  C  C     . GLY C 2  145  ? 7.428   -35.534 60.629  1.00 42.12  ? 145  GLY C C     1 
ATOM   4655  O  O     . GLY C 2  145  ? 7.302   -34.652 59.777  1.00 39.87  ? 145  GLY C O     1 
ATOM   4656  N  N     . VAL C 2  146  ? 6.598   -36.565 60.734  1.00 46.91  ? 146  VAL C N     1 
ATOM   4657  C  CA    . VAL C 2  146  ? 5.410   -36.677 59.900  1.00 42.74  ? 146  VAL C CA    1 
ATOM   4658  C  C     . VAL C 2  146  ? 4.166   -36.547 60.760  1.00 43.57  ? 146  VAL C C     1 
ATOM   4659  O  O     . VAL C 2  146  ? 3.986   -37.288 61.726  1.00 46.18  ? 146  VAL C O     1 
ATOM   4660  C  CB    . VAL C 2  146  ? 5.364   -38.012 59.145  1.00 43.80  ? 146  VAL C CB    1 
ATOM   4661  C  CG1   . VAL C 2  146  ? 4.019   -38.183 58.461  1.00 45.22  ? 146  VAL C CG1   1 
ATOM   4662  C  CG2   . VAL C 2  146  ? 6.492   -38.083 58.131  1.00 51.02  ? 146  VAL C CG2   1 
ATOM   4663  N  N     . TYR C 2  147  ? 3.313   -35.595 60.409  1.00 40.83  ? 147  TYR C N     1 
ATOM   4664  C  CA    . TYR C 2  147  ? 2.097   -35.352 61.165  1.00 47.33  ? 147  TYR C CA    1 
ATOM   4665  C  C     . TYR C 2  147  ? 0.871   -35.568 60.297  1.00 45.56  ? 147  TYR C C     1 
ATOM   4666  O  O     . TYR C 2  147  ? 0.932   -35.450 59.075  1.00 45.54  ? 147  TYR C O     1 
ATOM   4667  C  CB    . TYR C 2  147  ? 2.088   -33.929 61.728  1.00 44.17  ? 147  TYR C CB    1 
ATOM   4668  C  CG    . TYR C 2  147  ? 3.175   -33.666 62.742  1.00 40.16  ? 147  TYR C CG    1 
ATOM   4669  C  CD1   . TYR C 2  147  ? 4.336   -32.996 62.386  1.00 39.34  ? 147  TYR C CD1   1 
ATOM   4670  C  CD2   . TYR C 2  147  ? 3.040   -34.093 64.055  1.00 37.96  ? 147  TYR C CD2   1 
ATOM   4671  C  CE1   . TYR C 2  147  ? 5.331   -32.756 63.314  1.00 43.99  ? 147  TYR C CE1   1 
ATOM   4672  C  CE2   . TYR C 2  147  ? 4.029   -33.861 64.987  1.00 35.68  ? 147  TYR C CE2   1 
ATOM   4673  C  CZ    . TYR C 2  147  ? 5.173   -33.191 64.613  1.00 39.82  ? 147  TYR C CZ    1 
ATOM   4674  O  OH    . TYR C 2  147  ? 6.160   -32.956 65.544  1.00 42.81  ? 147  TYR C OH    1 
ATOM   4675  N  N     . PHE C 2  148  ? -0.242  -35.892 60.939  1.00 42.96  ? 148  PHE C N     1 
ATOM   4676  C  CA    . PHE C 2  148  ? -1.507  -36.019 60.240  1.00 43.07  ? 148  PHE C CA    1 
ATOM   4677  C  C     . PHE C 2  148  ? -2.543  -35.172 60.953  1.00 54.37  ? 148  PHE C C     1 
ATOM   4678  O  O     . PHE C 2  148  ? -2.862  -35.407 62.118  1.00 55.98  ? 148  PHE C O     1 
ATOM   4679  C  CB    . PHE C 2  148  ? -1.935  -37.483 60.163  1.00 48.73  ? 148  PHE C CB    1 
ATOM   4680  C  CG    . PHE C 2  148  ? -0.948  -38.354 59.446  1.00 51.46  ? 148  PHE C CG    1 
ATOM   4681  C  CD1   . PHE C 2  148  ? 0.045   -39.020 60.145  1.00 43.40  ? 148  PHE C CD1   1 
ATOM   4682  C  CD2   . PHE C 2  148  ? -0.996  -38.487 58.068  1.00 51.70  ? 148  PHE C CD2   1 
ATOM   4683  C  CE1   . PHE C 2  148  ? 0.961   -39.811 59.484  1.00 44.05  ? 148  PHE C CE1   1 
ATOM   4684  C  CE2   . PHE C 2  148  ? -0.082  -39.279 57.402  1.00 44.20  ? 148  PHE C CE2   1 
ATOM   4685  C  CZ    . PHE C 2  148  ? 0.898   -39.939 58.111  1.00 46.69  ? 148  PHE C CZ    1 
ATOM   4686  N  N     . THR C 2  149  ? -3.050  -34.168 60.251  1.00 60.23  ? 149  THR C N     1 
ATOM   4687  C  CA    . THR C 2  149  ? -3.959  -33.207 60.852  1.00 59.89  ? 149  THR C CA    1 
ATOM   4688  C  C     . THR C 2  149  ? -5.299  -33.222 60.124  1.00 62.31  ? 149  THR C C     1 
ATOM   4689  O  O     . THR C 2  149  ? -5.348  -33.446 58.915  1.00 66.82  ? 149  THR C O     1 
ATOM   4690  C  CB    . THR C 2  149  ? -3.341  -31.786 60.841  1.00 60.21  ? 149  THR C CB    1 
ATOM   4691  O  OG1   . THR C 2  149  ? -4.314  -30.826 61.269  1.00 75.74  ? 149  THR C OG1   1 
ATOM   4692  C  CG2   . THR C 2  149  ? -2.848  -31.419 59.448  1.00 47.51  ? 149  THR C CG2   1 
ATOM   4693  N  N     . PRO C 2  150  ? -6.395  -33.010 60.866  1.00 62.39  ? 150  PRO C N     1 
ATOM   4694  C  CA    . PRO C 2  150  ? -7.731  -32.960 60.263  1.00 65.72  ? 150  PRO C CA    1 
ATOM   4695  C  C     . PRO C 2  150  ? -7.857  -31.825 59.252  1.00 75.84  ? 150  PRO C C     1 
ATOM   4696  O  O     . PRO C 2  150  ? -7.495  -30.689 59.559  1.00 80.29  ? 150  PRO C O     1 
ATOM   4697  C  CB    . PRO C 2  150  ? -8.642  -32.686 61.462  1.00 73.41  ? 150  PRO C CB    1 
ATOM   4698  C  CG    . PRO C 2  150  ? -7.887  -33.207 62.638  1.00 76.54  ? 150  PRO C CG    1 
ATOM   4699  C  CD    . PRO C 2  150  ? -6.448  -32.936 62.337  1.00 69.25  ? 150  PRO C CD    1 
ATOM   4700  N  N     . ASP C 2  151  ? -8.369  -32.132 58.064  1.00 74.95  ? 151  ASP C N     1 
ATOM   4701  C  CA    . ASP C 2  151  ? -8.586  -31.117 57.039  1.00 83.26  ? 151  ASP C CA    1 
ATOM   4702  C  C     . ASP C 2  151  ? -9.711  -30.190 57.488  1.00 84.80  ? 151  ASP C C     1 
ATOM   4703  O  O     . ASP C 2  151  ? -10.829 -30.640 57.736  1.00 85.45  ? 151  ASP C O     1 
ATOM   4704  C  CB    . ASP C 2  151  ? -8.937  -31.779 55.701  1.00 92.67  ? 151  ASP C CB    1 
ATOM   4705  C  CG    . ASP C 2  151  ? -8.760  -30.843 54.509  1.00 92.99  ? 151  ASP C CG    1 
ATOM   4706  O  OD1   . ASP C 2  151  ? -8.959  -29.619 54.660  1.00 91.85  ? 151  ASP C OD1   1 
ATOM   4707  O  OD2   . ASP C 2  151  ? -8.425  -31.340 53.412  1.00 84.77  ? 151  ASP C OD2   1 
ATOM   4708  N  N     . PRO C 2  152  ? -9.412  -28.888 57.605  1.00 86.13  ? 152  PRO C N     1 
ATOM   4709  C  CA    . PRO C 2  152  ? -10.397 -27.886 58.032  1.00 90.55  ? 152  PRO C CA    1 
ATOM   4710  C  C     . PRO C 2  152  ? -11.524 -27.694 57.016  1.00 92.67  ? 152  PRO C C     1 
ATOM   4711  O  O     . PRO C 2  152  ? -12.577 -27.150 57.357  1.00 72.41  ? 152  PRO C O     1 
ATOM   4712  C  CB    . PRO C 2  152  ? -9.563  -26.606 58.149  1.00 97.73  ? 152  PRO C CB    1 
ATOM   4713  C  CG    . PRO C 2  152  ? -8.389  -26.832 57.252  1.00 94.27  ? 152  PRO C CG    1 
ATOM   4714  C  CD    . PRO C 2  152  ? -8.085  -28.292 57.372  1.00 87.55  ? 152  PRO C CD    1 
ATOM   4715  N  N     . ALA C 2  153  ? -11.300 -28.140 55.784  1.00 93.34  ? 153  ALA C N     1 
ATOM   4716  C  CA    . ALA C 2  153  ? -12.286 -28.000 54.717  1.00 91.19  ? 153  ALA C CA    1 
ATOM   4717  C  C     . ALA C 2  153  ? -13.422 -29.009 54.859  1.00 91.71  ? 153  ALA C C     1 
ATOM   4718  O  O     . ALA C 2  153  ? -14.574 -28.634 55.076  1.00 95.93  ? 153  ALA C O     1 
ATOM   4719  C  CB    . ALA C 2  153  ? -11.619 -28.137 53.357  1.00 94.57  ? 153  ALA C CB    1 
ATOM   4720  N  N     . ARG C 2  154  ? -13.089 -30.290 54.737  1.00 91.49  ? 154  ARG C N     1 
ATOM   4721  C  CA    . ARG C 2  154  ? -14.087 -31.353 54.781  1.00 94.77  ? 154  ARG C CA    1 
ATOM   4722  C  C     . ARG C 2  154  ? -13.769 -32.363 55.884  1.00 90.75  ? 154  ARG C C     1 
ATOM   4723  O  O     . ARG C 2  154  ? -12.603 -32.677 56.124  1.00 92.59  ? 154  ARG C O     1 
ATOM   4724  C  CB    . ARG C 2  154  ? -14.157 -32.042 53.418  1.00 92.10  ? 154  ARG C CB    1 
ATOM   4725  C  CG    . ARG C 2  154  ? -12.794 -32.266 52.790  1.00 95.25  ? 154  ARG C CG    1 
ATOM   4726  C  CD    . ARG C 2  154  ? -12.868 -32.299 51.272  1.00 98.96  ? 154  ARG C CD    1 
ATOM   4727  N  NE    . ARG C 2  154  ? -11.543 -32.441 50.675  1.00 95.98  ? 154  ARG C NE    1 
ATOM   4728  C  CZ    . ARG C 2  154  ? -10.724 -31.425 50.424  1.00 95.18  ? 154  ARG C CZ    1 
ATOM   4729  N  NH1   . ARG C 2  154  ? -9.535  -31.648 49.882  1.00 95.07  ? 154  ARG C NH1   1 
ATOM   4730  N  NH2   . ARG C 2  154  ? -11.093 -30.185 50.716  1.00 85.60  ? 154  ARG C NH2   1 
ATOM   4731  N  N     . PRO C 2  155  ? -14.812 -32.874 56.559  1.00 91.43  ? 155  PRO C N     1 
ATOM   4732  C  CA    . PRO C 2  155  ? -14.662 -33.732 57.742  1.00 96.40  ? 155  PRO C CA    1 
ATOM   4733  C  C     . PRO C 2  155  ? -13.904 -35.030 57.472  1.00 98.78  ? 155  PRO C C     1 
ATOM   4734  O  O     . PRO C 2  155  ? -13.027 -35.402 58.254  1.00 98.64  ? 155  PRO C O     1 
ATOM   4735  C  CB    . PRO C 2  155  ? -16.112 -34.053 58.126  1.00 92.22  ? 155  PRO C CB    1 
ATOM   4736  C  CG    . PRO C 2  155  ? -16.920 -32.955 57.529  1.00 94.87  ? 155  PRO C CG    1 
ATOM   4737  C  CD    . PRO C 2  155  ? -16.228 -32.615 56.248  1.00 96.34  ? 155  PRO C CD    1 
ATOM   4738  N  N     . GLY C 2  156  ? -14.236 -35.701 56.375  1.00 92.21  ? 156  GLY C N     1 
ATOM   4739  C  CA    . GLY C 2  156  ? -13.673 -37.007 56.085  1.00 92.02  ? 156  GLY C CA    1 
ATOM   4740  C  C     . GLY C 2  156  ? -12.193 -37.000 55.755  1.00 90.99  ? 156  GLY C C     1 
ATOM   4741  O  O     . GLY C 2  156  ? -11.446 -37.864 56.215  1.00 86.52  ? 156  GLY C O     1 
ATOM   4742  N  N     . ARG C 2  157  ? -11.766 -36.021 54.962  1.00 92.43  ? 157  ARG C N     1 
ATOM   4743  C  CA    . ARG C 2  157  ? -10.386 -35.965 54.489  1.00 86.32  ? 157  ARG C CA    1 
ATOM   4744  C  C     . ARG C 2  157  ? -9.411  -35.516 55.575  1.00 84.70  ? 157  ARG C C     1 
ATOM   4745  O  O     . ARG C 2  157  ? -9.787  -34.815 56.515  1.00 81.28  ? 157  ARG C O     1 
ATOM   4746  C  CB    . ARG C 2  157  ? -10.266 -35.046 53.270  1.00 82.46  ? 157  ARG C CB    1 
ATOM   4747  C  CG    . ARG C 2  157  ? -11.175 -35.407 52.104  1.00 84.23  ? 157  ARG C CG    1 
ATOM   4748  C  CD    . ARG C 2  157  ? -10.973 -36.837 51.631  1.00 85.93  ? 157  ARG C CD    1 
ATOM   4749  N  NE    . ARG C 2  157  ? -11.947 -37.749 52.222  1.00 88.12  ? 157  ARG C NE    1 
ATOM   4750  C  CZ    . ARG C 2  157  ? -12.109 -39.015 51.850  1.00 93.08  ? 157  ARG C CZ    1 
ATOM   4751  N  NH1   . ARG C 2  157  ? -11.359 -39.524 50.881  1.00 95.70  ? 157  ARG C NH1   1 
ATOM   4752  N  NH2   . ARG C 2  157  ? -13.022 -39.771 52.444  1.00 89.89  ? 157  ARG C NH2   1 
ATOM   4753  N  N     . TYR C 2  158  ? -8.158  -35.936 55.431  1.00 77.03  ? 158  TYR C N     1 
ATOM   4754  C  CA    . TYR C 2  158  ? -7.092  -35.553 56.349  1.00 69.47  ? 158  TYR C CA    1 
ATOM   4755  C  C     . TYR C 2  158  ? -5.865  -35.109 55.558  1.00 66.17  ? 158  TYR C C     1 
ATOM   4756  O  O     . TYR C 2  158  ? -5.630  -35.586 54.448  1.00 69.73  ? 158  TYR C O     1 
ATOM   4757  C  CB    . TYR C 2  158  ? -6.722  -36.721 57.268  1.00 71.01  ? 158  TYR C CB    1 
ATOM   4758  C  CG    . TYR C 2  158  ? -7.799  -37.108 58.260  1.00 67.91  ? 158  TYR C CG    1 
ATOM   4759  C  CD1   . TYR C 2  158  ? -7.901  -36.467 59.488  1.00 65.84  ? 158  TYR C CD1   1 
ATOM   4760  C  CD2   . TYR C 2  158  ? -8.705  -38.120 57.973  1.00 70.58  ? 158  TYR C CD2   1 
ATOM   4761  C  CE1   . TYR C 2  158  ? -8.880  -36.818 60.399  1.00 68.10  ? 158  TYR C CE1   1 
ATOM   4762  C  CE2   . TYR C 2  158  ? -9.688  -38.478 58.877  1.00 75.60  ? 158  TYR C CE2   1 
ATOM   4763  C  CZ    . TYR C 2  158  ? -9.771  -37.824 60.089  1.00 79.47  ? 158  TYR C CZ    1 
ATOM   4764  O  OH    . TYR C 2  158  ? -10.747 -38.176 60.995  1.00 82.24  ? 158  TYR C OH    1 
ATOM   4765  N  N     . ILE C 2  159  ? -5.087  -34.194 56.129  1.00 62.29  ? 159  ILE C N     1 
ATOM   4766  C  CA    . ILE C 2  159  ? -3.885  -33.695 55.468  1.00 62.26  ? 159  ILE C CA    1 
ATOM   4767  C  C     . ILE C 2  159  ? -2.615  -34.181 56.166  1.00 61.18  ? 159  ILE C C     1 
ATOM   4768  O  O     . ILE C 2  159  ? -2.485  -34.077 57.388  1.00 68.19  ? 159  ILE C O     1 
ATOM   4769  C  CB    . ILE C 2  159  ? -3.874  -32.152 55.401  1.00 60.25  ? 159  ILE C CB    1 
ATOM   4770  C  CG1   . ILE C 2  159  ? -5.134  -31.641 54.700  1.00 71.44  ? 159  ILE C CG1   1 
ATOM   4771  C  CG2   . ILE C 2  159  ? -2.626  -31.653 54.688  1.00 50.30  ? 159  ILE C CG2   1 
ATOM   4772  C  CD1   . ILE C 2  159  ? -5.222  -30.133 54.617  1.00 76.64  ? 159  ILE C CD1   1 
ATOM   4773  N  N     . ALA C 2  160  ? -1.685  -34.718 55.382  1.00 51.86  ? 160  ALA C N     1 
ATOM   4774  C  CA    . ALA C 2  160  ? -0.401  -35.164 55.909  1.00 44.51  ? 160  ALA C CA    1 
ATOM   4775  C  C     . ALA C 2  160  ? 0.654   -34.084 55.708  1.00 52.58  ? 160  ALA C C     1 
ATOM   4776  O  O     . ALA C 2  160  ? 0.657   -33.394 54.691  1.00 59.55  ? 160  ALA C O     1 
ATOM   4777  C  CB    . ALA C 2  160  ? 0.029   -36.455 55.240  1.00 46.81  ? 160  ALA C CB    1 
ATOM   4778  N  N     . SER C 2  161  ? 1.545   -33.937 56.682  1.00 52.85  ? 161  SER C N     1 
ATOM   4779  C  CA    . SER C 2  161  ? 2.594   -32.930 56.604  1.00 39.64  ? 161  SER C CA    1 
ATOM   4780  C  C     . SER C 2  161  ? 3.947   -33.519 56.983  1.00 38.54  ? 161  SER C C     1 
ATOM   4781  O  O     . SER C 2  161  ? 4.076   -34.186 58.008  1.00 43.89  ? 161  SER C O     1 
ATOM   4782  C  CB    . SER C 2  161  ? 2.262   -31.751 57.517  1.00 46.26  ? 161  SER C CB    1 
ATOM   4783  O  OG    . SER C 2  161  ? 0.941   -31.289 57.290  1.00 49.50  ? 161  SER C OG    1 
ATOM   4784  N  N     . ILE C 2  162  ? 4.952   -33.276 56.148  1.00 45.23  ? 162  ILE C N     1 
ATOM   4785  C  CA    . ILE C 2  162  ? 6.308   -33.734 56.424  1.00 45.32  ? 162  ILE C CA    1 
ATOM   4786  C  C     . ILE C 2  162  ? 7.213   -32.542 56.714  1.00 45.41  ? 162  ILE C C     1 
ATOM   4787  O  O     . ILE C 2  162  ? 7.542   -31.767 55.814  1.00 50.12  ? 162  ILE C O     1 
ATOM   4788  C  CB    . ILE C 2  162  ? 6.882   -34.514 55.231  1.00 40.58  ? 162  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C 2  162  ? 5.975   -35.694 54.881  1.00 34.41  ? 162  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C 2  162  ? 8.295   -34.985 55.532  1.00 46.66  ? 162  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C 2  162  ? 6.380   -36.416 53.619  1.00 37.08  ? 162  ILE C CD1   1 
ATOM   4792  N  N     . ILE C 2  163  ? 7.627   -32.408 57.970  1.00 37.15  ? 163  ILE C N     1 
ATOM   4793  C  CA    . ILE C 2  163  ? 8.395   -31.243 58.401  1.00 45.19  ? 163  ILE C CA    1 
ATOM   4794  C  C     . ILE C 2  163  ? 9.844   -31.580 58.749  1.00 41.80  ? 163  ILE C C     1 
ATOM   4795  O  O     . ILE C 2  163  ? 10.097  -32.413 59.608  1.00 41.44  ? 163  ILE C O     1 
ATOM   4796  C  CB    . ILE C 2  163  ? 7.732   -30.554 59.610  1.00 45.85  ? 163  ILE C CB    1 
ATOM   4797  C  CG1   . ILE C 2  163  ? 6.269   -30.233 59.303  1.00 44.10  ? 163  ILE C CG1   1 
ATOM   4798  C  CG2   . ILE C 2  163  ? 8.488   -29.293 59.987  1.00 39.02  ? 163  ILE C CG2   1 
ATOM   4799  C  CD1   . ILE C 2  163  ? 5.532   -29.610 60.462  1.00 45.71  ? 163  ILE C CD1   1 
ATOM   4800  N  N     . PRO C 2  164  ? 10.801  -30.944 58.061  1.00 35.07  ? 164  PRO C N     1 
ATOM   4801  C  CA    . PRO C 2  164  ? 12.221  -31.067 58.397  1.00 44.26  ? 164  PRO C CA    1 
ATOM   4802  C  C     . PRO C 2  164  ? 12.650  -29.999 59.401  1.00 49.90  ? 164  PRO C C     1 
ATOM   4803  O  O     . PRO C 2  164  ? 11.811  -29.232 59.873  1.00 47.14  ? 164  PRO C O     1 
ATOM   4804  C  CB    . PRO C 2  164  ? 12.901  -30.807 57.060  1.00 47.80  ? 164  PRO C CB    1 
ATOM   4805  C  CG    . PRO C 2  164  ? 12.004  -29.823 56.403  1.00 50.60  ? 164  PRO C CG    1 
ATOM   4806  C  CD    . PRO C 2  164  ? 10.599  -30.183 56.818  1.00 43.63  ? 164  PRO C CD    1 
ATOM   4807  N  N     . LEU C 2  165  ? 13.938  -29.965 59.731  1.00 52.02  ? 165  LEU C N     1 
ATOM   4808  C  CA    . LEU C 2  165  ? 14.498  -28.861 60.502  1.00 51.63  ? 165  LEU C CA    1 
ATOM   4809  C  C     . LEU C 2  165  ? 14.293  -27.570 59.708  1.00 58.51  ? 165  LEU C C     1 
ATOM   4810  O  O     . LEU C 2  165  ? 14.317  -27.595 58.478  1.00 61.11  ? 165  LEU C O     1 
ATOM   4811  C  CB    . LEU C 2  165  ? 15.981  -29.105 60.780  1.00 52.98  ? 165  LEU C CB    1 
ATOM   4812  C  CG    . LEU C 2  165  ? 16.308  -30.228 61.764  1.00 49.46  ? 165  LEU C CG    1 
ATOM   4813  C  CD1   . LEU C 2  165  ? 17.800  -30.507 61.783  1.00 54.93  ? 165  LEU C CD1   1 
ATOM   4814  C  CD2   . LEU C 2  165  ? 15.817  -29.859 63.150  1.00 45.81  ? 165  LEU C CD2   1 
ATOM   4815  N  N     . PRO C 2  166  ? 14.090  -26.440 60.407  1.00 59.15  ? 166  PRO C N     1 
ATOM   4816  C  CA    . PRO C 2  166  ? 13.542  -25.227 59.780  1.00 77.33  ? 166  PRO C CA    1 
ATOM   4817  C  C     . PRO C 2  166  ? 14.271  -24.689 58.540  1.00 75.95  ? 166  PRO C C     1 
ATOM   4818  O  O     . PRO C 2  166  ? 13.609  -24.397 57.545  1.00 79.93  ? 166  PRO C O     1 
ATOM   4819  C  CB    . PRO C 2  166  ? 13.586  -24.192 60.917  1.00 72.74  ? 166  PRO C CB    1 
ATOM   4820  C  CG    . PRO C 2  166  ? 14.491  -24.778 61.960  1.00 51.40  ? 166  PRO C CG    1 
ATOM   4821  C  CD    . PRO C 2  166  ? 14.320  -26.252 61.848  1.00 51.36  ? 166  PRO C CD    1 
ATOM   4822  N  N     . LYS C 2  167  ? 15.593  -24.568 58.579  1.00 69.84  ? 167  LYS C N     1 
ATOM   4823  C  CA    . LYS C 2  167  ? 16.320  -24.091 57.404  1.00 77.17  ? 167  LYS C CA    1 
ATOM   4824  C  C     . LYS C 2  167  ? 16.872  -25.251 56.583  1.00 74.70  ? 167  LYS C C     1 
ATOM   4825  O  O     . LYS C 2  167  ? 17.534  -25.053 55.563  1.00 74.62  ? 167  LYS C O     1 
ATOM   4826  C  CB    . LYS C 2  167  ? 17.433  -23.118 57.801  1.00 78.63  ? 167  LYS C CB    1 
ATOM   4827  C  CG    . LYS C 2  167  ? 16.923  -21.771 58.295  1.00 71.53  ? 167  LYS C CG    1 
ATOM   4828  C  CD    . LYS C 2  167  ? 18.066  -20.827 58.633  1.00 81.32  ? 167  LYS C CD    1 
ATOM   4829  C  CE    . LYS C 2  167  ? 18.882  -20.479 57.398  1.00 88.32  ? 167  LYS C CE    1 
ATOM   4830  N  NZ    . LYS C 2  167  ? 19.976  -19.515 57.705  1.00 72.78  ? 167  LYS C NZ    1 
ATOM   4831  N  N     . ARG C 2  168  ? 16.589  -26.464 57.044  1.00 66.04  ? 168  ARG C N     1 
ATOM   4832  C  CA    . ARG C 2  168  ? 17.161  -27.670 56.458  1.00 65.82  ? 168  ARG C CA    1 
ATOM   4833  C  C     . ARG C 2  168  ? 16.287  -28.362 55.404  1.00 67.98  ? 168  ARG C C     1 
ATOM   4834  O  O     . ARG C 2  168  ? 16.625  -29.447 54.947  1.00 65.82  ? 168  ARG C O     1 
ATOM   4835  C  CB    . ARG C 2  168  ? 17.575  -28.650 57.559  1.00 73.98  ? 168  ARG C CB    1 
ATOM   4836  C  CG    . ARG C 2  168  ? 18.504  -28.035 58.602  1.00 79.15  ? 168  ARG C CG    1 
ATOM   4837  C  CD    . ARG C 2  168  ? 19.883  -28.675 58.587  1.00 74.04  ? 168  ARG C CD    1 
ATOM   4838  N  NE    . ARG C 2  168  ? 20.501  -28.611 57.267  1.00 69.29  ? 168  ARG C NE    1 
ATOM   4839  C  CZ    . ARG C 2  168  ? 21.115  -27.538 56.781  1.00 77.78  ? 168  ARG C CZ    1 
ATOM   4840  N  NH1   . ARG C 2  168  ? 21.649  -27.573 55.568  1.00 80.16  ? 168  ARG C NH1   1 
ATOM   4841  N  NH2   . ARG C 2  168  ? 21.191  -26.427 57.504  1.00 77.90  ? 168  ARG C NH2   1 
ATOM   4842  N  N     . GLY C 2  169  ? 15.152  -27.765 55.049  1.00 70.21  ? 169  GLY C N     1 
ATOM   4843  C  CA    . GLY C 2  169  ? 14.349  -28.298 53.959  1.00 57.46  ? 169  GLY C CA    1 
ATOM   4844  C  C     . GLY C 2  169  ? 12.941  -27.743 53.830  1.00 62.69  ? 169  GLY C C     1 
ATOM   4845  O  O     . GLY C 2  169  ? 12.441  -27.088 54.744  1.00 72.60  ? 169  GLY C O     1 
ATOM   4846  N  N     . PRO C 2  170  ? 12.296  -28.000 52.680  1.00 63.74  ? 170  PRO C N     1 
ATOM   4847  C  CA    . PRO C 2  170  ? 10.921  -27.593 52.365  1.00 61.19  ? 170  PRO C CA    1 
ATOM   4848  C  C     . PRO C 2  170  ? 9.859   -28.455 53.043  1.00 60.30  ? 170  PRO C C     1 
ATOM   4849  O  O     . PRO C 2  170  ? 10.064  -29.657 53.230  1.00 54.10  ? 170  PRO C O     1 
ATOM   4850  C  CB    . PRO C 2  170  ? 10.847  -27.788 50.851  1.00 60.56  ? 170  PRO C CB    1 
ATOM   4851  C  CG    . PRO C 2  170  ? 11.775  -28.914 50.591  1.00 60.68  ? 170  PRO C CG    1 
ATOM   4852  C  CD    . PRO C 2  170  ? 12.915  -28.730 51.559  1.00 71.87  ? 170  PRO C CD    1 
ATOM   4853  N  N     . TRP C 2  171  ? 8.730   -27.846 53.393  1.00 58.61  ? 171  TRP C N     1 
ATOM   4854  C  CA    . TRP C 2  171  ? 7.594   -28.596 53.914  1.00 53.06  ? 171  TRP C CA    1 
ATOM   4855  C  C     . TRP C 2  171  ? 6.862   -29.280 52.767  1.00 58.57  ? 171  TRP C C     1 
ATOM   4856  O  O     . TRP C 2  171  ? 6.838   -28.771 51.647  1.00 61.81  ? 171  TRP C O     1 
ATOM   4857  C  CB    . TRP C 2  171  ? 6.629   -27.683 54.673  1.00 50.28  ? 171  TRP C CB    1 
ATOM   4858  C  CG    . TRP C 2  171  ? 7.133   -27.227 56.007  1.00 54.72  ? 171  TRP C CG    1 
ATOM   4859  C  CD1   . TRP C 2  171  ? 8.435   -27.049 56.377  1.00 58.89  ? 171  TRP C CD1   1 
ATOM   4860  C  CD2   . TRP C 2  171  ? 6.342   -26.901 57.155  1.00 54.02  ? 171  TRP C CD2   1 
ATOM   4861  N  NE1   . TRP C 2  171  ? 8.503   -26.625 57.683  1.00 56.67  ? 171  TRP C NE1   1 
ATOM   4862  C  CE2   . TRP C 2  171  ? 7.231   -26.527 58.183  1.00 54.78  ? 171  TRP C CE2   1 
ATOM   4863  C  CE3   . TRP C 2  171  ? 4.968   -26.889 57.412  1.00 53.87  ? 171  TRP C CE3   1 
ATOM   4864  C  CZ2   . TRP C 2  171  ? 6.792   -26.142 59.449  1.00 53.32  ? 171  TRP C CZ2   1 
ATOM   4865  C  CZ3   . TRP C 2  171  ? 4.533   -26.507 58.670  1.00 68.53  ? 171  TRP C CZ3   1 
ATOM   4866  C  CH2   . TRP C 2  171  ? 5.443   -26.139 59.672  1.00 66.26  ? 171  TRP C CH2   1 
ATOM   4867  N  N     . ILE C 2  172  ? 6.269   -30.436 53.050  1.00 57.97  ? 172  ILE C N     1 
ATOM   4868  C  CA    . ILE C 2  172  ? 5.539   -31.195 52.040  1.00 52.70  ? 172  ILE C CA    1 
ATOM   4869  C  C     . ILE C 2  172  ? 4.165   -31.600 52.555  1.00 50.13  ? 172  ILE C C     1 
ATOM   4870  O  O     . ILE C 2  172  ? 4.046   -32.146 53.649  1.00 51.21  ? 172  ILE C O     1 
ATOM   4871  C  CB    . ILE C 2  172  ? 6.303   -32.468 51.631  1.00 49.40  ? 172  ILE C CB    1 
ATOM   4872  C  CG1   . ILE C 2  172  ? 7.635   -32.109 50.970  1.00 52.08  ? 172  ILE C CG1   1 
ATOM   4873  C  CG2   . ILE C 2  172  ? 5.464   -33.315 50.692  1.00 54.95  ? 172  ILE C CG2   1 
ATOM   4874  C  CD1   . ILE C 2  172  ? 8.432   -33.312 50.523  1.00 53.69  ? 172  ILE C CD1   1 
ATOM   4875  N  N     . ASP C 2  173  ? 3.128   -31.330 51.769  1.00 59.45  ? 173  ASP C N     1 
ATOM   4876  C  CA    . ASP C 2  173  ? 1.775   -31.729 52.151  1.00 60.51  ? 173  ASP C CA    1 
ATOM   4877  C  C     . ASP C 2  173  ? 1.218   -32.818 51.242  1.00 68.19  ? 173  ASP C C     1 
ATOM   4878  O  O     . ASP C 2  173  ? 1.499   -32.843 50.050  1.00 69.84  ? 173  ASP C O     1 
ATOM   4879  C  CB    . ASP C 2  173  ? 0.831   -30.525 52.161  1.00 65.21  ? 173  ASP C CB    1 
ATOM   4880  C  CG    . ASP C 2  173  ? 0.826   -29.799 53.490  1.00 68.13  ? 173  ASP C CG    1 
ATOM   4881  O  OD1   . ASP C 2  173  ? 1.842   -29.875 54.215  1.00 66.43  ? 173  ASP C OD1   1 
ATOM   4882  O  OD2   . ASP C 2  173  ? -0.196  -29.153 53.810  1.00 73.08  ? 173  ASP C OD2   1 
ATOM   4883  N  N     . LEU C 2  174  ? 0.437   -33.724 51.820  1.00 69.96  ? 174  LEU C N     1 
ATOM   4884  C  CA    . LEU C 2  174  ? -0.268  -34.749 51.056  1.00 58.43  ? 174  LEU C CA    1 
ATOM   4885  C  C     . LEU C 2  174  ? -1.759  -34.647 51.354  1.00 67.70  ? 174  LEU C C     1 
ATOM   4886  O  O     . LEU C 2  174  ? -2.177  -34.745 52.509  1.00 72.98  ? 174  LEU C O     1 
ATOM   4887  C  CB    . LEU C 2  174  ? 0.244   -36.146 51.411  1.00 50.36  ? 174  LEU C CB    1 
ATOM   4888  C  CG    . LEU C 2  174  ? 1.407   -36.743 50.614  1.00 53.64  ? 174  LEU C CG    1 
ATOM   4889  C  CD1   . LEU C 2  174  ? 2.639   -35.856 50.643  1.00 53.14  ? 174  LEU C CD1   1 
ATOM   4890  C  CD2   . LEU C 2  174  ? 1.740   -38.127 51.147  1.00 55.66  ? 174  LEU C CD2   1 
ATOM   4891  N  N     . GLU C 2  175  ? -2.559  -34.442 50.313  1.00 76.92  ? 175  GLU C N     1 
ATOM   4892  C  CA    . GLU C 2  175  ? -3.992  -34.230 50.488  1.00 81.93  ? 175  GLU C CA    1 
ATOM   4893  C  C     . GLU C 2  175  ? -4.790  -34.950 49.407  1.00 85.33  ? 175  GLU C C     1 
ATOM   4894  O  O     . GLU C 2  175  ? -4.444  -34.886 48.232  1.00 86.62  ? 175  GLU C O     1 
ATOM   4895  C  CB    . GLU C 2  175  ? -4.303  -32.730 50.460  1.00 89.26  ? 175  GLU C CB    1 
ATOM   4896  C  CG    . GLU C 2  175  ? -5.786  -32.382 50.494  1.00 90.65  ? 175  GLU C CG    1 
ATOM   4897  C  CD    . GLU C 2  175  ? -6.044  -30.898 50.283  1.00 84.78  ? 175  GLU C CD    1 
ATOM   4898  O  OE1   . GLU C 2  175  ? -5.076  -30.108 50.328  1.00 74.32  ? 175  GLU C OE1   1 
ATOM   4899  O  OE2   . GLU C 2  175  ? -7.216  -30.523 50.067  1.00 81.96  ? 175  GLU C OE2   1 
ATOM   4900  N  N     . VAL C 2  176  ? -5.863  -35.626 49.801  1.00 91.34  ? 176  VAL C N     1 
ATOM   4901  C  CA    . VAL C 2  176  ? -6.719  -36.292 48.828  1.00 92.09  ? 176  VAL C CA    1 
ATOM   4902  C  C     . VAL C 2  176  ? -7.838  -35.334 48.443  1.00 93.16  ? 176  VAL C C     1 
ATOM   4903  O  O     . VAL C 2  176  ? -8.707  -35.017 49.257  1.00 93.03  ? 176  VAL C O     1 
ATOM   4904  C  CB    . VAL C 2  176  ? -7.322  -37.587 49.394  1.00 89.22  ? 176  VAL C CB    1 
ATOM   4905  C  CG1   . VAL C 2  176  ? -7.655  -38.549 48.265  1.00 91.46  ? 176  VAL C CG1   1 
ATOM   4906  C  CG2   . VAL C 2  176  ? -6.357  -38.235 50.373  1.00 85.54  ? 176  VAL C CG2   1 
ATOM   4907  N  N     . GLU C 2  177  ? -7.815  -34.883 47.193  1.00 89.36  ? 177  GLU C N     1 
ATOM   4908  C  CA    . GLU C 2  177  ? -8.677  -33.793 46.753  1.00 89.88  ? 177  GLU C CA    1 
ATOM   4909  C  C     . GLU C 2  177  ? -10.143 -34.213 46.652  1.00 92.92  ? 177  GLU C C     1 
ATOM   4910  O  O     . GLU C 2  177  ? -10.473 -35.381 46.863  1.00 92.51  ? 177  GLU C O     1 
ATOM   4911  C  CB    . GLU C 2  177  ? -8.185  -33.286 45.391  1.00 85.66  ? 177  GLU C CB    1 
ATOM   4912  C  CG    . GLU C 2  177  ? -6.733  -32.833 45.375  1.00 81.48  ? 177  GLU C CG    1 
ATOM   4913  C  CD    . GLU C 2  177  ? -6.504  -31.566 46.177  1.00 93.23  ? 177  GLU C CD    1 
ATOM   4914  O  OE1   . GLU C 2  177  ? -7.478  -30.819 46.410  1.00 100.73 ? 177  GLU C OE1   1 
ATOM   4915  O  OE2   . GLU C 2  177  ? -5.347  -31.316 46.577  1.00 91.39  ? 177  GLU C OE2   1 
ATOM   4916  N  N     . PRO C 2  178  ? -11.034 -33.256 46.336  1.00 91.73  ? 178  PRO C N     1 
ATOM   4917  C  CA    . PRO C 2  178  ? -12.385 -33.621 45.901  1.00 93.58  ? 178  PRO C CA    1 
ATOM   4918  C  C     . PRO C 2  178  ? -12.338 -34.271 44.523  1.00 92.03  ? 178  PRO C C     1 
ATOM   4919  O  O     . PRO C 2  178  ? -13.238 -35.028 44.160  1.00 92.51  ? 178  PRO C O     1 
ATOM   4920  C  CB    . PRO C 2  178  ? -13.104 -32.272 45.832  1.00 93.67  ? 178  PRO C CB    1 
ATOM   4921  C  CG    . PRO C 2  178  ? -12.385 -31.420 46.815  1.00 89.08  ? 178  PRO C CG    1 
ATOM   4922  C  CD    . PRO C 2  178  ? -10.948 -31.830 46.705  1.00 86.38  ? 178  PRO C CD    1 
ATOM   4923  N  N     . ASN C 2  179  ? -11.289 -33.961 43.766  1.00 90.16  ? 179  ASN C N     1 
ATOM   4924  C  CA    . ASN C 2  179  ? -11.053 -34.577 42.466  1.00 92.22  ? 179  ASN C CA    1 
ATOM   4925  C  C     . ASN C 2  179  ? -10.923 -36.090 42.585  1.00 97.01  ? 179  ASN C C     1 
ATOM   4926  O  O     . ASN C 2  179  ? -11.309 -36.831 41.682  1.00 106.34 ? 179  ASN C O     1 
ATOM   4927  C  CB    . ASN C 2  179  ? -9.791  -33.990 41.826  1.00 92.77  ? 179  ASN C CB    1 
ATOM   4928  C  CG    . ASN C 2  179  ? -9.459  -34.629 40.490  1.00 91.34  ? 179  ASN C CG    1 
ATOM   4929  O  OD1   . ASN C 2  179  ? -9.925  -34.182 39.442  1.00 98.84  ? 179  ASN C OD1   1 
ATOM   4930  N  ND2   . ASN C 2  179  ? -8.644  -35.678 40.520  1.00 82.93  ? 179  ASN C ND2   1 
ATOM   4931  N  N     . GLY C 2  180  ? -10.382 -36.541 43.711  1.00 92.57  ? 180  GLY C N     1 
ATOM   4932  C  CA    . GLY C 2  180  ? -10.201 -37.959 43.953  1.00 95.36  ? 180  GLY C CA    1 
ATOM   4933  C  C     . GLY C 2  180  ? -8.790  -38.421 43.654  1.00 100.74 ? 180  GLY C C     1 
ATOM   4934  O  O     . GLY C 2  180  ? -8.527  -39.620 43.573  1.00 103.71 ? 180  GLY C O     1 
ATOM   4935  N  N     . VAL C 2  181  ? -7.879  -37.468 43.485  1.00 97.36  ? 181  VAL C N     1 
ATOM   4936  C  CA    . VAL C 2  181  ? -6.475  -37.791 43.261  1.00 103.42 ? 181  VAL C CA    1 
ATOM   4937  C  C     . VAL C 2  181  ? -5.630  -37.316 44.445  1.00 102.79 ? 181  VAL C C     1 
ATOM   4938  O  O     . VAL C 2  181  ? -5.973  -36.337 45.112  1.00 94.56  ? 181  VAL C O     1 
ATOM   4939  C  CB    . VAL C 2  181  ? -5.951  -37.184 41.932  1.00 98.50  ? 181  VAL C CB    1 
ATOM   4940  C  CG1   . VAL C 2  181  ? -5.747  -35.680 42.062  1.00 90.25  ? 181  VAL C CG1   1 
ATOM   4941  C  CG2   . VAL C 2  181  ? -4.659  -37.868 41.496  1.00 92.29  ? 181  VAL C CG2   1 
ATOM   4942  N  N     . VAL C 2  182  ? -4.540  -38.028 44.718  1.00 105.30 ? 182  VAL C N     1 
ATOM   4943  C  CA    . VAL C 2  182  ? -3.630  -37.648 45.793  1.00 96.25  ? 182  VAL C CA    1 
ATOM   4944  C  C     . VAL C 2  182  ? -2.670  -36.553 45.329  1.00 89.76  ? 182  VAL C C     1 
ATOM   4945  O  O     . VAL C 2  182  ? -1.979  -36.695 44.318  1.00 90.83  ? 182  VAL C O     1 
ATOM   4946  C  CB    . VAL C 2  182  ? -2.845  -38.862 46.334  1.00 97.60  ? 182  VAL C CB    1 
ATOM   4947  C  CG1   . VAL C 2  182  ? -2.218  -39.644 45.192  1.00 96.07  ? 182  VAL C CG1   1 
ATOM   4948  C  CG2   . VAL C 2  182  ? -1.792  -38.415 47.337  1.00 89.56  ? 182  VAL C CG2   1 
ATOM   4949  N  N     . SER C 2  183  ? -2.642  -35.454 46.072  1.00 85.75  ? 183  SER C N     1 
ATOM   4950  C  CA    . SER C 2  183  ? -1.866  -34.289 45.678  1.00 83.67  ? 183  SER C CA    1 
ATOM   4951  C  C     . SER C 2  183  ? -0.783  -33.944 46.689  1.00 73.49  ? 183  SER C C     1 
ATOM   4952  O  O     . SER C 2  183  ? -1.024  -33.899 47.897  1.00 78.68  ? 183  SER C O     1 
ATOM   4953  C  CB    . SER C 2  183  ? -2.783  -33.081 45.466  1.00 81.83  ? 183  SER C CB    1 
ATOM   4954  O  OG    . SER C 2  183  ? -3.407  -32.692 46.677  1.00 75.45  ? 183  SER C OG    1 
ATOM   4955  N  N     . MET C 2  184  ? 0.414   -33.707 46.172  1.00 66.78  ? 184  MET C N     1 
ATOM   4956  C  CA    . MET C 2  184  ? 1.530   -33.227 46.964  1.00 63.91  ? 184  MET C CA    1 
ATOM   4957  C  C     . MET C 2  184  ? 1.729   -31.730 46.755  1.00 73.20  ? 184  MET C C     1 
ATOM   4958  O  O     . MET C 2  184  ? 1.765   -31.249 45.617  1.00 79.85  ? 184  MET C O     1 
ATOM   4959  C  CB    . MET C 2  184  ? 2.807   -33.981 46.599  1.00 62.50  ? 184  MET C CB    1 
ATOM   4960  C  CG    . MET C 2  184  ? 4.074   -33.290 47.063  1.00 66.75  ? 184  MET C CG    1 
ATOM   4961  S  SD    . MET C 2  184  ? 5.540   -34.307 46.837  1.00 68.68  ? 184  MET C SD    1 
ATOM   4962  C  CE    . MET C 2  184  ? 5.150   -35.678 47.917  1.00 70.39  ? 184  MET C CE    1 
ATOM   4963  N  N     . LYS C 2  185  ? 1.846   -31.004 47.863  1.00 73.60  ? 185  LYS C N     1 
ATOM   4964  C  CA    . LYS C 2  185  ? 2.132   -29.576 47.847  1.00 72.92  ? 185  LYS C CA    1 
ATOM   4965  C  C     . LYS C 2  185  ? 3.554   -29.326 48.345  1.00 71.45  ? 185  LYS C C     1 
ATOM   4966  O  O     . LYS C 2  185  ? 3.876   -29.628 49.499  1.00 71.51  ? 185  LYS C O     1 
ATOM   4967  C  CB    . LYS C 2  185  ? 1.132   -28.825 48.730  1.00 66.28  ? 185  LYS C CB    1 
ATOM   4968  C  CG    . LYS C 2  185  ? 1.341   -27.317 48.775  1.00 71.24  ? 185  LYS C CG    1 
ATOM   4969  C  CD    . LYS C 2  185  ? 0.622   -26.689 49.963  1.00 71.54  ? 185  LYS C CD    1 
ATOM   4970  C  CE    . LYS C 2  185  ? -0.880  -26.936 49.913  1.00 67.08  ? 185  LYS C CE    1 
ATOM   4971  N  NZ    . LYS C 2  185  ? -1.540  -26.209 48.793  1.00 55.07  ? 185  LYS C NZ    1 
ATOM   4972  N  N     . VAL C 2  186  ? 4.401   -28.793 47.466  1.00 66.91  ? 186  VAL C N     1 
ATOM   4973  C  CA    . VAL C 2  186  ? 5.773   -28.427 47.819  1.00 74.52  ? 186  VAL C CA    1 
ATOM   4974  C  C     . VAL C 2  186  ? 6.165   -27.086 47.183  1.00 80.00  ? 186  VAL C C     1 
ATOM   4975  O  O     . VAL C 2  186  ? 5.981   -26.883 45.980  1.00 80.69  ? 186  VAL C O     1 
ATOM   4976  C  CB    . VAL C 2  186  ? 6.788   -29.541 47.443  1.00 66.20  ? 186  VAL C CB    1 
ATOM   4977  C  CG1   . VAL C 2  186  ? 6.666   -29.920 45.974  1.00 72.70  ? 186  VAL C CG1   1 
ATOM   4978  C  CG2   . VAL C 2  186  ? 8.208   -29.112 47.774  1.00 57.89  ? 186  VAL C CG2   1 
ATOM   4979  N  N     . ASN C 2  187  ? 6.692   -26.177 48.003  1.00 78.66  ? 187  ASN C N     1 
ATOM   4980  C  CA    . ASN C 2  187  ? 7.010   -24.812 47.577  1.00 73.21  ? 187  ASN C CA    1 
ATOM   4981  C  C     . ASN C 2  187  ? 5.790   -24.078 47.023  1.00 75.95  ? 187  ASN C C     1 
ATOM   4982  O  O     . ASN C 2  187  ? 5.901   -23.301 46.075  1.00 70.36  ? 187  ASN C O     1 
ATOM   4983  C  CB    . ASN C 2  187  ? 8.151   -24.799 46.553  1.00 77.47  ? 187  ASN C CB    1 
ATOM   4984  C  CG    . ASN C 2  187  ? 9.429   -25.410 47.092  1.00 71.37  ? 187  ASN C CG    1 
ATOM   4985  O  OD1   . ASN C 2  187  ? 9.411   -26.147 48.075  1.00 69.74  ? 187  ASN C OD1   1 
ATOM   4986  N  ND2   . ASN C 2  187  ? 10.549  -25.107 46.446  1.00 83.29  ? 187  ASN C ND2   1 
ATOM   4987  N  N     . LYS C 2  188  ? 4.634   -24.332 47.636  1.00 91.85  ? 188  LYS C N     1 
ATOM   4988  C  CA    . LYS C 2  188  ? 3.346   -23.800 47.183  1.00 98.21  ? 188  LYS C CA    1 
ATOM   4989  C  C     . LYS C 2  188  ? 3.041   -24.188 45.733  1.00 95.33  ? 188  LYS C C     1 
ATOM   4990  O  O     . LYS C 2  188  ? 2.541   -23.379 44.950  1.00 93.10  ? 188  LYS C O     1 
ATOM   4991  C  CB    . LYS C 2  188  ? 3.263   -22.280 47.380  1.00 86.07  ? 188  LYS C CB    1 
ATOM   4992  C  CG    . LYS C 2  188  ? 1.975   -21.803 48.048  1.00 82.65  ? 188  LYS C CG    1 
ATOM   4993  C  CD    . LYS C 2  188  ? 0.744   -22.136 47.212  1.00 86.42  ? 188  LYS C CD    1 
ATOM   4994  C  CE    . LYS C 2  188  ? -0.539  -21.674 47.885  1.00 90.11  ? 188  LYS C CE    1 
ATOM   4995  N  NZ    . LYS C 2  188  ? -1.735  -21.932 47.031  1.00 85.07  ? 188  LYS C NZ    1 
ATOM   4996  N  N     . ARG C 2  189  ? 3.354   -25.433 45.384  1.00 88.54  ? 189  ARG C N     1 
ATOM   4997  C  CA    . ARG C 2  189  ? 3.058   -25.964 44.059  1.00 85.70  ? 189  ARG C CA    1 
ATOM   4998  C  C     . ARG C 2  189  ? 2.468   -27.368 44.183  1.00 82.26  ? 189  ARG C C     1 
ATOM   4999  O  O     . ARG C 2  189  ? 3.102   -28.268 44.733  1.00 81.95  ? 189  ARG C O     1 
ATOM   5000  C  CB    . ARG C 2  189  ? 4.322   -25.980 43.199  1.00 88.91  ? 189  ARG C CB    1 
ATOM   5001  C  CG    . ARG C 2  189  ? 4.063   -26.155 41.715  1.00 93.79  ? 189  ARG C CG    1 
ATOM   5002  C  CD    . ARG C 2  189  ? 5.353   -26.042 40.926  1.00 102.94 ? 189  ARG C CD    1 
ATOM   5003  N  NE    . ARG C 2  189  ? 5.931   -24.701 40.983  1.00 117.90 ? 189  ARG C NE    1 
ATOM   5004  C  CZ    . ARG C 2  189  ? 5.819   -23.794 40.016  1.00 118.98 ? 189  ARG C CZ    1 
ATOM   5005  N  NH1   . ARG C 2  189  ? 6.380   -22.600 40.155  1.00 104.44 ? 189  ARG C NH1   1 
ATOM   5006  N  NH2   . ARG C 2  189  ? 5.149   -24.080 38.907  1.00 120.45 ? 189  ARG C NH2   1 
ATOM   5007  N  N     . LYS C 2  190  ? 1.254   -27.551 43.671  1.00 82.54  ? 190  LYS C N     1 
ATOM   5008  C  CA    . LYS C 2  190  ? 0.520   -28.800 43.865  1.00 77.65  ? 190  LYS C CA    1 
ATOM   5009  C  C     . LYS C 2  190  ? 0.530   -29.699 42.624  1.00 73.52  ? 190  LYS C C     1 
ATOM   5010  O  O     . LYS C 2  190  ? 0.148   -29.272 41.536  1.00 67.50  ? 190  LYS C O     1 
ATOM   5011  C  CB    . LYS C 2  190  ? -0.919  -28.497 44.296  1.00 63.89  ? 190  LYS C CB    1 
ATOM   5012  C  CG    . LYS C 2  190  ? -1.686  -29.697 44.816  1.00 69.53  ? 190  LYS C CG    1 
ATOM   5013  C  CD    . LYS C 2  190  ? -3.080  -29.303 45.288  1.00 73.95  ? 190  LYS C CD    1 
ATOM   5014  C  CE    . LYS C 2  190  ? -3.022  -28.297 46.429  1.00 70.05  ? 190  LYS C CE    1 
ATOM   5015  N  NZ    . LYS C 2  190  ? -4.378  -27.966 46.956  1.00 68.12  ? 190  LYS C NZ    1 
ATOM   5016  N  N     . PHE C 2  191  ? 0.969   -30.944 42.796  1.00 76.73  ? 191  PHE C N     1 
ATOM   5017  C  CA    . PHE C 2  191  ? 1.007   -31.901 41.688  1.00 76.21  ? 191  PHE C CA    1 
ATOM   5018  C  C     . PHE C 2  191  ? 0.667   -33.307 42.184  1.00 83.79  ? 191  PHE C C     1 
ATOM   5019  O  O     . PHE C 2  191  ? 0.858   -33.600 43.356  1.00 90.98  ? 191  PHE C O     1 
ATOM   5020  C  CB    . PHE C 2  191  ? 2.387   -31.885 41.021  1.00 73.06  ? 191  PHE C CB    1 
ATOM   5021  C  CG    . PHE C 2  191  ? 3.471   -32.512 41.851  1.00 81.77  ? 191  PHE C CG    1 
ATOM   5022  C  CD1   . PHE C 2  191  ? 3.842   -33.833 41.650  1.00 91.13  ? 191  PHE C CD1   1 
ATOM   5023  C  CD2   . PHE C 2  191  ? 4.124   -31.781 42.829  1.00 85.34  ? 191  PHE C CD2   1 
ATOM   5024  C  CE1   . PHE C 2  191  ? 4.838   -34.414 42.412  1.00 88.48  ? 191  PHE C CE1   1 
ATOM   5025  C  CE2   . PHE C 2  191  ? 5.125   -32.356 43.593  1.00 89.44  ? 191  PHE C CE2   1 
ATOM   5026  C  CZ    . PHE C 2  191  ? 5.482   -33.674 43.383  1.00 87.55  ? 191  PHE C CZ    1 
ATOM   5027  N  N     . PRO C 2  192  ? 0.163   -34.185 41.297  1.00 85.58  ? 192  PRO C N     1 
ATOM   5028  C  CA    . PRO C 2  192  ? -0.178  -35.546 41.737  1.00 87.01  ? 192  PRO C CA    1 
ATOM   5029  C  C     . PRO C 2  192  ? 1.027   -36.335 42.258  1.00 92.76  ? 192  PRO C C     1 
ATOM   5030  O  O     . PRO C 2  192  ? 2.067   -36.387 41.599  1.00 90.67  ? 192  PRO C O     1 
ATOM   5031  C  CB    . PRO C 2  192  ? -0.728  -36.199 40.463  1.00 85.06  ? 192  PRO C CB    1 
ATOM   5032  C  CG    . PRO C 2  192  ? -0.170  -35.387 39.343  1.00 81.27  ? 192  PRO C CG    1 
ATOM   5033  C  CD    . PRO C 2  192  ? -0.122  -33.986 39.867  1.00 85.71  ? 192  PRO C CD    1 
ATOM   5034  N  N     . LEU C 2  193  ? 0.867   -36.951 43.428  1.00 95.02  ? 193  LEU C N     1 
ATOM   5035  C  CA    . LEU C 2  193  ? 1.926   -37.732 44.071  1.00 94.05  ? 193  LEU C CA    1 
ATOM   5036  C  C     . LEU C 2  193  ? 2.326   -38.939 43.222  1.00 96.09  ? 193  LEU C C     1 
ATOM   5037  O  O     . LEU C 2  193  ? 3.427   -39.484 43.361  1.00 87.99  ? 193  LEU C O     1 
ATOM   5038  C  CB    . LEU C 2  193  ? 1.469   -38.176 45.467  1.00 80.14  ? 193  LEU C CB    1 
ATOM   5039  C  CG    . LEU C 2  193  ? 2.340   -39.135 46.283  1.00 71.96  ? 193  LEU C CG    1 
ATOM   5040  C  CD1   . LEU C 2  193  ? 3.749   -38.598 46.444  1.00 74.30  ? 193  LEU C CD1   1 
ATOM   5041  C  CD2   . LEU C 2  193  ? 1.713   -39.393 47.639  1.00 73.07  ? 193  LEU C CD2   1 
ATOM   5042  N  N     . VAL C 2  194  ? 1.417   -39.331 42.334  1.00 101.00 ? 194  VAL C N     1 
ATOM   5043  C  CA    . VAL C 2  194  ? 1.625   -40.429 41.398  1.00 93.17  ? 194  VAL C CA    1 
ATOM   5044  C  C     . VAL C 2  194  ? 2.974   -40.317 40.699  1.00 91.60  ? 194  VAL C C     1 
ATOM   5045  O  O     . VAL C 2  194  ? 3.820   -41.199 40.828  1.00 95.29  ? 194  VAL C O     1 
ATOM   5046  C  CB    . VAL C 2  194  ? 0.515   -40.468 40.337  1.00 92.20  ? 194  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C 2  194  ? 0.589   -41.764 39.549  1.00 100.02 ? 194  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C 2  194  ? -0.849  -40.314 40.996  1.00 96.87  ? 194  VAL C CG2   1 
ATOM   5049  N  N     . LEU C 2  195  ? 3.148   -39.233 39.948  1.00 93.23  ? 195  LEU C N     1 
ATOM   5050  C  CA    . LEU C 2  195  ? 4.373   -38.965 39.199  1.00 97.33  ? 195  LEU C CA    1 
ATOM   5051  C  C     . LEU C 2  195  ? 5.641   -39.130 40.043  1.00 101.85 ? 195  LEU C C     1 
ATOM   5052  O  O     . LEU C 2  195  ? 6.613   -39.763 39.610  1.00 102.01 ? 195  LEU C O     1 
ATOM   5053  C  CB    . LEU C 2  195  ? 4.313   -37.549 38.620  1.00 93.60  ? 195  LEU C CB    1 
ATOM   5054  C  CG    . LEU C 2  195  ? 5.363   -37.138 37.589  1.00 106.48 ? 195  LEU C CG    1 
ATOM   5055  C  CD1   . LEU C 2  195  ? 5.298   -38.042 36.368  1.00 110.31 ? 195  LEU C CD1   1 
ATOM   5056  C  CD2   . LEU C 2  195  ? 5.162   -35.685 37.192  1.00 106.35 ? 195  LEU C CD2   1 
ATOM   5057  N  N     . LEU C 2  196  ? 5.621   -38.576 41.253  1.00 98.96  ? 196  LEU C N     1 
ATOM   5058  C  CA    . LEU C 2  196  ? 6.768   -38.679 42.149  1.00 92.46  ? 196  LEU C CA    1 
ATOM   5059  C  C     . LEU C 2  196  ? 7.015   -40.128 42.544  1.00 91.60  ? 196  LEU C C     1 
ATOM   5060  O  O     . LEU C 2  196  ? 8.158   -40.576 42.579  1.00 93.92  ? 196  LEU C O     1 
ATOM   5061  C  CB    . LEU C 2  196  ? 6.579   -37.809 43.395  1.00 98.35  ? 196  LEU C CB    1 
ATOM   5062  C  CG    . LEU C 2  196  ? 7.808   -37.626 44.297  1.00 87.25  ? 196  LEU C CG    1 
ATOM   5063  C  CD1   . LEU C 2  196  ? 7.829   -36.227 44.884  1.00 89.10  ? 196  LEU C CD1   1 
ATOM   5064  C  CD2   . LEU C 2  196  ? 7.854   -38.663 45.412  1.00 77.24  ? 196  LEU C CD2   1 
ATOM   5065  N  N     . LEU C 2  197  ? 5.944   -40.856 42.844  1.00 93.74  ? 197  LEU C N     1 
ATOM   5066  C  CA    . LEU C 2  197  ? 6.064   -42.274 43.169  1.00 93.44  ? 197  LEU C CA    1 
ATOM   5067  C  C     . LEU C 2  197  ? 6.689   -43.046 42.010  1.00 92.91  ? 197  LEU C C     1 
ATOM   5068  O  O     . LEU C 2  197  ? 7.502   -43.946 42.218  1.00 88.90  ? 197  LEU C O     1 
ATOM   5069  C  CB    . LEU C 2  197  ? 4.701   -42.863 43.535  1.00 90.87  ? 197  LEU C CB    1 
ATOM   5070  C  CG    . LEU C 2  197  ? 4.152   -42.456 44.903  1.00 84.93  ? 197  LEU C CG    1 
ATOM   5071  C  CD1   . LEU C 2  197  ? 2.739   -42.974 45.089  1.00 85.91  ? 197  LEU C CD1   1 
ATOM   5072  C  CD2   . LEU C 2  197  ? 5.058   -42.966 46.014  1.00 84.48  ? 197  LEU C CD2   1 
ATOM   5073  N  N     . ARG C 2  198  ? 6.314   -42.671 40.791  1.00 97.40  ? 198  ARG C N     1 
ATOM   5074  C  CA    . ARG C 2  198  ? 6.852   -43.292 39.586  1.00 101.97 ? 198  ARG C CA    1 
ATOM   5075  C  C     . ARG C 2  198  ? 8.341   -42.994 39.439  1.00 99.36  ? 198  ARG C C     1 
ATOM   5076  O  O     . ARG C 2  198  ? 9.114   -43.854 39.016  1.00 102.63 ? 198  ARG C O     1 
ATOM   5077  C  CB    . ARG C 2  198  ? 6.093   -42.800 38.352  1.00 106.54 ? 198  ARG C CB    1 
ATOM   5078  C  CG    . ARG C 2  198  ? 6.489   -43.479 37.049  1.00 115.49 ? 198  ARG C CG    1 
ATOM   5079  C  CD    . ARG C 2  198  ? 6.086   -44.945 37.035  1.00 114.83 ? 198  ARG C CD    1 
ATOM   5080  N  NE    . ARG C 2  198  ? 6.291   -45.554 35.724  1.00 120.25 ? 198  ARG C NE    1 
ATOM   5081  C  CZ    . ARG C 2  198  ? 7.394   -46.202 35.362  1.00 120.46 ? 198  ARG C CZ    1 
ATOM   5082  N  NH1   . ARG C 2  198  ? 7.490   -46.722 34.146  1.00 122.69 ? 198  ARG C NH1   1 
ATOM   5083  N  NH2   . ARG C 2  198  ? 8.401   -46.331 36.215  1.00 116.66 ? 198  ARG C NH2   1 
ATOM   5084  N  N     . VAL C 2  199  ? 8.734   -41.771 39.787  1.00 98.91  ? 199  VAL C N     1 
ATOM   5085  C  CA    . VAL C 2  199  ? 10.144  -41.377 39.770  1.00 93.75  ? 199  VAL C CA    1 
ATOM   5086  C  C     . VAL C 2  199  ? 11.012  -42.310 40.627  1.00 91.07  ? 199  VAL C C     1 
ATOM   5087  O  O     . VAL C 2  199  ? 12.177  -42.565 40.312  1.00 95.25  ? 199  VAL C O     1 
ATOM   5088  C  CB    . VAL C 2  199  ? 10.312  -39.909 40.238  1.00 89.01  ? 199  VAL C CB    1 
ATOM   5089  C  CG1   . VAL C 2  199  ? 11.774  -39.567 40.489  1.00 89.13  ? 199  VAL C CG1   1 
ATOM   5090  C  CG2   . VAL C 2  199  ? 9.704   -38.956 39.221  1.00 87.91  ? 199  VAL C CG2   1 
ATOM   5091  N  N     . LEU C 2  200  ? 10.421  -42.849 41.687  1.00 94.94  ? 200  LEU C N     1 
ATOM   5092  C  CA    . LEU C 2  200  ? 11.150  -43.670 42.650  1.00 98.74  ? 200  LEU C CA    1 
ATOM   5093  C  C     . LEU C 2  200  ? 11.300  -45.131 42.229  1.00 102.67 ? 200  LEU C C     1 
ATOM   5094  O  O     . LEU C 2  200  ? 11.917  -45.925 42.941  1.00 101.54 ? 200  LEU C O     1 
ATOM   5095  C  CB    . LEU C 2  200  ? 10.479  -43.597 44.024  1.00 104.60 ? 200  LEU C CB    1 
ATOM   5096  C  CG    . LEU C 2  200  ? 10.949  -42.492 44.974  1.00 101.39 ? 200  LEU C CG    1 
ATOM   5097  C  CD1   . LEU C 2  200  ? 12.443  -42.604 45.200  1.00 106.50 ? 200  LEU C CD1   1 
ATOM   5098  C  CD2   . LEU C 2  200  ? 10.585  -41.103 44.477  1.00 91.20  ? 200  LEU C CD2   1 
ATOM   5099  N  N     . GLY C 2  201  ? 10.745  -45.486 41.074  1.00 105.93 ? 201  GLY C N     1 
ATOM   5100  C  CA    . GLY C 2  201  ? 10.802  -46.862 40.612  1.00 107.24 ? 201  GLY C CA    1 
ATOM   5101  C  C     . GLY C 2  201  ? 9.616   -47.703 41.044  1.00 98.50  ? 201  GLY C C     1 
ATOM   5102  O  O     . GLY C 2  201  ? 9.716   -48.926 41.144  1.00 95.99  ? 201  GLY C O     1 
ATOM   5103  N  N     . TYR C 2  202  ? 8.492   -47.046 41.311  1.00 102.50 ? 202  TYR C N     1 
ATOM   5104  C  CA    . TYR C 2  202  ? 7.276   -47.735 41.736  1.00 107.18 ? 202  TYR C CA    1 
ATOM   5105  C  C     . TYR C 2  202  ? 6.371   -48.079 40.554  1.00 110.04 ? 202  TYR C C     1 
ATOM   5106  O  O     . TYR C 2  202  ? 6.258   -47.314 39.596  1.00 103.55 ? 202  TYR C O     1 
ATOM   5107  C  CB    . TYR C 2  202  ? 6.505   -46.892 42.755  1.00 104.38 ? 202  TYR C CB    1 
ATOM   5108  C  CG    . TYR C 2  202  ? 6.993   -47.042 44.178  1.00 100.98 ? 202  TYR C CG    1 
ATOM   5109  C  CD1   . TYR C 2  202  ? 6.139   -47.481 45.179  1.00 97.56  ? 202  TYR C CD1   1 
ATOM   5110  C  CD2   . TYR C 2  202  ? 8.308   -46.753 44.519  1.00 102.78 ? 202  TYR C CD2   1 
ATOM   5111  C  CE1   . TYR C 2  202  ? 6.575   -47.622 46.479  1.00 92.36  ? 202  TYR C CE1   1 
ATOM   5112  C  CE2   . TYR C 2  202  ? 8.755   -46.893 45.818  1.00 96.34  ? 202  TYR C CE2   1 
ATOM   5113  C  CZ    . TYR C 2  202  ? 7.883   -47.328 46.793  1.00 93.13  ? 202  TYR C CZ    1 
ATOM   5114  O  OH    . TYR C 2  202  ? 8.320   -47.470 48.089  1.00 98.76  ? 202  TYR C OH    1 
ATOM   5115  N  N     . ASP C 2  203  ? 5.734   -49.243 40.635  1.00 118.06 ? 203  ASP C N     1 
ATOM   5116  C  CA    . ASP C 2  203  ? 4.867   -49.738 39.571  1.00 127.69 ? 203  ASP C CA    1 
ATOM   5117  C  C     . ASP C 2  203  ? 3.437   -49.893 40.085  1.00 132.08 ? 203  ASP C C     1 
ATOM   5118  O  O     . ASP C 2  203  ? 3.221   -49.997 41.292  1.00 135.26 ? 203  ASP C O     1 
ATOM   5119  C  CB    . ASP C 2  203  ? 5.393   -51.078 39.050  1.00 131.39 ? 203  ASP C CB    1 
ATOM   5120  C  CG    . ASP C 2  203  ? 4.620   -51.584 37.848  1.00 136.35 ? 203  ASP C CG    1 
ATOM   5121  O  OD1   . ASP C 2  203  ? 3.608   -52.291 38.046  1.00 136.16 ? 203  ASP C OD1   1 
ATOM   5122  O  OD2   . ASP C 2  203  ? 5.023   -51.276 36.707  1.00 140.68 ? 203  ASP C OD2   1 
ATOM   5123  N  N     . GLN C 2  204  ? 2.469   -49.887 39.168  1.00 130.24 ? 204  GLN C N     1 
ATOM   5124  C  CA    . GLN C 2  204  ? 1.057   -50.064 39.509  1.00 126.07 ? 204  GLN C CA    1 
ATOM   5125  C  C     . GLN C 2  204  ? 0.831   -51.275 40.403  1.00 129.65 ? 204  GLN C C     1 
ATOM   5126  O  O     . GLN C 2  204  ? 0.060   -51.216 41.360  1.00 132.58 ? 204  GLN C O     1 
ATOM   5127  C  CB    . GLN C 2  204  ? 0.209   -50.212 38.244  1.00 129.94 ? 204  GLN C CB    1 
ATOM   5128  C  CG    . GLN C 2  204  ? -0.148  -48.905 37.567  1.00 134.62 ? 204  GLN C CG    1 
ATOM   5129  C  CD    . GLN C 2  204  ? -0.906  -49.106 36.268  1.00 140.95 ? 204  GLN C CD    1 
ATOM   5130  O  OE1   . GLN C 2  204  ? -1.211  -50.234 35.882  1.00 143.37 ? 204  GLN C OE1   1 
ATOM   5131  N  NE2   . GLN C 2  204  ? -1.211  -48.008 35.585  1.00 139.31 ? 204  GLN C NE2   1 
ATOM   5132  N  N     . GLU C 2  205  ? 1.510   -52.371 40.082  1.00 130.33 ? 205  GLU C N     1 
ATOM   5133  C  CA    . GLU C 2  205  ? 1.376   -53.608 40.838  1.00 136.03 ? 205  GLU C CA    1 
ATOM   5134  C  C     . GLU C 2  205  ? 1.893   -53.453 42.266  1.00 133.69 ? 205  GLU C C     1 
ATOM   5135  O  O     . GLU C 2  205  ? 1.176   -53.740 43.225  1.00 137.08 ? 205  GLU C O     1 
ATOM   5136  C  CB    . GLU C 2  205  ? 2.114   -54.747 40.132  1.00 144.50 ? 205  GLU C CB    1 
ATOM   5137  C  CG    . GLU C 2  205  ? 1.871   -56.118 40.742  1.00 153.64 ? 205  GLU C CG    1 
ATOM   5138  C  CD    . GLU C 2  205  ? 0.443   -56.599 40.553  1.00 157.63 ? 205  GLU C CD    1 
ATOM   5139  O  OE1   . GLU C 2  205  ? -0.227  -56.130 39.608  1.00 155.80 ? 205  GLU C OE1   1 
ATOM   5140  O  OE2   . GLU C 2  205  ? -0.009  -57.447 41.351  1.00 160.62 ? 205  GLU C OE2   1 
ATOM   5141  N  N     . THR C 2  206  ? 3.134   -52.989 42.396  1.00 127.93 ? 206  THR C N     1 
ATOM   5142  C  CA    . THR C 2  206  ? 3.777   -52.827 43.700  1.00 129.96 ? 206  THR C CA    1 
ATOM   5143  C  C     . THR C 2  206  ? 2.962   -51.930 44.631  1.00 130.02 ? 206  THR C C     1 
ATOM   5144  O  O     . THR C 2  206  ? 2.858   -52.195 45.831  1.00 122.65 ? 206  THR C O     1 
ATOM   5145  C  CB    . THR C 2  206  ? 5.198   -52.246 43.557  1.00 125.70 ? 206  THR C CB    1 
ATOM   5146  O  OG1   . THR C 2  206  ? 5.896   -52.934 42.512  1.00 130.31 ? 206  THR C OG1   1 
ATOM   5147  C  CG2   . THR C 2  206  ? 5.970   -52.389 44.861  1.00 114.51 ? 206  THR C CG2   1 
ATOM   5148  N  N     . LEU C 2  207  ? 2.386   -50.871 44.071  1.00 128.39 ? 207  LEU C N     1 
ATOM   5149  C  CA    . LEU C 2  207  ? 1.525   -49.973 44.833  1.00 123.08 ? 207  LEU C CA    1 
ATOM   5150  C  C     . LEU C 2  207  ? 0.207   -50.644 45.206  1.00 121.71 ? 207  LEU C C     1 
ATOM   5151  O  O     . LEU C 2  207  ? -0.177  -50.656 46.371  1.00 116.09 ? 207  LEU C O     1 
ATOM   5152  C  CB    . LEU C 2  207  ? 1.256   -48.683 44.053  1.00 120.91 ? 207  LEU C CB    1 
ATOM   5153  C  CG    . LEU C 2  207  ? 2.373   -47.637 44.029  1.00 108.26 ? 207  LEU C CG    1 
ATOM   5154  C  CD1   . LEU C 2  207  ? 2.030   -46.501 43.079  1.00 93.76  ? 207  LEU C CD1   1 
ATOM   5155  C  CD2   . LEU C 2  207  ? 2.628   -47.100 45.426  1.00 102.78 ? 207  LEU C CD2   1 
ATOM   5156  N  N     . ALA C 2  208  ? -0.474  -51.210 44.214  1.00 126.66 ? 208  ALA C N     1 
ATOM   5157  C  CA    . ALA C 2  208  ? -1.786  -51.817 44.431  1.00 120.89 ? 208  ALA C CA    1 
ATOM   5158  C  C     . ALA C 2  208  ? -1.764  -52.987 45.414  1.00 119.11 ? 208  ALA C C     1 
ATOM   5159  O  O     . ALA C 2  208  ? -2.760  -53.253 46.081  1.00 117.15 ? 208  ALA C O     1 
ATOM   5160  C  CB    . ALA C 2  208  ? -2.399  -52.252 43.106  1.00 120.89 ? 208  ALA C CB    1 
ATOM   5161  N  N     . ARG C 2  209  ? -0.636  -53.687 45.499  1.00 122.10 ? 209  ARG C N     1 
ATOM   5162  C  CA    . ARG C 2  209  ? -0.531  -54.842 46.390  1.00 126.34 ? 209  ARG C CA    1 
ATOM   5163  C  C     . ARG C 2  209  ? -0.726  -54.467 47.860  1.00 128.20 ? 209  ARG C C     1 
ATOM   5164  O  O     . ARG C 2  209  ? -1.621  -54.985 48.530  1.00 121.51 ? 209  ARG C O     1 
ATOM   5165  C  CB    . ARG C 2  209  ? 0.820   -55.541 46.207  1.00 132.98 ? 209  ARG C CB    1 
ATOM   5166  C  CG    . ARG C 2  209  ? 0.947   -56.334 44.916  1.00 140.18 ? 209  ARG C CG    1 
ATOM   5167  C  CD    . ARG C 2  209  ? 0.727   -57.820 45.143  1.00 146.23 ? 209  ARG C CD    1 
ATOM   5168  N  NE    . ARG C 2  209  ? 1.793   -58.410 45.947  1.00 146.75 ? 209  ARG C NE    1 
ATOM   5169  C  CZ    . ARG C 2  209  ? 1.907   -59.710 46.200  1.00 146.75 ? 209  ARG C CZ    1 
ATOM   5170  N  NH1   . ARG C 2  209  ? 2.910   -60.158 46.943  1.00 150.90 ? 209  ARG C NH1   1 
ATOM   5171  N  NH2   . ARG C 2  209  ? 1.019   -60.563 45.709  1.00 142.12 ? 209  ARG C NH2   1 
ATOM   5172  N  N     . GLU C 2  210  ? 0.117   -53.566 48.352  1.00 130.02 ? 210  GLU C N     1 
ATOM   5173  C  CA    . GLU C 2  210  ? 0.065   -53.135 49.745  1.00 123.68 ? 210  GLU C CA    1 
ATOM   5174  C  C     . GLU C 2  210  ? -1.014  -52.086 49.992  1.00 113.70 ? 210  GLU C C     1 
ATOM   5175  O  O     . GLU C 2  210  ? -1.721  -52.125 50.999  1.00 107.79 ? 210  GLU C O     1 
ATOM   5176  C  CB    . GLU C 2  210  ? 1.427   -52.590 50.172  1.00 112.66 ? 210  GLU C CB    1 
ATOM   5177  C  CG    . GLU C 2  210  ? 2.565   -53.569 49.959  1.00 114.92 ? 210  GLU C CG    1 
ATOM   5178  C  CD    . GLU C 2  210  ? 3.922   -52.917 50.092  1.00 111.22 ? 210  GLU C CD    1 
ATOM   5179  O  OE1   . GLU C 2  210  ? 3.972   -51.704 50.383  1.00 100.37 ? 210  GLU C OE1   1 
ATOM   5180  O  OE2   . GLU C 2  210  ? 4.938   -53.617 49.900  1.00 116.25 ? 210  GLU C OE2   1 
ATOM   5181  N  N     . LEU C 2  211  ? -1.128  -51.151 49.056  1.00 105.02 ? 211  LEU C N     1 
ATOM   5182  C  CA    . LEU C 2  211  ? -1.974  -49.976 49.218  1.00 101.70 ? 211  LEU C CA    1 
ATOM   5183  C  C     . LEU C 2  211  ? -3.373  -50.179 48.637  1.00 99.75  ? 211  LEU C C     1 
ATOM   5184  O  O     . LEU C 2  211  ? -4.201  -49.267 48.653  1.00 88.20  ? 211  LEU C O     1 
ATOM   5185  C  CB    . LEU C 2  211  ? -1.298  -48.774 48.557  1.00 103.77 ? 211  LEU C CB    1 
ATOM   5186  C  CG    . LEU C 2  211  ? -1.652  -47.366 49.024  1.00 92.67  ? 211  LEU C CG    1 
ATOM   5187  C  CD1   . LEU C 2  211  ? -0.437  -46.703 49.647  1.00 82.34  ? 211  LEU C CD1   1 
ATOM   5188  C  CD2   . LEU C 2  211  ? -2.156  -46.558 47.855  1.00 86.32  ? 211  LEU C CD2   1 
ATOM   5189  N  N     . GLY C 2  212  ? -3.633  -51.376 48.121  1.00 111.59 ? 212  GLY C N     1 
ATOM   5190  C  CA    . GLY C 2  212  ? -4.932  -51.684 47.550  1.00 110.12 ? 212  GLY C CA    1 
ATOM   5191  C  C     . GLY C 2  212  ? -5.913  -52.248 48.560  1.00 107.14 ? 212  GLY C C     1 
ATOM   5192  O  O     . GLY C 2  212  ? -7.041  -52.591 48.205  1.00 106.07 ? 212  GLY C O     1 
ATOM   5193  N  N     . ALA C 2  213  ? -5.481  -52.347 49.817  1.00 101.26 ? 213  ALA C N     1 
ATOM   5194  C  CA    . ALA C 2  213  ? -6.350  -52.797 50.902  1.00 92.93  ? 213  ALA C CA    1 
ATOM   5195  C  C     . ALA C 2  213  ? -7.588  -51.911 50.972  1.00 91.27  ? 213  ALA C C     1 
ATOM   5196  O  O     . ALA C 2  213  ? -8.677  -52.364 51.321  1.00 81.67  ? 213  ALA C O     1 
ATOM   5197  C  CB    . ALA C 2  213  ? -5.601  -52.781 52.224  1.00 82.86  ? 213  ALA C CB    1 
ATOM   5198  N  N     . TYR C 2  214  ? -7.399  -50.638 50.641  1.00 102.21 ? 214  TYR C N     1 
ATOM   5199  C  CA    . TYR C 2  214  ? -8.500  -49.708 50.459  1.00 104.15 ? 214  TYR C CA    1 
ATOM   5200  C  C     . TYR C 2  214  ? -8.540  -49.381 48.970  1.00 107.06 ? 214  TYR C C     1 
ATOM   5201  O  O     . TYR C 2  214  ? -7.675  -48.669 48.460  1.00 104.66 ? 214  TYR C O     1 
ATOM   5202  C  CB    . TYR C 2  214  ? -8.229  -48.446 51.281  1.00 86.89  ? 214  TYR C CB    1 
ATOM   5203  C  CG    . TYR C 2  214  ? -7.009  -48.582 52.173  1.00 75.25  ? 214  TYR C CG    1 
ATOM   5204  C  CD1   . TYR C 2  214  ? -7.125  -49.026 53.484  1.00 78.18  ? 214  TYR C CD1   1 
ATOM   5205  C  CD2   . TYR C 2  214  ? -5.736  -48.289 51.693  1.00 78.26  ? 214  TYR C CD2   1 
ATOM   5206  C  CE1   . TYR C 2  214  ? -6.011  -49.164 54.295  1.00 70.27  ? 214  TYR C CE1   1 
ATOM   5207  C  CE2   . TYR C 2  214  ? -4.619  -48.426 52.496  1.00 71.08  ? 214  TYR C CE2   1 
ATOM   5208  C  CZ    . TYR C 2  214  ? -4.762  -48.862 53.794  1.00 61.78  ? 214  TYR C CZ    1 
ATOM   5209  O  OH    . TYR C 2  214  ? -3.652  -48.996 54.594  1.00 60.49  ? 214  TYR C OH    1 
ATOM   5210  N  N     . GLY C 2  215  ? -9.545  -49.909 48.275  1.00 113.45 ? 215  GLY C N     1 
ATOM   5211  C  CA    . GLY C 2  215  ? -9.611  -49.815 46.825  1.00 121.26 ? 215  GLY C CA    1 
ATOM   5212  C  C     . GLY C 2  215  ? -10.045 -48.478 46.254  1.00 122.49 ? 215  GLY C C     1 
ATOM   5213  O  O     . GLY C 2  215  ? -9.414  -47.933 45.333  1.00 131.40 ? 215  GLY C O     1 
ATOM   5214  N  N     . GLU C 2  216  ? -11.130 -47.948 46.811  1.00 115.42 ? 216  GLU C N     1 
ATOM   5215  C  CA    . GLU C 2  216  ? -11.718 -46.704 46.330  1.00 122.46 ? 216  GLU C CA    1 
ATOM   5216  C  C     . GLU C 2  216  ? -10.712 -45.565 46.413  1.00 126.21 ? 216  GLU C C     1 
ATOM   5217  O  O     . GLU C 2  216  ? -10.690 -44.671 45.565  1.00 129.03 ? 216  GLU C O     1 
ATOM   5218  C  CB    . GLU C 2  216  ? -12.988 -46.374 47.125  1.00 115.82 ? 216  GLU C CB    1 
ATOM   5219  C  CG    . GLU C 2  216  ? -13.365 -44.892 47.180  1.00 113.76 ? 216  GLU C CG    1 
ATOM   5220  C  CD    . GLU C 2  216  ? -13.911 -44.349 45.867  1.00 115.38 ? 216  GLU C CD    1 
ATOM   5221  O  OE1   . GLU C 2  216  ? -13.836 -45.047 44.834  1.00 114.42 ? 216  GLU C OE1   1 
ATOM   5222  O  OE2   . GLU C 2  216  ? -14.426 -43.210 45.872  1.00 103.67 ? 216  GLU C OE2   1 
ATOM   5223  N  N     . LEU C 2  217  ? -9.864  -45.617 47.433  1.00 119.46 ? 217  LEU C N     1 
ATOM   5224  C  CA    . LEU C 2  217  ? -8.849  -44.596 47.629  1.00 114.72 ? 217  LEU C CA    1 
ATOM   5225  C  C     . LEU C 2  217  ? -7.640  -44.790 46.711  1.00 114.25 ? 217  LEU C C     1 
ATOM   5226  O  O     . LEU C 2  217  ? -7.108  -43.820 46.169  1.00 112.67 ? 217  LEU C O     1 
ATOM   5227  C  CB    . LEU C 2  217  ? -8.424  -44.552 49.098  1.00 105.64 ? 217  LEU C CB    1 
ATOM   5228  C  CG    . LEU C 2  217  ? -8.194  -43.159 49.686  1.00 103.17 ? 217  LEU C CG    1 
ATOM   5229  C  CD1   . LEU C 2  217  ? -8.938  -42.085 48.896  1.00 100.59 ? 217  LEU C CD1   1 
ATOM   5230  C  CD2   . LEU C 2  217  ? -8.598  -43.136 51.153  1.00 87.69  ? 217  LEU C CD2   1 
ATOM   5231  N  N     . VAL C 2  218  ? -7.214  -46.040 46.532  1.00 114.34 ? 218  VAL C N     1 
ATOM   5232  C  CA    . VAL C 2  218  ? -6.040  -46.334 45.710  1.00 108.94 ? 218  VAL C CA    1 
ATOM   5233  C  C     . VAL C 2  218  ? -6.307  -46.123 44.220  1.00 102.10 ? 218  VAL C C     1 
ATOM   5234  O  O     . VAL C 2  218  ? -5.381  -45.853 43.455  1.00 94.97  ? 218  VAL C O     1 
ATOM   5235  C  CB    . VAL C 2  218  ? -5.476  -47.766 45.962  1.00 114.27 ? 218  VAL C CB    1 
ATOM   5236  C  CG1   . VAL C 2  218  ? -6.443  -48.825 45.481  1.00 118.42 ? 218  VAL C CG1   1 
ATOM   5237  C  CG2   . VAL C 2  218  ? -4.126  -47.948 45.276  1.00 106.83 ? 218  VAL C CG2   1 
ATOM   5238  N  N     . GLN C 2  219  ? -7.564  -46.240 43.800  1.00 110.65 ? 219  GLN C N     1 
ATOM   5239  C  CA    . GLN C 2  219  ? -7.870  -46.056 42.380  1.00 119.74 ? 219  GLN C CA    1 
ATOM   5240  C  C     . GLN C 2  219  ? -7.612  -44.626 41.891  1.00 118.95 ? 219  GLN C C     1 
ATOM   5241  O  O     . GLN C 2  219  ? -7.428  -44.393 40.696  1.00 118.95 ? 219  GLN C O     1 
ATOM   5242  C  CB    . GLN C 2  219  ? -9.297  -46.506 42.049  1.00 119.11 ? 219  GLN C CB    1 
ATOM   5243  C  CG    . GLN C 2  219  ? -9.516  -46.777 40.565  1.00 118.88 ? 219  GLN C CG    1 
ATOM   5244  C  CD    . GLN C 2  219  ? -8.467  -47.709 39.978  1.00 120.32 ? 219  GLN C CD    1 
ATOM   5245  O  OE1   . GLN C 2  219  ? -8.104  -48.718 40.585  1.00 111.66 ? 219  GLN C OE1   1 
ATOM   5246  N  NE2   . GLN C 2  219  ? -7.966  -47.367 38.795  1.00 110.89 ? 219  GLN C NE2   1 
ATOM   5247  N  N     . GLY C 2  220  ? -7.594  -43.676 42.819  1.00 115.36 ? 220  GLY C N     1 
ATOM   5248  C  CA    . GLY C 2  220  ? -7.273  -42.300 42.489  1.00 102.95 ? 220  GLY C CA    1 
ATOM   5249  C  C     . GLY C 2  220  ? -5.777  -42.088 42.348  1.00 105.58 ? 220  GLY C C     1 
ATOM   5250  O  O     . GLY C 2  220  ? -5.324  -41.070 41.823  1.00 100.29 ? 220  GLY C O     1 
ATOM   5251  N  N     . LEU C 2  221  ? -5.010  -43.062 42.825  1.00 106.34 ? 221  LEU C N     1 
ATOM   5252  C  CA    . LEU C 2  221  ? -3.556  -43.040 42.719  1.00 103.85 ? 221  LEU C CA    1 
ATOM   5253  C  C     . LEU C 2  221  ? -3.126  -43.585 41.357  1.00 111.84 ? 221  LEU C C     1 
ATOM   5254  O  O     . LEU C 2  221  ? -1.962  -43.479 40.971  1.00 113.65 ? 221  LEU C O     1 
ATOM   5255  C  CB    . LEU C 2  221  ? -2.942  -43.882 43.845  1.00 102.94 ? 221  LEU C CB    1 
ATOM   5256  C  CG    . LEU C 2  221  ? -1.421  -44.015 43.965  1.00 97.72  ? 221  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C 2  221  ? -0.823  -42.806 44.650  1.00 92.58  ? 221  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C 2  221  ? -1.045  -45.291 44.698  1.00 97.56  ? 221  LEU C CD2   1 
ATOM   5259  N  N     . MET C 2  222  ? -4.080  -44.149 40.622  1.00 114.94 ? 222  MET C N     1 
ATOM   5260  C  CA    . MET C 2  222  ? -3.778  -44.825 39.363  1.00 115.40 ? 222  MET C CA    1 
ATOM   5261  C  C     . MET C 2  222  ? -3.917  -43.913 38.146  1.00 113.92 ? 222  MET C C     1 
ATOM   5262  O  O     . MET C 2  222  ? -5.018  -43.482 37.800  1.00 103.32 ? 222  MET C O     1 
ATOM   5263  C  CB    . MET C 2  222  ? -4.681  -46.051 39.191  1.00 116.66 ? 222  MET C CB    1 
ATOM   5264  C  CG    . MET C 2  222  ? -4.523  -47.103 40.278  1.00 117.90 ? 222  MET C CG    1 
ATOM   5265  S  SD    . MET C 2  222  ? -2.952  -47.984 40.186  1.00 122.24 ? 222  MET C SD    1 
ATOM   5266  C  CE    . MET C 2  222  ? -3.012  -48.937 41.700  1.00 110.95 ? 222  MET C CE    1 
ATOM   5267  N  N     . ASP C 2  223  ? -2.789  -43.631 37.500  1.00 115.66 ? 223  ASP C N     1 
ATOM   5268  C  CA    . ASP C 2  223  ? -2.787  -42.896 36.240  1.00 119.74 ? 223  ASP C CA    1 
ATOM   5269  C  C     . ASP C 2  223  ? -1.980  -43.652 35.190  1.00 121.49 ? 223  ASP C C     1 
ATOM   5270  O  O     . ASP C 2  223  ? -0.769  -43.821 35.321  1.00 116.47 ? 223  ASP C O     1 
ATOM   5271  C  CB    . ASP C 2  223  ? -2.231  -41.482 36.425  1.00 116.16 ? 223  ASP C CB    1 
ATOM   5272  C  CG    . ASP C 2  223  ? -2.325  -40.649 35.159  1.00 116.97 ? 223  ASP C CG    1 
ATOM   5273  O  OD1   . ASP C 2  223  ? -1.529  -39.700 35.005  1.00 101.15 ? 223  ASP C OD1   1 
ATOM   5274  O  OD2   . ASP C 2  223  ? -3.198  -40.943 34.315  1.00 122.89 ? 223  ASP C OD2   1 
ATOM   5275  N  N     . GLU C 2  224  ? -2.669  -44.096 34.146  1.00 125.59 ? 224  GLU C N     1 
ATOM   5276  C  CA    . GLU C 2  224  ? -2.075  -44.893 33.077  1.00 127.68 ? 224  GLU C CA    1 
ATOM   5277  C  C     . GLU C 2  224  ? -0.905  -44.185 32.393  1.00 126.19 ? 224  GLU C C     1 
ATOM   5278  O  O     . GLU C 2  224  ? 0.170   -44.767 32.212  1.00 121.31 ? 224  GLU C O     1 
ATOM   5279  C  CB    . GLU C 2  224  ? -3.143  -45.246 32.036  1.00 127.97 ? 224  GLU C CB    1 
ATOM   5280  C  CG    . GLU C 2  224  ? -4.583  -44.984 32.489  1.00 132.62 ? 224  GLU C CG    1 
ATOM   5281  C  CD    . GLU C 2  224  ? -4.968  -43.510 32.434  1.00 136.38 ? 224  GLU C CD    1 
ATOM   5282  O  OE1   . GLU C 2  224  ? -5.711  -43.054 33.330  1.00 124.30 ? 224  GLU C OE1   1 
ATOM   5283  O  OE2   . GLU C 2  224  ? -4.526  -42.809 31.498  1.00 135.67 ? 224  GLU C OE2   1 
ATOM   5284  N  N     . SER C 2  225  ? -1.126  -42.927 32.022  1.00 125.19 ? 225  SER C N     1 
ATOM   5285  C  CA    . SER C 2  225  ? -0.138  -42.142 31.285  1.00 123.82 ? 225  SER C CA    1 
ATOM   5286  C  C     . SER C 2  225  ? 1.185   -41.992 32.035  1.00 125.26 ? 225  SER C C     1 
ATOM   5287  O  O     . SER C 2  225  ? 2.244   -41.881 31.418  1.00 122.38 ? 225  SER C O     1 
ATOM   5288  C  CB    . SER C 2  225  ? -0.707  -40.764 30.933  1.00 111.30 ? 225  SER C CB    1 
ATOM   5289  O  OG    . SER C 2  225  ? -1.213  -40.110 32.085  1.00 104.00 ? 225  SER C OG    1 
ATOM   5290  N  N     . VAL C 2  226  ? 1.119   -41.994 33.362  1.00 126.00 ? 226  VAL C N     1 
ATOM   5291  C  CA    . VAL C 2  226  ? 2.316   -41.886 34.190  1.00 122.39 ? 226  VAL C CA    1 
ATOM   5292  C  C     . VAL C 2  226  ? 3.144   -43.170 34.167  1.00 122.74 ? 226  VAL C C     1 
ATOM   5293  O  O     . VAL C 2  226  ? 4.354   -43.134 33.941  1.00 119.07 ? 226  VAL C O     1 
ATOM   5294  C  CB    . VAL C 2  226  ? 1.963   -41.521 35.645  1.00 118.77 ? 226  VAL C CB    1 
ATOM   5295  C  CG1   . VAL C 2  226  ? 3.136   -41.804 36.570  1.00 110.04 ? 226  VAL C CG1   1 
ATOM   5296  C  CG2   . VAL C 2  226  ? 1.546   -40.064 35.735  1.00 113.26 ? 226  VAL C CG2   1 
ATOM   5297  N  N     . PHE C 2  227  ? 2.487   -44.303 34.397  1.00 123.36 ? 227  PHE C N     1 
ATOM   5298  C  CA    . PHE C 2  227  ? 3.174   -45.591 34.415  1.00 123.88 ? 227  PHE C CA    1 
ATOM   5299  C  C     . PHE C 2  227  ? 3.614   -46.015 33.018  1.00 122.05 ? 227  PHE C C     1 
ATOM   5300  O  O     . PHE C 2  227  ? 4.492   -46.865 32.866  1.00 112.05 ? 227  PHE C O     1 
ATOM   5301  C  CB    . PHE C 2  227  ? 2.293   -46.668 35.047  1.00 121.55 ? 227  PHE C CB    1 
ATOM   5302  C  CG    . PHE C 2  227  ? 2.029   -46.450 36.507  1.00 125.93 ? 227  PHE C CG    1 
ATOM   5303  C  CD1   . PHE C 2  227  ? 2.886   -46.967 37.464  1.00 120.62 ? 227  PHE C CD1   1 
ATOM   5304  C  CD2   . PHE C 2  227  ? 0.927   -45.724 36.922  1.00 130.60 ? 227  PHE C CD2   1 
ATOM   5305  C  CE1   . PHE C 2  227  ? 2.645   -46.764 38.810  1.00 124.04 ? 227  PHE C CE1   1 
ATOM   5306  C  CE2   . PHE C 2  227  ? 0.678   -45.520 38.265  1.00 128.86 ? 227  PHE C CE2   1 
ATOM   5307  C  CZ    . PHE C 2  227  ? 1.538   -46.040 39.211  1.00 133.58 ? 227  PHE C CZ    1 
ATOM   5308  N  N     . ALA C 2  228  ? 3.000   -45.418 32.000  1.00 124.89 ? 228  ALA C N     1 
ATOM   5309  C  CA    . ALA C 2  228  ? 3.402   -45.667 30.620  1.00 124.38 ? 228  ALA C CA    1 
ATOM   5310  C  C     . ALA C 2  228  ? 4.782   -45.074 30.350  1.00 126.38 ? 228  ALA C C     1 
ATOM   5311  O  O     . ALA C 2  228  ? 5.511   -45.543 29.475  1.00 123.90 ? 228  ALA C O     1 
ATOM   5312  C  CB    . ALA C 2  228  ? 2.379   -45.092 29.655  1.00 119.95 ? 228  ALA C CB    1 
ATOM   5313  N  N     . MET C 2  229  ? 5.132   -44.041 31.111  1.00 131.31 ? 229  MET C N     1 
ATOM   5314  C  CA    . MET C 2  229  ? 6.420   -43.369 30.966  1.00 132.16 ? 229  MET C CA    1 
ATOM   5315  C  C     . MET C 2  229  ? 7.550   -44.194 31.573  1.00 126.04 ? 229  MET C C     1 
ATOM   5316  O  O     . MET C 2  229  ? 7.336   -44.971 32.504  1.00 120.41 ? 229  MET C O     1 
ATOM   5317  C  CB    . MET C 2  229  ? 6.391   -41.998 31.650  1.00 130.00 ? 229  MET C CB    1 
ATOM   5318  C  CG    . MET C 2  229  ? 5.299   -41.055 31.170  1.00 132.60 ? 229  MET C CG    1 
ATOM   5319  S  SD    . MET C 2  229  ? 5.171   -39.579 32.206  1.00 125.03 ? 229  MET C SD    1 
ATOM   5320  C  CE    . MET C 2  229  ? 3.769   -38.749 31.462  1.00 107.72 ? 229  MET C CE    1 
ATOM   5321  N  N     . ARG C 2  230  ? 8.753   -44.021 31.035  1.00 125.83 ? 230  ARG C N     1 
ATOM   5322  C  CA    . ARG C 2  230  ? 9.959   -44.539 31.666  1.00 124.70 ? 230  ARG C CA    1 
ATOM   5323  C  C     . ARG C 2  230  ? 10.136  -43.731 32.949  1.00 125.38 ? 230  ARG C C     1 
ATOM   5324  O  O     . ARG C 2  230  ? 9.663   -42.596 33.024  1.00 127.51 ? 230  ARG C O     1 
ATOM   5325  C  CB    . ARG C 2  230  ? 11.161  -44.340 30.736  1.00 121.10 ? 230  ARG C CB    1 
ATOM   5326  C  CG    . ARG C 2  230  ? 12.188  -45.462 30.767  1.00 114.85 ? 230  ARG C CG    1 
ATOM   5327  C  CD    . ARG C 2  230  ? 11.637  -46.736 30.147  1.00 110.74 ? 230  ARG C CD    1 
ATOM   5328  N  NE    . ARG C 2  230  ? 12.207  -47.933 30.760  1.00 113.77 ? 230  ARG C NE    1 
ATOM   5329  C  CZ    . ARG C 2  230  ? 11.603  -48.644 31.707  1.00 106.01 ? 230  ARG C CZ    1 
ATOM   5330  N  NH1   . ARG C 2  230  ? 10.405  -48.285 32.146  1.00 105.07 ? 230  ARG C NH1   1 
ATOM   5331  N  NH2   . ARG C 2  230  ? 12.194  -49.718 32.212  1.00 95.93  ? 230  ARG C NH2   1 
ATOM   5332  N  N     . PRO C 2  231  ? 10.788  -44.312 33.973  1.00 120.69 ? 231  PRO C N     1 
ATOM   5333  C  CA    . PRO C 2  231  ? 11.040  -43.570 35.216  1.00 111.99 ? 231  PRO C CA    1 
ATOM   5334  C  C     . PRO C 2  231  ? 11.674  -42.199 34.973  1.00 118.91 ? 231  PRO C C     1 
ATOM   5335  O  O     . PRO C 2  231  ? 11.271  -41.220 35.602  1.00 121.92 ? 231  PRO C O     1 
ATOM   5336  C  CB    . PRO C 2  231  ? 12.014  -44.480 35.964  1.00 108.98 ? 231  PRO C CB    1 
ATOM   5337  C  CG    . PRO C 2  231  ? 11.627  -45.848 35.531  1.00 108.60 ? 231  PRO C CG    1 
ATOM   5338  C  CD    . PRO C 2  231  ? 11.196  -45.724 34.090  1.00 117.90 ? 231  PRO C CD    1 
ATOM   5339  N  N     . GLU C 2  232  ? 12.632  -42.130 34.054  1.00 120.80 ? 232  GLU C N     1 
ATOM   5340  C  CA    . GLU C 2  232  ? 13.301  -40.872 33.736  1.00 116.68 ? 232  GLU C CA    1 
ATOM   5341  C  C     . GLU C 2  232  ? 12.370  -39.940 32.961  1.00 114.98 ? 232  GLU C C     1 
ATOM   5342  O  O     . GLU C 2  232  ? 12.454  -38.712 33.080  1.00 110.95 ? 232  GLU C O     1 
ATOM   5343  C  CB    . GLU C 2  232  ? 14.582  -41.137 32.944  1.00 111.25 ? 232  GLU C CB    1 
ATOM   5344  C  CG    . GLU C 2  232  ? 15.369  -42.351 33.428  1.00 118.42 ? 232  GLU C CG    1 
ATOM   5345  C  CD    . GLU C 2  232  ? 15.669  -42.309 34.918  1.00 126.52 ? 232  GLU C CD    1 
ATOM   5346  O  OE1   . GLU C 2  232  ? 14.893  -42.899 35.702  1.00 120.46 ? 232  GLU C OE1   1 
ATOM   5347  O  OE2   . GLU C 2  232  ? 16.683  -41.692 35.307  1.00 127.74 ? 232  GLU C OE2   1 
ATOM   5348  N  N     . GLU C 2  233  ? 11.478  -40.531 32.171  1.00 121.44 ? 233  GLU C N     1 
ATOM   5349  C  CA    . GLU C 2  233  ? 10.455  -39.765 31.468  1.00 129.09 ? 233  GLU C CA    1 
ATOM   5350  C  C     . GLU C 2  233  ? 9.472   -39.159 32.467  1.00 123.93 ? 233  GLU C C     1 
ATOM   5351  O  O     . GLU C 2  233  ? 8.870   -38.117 32.210  1.00 122.25 ? 233  GLU C O     1 
ATOM   5352  C  CB    . GLU C 2  233  ? 9.717   -40.632 30.444  1.00 132.02 ? 233  GLU C CB    1 
ATOM   5353  C  CG    . GLU C 2  233  ? 10.577  -41.093 29.277  1.00 127.06 ? 233  GLU C CG    1 
ATOM   5354  C  CD    . GLU C 2  233  ? 9.771   -41.799 28.203  1.00 128.09 ? 233  GLU C CD    1 
ATOM   5355  O  OE1   . GLU C 2  233  ? 8.701   -41.278 27.821  1.00 125.23 ? 233  GLU C OE1   1 
ATOM   5356  O  OE2   . GLU C 2  233  ? 10.204  -42.878 27.745  1.00 119.77 ? 233  GLU C OE2   1 
ATOM   5357  N  N     . ALA C 2  234  ? 9.314   -39.823 33.607  1.00 121.79 ? 234  ALA C N     1 
ATOM   5358  C  CA    . ALA C 2  234  ? 8.512   -39.282 34.696  1.00 117.50 ? 234  ALA C CA    1 
ATOM   5359  C  C     . ALA C 2  234  ? 9.309   -38.206 35.425  1.00 115.35 ? 234  ALA C C     1 
ATOM   5360  O  O     . ALA C 2  234  ? 8.741   -37.236 35.930  1.00 111.12 ? 234  ALA C O     1 
ATOM   5361  C  CB    . ALA C 2  234  ? 8.096   -40.385 35.654  1.00 110.32 ? 234  ALA C CB    1 
ATOM   5362  N  N     . LEU C 2  235  ? 10.628  -38.384 35.476  1.00 114.04 ? 235  LEU C N     1 
ATOM   5363  C  CA    . LEU C 2  235  ? 11.512  -37.377 36.056  1.00 103.70 ? 235  LEU C CA    1 
ATOM   5364  C  C     . LEU C 2  235  ? 11.375  -36.051 35.319  1.00 105.66 ? 235  LEU C C     1 
ATOM   5365  O  O     . LEU C 2  235  ? 11.095  -35.022 35.933  1.00 105.58 ? 235  LEU C O     1 
ATOM   5366  C  CB    . LEU C 2  235  ? 12.975  -37.832 36.023  1.00 108.69 ? 235  LEU C CB    1 
ATOM   5367  C  CG    . LEU C 2  235  ? 13.620  -38.382 37.299  1.00 107.98 ? 235  LEU C CG    1 
ATOM   5368  C  CD1   . LEU C 2  235  ? 13.515  -39.896 37.363  1.00 113.01 ? 235  LEU C CD1   1 
ATOM   5369  C  CD2   . LEU C 2  235  ? 15.074  -37.942 37.394  1.00 87.51  ? 235  LEU C CD2   1 
ATOM   5370  N  N     . ILE C 2  236  ? 11.568  -36.081 34.002  1.00 116.28 ? 236  ILE C N     1 
ATOM   5371  C  CA    . ILE C 2  236  ? 11.503  -34.859 33.196  1.00 119.80 ? 236  ILE C CA    1 
ATOM   5372  C  C     . ILE C 2  236  ? 10.121  -34.196 33.240  1.00 116.43 ? 236  ILE C C     1 
ATOM   5373  O  O     . ILE C 2  236  ? 10.015  -32.968 33.288  1.00 110.25 ? 236  ILE C O     1 
ATOM   5374  C  CB    . ILE C 2  236  ? 11.966  -35.100 31.729  1.00 124.53 ? 236  ILE C CB    1 
ATOM   5375  C  CG1   . ILE C 2  236  ? 11.691  -33.872 30.852  1.00 122.52 ? 236  ILE C CG1   1 
ATOM   5376  C  CG2   . ILE C 2  236  ? 11.311  -36.339 31.151  1.00 127.75 ? 236  ILE C CG2   1 
ATOM   5377  C  CD1   . ILE C 2  236  ? 10.512  -34.015 29.893  1.00 119.54 ? 236  ILE C CD1   1 
ATOM   5378  N  N     . ARG C 2  237  ? 9.071   -35.013 33.236  1.00 119.19 ? 237  ARG C N     1 
ATOM   5379  C  CA    . ARG C 2  237  ? 7.700   -34.517 33.314  1.00 116.54 ? 237  ARG C CA    1 
ATOM   5380  C  C     . ARG C 2  237  ? 7.488   -33.704 34.589  1.00 114.21 ? 237  ARG C C     1 
ATOM   5381  O  O     . ARG C 2  237  ? 6.718   -32.743 34.608  1.00 117.26 ? 237  ARG C O     1 
ATOM   5382  C  CB    . ARG C 2  237  ? 6.709   -35.685 33.244  1.00 113.83 ? 237  ARG C CB    1 
ATOM   5383  C  CG    . ARG C 2  237  ? 5.265   -35.335 33.591  1.00 111.56 ? 237  ARG C CG    1 
ATOM   5384  C  CD    . ARG C 2  237  ? 4.691   -34.267 32.674  1.00 110.42 ? 237  ARG C CD    1 
ATOM   5385  N  NE    . ARG C 2  237  ? 3.350   -33.867 33.091  1.00 105.55 ? 237  ARG C NE    1 
ATOM   5386  C  CZ    . ARG C 2  237  ? 2.702   -32.808 32.616  1.00 100.22 ? 237  ARG C CZ    1 
ATOM   5387  N  NH1   . ARG C 2  237  ? 1.484   -32.522 33.055  1.00 96.47  ? 237  ARG C NH1   1 
ATOM   5388  N  NH2   . ARG C 2  237  ? 3.272   -32.031 31.705  1.00 96.28  ? 237  ARG C NH2   1 
ATOM   5389  N  N     . LEU C 2  238  ? 8.193   -34.087 35.647  1.00 107.71 ? 238  LEU C N     1 
ATOM   5390  C  CA    . LEU C 2  238  ? 8.086   -33.398 36.926  1.00 113.35 ? 238  LEU C CA    1 
ATOM   5391  C  C     . LEU C 2  238  ? 8.860   -32.079 36.934  1.00 119.17 ? 238  LEU C C     1 
ATOM   5392  O  O     . LEU C 2  238  ? 8.406   -31.086 37.507  1.00 118.10 ? 238  LEU C O     1 
ATOM   5393  C  CB    . LEU C 2  238  ? 8.578   -34.307 38.056  1.00 111.20 ? 238  LEU C CB    1 
ATOM   5394  C  CG    . LEU C 2  238  ? 8.320   -33.819 39.482  1.00 111.08 ? 238  LEU C CG    1 
ATOM   5395  C  CD1   . LEU C 2  238  ? 6.835   -33.583 39.693  1.00 109.31 ? 238  LEU C CD1   1 
ATOM   5396  C  CD2   . LEU C 2  238  ? 8.856   -34.815 40.500  1.00 85.54  ? 238  LEU C CD2   1 
ATOM   5397  N  N     . PHE C 2  239  ? 10.025  -32.076 36.291  1.00 113.89 ? 239  PHE C N     1 
ATOM   5398  C  CA    . PHE C 2  239  ? 10.927  -30.925 36.313  1.00 100.63 ? 239  PHE C CA    1 
ATOM   5399  C  C     . PHE C 2  239  ? 10.329  -29.678 35.665  1.00 108.73 ? 239  PHE C C     1 
ATOM   5400  O  O     . PHE C 2  239  ? 10.560  -28.561 36.127  1.00 108.78 ? 239  PHE C O     1 
ATOM   5401  C  CB    . PHE C 2  239  ? 12.256  -31.281 35.643  1.00 96.02  ? 239  PHE C CB    1 
ATOM   5402  C  CG    . PHE C 2  239  ? 13.330  -30.248 35.833  1.00 104.76 ? 239  PHE C CG    1 
ATOM   5403  C  CD1   . PHE C 2  239  ? 13.567  -29.284 34.866  1.00 110.88 ? 239  PHE C CD1   1 
ATOM   5404  C  CD2   . PHE C 2  239  ? 14.107  -30.243 36.979  1.00 100.83 ? 239  PHE C CD2   1 
ATOM   5405  C  CE1   . PHE C 2  239  ? 14.558  -28.335 35.040  1.00 108.26 ? 239  PHE C CE1   1 
ATOM   5406  C  CE2   . PHE C 2  239  ? 15.100  -29.296 37.158  1.00 98.71  ? 239  PHE C CE2   1 
ATOM   5407  C  CZ    . PHE C 2  239  ? 15.326  -28.343 36.187  1.00 100.51 ? 239  PHE C CZ    1 
ATOM   5408  N  N     . THR C 2  240  ? 9.569   -29.870 34.591  1.00 117.19 ? 240  THR C N     1 
ATOM   5409  C  CA    . THR C 2  240  ? 8.919   -28.755 33.908  1.00 119.67 ? 240  THR C CA    1 
ATOM   5410  C  C     . THR C 2  240  ? 7.805   -28.168 34.767  1.00 121.20 ? 240  THR C C     1 
ATOM   5411  O  O     . THR C 2  240  ? 7.564   -26.960 34.748  1.00 122.65 ? 240  THR C O     1 
ATOM   5412  C  CB    . THR C 2  240  ? 8.333   -29.179 32.547  1.00 117.51 ? 240  THR C CB    1 
ATOM   5413  O  OG1   . THR C 2  240  ? 7.371   -30.224 32.739  1.00 118.49 ? 240  THR C OG1   1 
ATOM   5414  C  CG2   . THR C 2  240  ? 9.432   -29.671 31.621  1.00 116.47 ? 240  THR C CG2   1 
ATOM   5415  N  N     . LEU C 2  241  ? 7.130   -29.033 35.517  1.00 122.29 ? 241  LEU C N     1 
ATOM   5416  C  CA    . LEU C 2  241  ? 6.032   -28.613 36.379  1.00 121.24 ? 241  LEU C CA    1 
ATOM   5417  C  C     . LEU C 2  241  ? 6.520   -27.782 37.560  1.00 122.72 ? 241  LEU C C     1 
ATOM   5418  O  O     . LEU C 2  241  ? 5.877   -26.808 37.946  1.00 121.68 ? 241  LEU C O     1 
ATOM   5419  C  CB    . LEU C 2  241  ? 5.251   -29.827 36.885  1.00 114.24 ? 241  LEU C CB    1 
ATOM   5420  C  CG    . LEU C 2  241  ? 4.382   -30.549 35.856  1.00 115.80 ? 241  LEU C CG    1 
ATOM   5421  C  CD1   . LEU C 2  241  ? 3.736   -31.779 36.471  1.00 111.10 ? 241  LEU C CD1   1 
ATOM   5422  C  CD2   . LEU C 2  241  ? 3.325   -29.606 35.300  1.00 114.12 ? 241  LEU C CD2   1 
ATOM   5423  N  N     . LEU C 2  242  ? 7.660   -28.169 38.125  1.00 123.77 ? 242  LEU C N     1 
ATOM   5424  C  CA    . LEU C 2  242  ? 8.191   -27.503 39.313  1.00 127.12 ? 242  LEU C CA    1 
ATOM   5425  C  C     . LEU C 2  242  ? 8.816   -26.139 39.019  1.00 124.95 ? 242  LEU C C     1 
ATOM   5426  O  O     . LEU C 2  242  ? 8.564   -25.169 39.735  1.00 119.22 ? 242  LEU C O     1 
ATOM   5427  C  CB    . LEU C 2  242  ? 9.188   -28.404 40.050  1.00 119.69 ? 242  LEU C CB    1 
ATOM   5428  C  CG    . LEU C 2  242  ? 8.616   -29.244 41.196  1.00 111.59 ? 242  LEU C CG    1 
ATOM   5429  C  CD1   . LEU C 2  242  ? 8.085   -28.348 42.305  1.00 107.95 ? 242  LEU C CD1   1 
ATOM   5430  C  CD2   . LEU C 2  242  ? 7.527   -30.180 40.703  1.00 108.61 ? 242  LEU C CD2   1 
ATOM   5431  N  N     . ARG C 2  243  ? 9.635   -26.063 37.975  1.00 125.83 ? 243  ARG C N     1 
ATOM   5432  C  CA    . ARG C 2  243  ? 10.244  -24.791 37.598  1.00 124.07 ? 243  ARG C CA    1 
ATOM   5433  C  C     . ARG C 2  243  ? 10.145  -24.472 36.106  1.00 117.21 ? 243  ARG C C     1 
ATOM   5434  O  O     . ARG C 2  243  ? 11.041  -24.808 35.329  1.00 109.72 ? 243  ARG C O     1 
ATOM   5435  C  CB    . ARG C 2  243  ? 11.697  -24.701 38.083  1.00 119.81 ? 243  ARG C CB    1 
ATOM   5436  C  CG    . ARG C 2  243  ? 12.542  -25.937 37.832  1.00 111.41 ? 243  ARG C CG    1 
ATOM   5437  C  CD    . ARG C 2  243  ? 14.018  -25.585 37.902  1.00 113.58 ? 243  ARG C CD    1 
ATOM   5438  N  NE    . ARG C 2  243  ? 14.362  -24.902 39.145  1.00 106.79 ? 243  ARG C NE    1 
ATOM   5439  C  CZ    . ARG C 2  243  ? 15.464  -24.180 39.318  1.00 101.86 ? 243  ARG C CZ    1 
ATOM   5440  N  NH1   . ARG C 2  243  ? 15.698  -23.593 40.483  1.00 95.18  ? 243  ARG C NH1   1 
ATOM   5441  N  NH2   . ARG C 2  243  ? 16.330  -24.039 38.323  1.00 106.79 ? 243  ARG C NH2   1 
ATOM   5442  N  N     . PRO C 2  244  ? 9.042   -23.824 35.702  1.00 116.70 ? 244  PRO C N     1 
ATOM   5443  C  CA    . PRO C 2  244  ? 8.916   -23.301 34.339  1.00 114.02 ? 244  PRO C CA    1 
ATOM   5444  C  C     . PRO C 2  244  ? 9.969   -22.227 34.104  1.00 109.14 ? 244  PRO C C     1 
ATOM   5445  O  O     . PRO C 2  244  ? 10.233  -21.426 35.000  1.00 112.76 ? 244  PRO C O     1 
ATOM   5446  C  CB    . PRO C 2  244  ? 7.520   -22.669 34.334  1.00 114.33 ? 244  PRO C CB    1 
ATOM   5447  C  CG    . PRO C 2  244  ? 6.790   -23.330 35.456  1.00 106.20 ? 244  PRO C CG    1 
ATOM   5448  C  CD    . PRO C 2  244  ? 7.826   -23.591 36.499  1.00 109.41 ? 244  PRO C CD    1 
ATOM   5449  N  N     . GLY C 2  245  ? 10.562  -22.208 32.916  1.00 107.98 ? 245  GLY C N     1 
ATOM   5450  C  CA    . GLY C 2  245  ? 11.606  -21.247 32.615  1.00 111.66 ? 245  GLY C CA    1 
ATOM   5451  C  C     . GLY C 2  245  ? 12.992  -21.859 32.662  1.00 115.04 ? 245  GLY C C     1 
ATOM   5452  O  O     . GLY C 2  245  ? 13.996  -21.152 32.569  1.00 111.51 ? 245  GLY C O     1 
ATOM   5453  N  N     . ASP C 2  246  ? 13.048  -23.177 32.818  1.00 115.27 ? 246  ASP C N     1 
ATOM   5454  C  CA    . ASP C 2  246  ? 14.309  -23.898 32.713  1.00 118.73 ? 246  ASP C CA    1 
ATOM   5455  C  C     . ASP C 2  246  ? 14.108  -25.086 31.779  1.00 116.04 ? 246  ASP C C     1 
ATOM   5456  O  O     . ASP C 2  246  ? 13.069  -25.748 31.828  1.00 108.49 ? 246  ASP C O     1 
ATOM   5457  C  CB    . ASP C 2  246  ? 14.759  -24.379 34.096  1.00 122.38 ? 246  ASP C CB    1 
ATOM   5458  C  CG    . ASP C 2  246  ? 16.206  -24.846 34.116  1.00 119.64 ? 246  ASP C CG    1 
ATOM   5459  O  OD1   . ASP C 2  246  ? 16.459  -26.024 33.785  1.00 118.64 ? 246  ASP C OD1   1 
ATOM   5460  O  OD2   . ASP C 2  246  ? 17.089  -24.036 34.471  1.00 116.34 ? 246  ASP C OD2   1 
ATOM   5461  N  N     . PRO C 2  247  ? 15.104  -25.364 30.925  1.00 123.90 ? 247  PRO C N     1 
ATOM   5462  C  CA    . PRO C 2  247  ? 15.003  -26.502 30.008  1.00 120.23 ? 247  PRO C CA    1 
ATOM   5463  C  C     . PRO C 2  247  ? 15.188  -27.820 30.744  1.00 115.92 ? 247  PRO C C     1 
ATOM   5464  O  O     . PRO C 2  247  ? 16.022  -27.894 31.648  1.00 116.99 ? 247  PRO C O     1 
ATOM   5465  C  CB    . PRO C 2  247  ? 16.163  -26.271 29.038  1.00 113.66 ? 247  PRO C CB    1 
ATOM   5466  C  CG    . PRO C 2  247  ? 17.153  -25.480 29.819  1.00 108.27 ? 247  PRO C CG    1 
ATOM   5467  C  CD    . PRO C 2  247  ? 16.343  -24.593 30.720  1.00 115.96 ? 247  PRO C CD    1 
ATOM   5468  N  N     . PRO C 2  248  ? 14.416  -28.849 30.369  1.00 108.41 ? 248  PRO C N     1 
ATOM   5469  C  CA    . PRO C 2  248  ? 14.680  -30.166 30.948  1.00 101.84 ? 248  PRO C CA    1 
ATOM   5470  C  C     . PRO C 2  248  ? 16.079  -30.618 30.562  1.00 100.93 ? 248  PRO C C     1 
ATOM   5471  O  O     . PRO C 2  248  ? 16.428  -30.604 29.383  1.00 111.22 ? 248  PRO C O     1 
ATOM   5472  C  CB    . PRO C 2  248  ? 13.643  -31.056 30.265  1.00 100.84 ? 248  PRO C CB    1 
ATOM   5473  C  CG    . PRO C 2  248  ? 12.541  -30.131 29.889  1.00 104.90 ? 248  PRO C CG    1 
ATOM   5474  C  CD    . PRO C 2  248  ? 13.209  -28.841 29.526  1.00 106.32 ? 248  PRO C CD    1 
ATOM   5475  N  N     . LYS C 2  249  ? 16.867  -31.015 31.551  1.00 94.98  ? 249  LYS C N     1 
ATOM   5476  C  CA    . LYS C 2  249  ? 18.221  -31.485 31.311  1.00 99.57  ? 249  LYS C CA    1 
ATOM   5477  C  C     . LYS C 2  249  ? 18.481  -32.675 32.213  1.00 100.31 ? 249  LYS C C     1 
ATOM   5478  O  O     . LYS C 2  249  ? 18.296  -32.584 33.423  1.00 105.52 ? 249  LYS C O     1 
ATOM   5479  C  CB    . LYS C 2  249  ? 19.237  -30.379 31.608  1.00 112.03 ? 249  LYS C CB    1 
ATOM   5480  C  CG    . LYS C 2  249  ? 19.195  -29.195 30.652  1.00 113.50 ? 249  LYS C CG    1 
ATOM   5481  C  CD    . LYS C 2  249  ? 20.163  -28.105 31.094  1.00 102.25 ? 249  LYS C CD    1 
ATOM   5482  C  CE    . LYS C 2  249  ? 20.372  -27.064 30.004  1.00 82.02  ? 249  LYS C CE    1 
ATOM   5483  N  NZ    . LYS C 2  249  ? 21.310  -25.988 30.434  1.00 59.73  ? 249  LYS C NZ    1 
ATOM   5484  N  N     . ARG C 2  250  ? 18.930  -33.781 31.631  1.00 104.50 ? 250  ARG C N     1 
ATOM   5485  C  CA    . ARG C 2  250  ? 19.206  -34.992 32.399  1.00 105.88 ? 250  ARG C CA    1 
ATOM   5486  C  C     . ARG C 2  250  ? 20.261  -34.742 33.480  1.00 109.47 ? 250  ARG C C     1 
ATOM   5487  O  O     . ARG C 2  250  ? 20.257  -35.392 34.525  1.00 106.36 ? 250  ARG C O     1 
ATOM   5488  C  CB    . ARG C 2  250  ? 19.629  -36.132 31.467  1.00 115.22 ? 250  ARG C CB    1 
ATOM   5489  C  CG    . ARG C 2  250  ? 19.876  -37.473 32.148  1.00 106.25 ? 250  ARG C CG    1 
ATOM   5490  C  CD    . ARG C 2  250  ? 18.780  -37.819 33.149  1.00 99.72  ? 250  ARG C CD    1 
ATOM   5491  N  NE    . ARG C 2  250  ? 18.898  -39.183 33.664  1.00 109.59 ? 250  ARG C NE    1 
ATOM   5492  C  CZ    . ARG C 2  250  ? 19.889  -39.619 34.440  1.00 111.54 ? 250  ARG C CZ    1 
ATOM   5493  N  NH1   . ARG C 2  250  ? 20.878  -38.805 34.795  1.00 101.01 ? 250  ARG C NH1   1 
ATOM   5494  N  NH2   . ARG C 2  250  ? 19.895  -40.880 34.855  1.00 118.44 ? 250  ARG C NH2   1 
ATOM   5495  N  N     . ASP C 2  251  ? 21.155  -33.790 33.228  1.00 114.73 ? 251  ASP C N     1 
ATOM   5496  C  CA    . ASP C 2  251  ? 22.148  -33.393 34.221  1.00 114.63 ? 251  ASP C CA    1 
ATOM   5497  C  C     . ASP C 2  251  ? 21.557  -32.490 35.306  1.00 114.19 ? 251  ASP C C     1 
ATOM   5498  O  O     . ASP C 2  251  ? 21.795  -32.700 36.495  1.00 106.67 ? 251  ASP C O     1 
ATOM   5499  C  CB    . ASP C 2  251  ? 23.330  -32.694 33.542  1.00 112.85 ? 251  ASP C CB    1 
ATOM   5500  C  CG    . ASP C 2  251  ? 23.914  -33.512 32.409  1.00 118.74 ? 251  ASP C CG    1 
ATOM   5501  O  OD1   . ASP C 2  251  ? 23.826  -34.757 32.465  1.00 118.92 ? 251  ASP C OD1   1 
ATOM   5502  O  OD2   . ASP C 2  251  ? 24.462  -32.910 31.463  1.00 118.78 ? 251  ASP C OD2   1 
ATOM   5503  N  N     . LYS C 2  252  ? 20.795  -31.481 34.890  1.00 114.51 ? 252  LYS C N     1 
ATOM   5504  C  CA    . LYS C 2  252  ? 20.233  -30.505 35.826  1.00 107.49 ? 252  LYS C CA    1 
ATOM   5505  C  C     . LYS C 2  252  ? 18.976  -30.991 36.556  1.00 104.78 ? 252  LYS C C     1 
ATOM   5506  O  O     . LYS C 2  252  ? 18.755  -30.634 37.714  1.00 103.06 ? 252  LYS C O     1 
ATOM   5507  C  CB    . LYS C 2  252  ? 19.958  -29.168 35.126  1.00 106.12 ? 252  LYS C CB    1 
ATOM   5508  C  CG    . LYS C 2  252  ? 19.678  -28.018 36.084  1.00 105.70 ? 252  LYS C CG    1 
ATOM   5509  C  CD    . LYS C 2  252  ? 19.603  -26.680 35.366  1.00 105.71 ? 252  LYS C CD    1 
ATOM   5510  C  CE    . LYS C 2  252  ? 19.420  -25.543 36.361  1.00 94.69  ? 252  LYS C CE    1 
ATOM   5511  N  NZ    . LYS C 2  252  ? 19.337  -24.212 35.700  1.00 85.15  ? 252  LYS C NZ    1 
ATOM   5512  N  N     . ALA C 2  253  ? 18.159  -31.799 35.884  1.00 105.25 ? 253  ALA C N     1 
ATOM   5513  C  CA    . ALA C 2  253  ? 16.898  -32.261 36.469  1.00 99.07  ? 253  ALA C CA    1 
ATOM   5514  C  C     . ALA C 2  253  ? 17.106  -33.232 37.625  1.00 101.12 ? 253  ALA C C     1 
ATOM   5515  O  O     . ALA C 2  253  ? 16.443  -33.126 38.656  1.00 102.97 ? 253  ALA C O     1 
ATOM   5516  C  CB    . ALA C 2  253  ? 15.995  -32.879 35.410  1.00 97.85  ? 253  ALA C CB    1 
ATOM   5517  N  N     . VAL C 2  254  ? 18.016  -34.183 37.445  1.00 99.00  ? 254  VAL C N     1 
ATOM   5518  C  CA    . VAL C 2  254  ? 18.336  -35.133 38.503  1.00 97.48  ? 254  VAL C CA    1 
ATOM   5519  C  C     . VAL C 2  254  ? 19.001  -34.410 39.672  1.00 103.36 ? 254  VAL C C     1 
ATOM   5520  O  O     . VAL C 2  254  ? 18.723  -34.704 40.834  1.00 104.17 ? 254  VAL C O     1 
ATOM   5521  C  CB    . VAL C 2  254  ? 19.255  -36.262 37.994  1.00 90.63  ? 254  VAL C CB    1 
ATOM   5522  C  CG1   . VAL C 2  254  ? 19.653  -37.185 39.135  1.00 88.54  ? 254  VAL C CG1   1 
ATOM   5523  C  CG2   . VAL C 2  254  ? 18.568  -37.046 36.891  1.00 96.72  ? 254  VAL C CG2   1 
ATOM   5524  N  N     . ALA C 2  255  ? 19.863  -33.448 39.353  1.00 101.98 ? 255  ALA C N     1 
ATOM   5525  C  CA    . ALA C 2  255  ? 20.573  -32.678 40.371  1.00 96.95  ? 255  ALA C CA    1 
ATOM   5526  C  C     . ALA C 2  255  ? 19.626  -31.837 41.228  1.00 96.24  ? 255  ALA C C     1 
ATOM   5527  O  O     . ALA C 2  255  ? 19.857  -31.658 42.424  1.00 91.23  ? 255  ALA C O     1 
ATOM   5528  C  CB    . ALA C 2  255  ? 21.633  -31.796 39.723  1.00 94.66  ? 255  ALA C CB    1 
ATOM   5529  N  N     . TYR C 2  256  ? 18.564  -31.323 40.615  1.00 91.76  ? 256  TYR C N     1 
ATOM   5530  C  CA    . TYR C 2  256  ? 17.589  -30.508 41.334  1.00 84.96  ? 256  TYR C CA    1 
ATOM   5531  C  C     . TYR C 2  256  ? 16.733  -31.344 42.278  1.00 82.71  ? 256  TYR C C     1 
ATOM   5532  O  O     . TYR C 2  256  ? 16.582  -31.005 43.450  1.00 86.02  ? 256  TYR C O     1 
ATOM   5533  C  CB    . TYR C 2  256  ? 16.691  -29.743 40.359  1.00 93.00  ? 256  TYR C CB    1 
ATOM   5534  C  CG    . TYR C 2  256  ? 15.525  -29.035 41.020  1.00 89.32  ? 256  TYR C CG    1 
ATOM   5535  C  CD1   . TYR C 2  256  ? 15.691  -27.794 41.620  1.00 91.03  ? 256  TYR C CD1   1 
ATOM   5536  C  CD2   . TYR C 2  256  ? 14.258  -29.607 41.037  1.00 83.84  ? 256  TYR C CD2   1 
ATOM   5537  C  CE1   . TYR C 2  256  ? 14.628  -27.143 42.223  1.00 100.19 ? 256  TYR C CE1   1 
ATOM   5538  C  CE2   . TYR C 2  256  ? 13.190  -28.964 41.638  1.00 89.72  ? 256  TYR C CE2   1 
ATOM   5539  C  CZ    . TYR C 2  256  ? 13.380  -27.733 42.229  1.00 97.55  ? 256  TYR C CZ    1 
ATOM   5540  O  OH    . TYR C 2  256  ? 12.320  -27.090 42.827  1.00 89.38  ? 256  TYR C OH    1 
ATOM   5541  N  N     . VAL C 2  257  ? 16.172  -32.433 41.763  1.00 83.46  ? 257  VAL C N     1 
ATOM   5542  C  CA    . VAL C 2  257  ? 15.277  -33.272 42.556  1.00 83.90  ? 257  VAL C CA    1 
ATOM   5543  C  C     . VAL C 2  257  ? 16.037  -34.017 43.652  1.00 84.70  ? 257  VAL C C     1 
ATOM   5544  O  O     . VAL C 2  257  ? 15.456  -34.407 44.665  1.00 78.65  ? 257  VAL C O     1 
ATOM   5545  C  CB    . VAL C 2  257  ? 14.475  -34.262 41.676  1.00 77.08  ? 257  VAL C CB    1 
ATOM   5546  C  CG1   . VAL C 2  257  ? 15.131  -35.638 41.659  1.00 81.53  ? 257  VAL C CG1   1 
ATOM   5547  C  CG2   . VAL C 2  257  ? 13.041  -34.362 42.169  1.00 52.63  ? 257  VAL C CG2   1 
ATOM   5548  N  N     . TYR C 2  258  ? 17.340  -34.197 43.450  1.00 88.88  ? 258  TYR C N     1 
ATOM   5549  C  CA    . TYR C 2  258  ? 18.192  -34.803 44.464  1.00 84.68  ? 258  TYR C CA    1 
ATOM   5550  C  C     . TYR C 2  258  ? 18.363  -33.833 45.624  1.00 86.68  ? 258  TYR C C     1 
ATOM   5551  O  O     . TYR C 2  258  ? 18.271  -34.220 46.789  1.00 86.48  ? 258  TYR C O     1 
ATOM   5552  C  CB    . TYR C 2  258  ? 19.557  -35.162 43.875  1.00 82.21  ? 258  TYR C CB    1 
ATOM   5553  C  CG    . TYR C 2  258  ? 20.562  -35.657 44.892  1.00 82.50  ? 258  TYR C CG    1 
ATOM   5554  C  CD1   . TYR C 2  258  ? 21.591  -34.836 45.339  1.00 81.02  ? 258  TYR C CD1   1 
ATOM   5555  C  CD2   . TYR C 2  258  ? 20.484  -36.945 45.405  1.00 79.48  ? 258  TYR C CD2   1 
ATOM   5556  C  CE1   . TYR C 2  258  ? 22.514  -35.284 46.266  1.00 70.06  ? 258  TYR C CE1   1 
ATOM   5557  C  CE2   . TYR C 2  258  ? 21.401  -37.401 46.334  1.00 79.43  ? 258  TYR C CE2   1 
ATOM   5558  C  CZ    . TYR C 2  258  ? 22.413  -36.568 46.761  1.00 75.45  ? 258  TYR C CZ    1 
ATOM   5559  O  OH    . TYR C 2  258  ? 23.327  -37.021 47.684  1.00 76.16  ? 258  TYR C OH    1 
ATOM   5560  N  N     . GLY C 2  259  ? 18.601  -32.568 45.292  1.00 89.15  ? 259  GLY C N     1 
ATOM   5561  C  CA    . GLY C 2  259  ? 18.797  -31.533 46.290  1.00 89.57  ? 259  GLY C CA    1 
ATOM   5562  C  C     . GLY C 2  259  ? 17.535  -31.198 47.060  1.00 82.91  ? 259  GLY C C     1 
ATOM   5563  O  O     . GLY C 2  259  ? 17.596  -30.703 48.184  1.00 84.79  ? 259  GLY C O     1 
ATOM   5564  N  N     . LEU C 2  260  ? 16.387  -31.461 46.448  1.00 76.82  ? 260  LEU C N     1 
ATOM   5565  C  CA    . LEU C 2  260  ? 15.106  -31.184 47.084  1.00 77.41  ? 260  LEU C CA    1 
ATOM   5566  C  C     . LEU C 2  260  ? 14.733  -32.263 48.100  1.00 77.65  ? 260  LEU C C     1 
ATOM   5567  O  O     . LEU C 2  260  ? 14.187  -31.963 49.162  1.00 76.24  ? 260  LEU C O     1 
ATOM   5568  C  CB    . LEU C 2  260  ? 14.006  -31.047 46.029  1.00 79.42  ? 260  LEU C CB    1 
ATOM   5569  C  CG    . LEU C 2  260  ? 12.687  -30.424 46.488  1.00 70.07  ? 260  LEU C CG    1 
ATOM   5570  C  CD1   . LEU C 2  260  ? 12.889  -28.967 46.879  1.00 79.82  ? 260  LEU C CD1   1 
ATOM   5571  C  CD2   . LEU C 2  260  ? 11.625  -30.553 45.405  1.00 55.64  ? 260  LEU C CD2   1 
ATOM   5572  N  N     . ILE C 2  261  ? 15.030  -33.518 47.770  1.00 78.49  ? 261  ILE C N     1 
ATOM   5573  C  CA    . ILE C 2  261  ? 14.619  -34.652 48.599  1.00 69.93  ? 261  ILE C CA    1 
ATOM   5574  C  C     . ILE C 2  261  ? 15.772  -35.478 49.186  1.00 72.01  ? 261  ILE C C     1 
ATOM   5575  O  O     . ILE C 2  261  ? 15.921  -35.559 50.404  1.00 82.36  ? 261  ILE C O     1 
ATOM   5576  C  CB    . ILE C 2  261  ? 13.610  -35.577 47.868  1.00 61.32  ? 261  ILE C CB    1 
ATOM   5577  C  CG1   . ILE C 2  261  ? 12.214  -34.952 47.862  1.00 58.68  ? 261  ILE C CG1   1 
ATOM   5578  C  CG2   . ILE C 2  261  ? 13.524  -36.924 48.551  1.00 66.74  ? 261  ILE C CG2   1 
ATOM   5579  C  CD1   . ILE C 2  261  ? 11.968  -33.990 46.729  1.00 62.71  ? 261  ILE C CD1   1 
ATOM   5580  N  N     . ALA C 2  262  ? 16.572  -36.103 48.326  1.00 66.57  ? 262  ALA C N     1 
ATOM   5581  C  CA    . ALA C 2  262  ? 17.538  -37.104 48.778  1.00 69.21  ? 262  ALA C CA    1 
ATOM   5582  C  C     . ALA C 2  262  ? 18.890  -36.568 49.261  1.00 73.71  ? 262  ALA C C     1 
ATOM   5583  O  O     . ALA C 2  262  ? 19.704  -37.330 49.781  1.00 74.84  ? 262  ALA C O     1 
ATOM   5584  C  CB    . ALA C 2  262  ? 17.746  -38.156 47.696  1.00 86.27  ? 262  ALA C CB    1 
ATOM   5585  N  N     . ASP C 2  263  ? 19.133  -35.272 49.088  1.00 74.86  ? 263  ASP C N     1 
ATOM   5586  C  CA    . ASP C 2  263  ? 20.417  -34.682 49.471  1.00 75.03  ? 263  ASP C CA    1 
ATOM   5587  C  C     . ASP C 2  263  ? 20.491  -34.416 50.973  1.00 77.87  ? 263  ASP C C     1 
ATOM   5588  O  O     . ASP C 2  263  ? 19.728  -33.606 51.498  1.00 83.43  ? 263  ASP C O     1 
ATOM   5589  C  CB    . ASP C 2  263  ? 20.661  -33.382 48.700  1.00 77.27  ? 263  ASP C CB    1 
ATOM   5590  C  CG    . ASP C 2  263  ? 22.126  -32.974 48.675  1.00 78.56  ? 263  ASP C CG    1 
ATOM   5591  O  OD1   . ASP C 2  263  ? 22.844  -33.222 49.666  1.00 73.09  ? 263  ASP C OD1   1 
ATOM   5592  O  OD2   . ASP C 2  263  ? 22.561  -32.402 47.653  1.00 84.04  ? 263  ASP C OD2   1 
ATOM   5593  N  N     . PRO C 2  264  ? 21.418  -35.095 51.667  1.00 74.66  ? 264  PRO C N     1 
ATOM   5594  C  CA    . PRO C 2  264  ? 21.606  -34.917 53.113  1.00 76.25  ? 264  PRO C CA    1 
ATOM   5595  C  C     . PRO C 2  264  ? 22.184  -33.548 53.475  1.00 79.19  ? 264  PRO C C     1 
ATOM   5596  O  O     . PRO C 2  264  ? 21.970  -33.066 54.588  1.00 80.93  ? 264  PRO C O     1 
ATOM   5597  C  CB    . PRO C 2  264  ? 22.596  -36.028 53.473  1.00 67.56  ? 264  PRO C CB    1 
ATOM   5598  C  CG    . PRO C 2  264  ? 23.343  -36.286 52.215  1.00 68.82  ? 264  PRO C CG    1 
ATOM   5599  C  CD    . PRO C 2  264  ? 22.350  -36.091 51.109  1.00 71.74  ? 264  PRO C CD    1 
ATOM   5600  N  N     . ARG C 2  265  ? 22.909  -32.937 52.542  1.00 76.07  ? 265  ARG C N     1 
ATOM   5601  C  CA    . ARG C 2  265  ? 23.528  -31.636 52.776  1.00 75.62  ? 265  ARG C CA    1 
ATOM   5602  C  C     . ARG C 2  265  ? 22.544  -30.500 52.506  1.00 73.28  ? 265  ARG C C     1 
ATOM   5603  O  O     . ARG C 2  265  ? 22.779  -29.355 52.894  1.00 66.18  ? 265  ARG C O     1 
ATOM   5604  C  CB    . ARG C 2  265  ? 24.780  -31.481 51.906  1.00 77.20  ? 265  ARG C CB    1 
ATOM   5605  C  CG    . ARG C 2  265  ? 25.831  -32.560 52.139  1.00 74.68  ? 265  ARG C CG    1 
ATOM   5606  C  CD    . ARG C 2  265  ? 26.705  -32.775 50.909  1.00 72.84  ? 265  ARG C CD    1 
ATOM   5607  N  NE    . ARG C 2  265  ? 27.634  -31.673 50.676  1.00 79.00  ? 265  ARG C NE    1 
ATOM   5608  C  CZ    . ARG C 2  265  ? 28.928  -31.707 50.983  1.00 72.44  ? 265  ARG C CZ    1 
ATOM   5609  N  NH1   . ARG C 2  265  ? 29.453  -32.794 51.536  1.00 58.45  ? 265  ARG C NH1   1 
ATOM   5610  N  NH2   . ARG C 2  265  ? 29.698  -30.656 50.734  1.00 65.10  ? 265  ARG C NH2   1 
ATOM   5611  N  N     . ARG C 2  266  ? 21.439  -30.829 51.845  1.00 75.90  ? 266  ARG C N     1 
ATOM   5612  C  CA    . ARG C 2  266  ? 20.403  -29.849 51.525  1.00 78.51  ? 266  ARG C CA    1 
ATOM   5613  C  C     . ARG C 2  266  ? 19.127  -30.090 52.331  1.00 75.06  ? 266  ARG C C     1 
ATOM   5614  O  O     . ARG C 2  266  ? 18.717  -29.236 53.115  1.00 74.83  ? 266  ARG C O     1 
ATOM   5615  C  CB    . ARG C 2  266  ? 20.106  -29.823 50.023  1.00 80.17  ? 266  ARG C CB    1 
ATOM   5616  C  CG    . ARG C 2  266  ? 21.050  -28.935 49.222  1.00 89.26  ? 266  ARG C CG    1 
ATOM   5617  C  CD    . ARG C 2  266  ? 20.620  -28.839 47.765  1.00 99.71  ? 266  ARG C CD    1 
ATOM   5618  N  NE    . ARG C 2  266  ? 21.391  -27.849 47.016  1.00 108.93 ? 266  ARG C NE    1 
ATOM   5619  C  CZ    . ARG C 2  266  ? 22.516  -28.116 46.358  1.00 101.17 ? 266  ARG C CZ    1 
ATOM   5620  N  NH1   . ARG C 2  266  ? 23.147  -27.151 45.702  1.00 87.41  ? 266  ARG C NH1   1 
ATOM   5621  N  NH2   . ARG C 2  266  ? 23.010  -29.347 46.356  1.00 94.39  ? 266  ARG C NH2   1 
ATOM   5622  N  N     . TYR C 2  267  ? 18.493  -31.240 52.122  1.00 70.15  ? 267  TYR C N     1 
ATOM   5623  C  CA    . TYR C 2  267  ? 17.318  -31.608 52.909  1.00 71.62  ? 267  TYR C CA    1 
ATOM   5624  C  C     . TYR C 2  267  ? 17.721  -32.418 54.138  1.00 76.54  ? 267  TYR C C     1 
ATOM   5625  O  O     . TYR C 2  267  ? 18.202  -33.545 54.018  1.00 83.02  ? 267  TYR C O     1 
ATOM   5626  C  CB    . TYR C 2  267  ? 16.328  -32.411 52.064  1.00 72.17  ? 267  TYR C CB    1 
ATOM   5627  C  CG    . TYR C 2  267  ? 15.040  -32.758 52.781  1.00 64.30  ? 267  TYR C CG    1 
ATOM   5628  C  CD1   . TYR C 2  267  ? 13.925  -31.940 52.671  1.00 63.30  ? 267  TYR C CD1   1 
ATOM   5629  C  CD2   . TYR C 2  267  ? 14.937  -33.905 53.559  1.00 59.56  ? 267  TYR C CD2   1 
ATOM   5630  C  CE1   . TYR C 2  267  ? 12.745  -32.250 53.316  1.00 61.47  ? 267  TYR C CE1   1 
ATOM   5631  C  CE2   . TYR C 2  267  ? 13.763  -34.221 54.210  1.00 58.29  ? 267  TYR C CE2   1 
ATOM   5632  C  CZ    . TYR C 2  267  ? 12.668  -33.390 54.084  1.00 57.50  ? 267  TYR C CZ    1 
ATOM   5633  O  OH    . TYR C 2  267  ? 11.490  -33.695 54.726  1.00 52.71  ? 267  TYR C OH    1 
ATOM   5634  N  N     . ASP C 2  268  ? 17.506  -31.853 55.320  1.00 67.24  ? 268  ASP C N     1 
ATOM   5635  C  CA    . ASP C 2  268  ? 17.879  -32.542 56.549  1.00 70.47  ? 268  ASP C CA    1 
ATOM   5636  C  C     . ASP C 2  268  ? 16.746  -32.603 57.569  1.00 67.40  ? 268  ASP C C     1 
ATOM   5637  O  O     . ASP C 2  268  ? 16.298  -31.583 58.093  1.00 61.68  ? 268  ASP C O     1 
ATOM   5638  C  CB    . ASP C 2  268  ? 19.124  -31.904 57.171  1.00 77.60  ? 268  ASP C CB    1 
ATOM   5639  C  CG    . ASP C 2  268  ? 19.628  -32.667 58.382  1.00 77.79  ? 268  ASP C CG    1 
ATOM   5640  O  OD1   . ASP C 2  268  ? 19.401  -33.893 58.450  1.00 78.47  ? 268  ASP C OD1   1 
ATOM   5641  O  OD2   . ASP C 2  268  ? 20.254  -32.040 59.264  1.00 69.09  ? 268  ASP C OD2   1 
ATOM   5642  N  N     . LEU C 2  269  ? 16.294  -33.819 57.844  1.00 67.33  ? 269  LEU C N     1 
ATOM   5643  C  CA    . LEU C 2  269  ? 15.323  -34.069 58.894  1.00 53.13  ? 269  LEU C CA    1 
ATOM   5644  C  C     . LEU C 2  269  ? 16.121  -34.243 60.173  1.00 57.06  ? 269  LEU C C     1 
ATOM   5645  O  O     . LEU C 2  269  ? 17.214  -34.809 60.150  1.00 69.49  ? 269  LEU C O     1 
ATOM   5646  C  CB    . LEU C 2  269  ? 14.557  -35.351 58.583  1.00 50.86  ? 269  LEU C CB    1 
ATOM   5647  C  CG    . LEU C 2  269  ? 13.241  -35.670 59.278  1.00 41.21  ? 269  LEU C CG    1 
ATOM   5648  C  CD1   . LEU C 2  269  ? 12.146  -34.778 58.738  1.00 45.22  ? 269  LEU C CD1   1 
ATOM   5649  C  CD2   . LEU C 2  269  ? 12.898  -37.130 59.059  1.00 42.05  ? 269  LEU C CD2   1 
ATOM   5650  N  N     . GLY C 2  270  ? 15.597  -33.746 61.285  1.00 50.88  ? 270  GLY C N     1 
ATOM   5651  C  CA    . GLY C 2  270  ? 16.289  -33.884 62.553  1.00 58.97  ? 270  GLY C CA    1 
ATOM   5652  C  C     . GLY C 2  270  ? 16.429  -35.337 62.969  1.00 53.49  ? 270  GLY C C     1 
ATOM   5653  O  O     . GLY C 2  270  ? 15.728  -36.204 62.449  1.00 51.55  ? 270  GLY C O     1 
ATOM   5654  N  N     . GLU C 2  271  ? 17.345  -35.607 63.895  1.00 54.34  ? 271  GLU C N     1 
ATOM   5655  C  CA    . GLU C 2  271  ? 17.448  -36.931 64.493  1.00 50.75  ? 271  GLU C CA    1 
ATOM   5656  C  C     . GLU C 2  271  ? 16.131  -37.212 65.197  1.00 53.30  ? 271  GLU C C     1 
ATOM   5657  O  O     . GLU C 2  271  ? 15.632  -38.343 65.201  1.00 52.77  ? 271  GLU C O     1 
ATOM   5658  C  CB    . GLU C 2  271  ? 18.604  -36.984 65.494  1.00 51.57  ? 271  GLU C CB    1 
ATOM   5659  C  CG    . GLU C 2  271  ? 19.960  -36.595 64.915  1.00 75.62  ? 271  GLU C CG    1 
ATOM   5660  C  CD    . GLU C 2  271  ? 20.507  -37.618 63.928  1.00 98.30  ? 271  GLU C CD    1 
ATOM   5661  O  OE1   . GLU C 2  271  ? 20.040  -38.779 63.940  1.00 100.24 ? 271  GLU C OE1   1 
ATOM   5662  O  OE2   . GLU C 2  271  ? 21.411  -37.259 63.141  1.00 84.20  ? 271  GLU C OE2   1 
ATOM   5663  N  N     . ALA C 2  272  ? 15.575  -36.157 65.787  1.00 55.79  ? 272  ALA C N     1 
ATOM   5664  C  CA    . ALA C 2  272  ? 14.248  -36.197 66.381  1.00 47.01  ? 272  ALA C CA    1 
ATOM   5665  C  C     . ALA C 2  272  ? 13.200  -36.408 65.296  1.00 46.42  ? 272  ALA C C     1 
ATOM   5666  O  O     . ALA C 2  272  ? 12.212  -37.102 65.510  1.00 47.08  ? 272  ALA C O     1 
ATOM   5667  C  CB    . ALA C 2  272  ? 13.971  -34.912 67.142  1.00 37.43  ? 272  ALA C CB    1 
ATOM   5668  N  N     . GLY C 2  273  ? 13.423  -35.805 64.133  1.00 48.12  ? 273  GLY C N     1 
ATOM   5669  C  CA    . GLY C 2  273  ? 12.539  -35.994 62.996  1.00 47.57  ? 273  GLY C CA    1 
ATOM   5670  C  C     . GLY C 2  273  ? 12.562  -37.433 62.521  1.00 52.25  ? 273  GLY C C     1 
ATOM   5671  O  O     . GLY C 2  273  ? 11.516  -38.025 62.239  1.00 50.32  ? 273  GLY C O     1 
ATOM   5672  N  N     . ARG C 2  274  ? 13.766  -37.994 62.433  1.00 57.70  ? 274  ARG C N     1 
ATOM   5673  C  CA    . ARG C 2  274  ? 13.945  -39.399 62.091  1.00 51.58  ? 274  ARG C CA    1 
ATOM   5674  C  C     . ARG C 2  274  ? 13.205  -40.294 63.072  1.00 51.97  ? 274  ARG C C     1 
ATOM   5675  O  O     . ARG C 2  274  ? 12.414  -41.141 62.665  1.00 51.44  ? 274  ARG C O     1 
ATOM   5676  C  CB    . ARG C 2  274  ? 15.427  -39.775 62.086  1.00 65.79  ? 274  ARG C CB    1 
ATOM   5677  C  CG    . ARG C 2  274  ? 15.660  -41.282 62.087  1.00 82.90  ? 274  ARG C CG    1 
ATOM   5678  C  CD    . ARG C 2  274  ? 17.112  -41.644 62.345  1.00 78.04  ? 274  ARG C CD    1 
ATOM   5679  N  NE    . ARG C 2  274  ? 17.990  -41.182 61.277  1.00 82.85  ? 274  ARG C NE    1 
ATOM   5680  C  CZ    . ARG C 2  274  ? 19.210  -41.658 61.062  1.00 93.69  ? 274  ARG C CZ    1 
ATOM   5681  N  NH1   . ARG C 2  274  ? 19.946  -41.183 60.067  1.00 97.87  ? 274  ARG C NH1   1 
ATOM   5682  N  NH2   . ARG C 2  274  ? 19.691  -42.617 61.841  1.00 96.57  ? 274  ARG C NH2   1 
ATOM   5683  N  N     . TYR C 2  275  ? 13.469  -40.102 64.362  1.00 56.16  ? 275  TYR C N     1 
ATOM   5684  C  CA    . TYR C 2  275  ? 12.832  -40.907 65.401  1.00 59.48  ? 275  TYR C CA    1 
ATOM   5685  C  C     . TYR C 2  275  ? 11.309  -40.827 65.351  1.00 58.07  ? 275  TYR C C     1 
ATOM   5686  O  O     . TYR C 2  275  ? 10.627  -41.850 65.375  1.00 58.64  ? 275  TYR C O     1 
ATOM   5687  C  CB    . TYR C 2  275  ? 13.330  -40.508 66.795  1.00 63.19  ? 275  TYR C CB    1 
ATOM   5688  C  CG    . TYR C 2  275  ? 12.495  -41.091 67.919  1.00 81.03  ? 275  TYR C CG    1 
ATOM   5689  C  CD1   . TYR C 2  275  ? 12.679  -42.404 68.340  1.00 76.42  ? 275  TYR C CD1   1 
ATOM   5690  C  CD2   . TYR C 2  275  ? 11.516  -40.330 68.553  1.00 77.35  ? 275  TYR C CD2   1 
ATOM   5691  C  CE1   . TYR C 2  275  ? 11.913  -42.942 69.363  1.00 80.46  ? 275  TYR C CE1   1 
ATOM   5692  C  CE2   . TYR C 2  275  ? 10.746  -40.860 69.574  1.00 78.94  ? 275  TYR C CE2   1 
ATOM   5693  C  CZ    . TYR C 2  275  ? 10.948  -42.165 69.976  1.00 82.94  ? 275  TYR C CZ    1 
ATOM   5694  O  OH    . TYR C 2  275  ? 10.183  -42.691 70.993  1.00 76.70  ? 275  TYR C OH    1 
ATOM   5695  N  N     . LYS C 2  276  ? 10.785  -39.607 65.291  1.00 57.31  ? 276  LYS C N     1 
ATOM   5696  C  CA    . LYS C 2  276  ? 9.344   -39.391 65.253  1.00 56.18  ? 276  LYS C CA    1 
ATOM   5697  C  C     . LYS C 2  276  ? 8.727   -40.050 64.027  1.00 58.20  ? 276  LYS C C     1 
ATOM   5698  O  O     . LYS C 2  276  ? 7.684   -40.693 64.125  1.00 63.90  ? 276  LYS C O     1 
ATOM   5699  C  CB    . LYS C 2  276  ? 9.016   -37.895 65.275  1.00 53.47  ? 276  LYS C CB    1 
ATOM   5700  C  CG    . LYS C 2  276  ? 9.284   -37.209 66.613  1.00 49.50  ? 276  LYS C CG    1 
ATOM   5701  C  CD    . LYS C 2  276  ? 8.238   -37.559 67.660  1.00 48.25  ? 276  LYS C CD    1 
ATOM   5702  C  CE    . LYS C 2  276  ? 7.048   -36.606 67.612  1.00 45.14  ? 276  LYS C CE    1 
ATOM   5703  N  NZ    . LYS C 2  276  ? 6.247   -36.703 66.355  1.00 40.74  ? 276  LYS C NZ    1 
ATOM   5704  N  N     . ALA C 2  277  ? 9.383   -39.901 62.879  1.00 57.86  ? 277  ALA C N     1 
ATOM   5705  C  CA    . ALA C 2  277  ? 8.904   -40.515 61.643  1.00 59.14  ? 277  ALA C CA    1 
ATOM   5706  C  C     . ALA C 2  277  ? 8.883   -42.040 61.740  1.00 62.79  ? 277  ALA C C     1 
ATOM   5707  O  O     . ALA C 2  277  ? 7.923   -42.684 61.313  1.00 65.00  ? 277  ALA C O     1 
ATOM   5708  C  CB    . ALA C 2  277  ? 9.752   -40.069 60.465  1.00 55.65  ? 277  ALA C CB    1 
ATOM   5709  N  N     . GLU C 2  278  ? 9.946   -42.608 62.306  1.00 60.09  ? 278  GLU C N     1 
ATOM   5710  C  CA    . GLU C 2  278  ? 10.060  -44.055 62.477  1.00 63.49  ? 278  GLU C CA    1 
ATOM   5711  C  C     . GLU C 2  278  ? 8.990   -44.611 63.410  1.00 64.54  ? 278  GLU C C     1 
ATOM   5712  O  O     . GLU C 2  278  ? 8.307   -45.580 63.079  1.00 64.70  ? 278  GLU C O     1 
ATOM   5713  C  CB    . GLU C 2  278  ? 11.448  -44.429 63.004  1.00 63.08  ? 278  GLU C CB    1 
ATOM   5714  C  CG    . GLU C 2  278  ? 12.565  -44.298 61.981  1.00 75.53  ? 278  GLU C CG    1 
ATOM   5715  C  CD    . GLU C 2  278  ? 13.931  -44.596 62.570  1.00 81.81  ? 278  GLU C CD    1 
ATOM   5716  O  OE1   . GLU C 2  278  ? 14.003  -44.896 63.781  1.00 79.32  ? 278  GLU C OE1   1 
ATOM   5717  O  OE2   . GLU C 2  278  ? 14.930  -44.529 61.822  1.00 79.69  ? 278  GLU C OE2   1 
ATOM   5718  N  N     . GLU C 2  279  ? 8.856   -43.995 64.580  1.00 62.69  ? 279  GLU C N     1 
ATOM   5719  C  CA    . GLU C 2  279  ? 7.902   -44.451 65.581  1.00 68.09  ? 279  GLU C CA    1 
ATOM   5720  C  C     . GLU C 2  279  ? 6.465   -44.255 65.096  1.00 65.58  ? 279  GLU C C     1 
ATOM   5721  O  O     . GLU C 2  279  ? 5.575   -45.035 65.436  1.00 66.91  ? 279  GLU C O     1 
ATOM   5722  C  CB    . GLU C 2  279  ? 8.128   -43.714 66.906  1.00 70.97  ? 279  GLU C CB    1 
ATOM   5723  C  CG    . GLU C 2  279  ? 7.671   -44.478 68.147  1.00 87.47  ? 279  GLU C CG    1 
ATOM   5724  C  CD    . GLU C 2  279  ? 8.640   -45.578 68.559  1.00 96.66  ? 279  GLU C CD    1 
ATOM   5725  O  OE1   . GLU C 2  279  ? 8.315   -46.341 69.495  1.00 88.32  ? 279  GLU C OE1   1 
ATOM   5726  O  OE2   . GLU C 2  279  ? 9.729   -45.677 67.953  1.00 94.18  ? 279  GLU C OE2   1 
ATOM   5727  N  N     . LYS C 2  280  ? 6.248   -43.215 64.296  1.00 59.42  ? 280  LYS C N     1 
ATOM   5728  C  CA    . LYS C 2  280  ? 4.914   -42.913 63.782  1.00 63.59  ? 280  LYS C CA    1 
ATOM   5729  C  C     . LYS C 2  280  ? 4.485   -43.832 62.640  1.00 76.59  ? 280  LYS C C     1 
ATOM   5730  O  O     . LYS C 2  280  ? 3.369   -44.354 62.640  1.00 73.63  ? 280  LYS C O     1 
ATOM   5731  C  CB    . LYS C 2  280  ? 4.839   -41.458 63.318  1.00 58.60  ? 280  LYS C CB    1 
ATOM   5732  C  CG    . LYS C 2  280  ? 3.478   -41.040 62.799  1.00 54.83  ? 280  LYS C CG    1 
ATOM   5733  C  CD    . LYS C 2  280  ? 2.435   -41.104 63.896  1.00 50.98  ? 280  LYS C CD    1 
ATOM   5734  C  CE    . LYS C 2  280  ? 1.110   -40.534 63.426  1.00 53.83  ? 280  LYS C CE    1 
ATOM   5735  N  NZ    . LYS C 2  280  ? 0.049   -40.665 64.465  1.00 62.50  ? 280  LYS C NZ    1 
ATOM   5736  N  N     . LEU C 2  281  ? 5.373   -44.028 61.669  1.00 79.64  ? 281  LEU C N     1 
ATOM   5737  C  CA    . LEU C 2  281  ? 5.030   -44.774 60.459  1.00 76.01  ? 281  LEU C CA    1 
ATOM   5738  C  C     . LEU C 2  281  ? 5.353   -46.262 60.554  1.00 81.40  ? 281  LEU C C     1 
ATOM   5739  O  O     . LEU C 2  281  ? 5.085   -47.020 59.620  1.00 81.94  ? 281  LEU C O     1 
ATOM   5740  C  CB    . LEU C 2  281  ? 5.733   -44.170 59.242  1.00 72.69  ? 281  LEU C CB    1 
ATOM   5741  C  CG    . LEU C 2  281  ? 5.368   -42.725 58.901  1.00 69.34  ? 281  LEU C CG    1 
ATOM   5742  C  CD1   . LEU C 2  281  ? 6.063   -42.286 57.622  1.00 62.92  ? 281  LEU C CD1   1 
ATOM   5743  C  CD2   . LEU C 2  281  ? 3.860   -42.571 58.780  1.00 65.44  ? 281  LEU C CD2   1 
ATOM   5744  N  N     . GLY C 2  282  ? 5.927   -46.674 61.680  1.00 80.10  ? 282  GLY C N     1 
ATOM   5745  C  CA    . GLY C 2  282  ? 6.282   -48.066 61.894  1.00 77.17  ? 282  GLY C CA    1 
ATOM   5746  C  C     . GLY C 2  282  ? 7.317   -48.565 60.904  1.00 75.55  ? 282  GLY C C     1 
ATOM   5747  O  O     . GLY C 2  282  ? 7.226   -49.689 60.411  1.00 75.50  ? 282  GLY C O     1 
ATOM   5748  N  N     . ILE C 2  283  ? 8.298   -47.719 60.606  1.00 76.56  ? 283  ILE C N     1 
ATOM   5749  C  CA    . ILE C 2  283  ? 9.376   -48.077 59.691  1.00 76.02  ? 283  ILE C CA    1 
ATOM   5750  C  C     . ILE C 2  283  ? 10.729  -47.710 60.290  1.00 75.48  ? 283  ILE C C     1 
ATOM   5751  O  O     . ILE C 2  283  ? 10.809  -47.240 61.425  1.00 75.34  ? 283  ILE C O     1 
ATOM   5752  C  CB    . ILE C 2  283  ? 9.227   -47.367 58.331  1.00 76.12  ? 283  ILE C CB    1 
ATOM   5753  C  CG1   . ILE C 2  283  ? 9.344   -45.851 58.505  1.00 71.94  ? 283  ILE C CG1   1 
ATOM   5754  C  CG2   . ILE C 2  283  ? 7.904   -47.739 57.672  1.00 73.53  ? 283  ILE C CG2   1 
ATOM   5755  C  CD1   . ILE C 2  283  ? 9.229   -45.073 57.212  1.00 63.65  ? 283  ILE C CD1   1 
ATOM   5756  N  N     . ARG C 2  284  ? 11.791  -47.928 59.523  1.00 76.40  ? 284  ARG C N     1 
ATOM   5757  C  CA    . ARG C 2  284  ? 13.135  -47.572 59.961  1.00 85.48  ? 284  ARG C CA    1 
ATOM   5758  C  C     . ARG C 2  284  ? 13.844  -46.771 58.875  1.00 84.09  ? 284  ARG C C     1 
ATOM   5759  O  O     . ARG C 2  284  ? 13.775  -47.110 57.694  1.00 81.53  ? 284  ARG C O     1 
ATOM   5760  C  CB    . ARG C 2  284  ? 13.939  -48.825 60.324  1.00 78.79  ? 284  ARG C CB    1 
ATOM   5761  C  CG    . ARG C 2  284  ? 15.393  -48.556 60.696  1.00 80.35  ? 284  ARG C CG    1 
ATOM   5762  C  CD    . ARG C 2  284  ? 15.514  -47.707 61.954  1.00 85.04  ? 284  ARG C CD    1 
ATOM   5763  N  NE    . ARG C 2  284  ? 16.901  -47.331 62.226  1.00 95.67  ? 284  ARG C NE    1 
ATOM   5764  C  CZ    . ARG C 2  284  ? 17.291  -46.590 63.260  1.00 94.54  ? 284  ARG C CZ    1 
ATOM   5765  N  NH1   . ARG C 2  284  ? 18.575  -46.299 63.422  1.00 97.31  ? 284  ARG C NH1   1 
ATOM   5766  N  NH2   . ARG C 2  284  ? 16.400  -46.141 64.132  1.00 89.27  ? 284  ARG C NH2   1 
ATOM   5767  N  N     . LEU C 2  285  ? 14.517  -45.701 59.281  1.00 83.50  ? 285  LEU C N     1 
ATOM   5768  C  CA    . LEU C 2  285  ? 15.199  -44.827 58.335  1.00 89.43  ? 285  LEU C CA    1 
ATOM   5769  C  C     . LEU C 2  285  ? 16.697  -45.103 58.285  1.00 91.11  ? 285  LEU C C     1 
ATOM   5770  O  O     . LEU C 2  285  ? 17.365  -45.164 59.319  1.00 92.10  ? 285  LEU C O     1 
ATOM   5771  C  CB    . LEU C 2  285  ? 14.945  -43.359 58.686  1.00 91.61  ? 285  LEU C CB    1 
ATOM   5772  C  CG    . LEU C 2  285  ? 13.779  -42.664 57.980  1.00 84.12  ? 285  LEU C CG    1 
ATOM   5773  C  CD1   . LEU C 2  285  ? 14.106  -42.446 56.512  1.00 84.38  ? 285  LEU C CD1   1 
ATOM   5774  C  CD2   . LEU C 2  285  ? 12.483  -43.446 58.137  1.00 77.26  ? 285  LEU C CD2   1 
ATOM   5775  N  N     . SER C 2  286  ? 17.218  -45.269 57.074  1.00 89.47  ? 286  SER C N     1 
ATOM   5776  C  CA    . SER C 2  286  ? 18.647  -45.475 56.876  1.00 98.83  ? 286  SER C CA    1 
ATOM   5777  C  C     . SER C 2  286  ? 19.380  -44.148 57.010  1.00 94.65  ? 286  SER C C     1 
ATOM   5778  O  O     . SER C 2  286  ? 20.570  -44.107 57.324  1.00 78.77  ? 286  SER C O     1 
ATOM   5779  C  CB    . SER C 2  286  ? 18.911  -46.079 55.496  1.00 102.11 ? 286  SER C CB    1 
ATOM   5780  O  OG    . SER C 2  286  ? 18.422  -45.232 54.468  1.00 93.09  ? 286  SER C OG    1 
ATOM   5781  N  N     . GLY C 2  287  ? 18.651  -43.063 56.777  1.00 99.49  ? 287  GLY C N     1 
ATOM   5782  C  CA    . GLY C 2  287  ? 19.221  -41.732 56.823  1.00 94.28  ? 287  GLY C CA    1 
ATOM   5783  C  C     . GLY C 2  287  ? 18.184  -40.680 57.164  1.00 89.31  ? 287  GLY C C     1 
ATOM   5784  O  O     . GLY C 2  287  ? 17.018  -40.991 57.409  1.00 82.25  ? 287  GLY C O     1 
ATOM   5785  N  N     . ARG C 2  288  ? 18.617  -39.425 57.172  1.00 84.02  ? 288  ARG C N     1 
ATOM   5786  C  CA    . ARG C 2  288  ? 17.759  -38.313 57.556  1.00 71.61  ? 288  ARG C CA    1 
ATOM   5787  C  C     . ARG C 2  288  ? 17.046  -37.680 56.363  1.00 74.74  ? 288  ARG C C     1 
ATOM   5788  O  O     . ARG C 2  288  ? 16.383  -36.656 56.502  1.00 74.49  ? 288  ARG C O     1 
ATOM   5789  C  CB    . ARG C 2  288  ? 18.558  -37.268 58.335  1.00 69.26  ? 288  ARG C CB    1 
ATOM   5790  C  CG    . ARG C 2  288  ? 19.131  -37.798 59.640  1.00 68.78  ? 288  ARG C CG    1 
ATOM   5791  C  CD    . ARG C 2  288  ? 19.974  -36.753 60.335  1.00 65.86  ? 288  ARG C CD    1 
ATOM   5792  N  NE    . ARG C 2  288  ? 21.007  -36.222 59.452  1.00 89.03  ? 288  ARG C NE    1 
ATOM   5793  C  CZ    . ARG C 2  288  ? 21.921  -35.330 59.820  1.00 96.91  ? 288  ARG C CZ    1 
ATOM   5794  N  NH1   . ARG C 2  288  ? 21.935  -34.868 61.063  1.00 96.87  ? 288  ARG C NH1   1 
ATOM   5795  N  NH2   . ARG C 2  288  ? 22.822  -34.901 58.946  1.00 92.61  ? 288  ARG C NH2   1 
ATOM   5796  N  N     . THR C 2  289  ? 17.205  -38.271 55.185  1.00 81.12  ? 289  THR C N     1 
ATOM   5797  C  CA    . THR C 2  289  ? 16.531  -37.760 53.997  1.00 75.52  ? 289  THR C CA    1 
ATOM   5798  C  C     . THR C 2  289  ? 15.229  -38.505 53.725  1.00 68.95  ? 289  THR C C     1 
ATOM   5799  O  O     . THR C 2  289  ? 14.874  -39.439 54.443  1.00 70.45  ? 289  THR C O     1 
ATOM   5800  C  CB    . THR C 2  289  ? 17.430  -37.859 52.754  1.00 78.05  ? 289  THR C CB    1 
ATOM   5801  O  OG1   . THR C 2  289  ? 17.853  -39.217 52.575  1.00 81.36  ? 289  THR C OG1   1 
ATOM   5802  C  CG2   . THR C 2  289  ? 18.651  -36.975 52.914  1.00 76.99  ? 289  THR C CG2   1 
ATOM   5803  N  N     . LEU C 2  290  ? 14.520  -38.082 52.683  1.00 70.05  ? 290  LEU C N     1 
ATOM   5804  C  CA    . LEU C 2  290  ? 13.275  -38.729 52.285  1.00 75.84  ? 290  LEU C CA    1 
ATOM   5805  C  C     . LEU C 2  290  ? 13.492  -39.761 51.178  1.00 85.59  ? 290  LEU C C     1 
ATOM   5806  O  O     . LEU C 2  290  ? 12.557  -40.462 50.783  1.00 79.97  ? 290  LEU C O     1 
ATOM   5807  C  CB    . LEU C 2  290  ? 12.259  -37.679 51.829  1.00 73.08  ? 290  LEU C CB    1 
ATOM   5808  C  CG    . LEU C 2  290  ? 11.190  -37.210 52.819  1.00 62.91  ? 290  LEU C CG    1 
ATOM   5809  C  CD1   . LEU C 2  290  ? 11.756  -37.048 54.219  1.00 69.82  ? 290  LEU C CD1   1 
ATOM   5810  C  CD2   . LEU C 2  290  ? 10.550  -35.916 52.336  1.00 49.54  ? 290  LEU C CD2   1 
ATOM   5811  N  N     . ALA C 2  291  ? 14.729  -39.858 50.695  1.00 90.52  ? 291  ALA C N     1 
ATOM   5812  C  CA    . ALA C 2  291  ? 15.083  -40.803 49.636  1.00 86.28  ? 291  ALA C CA    1 
ATOM   5813  C  C     . ALA C 2  291  ? 16.596  -40.987 49.516  1.00 92.02  ? 291  ALA C C     1 
ATOM   5814  O  O     . ALA C 2  291  ? 17.367  -40.370 50.252  1.00 90.05  ? 291  ALA C O     1 
ATOM   5815  C  CB    . ALA C 2  291  ? 14.499  -40.359 48.301  1.00 72.56  ? 291  ALA C CB    1 
ATOM   5816  N  N     . ARG C 2  292  ? 17.014  -41.835 48.580  1.00 100.63 ? 292  ARG C N     1 
ATOM   5817  C  CA    . ARG C 2  292  ? 18.432  -42.114 48.364  1.00 100.66 ? 292  ARG C CA    1 
ATOM   5818  C  C     . ARG C 2  292  ? 18.779  -42.147 46.877  1.00 104.85 ? 292  ARG C C     1 
ATOM   5819  O  O     . ARG C 2  292  ? 17.923  -42.418 46.036  1.00 107.03 ? 292  ARG C O     1 
ATOM   5820  C  CB    . ARG C 2  292  ? 18.825  -43.440 49.020  1.00 102.85 ? 292  ARG C CB    1 
ATOM   5821  C  CG    . ARG C 2  292  ? 18.693  -43.455 50.534  1.00 97.44  ? 292  ARG C CG    1 
ATOM   5822  C  CD    . ARG C 2  292  ? 19.006  -44.830 51.098  1.00 100.50 ? 292  ARG C CD    1 
ATOM   5823  N  NE    . ARG C 2  292  ? 18.123  -45.856 50.551  1.00 101.92 ? 292  ARG C NE    1 
ATOM   5824  C  CZ    . ARG C 2  292  ? 18.197  -47.147 50.858  1.00 110.78 ? 292  ARG C CZ    1 
ATOM   5825  N  NH1   . ARG C 2  292  ? 19.117  -47.576 51.711  1.00 104.63 ? 292  ARG C NH1   1 
ATOM   5826  N  NH2   . ARG C 2  292  ? 17.351  -48.010 50.312  1.00 116.22 ? 292  ARG C NH2   1 
ATOM   5827  N  N     . PHE C 2  293  ? 20.040  -41.863 46.563  1.00 107.30 ? 293  PHE C N     1 
ATOM   5828  C  CA    . PHE C 2  293  ? 20.514  -41.845 45.180  1.00 111.54 ? 293  PHE C CA    1 
ATOM   5829  C  C     . PHE C 2  293  ? 21.154  -43.172 44.761  1.00 121.52 ? 293  PHE C C     1 
ATOM   5830  O  O     . PHE C 2  293  ? 21.643  -43.301 43.637  1.00 126.73 ? 293  PHE C O     1 
ATOM   5831  C  CB    . PHE C 2  293  ? 21.488  -40.677 44.961  1.00 105.30 ? 293  PHE C CB    1 
ATOM   5832  C  CG    . PHE C 2  293  ? 21.929  -40.509 43.531  1.00 106.70 ? 293  PHE C CG    1 
ATOM   5833  C  CD1   . PHE C 2  293  ? 21.021  -40.150 42.549  1.00 101.82 ? 293  PHE C CD1   1 
ATOM   5834  C  CD2   . PHE C 2  293  ? 23.252  -40.713 43.171  1.00 113.66 ? 293  PHE C CD2   1 
ATOM   5835  C  CE1   . PHE C 2  293  ? 21.424  -39.999 41.235  1.00 105.09 ? 293  PHE C CE1   1 
ATOM   5836  C  CE2   . PHE C 2  293  ? 23.660  -40.563 41.859  1.00 110.29 ? 293  PHE C CE2   1 
ATOM   5837  C  CZ    . PHE C 2  293  ? 22.745  -40.205 40.891  1.00 110.44 ? 293  PHE C CZ    1 
ATOM   5838  N  N     . GLU C 2  294  ? 21.133  -44.156 45.659  1.00 122.04 ? 294  GLU C N     1 
ATOM   5839  C  CA    . GLU C 2  294  ? 21.831  -45.424 45.436  1.00 122.36 ? 294  GLU C CA    1 
ATOM   5840  C  C     . GLU C 2  294  ? 21.463  -46.047 44.089  1.00 133.01 ? 294  GLU C C     1 
ATOM   5841  O  O     . GLU C 2  294  ? 20.287  -46.197 43.762  1.00 134.65 ? 294  GLU C O     1 
ATOM   5842  C  CB    . GLU C 2  294  ? 21.546  -46.405 46.575  1.00 118.31 ? 294  GLU C CB    1 
ATOM   5843  C  CG    . GLU C 2  294  ? 22.382  -47.675 46.524  1.00 122.90 ? 294  GLU C CG    1 
ATOM   5844  C  CD    . GLU C 2  294  ? 22.140  -48.585 47.713  1.00 122.21 ? 294  GLU C CD    1 
ATOM   5845  O  OE1   . GLU C 2  294  ? 21.179  -48.333 48.472  1.00 111.03 ? 294  GLU C OE1   1 
ATOM   5846  O  OE2   . GLU C 2  294  ? 22.912  -49.551 47.891  1.00 115.52 ? 294  GLU C OE2   1 
ATOM   5847  N  N     . ASP C 2  295  ? 22.490  -46.416 43.329  1.00 134.60 ? 295  ASP C N     1 
ATOM   5848  C  CA    . ASP C 2  295  ? 22.362  -46.749 41.909  1.00 131.00 ? 295  ASP C CA    1 
ATOM   5849  C  C     . ASP C 2  295  ? 21.404  -47.903 41.602  1.00 135.42 ? 295  ASP C C     1 
ATOM   5850  O  O     . ASP C 2  295  ? 21.249  -48.817 42.412  1.00 134.54 ? 295  ASP C O     1 
ATOM   5851  C  CB    . ASP C 2  295  ? 23.747  -47.048 41.323  1.00 119.31 ? 295  ASP C CB    1 
ATOM   5852  C  CG    . ASP C 2  295  ? 24.635  -45.821 41.275  1.00 109.30 ? 295  ASP C CG    1 
ATOM   5853  O  OD1   . ASP C 2  295  ? 24.101  -44.705 41.097  1.00 105.22 ? 295  ASP C OD1   1 
ATOM   5854  O  OD2   . ASP C 2  295  ? 25.867  -45.973 41.417  1.00 101.14 ? 295  ASP C OD2   1 
ATOM   5855  N  N     . GLY C 2  296  ? 20.767  -47.862 40.430  1.00 133.33 ? 296  GLY C N     1 
ATOM   5856  C  CA    . GLY C 2  296  ? 20.831  -46.724 39.523  1.00 131.06 ? 296  GLY C CA    1 
ATOM   5857  C  C     . GLY C 2  296  ? 19.965  -45.520 39.856  1.00 126.48 ? 296  GLY C C     1 
ATOM   5858  O  O     . GLY C 2  296  ? 20.436  -44.381 39.857  1.00 112.24 ? 296  GLY C O     1 
ATOM   5859  N  N     . GLU C 2  297  ? 18.693  -45.780 40.150  1.00 135.07 ? 297  GLU C N     1 
ATOM   5860  C  CA    . GLU C 2  297  ? 17.699  -44.722 40.331  1.00 137.93 ? 297  GLU C CA    1 
ATOM   5861  C  C     . GLU C 2  297  ? 17.471  -44.354 41.794  1.00 134.23 ? 297  GLU C C     1 
ATOM   5862  O  O     . GLU C 2  297  ? 18.187  -44.815 42.680  1.00 136.39 ? 297  GLU C O     1 
ATOM   5863  C  CB    . GLU C 2  297  ? 16.367  -45.108 39.674  1.00 135.59 ? 297  GLU C CB    1 
ATOM   5864  C  CG    . GLU C 2  297  ? 16.393  -45.136 38.150  1.00 141.43 ? 297  GLU C CG    1 
ATOM   5865  C  CD    . GLU C 2  297  ? 17.075  -46.371 37.589  1.00 148.28 ? 297  GLU C CD    1 
ATOM   5866  O  OE1   . GLU C 2  297  ? 17.414  -47.279 38.379  1.00 149.00 ? 297  GLU C OE1   1 
ATOM   5867  O  OE2   . GLU C 2  297  ? 17.271  -46.435 36.356  1.00 141.56 ? 297  GLU C OE2   1 
ATOM   5868  N  N     . PHE C 2  298  ? 16.471  -43.512 42.036  1.00 120.32 ? 298  PHE C N     1 
ATOM   5869  C  CA    . PHE C 2  298  ? 16.136  -43.093 43.392  1.00 115.34 ? 298  PHE C CA    1 
ATOM   5870  C  C     . PHE C 2  298  ? 15.355  -44.164 44.154  1.00 114.18 ? 298  PHE C C     1 
ATOM   5871  O  O     . PHE C 2  298  ? 14.502  -44.849 43.587  1.00 113.27 ? 298  PHE C O     1 
ATOM   5872  C  CB    . PHE C 2  298  ? 15.335  -41.790 43.368  1.00 110.58 ? 298  PHE C CB    1 
ATOM   5873  C  CG    . PHE C 2  298  ? 16.080  -40.629 42.780  1.00 105.36 ? 298  PHE C CG    1 
ATOM   5874  C  CD1   . PHE C 2  298  ? 17.016  -39.938 43.531  1.00 101.18 ? 298  PHE C CD1   1 
ATOM   5875  C  CD2   . PHE C 2  298  ? 15.834  -40.218 41.482  1.00 101.24 ? 298  PHE C CD2   1 
ATOM   5876  C  CE1   . PHE C 2  298  ? 17.699  -38.865 42.995  1.00 98.47  ? 298  PHE C CE1   1 
ATOM   5877  C  CE2   . PHE C 2  298  ? 16.514  -39.145 40.940  1.00 104.76 ? 298  PHE C CE2   1 
ATOM   5878  C  CZ    . PHE C 2  298  ? 17.448  -38.468 41.698  1.00 102.43 ? 298  PHE C CZ    1 
ATOM   5879  N  N     . LYS C 2  299  ? 15.651  -44.293 45.444  1.00 109.53 ? 299  LYS C N     1 
ATOM   5880  C  CA    . LYS C 2  299  ? 14.950  -45.225 46.322  1.00 108.06 ? 299  LYS C CA    1 
ATOM   5881  C  C     . LYS C 2  299  ? 14.346  -44.453 47.489  1.00 106.86 ? 299  LYS C C     1 
ATOM   5882  O  O     . LYS C 2  299  ? 14.996  -43.573 48.051  1.00 104.50 ? 299  LYS C O     1 
ATOM   5883  C  CB    . LYS C 2  299  ? 15.915  -46.290 46.842  1.00 109.58 ? 299  LYS C CB    1 
ATOM   5884  C  CG    . LYS C 2  299  ? 16.612  -47.078 45.748  1.00 113.28 ? 299  LYS C CG    1 
ATOM   5885  C  CD    . LYS C 2  299  ? 17.679  -47.995 46.320  1.00 115.96 ? 299  LYS C CD    1 
ATOM   5886  C  CE    . LYS C 2  299  ? 18.375  -48.778 45.220  1.00 112.44 ? 299  LYS C CE    1 
ATOM   5887  N  NZ    . LYS C 2  299  ? 19.474  -49.625 45.755  1.00 108.22 ? 299  LYS C NZ    1 
ATOM   5888  N  N     . ASP C 2  300  ? 13.113  -44.786 47.862  1.00 104.32 ? 300  ASP C N     1 
ATOM   5889  C  CA    . ASP C 2  300  ? 12.387  -44.000 48.862  1.00 99.61  ? 300  ASP C CA    1 
ATOM   5890  C  C     . ASP C 2  300  ? 12.150  -44.717 50.187  1.00 94.93  ? 300  ASP C C     1 
ATOM   5891  O  O     . ASP C 2  300  ? 12.068  -45.944 50.247  1.00 91.38  ? 300  ASP C O     1 
ATOM   5892  C  CB    . ASP C 2  300  ? 11.050  -43.503 48.305  1.00 98.09  ? 300  ASP C CB    1 
ATOM   5893  C  CG    . ASP C 2  300  ? 9.860   -44.192 48.938  1.00 92.69  ? 300  ASP C CG    1 
ATOM   5894  O  OD1   . ASP C 2  300  ? 9.327   -43.665 49.938  1.00 83.76  ? 300  ASP C OD1   1 
ATOM   5895  O  OD2   . ASP C 2  300  ? 9.454   -45.258 48.433  1.00 100.84 ? 300  ASP C OD2   1 
ATOM   5896  N  N     . GLU C 2  301  ? 12.047  -43.924 51.248  1.00 91.79  ? 301  GLU C N     1 
ATOM   5897  C  CA    . GLU C 2  301  ? 11.740  -44.429 52.578  1.00 90.17  ? 301  GLU C CA    1 
ATOM   5898  C  C     . GLU C 2  301  ? 10.371  -43.958 53.062  1.00 86.35  ? 301  GLU C C     1 
ATOM   5899  O  O     . GLU C 2  301  ? 9.486   -44.767 53.317  1.00 87.33  ? 301  GLU C O     1 
ATOM   5900  C  CB    . GLU C 2  301  ? 12.817  -44.019 53.582  1.00 87.87  ? 301  GLU C CB    1 
ATOM   5901  C  CG    . GLU C 2  301  ? 14.141  -44.736 53.407  1.00 91.36  ? 301  GLU C CG    1 
ATOM   5902  C  CD    . GLU C 2  301  ? 15.258  -43.795 53.015  1.00 95.98  ? 301  GLU C CD    1 
ATOM   5903  O  OE1   . GLU C 2  301  ? 14.953  -42.668 52.570  1.00 88.48  ? 301  GLU C OE1   1 
ATOM   5904  O  OE2   . GLU C 2  301  ? 16.439  -44.179 53.155  1.00 99.87  ? 301  GLU C OE2   1 
ATOM   5905  N  N     . VAL C 2  302  ? 10.220  -42.645 53.205  1.00 83.09  ? 302  VAL C N     1 
ATOM   5906  C  CA    . VAL C 2  302  ? 9.079   -42.051 53.901  1.00 74.92  ? 302  VAL C CA    1 
ATOM   5907  C  C     . VAL C 2  302  ? 7.747   -41.989 53.131  1.00 73.30  ? 302  VAL C C     1 
ATOM   5908  O  O     . VAL C 2  302  ? 6.682   -42.222 53.712  1.00 73.67  ? 302  VAL C O     1 
ATOM   5909  C  CB    . VAL C 2  302  ? 9.436   -40.630 54.389  1.00 69.92  ? 302  VAL C CB    1 
ATOM   5910  C  CG1   . VAL C 2  302  ? 8.435   -40.152 55.426  1.00 68.45  ? 302  VAL C CG1   1 
ATOM   5911  C  CG2   . VAL C 2  302  ? 10.844  -40.613 54.965  1.00 68.63  ? 302  VAL C CG2   1 
ATOM   5912  N  N     . PHE C 2  303  ? 7.808   -41.672 51.839  1.00 73.46  ? 303  PHE C N     1 
ATOM   5913  C  CA    . PHE C 2  303  ? 6.606   -41.368 51.047  1.00 65.25  ? 303  PHE C CA    1 
ATOM   5914  C  C     . PHE C 2  303  ? 5.528   -42.455 51.046  1.00 71.99  ? 303  PHE C C     1 
ATOM   5915  O  O     . PHE C 2  303  ? 4.354   -42.177 51.317  1.00 73.85  ? 303  PHE C O     1 
ATOM   5916  C  CB    . PHE C 2  303  ? 6.985   -41.006 49.607  1.00 55.79  ? 303  PHE C CB    1 
ATOM   5917  C  CG    . PHE C 2  303  ? 7.776   -39.736 49.493  1.00 54.89  ? 303  PHE C CG    1 
ATOM   5918  C  CD1   . PHE C 2  303  ? 9.159   -39.757 49.565  1.00 62.18  ? 303  PHE C CD1   1 
ATOM   5919  C  CD2   . PHE C 2  303  ? 7.138   -38.518 49.321  1.00 51.79  ? 303  PHE C CD2   1 
ATOM   5920  C  CE1   . PHE C 2  303  ? 9.890   -38.588 49.465  1.00 57.53  ? 303  PHE C CE1   1 
ATOM   5921  C  CE2   . PHE C 2  303  ? 7.865   -37.346 49.221  1.00 50.64  ? 303  PHE C CE2   1 
ATOM   5922  C  CZ    . PHE C 2  303  ? 9.242   -37.381 49.293  1.00 52.26  ? 303  PHE C CZ    1 
ATOM   5923  N  N     . LEU C 2  304  ? 5.927   -43.684 50.739  1.00 76.16  ? 304  LEU C N     1 
ATOM   5924  C  CA    . LEU C 2  304  ? 4.988   -44.805 50.696  1.00 75.65  ? 304  LEU C CA    1 
ATOM   5925  C  C     . LEU C 2  304  ? 4.298   -45.099 52.044  1.00 73.88  ? 304  LEU C C     1 
ATOM   5926  O  O     . LEU C 2  304  ? 3.069   -45.202 52.089  1.00 71.81  ? 304  LEU C O     1 
ATOM   5927  C  CB    . LEU C 2  304  ? 5.652   -46.059 50.108  1.00 81.14  ? 304  LEU C CB    1 
ATOM   5928  C  CG    . LEU C 2  304  ? 4.794   -47.320 50.011  1.00 86.61  ? 304  LEU C CG    1 
ATOM   5929  C  CD1   . LEU C 2  304  ? 3.746   -47.178 48.915  1.00 79.98  ? 304  LEU C CD1   1 
ATOM   5930  C  CD2   . LEU C 2  304  ? 5.666   -48.549 49.783  1.00 81.16  ? 304  LEU C CD2   1 
ATOM   5931  N  N     . PRO C 2  305  ? 5.073   -45.233 53.143  1.00 71.85  ? 305  PRO C N     1 
ATOM   5932  C  CA    . PRO C 2  305  ? 4.424   -45.438 54.444  1.00 73.76  ? 305  PRO C CA    1 
ATOM   5933  C  C     . PRO C 2  305  ? 3.583   -44.242 54.881  1.00 67.86  ? 305  PRO C C     1 
ATOM   5934  O  O     . PRO C 2  305  ? 2.571   -44.431 55.556  1.00 67.09  ? 305  PRO C O     1 
ATOM   5935  C  CB    . PRO C 2  305  ? 5.606   -45.618 55.401  1.00 69.27  ? 305  PRO C CB    1 
ATOM   5936  C  CG    . PRO C 2  305  ? 6.714   -46.090 54.548  1.00 65.04  ? 305  PRO C CG    1 
ATOM   5937  C  CD    . PRO C 2  305  ? 6.536   -45.367 53.253  1.00 65.28  ? 305  PRO C CD    1 
ATOM   5938  N  N     . THR C 2  306  ? 4.001   -43.033 54.515  1.00 70.28  ? 306  THR C N     1 
ATOM   5939  C  CA    . THR C 2  306  ? 3.218   -41.840 54.821  1.00 66.06  ? 306  THR C CA    1 
ATOM   5940  C  C     . THR C 2  306  ? 1.863   -41.915 54.121  1.00 63.75  ? 306  THR C C     1 
ATOM   5941  O  O     . THR C 2  306  ? 0.824   -41.614 54.718  1.00 59.29  ? 306  THR C O     1 
ATOM   5942  C  CB    . THR C 2  306  ? 3.946   -40.551 54.395  1.00 59.88  ? 306  THR C CB    1 
ATOM   5943  O  OG1   . THR C 2  306  ? 5.221   -40.484 55.044  1.00 56.00  ? 306  THR C OG1   1 
ATOM   5944  C  CG2   . THR C 2  306  ? 3.130   -39.326 54.773  1.00 54.75  ? 306  THR C CG2   1 
ATOM   5945  N  N     . LEU C 2  307  ? 1.885   -42.335 52.858  1.00 69.36  ? 307  LEU C N     1 
ATOM   5946  C  CA    . LEU C 2  307  ? 0.660   -42.516 52.083  1.00 72.27  ? 307  LEU C CA    1 
ATOM   5947  C  C     . LEU C 2  307  ? -0.219  -43.605 52.704  1.00 74.44  ? 307  LEU C C     1 
ATOM   5948  O  O     . LEU C 2  307  ? -1.453  -43.479 52.754  1.00 71.96  ? 307  LEU C O     1 
ATOM   5949  C  CB    . LEU C 2  307  ? 1.001   -42.859 50.631  1.00 65.08  ? 307  LEU C CB    1 
ATOM   5950  C  CG    . LEU C 2  307  ? -0.152  -42.845 49.627  1.00 76.41  ? 307  LEU C CG    1 
ATOM   5951  C  CD1   . LEU C 2  307  ? -0.922  -41.537 49.715  1.00 70.20  ? 307  LEU C CD1   1 
ATOM   5952  C  CD2   . LEU C 2  307  ? 0.374   -43.067 48.215  1.00 79.04  ? 307  LEU C CD2   1 
ATOM   5953  N  N     . ARG C 2  308  ? 0.432   -44.663 53.186  1.00 72.64  ? 308  ARG C N     1 
ATOM   5954  C  CA    . ARG C 2  308  ? -0.242  -45.757 53.882  1.00 69.35  ? 308  ARG C CA    1 
ATOM   5955  C  C     . ARG C 2  308  ? -1.003  -45.239 55.099  1.00 67.88  ? 308  ARG C C     1 
ATOM   5956  O  O     . ARG C 2  308  ? -2.194  -45.510 55.261  1.00 62.17  ? 308  ARG C O     1 
ATOM   5957  C  CB    . ARG C 2  308  ? 0.775   -46.827 54.311  1.00 68.30  ? 308  ARG C CB    1 
ATOM   5958  C  CG    . ARG C 2  308  ? 0.165   -48.134 54.824  1.00 69.55  ? 308  ARG C CG    1 
ATOM   5959  C  CD    . ARG C 2  308  ? -0.119  -48.116 56.329  1.00 75.67  ? 308  ARG C CD    1 
ATOM   5960  N  NE    . ARG C 2  308  ? 1.066   -48.402 57.136  1.00 85.93  ? 308  ARG C NE    1 
ATOM   5961  C  CZ    . ARG C 2  308  ? 1.825   -47.478 57.719  1.00 83.11  ? 308  ARG C CZ    1 
ATOM   5962  N  NH1   . ARG C 2  308  ? 2.881   -47.840 58.434  1.00 90.44  ? 308  ARG C NH1   1 
ATOM   5963  N  NH2   . ARG C 2  308  ? 1.532   -46.193 57.590  1.00 74.84  ? 308  ARG C NH2   1 
ATOM   5964  N  N     . TYR C 2  309  ? -0.303  -44.499 55.954  1.00 69.51  ? 309  TYR C N     1 
ATOM   5965  C  CA    . TYR C 2  309  ? -0.899  -43.968 57.173  1.00 61.57  ? 309  TYR C CA    1 
ATOM   5966  C  C     . TYR C 2  309  ? -2.023  -43.002 56.829  1.00 57.24  ? 309  TYR C C     1 
ATOM   5967  O  O     . TYR C 2  309  ? -3.052  -42.980 57.500  1.00 53.27  ? 309  TYR C O     1 
ATOM   5968  C  CB    . TYR C 2  309  ? 0.157   -43.269 58.038  1.00 52.02  ? 309  TYR C CB    1 
ATOM   5969  C  CG    . TYR C 2  309  ? -0.197  -43.177 59.512  1.00 53.05  ? 309  TYR C CG    1 
ATOM   5970  C  CD1   . TYR C 2  309  ? 0.580   -43.812 60.472  1.00 57.65  ? 309  TYR C CD1   1 
ATOM   5971  C  CD2   . TYR C 2  309  ? -1.306  -42.457 59.943  1.00 57.00  ? 309  TYR C CD2   1 
ATOM   5972  C  CE1   . TYR C 2  309  ? 0.262   -43.731 61.819  1.00 59.57  ? 309  TYR C CE1   1 
ATOM   5973  C  CE2   . TYR C 2  309  ? -1.633  -42.372 61.285  1.00 52.36  ? 309  TYR C CE2   1 
ATOM   5974  C  CZ    . TYR C 2  309  ? -0.847  -43.011 62.217  1.00 53.44  ? 309  TYR C CZ    1 
ATOM   5975  O  OH    . TYR C 2  309  ? -1.170  -42.927 63.553  1.00 50.37  ? 309  TYR C OH    1 
ATOM   5976  N  N     . LEU C 2  310  ? -1.826  -42.205 55.782  1.00 60.18  ? 310  LEU C N     1 
ATOM   5977  C  CA    . LEU C 2  310  ? -2.851  -41.255 55.362  1.00 64.49  ? 310  LEU C CA    1 
ATOM   5978  C  C     . LEU C 2  310  ? -4.140  -41.972 54.964  1.00 72.38  ? 310  LEU C C     1 
ATOM   5979  O  O     . LEU C 2  310  ? -5.226  -41.648 55.464  1.00 68.01  ? 310  LEU C O     1 
ATOM   5980  C  CB    . LEU C 2  310  ? -2.349  -40.376 54.214  1.00 61.15  ? 310  LEU C CB    1 
ATOM   5981  C  CG    . LEU C 2  310  ? -3.328  -39.315 53.705  1.00 63.08  ? 310  LEU C CG    1 
ATOM   5982  C  CD1   . LEU C 2  310  ? -3.821  -38.435 54.846  1.00 56.90  ? 310  LEU C CD1   1 
ATOM   5983  C  CD2   . LEU C 2  310  ? -2.689  -38.470 52.611  1.00 63.96  ? 310  LEU C CD2   1 
ATOM   5984  N  N     . PHE C 2  311  ? -4.019  -42.957 54.077  1.00 79.99  ? 311  PHE C N     1 
ATOM   5985  C  CA    . PHE C 2  311  ? -5.193  -43.707 53.635  1.00 72.89  ? 311  PHE C CA    1 
ATOM   5986  C  C     . PHE C 2  311  ? -5.849  -44.486 54.778  1.00 72.63  ? 311  PHE C C     1 
ATOM   5987  O  O     . PHE C 2  311  ? -7.077  -44.581 54.851  1.00 75.46  ? 311  PHE C O     1 
ATOM   5988  C  CB    . PHE C 2  311  ? -4.845  -44.630 52.463  1.00 67.75  ? 311  PHE C CB    1 
ATOM   5989  C  CG    . PHE C 2  311  ? -4.661  -43.904 51.159  1.00 76.72  ? 311  PHE C CG    1 
ATOM   5990  C  CD1   . PHE C 2  311  ? -4.996  -42.564 51.045  1.00 79.55  ? 311  PHE C CD1   1 
ATOM   5991  C  CD2   . PHE C 2  311  ? -4.162  -44.558 50.046  1.00 78.57  ? 311  PHE C CD2   1 
ATOM   5992  C  CE1   . PHE C 2  311  ? -4.833  -41.889 49.849  1.00 81.99  ? 311  PHE C CE1   1 
ATOM   5993  C  CE2   . PHE C 2  311  ? -3.999  -43.887 48.847  1.00 82.87  ? 311  PHE C CE2   1 
ATOM   5994  C  CZ    . PHE C 2  311  ? -4.333  -42.552 48.750  1.00 87.68  ? 311  PHE C CZ    1 
ATOM   5995  N  N     . ALA C 2  312  ? -5.025  -45.021 55.676  1.00 70.91  ? 312  ALA C N     1 
ATOM   5996  C  CA    . ALA C 2  312  ? -5.519  -45.770 56.829  1.00 67.68  ? 312  ALA C CA    1 
ATOM   5997  C  C     . ALA C 2  312  ? -6.320  -44.879 57.774  1.00 65.13  ? 312  ALA C C     1 
ATOM   5998  O  O     . ALA C 2  312  ? -7.379  -45.269 58.266  1.00 69.03  ? 312  ALA C O     1 
ATOM   5999  C  CB    . ALA C 2  312  ? -4.364  -46.426 57.568  1.00 67.09  ? 312  ALA C CB    1 
ATOM   6000  N  N     . LEU C 2  313  ? -5.805  -43.682 58.026  1.00 68.15  ? 313  LEU C N     1 
ATOM   6001  C  CA    . LEU C 2  313  ? -6.499  -42.708 58.855  1.00 71.48  ? 313  LEU C CA    1 
ATOM   6002  C  C     . LEU C 2  313  ? -7.780  -42.259 58.166  1.00 75.29  ? 313  LEU C C     1 
ATOM   6003  O  O     . LEU C 2  313  ? -8.786  -41.981 58.822  1.00 74.81  ? 313  LEU C O     1 
ATOM   6004  C  CB    . LEU C 2  313  ? -5.594  -41.504 59.136  1.00 70.10  ? 313  LEU C CB    1 
ATOM   6005  C  CG    . LEU C 2  313  ? -6.213  -40.305 59.860  1.00 70.35  ? 313  LEU C CG    1 
ATOM   6006  C  CD1   . LEU C 2  313  ? -6.726  -40.698 61.239  1.00 70.93  ? 313  LEU C CD1   1 
ATOM   6007  C  CD2   . LEU C 2  313  ? -5.211  -39.164 59.962  1.00 62.09  ? 313  LEU C CD2   1 
ATOM   6008  N  N     . THR C 2  314  ? -7.739  -42.198 56.838  1.00 73.81  ? 314  THR C N     1 
ATOM   6009  C  CA    . THR C 2  314  ? -8.901  -41.776 56.061  1.00 81.96  ? 314  THR C CA    1 
ATOM   6010  C  C     . THR C 2  314  ? -10.049 -42.784 56.139  1.00 86.83  ? 314  THR C C     1 
ATOM   6011  O  O     . THR C 2  314  ? -11.198 -42.411 56.383  1.00 84.79  ? 314  THR C O     1 
ATOM   6012  C  CB    . THR C 2  314  ? -8.538  -41.544 54.584  1.00 79.82  ? 314  THR C CB    1 
ATOM   6013  O  OG1   . THR C 2  314  ? -7.385  -40.698 54.501  1.00 80.83  ? 314  THR C OG1   1 
ATOM   6014  C  CG2   . THR C 2  314  ? -9.698  -40.890 53.849  1.00 81.67  ? 314  THR C CG2   1 
ATOM   6015  N  N     . ALA C 2  315  ? -9.729  -44.059 55.934  1.00 86.69  ? 315  ALA C N     1 
ATOM   6016  C  CA    . ALA C 2  315  ? -10.739 -45.117 55.901  1.00 83.05  ? 315  ALA C CA    1 
ATOM   6017  C  C     . ALA C 2  315  ? -11.388 -45.382 57.261  1.00 75.30  ? 315  ALA C C     1 
ATOM   6018  O  O     . ALA C 2  315  ? -12.520 -45.863 57.334  1.00 69.26  ? 315  ALA C O     1 
ATOM   6019  C  CB    . ALA C 2  315  ? -10.140 -46.401 55.339  1.00 83.63  ? 315  ALA C CB    1 
ATOM   6020  N  N     . GLY C 2  316  ? -10.672 -45.064 58.334  1.00 72.76  ? 316  GLY C N     1 
ATOM   6021  C  CA    . GLY C 2  316  ? -11.146 -45.358 59.674  1.00 79.81  ? 316  GLY C CA    1 
ATOM   6022  C  C     . GLY C 2  316  ? -10.475 -46.588 60.256  1.00 77.07  ? 316  GLY C C     1 
ATOM   6023  O  O     . GLY C 2  316  ? -10.910 -47.119 61.279  1.00 77.80  ? 316  GLY C O     1 
ATOM   6024  N  N     . VAL C 2  317  ? -9.415  -47.041 59.593  1.00 65.91  ? 317  VAL C N     1 
ATOM   6025  C  CA    . VAL C 2  317  ? -8.621  -48.171 60.066  1.00 68.07  ? 317  VAL C CA    1 
ATOM   6026  C  C     . VAL C 2  317  ? -8.042  -47.893 61.453  1.00 73.16  ? 317  VAL C C     1 
ATOM   6027  O  O     . VAL C 2  317  ? -7.396  -46.867 61.664  1.00 73.66  ? 317  VAL C O     1 
ATOM   6028  C  CB    . VAL C 2  317  ? -7.472  -48.486 59.086  1.00 67.59  ? 317  VAL C CB    1 
ATOM   6029  C  CG1   . VAL C 2  317  ? -6.619  -49.633 59.606  1.00 65.12  ? 317  VAL C CG1   1 
ATOM   6030  C  CG2   . VAL C 2  317  ? -8.025  -48.805 57.703  1.00 60.29  ? 317  VAL C CG2   1 
ATOM   6031  N  N     . PRO C 2  318  ? -8.287  -48.808 62.407  1.00 78.31  ? 318  PRO C N     1 
ATOM   6032  C  CA    . PRO C 2  318  ? -7.837  -48.673 63.798  1.00 79.35  ? 318  PRO C CA    1 
ATOM   6033  C  C     . PRO C 2  318  ? -6.319  -48.591 63.930  1.00 79.29  ? 318  PRO C C     1 
ATOM   6034  O  O     . PRO C 2  318  ? -5.595  -49.147 63.103  1.00 78.11  ? 318  PRO C O     1 
ATOM   6035  C  CB    . PRO C 2  318  ? -8.343  -49.961 64.452  1.00 75.53  ? 318  PRO C CB    1 
ATOM   6036  C  CG    . PRO C 2  318  ? -9.491  -50.386 63.610  1.00 81.77  ? 318  PRO C CG    1 
ATOM   6037  C  CD    . PRO C 2  318  ? -9.110  -50.014 62.213  1.00 77.57  ? 318  PRO C CD    1 
ATOM   6038  N  N     . GLY C 2  319  ? -5.851  -47.906 64.968  1.00 76.69  ? 319  GLY C N     1 
ATOM   6039  C  CA    . GLY C 2  319  ? -4.428  -47.766 65.219  1.00 80.77  ? 319  GLY C CA    1 
ATOM   6040  C  C     . GLY C 2  319  ? -3.827  -46.574 64.501  1.00 77.55  ? 319  GLY C C     1 
ATOM   6041  O  O     . GLY C 2  319  ? -2.607  -46.454 64.383  1.00 76.19  ? 319  GLY C O     1 
ATOM   6042  N  N     . HIS C 2  320  ? -4.694  -45.690 64.017  1.00 79.02  ? 320  HIS C N     1 
ATOM   6043  C  CA    . HIS C 2  320  ? -4.257  -44.481 63.330  1.00 69.15  ? 320  HIS C CA    1 
ATOM   6044  C  C     . HIS C 2  320  ? -5.002  -43.259 63.863  1.00 69.69  ? 320  HIS C C     1 
ATOM   6045  O  O     . HIS C 2  320  ? -6.226  -43.165 63.753  1.00 65.13  ? 320  HIS C O     1 
ATOM   6046  C  CB    . HIS C 2  320  ? -4.463  -44.621 61.821  1.00 65.75  ? 320  HIS C CB    1 
ATOM   6047  C  CG    . HIS C 2  320  ? -3.799  -45.831 61.232  1.00 65.39  ? 320  HIS C CG    1 
ATOM   6048  N  ND1   . HIS C 2  320  ? -4.356  -47.086 61.293  1.00 72.19  ? 320  HIS C ND1   1 
ATOM   6049  C  CD2   . HIS C 2  320  ? -2.622  -45.967 60.578  1.00 66.10  ? 320  HIS C CD2   1 
ATOM   6050  C  CE1   . HIS C 2  320  ? -3.551  -47.952 60.696  1.00 71.98  ? 320  HIS C CE1   1 
ATOM   6051  N  NE2   . HIS C 2  320  ? -2.494  -47.298 60.254  1.00 63.89  ? 320  HIS C NE2   1 
ATOM   6052  N  N     . GLU C 2  321  ? -4.254  -42.325 64.443  1.00 70.61  ? 321  GLU C N     1 
ATOM   6053  C  CA    . GLU C 2  321  ? -4.835  -41.140 65.062  1.00 58.85  ? 321  GLU C CA    1 
ATOM   6054  C  C     . GLU C 2  321  ? -4.110  -39.870 64.627  1.00 53.92  ? 321  GLU C C     1 
ATOM   6055  O  O     . GLU C 2  321  ? -2.924  -39.902 64.300  1.00 50.56  ? 321  GLU C O     1 
ATOM   6056  C  CB    . GLU C 2  321  ? -4.811  -41.271 66.590  1.00 55.82  ? 321  GLU C CB    1 
ATOM   6057  C  CG    . GLU C 2  321  ? -3.839  -42.327 67.116  1.00 66.59  ? 321  GLU C CG    1 
ATOM   6058  C  CD    . GLU C 2  321  ? -2.613  -41.729 67.789  1.00 76.25  ? 321  GLU C CD    1 
ATOM   6059  O  OE1   . GLU C 2  321  ? -2.765  -41.091 68.853  1.00 62.99  ? 321  GLU C OE1   1 
ATOM   6060  O  OE2   . GLU C 2  321  ? -1.495  -41.900 67.255  1.00 75.69  ? 321  GLU C OE2   1 
ATOM   6061  N  N     . VAL C 2  322  ? -4.829  -38.753 64.617  1.00 54.45  ? 322  VAL C N     1 
ATOM   6062  C  CA    . VAL C 2  322  ? -4.230  -37.474 64.257  1.00 49.41  ? 322  VAL C CA    1 
ATOM   6063  C  C     . VAL C 2  322  ? -3.314  -36.988 65.373  1.00 52.04  ? 322  VAL C C     1 
ATOM   6064  O  O     . VAL C 2  322  ? -3.569  -37.239 66.552  1.00 56.11  ? 322  VAL C O     1 
ATOM   6065  C  CB    . VAL C 2  322  ? -5.296  -36.402 63.946  1.00 43.50  ? 322  VAL C CB    1 
ATOM   6066  C  CG1   . VAL C 2  322  ? -6.181  -36.855 62.801  1.00 54.14  ? 322  VAL C CG1   1 
ATOM   6067  C  CG2   . VAL C 2  322  ? -6.131  -36.097 65.177  1.00 49.72  ? 322  VAL C CG2   1 
ATOM   6068  N  N     . ASP C 2  323  ? -2.229  -36.320 64.999  1.00 47.96  ? 323  ASP C N     1 
ATOM   6069  C  CA    . ASP C 2  323  ? -1.289  -35.796 65.985  1.00 49.74  ? 323  ASP C CA    1 
ATOM   6070  C  C     . ASP C 2  323  ? -1.772  -34.489 66.609  1.00 47.37  ? 323  ASP C C     1 
ATOM   6071  O  O     . ASP C 2  323  ? -2.547  -33.746 66.005  1.00 43.67  ? 323  ASP C O     1 
ATOM   6072  C  CB    . ASP C 2  323  ? 0.101   -35.614 65.372  1.00 50.49  ? 323  ASP C CB    1 
ATOM   6073  C  CG    . ASP C 2  323  ? 0.666   -36.907 64.818  1.00 56.65  ? 323  ASP C CG    1 
ATOM   6074  O  OD1   . ASP C 2  323  ? 1.856   -37.200 65.069  1.00 51.47  ? 323  ASP C OD1   1 
ATOM   6075  O  OD2   . ASP C 2  323  ? -0.083  -37.628 64.125  1.00 57.14  ? 323  ASP C OD2   1 
ATOM   6076  N  N     . ASP C 2  324  ? -1.312  -34.226 67.828  1.00 40.83  ? 324  ASP C N     1 
ATOM   6077  C  CA    . ASP C 2  324  ? -1.585  -32.967 68.509  1.00 34.25  ? 324  ASP C CA    1 
ATOM   6078  C  C     . ASP C 2  324  ? -0.373  -32.051 68.344  1.00 36.88  ? 324  ASP C C     1 
ATOM   6079  O  O     . ASP C 2  324  ? 0.712   -32.349 68.842  1.00 38.21  ? 324  ASP C O     1 
ATOM   6080  C  CB    . ASP C 2  324  ? -1.862  -33.226 69.991  1.00 29.14  ? 324  ASP C CB    1 
ATOM   6081  C  CG    . ASP C 2  324  ? -2.530  -32.050 70.684  1.00 34.58  ? 324  ASP C CG    1 
ATOM   6082  O  OD1   . ASP C 2  324  ? -2.404  -30.905 70.201  1.00 41.25  ? 324  ASP C OD1   1 
ATOM   6083  O  OD2   . ASP C 2  324  ? -3.184  -32.275 71.724  1.00 35.13  ? 324  ASP C OD2   1 
ATOM   6084  N  N     . ILE C 2  325  ? -0.557  -30.940 67.639  1.00 33.56  ? 325  ILE C N     1 
ATOM   6085  C  CA    . ILE C 2  325  ? 0.546   -30.032 67.337  1.00 32.47  ? 325  ILE C CA    1 
ATOM   6086  C  C     . ILE C 2  325  ? 1.107   -29.361 68.592  1.00 30.96  ? 325  ILE C C     1 
ATOM   6087  O  O     . ILE C 2  325  ? 2.310   -29.116 68.692  1.00 28.00  ? 325  ILE C O     1 
ATOM   6088  C  CB    . ILE C 2  325  ? 0.117   -28.962 66.315  1.00 34.82  ? 325  ILE C CB    1 
ATOM   6089  C  CG1   . ILE C 2  325  ? -0.431  -29.631 65.054  1.00 43.28  ? 325  ILE C CG1   1 
ATOM   6090  C  CG2   . ILE C 2  325  ? 1.280   -28.052 65.963  1.00 35.29  ? 325  ILE C CG2   1 
ATOM   6091  C  CD1   . ILE C 2  325  ? -0.890  -28.654 63.994  1.00 63.94  ? 325  ILE C CD1   1 
ATOM   6092  N  N     . ASP C 2  326  ? 0.232   -29.078 69.552  1.00 29.47  ? 326  ASP C N     1 
ATOM   6093  C  CA    . ASP C 2  326  ? 0.638   -28.411 70.785  1.00 28.88  ? 326  ASP C CA    1 
ATOM   6094  C  C     . ASP C 2  326  ? 1.082   -29.393 71.865  1.00 28.10  ? 326  ASP C C     1 
ATOM   6095  O  O     . ASP C 2  326  ? 1.466   -28.980 72.961  1.00 26.70  ? 326  ASP C O     1 
ATOM   6096  C  CB    . ASP C 2  326  ? -0.492  -27.529 71.317  1.00 37.68  ? 326  ASP C CB    1 
ATOM   6097  C  CG    . ASP C 2  326  ? -0.766  -26.336 70.428  1.00 45.14  ? 326  ASP C CG    1 
ATOM   6098  O  OD1   . ASP C 2  326  ? 0.209   -25.709 69.958  1.00 40.33  ? 326  ASP C OD1   1 
ATOM   6099  O  OD2   . ASP C 2  326  ? -1.956  -26.031 70.198  1.00 49.19  ? 326  ASP C OD2   1 
ATOM   6100  N  N     . HIS C 2  327  ? 1.016   -30.686 71.556  1.00 24.84  ? 327  HIS C N     1 
ATOM   6101  C  CA    . HIS C 2  327  ? 1.507   -31.722 72.458  1.00 23.77  ? 327  HIS C CA    1 
ATOM   6102  C  C     . HIS C 2  327  ? 3.001   -31.507 72.639  1.00 22.59  ? 327  HIS C C     1 
ATOM   6103  O  O     . HIS C 2  327  ? 3.696   -31.150 71.689  1.00 24.41  ? 327  HIS C O     1 
ATOM   6104  C  CB    . HIS C 2  327  ? 1.248   -33.108 71.860  1.00 27.25  ? 327  HIS C CB    1 
ATOM   6105  C  CG    . HIS C 2  327  ? 1.249   -34.223 72.863  1.00 25.92  ? 327  HIS C CG    1 
ATOM   6106  N  ND1   . HIS C 2  327  ? 2.407   -34.801 73.336  1.00 25.21  ? 327  HIS C ND1   1 
ATOM   6107  C  CD2   . HIS C 2  327  ? 0.229   -34.882 73.463  1.00 24.09  ? 327  HIS C CD2   1 
ATOM   6108  C  CE1   . HIS C 2  327  ? 2.100   -35.760 74.194  1.00 20.88  ? 327  HIS C CE1   1 
ATOM   6109  N  NE2   . HIS C 2  327  ? 0.786   -35.828 74.288  1.00 19.10  ? 327  HIS C NE2   1 
ATOM   6110  N  N     . LEU C 2  328  ? 3.505   -31.733 73.846  1.00 17.30  ? 328  LEU C N     1 
ATOM   6111  C  CA    . LEU C 2  328  ? 4.907   -31.446 74.117  1.00 18.79  ? 328  LEU C CA    1 
ATOM   6112  C  C     . LEU C 2  328  ? 5.798   -32.598 73.682  1.00 20.84  ? 328  LEU C C     1 
ATOM   6113  O  O     . LEU C 2  328  ? 7.017   -32.559 73.861  1.00 24.13  ? 328  LEU C O     1 
ATOM   6114  C  CB    . LEU C 2  328  ? 5.139   -31.085 75.585  1.00 19.07  ? 328  LEU C CB    1 
ATOM   6115  C  CG    . LEU C 2  328  ? 5.044   -29.587 75.888  1.00 16.72  ? 328  LEU C CG    1 
ATOM   6116  C  CD1   . LEU C 2  328  ? 5.450   -29.290 77.322  1.00 16.19  ? 328  LEU C CD1   1 
ATOM   6117  C  CD2   . LEU C 2  328  ? 5.893   -28.787 74.910  1.00 13.67  ? 328  LEU C CD2   1 
ATOM   6118  N  N     . GLY C 2  329  ? 5.175   -33.628 73.124  1.00 18.65  ? 329  GLY C N     1 
ATOM   6119  C  CA    . GLY C 2  329  ? 5.907   -34.668 72.432  1.00 25.01  ? 329  GLY C CA    1 
ATOM   6120  C  C     . GLY C 2  329  ? 6.166   -34.241 70.999  1.00 28.63  ? 329  GLY C C     1 
ATOM   6121  O  O     . GLY C 2  329  ? 7.130   -34.677 70.373  1.00 34.25  ? 329  GLY C O     1 
ATOM   6122  N  N     . ASN C 2  330  ? 5.279   -33.402 70.471  1.00 24.57  ? 330  ASN C N     1 
ATOM   6123  C  CA    . ASN C 2  330  ? 5.408   -32.889 69.109  1.00 26.24  ? 330  ASN C CA    1 
ATOM   6124  C  C     . ASN C 2  330  ? 6.039   -31.500 69.000  1.00 24.33  ? 330  ASN C C     1 
ATOM   6125  O  O     . ASN C 2  330  ? 6.171   -30.956 67.903  1.00 21.56  ? 330  ASN C O     1 
ATOM   6126  C  CB    . ASN C 2  330  ? 4.057   -32.928 68.398  1.00 31.27  ? 330  ASN C CB    1 
ATOM   6127  C  CG    . ASN C 2  330  ? 3.471   -34.321 68.353  1.00 28.67  ? 330  ASN C CG    1 
ATOM   6128  O  OD1   . ASN C 2  330  ? 4.201   -35.311 68.384  1.00 31.83  ? 330  ASN C OD1   1 
ATOM   6129  N  ND2   . ASN C 2  330  ? 2.150   -34.407 68.282  1.00 32.56  ? 330  ASN C ND2   1 
ATOM   6130  N  N     . ARG C 2  331  ? 6.404   -30.925 70.142  1.00 20.95  ? 331  ARG C N     1 
ATOM   6131  C  CA    . ARG C 2  331  ? 7.133   -29.662 70.174  1.00 19.24  ? 331  ARG C CA    1 
ATOM   6132  C  C     . ARG C 2  331  ? 8.439   -29.876 70.918  1.00 19.72  ? 331  ARG C C     1 
ATOM   6133  O  O     . ARG C 2  331  ? 8.447   -30.391 72.035  1.00 20.70  ? 331  ARG C O     1 
ATOM   6134  C  CB    . ARG C 2  331  ? 6.328   -28.573 70.888  1.00 22.15  ? 331  ARG C CB    1 
ATOM   6135  C  CG    . ARG C 2  331  ? 5.121   -28.054 70.132  1.00 25.13  ? 331  ARG C CG    1 
ATOM   6136  C  CD    . ARG C 2  331  ? 4.324   -27.068 70.985  1.00 26.95  ? 331  ARG C CD    1 
ATOM   6137  N  NE    . ARG C 2  331  ? 4.951   -25.751 71.069  1.00 21.47  ? 331  ARG C NE    1 
ATOM   6138  C  CZ    . ARG C 2  331  ? 4.509   -24.763 71.842  1.00 22.39  ? 331  ARG C CZ    1 
ATOM   6139  N  NH1   . ARG C 2  331  ? 3.443   -24.946 72.608  1.00 34.12  ? 331  ARG C NH1   1 
ATOM   6140  N  NH2   . ARG C 2  331  ? 5.132   -23.594 71.857  1.00 20.50  ? 331  ARG C NH2   1 
ATOM   6141  N  N     . ARG C 2  332  ? 9.546   -29.475 70.308  1.00 23.28  ? 332  ARG C N     1 
ATOM   6142  C  CA    . ARG C 2  332  ? 10.842  -29.634 70.949  1.00 24.00  ? 332  ARG C CA    1 
ATOM   6143  C  C     . ARG C 2  332  ? 11.526  -28.300 71.231  1.00 18.33  ? 332  ARG C C     1 
ATOM   6144  O  O     . ARG C 2  332  ? 11.014  -27.228 70.878  1.00 16.61  ? 332  ARG C O     1 
ATOM   6145  C  CB    . ARG C 2  332  ? 11.753  -30.533 70.106  1.00 27.80  ? 332  ARG C CB    1 
ATOM   6146  C  CG    . ARG C 2  332  ? 11.905  -30.089 68.654  1.00 25.73  ? 332  ARG C CG    1 
ATOM   6147  C  CD    . ARG C 2  332  ? 12.858  -31.000 67.895  1.00 22.32  ? 332  ARG C CD    1 
ATOM   6148  N  NE    . ARG C 2  332  ? 14.200  -30.968 68.465  1.00 23.11  ? 332  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 2  332  ? 15.188  -30.206 68.009  1.00 25.33  ? 332  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 2  332  ? 14.989  -29.416 66.962  1.00 21.70  ? 332  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 2  332  ? 16.378  -30.237 68.596  1.00 25.37  ? 332  ARG C NH2   1 
ATOM   6152  N  N     . ILE C 2  333  ? 12.698  -28.393 71.853  1.00 18.23  ? 333  ILE C N     1 
ATOM   6153  C  CA    . ILE C 2  333  ? 13.471  -27.232 72.268  1.00 15.91  ? 333  ILE C CA    1 
ATOM   6154  C  C     . ILE C 2  333  ? 14.826  -27.190 71.586  1.00 18.09  ? 333  ILE C C     1 
ATOM   6155  O  O     . ILE C 2  333  ? 15.628  -28.112 71.725  1.00 23.27  ? 333  ILE C O     1 
ATOM   6156  C  CB    . ILE C 2  333  ? 13.749  -27.265 73.774  1.00 14.00  ? 333  ILE C CB    1 
ATOM   6157  C  CG1   . ILE C 2  333  ? 12.450  -27.428 74.559  1.00 18.81  ? 333  ILE C CG1   1 
ATOM   6158  C  CG2   . ILE C 2  333  ? 14.495  -26.010 74.199  1.00 15.18  ? 333  ILE C CG2   1 
ATOM   6159  C  CD1   . ILE C 2  333  ? 11.542  -26.229 74.487  1.00 25.38  ? 333  ILE C CD1   1 
ATOM   6160  N  N     . ARG C 2  334  ? 15.086  -26.110 70.862  1.00 18.74  ? 334  ARG C N     1 
ATOM   6161  C  CA    . ARG C 2  334  ? 16.405  -25.861 70.312  1.00 19.39  ? 334  ARG C CA    1 
ATOM   6162  C  C     . ARG C 2  334  ? 17.150  -24.993 71.312  1.00 14.56  ? 334  ARG C C     1 
ATOM   6163  O  O     . ARG C 2  334  ? 16.810  -23.828 71.506  1.00 15.41  ? 334  ARG C O     1 
ATOM   6164  C  CB    . ARG C 2  334  ? 16.290  -25.135 68.971  1.00 18.92  ? 334  ARG C CB    1 
ATOM   6165  C  CG    . ARG C 2  334  ? 15.343  -25.803 67.984  1.00 19.44  ? 334  ARG C CG    1 
ATOM   6166  C  CD    . ARG C 2  334  ? 15.166  -24.965 66.730  1.00 22.27  ? 334  ARG C CD    1 
ATOM   6167  N  NE    . ARG C 2  334  ? 16.403  -24.851 65.966  1.00 30.48  ? 334  ARG C NE    1 
ATOM   6168  C  CZ    . ARG C 2  334  ? 16.613  -23.941 65.020  1.00 38.78  ? 334  ARG C CZ    1 
ATOM   6169  N  NH1   . ARG C 2  334  ? 15.666  -23.059 64.728  1.00 41.66  ? 334  ARG C NH1   1 
ATOM   6170  N  NH2   . ARG C 2  334  ? 17.769  -23.905 64.372  1.00 38.19  ? 334  ARG C NH2   1 
ATOM   6171  N  N     . THR C 2  335  ? 18.169  -25.567 71.942  1.00 14.86  ? 335  THR C N     1 
ATOM   6172  C  CA    . THR C 2  335  ? 18.926  -24.869 72.974  1.00 16.06  ? 335  THR C CA    1 
ATOM   6173  C  C     . THR C 2  335  ? 20.122  -24.137 72.380  1.00 15.69  ? 335  THR C C     1 
ATOM   6174  O  O     . THR C 2  335  ? 20.361  -24.215 71.177  1.00 17.54  ? 335  THR C O     1 
ATOM   6175  C  CB    . THR C 2  335  ? 19.388  -25.832 74.079  1.00 19.57  ? 335  THR C CB    1 
ATOM   6176  O  OG1   . THR C 2  335  ? 20.003  -26.984 73.487  1.00 24.93  ? 335  THR C OG1   1 
ATOM   6177  C  CG2   . THR C 2  335  ? 18.202  -26.281 74.910  1.00 20.04  ? 335  THR C CG2   1 
ATOM   6178  N  N     . VAL C 2  336  ? 20.870  -23.437 73.231  1.00 15.09  ? 336  VAL C N     1 
ATOM   6179  C  CA    . VAL C 2  336  ? 21.947  -22.551 72.786  1.00 15.84  ? 336  VAL C CA    1 
ATOM   6180  C  C     . VAL C 2  336  ? 22.916  -23.228 71.814  1.00 22.28  ? 336  VAL C C     1 
ATOM   6181  O  O     . VAL C 2  336  ? 23.314  -22.638 70.802  1.00 24.92  ? 336  VAL C O     1 
ATOM   6182  C  CB    . VAL C 2  336  ? 22.719  -21.950 73.988  1.00 13.09  ? 336  VAL C CB    1 
ATOM   6183  C  CG1   . VAL C 2  336  ? 23.066  -23.024 75.002  1.00 17.88  ? 336  VAL C CG1   1 
ATOM   6184  C  CG2   . VAL C 2  336  ? 23.969  -21.235 73.519  1.00 13.28  ? 336  VAL C CG2   1 
ATOM   6185  N  N     . GLY C 2  337  ? 23.259  -24.478 72.106  1.00 19.19  ? 337  GLY C N     1 
ATOM   6186  C  CA    . GLY C 2  337  ? 24.184  -25.233 71.281  1.00 19.53  ? 337  GLY C CA    1 
ATOM   6187  C  C     . GLY C 2  337  ? 23.699  -25.463 69.862  1.00 21.03  ? 337  GLY C C     1 
ATOM   6188  O  O     . GLY C 2  337  ? 24.462  -25.309 68.908  1.00 22.11  ? 337  GLY C O     1 
ATOM   6189  N  N     . GLU C 2  338  ? 22.429  -25.835 69.723  1.00 21.66  ? 338  GLU C N     1 
ATOM   6190  C  CA    . GLU C 2  338  ? 21.837  -26.070 68.410  1.00 20.30  ? 338  GLU C CA    1 
ATOM   6191  C  C     . GLU C 2  338  ? 21.704  -24.768 67.621  1.00 24.18  ? 338  GLU C C     1 
ATOM   6192  O  O     . GLU C 2  338  ? 22.005  -24.718 66.421  1.00 29.34  ? 338  GLU C O     1 
ATOM   6193  C  CB    . GLU C 2  338  ? 20.475  -26.755 68.551  1.00 15.26  ? 338  GLU C CB    1 
ATOM   6194  C  CG    . GLU C 2  338  ? 19.704  -26.876 67.244  1.00 23.44  ? 338  GLU C CG    1 
ATOM   6195  C  CD    . GLU C 2  338  ? 18.462  -27.743 67.366  1.00 26.57  ? 338  GLU C CD    1 
ATOM   6196  O  OE1   . GLU C 2  338  ? 18.202  -28.274 68.468  1.00 20.78  ? 338  GLU C OE1   1 
ATOM   6197  O  OE2   . GLU C 2  338  ? 17.746  -27.897 66.353  1.00 30.48  ? 338  GLU C OE2   1 
ATOM   6198  N  N     . LEU C 2  339  ? 21.266  -23.716 68.308  1.00 18.74  ? 339  LEU C N     1 
ATOM   6199  C  CA    . LEU C 2  339  ? 21.087  -22.408 67.688  1.00 21.05  ? 339  LEU C CA    1 
ATOM   6200  C  C     . LEU C 2  339  ? 22.407  -21.841 67.183  1.00 23.57  ? 339  LEU C C     1 
ATOM   6201  O  O     . LEU C 2  339  ? 22.456  -21.223 66.121  1.00 28.02  ? 339  LEU C O     1 
ATOM   6202  C  CB    . LEU C 2  339  ? 20.447  -21.432 68.673  1.00 22.40  ? 339  LEU C CB    1 
ATOM   6203  C  CG    . LEU C 2  339  ? 19.075  -21.836 69.210  1.00 21.81  ? 339  LEU C CG    1 
ATOM   6204  C  CD1   . LEU C 2  339  ? 18.559  -20.782 70.178  1.00 15.59  ? 339  LEU C CD1   1 
ATOM   6205  C  CD2   . LEU C 2  339  ? 18.091  -22.074 68.067  1.00 16.31  ? 339  LEU C CD2   1 
ATOM   6206  N  N     . MET C 2  340  ? 23.471  -22.050 67.953  1.00 21.77  ? 340  MET C N     1 
ATOM   6207  C  CA    . MET C 2  340  ? 24.804  -21.622 67.541  1.00 23.59  ? 340  MET C CA    1 
ATOM   6208  C  C     . MET C 2  340  ? 25.307  -22.485 66.382  1.00 25.76  ? 340  MET C C     1 
ATOM   6209  O  O     . MET C 2  340  ? 25.838  -21.975 65.388  1.00 28.44  ? 340  MET C O     1 
ATOM   6210  C  CB    . MET C 2  340  ? 25.773  -21.695 68.725  1.00 23.78  ? 340  MET C CB    1 
ATOM   6211  C  CG    . MET C 2  340  ? 27.146  -21.080 68.466  1.00 31.98  ? 340  MET C CG    1 
ATOM   6212  S  SD    . MET C 2  340  ? 28.303  -22.149 67.576  1.00 24.62  ? 340  MET C SD    1 
ATOM   6213  C  CE    . MET C 2  340  ? 28.608  -23.420 68.799  1.00 24.78  ? 340  MET C CE    1 
ATOM   6214  N  N     . THR C 2  341  ? 25.141  -23.795 66.523  1.00 23.55  ? 341  THR C N     1 
ATOM   6215  C  CA    . THR C 2  341  ? 25.556  -24.738 65.494  1.00 23.71  ? 341  THR C CA    1 
ATOM   6216  C  C     . THR C 2  341  ? 24.925  -24.432 64.135  1.00 30.90  ? 341  THR C C     1 
ATOM   6217  O  O     . THR C 2  341  ? 25.576  -24.578 63.105  1.00 35.02  ? 341  THR C O     1 
ATOM   6218  C  CB    . THR C 2  341  ? 25.248  -26.188 65.912  1.00 23.94  ? 341  THR C CB    1 
ATOM   6219  O  OG1   . THR C 2  341  ? 26.084  -26.545 67.018  1.00 19.84  ? 341  THR C OG1   1 
ATOM   6220  C  CG2   . THR C 2  341  ? 25.498  -27.156 64.764  1.00 28.52  ? 341  THR C CG2   1 
ATOM   6221  N  N     . ASP C 2  342  ? 23.668  -23.995 64.130  1.00 28.75  ? 342  ASP C N     1 
ATOM   6222  C  CA    . ASP C 2  342  ? 23.004  -23.656 62.870  1.00 27.74  ? 342  ASP C CA    1 
ATOM   6223  C  C     . ASP C 2  342  ? 23.717  -22.526 62.126  1.00 30.80  ? 342  ASP C C     1 
ATOM   6224  O  O     . ASP C 2  342  ? 24.027  -22.639 60.928  1.00 39.53  ? 342  ASP C O     1 
ATOM   6225  C  CB    . ASP C 2  342  ? 21.538  -23.296 63.108  1.00 32.64  ? 342  ASP C CB    1 
ATOM   6226  C  CG    . ASP C 2  342  ? 20.589  -24.381 62.631  1.00 51.53  ? 342  ASP C CG    1 
ATOM   6227  O  OD1   . ASP C 2  342  ? 20.387  -25.366 63.375  1.00 54.05  ? 342  ASP C OD1   1 
ATOM   6228  O  OD2   . ASP C 2  342  ? 20.049  -24.249 61.511  1.00 54.78  ? 342  ASP C OD2   1 
ATOM   6229  N  N     . GLN C 2  343  ? 23.987  -21.441 62.842  1.00 28.39  ? 343  GLN C N     1 
ATOM   6230  C  CA    . GLN C 2  343  ? 24.679  -20.301 62.256  1.00 31.45  ? 343  GLN C CA    1 
ATOM   6231  C  C     . GLN C 2  343  ? 26.105  -20.668 61.866  1.00 34.59  ? 343  GLN C C     1 
ATOM   6232  O  O     . GLN C 2  343  ? 26.652  -20.146 60.881  1.00 41.00  ? 343  GLN C O     1 
ATOM   6233  C  CB    . GLN C 2  343  ? 24.658  -19.113 63.213  1.00 22.90  ? 343  GLN C CB    1 
ATOM   6234  C  CG    . GLN C 2  343  ? 23.261  -18.580 63.444  1.00 33.27  ? 343  GLN C CG    1 
ATOM   6235  C  CD    . GLN C 2  343  ? 22.531  -18.307 62.141  1.00 38.25  ? 343  GLN C CD    1 
ATOM   6236  O  OE1   . GLN C 2  343  ? 22.984  -17.511 61.319  1.00 38.14  ? 343  GLN C OE1   1 
ATOM   6237  N  NE2   . GLN C 2  343  ? 21.401  -18.979 61.941  1.00 34.61  ? 343  GLN C NE2   1 
ATOM   6238  N  N     . PHE C 2  344  ? 26.699  -21.581 62.628  1.00 29.69  ? 344  PHE C N     1 
ATOM   6239  C  CA    . PHE C 2  344  ? 28.018  -22.089 62.285  1.00 32.21  ? 344  PHE C CA    1 
ATOM   6240  C  C     . PHE C 2  344  ? 27.959  -22.799 60.936  1.00 32.44  ? 344  PHE C C     1 
ATOM   6241  O  O     . PHE C 2  344  ? 28.837  -22.622 60.089  1.00 37.32  ? 344  PHE C O     1 
ATOM   6242  C  CB    . PHE C 2  344  ? 28.541  -23.039 63.364  1.00 33.90  ? 344  PHE C CB    1 
ATOM   6243  C  CG    . PHE C 2  344  ? 30.014  -23.308 63.262  1.00 24.80  ? 344  PHE C CG    1 
ATOM   6244  C  CD1   . PHE C 2  344  ? 30.494  -24.303 62.431  1.00 23.88  ? 344  PHE C CD1   1 
ATOM   6245  C  CD2   . PHE C 2  344  ? 30.919  -22.553 63.987  1.00 24.62  ? 344  PHE C CD2   1 
ATOM   6246  C  CE1   . PHE C 2  344  ? 31.847  -24.543 62.331  1.00 30.10  ? 344  PHE C CE1   1 
ATOM   6247  C  CE2   . PHE C 2  344  ? 32.273  -22.789 63.889  1.00 21.27  ? 344  PHE C CE2   1 
ATOM   6248  C  CZ    . PHE C 2  344  ? 32.738  -23.785 63.064  1.00 27.30  ? 344  PHE C CZ    1 
ATOM   6249  N  N     . ARG C 2  345  ? 26.910  -23.593 60.745  1.00 32.31  ? 345  ARG C N     1 
ATOM   6250  C  CA    . ARG C 2  345  ? 26.687  -24.307 59.495  1.00 35.97  ? 345  ARG C CA    1 
ATOM   6251  C  C     . ARG C 2  345  ? 26.507  -23.332 58.330  1.00 33.42  ? 345  ARG C C     1 
ATOM   6252  O  O     . ARG C 2  345  ? 27.061  -23.533 57.244  1.00 34.03  ? 345  ARG C O     1 
ATOM   6253  C  CB    . ARG C 2  345  ? 25.477  -25.235 59.626  1.00 29.12  ? 345  ARG C CB    1 
ATOM   6254  C  CG    . ARG C 2  345  ? 25.173  -26.044 58.380  1.00 47.28  ? 345  ARG C CG    1 
ATOM   6255  C  CD    . ARG C 2  345  ? 24.142  -27.132 58.656  1.00 64.17  ? 345  ARG C CD    1 
ATOM   6256  N  NE    . ARG C 2  345  ? 24.671  -28.208 59.495  1.00 71.89  ? 345  ARG C NE    1 
ATOM   6257  C  CZ    . ARG C 2  345  ? 24.362  -28.386 60.777  1.00 71.64  ? 345  ARG C CZ    1 
ATOM   6258  N  NH1   . ARG C 2  345  ? 24.894  -29.395 61.456  1.00 51.25  ? 345  ARG C NH1   1 
ATOM   6259  N  NH2   . ARG C 2  345  ? 23.517  -27.559 61.382  1.00 71.29  ? 345  ARG C NH2   1 
ATOM   6260  N  N     . VAL C 2  346  ? 25.744  -22.268 58.565  1.00 31.61  ? 346  VAL C N     1 
ATOM   6261  C  CA    . VAL C 2  346  ? 25.554  -21.226 57.552  1.00 33.97  ? 346  VAL C CA    1 
ATOM   6262  C  C     . VAL C 2  346  ? 26.869  -20.548 57.119  1.00 34.63  ? 346  VAL C C     1 
ATOM   6263  O  O     . VAL C 2  346  ? 27.219  -20.515 55.916  1.00 37.43  ? 346  VAL C O     1 
ATOM   6264  C  CB    . VAL C 2  346  ? 24.563  -20.158 58.050  1.00 32.61  ? 346  VAL C CB    1 
ATOM   6265  C  CG1   . VAL C 2  346  ? 24.534  -18.972 57.106  1.00 37.78  ? 346  VAL C CG1   1 
ATOM   6266  C  CG2   . VAL C 2  346  ? 23.176  -20.765 58.209  1.00 33.94  ? 346  VAL C CG2   1 
ATOM   6267  N  N     . GLY C 2  347  ? 27.592  -20.011 58.102  1.00 35.19  ? 347  GLY C N     1 
ATOM   6268  C  CA    . GLY C 2  347  ? 28.867  -19.366 57.838  1.00 29.82  ? 347  GLY C CA    1 
ATOM   6269  C  C     . GLY C 2  347  ? 29.831  -20.305 57.137  1.00 35.53  ? 347  GLY C C     1 
ATOM   6270  O  O     . GLY C 2  347  ? 30.567  -19.905 56.226  1.00 36.71  ? 347  GLY C O     1 
ATOM   6271  N  N     . LEU C 2  348  ? 29.811  -21.566 57.559  1.00 31.53  ? 348  LEU C N     1 
ATOM   6272  C  CA    . LEU C 2  348  ? 30.638  -22.598 56.948  1.00 33.43  ? 348  LEU C CA    1 
ATOM   6273  C  C     . LEU C 2  348  ? 30.281  -22.794 55.477  1.00 35.36  ? 348  LEU C C     1 
ATOM   6274  O  O     . LEU C 2  348  ? 31.162  -22.957 54.630  1.00 32.61  ? 348  LEU C O     1 
ATOM   6275  C  CB    . LEU C 2  348  ? 30.483  -23.915 57.707  1.00 27.79  ? 348  LEU C CB    1 
ATOM   6276  C  CG    . LEU C 2  348  ? 31.779  -24.616 58.103  1.00 26.02  ? 348  LEU C CG    1 
ATOM   6277  C  CD1   . LEU C 2  348  ? 32.708  -23.636 58.795  1.00 29.16  ? 348  LEU C CD1   1 
ATOM   6278  C  CD2   . LEU C 2  348  ? 31.478  -25.800 59.003  1.00 27.74  ? 348  LEU C CD2   1 
ATOM   6279  N  N     . ALA C 2  349  ? 28.985  -22.777 55.179  1.00 40.94  ? 349  ALA C N     1 
ATOM   6280  C  CA    . ALA C 2  349  ? 28.524  -22.886 53.798  1.00 41.10  ? 349  ALA C CA    1 
ATOM   6281  C  C     . ALA C 2  349  ? 29.053  -21.730 52.952  1.00 41.51  ? 349  ALA C C     1 
ATOM   6282  O  O     . ALA C 2  349  ? 29.592  -21.942 51.851  1.00 46.20  ? 349  ALA C O     1 
ATOM   6283  C  CB    . ALA C 2  349  ? 27.003  -22.941 53.743  1.00 33.38  ? 349  ALA C CB    1 
ATOM   6284  N  N     . ARG C 2  350  ? 28.907  -20.508 53.466  1.00 36.53  ? 350  ARG C N     1 
ATOM   6285  C  CA    . ARG C 2  350  ? 29.436  -19.344 52.747  1.00 37.58  ? 350  ARG C CA    1 
ATOM   6286  C  C     . ARG C 2  350  ? 30.941  -19.475 52.490  1.00 44.61  ? 350  ARG C C     1 
ATOM   6287  O  O     . ARG C 2  350  ? 31.429  -19.209 51.376  1.00 47.23  ? 350  ARG C O     1 
ATOM   6288  C  CB    . ARG C 2  350  ? 29.129  -18.049 53.496  1.00 33.75  ? 350  ARG C CB    1 
ATOM   6289  C  CG    . ARG C 2  350  ? 27.662  -17.886 53.837  1.00 39.07  ? 350  ARG C CG    1 
ATOM   6290  C  CD    . ARG C 2  350  ? 27.285  -16.429 54.019  1.00 45.52  ? 350  ARG C CD    1 
ATOM   6291  N  NE    . ARG C 2  350  ? 25.884  -16.284 54.405  1.00 45.93  ? 350  ARG C NE    1 
ATOM   6292  C  CZ    . ARG C 2  350  ? 25.477  -15.913 55.614  1.00 42.05  ? 350  ARG C CZ    1 
ATOM   6293  N  NH1   . ARG C 2  350  ? 26.365  -15.634 56.561  1.00 33.60  ? 350  ARG C NH1   1 
ATOM   6294  N  NH2   . ARG C 2  350  ? 24.179  -15.812 55.872  1.00 38.56  ? 350  ARG C NH2   1 
ATOM   6295  N  N     . LEU C 2  351  ? 31.666  -19.902 53.522  1.00 42.34  ? 351  LEU C N     1 
ATOM   6296  C  CA    . LEU C 2  351  ? 33.097  -20.168 53.404  1.00 40.84  ? 351  LEU C CA    1 
ATOM   6297  C  C     . LEU C 2  351  ? 33.386  -21.195 52.308  1.00 45.75  ? 351  LEU C C     1 
ATOM   6298  O  O     . LEU C 2  351  ? 34.391  -21.094 51.604  1.00 45.71  ? 351  LEU C O     1 
ATOM   6299  C  CB    . LEU C 2  351  ? 33.662  -20.645 54.746  1.00 34.80  ? 351  LEU C CB    1 
ATOM   6300  C  CG    . LEU C 2  351  ? 35.145  -21.009 54.841  1.00 27.77  ? 351  LEU C CG    1 
ATOM   6301  C  CD1   . LEU C 2  351  ? 35.687  -20.599 56.196  1.00 31.29  ? 351  LEU C CD1   1 
ATOM   6302  C  CD2   . LEU C 2  351  ? 35.361  -22.498 54.626  1.00 24.36  ? 351  LEU C CD2   1 
ATOM   6303  N  N     . ALA C 2  352  ? 32.499  -22.179 52.174  1.00 40.65  ? 352  ALA C N     1 
ATOM   6304  C  CA    . ALA C 2  352  ? 32.650  -23.222 51.162  1.00 43.16  ? 352  ALA C CA    1 
ATOM   6305  C  C     . ALA C 2  352  ? 32.477  -22.674 49.748  1.00 53.28  ? 352  ALA C C     1 
ATOM   6306  O  O     . ALA C 2  352  ? 33.291  -22.960 48.855  1.00 64.13  ? 352  ALA C O     1 
ATOM   6307  C  CB    . ALA C 2  352  ? 31.672  -24.357 51.417  1.00 49.44  ? 352  ALA C CB    1 
ATOM   6308  N  N     . ARG C 2  353  ? 31.414  -21.899 49.540  1.00 53.94  ? 353  ARG C N     1 
ATOM   6309  C  CA    . ARG C 2  353  ? 31.215  -21.236 48.249  1.00 59.01  ? 353  ARG C CA    1 
ATOM   6310  C  C     . ARG C 2  353  ? 32.437  -20.385 47.895  1.00 52.93  ? 353  ARG C C     1 
ATOM   6311  O  O     . ARG C 2  353  ? 32.931  -20.414 46.754  1.00 60.73  ? 353  ARG C O     1 
ATOM   6312  C  CB    . ARG C 2  353  ? 29.939  -20.386 48.255  1.00 65.86  ? 353  ARG C CB    1 
ATOM   6313  C  CG    . ARG C 2  353  ? 28.865  -20.873 47.283  1.00 70.97  ? 353  ARG C CG    1 
ATOM   6314  C  CD    . ARG C 2  353  ? 28.619  -19.866 46.162  1.00 86.98  ? 353  ARG C CD    1 
ATOM   6315  N  NE    . ARG C 2  353  ? 27.677  -18.818 46.552  1.00 96.52  ? 353  ARG C NE    1 
ATOM   6316  C  CZ    . ARG C 2  353  ? 27.369  -17.767 45.797  1.00 89.58  ? 353  ARG C CZ    1 
ATOM   6317  N  NH1   . ARG C 2  353  ? 27.933  -17.610 44.607  1.00 84.06  ? 353  ARG C NH1   1 
ATOM   6318  N  NH2   . ARG C 2  353  ? 26.498  -16.867 46.234  1.00 78.86  ? 353  ARG C NH2   1 
ATOM   6319  N  N     . GLY C 2  354  ? 32.933  -19.645 48.885  1.00 49.21  ? 354  GLY C N     1 
ATOM   6320  C  CA    . GLY C 2  354  ? 34.171  -18.902 48.721  1.00 51.82  ? 354  GLY C CA    1 
ATOM   6321  C  C     . GLY C 2  354  ? 35.328  -19.785 48.282  1.00 57.23  ? 354  GLY C C     1 
ATOM   6322  O  O     . GLY C 2  354  ? 36.097  -19.417 47.390  1.00 59.57  ? 354  GLY C O     1 
ATOM   6323  N  N     . VAL C 2  355  ? 35.445  -20.958 48.902  1.00 58.55  ? 355  VAL C N     1 
ATOM   6324  C  CA    . VAL C 2  355  ? 36.503  -21.911 48.564  1.00 53.10  ? 355  VAL C CA    1 
ATOM   6325  C  C     . VAL C 2  355  ? 36.418  -22.386 47.116  1.00 62.06  ? 355  VAL C C     1 
ATOM   6326  O  O     . VAL C 2  355  ? 37.434  -22.440 46.426  1.00 70.02  ? 355  VAL C O     1 
ATOM   6327  C  CB    . VAL C 2  355  ? 36.510  -23.134 49.510  1.00 46.33  ? 355  VAL C CB    1 
ATOM   6328  C  CG1   . VAL C 2  355  ? 37.317  -24.278 48.911  1.00 38.42  ? 355  VAL C CG1   1 
ATOM   6329  C  CG2   . VAL C 2  355  ? 37.064  -22.747 50.868  1.00 51.28  ? 355  VAL C CG2   1 
ATOM   6330  N  N     . ARG C 2  356  ? 35.217  -22.727 46.654  1.00 62.61  ? 356  ARG C N     1 
ATOM   6331  C  CA    . ARG C 2  356  ? 35.047  -23.148 45.261  1.00 60.38  ? 356  ARG C CA    1 
ATOM   6332  C  C     . ARG C 2  356  ? 35.398  -22.017 44.291  1.00 61.73  ? 356  ARG C C     1 
ATOM   6333  O  O     . ARG C 2  356  ? 36.117  -22.223 43.295  1.00 65.45  ? 356  ARG C O     1 
ATOM   6334  C  CB    . ARG C 2  356  ? 33.622  -23.644 45.014  1.00 52.75  ? 356  ARG C CB    1 
ATOM   6335  C  CG    . ARG C 2  356  ? 33.177  -24.692 46.011  1.00 57.87  ? 356  ARG C CG    1 
ATOM   6336  C  CD    . ARG C 2  356  ? 31.902  -25.394 45.585  1.00 62.80  ? 356  ARG C CD    1 
ATOM   6337  N  NE    . ARG C 2  356  ? 31.501  -26.394 46.572  1.00 72.32  ? 356  ARG C NE    1 
ATOM   6338  C  CZ    . ARG C 2  356  ? 30.685  -26.151 47.593  1.00 69.51  ? 356  ARG C CZ    1 
ATOM   6339  N  NH1   . ARG C 2  356  ? 30.171  -24.939 47.759  1.00 67.51  ? 356  ARG C NH1   1 
ATOM   6340  N  NH2   . ARG C 2  356  ? 30.378  -27.119 48.445  1.00 61.38  ? 356  ARG C NH2   1 
ATOM   6341  N  N     . GLU C 2  357  ? 34.891  -20.824 44.598  1.00 63.59  ? 357  GLU C N     1 
ATOM   6342  C  CA    . GLU C 2  357  ? 35.202  -19.632 43.813  1.00 67.68  ? 357  GLU C CA    1 
ATOM   6343  C  C     . GLU C 2  357  ? 36.709  -19.421 43.668  1.00 69.07  ? 357  GLU C C     1 
ATOM   6344  O  O     . GLU C 2  357  ? 37.218  -19.261 42.558  1.00 70.25  ? 357  GLU C O     1 
ATOM   6345  C  CB    . GLU C 2  357  ? 34.566  -18.395 44.451  1.00 76.66  ? 357  GLU C CB    1 
ATOM   6346  C  CG    . GLU C 2  357  ? 35.067  -17.075 43.888  1.00 75.62  ? 357  GLU C CG    1 
ATOM   6347  C  CD    . GLU C 2  357  ? 34.722  -15.897 44.781  1.00 72.70  ? 357  GLU C CD    1 
ATOM   6348  O  OE1   . GLU C 2  357  ? 33.548  -15.780 45.193  1.00 65.63  ? 357  GLU C OE1   1 
ATOM   6349  O  OE2   . GLU C 2  357  ? 35.632  -15.094 45.079  1.00 64.00  ? 357  GLU C OE2   1 
ATOM   6350  N  N     . ARG C 2  358  ? 37.414  -19.426 44.796  1.00 69.73  ? 358  ARG C N     1 
ATOM   6351  C  CA    . ARG C 2  358  ? 38.865  -19.251 44.808  1.00 67.12  ? 358  ARG C CA    1 
ATOM   6352  C  C     . ARG C 2  358  ? 39.588  -20.433 44.166  1.00 67.41  ? 358  ARG C C     1 
ATOM   6353  O  O     . ARG C 2  358  ? 40.744  -20.317 43.756  1.00 65.98  ? 358  ARG C O     1 
ATOM   6354  C  CB    . ARG C 2  358  ? 39.366  -19.067 46.242  1.00 63.23  ? 358  ARG C CB    1 
ATOM   6355  C  CG    . ARG C 2  358  ? 39.028  -17.725 46.872  1.00 61.80  ? 358  ARG C CG    1 
ATOM   6356  C  CD    . ARG C 2  358  ? 39.218  -17.782 48.382  1.00 58.54  ? 358  ARG C CD    1 
ATOM   6357  N  NE    . ARG C 2  358  ? 39.353  -16.457 48.982  1.00 67.77  ? 358  ARG C NE    1 
ATOM   6358  C  CZ    . ARG C 2  358  ? 40.518  -15.851 49.193  1.00 78.57  ? 358  ARG C CZ    1 
ATOM   6359  N  NH1   . ARG C 2  358  ? 41.650  -16.452 48.850  1.00 80.81  ? 358  ARG C NH1   1 
ATOM   6360  N  NH2   . ARG C 2  358  ? 40.555  -14.645 49.747  1.00 63.15  ? 358  ARG C NH2   1 
ATOM   6361  N  N     . MET C 2  359  ? 38.905  -21.570 44.094  1.00 67.58  ? 359  MET C N     1 
ATOM   6362  C  CA    . MET C 2  359  ? 39.483  -22.783 43.531  1.00 64.52  ? 359  MET C CA    1 
ATOM   6363  C  C     . MET C 2  359  ? 39.469  -22.736 42.008  1.00 75.12  ? 359  MET C C     1 
ATOM   6364  O  O     . MET C 2  359  ? 40.408  -23.198 41.360  1.00 78.49  ? 359  MET C O     1 
ATOM   6365  C  CB    . MET C 2  359  ? 38.737  -24.019 44.036  1.00 64.43  ? 359  MET C CB    1 
ATOM   6366  C  CG    . MET C 2  359  ? 39.642  -25.169 44.439  1.00 65.44  ? 359  MET C CG    1 
ATOM   6367  S  SD    . MET C 2  359  ? 38.800  -26.394 45.462  1.00 67.78  ? 359  MET C SD    1 
ATOM   6368  C  CE    . MET C 2  359  ? 37.553  -26.994 44.328  1.00 81.26  ? 359  MET C CE    1 
ATOM   6369  N  N     . LEU C 2  360  ? 38.404  -22.180 41.434  1.00 82.69  ? 360  LEU C N     1 
ATOM   6370  C  CA    . LEU C 2  360  ? 38.374  -21.992 39.981  1.00 78.58  ? 360  LEU C CA    1 
ATOM   6371  C  C     . LEU C 2  360  ? 39.360  -20.915 39.518  1.00 79.84  ? 360  LEU C C     1 
ATOM   6372  O  O     . LEU C 2  360  ? 40.208  -21.160 38.660  1.00 69.38  ? 360  LEU C O     1 
ATOM   6373  C  CB    . LEU C 2  360  ? 36.964  -21.633 39.509  1.00 76.69  ? 360  LEU C CB    1 
ATOM   6374  C  CG    . LEU C 2  360  ? 36.188  -22.728 38.778  1.00 71.01  ? 360  LEU C CG    1 
ATOM   6375  C  CD1   . LEU C 2  360  ? 36.137  -23.998 39.608  1.00 69.78  ? 360  LEU C CD1   1 
ATOM   6376  C  CD2   . LEU C 2  360  ? 34.787  -22.245 38.437  1.00 67.78  ? 360  LEU C CD2   1 
ATOM   6377  N  N     . MET C 2  361  ? 39.244  -19.728 40.107  1.00 87.40  ? 361  MET C N     1 
ATOM   6378  C  CA    . MET C 2  361  ? 40.078  -18.582 39.752  1.00 91.80  ? 361  MET C CA    1 
ATOM   6379  C  C     . MET C 2  361  ? 41.509  -18.714 40.274  1.00 102.54 ? 361  MET C C     1 
ATOM   6380  O  O     . MET C 2  361  ? 41.776  -19.488 41.194  1.00 101.70 ? 361  MET C O     1 
ATOM   6381  C  CB    . MET C 2  361  ? 39.453  -17.289 40.283  1.00 96.23  ? 361  MET C CB    1 
ATOM   6382  C  CG    . MET C 2  361  ? 38.082  -16.969 39.708  1.00 91.74  ? 361  MET C CG    1 
ATOM   6383  S  SD    . MET C 2  361  ? 38.127  -15.656 38.473  1.00 97.87  ? 361  MET C SD    1 
ATOM   6384  C  CE    . MET C 2  361  ? 38.780  -14.295 39.440  1.00 80.44  ? 361  MET C CE    1 
ATOM   6385  N  N     . GLY C 2  362  ? 42.425  -17.958 39.675  1.00 107.75 ? 362  GLY C N     1 
ATOM   6386  C  CA    . GLY C 2  362  ? 43.806  -17.925 40.125  1.00 109.94 ? 362  GLY C CA    1 
ATOM   6387  C  C     . GLY C 2  362  ? 44.590  -19.146 39.690  1.00 113.39 ? 362  GLY C C     1 
ATOM   6388  O  O     . GLY C 2  362  ? 44.049  -20.029 39.022  1.00 112.09 ? 362  GLY C O     1 
ATOM   6389  N  N     . SER C 2  363  ? 45.865  -19.199 40.070  1.00 115.36 ? 363  SER C N     1 
ATOM   6390  C  CA    . SER C 2  363  ? 46.730  -20.312 39.691  1.00 118.07 ? 363  SER C CA    1 
ATOM   6391  C  C     . SER C 2  363  ? 46.185  -21.627 40.236  1.00 114.74 ? 363  SER C C     1 
ATOM   6392  O  O     . SER C 2  363  ? 45.945  -21.761 41.435  1.00 110.30 ? 363  SER C O     1 
ATOM   6393  C  CB    . SER C 2  363  ? 48.157  -20.087 40.199  1.00 104.65 ? 363  SER C CB    1 
ATOM   6394  O  OG    . SER C 2  363  ? 48.724  -18.912 39.643  1.00 89.79  ? 363  SER C OG    1 
ATOM   6395  N  N     . GLU C 2  364  ? 45.999  -22.597 39.346  1.00 125.23 ? 364  GLU C N     1 
ATOM   6396  C  CA    . GLU C 2  364  ? 45.448  -23.892 39.725  1.00 125.81 ? 364  GLU C CA    1 
ATOM   6397  C  C     . GLU C 2  364  ? 46.560  -24.889 40.026  1.00 130.34 ? 364  GLU C C     1 
ATOM   6398  O  O     . GLU C 2  364  ? 46.298  -26.045 40.364  1.00 123.32 ? 364  GLU C O     1 
ATOM   6399  C  CB    . GLU C 2  364  ? 44.534  -24.433 38.623  1.00 125.90 ? 364  GLU C CB    1 
ATOM   6400  C  CG    . GLU C 2  364  ? 45.220  -24.605 37.278  1.00 128.13 ? 364  GLU C CG    1 
ATOM   6401  C  CD    . GLU C 2  364  ? 44.286  -25.143 36.212  1.00 126.46 ? 364  GLU C CD    1 
ATOM   6402  O  OE1   . GLU C 2  364  ? 43.106  -25.405 36.531  1.00 129.04 ? 364  GLU C OE1   1 
ATOM   6403  O  OE2   . GLU C 2  364  ? 44.732  -25.305 35.057  1.00 112.83 ? 364  GLU C OE2   1 
ATOM   6404  N  N     . ASP C 2  365  ? 47.802  -24.431 39.897  1.00 131.51 ? 365  ASP C N     1 
ATOM   6405  C  CA    . ASP C 2  365  ? 48.965  -25.260 40.187  1.00 131.00 ? 365  ASP C CA    1 
ATOM   6406  C  C     . ASP C 2  365  ? 49.333  -25.148 41.662  1.00 119.40 ? 365  ASP C C     1 
ATOM   6407  O  O     . ASP C 2  365  ? 49.251  -26.125 42.406  1.00 115.92 ? 365  ASP C O     1 
ATOM   6408  C  CB    . ASP C 2  365  ? 50.156  -24.848 39.316  1.00 129.64 ? 365  ASP C CB    1 
ATOM   6409  C  CG    . ASP C 2  365  ? 51.277  -25.878 39.325  1.00 118.07 ? 365  ASP C CG    1 
ATOM   6410  O  OD1   . ASP C 2  365  ? 51.251  -26.798 40.171  1.00 108.97 ? 365  ASP C OD1   1 
ATOM   6411  O  OD2   . ASP C 2  365  ? 52.193  -25.763 38.484  1.00 106.30 ? 365  ASP C OD2   1 
ATOM   6412  N  N     . SER C 2  366  ? 49.743  -23.954 42.080  1.00 117.62 ? 366  SER C N     1 
ATOM   6413  C  CA    . SER C 2  366  ? 50.128  -23.739 43.468  1.00 109.95 ? 366  SER C CA    1 
ATOM   6414  C  C     . SER C 2  366  ? 48.963  -23.201 44.292  1.00 106.18 ? 366  SER C C     1 
ATOM   6415  O  O     . SER C 2  366  ? 48.543  -22.055 44.127  1.00 103.97 ? 366  SER C O     1 
ATOM   6416  C  CB    . SER C 2  366  ? 51.315  -22.774 43.544  1.00 110.53 ? 366  SER C CB    1 
ATOM   6417  O  OG    . SER C 2  366  ? 51.038  -21.569 42.850  1.00 101.08 ? 366  SER C OG    1 
ATOM   6418  N  N     . LEU C 2  367  ? 48.463  -24.040 45.194  1.00 98.14  ? 367  LEU C N     1 
ATOM   6419  C  CA    . LEU C 2  367  ? 47.398  -23.660 46.113  1.00 86.79  ? 367  LEU C CA    1 
ATOM   6420  C  C     . LEU C 2  367  ? 47.547  -24.424 47.421  1.00 78.90  ? 367  LEU C C     1 
ATOM   6421  O  O     . LEU C 2  367  ? 47.941  -25.591 47.431  1.00 72.78  ? 367  LEU C O     1 
ATOM   6422  C  CB    . LEU C 2  367  ? 46.016  -23.930 45.506  1.00 83.53  ? 367  LEU C CB    1 
ATOM   6423  C  CG    . LEU C 2  367  ? 45.460  -22.929 44.489  1.00 77.60  ? 367  LEU C CG    1 
ATOM   6424  C  CD1   . LEU C 2  367  ? 44.083  -23.361 44.014  1.00 69.10  ? 367  LEU C CD1   1 
ATOM   6425  C  CD2   . LEU C 2  367  ? 45.412  -21.524 45.072  1.00 66.18  ? 367  LEU C CD2   1 
ATOM   6426  N  N     . THR C 2  368  ? 47.229  -23.756 48.522  1.00 76.09  ? 368  THR C N     1 
ATOM   6427  C  CA    . THR C 2  368  ? 47.289  -24.360 49.843  1.00 68.03  ? 368  THR C CA    1 
ATOM   6428  C  C     . THR C 2  368  ? 45.953  -24.119 50.531  1.00 65.36  ? 368  THR C C     1 
ATOM   6429  O  O     . THR C 2  368  ? 45.196  -23.246 50.107  1.00 69.80  ? 368  THR C O     1 
ATOM   6430  C  CB    . THR C 2  368  ? 48.432  -23.749 50.687  1.00 63.99  ? 368  THR C CB    1 
ATOM   6431  O  OG1   . THR C 2  368  ? 48.383  -22.319 50.601  1.00 56.55  ? 368  THR C OG1   1 
ATOM   6432  C  CG2   . THR C 2  368  ? 49.783  -24.232 50.185  1.00 68.56  ? 368  THR C CG2   1 
ATOM   6433  N  N     . PRO C 2  369  ? 45.642  -24.905 51.576  1.00 57.22  ? 369  PRO C N     1 
ATOM   6434  C  CA    . PRO C 2  369  ? 44.437  -24.646 52.370  1.00 51.27  ? 369  PRO C CA    1 
ATOM   6435  C  C     . PRO C 2  369  ? 44.379  -23.211 52.893  1.00 54.96  ? 369  PRO C C     1 
ATOM   6436  O  O     . PRO C 2  369  ? 43.289  -22.662 53.043  1.00 53.79  ? 369  PRO C O     1 
ATOM   6437  C  CB    . PRO C 2  369  ? 44.578  -25.629 53.530  1.00 50.07  ? 369  PRO C CB    1 
ATOM   6438  C  CG    . PRO C 2  369  ? 45.305  -26.778 52.934  1.00 54.76  ? 369  PRO C CG    1 
ATOM   6439  C  CD    . PRO C 2  369  ? 46.279  -26.180 51.953  1.00 62.46  ? 369  PRO C CD    1 
ATOM   6440  N  N     . ALA C 2  370  ? 45.537  -22.613 53.154  1.00 55.01  ? 370  ALA C N     1 
ATOM   6441  C  CA    . ALA C 2  370  ? 45.596  -21.240 53.646  1.00 49.79  ? 370  ALA C CA    1 
ATOM   6442  C  C     . ALA C 2  370  ? 45.127  -20.228 52.601  1.00 54.24  ? 370  ALA C C     1 
ATOM   6443  O  O     . ALA C 2  370  ? 44.367  -19.313 52.915  1.00 64.25  ? 370  ALA C O     1 
ATOM   6444  C  CB    . ALA C 2  370  ? 47.005  -20.906 54.116  1.00 56.37  ? 370  ALA C CB    1 
ATOM   6445  N  N     . LYS C 2  371  ? 45.585  -20.394 51.364  1.00 57.01  ? 371  LYS C N     1 
ATOM   6446  C  CA    . LYS C 2  371  ? 45.230  -19.476 50.282  1.00 61.66  ? 371  LYS C CA    1 
ATOM   6447  C  C     . LYS C 2  371  ? 43.822  -19.726 49.757  1.00 53.92  ? 371  LYS C C     1 
ATOM   6448  O  O     . LYS C 2  371  ? 43.221  -18.857 49.125  1.00 48.34  ? 371  LYS C O     1 
ATOM   6449  C  CB    . LYS C 2  371  ? 46.228  -19.590 49.127  1.00 68.59  ? 371  LYS C CB    1 
ATOM   6450  C  CG    . LYS C 2  371  ? 47.575  -18.934 49.380  1.00 77.96  ? 371  LYS C CG    1 
ATOM   6451  C  CD    . LYS C 2  371  ? 48.467  -19.040 48.151  1.00 89.63  ? 371  LYS C CD    1 
ATOM   6452  C  CE    . LYS C 2  371  ? 49.767  -18.277 48.341  1.00 90.93  ? 371  LYS C CE    1 
ATOM   6453  N  NZ    . LYS C 2  371  ? 49.526  -16.825 48.570  1.00 83.00  ? 371  LYS C NZ    1 
ATOM   6454  N  N     . LEU C 2  372  ? 43.310  -20.925 50.008  1.00 57.00  ? 372  LEU C N     1 
ATOM   6455  C  CA    . LEU C 2  372  ? 42.010  -21.336 49.494  1.00 52.25  ? 372  LEU C CA    1 
ATOM   6456  C  C     . LEU C 2  372  ? 40.856  -20.953 50.422  1.00 55.14  ? 372  LEU C C     1 
ATOM   6457  O  O     . LEU C 2  372  ? 39.690  -21.009 50.028  1.00 53.43  ? 372  LEU C O     1 
ATOM   6458  C  CB    . LEU C 2  372  ? 42.012  -22.847 49.259  1.00 46.40  ? 372  LEU C CB    1 
ATOM   6459  C  CG    . LEU C 2  372  ? 41.269  -23.369 48.033  1.00 51.61  ? 372  LEU C CG    1 
ATOM   6460  C  CD1   . LEU C 2  372  ? 41.744  -22.644 46.787  1.00 60.31  ? 372  LEU C CD1   1 
ATOM   6461  C  CD2   . LEU C 2  372  ? 41.476  -24.870 47.900  1.00 46.09  ? 372  LEU C CD2   1 
ATOM   6462  N  N     . VAL C 2  373  ? 41.185  -20.551 51.647  1.00 50.46  ? 373  VAL C N     1 
ATOM   6463  C  CA    . VAL C 2  373  ? 40.176  -20.315 52.678  1.00 38.01  ? 373  VAL C CA    1 
ATOM   6464  C  C     . VAL C 2  373  ? 40.125  -18.865 53.162  1.00 44.80  ? 373  VAL C C     1 
ATOM   6465  O  O     . VAL C 2  373  ? 41.150  -18.272 53.499  1.00 45.59  ? 373  VAL C O     1 
ATOM   6466  C  CB    . VAL C 2  373  ? 40.385  -21.263 53.887  1.00 33.45  ? 373  VAL C CB    1 
ATOM   6467  C  CG1   . VAL C 2  373  ? 39.661  -20.751 55.124  1.00 28.94  ? 373  VAL C CG1   1 
ATOM   6468  C  CG2   . VAL C 2  373  ? 39.932  -22.672 53.541  1.00 35.88  ? 373  VAL C CG2   1 
ATOM   6469  N  N     . ASN C 2  374  ? 38.919  -18.302 53.180  1.00 48.13  ? 374  ASN C N     1 
ATOM   6470  C  CA    . ASN C 2  374  ? 38.678  -16.984 53.756  1.00 39.49  ? 374  ASN C CA    1 
ATOM   6471  C  C     . ASN C 2  374  ? 37.832  -17.105 55.020  1.00 40.30  ? 374  ASN C C     1 
ATOM   6472  O  O     . ASN C 2  374  ? 36.688  -17.554 54.970  1.00 41.36  ? 374  ASN C O     1 
ATOM   6473  C  CB    . ASN C 2  374  ? 37.980  -16.075 52.744  1.00 40.10  ? 374  ASN C CB    1 
ATOM   6474  C  CG    . ASN C 2  374  ? 37.883  -14.639 53.220  1.00 49.82  ? 374  ASN C CG    1 
ATOM   6475  O  OD1   . ASN C 2  374  ? 38.790  -14.128 53.877  1.00 50.45  ? 374  ASN C OD1   1 
ATOM   6476  N  ND2   . ASN C 2  374  ? 36.778  -13.981 52.892  1.00 58.41  ? 374  ASN C ND2   1 
ATOM   6477  N  N     . SER C 2  375  ? 38.400  -16.705 56.152  1.00 46.90  ? 375  SER C N     1 
ATOM   6478  C  CA    . SER C 2  375  ? 37.749  -16.878 57.447  1.00 38.23  ? 375  SER C CA    1 
ATOM   6479  C  C     . SER C 2  375  ? 36.520  -15.989 57.605  1.00 41.48  ? 375  SER C C     1 
ATOM   6480  O  O     . SER C 2  375  ? 35.568  -16.357 58.290  1.00 42.76  ? 375  SER C O     1 
ATOM   6481  C  CB    . SER C 2  375  ? 38.737  -16.577 58.577  1.00 42.14  ? 375  SER C CB    1 
ATOM   6482  O  OG    . SER C 2  375  ? 40.035  -17.058 58.272  1.00 60.64  ? 375  SER C OG    1 
ATOM   6483  N  N     . ARG C 2  376  ? 36.552  -14.828 56.953  1.00 46.70  ? 376  ARG C N     1 
ATOM   6484  C  CA    . ARG C 2  376  ? 35.574  -13.750 57.167  1.00 42.85  ? 376  ARG C CA    1 
ATOM   6485  C  C     . ARG C 2  376  ? 34.077  -14.108 57.231  1.00 36.46  ? 376  ARG C C     1 
ATOM   6486  O  O     . ARG C 2  376  ? 33.386  -13.626 58.125  1.00 32.28  ? 376  ARG C O     1 
ATOM   6487  C  CB    . ARG C 2  376  ? 35.810  -12.599 56.178  1.00 44.92  ? 376  ARG C CB    1 
ATOM   6488  C  CG    . ARG C 2  376  ? 37.202  -11.997 56.267  1.00 54.60  ? 376  ARG C CG    1 
ATOM   6489  C  CD    . ARG C 2  376  ? 37.530  -11.608 57.699  1.00 61.14  ? 376  ARG C CD    1 
ATOM   6490  N  NE    . ARG C 2  376  ? 38.920  -11.190 57.860  1.00 57.74  ? 376  ARG C NE    1 
ATOM   6491  C  CZ    . ARG C 2  376  ? 39.451  -10.801 59.014  1.00 59.88  ? 376  ARG C CZ    1 
ATOM   6492  N  NH1   . ARG C 2  376  ? 38.706  -10.775 60.112  1.00 62.72  ? 376  ARG C NH1   1 
ATOM   6493  N  NH2   . ARG C 2  376  ? 40.725  -10.435 59.074  1.00 58.95  ? 376  ARG C NH2   1 
ATOM   6494  N  N     . PRO C 2  377  ? 33.568  -14.929 56.288  1.00 33.89  ? 377  PRO C N     1 
ATOM   6495  C  CA    . PRO C 2  377  ? 32.139  -15.268 56.333  1.00 29.82  ? 377  PRO C CA    1 
ATOM   6496  C  C     . PRO C 2  377  ? 31.712  -15.947 57.632  1.00 30.21  ? 377  PRO C C     1 
ATOM   6497  O  O     . PRO C 2  377  ? 30.656  -15.623 58.173  1.00 36.29  ? 377  PRO C O     1 
ATOM   6498  C  CB    . PRO C 2  377  ? 31.979  -16.245 55.168  1.00 28.02  ? 377  PRO C CB    1 
ATOM   6499  C  CG    . PRO C 2  377  ? 33.046  -15.872 54.229  1.00 32.74  ? 377  PRO C CG    1 
ATOM   6500  C  CD    . PRO C 2  377  ? 34.209  -15.478 55.080  1.00 33.19  ? 377  PRO C CD    1 
ATOM   6501  N  N     . LEU C 2  378  ? 32.527  -16.877 58.118  1.00 27.65  ? 378  LEU C N     1 
ATOM   6502  C  CA    . LEU C 2  378  ? 32.227  -17.604 59.345  1.00 25.18  ? 378  LEU C CA    1 
ATOM   6503  C  C     . LEU C 2  378  ? 32.223  -16.675 60.557  1.00 26.10  ? 378  LEU C C     1 
ATOM   6504  O  O     . LEU C 2  378  ? 31.272  -16.670 61.352  1.00 25.73  ? 378  LEU C O     1 
ATOM   6505  C  CB    . LEU C 2  378  ? 33.250  -18.719 59.544  1.00 30.12  ? 378  LEU C CB    1 
ATOM   6506  C  CG    . LEU C 2  378  ? 32.992  -19.720 60.665  1.00 24.80  ? 378  LEU C CG    1 
ATOM   6507  C  CD1   . LEU C 2  378  ? 31.676  -20.431 60.433  1.00 26.62  ? 378  LEU C CD1   1 
ATOM   6508  C  CD2   . LEU C 2  378  ? 34.135  -20.714 60.743  1.00 24.57  ? 378  LEU C CD2   1 
ATOM   6509  N  N     . GLU C 2  379  ? 33.296  -15.897 60.691  1.00 32.39  ? 379  GLU C N     1 
ATOM   6510  C  CA    . GLU C 2  379  ? 33.417  -14.914 61.761  1.00 33.67  ? 379  GLU C CA    1 
ATOM   6511  C  C     . GLU C 2  379  ? 32.194  -14.014 61.760  1.00 33.33  ? 379  GLU C C     1 
ATOM   6512  O  O     . GLU C 2  379  ? 31.596  -13.759 62.804  1.00 34.64  ? 379  GLU C O     1 
ATOM   6513  C  CB    . GLU C 2  379  ? 34.661  -14.045 61.567  1.00 35.85  ? 379  GLU C CB    1 
ATOM   6514  C  CG    . GLU C 2  379  ? 35.947  -14.793 61.272  1.00 38.26  ? 379  GLU C CG    1 
ATOM   6515  C  CD    . GLU C 2  379  ? 37.138  -13.853 61.137  1.00 54.93  ? 379  GLU C CD    1 
ATOM   6516  O  OE1   . GLU C 2  379  ? 37.882  -13.960 60.137  1.00 49.87  ? 379  GLU C OE1   1 
ATOM   6517  O  OE2   . GLU C 2  379  ? 37.330  -13.005 62.034  1.00 65.20  ? 379  GLU C OE2   1 
ATOM   6518  N  N     . ALA C 2  380  ? 31.834  -13.543 60.569  1.00 31.11  ? 380  ALA C N     1 
ATOM   6519  C  CA    . ALA C 2  380  ? 30.681  -12.673 60.385  1.00 27.26  ? 380  ALA C CA    1 
ATOM   6520  C  C     . ALA C 2  380  ? 29.393  -13.353 60.820  1.00 30.73  ? 380  ALA C C     1 
ATOM   6521  O  O     . ALA C 2  380  ? 28.532  -12.719 61.406  1.00 31.93  ? 380  ALA C O     1 
ATOM   6522  C  CB    . ALA C 2  380  ? 30.577  -12.225 58.940  1.00 28.99  ? 380  ALA C CB    1 
ATOM   6523  N  N     . ALA C 2  381  ? 29.267  -14.646 60.536  1.00 33.08  ? 381  ALA C N     1 
ATOM   6524  C  CA    . ALA C 2  381  ? 28.060  -15.390 60.892  1.00 28.80  ? 381  ALA C CA    1 
ATOM   6525  C  C     . ALA C 2  381  ? 27.910  -15.561 62.403  1.00 28.83  ? 381  ALA C C     1 
ATOM   6526  O  O     . ALA C 2  381  ? 26.829  -15.338 62.966  1.00 32.22  ? 381  ALA C O     1 
ATOM   6527  C  CB    . ALA C 2  381  ? 28.048  -16.744 60.201  1.00 27.27  ? 381  ALA C CB    1 
ATOM   6528  N  N     . ILE C 2  382  ? 28.994  -15.962 63.060  1.00 28.39  ? 382  ILE C N     1 
ATOM   6529  C  CA    . ILE C 2  382  ? 28.957  -16.153 64.506  1.00 24.01  ? 382  ILE C CA    1 
ATOM   6530  C  C     . ILE C 2  382  ? 28.749  -14.822 65.229  1.00 26.23  ? 382  ILE C C     1 
ATOM   6531  O  O     . ILE C 2  382  ? 27.925  -14.719 66.148  1.00 25.66  ? 382  ILE C O     1 
ATOM   6532  C  CB    . ILE C 2  382  ? 30.234  -16.837 65.016  1.00 20.83  ? 382  ILE C CB    1 
ATOM   6533  C  CG1   . ILE C 2  382  ? 30.397  -18.205 64.358  1.00 20.99  ? 382  ILE C CG1   1 
ATOM   6534  C  CG2   . ILE C 2  382  ? 30.190  -16.991 66.522  1.00 18.27  ? 382  ILE C CG2   1 
ATOM   6535  C  CD1   . ILE C 2  382  ? 31.676  -18.908 64.742  1.00 28.99  ? 382  ILE C CD1   1 
ATOM   6536  N  N     . ARG C 2  383  ? 29.489  -13.804 64.797  1.00 32.01  ? 383  ARG C N     1 
ATOM   6537  C  CA    . ARG C 2  383  ? 29.366  -12.469 65.373  1.00 35.37  ? 383  ARG C CA    1 
ATOM   6538  C  C     . ARG C 2  383  ? 27.956  -11.920 65.172  1.00 31.55  ? 383  ARG C C     1 
ATOM   6539  O  O     . ARG C 2  383  ? 27.401  -11.288 66.067  1.00 28.17  ? 383  ARG C O     1 
ATOM   6540  C  CB    . ARG C 2  383  ? 30.408  -11.512 64.783  1.00 37.63  ? 383  ARG C CB    1 
ATOM   6541  C  CG    . ARG C 2  383  ? 30.428  -10.140 65.448  1.00 48.98  ? 383  ARG C CG    1 
ATOM   6542  C  CD    . ARG C 2  383  ? 31.560  -9.261  64.934  1.00 44.57  ? 383  ARG C CD    1 
ATOM   6543  N  NE    . ARG C 2  383  ? 31.441  -8.988  63.506  1.00 56.68  ? 383  ARG C NE    1 
ATOM   6544  C  CZ    . ARG C 2  383  ? 32.209  -9.540  62.572  1.00 57.92  ? 383  ARG C CZ    1 
ATOM   6545  N  NH1   . ARG C 2  383  ? 33.164  -10.396 62.917  1.00 44.42  ? 383  ARG C NH1   1 
ATOM   6546  N  NH2   . ARG C 2  383  ? 32.027  -9.233  61.294  1.00 48.88  ? 383  ARG C NH2   1 
ATOM   6547  N  N     . GLU C 2  384  ? 27.381  -12.174 63.997  1.00 33.40  ? 384  GLU C N     1 
ATOM   6548  C  CA    . GLU C 2  384  ? 25.993  -11.810 63.719  1.00 36.26  ? 384  GLU C CA    1 
ATOM   6549  C  C     . GLU C 2  384  ? 25.067  -12.479 64.722  1.00 34.33  ? 384  GLU C C     1 
ATOM   6550  O  O     . GLU C 2  384  ? 24.291  -11.804 65.399  1.00 37.93  ? 384  GLU C O     1 
ATOM   6551  C  CB    . GLU C 2  384  ? 25.584  -12.222 62.301  1.00 38.16  ? 384  GLU C CB    1 
ATOM   6552  C  CG    . GLU C 2  384  ? 25.876  -11.193 61.214  1.00 55.36  ? 384  GLU C CG    1 
ATOM   6553  C  CD    . GLU C 2  384  ? 25.806  -11.787 59.806  1.00 75.54  ? 384  GLU C CD    1 
ATOM   6554  O  OE1   . GLU C 2  384  ? 26.220  -11.099 58.846  1.00 67.95  ? 384  GLU C OE1   1 
ATOM   6555  O  OE2   . GLU C 2  384  ? 25.340  -12.941 59.658  1.00 60.16  ? 384  GLU C OE2   1 
ATOM   6556  N  N     . PHE C 2  385  ? 25.156  -13.805 64.817  1.00 32.23  ? 385  PHE C N     1 
ATOM   6557  C  CA    . PHE C 2  385  ? 24.303  -14.557 65.732  1.00 24.87  ? 385  PHE C CA    1 
ATOM   6558  C  C     . PHE C 2  385  ? 24.372  -14.030 67.155  1.00 25.07  ? 385  PHE C C     1 
ATOM   6559  O  O     . PHE C 2  385  ? 23.344  -13.804 67.786  1.00 28.98  ? 385  PHE C O     1 
ATOM   6560  C  CB    . PHE C 2  385  ? 24.662  -16.040 65.727  1.00 24.90  ? 385  PHE C CB    1 
ATOM   6561  C  CG    . PHE C 2  385  ? 23.963  -16.835 66.796  1.00 21.72  ? 385  PHE C CG    1 
ATOM   6562  C  CD1   . PHE C 2  385  ? 22.633  -17.194 66.652  1.00 24.47  ? 385  PHE C CD1   1 
ATOM   6563  C  CD2   . PHE C 2  385  ? 24.637  -17.228 67.940  1.00 21.06  ? 385  PHE C CD2   1 
ATOM   6564  C  CE1   . PHE C 2  385  ? 21.988  -17.927 67.629  1.00 25.66  ? 385  PHE C CE1   1 
ATOM   6565  C  CE2   . PHE C 2  385  ? 23.999  -17.960 68.920  1.00 21.39  ? 385  PHE C CE2   1 
ATOM   6566  C  CZ    . PHE C 2  385  ? 22.673  -18.310 68.766  1.00 24.53  ? 385  PHE C CZ    1 
ATOM   6567  N  N     . PHE C 2  386  ? 25.583  -13.830 67.662  1.00 22.65  ? 386  PHE C N     1 
ATOM   6568  C  CA    . PHE C 2  386  ? 25.732  -13.413 69.053  1.00 23.40  ? 386  PHE C CA    1 
ATOM   6569  C  C     . PHE C 2  386  ? 25.368  -11.952 69.333  1.00 30.65  ? 386  PHE C C     1 
ATOM   6570  O  O     . PHE C 2  386  ? 24.659  -11.668 70.299  1.00 29.38  ? 386  PHE C O     1 
ATOM   6571  C  CB    . PHE C 2  386  ? 27.134  -13.733 69.574  1.00 25.66  ? 386  PHE C CB    1 
ATOM   6572  C  CG    . PHE C 2  386  ? 27.301  -15.159 70.005  1.00 18.90  ? 386  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C 2  386  ? 27.827  -16.100 69.141  1.00 16.39  ? 386  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C 2  386  ? 26.918  -15.559 71.275  1.00 20.79  ? 386  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C 2  386  ? 27.976  -17.416 69.535  1.00 18.56  ? 386  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C 2  386  ? 27.065  -16.873 71.677  1.00 20.60  ? 386  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C 2  386  ? 27.594  -17.803 70.804  1.00 19.64  ? 386  PHE C CZ    1 
ATOM   6578  N  N     . SER C 2  387  ? 25.862  -11.033 68.504  1.00 43.04  ? 387  SER C N     1 
ATOM   6579  C  CA    . SER C 2  387  ? 25.641  -9.598  68.721  1.00 40.18  ? 387  SER C CA    1 
ATOM   6580  C  C     . SER C 2  387  ? 24.210  -9.128  68.452  1.00 36.98  ? 387  SER C C     1 
ATOM   6581  O  O     . SER C 2  387  ? 23.588  -8.500  69.310  1.00 34.12  ? 387  SER C O     1 
ATOM   6582  C  CB    . SER C 2  387  ? 26.632  -8.764  67.903  1.00 35.90  ? 387  SER C CB    1 
ATOM   6583  O  OG    . SER C 2  387  ? 27.958  -8.946  68.370  1.00 37.82  ? 387  SER C OG    1 
ATOM   6584  N  N     . ARG C 2  388  ? 23.693  -9.415  67.262  1.00 34.17  ? 388  ARG C N     1 
ATOM   6585  C  CA    . ARG C 2  388  ? 22.307  -9.073  66.956  1.00 39.42  ? 388  ARG C CA    1 
ATOM   6586  C  C     . ARG C 2  388  ? 21.463  -10.319 66.712  1.00 32.10  ? 388  ARG C C     1 
ATOM   6587  O  O     . ARG C 2  388  ? 21.604  -10.980 65.688  1.00 37.93  ? 388  ARG C O     1 
ATOM   6588  C  CB    . ARG C 2  388  ? 22.220  -8.145  65.737  1.00 44.75  ? 388  ARG C CB    1 
ATOM   6589  C  CG    . ARG C 2  388  ? 22.799  -6.745  65.936  1.00 46.10  ? 388  ARG C CG    1 
ATOM   6590  C  CD    . ARG C 2  388  ? 24.303  -6.708  65.690  1.00 56.74  ? 388  ARG C CD    1 
ATOM   6591  N  NE    . ARG C 2  388  ? 24.668  -7.335  64.421  1.00 64.74  ? 388  ARG C NE    1 
ATOM   6592  C  CZ    . ARG C 2  388  ? 25.915  -7.454  63.972  1.00 65.05  ? 388  ARG C CZ    1 
ATOM   6593  N  NH1   . ARG C 2  388  ? 26.930  -6.984  64.688  1.00 61.66  ? 388  ARG C NH1   1 
ATOM   6594  N  NH2   . ARG C 2  388  ? 26.149  -8.044  62.805  1.00 49.66  ? 388  ARG C NH2   1 
ATOM   6595  N  N     . SER C 2  389  ? 20.575  -10.626 67.647  1.00 29.78  ? 389  SER C N     1 
ATOM   6596  C  CA    . SER C 2  389  ? 19.623  -11.713 67.460  1.00 30.82  ? 389  SER C CA    1 
ATOM   6597  C  C     . SER C 2  389  ? 18.431  -11.521 68.384  1.00 27.86  ? 389  SER C C     1 
ATOM   6598  O  O     . SER C 2  389  ? 18.517  -10.804 69.382  1.00 28.93  ? 389  SER C O     1 
ATOM   6599  C  CB    . SER C 2  389  ? 20.282  -13.070 67.719  1.00 32.28  ? 389  SER C CB    1 
ATOM   6600  O  OG    . SER C 2  389  ? 19.398  -14.139 67.420  1.00 32.85  ? 389  SER C OG    1 
ATOM   6601  N  N     . GLN C 2  390  ? 17.319  -12.164 68.056  1.00 24.33  ? 390  GLN C N     1 
ATOM   6602  C  CA    . GLN C 2  390  ? 16.154  -12.098 68.918  1.00 34.23  ? 390  GLN C CA    1 
ATOM   6603  C  C     . GLN C 2  390  ? 16.369  -13.031 70.100  1.00 32.34  ? 390  GLN C C     1 
ATOM   6604  O  O     . GLN C 2  390  ? 15.868  -12.789 71.197  1.00 34.49  ? 390  GLN C O     1 
ATOM   6605  C  CB    . GLN C 2  390  ? 14.886  -12.473 68.151  1.00 46.64  ? 390  GLN C CB    1 
ATOM   6606  C  CG    . GLN C 2  390  ? 13.600  -12.266 68.939  1.00 49.96  ? 390  GLN C CG    1 
ATOM   6607  C  CD    . GLN C 2  390  ? 12.362  -12.304 68.057  1.00 70.08  ? 390  GLN C CD    1 
ATOM   6608  O  OE1   . GLN C 2  390  ? 12.455  -12.495 66.843  1.00 79.38  ? 390  GLN C OE1   1 
ATOM   6609  N  NE2   . GLN C 2  390  ? 11.196  -12.111 68.666  1.00 64.01  ? 390  GLN C NE2   1 
ATOM   6610  N  N     . LEU C 2  391  ? 17.121  -14.102 69.869  1.00 27.98  ? 391  LEU C N     1 
ATOM   6611  C  CA    . LEU C 2  391  ? 17.372  -15.086 70.913  1.00 22.11  ? 391  LEU C CA    1 
ATOM   6612  C  C     . LEU C 2  391  ? 18.638  -14.803 71.722  1.00 19.85  ? 391  LEU C C     1 
ATOM   6613  O  O     . LEU C 2  391  ? 18.869  -15.425 72.761  1.00 17.29  ? 391  LEU C O     1 
ATOM   6614  C  CB    . LEU C 2  391  ? 17.389  -16.499 70.323  1.00 16.67  ? 391  LEU C CB    1 
ATOM   6615  C  CG    . LEU C 2  391  ? 16.010  -16.969 69.852  1.00 21.10  ? 391  LEU C CG    1 
ATOM   6616  C  CD1   . LEU C 2  391  ? 16.088  -18.287 69.110  1.00 24.94  ? 391  LEU C CD1   1 
ATOM   6617  C  CD2   . LEU C 2  391  ? 15.066  -17.083 71.035  1.00 20.31  ? 391  LEU C CD2   1 
ATOM   6618  N  N     . SER C 2  392  ? 19.449  -13.854 71.265  1.00 16.65  ? 392  SER C N     1 
ATOM   6619  C  CA    . SER C 2  392  ? 20.583  -13.423 72.069  1.00 18.04  ? 392  SER C CA    1 
ATOM   6620  C  C     . SER C 2  392  ? 20.152  -12.197 72.852  1.00 18.87  ? 392  SER C C     1 
ATOM   6621  O  O     . SER C 2  392  ? 19.973  -11.121 72.283  1.00 24.09  ? 392  SER C O     1 
ATOM   6622  C  CB    . SER C 2  392  ? 21.786  -13.089 71.189  1.00 21.52  ? 392  SER C CB    1 
ATOM   6623  O  OG    . SER C 2  392  ? 22.888  -12.664 71.974  1.00 21.05  ? 392  SER C OG    1 
ATOM   6624  N  N     . GLN C 2  393  ? 20.015  -12.355 74.163  1.00 14.95  ? 393  GLN C N     1 
ATOM   6625  C  CA    . GLN C 2  393  ? 19.399  -11.320 74.978  1.00 12.47  ? 393  GLN C CA    1 
ATOM   6626  C  C     . GLN C 2  393  ? 20.373  -10.751 75.988  1.00 17.79  ? 393  GLN C C     1 
ATOM   6627  O  O     . GLN C 2  393  ? 21.164  -11.486 76.572  1.00 16.91  ? 393  GLN C O     1 
ATOM   6628  C  CB    . GLN C 2  393  ? 18.157  -11.864 75.685  1.00 9.03   ? 393  GLN C CB    1 
ATOM   6629  C  CG    . GLN C 2  393  ? 17.013  -12.199 74.741  1.00 8.92   ? 393  GLN C CG    1 
ATOM   6630  C  CD    . GLN C 2  393  ? 15.791  -12.716 75.470  1.00 13.45  ? 393  GLN C CD    1 
ATOM   6631  O  OE1   . GLN C 2  393  ? 15.814  -12.902 76.687  1.00 12.72  ? 393  GLN C OE1   1 
ATOM   6632  N  NE2   . GLN C 2  393  ? 14.713  -12.952 74.728  1.00 16.76  ? 393  GLN C NE2   1 
ATOM   6633  N  N     . PHE C 2  394  ? 20.323  -9.434  76.169  1.00 22.96  ? 394  PHE C N     1 
ATOM   6634  C  CA    . PHE C 2  394  ? 21.128  -8.772  77.182  1.00 17.61  ? 394  PHE C CA    1 
ATOM   6635  C  C     . PHE C 2  394  ? 20.760  -9.424  78.513  1.00 20.78  ? 394  PHE C C     1 
ATOM   6636  O  O     . PHE C 2  394  ? 19.587  -9.477  78.885  1.00 27.99  ? 394  PHE C O     1 
ATOM   6637  C  CB    . PHE C 2  394  ? 20.805  -7.275  77.178  1.00 17.78  ? 394  PHE C CB    1 
ATOM   6638  C  CG    . PHE C 2  394  ? 21.793  -6.425  77.929  1.00 22.63  ? 394  PHE C CG    1 
ATOM   6639  C  CD1   . PHE C 2  394  ? 23.124  -6.383  77.550  1.00 24.89  ? 394  PHE C CD1   1 
ATOM   6640  C  CD2   . PHE C 2  394  ? 21.380  -5.638  78.994  1.00 22.31  ? 394  PHE C CD2   1 
ATOM   6641  C  CE1   . PHE C 2  394  ? 24.027  -5.592  78.239  1.00 24.56  ? 394  PHE C CE1   1 
ATOM   6642  C  CE2   . PHE C 2  394  ? 22.277  -4.845  79.682  1.00 16.69  ? 394  PHE C CE2   1 
ATOM   6643  C  CZ    . PHE C 2  394  ? 23.602  -4.822  79.306  1.00 21.20  ? 394  PHE C CZ    1 
ATOM   6644  N  N     . LYS C 2  395  ? 21.762  -9.932  79.221  1.00 16.51  ? 395  LYS C N     1 
ATOM   6645  C  CA    . LYS C 2  395  ? 21.522  -10.770 80.392  1.00 17.85  ? 395  LYS C CA    1 
ATOM   6646  C  C     . LYS C 2  395  ? 20.870  -9.969  81.499  1.00 18.46  ? 395  LYS C C     1 
ATOM   6647  O  O     . LYS C 2  395  ? 21.201  -8.801  81.693  1.00 17.16  ? 395  LYS C O     1 
ATOM   6648  C  CB    . LYS C 2  395  ? 22.845  -11.358 80.890  1.00 27.14  ? 395  LYS C CB    1 
ATOM   6649  C  CG    . LYS C 2  395  ? 22.748  -12.197 82.155  1.00 20.27  ? 395  LYS C CG    1 
ATOM   6650  C  CD    . LYS C 2  395  ? 24.132  -12.587 82.639  1.00 20.85  ? 395  LYS C CD    1 
ATOM   6651  C  CE    . LYS C 2  395  ? 24.060  -13.476 83.863  1.00 30.01  ? 395  LYS C CE    1 
ATOM   6652  N  NZ    . LYS C 2  395  ? 25.413  -13.874 84.336  1.00 36.11  ? 395  LYS C NZ    1 
ATOM   6653  N  N     . ASP C 2  396  ? 19.956  -10.590 82.240  1.00 19.08  ? 396  ASP C N     1 
ATOM   6654  C  CA    . ASP C 2  396  ? 19.363  -9.888  83.363  1.00 22.25  ? 396  ASP C CA    1 
ATOM   6655  C  C     . ASP C 2  396  ? 20.188  -10.232 84.598  1.00 22.66  ? 396  ASP C C     1 
ATOM   6656  O  O     . ASP C 2  396  ? 20.131  -11.342 85.122  1.00 20.39  ? 396  ASP C O     1 
ATOM   6657  C  CB    . ASP C 2  396  ? 17.912  -10.333 83.549  1.00 17.49  ? 396  ASP C CB    1 
ATOM   6658  C  CG    . ASP C 2  396  ? 17.144  -9.446  84.513  1.00 28.87  ? 396  ASP C CG    1 
ATOM   6659  O  OD1   . ASP C 2  396  ? 17.781  -8.680  85.268  1.00 25.69  ? 396  ASP C OD1   1 
ATOM   6660  O  OD2   . ASP C 2  396  ? 15.896  -9.520  84.520  1.00 41.70  ? 396  ASP C OD2   1 
ATOM   6661  N  N     . GLU C 2  397  ? 20.954  -9.247  85.048  1.00 19.81  ? 397  GLU C N     1 
ATOM   6662  C  CA    . GLU C 2  397  ? 21.837  -9.383  86.195  1.00 15.57  ? 397  GLU C CA    1 
ATOM   6663  C  C     . GLU C 2  397  ? 21.304  -8.817  87.511  1.00 22.85  ? 397  GLU C C     1 
ATOM   6664  O  O     . GLU C 2  397  ? 22.034  -8.805  88.503  1.00 33.70  ? 397  GLU C O     1 
ATOM   6665  C  CB    . GLU C 2  397  ? 23.219  -8.810  85.883  1.00 21.84  ? 397  GLU C CB    1 
ATOM   6666  C  CG    . GLU C 2  397  ? 24.122  -9.759  85.118  1.00 28.89  ? 397  GLU C CG    1 
ATOM   6667  C  CD    . GLU C 2  397  ? 25.548  -9.245  85.016  1.00 37.41  ? 397  GLU C CD    1 
ATOM   6668  O  OE1   . GLU C 2  397  ? 26.490  -10.062 85.136  1.00 39.93  ? 397  GLU C OE1   1 
ATOM   6669  O  OE2   . GLU C 2  397  ? 25.726  -8.023  84.816  1.00 26.79  ? 397  GLU C OE2   1 
ATOM   6670  N  N     . THR C 2  398  ? 20.067  -8.319  87.511  1.00 17.58  ? 398  THR C N     1 
ATOM   6671  C  CA    . THR C 2  398  ? 19.548  -7.534  88.636  1.00 14.81  ? 398  THR C CA    1 
ATOM   6672  C  C     . THR C 2  398  ? 19.803  -8.207  89.980  1.00 14.40  ? 398  THR C C     1 
ATOM   6673  O  O     . THR C 2  398  ? 20.369  -7.600  90.887  1.00 15.86  ? 398  THR C O     1 
ATOM   6674  C  CB    . THR C 2  398  ? 18.031  -7.292  88.499  1.00 17.80  ? 398  THR C CB    1 
ATOM   6675  O  OG1   . THR C 2  398  ? 17.746  -6.701  87.227  1.00 21.80  ? 398  THR C OG1   1 
ATOM   6676  C  CG2   . THR C 2  398  ? 17.537  -6.367  89.596  1.00 16.57  ? 398  THR C CG2   1 
ATOM   6677  N  N     . ASN C 2  399  ? 19.400  -9.467  90.089  1.00 14.49  ? 399  ASN C N     1 
ATOM   6678  C  CA    . ASN C 2  399  ? 19.763  -10.318 91.219  1.00 15.85  ? 399  ASN C CA    1 
ATOM   6679  C  C     . ASN C 2  399  ? 20.066  -11.717 90.681  1.00 18.04  ? 399  ASN C C     1 
ATOM   6680  O  O     . ASN C 2  399  ? 19.723  -12.008 89.540  1.00 18.77  ? 399  ASN C O     1 
ATOM   6681  C  CB    . ASN C 2  399  ? 18.657  -10.331 92.277  1.00 13.15  ? 399  ASN C CB    1 
ATOM   6682  C  CG    . ASN C 2  399  ? 17.357  -10.873 91.752  1.00 15.91  ? 399  ASN C CG    1 
ATOM   6683  O  OD1   . ASN C 2  399  ? 17.213  -12.075 91.537  1.00 16.53  ? 399  ASN C OD1   1 
ATOM   6684  N  ND2   . ASN C 2  399  ? 16.390  -9.989  91.549  1.00 21.53  ? 399  ASN C ND2   1 
ATOM   6685  N  N     . PRO C 2  400  ? 20.736  -12.575 91.473  1.00 19.59  ? 400  PRO C N     1 
ATOM   6686  C  CA    . PRO C 2  400  ? 21.082  -13.925 90.997  1.00 18.94  ? 400  PRO C CA    1 
ATOM   6687  C  C     . PRO C 2  400  ? 19.912  -14.699 90.374  1.00 20.61  ? 400  PRO C C     1 
ATOM   6688  O  O     . PRO C 2  400  ? 20.089  -15.391 89.357  1.00 29.62  ? 400  PRO C O     1 
ATOM   6689  C  CB    . PRO C 2  400  ? 21.548  -14.620 92.274  1.00 22.54  ? 400  PRO C CB    1 
ATOM   6690  C  CG    . PRO C 2  400  ? 22.140  -13.524 93.082  1.00 20.35  ? 400  PRO C CG    1 
ATOM   6691  C  CD    . PRO C 2  400  ? 21.301  -12.310 92.810  1.00 18.10  ? 400  PRO C CD    1 
ATOM   6692  N  N     . LEU C 2  401  ? 18.730  -14.567 90.970  1.00 15.42  ? 401  LEU C N     1 
ATOM   6693  C  CA    . LEU C 2  401  ? 17.528  -15.214 90.454  1.00 14.54  ? 401  LEU C CA    1 
ATOM   6694  C  C     . LEU C 2  401  ? 17.121  -14.672 89.082  1.00 17.37  ? 401  LEU C C     1 
ATOM   6695  O  O     . LEU C 2  401  ? 16.526  -15.391 88.280  1.00 21.73  ? 401  LEU C O     1 
ATOM   6696  C  CB    . LEU C 2  401  ? 16.375  -15.078 91.453  1.00 14.49  ? 401  LEU C CB    1 
ATOM   6697  C  CG    . LEU C 2  401  ? 14.996  -15.617 91.068  1.00 13.97  ? 401  LEU C CG    1 
ATOM   6698  C  CD1   . LEU C 2  401  ? 15.050  -17.098 90.730  1.00 15.44  ? 401  LEU C CD1   1 
ATOM   6699  C  CD2   . LEU C 2  401  ? 14.012  -15.366 92.190  1.00 19.96  ? 401  LEU C CD2   1 
ATOM   6700  N  N     . SER C 2  402  ? 17.447  -13.412 88.807  1.00 15.46  ? 402  SER C N     1 
ATOM   6701  C  CA    . SER C 2  402  ? 17.164  -12.829 87.498  1.00 17.34  ? 402  SER C CA    1 
ATOM   6702  C  C     . SER C 2  402  ? 17.900  -13.596 86.403  1.00 19.51  ? 402  SER C C     1 
ATOM   6703  O  O     . SER C 2  402  ? 17.308  -13.984 85.392  1.00 20.18  ? 402  SER C O     1 
ATOM   6704  C  CB    . SER C 2  402  ? 17.576  -11.356 87.455  1.00 18.73  ? 402  SER C CB    1 
ATOM   6705  O  OG    . SER C 2  402  ? 17.255  -10.691 88.663  1.00 18.21  ? 402  SER C OG    1 
ATOM   6706  N  N     . SER C 2  403  ? 19.197  -13.805 86.619  1.00 18.56  ? 403  SER C N     1 
ATOM   6707  C  CA    . SER C 2  403  ? 20.040  -14.529 85.679  1.00 15.02  ? 403  SER C CA    1 
ATOM   6708  C  C     . SER C 2  403  ? 19.590  -15.971 85.592  1.00 17.25  ? 403  SER C C     1 
ATOM   6709  O  O     . SER C 2  403  ? 19.407  -16.515 84.496  1.00 20.59  ? 403  SER C O     1 
ATOM   6710  C  CB    . SER C 2  403  ? 21.493  -14.488 86.139  1.00 14.61  ? 403  SER C CB    1 
ATOM   6711  O  OG    . SER C 2  403  ? 21.874  -13.174 86.490  1.00 21.25  ? 403  SER C OG    1 
ATOM   6712  N  N     . LEU C 2  404  ? 19.410  -16.586 86.758  1.00 16.56  ? 404  LEU C N     1 
ATOM   6713  C  CA    . LEU C 2  404  ? 19.023  -17.990 86.813  1.00 19.16  ? 404  LEU C CA    1 
ATOM   6714  C  C     . LEU C 2  404  ? 17.719  -18.260 86.062  1.00 18.00  ? 404  LEU C C     1 
ATOM   6715  O  O     . LEU C 2  404  ? 17.578  -19.288 85.405  1.00 19.85  ? 404  LEU C O     1 
ATOM   6716  C  CB    . LEU C 2  404  ? 18.914  -18.466 88.261  1.00 22.29  ? 404  LEU C CB    1 
ATOM   6717  C  CG    . LEU C 2  404  ? 18.713  -19.969 88.442  1.00 21.16  ? 404  LEU C CG    1 
ATOM   6718  C  CD1   . LEU C 2  404  ? 19.778  -20.739 87.679  1.00 21.33  ? 404  LEU C CD1   1 
ATOM   6719  C  CD2   . LEU C 2  404  ? 18.745  -20.322 89.918  1.00 23.88  ? 404  LEU C CD2   1 
ATOM   6720  N  N     . ARG C 2  405  ? 16.776  -17.329 86.147  1.00 15.98  ? 405  ARG C N     1 
ATOM   6721  C  CA    . ARG C 2  405  ? 15.515  -17.475 85.434  1.00 17.48  ? 405  ARG C CA    1 
ATOM   6722  C  C     . ARG C 2  405  ? 15.697  -17.177 83.955  1.00 15.90  ? 405  ARG C C     1 
ATOM   6723  O  O     . ARG C 2  405  ? 15.095  -17.831 83.103  1.00 16.82  ? 405  ARG C O     1 
ATOM   6724  C  CB    . ARG C 2  405  ? 14.445  -16.546 86.003  1.00 16.54  ? 405  ARG C CB    1 
ATOM   6725  C  CG    . ARG C 2  405  ? 13.086  -16.752 85.355  1.00 19.79  ? 405  ARG C CG    1 
ATOM   6726  C  CD    . ARG C 2  405  ? 12.189  -15.547 85.523  1.00 20.98  ? 405  ARG C CD    1 
ATOM   6727  N  NE    . ARG C 2  405  ? 12.597  -14.447 84.659  1.00 25.72  ? 405  ARG C NE    1 
ATOM   6728  C  CZ    . ARG C 2  405  ? 11.792  -13.461 84.282  1.00 28.40  ? 405  ARG C CZ    1 
ATOM   6729  N  NH1   . ARG C 2  405  ? 10.528  -13.444 84.688  1.00 22.06  ? 405  ARG C NH1   1 
ATOM   6730  N  NH2   . ARG C 2  405  ? 12.248  -12.498 83.494  1.00 32.03  ? 405  ARG C NH2   1 
ATOM   6731  N  N     . HIS C 2  406  ? 16.520  -16.177 83.658  1.00 13.51  ? 406  HIS C N     1 
ATOM   6732  C  CA    . HIS C 2  406  ? 16.745  -15.755 82.284  1.00 13.37  ? 406  HIS C CA    1 
ATOM   6733  C  C     . HIS C 2  406  ? 17.337  -16.890 81.464  1.00 14.36  ? 406  HIS C C     1 
ATOM   6734  O  O     . HIS C 2  406  ? 17.007  -17.055 80.292  1.00 12.20  ? 406  HIS C O     1 
ATOM   6735  C  CB    . HIS C 2  406  ? 17.670  -14.541 82.238  1.00 14.06  ? 406  HIS C CB    1 
ATOM   6736  C  CG    . HIS C 2  406  ? 17.687  -13.845 80.913  1.00 13.84  ? 406  HIS C CG    1 
ATOM   6737  N  ND1   . HIS C 2  406  ? 18.414  -12.698 80.685  1.00 16.66  ? 406  HIS C ND1   1 
ATOM   6738  C  CD2   . HIS C 2  406  ? 17.057  -14.130 79.749  1.00 11.59  ? 406  HIS C CD2   1 
ATOM   6739  C  CE1   . HIS C 2  406  ? 18.236  -12.307 79.436  1.00 15.19  ? 406  HIS C CE1   1 
ATOM   6740  N  NE2   . HIS C 2  406  ? 17.417  -13.159 78.847  1.00 12.81  ? 406  HIS C NE2   1 
ATOM   6741  N  N     . LYS C 2  407  ? 18.209  -17.674 82.092  1.00 15.82  ? 407  LYS C N     1 
ATOM   6742  C  CA    . LYS C 2  407  ? 18.822  -18.814 81.422  1.00 12.17  ? 407  LYS C CA    1 
ATOM   6743  C  C     . LYS C 2  407  ? 17.818  -19.943 81.184  1.00 14.93  ? 407  LYS C C     1 
ATOM   6744  O  O     . LYS C 2  407  ? 17.950  -20.717 80.232  1.00 17.36  ? 407  LYS C O     1 
ATOM   6745  C  CB    . LYS C 2  407  ? 20.021  -19.318 82.227  1.00 10.64  ? 407  LYS C CB    1 
ATOM   6746  C  CG    . LYS C 2  407  ? 21.228  -18.413 82.133  1.00 11.30  ? 407  LYS C CG    1 
ATOM   6747  C  CD    . LYS C 2  407  ? 22.011  -18.382 83.428  1.00 15.37  ? 407  LYS C CD    1 
ATOM   6748  C  CE    . LYS C 2  407  ? 23.093  -17.314 83.372  1.00 21.23  ? 407  LYS C CE    1 
ATOM   6749  N  NZ    . LYS C 2  407  ? 23.685  -17.038 84.710  1.00 28.13  ? 407  LYS C NZ    1 
ATOM   6750  N  N     . ARG C 2  408  ? 16.814  -20.030 82.048  1.00 11.76  ? 408  ARG C N     1 
ATOM   6751  C  CA    . ARG C 2  408  ? 15.808  -21.086 81.956  1.00 13.05  ? 408  ARG C CA    1 
ATOM   6752  C  C     . ARG C 2  408  ? 14.552  -20.689 81.169  1.00 14.34  ? 408  ARG C C     1 
ATOM   6753  O  O     . ARG C 2  408  ? 13.571  -21.432 81.144  1.00 11.72  ? 408  ARG C O     1 
ATOM   6754  C  CB    . ARG C 2  408  ? 15.466  -21.627 83.343  1.00 13.04  ? 408  ARG C CB    1 
ATOM   6755  C  CG    . ARG C 2  408  ? 16.707  -22.028 84.115  1.00 15.22  ? 408  ARG C CG    1 
ATOM   6756  C  CD    . ARG C 2  408  ? 16.390  -22.554 85.503  1.00 25.73  ? 408  ARG C CD    1 
ATOM   6757  N  NE    . ARG C 2  408  ? 16.153  -23.994 85.505  1.00 21.44  ? 408  ARG C NE    1 
ATOM   6758  C  CZ    . ARG C 2  408  ? 14.949  -24.547 85.568  1.00 23.30  ? 408  ARG C CZ    1 
ATOM   6759  N  NH1   . ARG C 2  408  ? 13.870  -23.775 85.639  1.00 25.17  ? 408  ARG C NH1   1 
ATOM   6760  N  NH2   . ARG C 2  408  ? 14.825  -25.867 85.565  1.00 20.74  ? 408  ARG C NH2   1 
ATOM   6761  N  N     . ARG C 2  409  ? 14.572  -19.501 80.569  1.00 15.00  ? 409  ARG C N     1 
ATOM   6762  C  CA    . ARG C 2  409  ? 13.489  -19.061 79.688  1.00 16.91  ? 409  ARG C CA    1 
ATOM   6763  C  C     . ARG C 2  409  ? 13.374  -19.922 78.431  1.00 14.42  ? 409  ARG C C     1 
ATOM   6764  O  O     . ARG C 2  409  ? 14.356  -20.496 77.961  1.00 11.55  ? 409  ARG C O     1 
ATOM   6765  C  CB    . ARG C 2  409  ? 13.678  -17.597 79.273  1.00 17.93  ? 409  ARG C CB    1 
ATOM   6766  C  CG    . ARG C 2  409  ? 13.104  -16.571 80.239  1.00 28.03  ? 409  ARG C CG    1 
ATOM   6767  C  CD    . ARG C 2  409  ? 11.639  -16.850 80.547  1.00 34.89  ? 409  ARG C CD    1 
ATOM   6768  N  NE    . ARG C 2  409  ? 10.973  -15.695 81.149  1.00 42.94  ? 409  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C 2  409  ? 9.780   -15.743 81.735  1.00 38.97  ? 409  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C 2  409  ? 9.246   -14.643 82.254  1.00 36.14  ? 409  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C 2  409  ? 9.121   -16.894 81.807  1.00 27.81  ? 409  ARG C NH2   1 
ATOM   6772  N  N     . ILE C 2  410  ? 12.160  -19.997 77.893  1.00 14.73  ? 410  ILE C N     1 
ATOM   6773  C  CA    . ILE C 2  410  ? 11.886  -20.703 76.647  1.00 13.29  ? 410  ILE C CA    1 
ATOM   6774  C  C     . ILE C 2  410  ? 11.035  -19.807 75.756  1.00 15.36  ? 410  ILE C C     1 
ATOM   6775  O  O     . ILE C 2  410  ? 9.929   -19.435 76.131  1.00 16.42  ? 410  ILE C O     1 
ATOM   6776  C  CB    . ILE C 2  410  ? 11.091  -21.996 76.896  1.00 16.32  ? 410  ILE C CB    1 
ATOM   6777  C  CG1   . ILE C 2  410  ? 11.798  -22.891 77.913  1.00 15.54  ? 410  ILE C CG1   1 
ATOM   6778  C  CG2   . ILE C 2  410  ? 10.870  -22.740 75.594  1.00 17.07  ? 410  ILE C CG2   1 
ATOM   6779  C  CD1   . ILE C 2  410  ? 10.954  -24.058 78.381  1.00 12.45  ? 410  ILE C CD1   1 
ATOM   6780  N  N     . SER C 2  411  ? 11.536  -19.467 74.575  1.00 16.15  ? 411  SER C N     1 
ATOM   6781  C  CA    . SER C 2  411  ? 10.814  -18.552 73.694  1.00 16.30  ? 411  SER C CA    1 
ATOM   6782  C  C     . SER C 2  411  ? 10.243  -19.248 72.465  1.00 16.07  ? 411  SER C C     1 
ATOM   6783  O  O     . SER C 2  411  ? 10.903  -20.081 71.854  1.00 15.98  ? 411  SER C O     1 
ATOM   6784  C  CB    . SER C 2  411  ? 11.720  -17.397 73.264  1.00 16.80  ? 411  SER C CB    1 
ATOM   6785  O  OG    . SER C 2  411  ? 11.044  -16.523 72.377  1.00 19.14  ? 411  SER C OG    1 
ATOM   6786  N  N     . ALA C 2  412  ? 9.009   -18.903 72.111  1.00 20.52  ? 412  ALA C N     1 
ATOM   6787  C  CA    . ALA C 2  412  ? 8.387   -19.413 70.891  1.00 22.78  ? 412  ALA C CA    1 
ATOM   6788  C  C     . ALA C 2  412  ? 8.714   -18.507 69.710  1.00 29.30  ? 412  ALA C C     1 
ATOM   6789  O  O     . ALA C 2  412  ? 8.444   -18.841 68.556  1.00 29.99  ? 412  ALA C O     1 
ATOM   6790  C  CB    . ALA C 2  412  ? 6.881   -19.535 71.071  1.00 18.18  ? 412  ALA C CB    1 
ATOM   6791  N  N     . LEU C 2  413  ? 9.307   -17.358 70.017  1.00 32.05  ? 413  LEU C N     1 
ATOM   6792  C  CA    . LEU C 2  413  ? 9.640   -16.355 69.017  1.00 28.77  ? 413  LEU C CA    1 
ATOM   6793  C  C     . LEU C 2  413  ? 11.045  -16.584 68.480  1.00 37.06  ? 413  LEU C C     1 
ATOM   6794  O  O     . LEU C 2  413  ? 11.662  -17.612 68.757  1.00 36.63  ? 413  LEU C O     1 
ATOM   6795  C  CB    . LEU C 2  413  ? 9.530   -14.961 69.628  1.00 26.76  ? 413  LEU C CB    1 
ATOM   6796  C  CG    . LEU C 2  413  ? 8.222   -14.715 70.378  1.00 24.89  ? 413  LEU C CG    1 
ATOM   6797  C  CD1   . LEU C 2  413  ? 8.180   -13.315 70.965  1.00 41.92  ? 413  LEU C CD1   1 
ATOM   6798  C  CD2   . LEU C 2  413  ? 7.040   -14.947 69.454  1.00 36.37  ? 413  LEU C CD2   1 
ATOM   6799  N  N     . GLY C 2  414  ? 11.545  -15.626 67.706  1.00 46.80  ? 414  GLY C N     1 
ATOM   6800  C  CA    . GLY C 2  414  ? 12.865  -15.733 67.109  1.00 46.63  ? 414  GLY C CA    1 
ATOM   6801  C  C     . GLY C 2  414  ? 12.792  -16.192 65.665  1.00 47.90  ? 414  GLY C C     1 
ATOM   6802  O  O     . GLY C 2  414  ? 11.701  -16.389 65.129  1.00 47.85  ? 414  GLY C O     1 
ATOM   6803  N  N     . PRO C 2  415  ? 13.956  -16.360 65.020  1.00 41.45  ? 415  PRO C N     1 
ATOM   6804  C  CA    . PRO C 2  415  ? 13.987  -16.853 63.639  1.00 45.06  ? 415  PRO C CA    1 
ATOM   6805  C  C     . PRO C 2  415  ? 13.393  -18.258 63.538  1.00 49.99  ? 415  PRO C C     1 
ATOM   6806  O  O     . PRO C 2  415  ? 13.774  -19.146 64.301  1.00 48.88  ? 415  PRO C O     1 
ATOM   6807  C  CB    . PRO C 2  415  ? 15.484  -16.877 63.310  1.00 42.85  ? 415  PRO C CB    1 
ATOM   6808  C  CG    . PRO C 2  415  ? 16.171  -16.929 64.637  1.00 42.47  ? 415  PRO C CG    1 
ATOM   6809  C  CD    . PRO C 2  415  ? 15.306  -16.127 65.557  1.00 41.92  ? 415  PRO C CD    1 
ATOM   6810  N  N     . GLY C 2  416  ? 12.473  -18.452 62.598  1.00 47.72  ? 416  GLY C N     1 
ATOM   6811  C  CA    . GLY C 2  416  ? 11.762  -19.711 62.476  1.00 47.83  ? 416  GLY C CA    1 
ATOM   6812  C  C     . GLY C 2  416  ? 10.654  -19.828 63.507  1.00 47.45  ? 416  GLY C C     1 
ATOM   6813  O  O     . GLY C 2  416  ? 9.921   -20.818 63.547  1.00 42.78  ? 416  GLY C O     1 
ATOM   6814  N  N     . GLY C 2  417  ? 10.534  -18.806 64.348  1.00 41.10  ? 417  GLY C N     1 
ATOM   6815  C  CA    . GLY C 2  417  ? 9.523   -18.785 65.386  1.00 40.58  ? 417  GLY C CA    1 
ATOM   6816  C  C     . GLY C 2  417  ? 8.264   -18.073 64.939  1.00 45.38  ? 417  GLY C C     1 
ATOM   6817  O  O     . GLY C 2  417  ? 8.123   -17.710 63.770  1.00 54.75  ? 417  GLY C O     1 
ATOM   6818  N  N     . LEU C 2  418  ? 7.344   -17.878 65.875  1.00 42.03  ? 418  LEU C N     1 
ATOM   6819  C  CA    . LEU C 2  418  ? 6.077   -17.223 65.583  1.00 44.46  ? 418  LEU C CA    1 
ATOM   6820  C  C     . LEU C 2  418  ? 6.218   -15.707 65.520  1.00 45.24  ? 418  LEU C C     1 
ATOM   6821  O  O     . LEU C 2  418  ? 7.110   -15.129 66.142  1.00 38.26  ? 418  LEU C O     1 
ATOM   6822  C  CB    . LEU C 2  418  ? 5.036   -17.600 66.637  1.00 43.76  ? 418  LEU C CB    1 
ATOM   6823  C  CG    . LEU C 2  418  ? 4.765   -19.094 66.808  1.00 34.82  ? 418  LEU C CG    1 
ATOM   6824  C  CD1   . LEU C 2  418  ? 3.710   -19.320 67.870  1.00 31.56  ? 418  LEU C CD1   1 
ATOM   6825  C  CD2   . LEU C 2  418  ? 4.334   -19.703 65.491  1.00 36.66  ? 418  LEU C CD2   1 
ATOM   6826  N  N     . THR C 2  419  ? 5.335   -15.067 64.760  1.00 55.16  ? 419  THR C N     1 
ATOM   6827  C  CA    . THR C 2  419  ? 5.226   -13.616 64.789  1.00 58.29  ? 419  THR C CA    1 
ATOM   6828  C  C     . THR C 2  419  ? 4.238   -13.239 65.884  1.00 50.05  ? 419  THR C C     1 
ATOM   6829  O  O     . THR C 2  419  ? 3.157   -13.821 65.980  1.00 45.55  ? 419  THR C O     1 
ATOM   6830  C  CB    . THR C 2  419  ? 4.767   -13.040 63.434  1.00 62.09  ? 419  THR C CB    1 
ATOM   6831  O  OG1   . THR C 2  419  ? 5.757   -13.314 62.435  1.00 57.63  ? 419  THR C OG1   1 
ATOM   6832  C  CG2   . THR C 2  419  ? 4.562   -11.531 63.530  1.00 58.97  ? 419  THR C CG2   1 
ATOM   6833  N  N     . ARG C 2  420  ? 4.627   -12.273 66.711  1.00 51.08  ? 420  ARG C N     1 
ATOM   6834  C  CA    . ARG C 2  420  ? 3.851   -11.867 67.879  1.00 49.83  ? 420  ARG C CA    1 
ATOM   6835  C  C     . ARG C 2  420  ? 2.412   -11.495 67.527  1.00 53.97  ? 420  ARG C C     1 
ATOM   6836  O  O     . ARG C 2  420  ? 1.486   -11.775 68.286  1.00 44.89  ? 420  ARG C O     1 
ATOM   6837  C  CB    . ARG C 2  420  ? 4.546   -10.694 68.577  1.00 52.63  ? 420  ARG C CB    1 
ATOM   6838  C  CG    . ARG C 2  420  ? 3.995   -10.357 69.951  1.00 50.94  ? 420  ARG C CG    1 
ATOM   6839  C  CD    . ARG C 2  420  ? 4.697   -9.143  70.553  1.00 51.77  ? 420  ARG C CD    1 
ATOM   6840  N  NE    . ARG C 2  420  ? 6.118   -9.379  70.804  1.00 55.35  ? 420  ARG C NE    1 
ATOM   6841  C  CZ    . ARG C 2  420  ? 7.103   -8.924  70.034  1.00 70.07  ? 420  ARG C CZ    1 
ATOM   6842  N  NH1   . ARG C 2  420  ? 6.828   -8.201  68.955  1.00 68.17  ? 420  ARG C NH1   1 
ATOM   6843  N  NH2   . ARG C 2  420  ? 8.366   -9.190  70.345  1.00 64.91  ? 420  ARG C NH2   1 
ATOM   6844  N  N     . GLU C 2  421  ? 2.234   -10.871 66.367  1.00 67.48  ? 421  GLU C N     1 
ATOM   6845  C  CA    . GLU C 2  421  ? 0.919   -10.442 65.905  1.00 63.39  ? 421  GLU C CA    1 
ATOM   6846  C  C     . GLU C 2  421  ? 0.033   -11.636 65.562  1.00 61.51  ? 421  GLU C C     1 
ATOM   6847  O  O     . GLU C 2  421  ? -1.175  -11.615 65.793  1.00 68.01  ? 421  GLU C O     1 
ATOM   6848  C  CB    . GLU C 2  421  ? 1.062   -9.563  64.660  1.00 73.02  ? 421  GLU C CB    1 
ATOM   6849  C  CG    . GLU C 2  421  ? 2.043   -8.407  64.792  1.00 78.91  ? 421  GLU C CG    1 
ATOM   6850  C  CD    . GLU C 2  421  ? 1.384   -7.133  65.282  1.00 84.50  ? 421  GLU C CD    1 
ATOM   6851  O  OE1   . GLU C 2  421  ? 1.793   -6.041  64.831  1.00 86.90  ? 421  GLU C OE1   1 
ATOM   6852  O  OE2   . GLU C 2  421  ? 0.459   -7.222  66.117  1.00 79.14  ? 421  GLU C OE2   1 
ATOM   6853  N  N     . ARG C 2  422  ? 0.647   -12.673 65.003  1.00 55.07  ? 422  ARG C N     1 
ATOM   6854  C  CA    . ARG C 2  422  ? -0.096  -13.796 64.445  1.00 53.18  ? 422  ARG C CA    1 
ATOM   6855  C  C     . ARG C 2  422  ? -0.360  -14.936 65.429  1.00 63.10  ? 422  ARG C C     1 
ATOM   6856  O  O     . ARG C 2  422  ? -1.094  -15.873 65.113  1.00 63.72  ? 422  ARG C O     1 
ATOM   6857  C  CB    . ARG C 2  422  ? 0.602   -14.327 63.191  1.00 52.41  ? 422  ARG C CB    1 
ATOM   6858  C  CG    . ARG C 2  422  ? 0.379   -13.475 61.951  1.00 60.96  ? 422  ARG C CG    1 
ATOM   6859  C  CD    . ARG C 2  422  ? 1.266   -12.239 61.923  1.00 71.33  ? 422  ARG C CD    1 
ATOM   6860  N  NE    . ARG C 2  422  ? 2.450   -12.441 61.094  1.00 76.66  ? 422  ARG C NE    1 
ATOM   6861  C  CZ    . ARG C 2  422  ? 2.528   -12.103 59.811  1.00 71.86  ? 422  ARG C CZ    1 
ATOM   6862  N  NH1   . ARG C 2  422  ? 3.645   -12.328 59.131  1.00 77.92  ? 422  ARG C NH1   1 
ATOM   6863  N  NH2   . ARG C 2  422  ? 1.490   -11.540 59.209  1.00 62.32  ? 422  ARG C NH2   1 
ATOM   6864  N  N     . ALA C 2  423  ? 0.235   -14.861 66.615  1.00 62.61  ? 423  ALA C N     1 
ATOM   6865  C  CA    . ALA C 2  423  ? 0.048   -15.912 67.611  1.00 46.82  ? 423  ALA C CA    1 
ATOM   6866  C  C     . ALA C 2  423  ? -1.386  -15.918 68.122  1.00 46.71  ? 423  ALA C C     1 
ATOM   6867  O  O     . ALA C 2  423  ? -1.890  -14.900 68.597  1.00 45.45  ? 423  ALA C O     1 
ATOM   6868  C  CB    . ALA C 2  423  ? 1.023   -15.737 68.757  1.00 37.49  ? 423  ALA C CB    1 
ATOM   6869  N  N     . GLY C 2  424  ? -2.029  -17.079 68.037  1.00 52.72  ? 424  GLY C N     1 
ATOM   6870  C  CA    . GLY C 2  424  ? -3.424  -17.212 68.419  1.00 61.10  ? 424  GLY C CA    1 
ATOM   6871  C  C     . GLY C 2  424  ? -3.588  -17.738 69.830  1.00 55.46  ? 424  GLY C C     1 
ATOM   6872  O  O     . GLY C 2  424  ? -2.682  -17.612 70.650  1.00 61.20  ? 424  GLY C O     1 
ATOM   6873  N  N     . PHE C 2  425  ? -4.743  -18.330 70.115  1.00 54.19  ? 425  PHE C N     1 
ATOM   6874  C  CA    . PHE C 2  425  ? -5.014  -18.877 71.442  1.00 54.32  ? 425  PHE C CA    1 
ATOM   6875  C  C     . PHE C 2  425  ? -4.332  -20.226 71.676  1.00 51.06  ? 425  PHE C C     1 
ATOM   6876  O  O     . PHE C 2  425  ? -3.938  -20.539 72.798  1.00 49.61  ? 425  PHE C O     1 
ATOM   6877  C  CB    . PHE C 2  425  ? -6.520  -19.021 71.670  1.00 55.98  ? 425  PHE C CB    1 
ATOM   6878  C  CG    . PHE C 2  425  ? -7.233  -17.716 71.882  1.00 61.23  ? 425  PHE C CG    1 
ATOM   6879  C  CD1   . PHE C 2  425  ? -7.421  -17.216 73.161  1.00 62.86  ? 425  PHE C CD1   1 
ATOM   6880  C  CD2   . PHE C 2  425  ? -7.723  -16.996 70.807  1.00 59.62  ? 425  PHE C CD2   1 
ATOM   6881  C  CE1   . PHE C 2  425  ? -8.082  -16.018 73.363  1.00 54.85  ? 425  PHE C CE1   1 
ATOM   6882  C  CE2   . PHE C 2  425  ? -8.385  -15.798 71.001  1.00 64.03  ? 425  PHE C CE2   1 
ATOM   6883  C  CZ    . PHE C 2  425  ? -8.564  -15.308 72.281  1.00 64.33  ? 425  PHE C CZ    1 
ATOM   6884  N  N     . ASP C 2  426  ? -4.196  -21.019 70.617  1.00 51.78  ? 426  ASP C N     1 
ATOM   6885  C  CA    . ASP C 2  426  ? -3.723  -22.396 70.740  1.00 45.25  ? 426  ASP C CA    1 
ATOM   6886  C  C     . ASP C 2  426  ? -2.314  -22.517 71.311  1.00 42.52  ? 426  ASP C C     1 
ATOM   6887  O  O     . ASP C 2  426  ? -2.099  -23.196 72.315  1.00 43.25  ? 426  ASP C O     1 
ATOM   6888  C  CB    . ASP C 2  426  ? -3.802  -23.109 69.390  1.00 51.98  ? 426  ASP C CB    1 
ATOM   6889  C  CG    . ASP C 2  426  ? -5.228  -23.298 68.917  1.00 70.41  ? 426  ASP C CG    1 
ATOM   6890  O  OD1   . ASP C 2  426  ? -6.064  -22.407 69.179  1.00 67.18  ? 426  ASP C OD1   1 
ATOM   6891  O  OD2   . ASP C 2  426  ? -5.514  -24.340 68.288  1.00 79.78  ? 426  ASP C OD2   1 
ATOM   6892  N  N     . VAL C 2  427  ? -1.356  -21.861 70.669  1.00 41.91  ? 427  VAL C N     1 
ATOM   6893  C  CA    . VAL C 2  427  ? 0.040   -21.973 71.072  1.00 35.58  ? 427  VAL C CA    1 
ATOM   6894  C  C     . VAL C 2  427  ? 0.284   -21.308 72.430  1.00 31.07  ? 427  VAL C C     1 
ATOM   6895  O  O     . VAL C 2  427  ? 1.174   -21.714 73.182  1.00 25.20  ? 427  VAL C O     1 
ATOM   6896  C  CB    . VAL C 2  427  ? 0.978   -21.399 69.983  1.00 31.81  ? 427  VAL C CB    1 
ATOM   6897  C  CG1   . VAL C 2  427  ? 0.638   -19.946 69.687  1.00 33.76  ? 427  VAL C CG1   1 
ATOM   6898  C  CG2   . VAL C 2  427  ? 2.438   -21.557 70.384  1.00 34.73  ? 427  VAL C CG2   1 
ATOM   6899  N  N     . ARG C 2  428  ? -0.530  -20.304 72.750  1.00 30.87  ? 428  ARG C N     1 
ATOM   6900  C  CA    . ARG C 2  428  ? -0.413  -19.590 74.018  1.00 27.72  ? 428  ARG C CA    1 
ATOM   6901  C  C     . ARG C 2  428  ? -0.993  -20.385 75.184  1.00 25.62  ? 428  ARG C C     1 
ATOM   6902  O  O     . ARG C 2  428  ? -0.624  -20.163 76.336  1.00 23.99  ? 428  ARG C O     1 
ATOM   6903  C  CB    . ARG C 2  428  ? -1.107  -18.228 73.943  1.00 24.06  ? 428  ARG C CB    1 
ATOM   6904  C  CG    . ARG C 2  428  ? -0.480  -17.240 72.976  1.00 25.60  ? 428  ARG C CG    1 
ATOM   6905  C  CD    . ARG C 2  428  ? -1.256  -15.927 72.973  1.00 35.61  ? 428  ARG C CD    1 
ATOM   6906  N  NE    . ARG C 2  428  ? -0.886  -15.059 71.857  1.00 32.98  ? 428  ARG C NE    1 
ATOM   6907  C  CZ    . ARG C 2  428  ? -0.048  -14.033 71.954  1.00 26.39  ? 428  ARG C CZ    1 
ATOM   6908  N  NH1   . ARG C 2  428  ? 0.230   -13.301 70.886  1.00 31.63  ? 428  ARG C NH1   1 
ATOM   6909  N  NH2   . ARG C 2  428  ? 0.510   -13.737 73.119  1.00 24.59  ? 428  ARG C NH2   1 
ATOM   6910  N  N     . ASP C 2  429  ? -1.901  -21.309 74.885  1.00 27.35  ? 429  ASP C N     1 
ATOM   6911  C  CA    . ASP C 2  429  ? -2.557  -22.098 75.923  1.00 28.09  ? 429  ASP C CA    1 
ATOM   6912  C  C     . ASP C 2  429  ? -1.563  -22.992 76.648  1.00 25.90  ? 429  ASP C C     1 
ATOM   6913  O  O     . ASP C 2  429  ? -0.518  -23.346 76.099  1.00 29.09  ? 429  ASP C O     1 
ATOM   6914  C  CB    . ASP C 2  429  ? -3.669  -22.963 75.319  1.00 34.22  ? 429  ASP C CB    1 
ATOM   6915  C  CG    . ASP C 2  429  ? -5.015  -22.257 75.285  1.00 52.81  ? 429  ASP C CG    1 
ATOM   6916  O  OD1   . ASP C 2  429  ? -5.046  -21.009 75.352  1.00 60.54  ? 429  ASP C OD1   1 
ATOM   6917  O  OD2   . ASP C 2  429  ? -6.048  -22.954 75.187  1.00 52.85  ? 429  ASP C OD2   1 
ATOM   6918  N  N     . VAL C 2  430  ? -1.883  -23.350 77.886  1.00 21.93  ? 430  VAL C N     1 
ATOM   6919  C  CA    . VAL C 2  430  ? -1.108  -24.369 78.580  1.00 22.07  ? 430  VAL C CA    1 
ATOM   6920  C  C     . VAL C 2  430  ? -1.677  -25.745 78.233  1.00 20.21  ? 430  VAL C C     1 
ATOM   6921  O  O     . VAL C 2  430  ? -2.842  -26.041 78.498  1.00 21.42  ? 430  VAL C O     1 
ATOM   6922  C  CB    . VAL C 2  430  ? -1.068  -24.134 80.112  1.00 17.75  ? 430  VAL C CB    1 
ATOM   6923  C  CG1   . VAL C 2  430  ? -2.276  -23.347 80.565  1.00 19.22  ? 430  VAL C CG1   1 
ATOM   6924  C  CG2   . VAL C 2  430  ? -0.956  -25.453 80.870  1.00 18.50  ? 430  VAL C CG2   1 
ATOM   6925  N  N     . HIS C 2  431  ? -0.849  -26.567 77.601  1.00 18.02  ? 431  HIS C N     1 
ATOM   6926  C  CA    . HIS C 2  431  ? -1.240  -27.913 77.213  1.00 17.76  ? 431  HIS C CA    1 
ATOM   6927  C  C     . HIS C 2  431  ? -1.163  -28.793 78.447  1.00 21.20  ? 431  HIS C C     1 
ATOM   6928  O  O     . HIS C 2  431  ? -0.430  -28.473 79.382  1.00 25.16  ? 431  HIS C O     1 
ATOM   6929  C  CB    . HIS C 2  431  ? -0.294  -28.431 76.133  1.00 17.53  ? 431  HIS C CB    1 
ATOM   6930  C  CG    . HIS C 2  431  ? -0.890  -29.481 75.255  1.00 17.86  ? 431  HIS C CG    1 
ATOM   6931  N  ND1   . HIS C 2  431  ? -0.866  -30.824 75.575  1.00 21.06  ? 431  HIS C ND1   1 
ATOM   6932  C  CD2   . HIS C 2  431  ? -1.518  -29.395 74.060  1.00 21.95  ? 431  HIS C CD2   1 
ATOM   6933  C  CE1   . HIS C 2  431  ? -1.455  -31.513 74.620  1.00 25.69  ? 431  HIS C CE1   1 
ATOM   6934  N  NE2   . HIS C 2  431  ? -1.862  -30.668 73.684  1.00 28.99  ? 431  HIS C NE2   1 
ATOM   6935  N  N     . ARG C 2  432  ? -1.921  -29.886 78.472  1.00 18.67  ? 432  ARG C N     1 
ATOM   6936  C  CA    . ARG C 2  432  ? -1.836  -30.823 79.593  1.00 19.96  ? 432  ARG C CA    1 
ATOM   6937  C  C     . ARG C 2  432  ? -0.411  -31.355 79.738  1.00 18.74  ? 432  ARG C C     1 
ATOM   6938  O  O     . ARG C 2  432  ? 0.065   -31.604 80.844  1.00 19.63  ? 432  ARG C O     1 
ATOM   6939  C  CB    . ARG C 2  432  ? -2.825  -31.982 79.425  1.00 15.52  ? 432  ARG C CB    1 
ATOM   6940  C  CG    . ARG C 2  432  ? -2.627  -32.791 78.160  1.00 19.22  ? 432  ARG C CG    1 
ATOM   6941  C  CD    . ARG C 2  432  ? -3.632  -33.921 78.045  1.00 23.06  ? 432  ARG C CD    1 
ATOM   6942  N  NE    . ARG C 2  432  ? -3.583  -34.555 76.728  1.00 23.55  ? 432  ARG C NE    1 
ATOM   6943  C  CZ    . ARG C 2  432  ? -2.762  -35.549 76.407  1.00 20.85  ? 432  ARG C CZ    1 
ATOM   6944  N  NH1   . ARG C 2  432  ? -1.914  -36.029 77.307  1.00 18.80  ? 432  ARG C NH1   1 
ATOM   6945  N  NH2   . ARG C 2  432  ? -2.786  -36.062 75.184  1.00 22.25  ? 432  ARG C NH2   1 
ATOM   6946  N  N     . THR C 2  433  ? 0.275   -31.491 78.608  1.00 14.58  ? 433  THR C N     1 
ATOM   6947  C  CA    . THR C 2  433  ? 1.617   -32.045 78.576  1.00 14.45  ? 433  THR C CA    1 
ATOM   6948  C  C     . THR C 2  433  ? 2.648   -31.087 79.161  1.00 21.01  ? 433  THR C C     1 
ATOM   6949  O  O     . THR C 2  433  ? 3.818   -31.439 79.311  1.00 24.15  ? 433  THR C O     1 
ATOM   6950  C  CB    . THR C 2  433  ? 2.022   -32.405 77.145  1.00 16.44  ? 433  THR C CB    1 
ATOM   6951  O  OG1   . THR C 2  433  ? 2.000   -31.225 76.337  1.00 22.20  ? 433  THR C OG1   1 
ATOM   6952  C  CG2   . THR C 2  433  ? 1.053   -33.412 76.564  1.00 17.59  ? 433  THR C CG2   1 
ATOM   6953  N  N     . HIS C 2  434  ? 2.218   -29.870 79.479  1.00 20.58  ? 434  HIS C N     1 
ATOM   6954  C  CA    . HIS C 2  434  ? 3.087   -28.909 80.147  1.00 17.97  ? 434  HIS C CA    1 
ATOM   6955  C  C     . HIS C 2  434  ? 3.388   -29.343 81.577  1.00 18.18  ? 434  HIS C C     1 
ATOM   6956  O  O     . HIS C 2  434  ? 4.323   -28.839 82.199  1.00 22.57  ? 434  HIS C O     1 
ATOM   6957  C  CB    . HIS C 2  434  ? 2.454   -27.516 80.155  1.00 16.23  ? 434  HIS C CB    1 
ATOM   6958  C  CG    . HIS C 2  434  ? 2.573   -26.788 78.852  1.00 17.67  ? 434  HIS C CG    1 
ATOM   6959  N  ND1   . HIS C 2  434  ? 2.541   -27.433 77.635  1.00 19.59  ? 434  HIS C ND1   1 
ATOM   6960  C  CD2   . HIS C 2  434  ? 2.723   -25.473 78.578  1.00 15.24  ? 434  HIS C CD2   1 
ATOM   6961  C  CE1   . HIS C 2  434  ? 2.669   -26.545 76.664  1.00 18.03  ? 434  HIS C CE1   1 
ATOM   6962  N  NE2   . HIS C 2  434  ? 2.780   -25.347 77.211  1.00 18.99  ? 434  HIS C NE2   1 
ATOM   6963  N  N     . TYR C 2  435  ? 2.588   -30.271 82.094  1.00 15.94  ? 435  TYR C N     1 
ATOM   6964  C  CA    . TYR C 2  435  ? 2.727   -30.721 83.473  1.00 15.52  ? 435  TYR C CA    1 
ATOM   6965  C  C     . TYR C 2  435  ? 4.130   -31.257 83.719  1.00 16.75  ? 435  TYR C C     1 
ATOM   6966  O  O     . TYR C 2  435  ? 4.589   -32.166 83.031  1.00 16.98  ? 435  TYR C O     1 
ATOM   6967  C  CB    . TYR C 2  435  ? 1.686   -31.804 83.780  1.00 17.26  ? 435  TYR C CB    1 
ATOM   6968  C  CG    . TYR C 2  435  ? 1.638   -32.244 85.229  1.00 20.69  ? 435  TYR C CG    1 
ATOM   6969  C  CD1   . TYR C 2  435  ? 0.627   -31.808 86.073  1.00 17.03  ? 435  TYR C CD1   1 
ATOM   6970  C  CD2   . TYR C 2  435  ? 2.599   -33.104 85.750  1.00 29.50  ? 435  TYR C CD2   1 
ATOM   6971  C  CE1   . TYR C 2  435  ? 0.578   -32.211 87.395  1.00 18.63  ? 435  TYR C CE1   1 
ATOM   6972  C  CE2   . TYR C 2  435  ? 2.561   -33.507 87.069  1.00 24.34  ? 435  TYR C CE2   1 
ATOM   6973  C  CZ    . TYR C 2  435  ? 1.549   -33.060 87.885  1.00 22.90  ? 435  TYR C CZ    1 
ATOM   6974  O  OH    . TYR C 2  435  ? 1.513   -33.467 89.198  1.00 31.29  ? 435  TYR C OH    1 
ATOM   6975  N  N     . GLY C 2  436  ? 4.798   -30.701 84.723  1.00 19.94  ? 436  GLY C N     1 
ATOM   6976  C  CA    . GLY C 2  436  ? 6.141   -31.124 85.072  1.00 20.22  ? 436  GLY C CA    1 
ATOM   6977  C  C     . GLY C 2  436  ? 7.228   -30.664 84.115  1.00 17.76  ? 436  GLY C C     1 
ATOM   6978  O  O     . GLY C 2  436  ? 8.405   -30.948 84.328  1.00 21.20  ? 436  GLY C O     1 
ATOM   6979  N  N     . ARG C 2  437  ? 6.843   -29.950 83.063  1.00 15.44  ? 437  ARG C N     1 
ATOM   6980  C  CA    . ARG C 2  437  ? 7.794   -29.534 82.039  1.00 13.43  ? 437  ARG C CA    1 
ATOM   6981  C  C     . ARG C 2  437  ? 7.881   -28.021 81.909  1.00 14.53  ? 437  ARG C C     1 
ATOM   6982  O  O     . ARG C 2  437  ? 8.926   -27.422 82.164  1.00 13.70  ? 437  ARG C O     1 
ATOM   6983  C  CB    . ARG C 2  437  ? 7.430   -30.160 80.695  1.00 14.57  ? 437  ARG C CB    1 
ATOM   6984  C  CG    . ARG C 2  437  ? 7.573   -31.664 80.682  1.00 16.21  ? 437  ARG C CG    1 
ATOM   6985  C  CD    . ARG C 2  437  ? 6.977   -32.285 79.436  1.00 15.68  ? 437  ARG C CD    1 
ATOM   6986  N  NE    . ARG C 2  437  ? 7.017   -33.742 79.511  1.00 22.92  ? 437  ARG C NE    1 
ATOM   6987  C  CZ    . ARG C 2  437  ? 6.118   -34.481 80.155  1.00 23.69  ? 437  ARG C CZ    1 
ATOM   6988  N  NH1   . ARG C 2  437  ? 5.103   -33.904 80.781  1.00 25.73  ? 437  ARG C NH1   1 
ATOM   6989  N  NH2   . ARG C 2  437  ? 6.236   -35.800 80.177  1.00 24.65  ? 437  ARG C NH2   1 
ATOM   6990  N  N     . ILE C 2  438  ? 6.778   -27.413 81.490  1.00 19.40  ? 438  ILE C N     1 
ATOM   6991  C  CA    . ILE C 2  438  ? 6.711   -25.968 81.312  1.00 19.95  ? 438  ILE C CA    1 
ATOM   6992  C  C     . ILE C 2  438  ? 5.791   -25.350 82.360  1.00 13.86  ? 438  ILE C C     1 
ATOM   6993  O  O     . ILE C 2  438  ? 4.627   -25.724 82.463  1.00 17.03  ? 438  ILE C O     1 
ATOM   6994  C  CB    . ILE C 2  438  ? 6.213   -25.611 79.903  1.00 14.49  ? 438  ILE C CB    1 
ATOM   6995  C  CG1   . ILE C 2  438  ? 7.230   -26.068 78.857  1.00 10.76  ? 438  ILE C CG1   1 
ATOM   6996  C  CG2   . ILE C 2  438  ? 5.971   -24.126 79.788  1.00 14.51  ? 438  ILE C CG2   1 
ATOM   6997  C  CD1   . ILE C 2  438  ? 6.815   -25.768 77.444  1.00 16.16  ? 438  ILE C CD1   1 
ATOM   6998  N  N     . CYS C 2  439  ? 6.319   -24.407 83.136  1.00 12.12  ? 439  CYS C N     1 
ATOM   6999  C  CA    . CYS C 2  439  ? 5.575   -23.830 84.253  1.00 11.63  ? 439  CYS C CA    1 
ATOM   7000  C  C     . CYS C 2  439  ? 4.312   -23.097 83.827  1.00 12.96  ? 439  CYS C C     1 
ATOM   7001  O  O     . CYS C 2  439  ? 4.367   -22.174 83.019  1.00 16.88  ? 439  CYS C O     1 
ATOM   7002  C  CB    . CYS C 2  439  ? 6.452   -22.879 85.054  1.00 14.34  ? 439  CYS C CB    1 
ATOM   7003  S  SG    . CYS C 2  439  ? 5.533   -22.013 86.335  1.00 17.30  ? 439  CYS C SG    1 
ATOM   7004  N  N     . PRO C 2  440  ? 3.165   -23.504 84.384  1.00 12.54  ? 440  PRO C N     1 
ATOM   7005  C  CA    . PRO C 2  440  ? 1.864   -22.936 84.023  1.00 13.17  ? 440  PRO C CA    1 
ATOM   7006  C  C     . PRO C 2  440  ? 1.691   -21.482 84.461  1.00 10.93  ? 440  PRO C C     1 
ATOM   7007  O  O     . PRO C 2  440  ? 1.031   -20.719 83.762  1.00 15.81  ? 440  PRO C O     1 
ATOM   7008  C  CB    . PRO C 2  440  ? 0.874   -23.839 84.763  1.00 12.36  ? 440  PRO C CB    1 
ATOM   7009  C  CG    . PRO C 2  440  ? 1.634   -24.333 85.940  1.00 12.68  ? 440  PRO C CG    1 
ATOM   7010  C  CD    . PRO C 2  440  ? 3.056   -24.489 85.474  1.00 12.70  ? 440  PRO C CD    1 
ATOM   7011  N  N     . VAL C 2  441  ? 2.237   -21.110 85.613  1.00 8.98   ? 441  VAL C N     1 
ATOM   7012  C  CA    . VAL C 2  441  ? 2.075   -19.742 86.105  1.00 11.52  ? 441  VAL C CA    1 
ATOM   7013  C  C     . VAL C 2  441  ? 3.022   -18.684 85.521  1.00 11.49  ? 441  VAL C C     1 
ATOM   7014  O  O     . VAL C 2  441  ? 2.580   -17.590 85.182  1.00 12.42  ? 441  VAL C O     1 
ATOM   7015  C  CB    . VAL C 2  441  ? 2.018   -19.669 87.662  1.00 10.55  ? 441  VAL C CB    1 
ATOM   7016  C  CG1   . VAL C 2  441  ? 2.262   -21.030 88.267  1.00 16.14  ? 441  VAL C CG1   1 
ATOM   7017  C  CG2   . VAL C 2  441  ? 2.988   -18.635 88.212  1.00 7.68   ? 441  VAL C CG2   1 
ATOM   7018  N  N     . GLU C 2  442  ? 4.306   -18.998 85.373  1.00 12.49  ? 442  GLU C N     1 
ATOM   7019  C  CA    . GLU C 2  442  ? 5.256   -17.945 85.023  1.00 13.35  ? 442  GLU C CA    1 
ATOM   7020  C  C     . GLU C 2  442  ? 5.365   -17.685 83.530  1.00 15.38  ? 442  GLU C C     1 
ATOM   7021  O  O     . GLU C 2  442  ? 5.808   -18.539 82.763  1.00 18.04  ? 442  GLU C O     1 
ATOM   7022  C  CB    . GLU C 2  442  ? 6.646   -18.230 85.587  1.00 16.35  ? 442  GLU C CB    1 
ATOM   7023  C  CG    . GLU C 2  442  ? 7.701   -17.286 85.030  1.00 21.22  ? 442  GLU C CG    1 
ATOM   7024  C  CD    . GLU C 2  442  ? 9.090   -17.580 85.547  1.00 25.40  ? 442  GLU C CD    1 
ATOM   7025  O  OE1   . GLU C 2  442  ? 9.251   -17.704 86.778  1.00 26.18  ? 442  GLU C OE1   1 
ATOM   7026  O  OE2   . GLU C 2  442  ? 10.021  -17.690 84.721  1.00 27.96  ? 442  GLU C OE2   1 
ATOM   7027  N  N     . THR C 2  443  ? 4.991   -16.471 83.145  1.00 19.15  ? 443  THR C N     1 
ATOM   7028  C  CA    . THR C 2  443  ? 5.085   -16.009 81.774  1.00 18.37  ? 443  THR C CA    1 
ATOM   7029  C  C     . THR C 2  443  ? 4.909   -14.497 81.863  1.00 16.95  ? 443  THR C C     1 
ATOM   7030  O  O     . THR C 2  443  ? 4.612   -13.981 82.940  1.00 13.46  ? 443  THR C O     1 
ATOM   7031  C  CB    . THR C 2  443  ? 3.949   -16.657 80.935  1.00 14.89  ? 443  THR C CB    1 
ATOM   7032  O  OG1   . THR C 2  443  ? 4.091   -16.330 79.549  1.00 13.97  ? 443  THR C OG1   1 
ATOM   7033  C  CG2   . THR C 2  443  ? 2.589   -16.204 81.425  1.00 14.43  ? 443  THR C CG2   1 
ATOM   7034  N  N     . PRO C 2  444  ? 5.070   -13.777 80.741  1.00 17.88  ? 444  PRO C N     1 
ATOM   7035  C  CA    . PRO C 2  444  ? 4.741   -12.348 80.765  1.00 17.10  ? 444  PRO C CA    1 
ATOM   7036  C  C     . PRO C 2  444  ? 3.243   -12.087 80.808  1.00 22.46  ? 444  PRO C C     1 
ATOM   7037  O  O     . PRO C 2  444  ? 2.469   -12.811 80.186  1.00 22.98  ? 444  PRO C O     1 
ATOM   7038  C  CB    . PRO C 2  444  ? 5.320   -11.841 79.449  1.00 19.63  ? 444  PRO C CB    1 
ATOM   7039  C  CG    . PRO C 2  444  ? 6.466   -12.733 79.195  1.00 25.27  ? 444  PRO C CG    1 
ATOM   7040  C  CD    . PRO C 2  444  ? 6.030   -14.088 79.668  1.00 18.49  ? 444  PRO C CD    1 
ATOM   7041  N  N     . GLU C 2  445  ? 2.849   -11.049 81.536  1.00 27.38  ? 445  GLU C N     1 
ATOM   7042  C  CA    . GLU C 2  445  ? 1.443   -10.694 81.682  1.00 23.08  ? 445  GLU C CA    1 
ATOM   7043  C  C     . GLU C 2  445  ? 0.951   -9.935  80.450  1.00 26.66  ? 445  GLU C C     1 
ATOM   7044  O  O     . GLU C 2  445  ? -0.249  -9.734  80.268  1.00 40.84  ? 445  GLU C O     1 
ATOM   7045  C  CB    . GLU C 2  445  ? 1.252   -9.848  82.944  1.00 25.44  ? 445  GLU C CB    1 
ATOM   7046  C  CG    . GLU C 2  445  ? -0.188  -9.708  83.410  1.00 36.30  ? 445  GLU C CG    1 
ATOM   7047  C  CD    . GLU C 2  445  ? -0.348  -8.689  84.527  1.00 50.16  ? 445  GLU C CD    1 
ATOM   7048  O  OE1   . GLU C 2  445  ? -1.500  -8.445  84.944  1.00 48.47  ? 445  GLU C OE1   1 
ATOM   7049  O  OE2   . GLU C 2  445  ? 0.676   -8.129  84.984  1.00 46.20  ? 445  GLU C OE2   1 
ATOM   7050  N  N     . GLY C 2  446  ? 1.885   -9.549  79.587  1.00 23.30  ? 446  GLY C N     1 
ATOM   7051  C  CA    . GLY C 2  446  ? 1.595   -8.667  78.470  1.00 28.62  ? 446  GLY C CA    1 
ATOM   7052  C  C     . GLY C 2  446  ? 1.245   -9.375  77.172  1.00 28.43  ? 446  GLY C C     1 
ATOM   7053  O  O     . GLY C 2  446  ? 0.598   -10.420 77.181  1.00 26.23  ? 446  GLY C O     1 
ATOM   7054  N  N     . ALA C 2  447  ? 1.634   -8.770  76.051  1.00 29.92  ? 447  ALA C N     1 
ATOM   7055  C  CA    . ALA C 2  447  ? 1.355   -9.310  74.721  1.00 24.36  ? 447  ALA C CA    1 
ATOM   7056  C  C     . ALA C 2  447  ? 2.112   -10.604 74.416  1.00 27.50  ? 447  ALA C C     1 
ATOM   7057  O  O     . ALA C 2  447  ? 1.749   -11.342 73.498  1.00 26.57  ? 447  ALA C O     1 
ATOM   7058  C  CB    . ALA C 2  447  ? 1.658   -8.264  73.661  1.00 26.84  ? 447  ALA C CB    1 
ATOM   7059  N  N     . ASN C 2  448  ? 3.165   -10.870 75.182  1.00 25.51  ? 448  ASN C N     1 
ATOM   7060  C  CA    . ASN C 2  448  ? 3.984   -12.063 74.984  1.00 22.51  ? 448  ASN C CA    1 
ATOM   7061  C  C     . ASN C 2  448  ? 3.457   -13.297 75.706  1.00 24.56  ? 448  ASN C C     1 
ATOM   7062  O  O     . ASN C 2  448  ? 4.080   -14.359 75.657  1.00 25.15  ? 448  ASN C O     1 
ATOM   7063  C  CB    . ASN C 2  448  ? 5.421   -11.803 75.429  1.00 17.99  ? 448  ASN C CB    1 
ATOM   7064  C  CG    . ASN C 2  448  ? 6.196   -10.995 74.428  1.00 24.50  ? 448  ASN C CG    1 
ATOM   7065  O  OD1   . ASN C 2  448  ? 6.009   -11.141 73.220  1.00 29.92  ? 448  ASN C OD1   1 
ATOM   7066  N  ND2   . ASN C 2  448  ? 7.078   -10.134 74.920  1.00 29.59  ? 448  ASN C ND2   1 
ATOM   7067  N  N     . ILE C 2  449  ? 2.319   -13.152 76.381  1.00 21.11  ? 449  ILE C N     1 
ATOM   7068  C  CA    . ILE C 2  449  ? 1.797   -14.210 77.242  1.00 23.17  ? 449  ILE C CA    1 
ATOM   7069  C  C     . ILE C 2  449  ? 1.622   -15.551 76.512  1.00 30.34  ? 449  ILE C C     1 
ATOM   7070  O  O     . ILE C 2  449  ? 1.021   -15.624 75.437  1.00 31.71  ? 449  ILE C O     1 
ATOM   7071  C  CB    . ILE C 2  449  ? 0.484   -13.778 77.947  1.00 16.73  ? 449  ILE C CB    1 
ATOM   7072  C  CG1   . ILE C 2  449  ? 0.048   -14.837 78.958  1.00 17.87  ? 449  ILE C CG1   1 
ATOM   7073  C  CG2   . ILE C 2  449  ? -0.615  -13.491 76.937  1.00 20.61  ? 449  ILE C CG2   1 
ATOM   7074  C  CD1   . ILE C 2  449  ? -1.192  -14.465 79.718  1.00 25.87  ? 449  ILE C CD1   1 
ATOM   7075  N  N     . GLY C 2  450  ? 2.195   -16.601 77.094  1.00 18.03  ? 450  GLY C N     1 
ATOM   7076  C  CA    . GLY C 2  450  ? 2.129   -17.934 76.529  1.00 18.27  ? 450  GLY C CA    1 
ATOM   7077  C  C     . GLY C 2  450  ? 3.185   -18.185 75.470  1.00 21.25  ? 450  GLY C C     1 
ATOM   7078  O  O     . GLY C 2  450  ? 3.476   -19.334 75.138  1.00 25.08  ? 450  GLY C O     1 
ATOM   7079  N  N     . LEU C 2  451  ? 3.748   -17.110 74.924  1.00 18.25  ? 451  LEU C N     1 
ATOM   7080  C  CA    . LEU C 2  451  ? 4.877   -17.217 74.001  1.00 21.23  ? 451  LEU C CA    1 
ATOM   7081  C  C     . LEU C 2  451  ? 6.226   -17.371 74.706  1.00 20.70  ? 451  LEU C C     1 
ATOM   7082  O  O     . LEU C 2  451  ? 7.079   -18.142 74.268  1.00 20.13  ? 451  LEU C O     1 
ATOM   7083  C  CB    . LEU C 2  451  ? 4.898   -16.042 73.029  1.00 18.86  ? 451  LEU C CB    1 
ATOM   7084  C  CG    . LEU C 2  451  ? 3.674   -16.016 72.121  1.00 19.61  ? 451  LEU C CG    1 
ATOM   7085  C  CD1   . LEU C 2  451  ? 3.798   -14.921 71.080  1.00 32.67  ? 451  LEU C CD1   1 
ATOM   7086  C  CD2   . LEU C 2  451  ? 3.486   -17.369 71.464  1.00 22.66  ? 451  LEU C CD2   1 
ATOM   7087  N  N     . ILE C 2  452  ? 6.420   -16.620 75.787  1.00 17.95  ? 452  ILE C N     1 
ATOM   7088  C  CA    . ILE C 2  452  ? 7.626   -16.744 76.594  1.00 15.65  ? 452  ILE C CA    1 
ATOM   7089  C  C     . ILE C 2  452  ? 7.289   -17.531 77.847  1.00 16.07  ? 452  ILE C C     1 
ATOM   7090  O  O     . ILE C 2  452  ? 6.592   -17.042 78.729  1.00 19.95  ? 452  ILE C O     1 
ATOM   7091  C  CB    . ILE C 2  452  ? 8.179   -15.369 77.019  1.00 19.18  ? 452  ILE C CB    1 
ATOM   7092  C  CG1   . ILE C 2  452  ? 8.322   -14.433 75.813  1.00 20.37  ? 452  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE C 2  452  ? 9.502   -15.529 77.757  1.00 16.25  ? 452  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE C 2  452  ? 9.357   -14.871 74.804  1.00 16.29  ? 452  ILE C CD1   1 
ATOM   7095  N  N     . THR C 2  453  ? 7.798   -18.750 77.929  1.00 20.12  ? 453  THR C N     1 
ATOM   7096  C  CA    . THR C 2  453  ? 7.486   -19.629 79.045  1.00 22.05  ? 453  THR C CA    1 
ATOM   7097  C  C     . THR C 2  453  ? 8.734   -19.974 79.850  1.00 18.21  ? 453  THR C C     1 
ATOM   7098  O  O     . THR C 2  453  ? 9.834   -19.524 79.531  1.00 15.90  ? 453  THR C O     1 
ATOM   7099  C  CB    . THR C 2  453  ? 6.798   -20.918 78.559  1.00 31.01  ? 453  THR C CB    1 
ATOM   7100  O  OG1   . THR C 2  453  ? 7.568   -21.508 77.502  1.00 28.18  ? 453  THR C OG1   1 
ATOM   7101  C  CG2   . THR C 2  453  ? 5.389   -20.616 78.050  1.00 25.54  ? 453  THR C CG2   1 
ATOM   7102  N  N     . SER C 2  454  ? 8.564   -20.771 80.898  1.00 19.81  ? 454  SER C N     1 
ATOM   7103  C  CA    . SER C 2  454  ? 9.686   -21.100 81.768  1.00 18.93  ? 454  SER C CA    1 
ATOM   7104  C  C     . SER C 2  454  ? 9.806   -22.593 82.033  1.00 16.94  ? 454  SER C C     1 
ATOM   7105  O  O     . SER C 2  454  ? 8.811   -23.285 82.250  1.00 16.06  ? 454  SER C O     1 
ATOM   7106  C  CB    . SER C 2  454  ? 9.586   -20.343 83.090  1.00 16.52  ? 454  SER C CB    1 
ATOM   7107  O  OG    . SER C 2  454  ? 10.840  -20.326 83.747  1.00 19.99  ? 454  SER C OG    1 
ATOM   7108  N  N     . LEU C 2  455  ? 11.042  -23.076 82.014  1.00 15.77  ? 455  LEU C N     1 
ATOM   7109  C  CA    . LEU C 2  455  ? 11.332  -24.475 82.267  1.00 14.10  ? 455  LEU C CA    1 
ATOM   7110  C  C     . LEU C 2  455  ? 11.005  -24.806 83.712  1.00 17.04  ? 455  LEU C C     1 
ATOM   7111  O  O     . LEU C 2  455  ? 11.361  -24.054 84.621  1.00 20.51  ? 455  LEU C O     1 
ATOM   7112  C  CB    . LEU C 2  455  ? 12.810  -24.748 82.000  1.00 14.47  ? 455  LEU C CB    1 
ATOM   7113  C  CG    . LEU C 2  455  ? 13.280  -26.198 82.019  1.00 13.82  ? 455  LEU C CG    1 
ATOM   7114  C  CD1   . LEU C 2  455  ? 12.552  -27.007 80.958  1.00 13.84  ? 455  LEU C CD1   1 
ATOM   7115  C  CD2   . LEU C 2  455  ? 14.777  -26.247 81.794  1.00 16.56  ? 455  LEU C CD2   1 
ATOM   7116  N  N     . ALA C 2  456  ? 10.324  -25.927 83.921  1.00 14.92  ? 456  ALA C N     1 
ATOM   7117  C  CA    . ALA C 2  456  ? 10.006  -26.380 85.270  1.00 15.48  ? 456  ALA C CA    1 
ATOM   7118  C  C     . ALA C 2  456  ? 11.274  -26.811 86.008  1.00 15.21  ? 456  ALA C C     1 
ATOM   7119  O  O     . ALA C 2  456  ? 12.309  -27.054 85.387  1.00 17.37  ? 456  ALA C O     1 
ATOM   7120  C  CB    . ALA C 2  456  ? 8.987   -27.498 85.239  1.00 16.19  ? 456  ALA C CB    1 
ATOM   7121  N  N     . ALA C 2  457  ? 11.192  -26.871 87.334  1.00 14.59  ? 457  ALA C N     1 
ATOM   7122  C  CA    . ALA C 2  457  ? 12.355  -27.130 88.181  1.00 21.04  ? 457  ALA C CA    1 
ATOM   7123  C  C     . ALA C 2  457  ? 13.066  -28.457 87.892  1.00 25.49  ? 457  ALA C C     1 
ATOM   7124  O  O     . ALA C 2  457  ? 14.262  -28.476 87.591  1.00 25.73  ? 457  ALA C O     1 
ATOM   7125  C  CB    . ALA C 2  457  ? 11.958  -27.050 89.649  1.00 17.20  ? 457  ALA C CB    1 
ATOM   7126  N  N     . TYR C 2  458  ? 12.326  -29.559 87.979  1.00 25.51  ? 458  TYR C N     1 
ATOM   7127  C  CA    . TYR C 2  458  ? 12.896  -30.889 87.773  1.00 20.96  ? 458  TYR C CA    1 
ATOM   7128  C  C     . TYR C 2  458  ? 13.010  -31.257 86.300  1.00 23.22  ? 458  TYR C C     1 
ATOM   7129  O  O     . TYR C 2  458  ? 13.576  -32.296 85.963  1.00 26.25  ? 458  TYR C O     1 
ATOM   7130  C  CB    . TYR C 2  458  ? 12.050  -31.949 88.473  1.00 21.36  ? 458  TYR C CB    1 
ATOM   7131  C  CG    . TYR C 2  458  ? 12.304  -32.089 89.951  1.00 23.97  ? 458  TYR C CG    1 
ATOM   7132  C  CD1   . TYR C 2  458  ? 11.478  -31.470 90.874  1.00 28.98  ? 458  TYR C CD1   1 
ATOM   7133  C  CD2   . TYR C 2  458  ? 13.360  -32.854 90.426  1.00 27.39  ? 458  TYR C CD2   1 
ATOM   7134  C  CE1   . TYR C 2  458  ? 11.698  -31.602 92.230  1.00 35.18  ? 458  TYR C CE1   1 
ATOM   7135  C  CE2   . TYR C 2  458  ? 13.589  -32.992 91.781  1.00 29.15  ? 458  TYR C CE2   1 
ATOM   7136  C  CZ    . TYR C 2  458  ? 12.753  -32.364 92.679  1.00 31.13  ? 458  TYR C CZ    1 
ATOM   7137  O  OH    . TYR C 2  458  ? 12.967  -32.490 94.031  1.00 34.46  ? 458  TYR C OH    1 
ATOM   7138  N  N     . ALA C 2  459  ? 12.460  -30.415 85.429  1.00 22.94  ? 459  ALA C N     1 
ATOM   7139  C  CA    . ALA C 2  459  ? 12.431  -30.699 83.998  1.00 18.31  ? 459  ALA C CA    1 
ATOM   7140  C  C     . ALA C 2  459  ? 13.827  -30.722 83.376  1.00 21.06  ? 459  ALA C C     1 
ATOM   7141  O  O     . ALA C 2  459  ? 14.692  -29.913 83.727  1.00 17.32  ? 459  ALA C O     1 
ATOM   7142  C  CB    . ALA C 2  459  ? 11.542  -29.700 83.280  1.00 13.29  ? 459  ALA C CB    1 
ATOM   7143  N  N     . ARG C 2  460  ? 14.034  -31.664 82.458  1.00 19.25  ? 460  ARG C N     1 
ATOM   7144  C  CA    . ARG C 2  460  ? 15.295  -31.786 81.732  1.00 24.33  ? 460  ARG C CA    1 
ATOM   7145  C  C     . ARG C 2  460  ? 15.041  -31.968 80.237  1.00 19.36  ? 460  ARG C C     1 
ATOM   7146  O  O     . ARG C 2  460  ? 14.051  -32.578 79.840  1.00 17.79  ? 460  ARG C O     1 
ATOM   7147  C  CB    . ARG C 2  460  ? 16.112  -32.967 82.264  1.00 27.38  ? 460  ARG C CB    1 
ATOM   7148  C  CG    . ARG C 2  460  ? 16.579  -32.813 83.705  1.00 36.19  ? 460  ARG C CG    1 
ATOM   7149  C  CD    . ARG C 2  460  ? 17.245  -34.087 84.221  1.00 39.55  ? 460  ARG C CD    1 
ATOM   7150  N  NE    . ARG C 2  460  ? 18.491  -34.392 83.525  1.00 52.53  ? 460  ARG C NE    1 
ATOM   7151  C  CZ    . ARG C 2  460  ? 19.680  -34.455 84.116  1.00 50.47  ? 460  ARG C CZ    1 
ATOM   7152  N  NH1   . ARG C 2  460  ? 19.787  -34.242 85.422  1.00 38.67  ? 460  ARG C NH1   1 
ATOM   7153  N  NH2   . ARG C 2  460  ? 20.762  -34.739 83.402  1.00 53.86  ? 460  ARG C NH2   1 
ATOM   7154  N  N     . VAL C 2  461  ? 15.937  -31.435 79.413  1.00 18.76  ? 461  VAL C N     1 
ATOM   7155  C  CA    . VAL C 2  461  ? 15.836  -31.602 77.969  1.00 18.87  ? 461  VAL C CA    1 
ATOM   7156  C  C     . VAL C 2  461  ? 16.833  -32.661 77.507  1.00 24.95  ? 461  VAL C C     1 
ATOM   7157  O  O     . VAL C 2  461  ? 18.017  -32.591 77.840  1.00 23.22  ? 461  VAL C O     1 
ATOM   7158  C  CB    . VAL C 2  461  ? 16.115  -30.280 77.225  1.00 17.44  ? 461  VAL C CB    1 
ATOM   7159  C  CG1   . VAL C 2  461  ? 15.734  -30.404 75.759  1.00 18.18  ? 461  VAL C CG1   1 
ATOM   7160  C  CG2   . VAL C 2  461  ? 15.355  -29.136 77.871  1.00 15.27  ? 461  VAL C CG2   1 
ATOM   7161  N  N     . ASP C 2  462  ? 16.353  -33.639 76.741  1.00 24.52  ? 462  ASP C N     1 
ATOM   7162  C  CA    . ASP C 2  462  ? 17.193  -34.754 76.298  1.00 35.90  ? 462  ASP C CA    1 
ATOM   7163  C  C     . ASP C 2  462  ? 17.972  -34.472 75.006  1.00 42.95  ? 462  ASP C C     1 
ATOM   7164  O  O     . ASP C 2  462  ? 17.978  -33.347 74.504  1.00 36.69  ? 462  ASP C O     1 
ATOM   7165  C  CB    . ASP C 2  462  ? 16.365  -36.041 76.164  1.00 40.63  ? 462  ASP C CB    1 
ATOM   7166  C  CG    . ASP C 2  462  ? 15.163  -35.880 75.242  1.00 45.50  ? 462  ASP C CG    1 
ATOM   7167  O  OD1   . ASP C 2  462  ? 15.260  -35.142 74.236  1.00 46.41  ? 462  ASP C OD1   1 
ATOM   7168  O  OD2   . ASP C 2  462  ? 14.113  -36.499 75.522  1.00 40.66  ? 462  ASP C OD2   1 
ATOM   7169  N  N     . GLU C 2  463  ? 18.625  -35.505 74.475  1.00 50.74  ? 463  GLU C N     1 
ATOM   7170  C  CA    . GLU C 2  463  ? 19.429  -35.372 73.262  1.00 46.62  ? 463  GLU C CA    1 
ATOM   7171  C  C     . GLU C 2  463  ? 18.585  -34.932 72.075  1.00 43.78  ? 463  GLU C C     1 
ATOM   7172  O  O     . GLU C 2  463  ? 19.024  -34.124 71.256  1.00 43.80  ? 463  GLU C O     1 
ATOM   7173  C  CB    . GLU C 2  463  ? 20.133  -36.690 72.924  1.00 60.35  ? 463  GLU C CB    1 
ATOM   7174  C  CG    . GLU C 2  463  ? 21.153  -37.154 73.953  1.00 73.50  ? 463  GLU C CG    1 
ATOM   7175  C  CD    . GLU C 2  463  ? 20.537  -38.000 75.051  1.00 93.05  ? 463  GLU C CD    1 
ATOM   7176  O  OE1   . GLU C 2  463  ? 19.294  -38.150 75.068  1.00 90.48  ? 463  GLU C OE1   1 
ATOM   7177  O  OE2   . GLU C 2  463  ? 21.298  -38.520 75.896  1.00 95.76  ? 463  GLU C OE2   1 
ATOM   7178  N  N     . LEU C 2  464  ? 17.372  -35.468 71.988  1.00 44.76  ? 464  LEU C N     1 
ATOM   7179  C  CA    . LEU C 2  464  ? 16.470  -35.155 70.885  1.00 41.80  ? 464  LEU C CA    1 
ATOM   7180  C  C     . LEU C 2  464  ? 15.907  -33.740 70.992  1.00 36.54  ? 464  LEU C C     1 
ATOM   7181  O  O     . LEU C 2  464  ? 15.527  -33.137 69.987  1.00 36.47  ? 464  LEU C O     1 
ATOM   7182  C  CB    . LEU C 2  464  ? 15.328  -36.175 70.797  1.00 37.07  ? 464  LEU C CB    1 
ATOM   7183  C  CG    . LEU C 2  464  ? 15.671  -37.589 70.317  1.00 32.53  ? 464  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C 2  464  ? 16.650  -37.538 69.153  1.00 23.06  ? 464  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C 2  464  ? 16.230  -38.436 71.453  1.00 52.91  ? 464  LEU C CD2   1 
ATOM   7186  N  N     . GLY C 2  465  ? 15.872  -33.206 72.208  1.00 36.72  ? 465  GLY C N     1 
ATOM   7187  C  CA    . GLY C 2  465  ? 15.368  -31.862 72.424  1.00 34.56  ? 465  GLY C CA    1 
ATOM   7188  C  C     . GLY C 2  465  ? 13.957  -31.806 72.976  1.00 24.35  ? 465  GLY C C     1 
ATOM   7189  O  O     . GLY C 2  465  ? 13.328  -30.748 72.970  1.00 20.57  ? 465  GLY C O     1 
ATOM   7190  N  N     . PHE C 2  466  ? 13.458  -32.946 73.445  1.00 24.50  ? 466  PHE C N     1 
ATOM   7191  C  CA    . PHE C 2  466  ? 12.153  -33.006 74.097  1.00 22.41  ? 466  PHE C CA    1 
ATOM   7192  C  C     . PHE C 2  466  ? 12.311  -32.867 75.612  1.00 20.00  ? 466  PHE C C     1 
ATOM   7193  O  O     . PHE C 2  466  ? 13.283  -33.353 76.187  1.00 24.29  ? 466  PHE C O     1 
ATOM   7194  C  CB    . PHE C 2  466  ? 11.429  -34.311 73.752  1.00 20.90  ? 466  PHE C CB    1 
ATOM   7195  C  CG    . PHE C 2  466  ? 11.189  -34.501 72.281  1.00 22.66  ? 466  PHE C CG    1 
ATOM   7196  C  CD1   . PHE C 2  466  ? 11.895  -35.453 71.568  1.00 30.87  ? 466  PHE C CD1   1 
ATOM   7197  C  CD2   . PHE C 2  466  ? 10.263  -33.721 71.610  1.00 26.34  ? 466  PHE C CD2   1 
ATOM   7198  C  CE1   . PHE C 2  466  ? 11.678  -35.628 70.209  1.00 33.39  ? 466  PHE C CE1   1 
ATOM   7199  C  CE2   . PHE C 2  466  ? 10.043  -33.888 70.253  1.00 27.03  ? 466  PHE C CE2   1 
ATOM   7200  C  CZ    . PHE C 2  466  ? 10.749  -34.845 69.553  1.00 30.05  ? 466  PHE C CZ    1 
ATOM   7201  N  N     . ILE C 2  467  ? 11.370  -32.182 76.253  1.00 16.59  ? 467  ILE C N     1 
ATOM   7202  C  CA    . ILE C 2  467  ? 11.443  -31.953 77.694  1.00 19.33  ? 467  ILE C CA    1 
ATOM   7203  C  C     . ILE C 2  467  ? 10.933  -33.156 78.489  1.00 16.43  ? 467  ILE C C     1 
ATOM   7204  O  O     . ILE C 2  467  ? 9.828   -33.646 78.251  1.00 15.53  ? 467  ILE C O     1 
ATOM   7205  C  CB    . ILE C 2  467  ? 10.655  -30.690 78.105  1.00 18.17  ? 467  ILE C CB    1 
ATOM   7206  C  CG1   . ILE C 2  467  ? 10.992  -29.528 77.172  1.00 11.97  ? 467  ILE C CG1   1 
ATOM   7207  C  CG2   . ILE C 2  467  ? 10.945  -30.320 79.553  1.00 13.20  ? 467  ILE C CG2   1 
ATOM   7208  C  CD1   . ILE C 2  467  ? 10.250  -28.259 77.501  1.00 15.57  ? 467  ILE C CD1   1 
ATOM   7209  N  N     . ARG C 2  468  ? 11.742  -33.626 79.433  1.00 17.24  ? 468  ARG C N     1 
ATOM   7210  C  CA    . ARG C 2  468  ? 11.382  -34.790 80.236  1.00 18.13  ? 468  ARG C CA    1 
ATOM   7211  C  C     . ARG C 2  468  ? 11.245  -34.439 81.713  1.00 20.44  ? 468  ARG C C     1 
ATOM   7212  O  O     . ARG C 2  468  ? 11.989  -33.608 82.236  1.00 22.90  ? 468  ARG C O     1 
ATOM   7213  C  CB    . ARG C 2  468  ? 12.410  -35.914 80.067  1.00 18.30  ? 468  ARG C CB    1 
ATOM   7214  C  CG    . ARG C 2  468  ? 12.796  -36.197 78.626  1.00 27.80  ? 468  ARG C CG    1 
ATOM   7215  C  CD    . ARG C 2  468  ? 13.707  -37.411 78.515  1.00 35.81  ? 468  ARG C CD    1 
ATOM   7216  N  NE    . ARG C 2  468  ? 12.943  -38.654 78.463  1.00 46.69  ? 468  ARG C NE    1 
ATOM   7217  C  CZ    . ARG C 2  468  ? 13.219  -39.671 77.653  1.00 35.00  ? 468  ARG C CZ    1 
ATOM   7218  N  NH1   . ARG C 2  468  ? 14.250  -39.601 76.823  1.00 16.78  ? 468  ARG C NH1   1 
ATOM   7219  N  NH2   . ARG C 2  468  ? 12.461  -40.760 77.674  1.00 43.56  ? 468  ARG C NH2   1 
ATOM   7220  N  N     . THR C 2  469  ? 10.294  -35.086 82.378  1.00 19.62  ? 469  THR C N     1 
ATOM   7221  C  CA    . THR C 2  469  ? 10.060  -34.870 83.800  1.00 22.08  ? 469  THR C CA    1 
ATOM   7222  C  C     . THR C 2  469  ? 10.124  -36.200 84.558  1.00 25.05  ? 469  THR C C     1 
ATOM   7223  O  O     . THR C 2  469  ? 9.663   -37.224 84.056  1.00 28.97  ? 469  THR C O     1 
ATOM   7224  C  CB    . THR C 2  469  ? 8.693   -34.182 84.030  1.00 25.56  ? 469  THR C CB    1 
ATOM   7225  O  OG1   . THR C 2  469  ? 8.369   -34.189 85.425  1.00 26.42  ? 469  THR C OG1   1 
ATOM   7226  C  CG2   . THR C 2  469  ? 7.590   -34.892 83.253  1.00 25.55  ? 469  THR C CG2   1 
ATOM   7227  N  N     . PRO C 2  470  ? 10.704  -36.187 85.771  1.00 24.05  ? 470  PRO C N     1 
ATOM   7228  C  CA    . PRO C 2  470  ? 10.904  -37.399 86.576  1.00 22.98  ? 470  PRO C CA    1 
ATOM   7229  C  C     . PRO C 2  470  ? 9.636   -37.944 87.222  1.00 22.85  ? 470  PRO C C     1 
ATOM   7230  O  O     . PRO C 2  470  ? 8.797   -37.175 87.682  1.00 24.55  ? 470  PRO C O     1 
ATOM   7231  C  CB    . PRO C 2  470  ? 11.871  -36.933 87.663  1.00 26.68  ? 470  PRO C CB    1 
ATOM   7232  C  CG    . PRO C 2  470  ? 11.569  -35.498 87.826  1.00 27.60  ? 470  PRO C CG    1 
ATOM   7233  C  CD    . PRO C 2  470  ? 11.233  -34.992 86.450  1.00 25.70  ? 470  PRO C CD    1 
ATOM   7234  N  N     . TYR C 2  471  ? 9.522   -39.268 87.269  1.00 31.88  ? 471  TYR C N     1 
ATOM   7235  C  CA    . TYR C 2  471  ? 8.430   -39.944 87.962  1.00 29.08  ? 471  TYR C CA    1 
ATOM   7236  C  C     . TYR C 2  471  ? 8.962   -41.175 88.683  1.00 30.56  ? 471  TYR C C     1 
ATOM   7237  O  O     . TYR C 2  471  ? 9.782   -41.907 88.142  1.00 33.12  ? 471  TYR C O     1 
ATOM   7238  C  CB    . TYR C 2  471  ? 7.338   -40.373 86.981  1.00 31.22  ? 471  TYR C CB    1 
ATOM   7239  C  CG    . TYR C 2  471  ? 6.543   -39.234 86.385  1.00 36.87  ? 471  TYR C CG    1 
ATOM   7240  C  CD1   . TYR C 2  471  ? 6.681   -38.891 85.046  1.00 30.48  ? 471  TYR C CD1   1 
ATOM   7241  C  CD2   . TYR C 2  471  ? 5.651   -38.504 87.161  1.00 36.92  ? 471  TYR C CD2   1 
ATOM   7242  C  CE1   . TYR C 2  471  ? 5.952   -37.851 84.497  1.00 34.49  ? 471  TYR C CE1   1 
ATOM   7243  C  CE2   . TYR C 2  471  ? 4.918   -37.462 86.622  1.00 33.79  ? 471  TYR C CE2   1 
ATOM   7244  C  CZ    . TYR C 2  471  ? 5.073   -37.140 85.290  1.00 38.03  ? 471  TYR C CZ    1 
ATOM   7245  O  OH    . TYR C 2  471  ? 4.345   -36.104 84.749  1.00 40.92  ? 471  TYR C OH    1 
ATOM   7246  N  N     . ARG C 2  472  ? 8.493   -41.400 89.904  1.00 36.90  ? 472  ARG C N     1 
ATOM   7247  C  CA    . ARG C 2  472  ? 8.860   -42.591 90.660  1.00 35.39  ? 472  ARG C CA    1 
ATOM   7248  C  C     . ARG C 2  472  ? 8.095   -43.811 90.160  1.00 37.22  ? 472  ARG C C     1 
ATOM   7249  O  O     . ARG C 2  472  ? 6.916   -43.716 89.822  1.00 34.62  ? 472  ARG C O     1 
ATOM   7250  C  CB    . ARG C 2  472  ? 8.585   -42.385 92.148  1.00 36.35  ? 472  ARG C CB    1 
ATOM   7251  C  CG    . ARG C 2  472  ? 9.616   -41.535 92.862  1.00 42.81  ? 472  ARG C CG    1 
ATOM   7252  C  CD    . ARG C 2  472  ? 9.304   -41.447 94.342  1.00 43.16  ? 472  ARG C CD    1 
ATOM   7253  N  NE    . ARG C 2  472  ? 8.277   -40.450 94.631  1.00 54.49  ? 472  ARG C NE    1 
ATOM   7254  C  CZ    . ARG C 2  472  ? 7.570   -40.411 95.756  1.00 59.15  ? 472  ARG C CZ    1 
ATOM   7255  N  NH1   . ARG C 2  472  ? 7.769   -41.327 96.696  1.00 64.81  ? 472  ARG C NH1   1 
ATOM   7256  N  NH2   . ARG C 2  472  ? 6.658   -39.463 95.939  1.00 40.93  ? 472  ARG C NH2   1 
ATOM   7257  N  N     . ARG C 2  473  ? 8.770   -44.956 90.117  1.00 41.47  ? 473  ARG C N     1 
ATOM   7258  C  CA    . ARG C 2  473  ? 8.139   -46.200 89.689  1.00 42.27  ? 473  ARG C CA    1 
ATOM   7259  C  C     . ARG C 2  473  ? 7.368   -46.849 90.831  1.00 40.78  ? 473  ARG C C     1 
ATOM   7260  O  O     . ARG C 2  473  ? 7.857   -46.929 91.958  1.00 42.20  ? 473  ARG C O     1 
ATOM   7261  C  CB    . ARG C 2  473  ? 9.184   -47.181 89.158  1.00 44.23  ? 473  ARG C CB    1 
ATOM   7262  C  CG    . ARG C 2  473  ? 8.628   -48.559 88.820  1.00 42.20  ? 473  ARG C CG    1 
ATOM   7263  C  CD    . ARG C 2  473  ? 8.393   -48.723 87.327  1.00 32.26  ? 473  ARG C CD    1 
ATOM   7264  N  NE    . ARG C 2  473  ? 9.627   -48.535 86.567  1.00 33.49  ? 473  ARG C NE    1 
ATOM   7265  C  CZ    . ARG C 2  473  ? 9.722   -48.657 85.247  1.00 32.93  ? 473  ARG C CZ    1 
ATOM   7266  N  NH1   . ARG C 2  473  ? 8.652   -48.977 84.528  1.00 27.57  ? 473  ARG C NH1   1 
ATOM   7267  N  NH2   . ARG C 2  473  ? 10.889  -48.461 84.645  1.00 28.16  ? 473  ARG C NH2   1 
ATOM   7268  N  N     . VAL C 2  474  ? 6.159   -47.309 90.532  1.00 39.25  ? 474  VAL C N     1 
ATOM   7269  C  CA    . VAL C 2  474  ? 5.344   -48.008 91.515  1.00 45.90  ? 474  VAL C CA    1 
ATOM   7270  C  C     . VAL C 2  474  ? 5.047   -49.432 91.049  1.00 53.52  ? 474  VAL C C     1 
ATOM   7271  O  O     . VAL C 2  474  ? 4.358   -49.639 90.049  1.00 51.49  ? 474  VAL C O     1 
ATOM   7272  C  CB    . VAL C 2  474  ? 4.022   -47.261 91.802  1.00 36.33  ? 474  VAL C CB    1 
ATOM   7273  C  CG1   . VAL C 2  474  ? 3.106   -48.109 92.668  1.00 49.04  ? 474  VAL C CG1   1 
ATOM   7274  C  CG2   . VAL C 2  474  ? 4.301   -45.933 92.476  1.00 34.14  ? 474  VAL C CG2   1 
ATOM   7275  N  N     . VAL C 2  475  ? 5.584   -50.407 91.776  1.00 61.99  ? 475  VAL C N     1 
ATOM   7276  C  CA    . VAL C 2  475  ? 5.337   -51.817 91.489  1.00 60.91  ? 475  VAL C CA    1 
ATOM   7277  C  C     . VAL C 2  475  ? 4.486   -52.434 92.599  1.00 57.92  ? 475  VAL C C     1 
ATOM   7278  O  O     . VAL C 2  475  ? 4.862   -52.405 93.775  1.00 50.62  ? 475  VAL C O     1 
ATOM   7279  C  CB    . VAL C 2  475  ? 6.658   -52.604 91.305  1.00 59.55  ? 475  VAL C CB    1 
ATOM   7280  C  CG1   . VAL C 2  475  ? 7.683   -52.204 92.364  1.00 50.16  ? 475  VAL C CG1   1 
ATOM   7281  C  CG2   . VAL C 2  475  ? 6.397   -54.103 91.320  1.00 64.84  ? 475  VAL C CG2   1 
ATOM   7282  N  N     . GLY C 2  476  ? 3.336   -52.988 92.222  1.00 51.95  ? 476  GLY C N     1 
ATOM   7283  C  CA    . GLY C 2  476  ? 2.356   -53.420 93.201  1.00 47.13  ? 476  GLY C CA    1 
ATOM   7284  C  C     . GLY C 2  476  ? 1.825   -52.197 93.920  1.00 54.34  ? 476  GLY C C     1 
ATOM   7285  O  O     . GLY C 2  476  ? 1.324   -51.267 93.288  1.00 61.62  ? 476  GLY C O     1 
ATOM   7286  N  N     . GLY C 2  477  ? 1.928   -52.194 95.243  1.00 52.27  ? 477  GLY C N     1 
ATOM   7287  C  CA    . GLY C 2  477  ? 1.604   -51.011 96.019  1.00 58.32  ? 477  GLY C CA    1 
ATOM   7288  C  C     . GLY C 2  477  ? 2.859   -50.285 96.465  1.00 55.93  ? 477  GLY C C     1 
ATOM   7289  O  O     . GLY C 2  477  ? 2.792   -49.216 97.067  1.00 53.71  ? 477  GLY C O     1 
ATOM   7290  N  N     . VAL C 2  478  ? 4.012   -50.874 96.165  1.00 55.85  ? 478  VAL C N     1 
ATOM   7291  C  CA    . VAL C 2  478  ? 5.292   -50.356 96.636  1.00 59.09  ? 478  VAL C CA    1 
ATOM   7292  C  C     . VAL C 2  478  ? 5.844   -49.273 95.709  1.00 55.58  ? 478  VAL C C     1 
ATOM   7293  O  O     . VAL C 2  478  ? 5.734   -49.376 94.488  1.00 53.33  ? 478  VAL C O     1 
ATOM   7294  C  CB    . VAL C 2  478  ? 6.326   -51.494 96.769  1.00 61.38  ? 478  VAL C CB    1 
ATOM   7295  C  CG1   . VAL C 2  478  ? 7.558   -51.019 97.530  1.00 55.10  ? 478  VAL C CG1   1 
ATOM   7296  C  CG2   . VAL C 2  478  ? 5.700   -52.693 97.463  1.00 58.76  ? 478  VAL C CG2   1 
ATOM   7297  N  N     . VAL C 2  479  ? 6.435   -48.234 96.292  1.00 51.18  ? 479  VAL C N     1 
ATOM   7298  C  CA    . VAL C 2  479  ? 7.031   -47.160 95.505  1.00 51.37  ? 479  VAL C CA    1 
ATOM   7299  C  C     . VAL C 2  479  ? 8.549   -47.295 95.463  1.00 46.73  ? 479  VAL C C     1 
ATOM   7300  O  O     . VAL C 2  479  ? 9.233   -47.083 96.464  1.00 45.76  ? 479  VAL C O     1 
ATOM   7301  C  CB    . VAL C 2  479  ? 6.663   -45.773 96.072  1.00 55.16  ? 479  VAL C CB    1 
ATOM   7302  C  CG1   . VAL C 2  479  ? 7.389   -44.675 95.308  1.00 52.90  ? 479  VAL C CG1   1 
ATOM   7303  C  CG2   . VAL C 2  479  ? 5.156   -45.559 96.027  1.00 45.64  ? 479  VAL C CG2   1 
ATOM   7304  N  N     . THR C 2  480  ? 9.073   -47.639 94.293  1.00 47.88  ? 480  THR C N     1 
ATOM   7305  C  CA    . THR C 2  480  ? 10.508  -47.819 94.131  1.00 55.76  ? 480  THR C CA    1 
ATOM   7306  C  C     . THR C 2  480  ? 11.195  -46.463 94.124  1.00 58.54  ? 480  THR C C     1 
ATOM   7307  O  O     . THR C 2  480  ? 10.568  -45.444 93.837  1.00 61.38  ? 480  THR C O     1 
ATOM   7308  C  CB    . THR C 2  480  ? 10.839  -48.559 92.822  1.00 59.00  ? 480  THR C CB    1 
ATOM   7309  O  OG1   . THR C 2  480  ? 9.797   -49.494 92.520  1.00 56.41  ? 480  THR C OG1   1 
ATOM   7310  C  CG2   . THR C 2  480  ? 12.167  -49.299 92.945  1.00 68.27  ? 480  THR C CG2   1 
ATOM   7311  N  N     . ASP C 2  481  ? 12.482  -46.445 94.448  1.00 56.27  ? 481  ASP C N     1 
ATOM   7312  C  CA    . ASP C 2  481  ? 13.243  -45.203 94.415  1.00 61.98  ? 481  ASP C CA    1 
ATOM   7313  C  C     . ASP C 2  481  ? 13.915  -44.983 93.064  1.00 60.71  ? 481  ASP C C     1 
ATOM   7314  O  O     . ASP C 2  481  ? 14.655  -44.016 92.882  1.00 56.45  ? 481  ASP C O     1 
ATOM   7315  C  CB    . ASP C 2  481  ? 14.259  -45.147 95.557  1.00 64.05  ? 481  ASP C CB    1 
ATOM   7316  C  CG    . ASP C 2  481  ? 13.625  -44.752 96.876  1.00 67.31  ? 481  ASP C CG    1 
ATOM   7317  O  OD1   . ASP C 2  481  ? 12.433  -45.068 97.079  1.00 69.86  ? 481  ASP C OD1   1 
ATOM   7318  O  OD2   . ASP C 2  481  ? 14.312  -44.120 97.706  1.00 74.72  ? 481  ASP C OD2   1 
ATOM   7319  N  N     . GLU C 2  482  ? 13.664  -45.888 92.122  1.00 51.66  ? 482  GLU C N     1 
ATOM   7320  C  CA    . GLU C 2  482  ? 14.115  -45.674 90.753  1.00 52.93  ? 482  GLU C CA    1 
ATOM   7321  C  C     . GLU C 2  482  ? 13.240  -44.604 90.109  1.00 54.59  ? 482  GLU C C     1 
ATOM   7322  O  O     . GLU C 2  482  ? 12.014  -44.626 90.243  1.00 51.91  ? 482  GLU C O     1 
ATOM   7323  C  CB    . GLU C 2  482  ? 14.080  -46.971 89.936  1.00 57.73  ? 482  GLU C CB    1 
ATOM   7324  C  CG    . GLU C 2  482  ? 12.701  -47.592 89.780  1.00 61.36  ? 482  GLU C CG    1 
ATOM   7325  C  CD    . GLU C 2  482  ? 12.535  -48.348 88.470  1.00 60.27  ? 482  GLU C CD    1 
ATOM   7326  O  OE1   . GLU C 2  482  ? 13.158  -47.951 87.458  1.00 43.83  ? 482  GLU C OE1   1 
ATOM   7327  O  OE2   . GLU C 2  482  ? 11.776  -49.340 88.454  1.00 59.61  ? 482  GLU C OE2   1 
ATOM   7328  N  N     . VAL C 2  483  ? 13.874  -43.659 89.422  1.00 51.21  ? 483  VAL C N     1 
ATOM   7329  C  CA    . VAL C 2  483  ? 13.150  -42.541 88.828  1.00 35.86  ? 483  VAL C CA    1 
ATOM   7330  C  C     . VAL C 2  483  ? 13.288  -42.521 87.306  1.00 29.84  ? 483  VAL C C     1 
ATOM   7331  O  O     . VAL C 2  483  ? 14.396  -42.553 86.769  1.00 29.96  ? 483  VAL C O     1 
ATOM   7332  C  CB    . VAL C 2  483  ? 13.629  -41.196 89.399  1.00 30.42  ? 483  VAL C CB    1 
ATOM   7333  C  CG1   . VAL C 2  483  ? 12.534  -40.156 89.275  1.00 36.55  ? 483  VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C 2  483  ? 14.063  -41.355 90.848  1.00 36.57  ? 483  VAL C CG2   1 
ATOM   7335  N  N     . VAL C 2  484  ? 12.153  -42.470 86.620  1.00 25.79  ? 484  VAL C N     1 
ATOM   7336  C  CA    . VAL C 2  484  ? 12.131  -42.468 85.163  1.00 37.46  ? 484  VAL C CA    1 
ATOM   7337  C  C     . VAL C 2  484  ? 11.807  -41.082 84.620  1.00 38.41  ? 484  VAL C C     1 
ATOM   7338  O  O     . VAL C 2  484  ? 10.787  -40.494 84.974  1.00 42.15  ? 484  VAL C O     1 
ATOM   7339  C  CB    . VAL C 2  484  ? 11.084  -43.462 84.619  1.00 33.80  ? 484  VAL C CB    1 
ATOM   7340  C  CG1   . VAL C 2  484  ? 11.092  -43.472 83.091  1.00 25.28  ? 484  VAL C CG1   1 
ATOM   7341  C  CG2   . VAL C 2  484  ? 11.336  -44.853 85.173  1.00 37.36  ? 484  VAL C CG2   1 
ATOM   7342  N  N     . TYR C 2  485  ? 12.677  -40.563 83.761  1.00 31.43  ? 485  TYR C N     1 
ATOM   7343  C  CA    . TYR C 2  485  ? 12.415  -39.300 83.085  1.00 26.04  ? 485  TYR C CA    1 
ATOM   7344  C  C     . TYR C 2  485  ? 11.726  -39.572 81.754  1.00 31.41  ? 485  TYR C C     1 
ATOM   7345  O  O     . TYR C 2  485  ? 12.314  -40.167 80.853  1.00 38.11  ? 485  TYR C O     1 
ATOM   7346  C  CB    . TYR C 2  485  ? 13.720  -38.544 82.851  1.00 25.66  ? 485  TYR C CB    1 
ATOM   7347  C  CG    . TYR C 2  485  ? 14.122  -37.632 83.988  1.00 29.52  ? 485  TYR C CG    1 
ATOM   7348  C  CD1   . TYR C 2  485  ? 14.759  -38.129 85.118  1.00 26.56  ? 485  TYR C CD1   1 
ATOM   7349  C  CD2   . TYR C 2  485  ? 13.870  -36.269 83.926  1.00 32.17  ? 485  TYR C CD2   1 
ATOM   7350  C  CE1   . TYR C 2  485  ? 15.130  -37.290 86.154  1.00 25.94  ? 485  TYR C CE1   1 
ATOM   7351  C  CE2   . TYR C 2  485  ? 14.234  -35.427 84.953  1.00 29.88  ? 485  TYR C CE2   1 
ATOM   7352  C  CZ    . TYR C 2  485  ? 14.863  -35.937 86.065  1.00 28.88  ? 485  TYR C CZ    1 
ATOM   7353  O  OH    . TYR C 2  485  ? 15.223  -35.085 87.086  1.00 28.35  ? 485  TYR C OH    1 
ATOM   7354  N  N     . MET C 2  486  ? 10.479  -39.130 81.627  1.00 27.12  ? 486  MET C N     1 
ATOM   7355  C  CA    . MET C 2  486  ? 9.700   -39.437 80.434  1.00 34.90  ? 486  MET C CA    1 
ATOM   7356  C  C     . MET C 2  486  ? 9.402   -38.209 79.594  1.00 24.52  ? 486  MET C C     1 
ATOM   7357  O  O     . MET C 2  486  ? 9.269   -37.107 80.114  1.00 24.44  ? 486  MET C O     1 
ATOM   7358  C  CB    . MET C 2  486  ? 8.369   -40.080 80.813  1.00 35.49  ? 486  MET C CB    1 
ATOM   7359  C  CG    . MET C 2  486  ? 8.440   -41.092 81.926  1.00 34.58  ? 486  MET C CG    1 
ATOM   7360  S  SD    . MET C 2  486  ? 6.807   -41.791 82.205  1.00 46.35  ? 486  MET C SD    1 
ATOM   7361  C  CE    . MET C 2  486  ? 7.008   -42.441 83.855  1.00 42.35  ? 486  MET C CE    1 
ATOM   7362  N  N     . THR C 2  487  ? 9.279   -38.412 78.288  1.00 21.11  ? 487  THR C N     1 
ATOM   7363  C  CA    . THR C 2  487  ? 8.697   -37.399 77.431  1.00 24.86  ? 487  THR C CA    1 
ATOM   7364  C  C     . THR C 2  487  ? 7.193   -37.434 77.673  1.00 27.74  ? 487  THR C C     1 
ATOM   7365  O  O     . THR C 2  487  ? 6.709   -38.251 78.451  1.00 30.70  ? 487  THR C O     1 
ATOM   7366  C  CB    . THR C 2  487  ? 8.986   -37.678 75.948  1.00 26.44  ? 487  THR C CB    1 
ATOM   7367  O  OG1   . THR C 2  487  ? 8.290   -38.861 75.536  1.00 26.93  ? 487  THR C OG1   1 
ATOM   7368  C  CG2   . THR C 2  487  ? 10.479  -37.863 75.724  1.00 21.52  ? 487  THR C CG2   1 
ATOM   7369  N  N     . ALA C 2  488  ? 6.449   -36.560 77.008  1.00 26.34  ? 488  ALA C N     1 
ATOM   7370  C  CA    . ALA C 2  488  ? 5.002   -36.541 77.180  1.00 27.61  ? 488  ALA C CA    1 
ATOM   7371  C  C     . ALA C 2  488  ? 4.363   -37.723 76.452  1.00 31.05  ? 488  ALA C C     1 
ATOM   7372  O  O     . ALA C 2  488  ? 3.410   -38.340 76.950  1.00 30.47  ? 488  ALA C O     1 
ATOM   7373  C  CB    . ALA C 2  488  ? 4.426   -35.224 76.692  1.00 24.45  ? 488  ALA C CB    1 
ATOM   7374  N  N     . THR C 2  489  ? 4.909   -38.032 75.276  1.00 25.96  ? 489  THR C N     1 
ATOM   7375  C  CA    . THR C 2  489  ? 4.441   -39.143 74.456  1.00 27.94  ? 489  THR C CA    1 
ATOM   7376  C  C     . THR C 2  489  ? 4.462   -40.437 75.256  1.00 35.65  ? 489  THR C C     1 
ATOM   7377  O  O     . THR C 2  489  ? 3.524   -41.234 75.200  1.00 35.57  ? 489  THR C O     1 
ATOM   7378  C  CB    . THR C 2  489  ? 5.311   -39.323 73.197  1.00 26.25  ? 489  THR C CB    1 
ATOM   7379  O  OG1   . THR C 2  489  ? 5.301   -38.118 72.420  1.00 31.61  ? 489  THR C OG1   1 
ATOM   7380  C  CG2   . THR C 2  489  ? 4.792   -40.470 72.345  1.00 23.68  ? 489  THR C CG2   1 
ATOM   7381  N  N     . GLU C 2  490  ? 5.540   -40.632 76.009  1.00 34.40  ? 490  GLU C N     1 
ATOM   7382  C  CA    . GLU C 2  490  ? 5.685   -41.814 76.846  1.00 33.29  ? 490  GLU C CA    1 
ATOM   7383  C  C     . GLU C 2  490  ? 4.781   -41.743 78.074  1.00 36.50  ? 490  GLU C C     1 
ATOM   7384  O  O     . GLU C 2  490  ? 4.128   -42.724 78.426  1.00 39.26  ? 490  GLU C O     1 
ATOM   7385  C  CB    . GLU C 2  490  ? 7.138   -41.987 77.276  1.00 32.29  ? 490  GLU C CB    1 
ATOM   7386  C  CG    . GLU C 2  490  ? 7.410   -43.299 77.979  1.00 48.59  ? 490  GLU C CG    1 
ATOM   7387  C  CD    . GLU C 2  490  ? 8.823   -43.387 78.507  1.00 70.10  ? 490  GLU C CD    1 
ATOM   7388  O  OE1   . GLU C 2  490  ? 9.591   -42.416 78.320  1.00 65.73  ? 490  GLU C OE1   1 
ATOM   7389  O  OE2   . GLU C 2  490  ? 9.165   -44.427 79.112  1.00 71.89  ? 490  GLU C OE2   1 
ATOM   7390  N  N     . GLU C 2  491  ? 4.750   -40.579 78.720  1.00 40.58  ? 491  GLU C N     1 
ATOM   7391  C  CA    . GLU C 2  491  ? 3.923   -40.364 79.906  1.00 37.13  ? 491  GLU C CA    1 
ATOM   7392  C  C     . GLU C 2  491  ? 2.459   -40.698 79.640  1.00 37.90  ? 491  GLU C C     1 
ATOM   7393  O  O     . GLU C 2  491  ? 1.752   -41.171 80.531  1.00 33.51  ? 491  GLU C O     1 
ATOM   7394  C  CB    . GLU C 2  491  ? 4.047   -38.917 80.401  1.00 39.19  ? 491  GLU C CB    1 
ATOM   7395  C  CG    . GLU C 2  491  ? 3.117   -38.573 81.568  1.00 42.52  ? 491  GLU C CG    1 
ATOM   7396  C  CD    . GLU C 2  491  ? 3.153   -37.102 81.961  1.00 40.60  ? 491  GLU C CD    1 
ATOM   7397  O  OE1   . GLU C 2  491  ? 2.186   -36.638 82.603  1.00 34.09  ? 491  GLU C OE1   1 
ATOM   7398  O  OE2   . GLU C 2  491  ? 4.143   -36.411 81.636  1.00 42.86  ? 491  GLU C OE2   1 
ATOM   7399  N  N     . ASP C 2  492  ? 2.013   -40.466 78.407  1.00 39.35  ? 492  ASP C N     1 
ATOM   7400  C  CA    . ASP C 2  492  ? 0.623   -40.743 78.037  1.00 40.00  ? 492  ASP C CA    1 
ATOM   7401  C  C     . ASP C 2  492  ? 0.244   -42.227 78.121  1.00 42.22  ? 492  ASP C C     1 
ATOM   7402  O  O     . ASP C 2  492  ? -0.933  -42.577 78.024  1.00 43.53  ? 492  ASP C O     1 
ATOM   7403  C  CB    . ASP C 2  492  ? 0.306   -40.191 76.642  1.00 38.43  ? 492  ASP C CB    1 
ATOM   7404  C  CG    . ASP C 2  492  ? -0.080  -38.720 76.666  1.00 34.93  ? 492  ASP C CG    1 
ATOM   7405  O  OD1   . ASP C 2  492  ? 0.327   -37.979 75.745  1.00 35.51  ? 492  ASP C OD1   1 
ATOM   7406  O  OD2   . ASP C 2  492  ? -0.795  -38.305 77.602  1.00 33.07  ? 492  ASP C OD2   1 
ATOM   7407  N  N     . ARG C 2  493  ? 1.237   -43.095 78.296  1.00 48.94  ? 493  ARG C N     1 
ATOM   7408  C  CA    . ARG C 2  493  ? 1.001   -44.539 78.332  1.00 43.98  ? 493  ARG C CA    1 
ATOM   7409  C  C     . ARG C 2  493  ? 0.705   -45.095 79.728  1.00 39.63  ? 493  ARG C C     1 
ATOM   7410  O  O     . ARG C 2  493  ? 0.367   -46.270 79.866  1.00 41.95  ? 493  ARG C O     1 
ATOM   7411  C  CB    . ARG C 2  493  ? 2.192   -45.289 77.727  1.00 38.19  ? 493  ARG C CB    1 
ATOM   7412  C  CG    . ARG C 2  493  ? 2.415   -45.029 76.244  1.00 44.58  ? 493  ARG C CG    1 
ATOM   7413  C  CD    . ARG C 2  493  ? 3.579   -45.848 75.694  1.00 51.28  ? 493  ARG C CD    1 
ATOM   7414  N  NE    . ARG C 2  493  ? 3.340   -47.288 75.774  1.00 52.33  ? 493  ARG C NE    1 
ATOM   7415  C  CZ    . ARG C 2  493  ? 3.830   -48.076 76.727  1.00 62.58  ? 493  ARG C CZ    1 
ATOM   7416  N  NH1   . ARG C 2  493  ? 4.591   -47.564 77.686  1.00 65.62  ? 493  ARG C NH1   1 
ATOM   7417  N  NH2   . ARG C 2  493  ? 3.561   -49.375 76.722  1.00 55.23  ? 493  ARG C NH2   1 
ATOM   7418  N  N     . TYR C 2  494  ? 0.828   -44.264 80.759  1.00 39.65  ? 494  TYR C N     1 
ATOM   7419  C  CA    . TYR C 2  494  ? 0.704   -44.757 82.130  1.00 37.10  ? 494  TYR C CA    1 
ATOM   7420  C  C     . TYR C 2  494  ? -0.371  -44.070 82.969  1.00 33.43  ? 494  TYR C C     1 
ATOM   7421  O  O     . TYR C 2  494  ? -1.063  -43.159 82.514  1.00 35.85  ? 494  TYR C O     1 
ATOM   7422  C  CB    . TYR C 2  494  ? 2.048   -44.658 82.861  1.00 34.92  ? 494  TYR C CB    1 
ATOM   7423  C  CG    . TYR C 2  494  ? 3.211   -45.243 82.095  1.00 40.41  ? 494  TYR C CG    1 
ATOM   7424  C  CD1   . TYR C 2  494  ? 3.250   -46.593 81.779  1.00 41.02  ? 494  TYR C CD1   1 
ATOM   7425  C  CD2   . TYR C 2  494  ? 4.273   -44.445 81.694  1.00 45.09  ? 494  TYR C CD2   1 
ATOM   7426  C  CE1   . TYR C 2  494  ? 4.310   -47.134 81.080  1.00 45.80  ? 494  TYR C CE1   1 
ATOM   7427  C  CE2   . TYR C 2  494  ? 5.341   -44.977 80.996  1.00 60.36  ? 494  TYR C CE2   1 
ATOM   7428  C  CZ    . TYR C 2  494  ? 5.354   -46.323 80.691  1.00 59.23  ? 494  TYR C CZ    1 
ATOM   7429  O  OH    . TYR C 2  494  ? 6.414   -46.859 79.995  1.00 65.93  ? 494  TYR C OH    1 
ATOM   7430  N  N     . THR C 2  495  ? -0.490  -44.532 84.208  1.00 30.19  ? 495  THR C N     1 
ATOM   7431  C  CA    . THR C 2  495  ? -1.383  -43.947 85.193  1.00 29.08  ? 495  THR C CA    1 
ATOM   7432  C  C     . THR C 2  495  ? -0.519  -43.425 86.331  1.00 32.90  ? 495  THR C C     1 
ATOM   7433  O  O     . THR C 2  495  ? 0.128   -44.208 87.025  1.00 30.31  ? 495  THR C O     1 
ATOM   7434  C  CB    . THR C 2  495  ? -2.350  -45.001 85.747  1.00 31.02  ? 495  THR C CB    1 
ATOM   7435  O  OG1   . THR C 2  495  ? -3.161  -45.512 84.682  1.00 34.99  ? 495  THR C OG1   1 
ATOM   7436  C  CG2   . THR C 2  495  ? -3.241  -44.401 86.822  1.00 33.56  ? 495  THR C CG2   1 
ATOM   7437  N  N     . ILE C 2  496  ? -0.497  -42.107 86.520  1.00 34.58  ? 496  ILE C N     1 
ATOM   7438  C  CA    . ILE C 2  496  ? 0.444   -41.504 87.467  1.00 33.12  ? 496  ILE C CA    1 
ATOM   7439  C  C     . ILE C 2  496  ? -0.214  -40.816 88.669  1.00 36.68  ? 496  ILE C C     1 
ATOM   7440  O  O     . ILE C 2  496  ? -0.914  -39.816 88.518  1.00 44.05  ? 496  ILE C O     1 
ATOM   7441  C  CB    . ILE C 2  496  ? 1.380   -40.503 86.764  1.00 30.75  ? 496  ILE C CB    1 
ATOM   7442  C  CG1   . ILE C 2  496  ? 1.864   -41.071 85.430  1.00 26.68  ? 496  ILE C CG1   1 
ATOM   7443  C  CG2   . ILE C 2  496  ? 2.551   -40.147 87.670  1.00 35.00  ? 496  ILE C CG2   1 
ATOM   7444  C  CD1   . ILE C 2  496  ? 2.868   -40.194 84.728  1.00 30.37  ? 496  ILE C CD1   1 
ATOM   7445  N  N     . ALA C 2  497  ? 0.040   -41.343 89.862  1.00 28.25  ? 497  ALA C N     1 
ATOM   7446  C  CA    . ALA C 2  497  ? -0.559  -40.816 91.085  1.00 33.12  ? 497  ALA C CA    1 
ATOM   7447  C  C     . ALA C 2  497  ? 0.118   -39.537 91.571  1.00 38.95  ? 497  ALA C C     1 
ATOM   7448  O  O     . ALA C 2  497  ? 1.295   -39.303 91.299  1.00 36.69  ? 497  ALA C O     1 
ATOM   7449  C  CB    . ALA C 2  497  ? -0.536  -41.870 92.177  1.00 38.37  ? 497  ALA C CB    1 
ATOM   7450  N  N     . GLN C 2  498  ? -0.636  -38.720 92.300  1.00 37.76  ? 498  GLN C N     1 
ATOM   7451  C  CA    . GLN C 2  498  ? -0.118  -37.479 92.868  1.00 36.71  ? 498  GLN C CA    1 
ATOM   7452  C  C     . GLN C 2  498  ? 0.898   -37.741 93.975  1.00 33.86  ? 498  GLN C C     1 
ATOM   7453  O  O     . GLN C 2  498  ? 0.857   -38.779 94.629  1.00 40.19  ? 498  GLN C O     1 
ATOM   7454  C  CB    . GLN C 2  498  ? -1.265  -36.621 93.402  1.00 42.98  ? 498  GLN C CB    1 
ATOM   7455  C  CG    . GLN C 2  498  ? -2.108  -35.978 92.316  1.00 35.31  ? 498  GLN C CG    1 
ATOM   7456  C  CD    . GLN C 2  498  ? -1.323  -34.966 91.507  1.00 34.88  ? 498  GLN C CD    1 
ATOM   7457  O  OE1   . GLN C 2  498  ? -0.518  -34.208 92.050  1.00 31.43  ? 498  GLN C OE1   1 
ATOM   7458  N  NE2   . GLN C 2  498  ? -1.543  -34.958 90.198  1.00 33.74  ? 498  GLN C NE2   1 
ATOM   7459  N  N     . ALA C 2  499  ? 1.804   -36.793 94.183  1.00 36.06  ? 499  ALA C N     1 
ATOM   7460  C  CA    . ALA C 2  499  ? 2.893   -36.975 95.137  1.00 33.10  ? 499  ALA C CA    1 
ATOM   7461  C  C     . ALA C 2  499  ? 2.450   -36.857 96.595  1.00 38.82  ? 499  ALA C C     1 
ATOM   7462  O  O     . ALA C 2  499  ? 3.181   -37.255 97.502  1.00 44.12  ? 499  ALA C O     1 
ATOM   7463  C  CB    . ALA C 2  499  ? 4.019   -35.995 94.847  1.00 25.64  ? 499  ALA C CB    1 
ATOM   7464  N  N     . ASN C 2  500  ? 1.258   -36.317 96.824  1.00 39.79  ? 500  ASN C N     1 
ATOM   7465  C  CA    . ASN C 2  500  ? 0.776   -36.113 98.187  1.00 41.67  ? 500  ASN C CA    1 
ATOM   7466  C  C     . ASN C 2  500  ? 0.163   -37.363 98.817  1.00 56.04  ? 500  ASN C C     1 
ATOM   7467  O  O     . ASN C 2  500  ? -0.042  -37.412 100.030 1.00 66.15  ? 500  ASN C O     1 
ATOM   7468  C  CB    . ASN C 2  500  ? -0.213  -34.937 98.260  1.00 43.33  ? 500  ASN C CB    1 
ATOM   7469  C  CG    . ASN C 2  500  ? -1.499  -35.177 97.468  1.00 52.37  ? 500  ASN C CG    1 
ATOM   7470  O  OD1   . ASN C 2  500  ? -1.983  -36.303 97.345  1.00 46.10  ? 500  ASN C OD1   1 
ATOM   7471  N  ND2   . ASN C 2  500  ? -2.060  -34.099 96.928  1.00 57.41  ? 500  ASN C ND2   1 
ATOM   7472  N  N     . THR C 2  501  ? -0.129  -38.363 97.989  1.00 53.83  ? 501  THR C N     1 
ATOM   7473  C  CA    . THR C 2  501  ? -0.831  -39.563 98.443  1.00 53.40  ? 501  THR C CA    1 
ATOM   7474  C  C     . THR C 2  501  ? -0.078  -40.279 99.565  1.00 51.77  ? 501  THR C C     1 
ATOM   7475  O  O     . THR C 2  501  ? 1.139   -40.449 99.487  1.00 52.96  ? 501  THR C O     1 
ATOM   7476  C  CB    . THR C 2  501  ? -1.118  -40.535 97.277  1.00 51.56  ? 501  THR C CB    1 
ATOM   7477  O  OG1   . THR C 2  501  ? 0.114   -41.044 96.754  1.00 46.92  ? 501  THR C OG1   1 
ATOM   7478  C  CG2   . THR C 2  501  ? -1.881  -39.821 96.171  1.00 46.73  ? 501  THR C CG2   1 
ATOM   7479  N  N     . PRO C 2  502  ? -0.811  -40.689 100.616 1.00 50.99  ? 502  PRO C N     1 
ATOM   7480  C  CA    . PRO C 2  502  ? -0.256  -41.243 101.859 1.00 58.65  ? 502  PRO C CA    1 
ATOM   7481  C  C     . PRO C 2  502  ? 0.578   -42.502 101.650 1.00 60.64  ? 502  PRO C C     1 
ATOM   7482  O  O     . PRO C 2  502  ? 0.156   -43.417 100.943 1.00 57.59  ? 502  PRO C O     1 
ATOM   7483  C  CB    . PRO C 2  502  ? -1.505  -41.581 102.681 1.00 62.54  ? 502  PRO C CB    1 
ATOM   7484  C  CG    . PRO C 2  502  ? -2.572  -40.709 102.128 1.00 62.70  ? 502  PRO C CG    1 
ATOM   7485  C  CD    . PRO C 2  502  ? -2.281  -40.617 100.664 1.00 51.31  ? 502  PRO C CD    1 
ATOM   7486  N  N     . LEU C 2  503  ? 1.751   -42.538 102.274 1.00 60.82  ? 503  LEU C N     1 
ATOM   7487  C  CA    . LEU C 2  503  ? 2.636   -43.691 102.186 1.00 62.72  ? 503  LEU C CA    1 
ATOM   7488  C  C     . LEU C 2  503  ? 3.077   -44.162 103.566 1.00 74.21  ? 503  LEU C C     1 
ATOM   7489  O  O     . LEU C 2  503  ? 3.617   -43.384 104.354 1.00 84.29  ? 503  LEU C O     1 
ATOM   7490  C  CB    . LEU C 2  503  ? 3.879   -43.361 101.356 1.00 52.65  ? 503  LEU C CB    1 
ATOM   7491  C  CG    . LEU C 2  503  ? 3.722   -43.015 99.876  1.00 47.98  ? 503  LEU C CG    1 
ATOM   7492  C  CD1   . LEU C 2  503  ? 5.089   -42.916 99.221  1.00 47.95  ? 503  LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C 2  503  ? 2.862   -44.040 99.168  1.00 43.48  ? 503  LEU C CD2   1 
ATOM   7494  N  N     . GLU C 2  504  ? 2.849   -45.438 103.853 1.00 71.35  ? 504  GLU C N     1 
ATOM   7495  C  CA    . GLU C 2  504  ? 3.463   -46.068 105.011 1.00 71.76  ? 504  GLU C CA    1 
ATOM   7496  C  C     . GLU C 2  504  ? 4.640   -46.886 104.497 1.00 70.89  ? 504  GLU C C     1 
ATOM   7497  O  O     . GLU C 2  504  ? 4.457   -47.893 103.812 1.00 70.92  ? 504  GLU C O     1 
ATOM   7498  C  CB    . GLU C 2  504  ? 2.457   -46.943 105.759 1.00 62.68  ? 504  GLU C CB    1 
ATOM   7499  C  CG    . GLU C 2  504  ? 1.477   -47.678 104.859 1.00 74.43  ? 504  GLU C CG    1 
ATOM   7500  C  CD    . GLU C 2  504  ? 0.452   -48.474 105.643 1.00 90.06  ? 504  GLU C CD    1 
ATOM   7501  O  OE1   . GLU C 2  504  ? 0.483   -48.416 106.891 1.00 85.52  ? 504  GLU C OE1   1 
ATOM   7502  O  OE2   . GLU C 2  504  ? -0.384  -49.156 105.012 1.00 88.63  ? 504  GLU C OE2   1 
ATOM   7503  N  N     . GLY C 2  505  ? 5.850   -46.442 104.819 1.00 65.46  ? 505  GLY C N     1 
ATOM   7504  C  CA    . GLY C 2  505  ? 7.033   -46.970 104.168 1.00 60.87  ? 505  GLY C CA    1 
ATOM   7505  C  C     . GLY C 2  505  ? 6.948   -46.620 102.695 1.00 58.23  ? 505  GLY C C     1 
ATOM   7506  O  O     . GLY C 2  505  ? 6.669   -45.476 102.344 1.00 63.44  ? 505  GLY C O     1 
ATOM   7507  N  N     . ASN C 2  506  ? 7.184   -47.601 101.832 1.00 54.46  ? 506  ASN C N     1 
ATOM   7508  C  CA    . ASN C 2  506  ? 7.023   -47.409 100.393 1.00 55.62  ? 506  ASN C CA    1 
ATOM   7509  C  C     . ASN C 2  506  ? 5.657   -47.858 99.873  1.00 54.01  ? 506  ASN C C     1 
ATOM   7510  O  O     . ASN C 2  506  ? 5.399   -47.829 98.670  1.00 44.03  ? 506  ASN C O     1 
ATOM   7511  C  CB    . ASN C 2  506  ? 8.150   -48.099 99.625  1.00 49.30  ? 506  ASN C CB    1 
ATOM   7512  C  CG    . ASN C 2  506  ? 9.497   -47.451 99.872  1.00 62.02  ? 506  ASN C CG    1 
ATOM   7513  O  OD1   . ASN C 2  506  ? 9.688   -46.756 100.871 1.00 61.07  ? 506  ASN C OD1   1 
ATOM   7514  N  ND2   . ASN C 2  506  ? 10.438  -47.670 98.959  1.00 64.44  ? 506  ASN C ND2   1 
ATOM   7515  N  N     . ARG C 2  507  ? 4.793   -48.282 100.790 1.00 56.65  ? 507  ARG C N     1 
ATOM   7516  C  CA    . ARG C 2  507  ? 3.483   -48.823 100.438 1.00 63.64  ? 507  ARG C CA    1 
ATOM   7517  C  C     . ARG C 2  507  ? 2.428   -47.723 100.348 1.00 59.07  ? 507  ARG C C     1 
ATOM   7518  O  O     . ARG C 2  507  ? 2.406   -46.811 101.175 1.00 59.07  ? 507  ARG C O     1 
ATOM   7519  C  CB    . ARG C 2  507  ? 3.058   -49.866 101.479 1.00 80.73  ? 507  ARG C CB    1 
ATOM   7520  C  CG    . ARG C 2  507  ? 1.742   -50.578 101.182 1.00 80.68  ? 507  ARG C CG    1 
ATOM   7521  C  CD    . ARG C 2  507  ? 1.938   -51.748 100.229 1.00 82.98  ? 507  ARG C CD    1 
ATOM   7522  N  NE    . ARG C 2  507  ? 2.768   -52.798 100.816 1.00 92.53  ? 507  ARG C NE    1 
ATOM   7523  C  CZ    . ARG C 2  507  ? 3.092   -53.929 100.197 1.00 92.79  ? 507  ARG C CZ    1 
ATOM   7524  N  NH1   . ARG C 2  507  ? 2.655   -54.164 98.967  1.00 84.37  ? 507  ARG C NH1   1 
ATOM   7525  N  NH2   . ARG C 2  507  ? 3.853   -54.828 100.808 1.00 87.05  ? 507  ARG C NH2   1 
ATOM   7526  N  N     . ILE C 2  508  ? 1.552   -47.816 99.348  1.00 53.99  ? 508  ILE C N     1 
ATOM   7527  C  CA    . ILE C 2  508  ? 0.445   -46.873 99.213  1.00 54.77  ? 508  ILE C CA    1 
ATOM   7528  C  C     . ILE C 2  508  ? -0.575  -47.121 100.321 1.00 62.27  ? 508  ILE C C     1 
ATOM   7529  O  O     . ILE C 2  508  ? -1.098  -48.227 100.458 1.00 64.69  ? 508  ILE C O     1 
ATOM   7530  C  CB    . ILE C 2  508  ? -0.272  -47.027 97.856  1.00 53.32  ? 508  ILE C CB    1 
ATOM   7531  C  CG1   . ILE C 2  508  ? 0.712   -46.888 96.692  1.00 51.60  ? 508  ILE C CG1   1 
ATOM   7532  C  CG2   . ILE C 2  508  ? -1.396  -46.009 97.728  1.00 56.50  ? 508  ILE C CG2   1 
ATOM   7533  C  CD1   . ILE C 2  508  ? 1.112   -45.466 96.385  1.00 56.20  ? 508  ILE C CD1   1 
ATOM   7534  N  N     . ALA C 2  509  ? -0.866  -46.086 101.101 1.00 61.69  ? 509  ALA C N     1 
ATOM   7535  C  CA    . ALA C 2  509  ? -1.748  -46.230 102.254 1.00 61.79  ? 509  ALA C CA    1 
ATOM   7536  C  C     . ALA C 2  509  ? -3.203  -45.855 101.965 1.00 63.24  ? 509  ALA C C     1 
ATOM   7537  O  O     . ALA C 2  509  ? -4.061  -45.964 102.839 1.00 73.98  ? 509  ALA C O     1 
ATOM   7538  C  CB    . ALA C 2  509  ? -1.211  -45.425 103.431 1.00 65.92  ? 509  ALA C CB    1 
ATOM   7539  N  N     . ALA C 2  510  ? -3.480  -45.415 100.743 1.00 60.48  ? 510  ALA C N     1 
ATOM   7540  C  CA    . ALA C 2  510  ? -4.826  -44.972 100.389 1.00 54.28  ? 510  ALA C CA    1 
ATOM   7541  C  C     . ALA C 2  510  ? -5.586  -46.035 99.604  1.00 55.93  ? 510  ALA C C     1 
ATOM   7542  O  O     . ALA C 2  510  ? -5.048  -46.633 98.675  1.00 54.96  ? 510  ALA C O     1 
ATOM   7543  C  CB    . ALA C 2  510  ? -4.766  -43.669 99.603  1.00 52.83  ? 510  ALA C CB    1 
ATOM   7544  N  N     . GLU C 2  511  ? -6.839  -46.266 99.984  1.00 60.26  ? 511  GLU C N     1 
ATOM   7545  C  CA    . GLU C 2  511  ? -7.684  -47.236 99.294  1.00 61.61  ? 511  GLU C CA    1 
ATOM   7546  C  C     . GLU C 2  511  ? -8.078  -46.716 97.915  1.00 49.74  ? 511  GLU C C     1 
ATOM   7547  O  O     . GLU C 2  511  ? -8.243  -47.484 96.969  1.00 46.42  ? 511  GLU C O     1 
ATOM   7548  C  CB    . GLU C 2  511  ? -8.929  -47.549 100.131 1.00 67.71  ? 511  GLU C CB    1 
ATOM   7549  C  CG    . GLU C 2  511  ? -9.697  -46.313 100.585 1.00 81.74  ? 511  GLU C CG    1 
ATOM   7550  C  CD    . GLU C 2  511  ? -10.823 -46.637 101.549 1.00 89.41  ? 511  GLU C CD    1 
ATOM   7551  O  OE1   . GLU C 2  511  ? -10.633 -47.513 102.419 1.00 84.97  ? 511  GLU C OE1   1 
ATOM   7552  O  OE2   . GLU C 2  511  ? -11.900 -46.014 101.434 1.00 93.50  ? 511  GLU C OE2   1 
ATOM   7553  N  N     . ARG C 2  512  ? -8.225  -45.400 97.813  1.00 52.83  ? 512  ARG C N     1 
ATOM   7554  C  CA    . ARG C 2  512  ? -8.519  -44.750 96.546  1.00 52.64  ? 512  ARG C CA    1 
ATOM   7555  C  C     . ARG C 2  512  ? -7.517  -43.621 96.333  1.00 49.03  ? 512  ARG C C     1 
ATOM   7556  O  O     . ARG C 2  512  ? -7.462  -42.673 97.117  1.00 51.07  ? 512  ARG C O     1 
ATOM   7557  C  CB    . ARG C 2  512  ? -9.953  -44.215 96.534  1.00 50.08  ? 512  ARG C CB    1 
ATOM   7558  C  CG    . ARG C 2  512  ? -11.011 -45.293 96.720  1.00 54.68  ? 512  ARG C CG    1 
ATOM   7559  C  CD    . ARG C 2  512  ? -12.413 -44.706 96.805  1.00 65.05  ? 512  ARG C CD    1 
ATOM   7560  N  NE    . ARG C 2  512  ? -12.873 -44.173 95.524  1.00 68.19  ? 512  ARG C NE    1 
ATOM   7561  C  CZ    . ARG C 2  512  ? -13.361 -42.948 95.354  1.00 64.08  ? 512  ARG C CZ    1 
ATOM   7562  N  NH1   . ARG C 2  512  ? -13.457 -42.118 96.386  1.00 62.04  ? 512  ARG C NH1   1 
ATOM   7563  N  NH2   . ARG C 2  512  ? -13.757 -42.552 94.150  1.00 45.54  ? 512  ARG C NH2   1 
ATOM   7564  N  N     . VAL C 2  513  ? -6.722  -43.731 95.273  1.00 41.84  ? 513  VAL C N     1 
ATOM   7565  C  CA    . VAL C 2  513  ? -5.637  -42.787 95.032  1.00 42.47  ? 513  VAL C CA    1 
ATOM   7566  C  C     . VAL C 2  513  ? -5.871  -41.929 93.784  1.00 41.87  ? 513  VAL C C     1 
ATOM   7567  O  O     . VAL C 2  513  ? -6.234  -42.439 92.720  1.00 35.02  ? 513  VAL C O     1 
ATOM   7568  C  CB    . VAL C 2  513  ? -4.268  -43.515 94.957  1.00 45.57  ? 513  VAL C CB    1 
ATOM   7569  C  CG1   . VAL C 2  513  ? -4.363  -44.749 94.086  1.00 35.80  ? 513  VAL C CG1   1 
ATOM   7570  C  CG2   . VAL C 2  513  ? -3.182  -42.587 94.453  1.00 51.55  ? 513  VAL C CG2   1 
ATOM   7571  N  N     . VAL C 2  514  ? -5.669  -40.621 93.931  1.00 38.10  ? 514  VAL C N     1 
ATOM   7572  C  CA    . VAL C 2  514  ? -5.887  -39.673 92.842  1.00 35.31  ? 514  VAL C CA    1 
ATOM   7573  C  C     . VAL C 2  514  ? -4.723  -39.686 91.859  1.00 33.82  ? 514  VAL C C     1 
ATOM   7574  O  O     . VAL C 2  514  ? -3.564  -39.535 92.254  1.00 32.93  ? 514  VAL C O     1 
ATOM   7575  C  CB    . VAL C 2  514  ? -6.064  -38.241 93.374  1.00 33.56  ? 514  VAL C CB    1 
ATOM   7576  C  CG1   . VAL C 2  514  ? -6.515  -37.318 92.254  1.00 27.33  ? 514  VAL C CG1   1 
ATOM   7577  C  CG2   . VAL C 2  514  ? -7.062  -38.222 94.522  1.00 26.33  ? 514  VAL C CG2   1 
ATOM   7578  N  N     . ALA C 2  515  ? -5.034  -39.855 90.578  1.00 26.37  ? 515  ALA C N     1 
ATOM   7579  C  CA    . ALA C 2  515  ? -3.994  -39.988 89.564  1.00 28.60  ? 515  ALA C CA    1 
ATOM   7580  C  C     . ALA C 2  515  ? -4.347  -39.316 88.242  1.00 28.17  ? 515  ALA C C     1 
ATOM   7581  O  O     . ALA C 2  515  ? -5.375  -38.648 88.121  1.00 30.17  ? 515  ALA C O     1 
ATOM   7582  C  CB    . ALA C 2  515  ? -3.669  -41.457 89.335  1.00 32.89  ? 515  ALA C CB    1 
ATOM   7583  N  N     . ARG C 2  516  ? -3.481  -39.513 87.252  1.00 28.33  ? 516  ARG C N     1 
ATOM   7584  C  CA    . ARG C 2  516  ? -3.658  -38.946 85.923  1.00 33.61  ? 516  ARG C CA    1 
ATOM   7585  C  C     . ARG C 2  516  ? -3.432  -39.989 84.831  1.00 33.31  ? 516  ARG C C     1 
ATOM   7586  O  O     . ARG C 2  516  ? -2.404  -40.673 84.813  1.00 37.19  ? 516  ARG C O     1 
ATOM   7587  C  CB    . ARG C 2  516  ? -2.694  -37.776 85.703  1.00 38.01  ? 516  ARG C CB    1 
ATOM   7588  C  CG    . ARG C 2  516  ? -2.938  -36.574 86.594  1.00 36.85  ? 516  ARG C CG    1 
ATOM   7589  C  CD    . ARG C 2  516  ? -1.942  -35.455 86.302  1.00 35.34  ? 516  ARG C CD    1 
ATOM   7590  N  NE    . ARG C 2  516  ? -0.559  -35.854 86.554  1.00 32.17  ? 516  ARG C NE    1 
ATOM   7591  C  CZ    . ARG C 2  516  ? 0.365   -35.980 85.609  1.00 29.74  ? 516  ARG C CZ    1 
ATOM   7592  N  NH1   . ARG C 2  516  ? 0.057   -35.733 84.342  1.00 32.19  ? 516  ARG C NH1   1 
ATOM   7593  N  NH2   . ARG C 2  516  ? 1.599   -36.347 85.929  1.00 25.60  ? 516  ARG C NH2   1 
ATOM   7594  N  N     . ARG C 2  517  ? -4.402  -40.104 83.929  1.00 31.24  ? 517  ARG C N     1 
ATOM   7595  C  CA    . ARG C 2  517  ? -4.259  -40.902 82.719  1.00 30.03  ? 517  ARG C CA    1 
ATOM   7596  C  C     . ARG C 2  517  ? -4.419  -39.973 81.528  1.00 34.07  ? 517  ARG C C     1 
ATOM   7597  O  O     . ARG C 2  517  ? -5.512  -39.457 81.286  1.00 35.07  ? 517  ARG C O     1 
ATOM   7598  C  CB    . ARG C 2  517  ? -5.332  -41.991 82.657  1.00 38.86  ? 517  ARG C CB    1 
ATOM   7599  C  CG    . ARG C 2  517  ? -5.134  -43.143 83.630  1.00 50.01  ? 517  ARG C CG    1 
ATOM   7600  C  CD    . ARG C 2  517  ? -6.393  -44.000 83.730  1.00 54.51  ? 517  ARG C CD    1 
ATOM   7601  N  NE    . ARG C 2  517  ? -6.192  -45.188 84.556  1.00 44.38  ? 517  ARG C NE    1 
ATOM   7602  C  CZ    . ARG C 2  517  ? -7.159  -46.037 84.889  1.00 48.88  ? 517  ARG C CZ    1 
ATOM   7603  N  NH1   . ARG C 2  517  ? -8.401  -45.827 84.474  1.00 63.65  ? 517  ARG C NH1   1 
ATOM   7604  N  NH2   . ARG C 2  517  ? -6.885  -47.094 85.641  1.00 51.73  ? 517  ARG C NH2   1 
ATOM   7605  N  N     . LYS C 2  518  ? -3.334  -39.774 80.784  1.00 34.92  ? 518  LYS C N     1 
ATOM   7606  C  CA    . LYS C 2  518  ? -3.307  -38.824 79.670  1.00 29.30  ? 518  LYS C CA    1 
ATOM   7607  C  C     . LYS C 2  518  ? -3.820  -37.440 80.066  1.00 33.24  ? 518  LYS C C     1 
ATOM   7608  O  O     . LYS C 2  518  ? -4.511  -36.780 79.290  1.00 33.87  ? 518  LYS C O     1 
ATOM   7609  C  CB    . LYS C 2  518  ? -4.090  -39.357 78.466  1.00 30.42  ? 518  LYS C CB    1 
ATOM   7610  C  CG    . LYS C 2  518  ? -3.364  -40.432 77.675  1.00 32.08  ? 518  LYS C CG    1 
ATOM   7611  C  CD    . LYS C 2  518  ? -4.136  -40.810 76.421  1.00 31.87  ? 518  LYS C CD    1 
ATOM   7612  C  CE    . LYS C 2  518  ? -3.345  -41.775 75.553  1.00 53.38  ? 518  LYS C CE    1 
ATOM   7613  N  NZ    . LYS C 2  518  ? -2.990  -43.031 76.274  1.00 58.73  ? 518  LYS C NZ    1 
ATOM   7614  N  N     . GLY C 2  519  ? -3.490  -37.016 81.282  1.00 36.57  ? 519  GLY C N     1 
ATOM   7615  C  CA    . GLY C 2  519  ? -3.850  -35.693 81.759  1.00 35.40  ? 519  GLY C CA    1 
ATOM   7616  C  C     . GLY C 2  519  ? -5.182  -35.619 82.480  1.00 35.48  ? 519  GLY C C     1 
ATOM   7617  O  O     . GLY C 2  519  ? -5.424  -34.683 83.241  1.00 41.68  ? 519  GLY C O     1 
ATOM   7618  N  N     . GLU C 2  520  ? -6.047  -36.601 82.243  1.00 36.89  ? 520  GLU C N     1 
ATOM   7619  C  CA    . GLU C 2  520  ? -7.367  -36.629 82.870  1.00 37.72  ? 520  GLU C CA    1 
ATOM   7620  C  C     . GLU C 2  520  ? -7.289  -37.100 84.317  1.00 36.69  ? 520  GLU C C     1 
ATOM   7621  O  O     . GLU C 2  520  ? -6.797  -38.194 84.588  1.00 35.72  ? 520  GLU C O     1 
ATOM   7622  C  CB    . GLU C 2  520  ? -8.310  -37.541 82.084  1.00 39.99  ? 520  GLU C CB    1 
ATOM   7623  C  CG    . GLU C 2  520  ? -8.794  -36.962 80.765  1.00 57.80  ? 520  GLU C CG    1 
ATOM   7624  C  CD    . GLU C 2  520  ? -10.058 -36.133 80.914  1.00 74.07  ? 520  GLU C CD    1 
ATOM   7625  O  OE1   . GLU C 2  520  ? -10.674 -35.803 79.877  1.00 83.83  ? 520  GLU C OE1   1 
ATOM   7626  O  OE2   . GLU C 2  520  ? -10.438 -35.815 82.064  1.00 64.21  ? 520  GLU C OE2   1 
ATOM   7627  N  N     . PRO C 2  521  ? -7.770  -36.270 85.257  1.00 38.84  ? 521  PRO C N     1 
ATOM   7628  C  CA    . PRO C 2  521  ? -7.768  -36.670 86.668  1.00 36.11  ? 521  PRO C CA    1 
ATOM   7629  C  C     . PRO C 2  521  ? -8.711  -37.843 86.899  1.00 32.05  ? 521  PRO C C     1 
ATOM   7630  O  O     . PRO C 2  521  ? -9.859  -37.792 86.461  1.00 33.72  ? 521  PRO C O     1 
ATOM   7631  C  CB    . PRO C 2  521  ? -8.304  -35.425 87.385  1.00 34.74  ? 521  PRO C CB    1 
ATOM   7632  C  CG    . PRO C 2  521  ? -8.087  -34.298 86.426  1.00 34.62  ? 521  PRO C CG    1 
ATOM   7633  C  CD    . PRO C 2  521  ? -8.269  -34.898 85.071  1.00 37.21  ? 521  PRO C CD    1 
ATOM   7634  N  N     . VAL C 2  522  ? -8.238  -38.879 87.585  1.00 35.39  ? 522  VAL C N     1 
ATOM   7635  C  CA    . VAL C 2  522  ? -9.072  -40.049 87.839  1.00 38.27  ? 522  VAL C CA    1 
ATOM   7636  C  C     . VAL C 2  522  ? -8.752  -40.713 89.182  1.00 37.13  ? 522  VAL C C     1 
ATOM   7637  O  O     . VAL C 2  522  ? -7.588  -40.799 89.583  1.00 33.96  ? 522  VAL C O     1 
ATOM   7638  C  CB    . VAL C 2  522  ? -8.964  -41.074 86.680  1.00 39.32  ? 522  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C 2  522  ? -7.542  -41.601 86.554  1.00 32.85  ? 522  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C 2  522  ? -9.962  -42.213 86.863  1.00 51.82  ? 522  VAL C CG2   1 
ATOM   7641  N  N     . ILE C 2  523  ? -9.791  -41.170 89.877  1.00 42.61  ? 523  ILE C N     1 
ATOM   7642  C  CA    . ILE C 2  523  ? -9.614  -41.903 91.127  1.00 41.35  ? 523  ILE C CA    1 
ATOM   7643  C  C     . ILE C 2  523  ? -9.382  -43.375 90.807  1.00 41.34  ? 523  ILE C C     1 
ATOM   7644  O  O     . ILE C 2  523  ? -10.139 -43.983 90.048  1.00 40.82  ? 523  ILE C O     1 
ATOM   7645  C  CB    . ILE C 2  523  ? -10.829 -41.759 92.057  1.00 34.30  ? 523  ILE C CB    1 
ATOM   7646  C  CG1   . ILE C 2  523  ? -11.225 -40.289 92.198  1.00 24.51  ? 523  ILE C CG1   1 
ATOM   7647  C  CG2   . ILE C 2  523  ? -10.520 -42.359 93.416  1.00 37.33  ? 523  ILE C CG2   1 
ATOM   7648  C  CD1   . ILE C 2  523  ? -10.177 -39.440 92.867  1.00 17.66  ? 523  ILE C CD1   1 
ATOM   7649  N  N     . VAL C 2  524  ? -8.336  -43.948 91.390  1.00 40.20  ? 524  VAL C N     1 
ATOM   7650  C  CA    . VAL C 2  524  ? -7.856  -45.243 90.933  1.00 39.63  ? 524  VAL C CA    1 
ATOM   7651  C  C     . VAL C 2  524  ? -7.457  -46.171 92.084  1.00 38.78  ? 524  VAL C C     1 
ATOM   7652  O  O     . VAL C 2  524  ? -7.258  -45.724 93.215  1.00 40.10  ? 524  VAL C O     1 
ATOM   7653  C  CB    . VAL C 2  524  ? -6.683  -45.051 89.938  1.00 34.29  ? 524  VAL C CB    1 
ATOM   7654  C  CG1   . VAL C 2  524  ? -5.337  -45.194 90.635  1.00 28.04  ? 524  VAL C CG1   1 
ATOM   7655  C  CG2   . VAL C 2  524  ? -6.805  -46.011 88.776  1.00 42.81  ? 524  VAL C CG2   1 
ATOM   7656  N  N     . SER C 2  525  ? -7.365  -47.466 91.791  1.00 42.44  ? 525  SER C N     1 
ATOM   7657  C  CA    . SER C 2  525  ? -6.931  -48.456 92.773  1.00 40.55  ? 525  SER C CA    1 
ATOM   7658  C  C     . SER C 2  525  ? -5.409  -48.504 92.831  1.00 35.70  ? 525  SER C C     1 
ATOM   7659  O  O     . SER C 2  525  ? -4.747  -48.397 91.800  1.00 37.24  ? 525  SER C O     1 
ATOM   7660  C  CB    . SER C 2  525  ? -7.476  -49.843 92.415  1.00 46.90  ? 525  SER C CB    1 
ATOM   7661  O  OG    . SER C 2  525  ? -8.892  -49.847 92.350  1.00 53.44  ? 525  SER C OG    1 
ATOM   7662  N  N     . PRO C 2  526  ? -4.849  -48.676 94.039  1.00 31.87  ? 526  PRO C N     1 
ATOM   7663  C  CA    . PRO C 2  526  ? -3.395  -48.729 94.250  1.00 32.83  ? 526  PRO C CA    1 
ATOM   7664  C  C     . PRO C 2  526  ? -2.698  -49.762 93.370  1.00 39.94  ? 526  PRO C C     1 
ATOM   7665  O  O     . PRO C 2  526  ? -1.512  -49.613 93.083  1.00 45.69  ? 526  PRO C O     1 
ATOM   7666  C  CB    . PRO C 2  526  ? -3.272  -49.129 95.720  1.00 30.33  ? 526  PRO C CB    1 
ATOM   7667  C  CG    . PRO C 2  526  ? -4.509  -48.603 96.343  1.00 40.30  ? 526  PRO C CG    1 
ATOM   7668  C  CD    . PRO C 2  526  ? -5.593  -48.735 95.308  1.00 33.53  ? 526  PRO C CD    1 
ATOM   7669  N  N     . GLU C 2  527  ? -3.426  -50.793 92.951  1.00 52.08  ? 527  GLU C N     1 
ATOM   7670  C  CA    . GLU C 2  527  ? -2.882  -51.804 92.051  1.00 52.30  ? 527  GLU C CA    1 
ATOM   7671  C  C     . GLU C 2  527  ? -2.731  -51.253 90.639  1.00 48.59  ? 527  GLU C C     1 
ATOM   7672  O  O     . GLU C 2  527  ? -1.928  -51.752 89.850  1.00 53.48  ? 527  GLU C O     1 
ATOM   7673  C  CB    . GLU C 2  527  ? -3.773  -53.053 92.022  1.00 48.20  ? 527  GLU C CB    1 
ATOM   7674  C  CG    . GLU C 2  527  ? -3.734  -53.889 93.294  1.00 63.28  ? 527  GLU C CG    1 
ATOM   7675  C  CD    . GLU C 2  527  ? -4.617  -53.328 94.394  1.00 66.13  ? 527  GLU C CD    1 
ATOM   7676  O  OE1   . GLU C 2  527  ? -5.810  -53.067 94.124  1.00 59.01  ? 527  GLU C OE1   1 
ATOM   7677  O  OE2   . GLU C 2  527  ? -4.118  -53.145 95.526  1.00 60.20  ? 527  GLU C OE2   1 
ATOM   7678  N  N     . GLU C 2  528  ? -3.506  -50.220 90.325  1.00 39.56  ? 528  GLU C N     1 
ATOM   7679  C  CA    . GLU C 2  528  ? -3.511  -49.660 88.981  1.00 38.96  ? 528  GLU C CA    1 
ATOM   7680  C  C     . GLU C 2  528  ? -2.441  -48.592 88.789  1.00 38.57  ? 528  GLU C C     1 
ATOM   7681  O  O     . GLU C 2  528  ? -2.235  -48.119 87.670  1.00 36.21  ? 528  GLU C O     1 
ATOM   7682  C  CB    . GLU C 2  528  ? -4.878  -49.063 88.651  1.00 37.97  ? 528  GLU C CB    1 
ATOM   7683  C  CG    . GLU C 2  528  ? -6.047  -50.002 88.847  1.00 43.60  ? 528  GLU C CG    1 
ATOM   7684  C  CD    . GLU C 2  528  ? -7.360  -49.371 88.433  1.00 42.61  ? 528  GLU C CD    1 
ATOM   7685  O  OE1   . GLU C 2  528  ? -8.171  -49.041 89.325  1.00 40.46  ? 528  GLU C OE1   1 
ATOM   7686  O  OE2   . GLU C 2  528  ? -7.576  -49.196 87.215  1.00 42.58  ? 528  GLU C OE2   1 
ATOM   7687  N  N     . VAL C 2  529  ? -1.762  -48.210 89.868  1.00 37.22  ? 529  VAL C N     1 
ATOM   7688  C  CA    . VAL C 2  529  ? -0.799  -47.118 89.777  1.00 31.86  ? 529  VAL C CA    1 
ATOM   7689  C  C     . VAL C 2  529  ? 0.530   -47.603 89.208  1.00 31.32  ? 529  VAL C C     1 
ATOM   7690  O  O     . VAL C 2  529  ? 1.223   -48.419 89.815  1.00 37.54  ? 529  VAL C O     1 
ATOM   7691  C  CB    . VAL C 2  529  ? -0.541  -46.498 91.168  1.00 27.09  ? 529  VAL C CB    1 
ATOM   7692  C  CG1   . VAL C 2  529  ? 0.617   -45.519 91.112  1.00 31.30  ? 529  VAL C CG1   1 
ATOM   7693  C  CG2   . VAL C 2  529  ? -1.795  -45.824 91.697  1.00 25.03  ? 529  VAL C CG2   1 
ATOM   7694  N  N     . GLU C 2  530  ? 0.881   -47.082 88.038  1.00 29.33  ? 530  GLU C N     1 
ATOM   7695  C  CA    . GLU C 2  530  ? 2.165   -47.357 87.405  1.00 33.48  ? 530  GLU C CA    1 
ATOM   7696  C  C     . GLU C 2  530  ? 3.311   -46.465 87.906  1.00 38.80  ? 530  GLU C C     1 
ATOM   7697  O  O     . GLU C 2  530  ? 4.430   -46.933 88.122  1.00 38.11  ? 530  GLU C O     1 
ATOM   7698  C  CB    . GLU C 2  530  ? 2.017   -47.286 85.885  1.00 32.20  ? 530  GLU C CB    1 
ATOM   7699  C  CG    . GLU C 2  530  ? 0.654   -47.776 85.411  1.00 29.77  ? 530  GLU C CG    1 
ATOM   7700  C  CD    . GLU C 2  530  ? 0.644   -48.197 83.956  1.00 40.58  ? 530  GLU C CD    1 
ATOM   7701  O  OE1   . GLU C 2  530  ? -0.425  -48.106 83.313  1.00 36.50  ? 530  GLU C OE1   1 
ATOM   7702  O  OE2   . GLU C 2  530  ? 1.704   -48.632 83.460  1.00 47.18  ? 530  GLU C OE2   1 
ATOM   7703  N  N     . PHE C 2  531  ? 3.018   -45.176 88.072  1.00 33.63  ? 531  PHE C N     1 
ATOM   7704  C  CA    . PHE C 2  531  ? 4.019   -44.184 88.463  1.00 29.81  ? 531  PHE C CA    1 
ATOM   7705  C  C     . PHE C 2  531  ? 3.466   -43.155 89.444  1.00 35.08  ? 531  PHE C C     1 
ATOM   7706  O  O     . PHE C 2  531  ? 2.259   -43.078 89.659  1.00 38.96  ? 531  PHE C O     1 
ATOM   7707  C  CB    . PHE C 2  531  ? 4.580   -43.472 87.235  1.00 30.93  ? 531  PHE C CB    1 
ATOM   7708  C  CG    . PHE C 2  531  ? 5.442   -44.341 86.371  1.00 38.53  ? 531  PHE C CG    1 
ATOM   7709  C  CD1   . PHE C 2  531  ? 4.923   -44.947 85.236  1.00 42.45  ? 531  PHE C CD1   1 
ATOM   7710  C  CD2   . PHE C 2  531  ? 6.772   -44.552 86.690  1.00 34.81  ? 531  PHE C CD2   1 
ATOM   7711  C  CE1   . PHE C 2  531  ? 5.718   -45.746 84.436  1.00 36.80  ? 531  PHE C CE1   1 
ATOM   7712  C  CE2   . PHE C 2  531  ? 7.571   -45.349 85.894  1.00 33.64  ? 531  PHE C CE2   1 
ATOM   7713  C  CZ    . PHE C 2  531  ? 7.042   -45.945 84.764  1.00 37.63  ? 531  PHE C CZ    1 
ATOM   7714  N  N     . MET C 2  532  ? 4.356   -42.365 90.040  1.00 36.32  ? 532  MET C N     1 
ATOM   7715  C  CA    . MET C 2  532  ? 3.954   -41.340 91.002  1.00 36.29  ? 532  MET C CA    1 
ATOM   7716  C  C     . MET C 2  532  ? 4.801   -40.074 90.857  1.00 35.57  ? 532  MET C C     1 
ATOM   7717  O  O     . MET C 2  532  ? 5.992   -40.149 90.572  1.00 35.03  ? 532  MET C O     1 
ATOM   7718  C  CB    . MET C 2  532  ? 4.058   -41.897 92.425  1.00 35.64  ? 532  MET C CB    1 
ATOM   7719  C  CG    . MET C 2  532  ? 3.588   -40.964 93.528  1.00 31.37  ? 532  MET C CG    1 
ATOM   7720  S  SD    . MET C 2  532  ? 3.445   -41.843 95.098  1.00 30.70  ? 532  MET C SD    1 
ATOM   7721  C  CE    . MET C 2  532  ? 3.224   -40.492 96.251  1.00 42.50  ? 532  MET C CE    1 
ATOM   7722  N  N     . ASP C 2  533  ? 4.177   -38.912 91.041  1.00 40.82  ? 533  ASP C N     1 
ATOM   7723  C  CA    . ASP C 2  533  ? 4.885   -37.634 90.977  1.00 31.47  ? 533  ASP C CA    1 
ATOM   7724  C  C     . ASP C 2  533  ? 5.995   -37.590 92.018  1.00 32.13  ? 533  ASP C C     1 
ATOM   7725  O  O     . ASP C 2  533  ? 5.808   -38.036 93.149  1.00 38.91  ? 533  ASP C O     1 
ATOM   7726  C  CB    . ASP C 2  533  ? 3.923   -36.468 91.222  1.00 34.76  ? 533  ASP C CB    1 
ATOM   7727  C  CG    . ASP C 2  533  ? 2.812   -36.394 90.192  1.00 42.75  ? 533  ASP C CG    1 
ATOM   7728  O  OD1   . ASP C 2  533  ? 2.677   -37.337 89.382  1.00 40.88  ? 533  ASP C OD1   1 
ATOM   7729  O  OD2   . ASP C 2  533  ? 2.064   -35.392 90.204  1.00 43.16  ? 533  ASP C OD2   1 
ATOM   7730  N  N     . VAL C 2  534  ? 7.153   -37.069 91.628  1.00 29.12  ? 534  VAL C N     1 
ATOM   7731  C  CA    . VAL C 2  534  ? 8.276   -36.934 92.548  1.00 24.06  ? 534  VAL C CA    1 
ATOM   7732  C  C     . VAL C 2  534  ? 8.002   -35.915 93.650  1.00 24.60  ? 534  VAL C C     1 
ATOM   7733  O  O     . VAL C 2  534  ? 8.076   -36.229 94.838  1.00 29.14  ? 534  VAL C O     1 
ATOM   7734  C  CB    . VAL C 2  534  ? 9.550   -36.519 91.799  1.00 22.98  ? 534  VAL C CB    1 
ATOM   7735  C  CG1   . VAL C 2  534  ? 10.636  -36.098 92.779  1.00 28.60  ? 534  VAL C CG1   1 
ATOM   7736  C  CG2   . VAL C 2  534  ? 10.028  -37.653 90.904  1.00 33.13  ? 534  VAL C CG2   1 
ATOM   7737  N  N     . SER C 2  535  ? 7.690   -34.690 93.241  1.00 25.39  ? 535  SER C N     1 
ATOM   7738  C  CA    . SER C 2  535  ? 7.405   -33.603 94.170  1.00 28.77  ? 535  SER C CA    1 
ATOM   7739  C  C     . SER C 2  535  ? 6.360   -32.664 93.568  1.00 28.19  ? 535  SER C C     1 
ATOM   7740  O  O     . SER C 2  535  ? 6.161   -32.661 92.354  1.00 29.11  ? 535  SER C O     1 
ATOM   7741  C  CB    . SER C 2  535  ? 8.687   -32.836 94.502  1.00 26.03  ? 535  SER C CB    1 
ATOM   7742  O  OG    . SER C 2  535  ? 8.565   -32.135 95.728  1.00 25.59  ? 535  SER C OG    1 
ATOM   7743  N  N     . PRO C 2  536  ? 5.657   -31.893 94.414  1.00 25.04  ? 536  PRO C N     1 
ATOM   7744  C  CA    . PRO C 2  536  ? 4.863   -30.791 93.861  1.00 21.69  ? 536  PRO C CA    1 
ATOM   7745  C  C     . PRO C 2  536  ? 5.747   -29.818 93.076  1.00 22.82  ? 536  PRO C C     1 
ATOM   7746  O  O     . PRO C 2  536  ? 5.326   -29.307 92.027  1.00 21.74  ? 536  PRO C O     1 
ATOM   7747  C  CB    . PRO C 2  536  ? 4.308   -30.109 95.113  1.00 21.14  ? 536  PRO C CB    1 
ATOM   7748  C  CG    . PRO C 2  536  ? 4.225   -31.199 96.120  1.00 24.65  ? 536  PRO C CG    1 
ATOM   7749  C  CD    . PRO C 2  536  ? 5.400   -32.098 95.850  1.00 29.86  ? 536  PRO C CD    1 
ATOM   7750  N  N     . LYS C 2  537  ? 6.975   -29.618 93.556  1.00 19.23  ? 537  LYS C N     1 
ATOM   7751  C  CA    . LYS C 2  537  ? 7.909   -28.649 92.980  1.00 18.88  ? 537  LYS C CA    1 
ATOM   7752  C  C     . LYS C 2  537  ? 8.056   -28.785 91.467  1.00 21.85  ? 537  LYS C C     1 
ATOM   7753  O  O     . LYS C 2  537  ? 8.257   -27.794 90.765  1.00 24.58  ? 537  LYS C O     1 
ATOM   7754  C  CB    . LYS C 2  537  ? 9.299   -28.797 93.602  1.00 14.13  ? 537  LYS C CB    1 
ATOM   7755  C  CG    . LYS C 2  537  ? 9.338   -28.927 95.108  1.00 18.50  ? 537  LYS C CG    1 
ATOM   7756  C  CD    . LYS C 2  537  ? 10.785  -28.961 95.586  1.00 20.99  ? 537  LYS C CD    1 
ATOM   7757  C  CE    . LYS C 2  537  ? 10.884  -29.379 97.039  1.00 31.62  ? 537  LYS C CE    1 
ATOM   7758  N  NZ    . LYS C 2  537  ? 10.015  -28.552 97.920  1.00 35.92  ? 537  LYS C NZ    1 
ATOM   7759  N  N     . GLN C 2  538  ? 7.960   -30.014 90.971  1.00 19.69  ? 538  GLN C N     1 
ATOM   7760  C  CA    . GLN C 2  538  ? 8.217   -30.290 89.564  1.00 21.88  ? 538  GLN C CA    1 
ATOM   7761  C  C     . GLN C 2  538  ? 7.180   -29.669 88.637  1.00 22.45  ? 538  GLN C C     1 
ATOM   7762  O  O     . GLN C 2  538  ? 7.407   -29.573 87.433  1.00 25.83  ? 538  GLN C O     1 
ATOM   7763  C  CB    . GLN C 2  538  ? 8.310   -31.798 89.307  1.00 29.21  ? 538  GLN C CB    1 
ATOM   7764  C  CG    . GLN C 2  538  ? 6.975   -32.525 89.339  1.00 24.55  ? 538  GLN C CG    1 
ATOM   7765  C  CD    . GLN C 2  538  ? 7.097   -33.979 88.934  1.00 23.90  ? 538  GLN C CD    1 
ATOM   7766  O  OE1   . GLN C 2  538  ? 7.021   -34.878 89.770  1.00 28.55  ? 538  GLN C OE1   1 
ATOM   7767  N  NE2   . GLN C 2  538  ? 7.286   -34.218 87.643  1.00 26.97  ? 538  GLN C NE2   1 
ATOM   7768  N  N     . VAL C 2  539  ? 6.045   -29.247 89.185  1.00 18.96  ? 539  VAL C N     1 
ATOM   7769  C  CA    . VAL C 2  539  ? 5.010   -28.647 88.344  1.00 20.57  ? 539  VAL C CA    1 
ATOM   7770  C  C     . VAL C 2  539  ? 5.327   -27.185 87.983  1.00 16.07  ? 539  VAL C C     1 
ATOM   7771  O  O     . VAL C 2  539  ? 4.866   -26.675 86.963  1.00 14.14  ? 539  VAL C O     1 
ATOM   7772  C  CB    . VAL C 2  539  ? 3.607   -28.796 88.984  1.00 18.76  ? 539  VAL C CB    1 
ATOM   7773  C  CG1   . VAL C 2  539  ? 2.528   -28.171 88.117  1.00 16.51  ? 539  VAL C CG1   1 
ATOM   7774  C  CG2   . VAL C 2  539  ? 3.300   -30.261 89.193  1.00 26.20  ? 539  VAL C CG2   1 
ATOM   7775  N  N     . PHE C 2  540  ? 6.157   -26.533 88.791  1.00 15.52  ? 540  PHE C N     1 
ATOM   7776  C  CA    . PHE C 2  540  ? 6.391   -25.098 88.635  1.00 18.05  ? 540  PHE C CA    1 
ATOM   7777  C  C     . PHE C 2  540  ? 7.856   -24.727 88.420  1.00 15.33  ? 540  PHE C C     1 
ATOM   7778  O  O     . PHE C 2  540  ? 8.758   -25.517 88.697  1.00 18.17  ? 540  PHE C O     1 
ATOM   7779  C  CB    . PHE C 2  540  ? 5.840   -24.334 89.843  1.00 18.34  ? 540  PHE C CB    1 
ATOM   7780  C  CG    . PHE C 2  540  ? 4.428   -24.697 90.192  1.00 18.07  ? 540  PHE C CG    1 
ATOM   7781  C  CD1   . PHE C 2  540  ? 4.156   -25.494 91.289  1.00 21.53  ? 540  PHE C CD1   1 
ATOM   7782  C  CD2   . PHE C 2  540  ? 3.374   -24.257 89.410  1.00 16.02  ? 540  PHE C CD2   1 
ATOM   7783  C  CE1   . PHE C 2  540  ? 2.859   -25.837 91.607  1.00 22.55  ? 540  PHE C CE1   1 
ATOM   7784  C  CE2   . PHE C 2  540  ? 2.074   -24.596 89.722  1.00 17.50  ? 540  PHE C CE2   1 
ATOM   7785  C  CZ    . PHE C 2  540  ? 1.816   -25.387 90.825  1.00 23.32  ? 540  PHE C CZ    1 
ATOM   7786  N  N     . SER C 2  541  ? 8.076   -23.511 87.930  1.00 11.72  ? 541  SER C N     1 
ATOM   7787  C  CA    . SER C 2  541  ? 9.417   -22.996 87.684  1.00 13.65  ? 541  SER C CA    1 
ATOM   7788  C  C     . SER C 2  541  ? 10.119  -22.666 88.993  1.00 14.04  ? 541  SER C C     1 
ATOM   7789  O  O     . SER C 2  541  ? 9.572   -22.879 90.072  1.00 15.79  ? 541  SER C O     1 
ATOM   7790  C  CB    . SER C 2  541  ? 9.351   -21.739 86.815  1.00 18.99  ? 541  SER C CB    1 
ATOM   7791  O  OG    . SER C 2  541  ? 8.669   -20.689 87.483  1.00 13.90  ? 541  SER C OG    1 
ATOM   7792  N  N     . VAL C 2  542  ? 11.334  -22.142 88.894  1.00 14.03  ? 542  VAL C N     1 
ATOM   7793  C  CA    . VAL C 2  542  ? 12.110  -21.805 90.081  1.00 14.20  ? 542  VAL C CA    1 
ATOM   7794  C  C     . VAL C 2  542  ? 11.533  -20.601 90.832  1.00 17.44  ? 542  VAL C C     1 
ATOM   7795  O  O     . VAL C 2  542  ? 11.406  -20.632 92.058  1.00 19.56  ? 542  VAL C O     1 
ATOM   7796  C  CB    . VAL C 2  542  ? 13.597  -21.581 89.735  1.00 12.35  ? 542  VAL C CB    1 
ATOM   7797  C  CG1   . VAL C 2  542  ? 14.318  -20.869 90.866  1.00 10.90  ? 542  VAL C CG1   1 
ATOM   7798  C  CG2   . VAL C 2  542  ? 14.262  -22.910 89.421  1.00 12.34  ? 542  VAL C CG2   1 
ATOM   7799  N  N     . ASN C 2  543  ? 11.174  -19.549 90.102  1.00 17.39  ? 543  ASN C N     1 
ATOM   7800  C  CA    . ASN C 2  543  ? 10.602  -18.362 90.729  1.00 14.69  ? 543  ASN C CA    1 
ATOM   7801  C  C     . ASN C 2  543  ? 9.281   -18.677 91.405  1.00 16.12  ? 543  ASN C C     1 
ATOM   7802  O  O     . ASN C 2  543  ? 9.033   -18.255 92.536  1.00 16.49  ? 543  ASN C O     1 
ATOM   7803  C  CB    . ASN C 2  543  ? 10.393  -17.254 89.703  1.00 11.77  ? 543  ASN C CB    1 
ATOM   7804  C  CG    . ASN C 2  543  ? 11.654  -16.913 88.964  1.00 15.74  ? 543  ASN C CG    1 
ATOM   7805  O  OD1   . ASN C 2  543  ? 12.187  -17.737 88.224  1.00 22.02  ? 543  ASN C OD1   1 
ATOM   7806  N  ND2   . ASN C 2  543  ? 12.142  -15.694 89.152  1.00 15.56  ? 543  ASN C ND2   1 
ATOM   7807  N  N     . THR C 2  544  ? 8.437   -19.425 90.703  1.00 13.94  ? 544  THR C N     1 
ATOM   7808  C  CA    . THR C 2  544  ? 7.128   -19.797 91.221  1.00 14.20  ? 544  THR C CA    1 
ATOM   7809  C  C     . THR C 2  544  ? 7.257   -20.667 92.469  1.00 19.75  ? 544  THR C C     1 
ATOM   7810  O  O     . THR C 2  544  ? 6.480   -20.532 93.419  1.00 17.69  ? 544  THR C O     1 
ATOM   7811  C  CB    . THR C 2  544  ? 6.312   -20.551 90.171  1.00 10.75  ? 544  THR C CB    1 
ATOM   7812  O  OG1   . THR C 2  544  ? 6.393   -19.860 88.920  1.00 11.75  ? 544  THR C OG1   1 
ATOM   7813  C  CG2   . THR C 2  544  ? 4.869   -20.644 90.605  1.00 10.46  ? 544  THR C CG2   1 
ATOM   7814  N  N     . ASN C 2  545  ? 8.254   -21.548 92.462  1.00 18.15  ? 545  ASN C N     1 
ATOM   7815  C  CA    . ASN C 2  545  ? 8.535   -22.415 93.601  1.00 15.19  ? 545  ASN C CA    1 
ATOM   7816  C  C     . ASN C 2  545  ? 8.975   -21.650 94.842  1.00 16.47  ? 545  ASN C C     1 
ATOM   7817  O  O     . ASN C 2  545  ? 9.074   -22.223 95.923  1.00 16.29  ? 545  ASN C O     1 
ATOM   7818  C  CB    . ASN C 2  545  ? 9.598   -23.450 93.239  1.00 13.43  ? 545  ASN C CB    1 
ATOM   7819  C  CG    . ASN C 2  545  ? 9.002   -24.786 92.861  1.00 17.36  ? 545  ASN C CG    1 
ATOM   7820  O  OD1   . ASN C 2  545  ? 8.466   -25.498 93.708  1.00 21.56  ? 545  ASN C OD1   1 
ATOM   7821  N  ND2   . ASN C 2  545  ? 9.101   -25.141 91.585  1.00 16.61  ? 545  ASN C ND2   1 
ATOM   7822  N  N     . LEU C 2  546  ? 9.255   -20.361 94.676  1.00 17.18  ? 546  LEU C N     1 
ATOM   7823  C  CA    . LEU C 2  546  ? 9.738   -19.529 95.770  1.00 15.97  ? 546  LEU C CA    1 
ATOM   7824  C  C     . LEU C 2  546  ? 8.621   -18.791 96.507  1.00 14.06  ? 546  LEU C C     1 
ATOM   7825  O  O     . LEU C 2  546  ? 8.883   -18.028 97.436  1.00 10.34  ? 546  LEU C O     1 
ATOM   7826  C  CB    . LEU C 2  546  ? 10.786  -18.543 95.258  1.00 14.68  ? 546  LEU C CB    1 
ATOM   7827  C  CG    . LEU C 2  546  ? 12.125  -19.196 94.931  1.00 13.54  ? 546  LEU C CG    1 
ATOM   7828  C  CD1   . LEU C 2  546  ? 13.051  -18.216 94.241  1.00 17.06  ? 546  LEU C CD1   1 
ATOM   7829  C  CD2   . LEU C 2  546  ? 12.755  -19.721 96.208  1.00 14.24  ? 546  LEU C CD2   1 
ATOM   7830  N  N     . ILE C 2  547  ? 7.378   -19.027 96.095  1.00 16.91  ? 547  ILE C N     1 
ATOM   7831  C  CA    . ILE C 2  547  ? 6.227   -18.412 96.751  1.00 19.00  ? 547  ILE C CA    1 
ATOM   7832  C  C     . ILE C 2  547  ? 5.597   -19.356 97.773  1.00 18.31  ? 547  ILE C C     1 
ATOM   7833  O  O     . ILE C 2  547  ? 4.904   -20.303 97.401  1.00 20.96  ? 547  ILE C O     1 
ATOM   7834  C  CB    . ILE C 2  547  ? 5.127   -18.061 95.728  1.00 14.83  ? 547  ILE C CB    1 
ATOM   7835  C  CG1   . ILE C 2  547  ? 5.719   -17.387 94.495  1.00 12.26  ? 547  ILE C CG1   1 
ATOM   7836  C  CG2   . ILE C 2  547  ? 4.062   -17.185 96.365  1.00 16.19  ? 547  ILE C CG2   1 
ATOM   7837  C  CD1   . ILE C 2  547  ? 4.694   -17.106 93.425  1.00 12.26  ? 547  ILE C CD1   1 
ATOM   7838  N  N     . PRO C 2  548  ? 5.796   -19.077 99.068  1.00 16.46  ? 548  PRO C N     1 
ATOM   7839  C  CA    . PRO C 2  548  ? 5.167   -19.915 100.093 1.00 14.11  ? 548  PRO C CA    1 
ATOM   7840  C  C     . PRO C 2  548  ? 3.646   -19.804 100.037 1.00 13.44  ? 548  PRO C C     1 
ATOM   7841  O  O     . PRO C 2  548  ? 3.130   -18.789 99.586  1.00 15.12  ? 548  PRO C O     1 
ATOM   7842  C  CB    . PRO C 2  548  ? 5.709   -19.332 101.403 1.00 14.86  ? 548  PRO C CB    1 
ATOM   7843  C  CG    . PRO C 2  548  ? 6.166   -17.952 101.057 1.00 14.45  ? 548  PRO C CG    1 
ATOM   7844  C  CD    . PRO C 2  548  ? 6.645   -18.024 99.650  1.00 13.86  ? 548  PRO C CD    1 
ATOM   7845  N  N     . PHE C 2  549  ? 2.949   -20.852 100.462 1.00 16.40  ? 549  PHE C N     1 
ATOM   7846  C  CA    . PHE C 2  549  ? 1.485   -20.875 100.480 1.00 16.55  ? 549  PHE C CA    1 
ATOM   7847  C  C     . PHE C 2  549  ? 0.846   -20.677 99.107  1.00 12.87  ? 549  PHE C C     1 
ATOM   7848  O  O     . PHE C 2  549  ? -0.291  -20.222 99.014  1.00 11.46  ? 549  PHE C O     1 
ATOM   7849  C  CB    . PHE C 2  549  ? 0.930   -19.839 101.457 1.00 13.63  ? 549  PHE C CB    1 
ATOM   7850  C  CG    . PHE C 2  549  ? 1.392   -20.027 102.867 1.00 13.02  ? 549  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C 2  549  ? 1.022   -21.150 103.586 1.00 15.74  ? 549  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C 2  549  ? 2.183   -19.072 103.481 1.00 13.30  ? 549  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C 2  549  ? 1.443   -21.322 104.890 1.00 22.29  ? 549  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C 2  549  ? 2.604   -19.234 104.783 1.00 16.17  ? 549  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C 2  549  ? 2.234   -20.361 105.490 1.00 20.14  ? 549  PHE C CZ    1 
ATOM   7856  N  N     . LEU C 2  550  ? 1.571   -21.040 98.055  1.00 15.32  ? 550  LEU C N     1 
ATOM   7857  C  CA    . LEU C 2  550  ? 1.110   -20.851 96.680  1.00 17.39  ? 550  LEU C CA    1 
ATOM   7858  C  C     . LEU C 2  550  ? -0.294  -21.402 96.425  1.00 18.57  ? 550  LEU C C     1 
ATOM   7859  O  O     . LEU C 2  550  ? -1.050  -20.834 95.639  1.00 21.31  ? 550  LEU C O     1 
ATOM   7860  C  CB    . LEU C 2  550  ? 2.099   -21.483 95.695  1.00 20.48  ? 550  LEU C CB    1 
ATOM   7861  C  CG    . LEU C 2  550  ? 1.701   -21.445 94.218  1.00 15.68  ? 550  LEU C CG    1 
ATOM   7862  C  CD1   . LEU C 2  550  ? 1.675   -20.013 93.720  1.00 19.62  ? 550  LEU C CD1   1 
ATOM   7863  C  CD2   . LEU C 2  550  ? 2.635   -22.295 93.374  1.00 17.64  ? 550  LEU C CD2   1 
ATOM   7864  N  N     . GLU C 2  551  ? -0.641  -22.500 97.095  1.00 22.00  ? 551  GLU C N     1 
ATOM   7865  C  CA    . GLU C 2  551  ? -1.950  -23.133 96.919  1.00 18.58  ? 551  GLU C CA    1 
ATOM   7866  C  C     . GLU C 2  551  ? -3.113  -22.214 97.293  1.00 21.28  ? 551  GLU C C     1 
ATOM   7867  O  O     . GLU C 2  551  ? -4.252  -22.449 96.885  1.00 21.22  ? 551  GLU C O     1 
ATOM   7868  C  CB    . GLU C 2  551  ? -2.045  -24.433 97.723  1.00 14.60  ? 551  GLU C CB    1 
ATOM   7869  C  CG    . GLU C 2  551  ? -1.986  -24.261 99.234  1.00 17.29  ? 551  GLU C CG    1 
ATOM   7870  C  CD    . GLU C 2  551  ? -0.564  -24.234 99.770  1.00 18.59  ? 551  GLU C CD    1 
ATOM   7871  O  OE1   . GLU C 2  551  ? -0.381  -24.333 101.002 1.00 21.07  ? 551  GLU C OE1   1 
ATOM   7872  O  OE2   . GLU C 2  551  ? 0.374   -24.114 98.959  1.00 16.45  ? 551  GLU C OE2   1 
ATOM   7873  N  N     . HIS C 2  552  ? -2.826  -21.175 98.071  1.00 19.24  ? 552  HIS C N     1 
ATOM   7874  C  CA    . HIS C 2  552  ? -3.861  -20.242 98.498  1.00 19.53  ? 552  HIS C CA    1 
ATOM   7875  C  C     . HIS C 2  552  ? -3.969  -19.000 97.606  1.00 19.98  ? 552  HIS C C     1 
ATOM   7876  O  O     . HIS C 2  552  ? -4.849  -18.166 97.813  1.00 25.62  ? 552  HIS C O     1 
ATOM   7877  C  CB    . HIS C 2  552  ? -3.631  -19.828 99.955  1.00 18.42  ? 552  HIS C CB    1 
ATOM   7878  C  CG    . HIS C 2  552  ? -3.520  -20.983 100.902 1.00 21.62  ? 552  HIS C CG    1 
ATOM   7879  N  ND1   . HIS C 2  552  ? -4.622  -21.635 101.416 1.00 21.82  ? 552  HIS C ND1   1 
ATOM   7880  C  CD2   . HIS C 2  552  ? -2.440  -21.602 101.432 1.00 19.58  ? 552  HIS C CD2   1 
ATOM   7881  C  CE1   . HIS C 2  552  ? -4.224  -22.604 102.219 1.00 18.48  ? 552  HIS C CE1   1 
ATOM   7882  N  NE2   . HIS C 2  552  ? -2.901  -22.604 102.247 1.00 17.77  ? 552  HIS C NE2   1 
ATOM   7883  N  N     . ASP C 2  553  ? -3.091  -18.886 96.611  1.00 15.54  ? 553  ASP C N     1 
ATOM   7884  C  CA    . ASP C 2  553  ? -3.075  -17.718 95.728  1.00 15.22  ? 553  ASP C CA    1 
ATOM   7885  C  C     . ASP C 2  553  ? -3.614  -18.046 94.339  1.00 16.03  ? 553  ASP C C     1 
ATOM   7886  O  O     . ASP C 2  553  ? -3.282  -19.085 93.775  1.00 17.97  ? 553  ASP C O     1 
ATOM   7887  C  CB    . ASP C 2  553  ? -1.652  -17.167 95.585  1.00 13.55  ? 553  ASP C CB    1 
ATOM   7888  C  CG    . ASP C 2  553  ? -1.026  -16.798 96.915  1.00 16.24  ? 553  ASP C CG    1 
ATOM   7889  O  OD1   . ASP C 2  553  ? 0.208   -16.945 97.059  1.00 14.01  ? 553  ASP C OD1   1 
ATOM   7890  O  OD2   . ASP C 2  553  ? -1.765  -16.354 97.817  1.00 17.20  ? 553  ASP C OD2   1 
ATOM   7891  N  N     . ASP C 2  554  ? -4.434  -17.158 93.784  1.00 13.71  ? 554  ASP C N     1 
ATOM   7892  C  CA    . ASP C 2  554  ? -4.884  -17.311 92.403  1.00 16.05  ? 554  ASP C CA    1 
ATOM   7893  C  C     . ASP C 2  554  ? -3.689  -17.191 91.455  1.00 18.56  ? 554  ASP C C     1 
ATOM   7894  O  O     . ASP C 2  554  ? -2.750  -16.440 91.721  1.00 19.06  ? 554  ASP C O     1 
ATOM   7895  C  CB    . ASP C 2  554  ? -5.952  -16.272 92.053  1.00 17.45  ? 554  ASP C CB    1 
ATOM   7896  C  CG    . ASP C 2  554  ? -6.642  -16.563 90.726  1.00 27.33  ? 554  ASP C CG    1 
ATOM   7897  O  OD1   . ASP C 2  554  ? -7.850  -16.886 90.737  1.00 28.41  ? 554  ASP C OD1   1 
ATOM   7898  O  OD2   . ASP C 2  554  ? -5.976  -16.477 89.671  1.00 31.29  ? 554  ASP C OD2   1 
ATOM   7899  N  N     . ALA C 2  555  ? -3.738  -17.924 90.347  1.00 19.09  ? 555  ALA C N     1 
ATOM   7900  C  CA    . ALA C 2  555  ? -2.594  -18.051 89.443  1.00 16.49  ? 555  ALA C CA    1 
ATOM   7901  C  C     . ALA C 2  555  ? -2.046  -16.736 88.881  1.00 21.01  ? 555  ALA C C     1 
ATOM   7902  O  O     . ALA C 2  555  ? -0.865  -16.656 88.548  1.00 17.58  ? 555  ALA C O     1 
ATOM   7903  C  CB    . ALA C 2  555  ? -2.923  -19.006 88.308  1.00 15.54  ? 555  ALA C CB    1 
ATOM   7904  N  N     . ASN C 2  556  ? -2.895  -15.717 88.766  1.00 20.43  ? 556  ASN C N     1 
ATOM   7905  C  CA    . ASN C 2  556  ? -2.479  -14.441 88.178  1.00 18.77  ? 556  ASN C CA    1 
ATOM   7906  C  C     . ASN C 2  556  ? -1.531  -13.634 89.063  1.00 16.89  ? 556  ASN C C     1 
ATOM   7907  O  O     . ASN C 2  556  ? -0.450  -13.208 88.626  1.00 22.10  ? 556  ASN C O     1 
ATOM   7908  C  CB    . ASN C 2  556  ? -3.701  -13.607 87.804  1.00 20.41  ? 556  ASN C CB    1 
ATOM   7909  C  CG    . ASN C 2  556  ? -4.649  -14.354 86.892  1.00 23.63  ? 556  ASN C CG    1 
ATOM   7910  O  OD1   . ASN C 2  556  ? -4.617  -14.191 85.672  1.00 29.48  ? 556  ASN C OD1   1 
ATOM   7911  N  ND2   . ASN C 2  556  ? -5.495  -15.190 87.481  1.00 22.98  ? 556  ASN C ND2   1 
ATOM   7912  N  N     . ARG C 2  557  ? -1.932  -13.428 90.312  1.00 11.81  ? 557  ARG C N     1 
ATOM   7913  C  CA    . ARG C 2  557  ? -1.070  -12.754 91.270  1.00 12.82  ? 557  ARG C CA    1 
ATOM   7914  C  C     . ARG C 2  557  ? 0.174   -13.595 91.552  1.00 14.58  ? 557  ARG C C     1 
ATOM   7915  O  O     . ARG C 2  557  ? 1.236   -13.057 91.866  1.00 13.49  ? 557  ARG C O     1 
ATOM   7916  C  CB    . ARG C 2  557  ? -1.828  -12.436 92.559  1.00 13.91  ? 557  ARG C CB    1 
ATOM   7917  C  CG    . ARG C 2  557  ? -2.810  -11.286 92.422  1.00 15.36  ? 557  ARG C CG    1 
ATOM   7918  C  CD    . ARG C 2  557  ? -2.100  -9.940  92.296  1.00 13.57  ? 557  ARG C CD    1 
ATOM   7919  N  NE    . ARG C 2  557  ? -2.918  -8.966  91.579  1.00 12.54  ? 557  ARG C NE    1 
ATOM   7920  C  CZ    . ARG C 2  557  ? -2.665  -7.663  91.523  1.00 14.44  ? 557  ARG C CZ    1 
ATOM   7921  N  NH1   . ARG C 2  557  ? -1.614  -7.159  92.154  1.00 19.80  ? 557  ARG C NH1   1 
ATOM   7922  N  NH2   . ARG C 2  557  ? -3.472  -6.860  90.843  1.00 16.31  ? 557  ARG C NH2   1 
ATOM   7923  N  N     . ALA C 2  558  ? 0.042   -14.913 91.426  1.00 12.91  ? 558  ALA C N     1 
ATOM   7924  C  CA    . ALA C 2  558  ? 1.186   -15.811 91.557  1.00 13.09  ? 558  ALA C CA    1 
ATOM   7925  C  C     . ALA C 2  558  ? 2.181   -15.540 90.437  1.00 11.58  ? 558  ALA C C     1 
ATOM   7926  O  O     . ALA C 2  558  ? 3.391   -15.461 90.667  1.00 11.62  ? 558  ALA C O     1 
ATOM   7927  C  CB    . ALA C 2  558  ? 0.735   -17.259 91.525  1.00 13.14  ? 558  ALA C CB    1 
ATOM   7928  N  N     . LEU C 2  559  ? 1.653   -15.405 89.224  1.00 11.14  ? 559  LEU C N     1 
ATOM   7929  C  CA    . LEU C 2  559  ? 2.439   -15.030 88.057  1.00 13.51  ? 559  LEU C CA    1 
ATOM   7930  C  C     . LEU C 2  559  ? 3.175   -13.732 88.338  1.00 13.13  ? 559  LEU C C     1 
ATOM   7931  O  O     . LEU C 2  559  ? 4.373   -13.598 88.053  1.00 12.58  ? 559  LEU C O     1 
ATOM   7932  C  CB    . LEU C 2  559  ? 1.523   -14.877 86.837  1.00 11.05  ? 559  LEU C CB    1 
ATOM   7933  C  CG    . LEU C 2  559  ? 1.963   -14.034 85.640  1.00 10.34  ? 559  LEU C CG    1 
ATOM   7934  C  CD1   . LEU C 2  559  ? 1.424   -14.647 84.374  1.00 10.92  ? 559  LEU C CD1   1 
ATOM   7935  C  CD2   . LEU C 2  559  ? 1.468   -12.599 85.762  1.00 15.52  ? 559  LEU C CD2   1 
ATOM   7936  N  N     . MET C 2  560  ? 2.451   -12.776 88.909  1.00 12.10  ? 560  MET C N     1 
ATOM   7937  C  CA    . MET C 2  560  ? 3.064   -11.498 89.234  1.00 13.17  ? 560  MET C CA    1 
ATOM   7938  C  C     . MET C 2  560  ? 4.206   -11.650 90.235  1.00 15.25  ? 560  MET C C     1 
ATOM   7939  O  O     . MET C 2  560  ? 5.255   -11.050 90.056  1.00 15.73  ? 560  MET C O     1 
ATOM   7940  C  CB    . MET C 2  560  ? 2.021   -10.493 89.722  1.00 15.47  ? 560  MET C CB    1 
ATOM   7941  C  CG    . MET C 2  560  ? 0.939   -10.225 88.692  1.00 21.46  ? 560  MET C CG    1 
ATOM   7942  S  SD    . MET C 2  560  ? -0.175  -8.883  89.132  1.00 25.89  ? 560  MET C SD    1 
ATOM   7943  C  CE    . MET C 2  560  ? -1.538  -9.211  88.015  1.00 21.25  ? 560  MET C CE    1 
ATOM   7944  N  N     . GLY C 2  561  ? 4.010   -12.463 91.272  1.00 13.51  ? 561  GLY C N     1 
ATOM   7945  C  CA    . GLY C 2  561  ? 5.052   -12.699 92.260  1.00 9.40   ? 561  GLY C CA    1 
ATOM   7946  C  C     . GLY C 2  561  ? 6.296   -13.309 91.638  1.00 14.55  ? 561  GLY C C     1 
ATOM   7947  O  O     . GLY C 2  561  ? 7.429   -12.838 91.857  1.00 18.86  ? 561  GLY C O     1 
ATOM   7948  N  N     . SER C 2  562  ? 6.075   -14.359 90.849  1.00 13.53  ? 562  SER C N     1 
ATOM   7949  C  CA    . SER C 2  562  ? 7.149   -15.016 90.117  1.00 14.91  ? 562  SER C CA    1 
ATOM   7950  C  C     . SER C 2  562  ? 7.942   -14.007 89.308  1.00 17.62  ? 562  SER C C     1 
ATOM   7951  O  O     . SER C 2  562  ? 9.161   -13.917 89.442  1.00 20.72  ? 562  SER C O     1 
ATOM   7952  C  CB    . SER C 2  562  ? 6.587   -16.082 89.177  1.00 11.24  ? 562  SER C CB    1 
ATOM   7953  O  OG    . SER C 2  562  ? 5.923   -17.092 89.904  1.00 13.70  ? 562  SER C OG    1 
ATOM   7954  N  N     . ASN C 2  563  ? 7.245   -13.238 88.477  1.00 14.81  ? 563  ASN C N     1 
ATOM   7955  C  CA    . ASN C 2  563  ? 7.921   -12.279 87.615  1.00 15.43  ? 563  ASN C CA    1 
ATOM   7956  C  C     . ASN C 2  563  ? 8.655   -11.198 88.400  1.00 15.90  ? 563  ASN C C     1 
ATOM   7957  O  O     . ASN C 2  563  ? 9.733   -10.753 88.007  1.00 16.64  ? 563  ASN C O     1 
ATOM   7958  C  CB    . ASN C 2  563  ? 6.935   -11.652 86.631  1.00 12.23  ? 563  ASN C CB    1 
ATOM   7959  C  CG    . ASN C 2  563  ? 6.503   -12.618 85.550  1.00 17.88  ? 563  ASN C CG    1 
ATOM   7960  O  OD1   . ASN C 2  563  ? 7.282   -13.472 85.113  1.00 18.35  ? 563  ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C 2  563  ? 5.256   -12.493 85.109  1.00 20.37  ? 563  ASN C ND2   1 
ATOM   7962  N  N     . MET C 2  564  ? 8.070   -10.796 89.520  1.00 13.36  ? 564  MET C N     1 
ATOM   7963  C  CA    . MET C 2  564  ? 8.577   -9.663  90.280  1.00 15.48  ? 564  MET C CA    1 
ATOM   7964  C  C     . MET C 2  564  ? 9.780   -9.995  91.138  1.00 17.20  ? 564  MET C C     1 
ATOM   7965  O  O     . MET C 2  564  ? 10.588  -9.113  91.434  1.00 16.44  ? 564  MET C O     1 
ATOM   7966  C  CB    . MET C 2  564  ? 7.474   -9.033  91.126  1.00 10.77  ? 564  MET C CB    1 
ATOM   7967  C  CG    . MET C 2  564  ? 6.516   -8.209  90.306  1.00 11.40  ? 564  MET C CG    1 
ATOM   7968  S  SD    . MET C 2  564  ? 5.418   -7.237  91.325  1.00 22.90  ? 564  MET C SD    1 
ATOM   7969  C  CE    . MET C 2  564  ? 4.649   -8.522  92.308  1.00 21.19  ? 564  MET C CE    1 
ATOM   7970  N  N     . GLN C 2  565  ? 9.903   -11.254 91.549  1.00 20.68  ? 565  GLN C N     1 
ATOM   7971  C  CA    . GLN C 2  565  ? 11.107  -11.646 92.275  1.00 19.20  ? 565  GLN C CA    1 
ATOM   7972  C  C     . GLN C 2  565  ? 12.346  -11.335 91.435  1.00 16.33  ? 565  GLN C C     1 
ATOM   7973  O  O     . GLN C 2  565  ? 13.375  -10.924 91.963  1.00 16.24  ? 565  GLN C O     1 
ATOM   7974  C  CB    . GLN C 2  565  ? 11.061  -13.118 92.677  1.00 17.22  ? 565  GLN C CB    1 
ATOM   7975  C  CG    . GLN C 2  565  ? 9.995   -13.419 93.712  1.00 17.61  ? 565  GLN C CG    1 
ATOM   7976  C  CD    . GLN C 2  565  ? 10.148  -14.790 94.327  1.00 23.45  ? 565  GLN C CD    1 
ATOM   7977  O  OE1   . GLN C 2  565  ? 9.449   -15.729 93.949  1.00 23.33  ? 565  GLN C OE1   1 
ATOM   7978  N  NE2   . GLN C 2  565  ? 11.063  -14.913 95.288  1.00 19.35  ? 565  GLN C NE2   1 
ATOM   7979  N  N     . THR C 2  566  ? 12.217  -11.496 90.122  1.00 18.68  ? 566  THR C N     1 
ATOM   7980  C  CA    . THR C 2  566  ? 13.278  -11.173 89.173  1.00 16.95  ? 566  THR C CA    1 
ATOM   7981  C  C     . THR C 2  566  ? 13.686  -9.708  89.282  1.00 18.40  ? 566  THR C C     1 
ATOM   7982  O  O     . THR C 2  566  ? 14.826  -9.344  88.996  1.00 19.14  ? 566  THR C O     1 
ATOM   7983  C  CB    . THR C 2  566  ? 12.809  -11.436 87.727  1.00 19.88  ? 566  THR C CB    1 
ATOM   7984  O  OG1   . THR C 2  566  ? 12.268  -12.759 87.630  1.00 25.23  ? 566  THR C OG1   1 
ATOM   7985  C  CG2   . THR C 2  566  ? 13.956  -11.286 86.740  1.00 29.31  ? 566  THR C CG2   1 
ATOM   7986  N  N     . GLN C 2  567  ? 12.747  -8.872  89.712  1.00 22.74  ? 567  GLN C N     1 
ATOM   7987  C  CA    . GLN C 2  567  ? 12.937  -7.426  89.704  1.00 18.35  ? 567  GLN C CA    1 
ATOM   7988  C  C     . GLN C 2  567  ? 13.456  -6.883  91.033  1.00 13.46  ? 567  GLN C C     1 
ATOM   7989  O  O     . GLN C 2  567  ? 13.652  -5.679  91.184  1.00 11.75  ? 567  GLN C O     1 
ATOM   7990  C  CB    . GLN C 2  567  ? 11.628  -6.733  89.317  1.00 17.57  ? 567  GLN C CB    1 
ATOM   7991  C  CG    . GLN C 2  567  ? 11.019  -7.270  88.026  1.00 18.34  ? 567  GLN C CG    1 
ATOM   7992  C  CD    . GLN C 2  567  ? 9.650   -6.692  87.732  1.00 19.69  ? 567  GLN C CD    1 
ATOM   7993  O  OE1   . GLN C 2  567  ? 9.251   -5.681  88.310  1.00 24.54  ? 567  GLN C OE1   1 
ATOM   7994  N  NE2   . GLN C 2  567  ? 8.920   -7.336  86.829  1.00 24.23  ? 567  GLN C NE2   1 
ATOM   7995  N  N     . ALA C 2  568  ? 13.686  -7.774  91.990  1.00 13.99  ? 568  ALA C N     1 
ATOM   7996  C  CA    . ALA C 2  568  ? 14.165  -7.364  93.306  1.00 16.47  ? 568  ALA C CA    1 
ATOM   7997  C  C     . ALA C 2  568  ? 15.626  -6.926  93.269  1.00 17.07  ? 568  ALA C C     1 
ATOM   7998  O  O     . ALA C 2  568  ? 16.486  -7.648  92.766  1.00 21.78  ? 568  ALA C O     1 
ATOM   7999  C  CB    . ALA C 2  568  ? 13.975  -8.491  94.311  1.00 16.50  ? 568  ALA C CB    1 
ATOM   8000  N  N     . VAL C 2  569  ? 15.908  -5.744  93.804  1.00 14.06  ? 569  VAL C N     1 
ATOM   8001  C  CA    . VAL C 2  569  ? 17.280  -5.256  93.860  1.00 15.33  ? 569  VAL C CA    1 
ATOM   8002  C  C     . VAL C 2  569  ? 17.967  -5.748  95.127  1.00 19.08  ? 569  VAL C C     1 
ATOM   8003  O  O     . VAL C 2  569  ? 17.314  -5.947  96.152  1.00 18.92  ? 569  VAL C O     1 
ATOM   8004  C  CB    . VAL C 2  569  ? 17.347  -3.717  93.792  1.00 12.58  ? 569  VAL C CB    1 
ATOM   8005  C  CG1   . VAL C 2  569  ? 16.728  -3.227  92.497  1.00 16.39  ? 569  VAL C CG1   1 
ATOM   8006  C  CG2   . VAL C 2  569  ? 16.650  -3.093  94.983  1.00 12.44  ? 569  VAL C CG2   1 
ATOM   8007  N  N     . PRO C 2  570  ? 19.286  -5.987  95.049  1.00 21.51  ? 570  PRO C N     1 
ATOM   8008  C  CA    . PRO C 2  570  ? 20.070  -6.336  96.239  1.00 19.04  ? 570  PRO C CA    1 
ATOM   8009  C  C     . PRO C 2  570  ? 20.135  -5.163  97.213  1.00 24.05  ? 570  PRO C C     1 
ATOM   8010  O  O     . PRO C 2  570  ? 20.403  -4.033  96.796  1.00 21.30  ? 570  PRO C O     1 
ATOM   8011  C  CB    . PRO C 2  570  ? 21.463  -6.622  95.670  1.00 14.78  ? 570  PRO C CB    1 
ATOM   8012  C  CG    . PRO C 2  570  ? 21.228  -6.962  94.241  1.00 19.51  ? 570  PRO C CG    1 
ATOM   8013  C  CD    . PRO C 2  570  ? 20.077  -6.108  93.813  1.00 17.93  ? 570  PRO C CD    1 
ATOM   8014  N  N     . LEU C 2  571  ? 19.898  -5.435  98.493  1.00 21.22  ? 571  LEU C N     1 
ATOM   8015  C  CA    . LEU C 2  571  ? 19.926  -4.402  99.521  1.00 19.28  ? 571  LEU C CA    1 
ATOM   8016  C  C     . LEU C 2  571  ? 21.194  -4.550  100.355 1.00 21.12  ? 571  LEU C C     1 
ATOM   8017  O  O     . LEU C 2  571  ? 21.667  -5.670  100.562 1.00 20.44  ? 571  LEU C O     1 
ATOM   8018  C  CB    . LEU C 2  571  ? 18.687  -4.517  100.404 1.00 17.23  ? 571  LEU C CB    1 
ATOM   8019  C  CG    . LEU C 2  571  ? 17.372  -4.542  99.622  1.00 15.77  ? 571  LEU C CG    1 
ATOM   8020  C  CD1   . LEU C 2  571  ? 16.200  -4.861  100.530 1.00 14.83  ? 571  LEU C CD1   1 
ATOM   8021  C  CD2   . LEU C 2  571  ? 17.152  -3.218  98.908  1.00 15.35  ? 571  LEU C CD2   1 
ATOM   8022  N  N     . ILE C 2  572  ? 21.748  -3.429  100.819 1.00 18.61  ? 572  ILE C N     1 
ATOM   8023  C  CA    . ILE C 2  572  ? 23.010  -3.449  101.565 1.00 17.65  ? 572  ILE C CA    1 
ATOM   8024  C  C     . ILE C 2  572  ? 22.931  -4.354  102.792 1.00 17.57  ? 572  ILE C C     1 
ATOM   8025  O  O     . ILE C 2  572  ? 23.877  -5.077  103.099 1.00 18.38  ? 572  ILE C O     1 
ATOM   8026  C  CB    . ILE C 2  572  ? 23.505  -2.034  101.962 1.00 15.46  ? 572  ILE C CB    1 
ATOM   8027  C  CG1   . ILE C 2  572  ? 22.433  -1.262  102.728 1.00 17.22  ? 572  ILE C CG1   1 
ATOM   8028  C  CG2   . ILE C 2  572  ? 23.926  -1.252  100.735 1.00 16.26  ? 572  ILE C CG2   1 
ATOM   8029  C  CD1   . ILE C 2  572  ? 22.872  0.120   103.143 1.00 14.74  ? 572  ILE C CD1   1 
ATOM   8030  N  N     . ARG C 2  573  ? 21.805  -4.302  103.494 1.00 17.49  ? 573  ARG C N     1 
ATOM   8031  C  CA    . ARG C 2  573  ? 21.481  -5.330  104.468 1.00 19.84  ? 573  ARG C CA    1 
ATOM   8032  C  C     . ARG C 2  573  ? 20.241  -6.078  104.012 1.00 21.95  ? 573  ARG C C     1 
ATOM   8033  O  O     . ARG C 2  573  ? 19.134  -5.551  104.075 1.00 31.54  ? 573  ARG C O     1 
ATOM   8034  C  CB    . ARG C 2  573  ? 21.250  -4.717  105.847 1.00 22.41  ? 573  ARG C CB    1 
ATOM   8035  C  CG    . ARG C 2  573  ? 20.594  -3.351  105.832 1.00 22.06  ? 573  ARG C CG    1 
ATOM   8036  C  CD    . ARG C 2  573  ? 20.356  -2.882  107.254 1.00 33.29  ? 573  ARG C CD    1 
ATOM   8037  N  NE    . ARG C 2  573  ? 21.497  -3.189  108.111 1.00 34.80  ? 573  ARG C NE    1 
ATOM   8038  C  CZ    . ARG C 2  573  ? 21.496  -3.067  109.434 1.00 33.44  ? 573  ARG C CZ    1 
ATOM   8039  N  NH1   . ARG C 2  573  ? 20.410  -2.642  110.065 1.00 29.73  ? 573  ARG C NH1   1 
ATOM   8040  N  NH2   . ARG C 2  573  ? 22.585  -3.372  110.125 1.00 47.94  ? 573  ARG C NH2   1 
ATOM   8041  N  N     . ALA C 2  574  ? 20.421  -7.321  103.582 1.00 19.56  ? 574  ALA C N     1 
ATOM   8042  C  CA    . ALA C 2  574  ? 19.316  -8.095  103.037 1.00 18.37  ? 574  ALA C CA    1 
ATOM   8043  C  C     . ALA C 2  574  ? 19.120  -9.360  103.842 1.00 20.45  ? 574  ALA C C     1 
ATOM   8044  O  O     . ALA C 2  574  ? 20.082  -9.958  104.317 1.00 28.65  ? 574  ALA C O     1 
ATOM   8045  C  CB    . ALA C 2  574  ? 19.566  -8.431  101.580 1.00 19.95  ? 574  ALA C CB    1 
ATOM   8046  N  N     . GLN C 2  575  ? 17.869  -9.768  103.994 1.00 17.27  ? 575  GLN C N     1 
ATOM   8047  C  CA    . GLN C 2  575  ? 17.562  -10.937 104.795 1.00 18.07  ? 575  GLN C CA    1 
ATOM   8048  C  C     . GLN C 2  575  ? 16.629  -11.892 104.064 1.00 18.49  ? 575  GLN C C     1 
ATOM   8049  O  O     . GLN C 2  575  ? 15.716  -11.465 103.355 1.00 14.11  ? 575  GLN C O     1 
ATOM   8050  C  CB    . GLN C 2  575  ? 16.970  -10.512 106.141 1.00 20.04  ? 575  GLN C CB    1 
ATOM   8051  C  CG    . GLN C 2  575  ? 15.855  -9.490  106.036 1.00 13.56  ? 575  GLN C CG    1 
ATOM   8052  C  CD    . GLN C 2  575  ? 15.630  -8.747  107.333 1.00 17.46  ? 575  GLN C CD    1 
ATOM   8053  O  OE1   . GLN C 2  575  ? 16.105  -7.628  107.503 1.00 19.57  ? 575  GLN C OE1   1 
ATOM   8054  N  NE2   . GLN C 2  575  ? 14.900  -9.363  108.255 1.00 23.30  ? 575  GLN C NE2   1 
ATOM   8055  N  N     . ALA C 2  576  ? 16.885  -13.187 104.217 1.00 17.45  ? 576  ALA C N     1 
ATOM   8056  C  CA    . ALA C 2  576  ? 16.016  -14.208 103.654 1.00 16.55  ? 576  ALA C CA    1 
ATOM   8057  C  C     . ALA C 2  576  ? 14.639  -14.106 104.304 1.00 25.03  ? 576  ALA C C     1 
ATOM   8058  O  O     . ALA C 2  576  ? 14.522  -13.663 105.452 1.00 23.31  ? 576  ALA C O     1 
ATOM   8059  C  CB    . ALA C 2  576  ? 16.610  -15.586 103.873 1.00 15.23  ? 576  ALA C CB    1 
ATOM   8060  N  N     . PRO C 2  577  ? 13.587  -14.496 103.567 1.00 18.00  ? 577  PRO C N     1 
ATOM   8061  C  CA    . PRO C 2  577  ? 12.222  -14.412 104.100 1.00 17.00  ? 577  PRO C CA    1 
ATOM   8062  C  C     . PRO C 2  577  ? 12.014  -15.262 105.359 1.00 19.48  ? 577  PRO C C     1 
ATOM   8063  O  O     . PRO C 2  577  ? 12.580  -16.350 105.460 1.00 21.86  ? 577  PRO C O     1 
ATOM   8064  C  CB    . PRO C 2  577  ? 11.360  -14.929 102.938 1.00 13.54  ? 577  PRO C CB    1 
ATOM   8065  C  CG    . PRO C 2  577  ? 12.298  -15.640 102.029 1.00 13.05  ? 577  PRO C CG    1 
ATOM   8066  C  CD    . PRO C 2  577  ? 13.605  -14.951 102.167 1.00 12.27  ? 577  PRO C CD    1 
ATOM   8067  N  N     . VAL C 2  578  ? 11.217  -14.764 106.305 1.00 17.85  ? 578  VAL C N     1 
ATOM   8068  C  CA    . VAL C 2  578  ? 10.937  -15.501 107.538 1.00 20.06  ? 578  VAL C CA    1 
ATOM   8069  C  C     . VAL C 2  578  ? 10.128  -16.762 107.267 1.00 17.71  ? 578  VAL C C     1 
ATOM   8070  O  O     . VAL C 2  578  ? 10.141  -17.700 108.060 1.00 18.01  ? 578  VAL C O     1 
ATOM   8071  C  CB    . VAL C 2  578  ? 10.187  -14.645 108.572 1.00 18.36  ? 578  VAL C CB    1 
ATOM   8072  C  CG1   . VAL C 2  578  ? 11.120  -13.610 109.185 1.00 20.55  ? 578  VAL C CG1   1 
ATOM   8073  C  CG2   . VAL C 2  578  ? 8.969   -13.991 107.937 1.00 23.82  ? 578  VAL C CG2   1 
ATOM   8074  N  N     . VAL C 2  579  ? 9.410   -16.774 106.152 1.00 16.49  ? 579  VAL C N     1 
ATOM   8075  C  CA    . VAL C 2  579  ? 8.770   -17.992 105.689 1.00 19.12  ? 579  VAL C CA    1 
ATOM   8076  C  C     . VAL C 2  579  ? 9.351   -18.326 104.324 1.00 17.17  ? 579  VAL C C     1 
ATOM   8077  O  O     . VAL C 2  579  ? 9.105   -17.616 103.351 1.00 16.83  ? 579  VAL C O     1 
ATOM   8078  C  CB    . VAL C 2  579  ? 7.243   -17.814 105.567 1.00 16.29  ? 579  VAL C CB    1 
ATOM   8079  C  CG1   . VAL C 2  579  ? 6.584   -19.118 105.140 1.00 14.25  ? 579  VAL C CG1   1 
ATOM   8080  C  CG2   . VAL C 2  579  ? 6.660   -17.327 106.879 1.00 17.51  ? 579  VAL C CG2   1 
ATOM   8081  N  N     . MET C 2  580  ? 10.132  -19.398 104.250 1.00 19.14  ? 580  MET C N     1 
ATOM   8082  C  CA    . MET C 2  580  ? 10.706  -19.803 102.976 1.00 19.41  ? 580  MET C CA    1 
ATOM   8083  C  C     . MET C 2  580  ? 9.993   -21.024 102.416 1.00 20.42  ? 580  MET C C     1 
ATOM   8084  O  O     . MET C 2  580  ? 9.145   -21.614 103.082 1.00 21.06  ? 580  MET C O     1 
ATOM   8085  C  CB    . MET C 2  580  ? 12.186  -20.118 103.169 1.00 18.42  ? 580  MET C CB    1 
ATOM   8086  C  CG    . MET C 2  580  ? 13.032  -18.905 103.490 1.00 19.32  ? 580  MET C CG    1 
ATOM   8087  S  SD    . MET C 2  580  ? 14.656  -19.350 104.123 1.00 28.90  ? 580  MET C SD    1 
ATOM   8088  C  CE    . MET C 2  580  ? 14.199  -20.217 105.621 1.00 24.02  ? 580  MET C CE    1 
ATOM   8089  N  N     . THR C 2  581  ? 10.355  -21.407 101.194 1.00 18.38  ? 581  THR C N     1 
ATOM   8090  C  CA    . THR C 2  581  ? 9.881   -22.653 100.599 1.00 20.86  ? 581  THR C CA    1 
ATOM   8091  C  C     . THR C 2  581  ? 10.906  -23.782 100.694 1.00 30.62  ? 581  THR C C     1 
ATOM   8092  O  O     . THR C 2  581  ? 10.635  -24.913 100.284 1.00 27.18  ? 581  THR C O     1 
ATOM   8093  C  CB    . THR C 2  581  ? 9.482   -22.454 99.134  1.00 21.13  ? 581  THR C CB    1 
ATOM   8094  O  OG1   . THR C 2  581  ? 10.611  -21.972 98.393  1.00 22.39  ? 581  THR C OG1   1 
ATOM   8095  C  CG2   . THR C 2  581  ? 8.344   -21.453 99.033  1.00 16.17  ? 581  THR C CG2   1 
ATOM   8096  N  N     . GLY C 2  582  ? 12.082  -23.467 101.229 1.00 33.37  ? 582  GLY C N     1 
ATOM   8097  C  CA    . GLY C 2  582  ? 13.167  -24.428 101.323 1.00 28.90  ? 582  GLY C CA    1 
ATOM   8098  C  C     . GLY C 2  582  ? 14.034  -24.500 100.079 1.00 31.58  ? 582  GLY C C     1 
ATOM   8099  O  O     . GLY C 2  582  ? 15.018  -25.241 100.041 1.00 39.49  ? 582  GLY C O     1 
ATOM   8100  N  N     . LEU C 2  583  ? 13.664  -23.741 99.052  1.00 27.61  ? 583  LEU C N     1 
ATOM   8101  C  CA    . LEU C 2  583  ? 14.413  -23.722 97.800  1.00 21.06  ? 583  LEU C CA    1 
ATOM   8102  C  C     . LEU C 2  583  ? 15.406  -22.560 97.746  1.00 19.93  ? 583  LEU C C     1 
ATOM   8103  O  O     . LEU C 2  583  ? 16.157  -22.416 96.786  1.00 19.00  ? 583  LEU C O     1 
ATOM   8104  C  CB    . LEU C 2  583  ? 13.447  -23.645 96.617  1.00 16.90  ? 583  LEU C CB    1 
ATOM   8105  C  CG    . LEU C 2  583  ? 14.006  -24.061 95.258  1.00 21.15  ? 583  LEU C CG    1 
ATOM   8106  C  CD1   . LEU C 2  583  ? 14.477  -25.502 95.322  1.00 44.77  ? 583  LEU C CD1   1 
ATOM   8107  C  CD2   . LEU C 2  583  ? 12.978  -23.877 94.160  1.00 14.33  ? 583  LEU C CD2   1 
ATOM   8108  N  N     . GLU C 2  584  ? 15.413  -21.740 98.791  1.00 22.39  ? 584  GLU C N     1 
ATOM   8109  C  CA    . GLU C 2  584  ? 16.166  -20.487 98.787  1.00 21.86  ? 584  GLU C CA    1 
ATOM   8110  C  C     . GLU C 2  584  ? 17.680  -20.669 98.746  1.00 27.19  ? 584  GLU C C     1 
ATOM   8111  O  O     . GLU C 2  584  ? 18.387  -19.859 98.159  1.00 28.29  ? 584  GLU C O     1 
ATOM   8112  C  CB    . GLU C 2  584  ? 15.783  -19.623 99.994  1.00 21.48  ? 584  GLU C CB    1 
ATOM   8113  C  CG    . GLU C 2  584  ? 14.375  -19.042 99.941  1.00 22.95  ? 584  GLU C CG    1 
ATOM   8114  C  CD    . GLU C 2  584  ? 13.289  -20.089 100.128 1.00 28.97  ? 584  GLU C CD    1 
ATOM   8115  O  OE1   . GLU C 2  584  ? 13.618  -21.241 100.485 1.00 28.61  ? 584  GLU C OE1   1 
ATOM   8116  O  OE2   . GLU C 2  584  ? 12.099  -19.758 99.932  1.00 27.28  ? 584  GLU C OE2   1 
ATOM   8117  N  N     . GLU C 2  585  ? 18.182  -21.726 99.372  1.00 31.30  ? 585  GLU C N     1 
ATOM   8118  C  CA    . GLU C 2  585  ? 19.625  -21.926 99.450  1.00 33.08  ? 585  GLU C CA    1 
ATOM   8119  C  C     . GLU C 2  585  ? 20.178  -22.480 98.140  1.00 31.07  ? 585  GLU C C     1 
ATOM   8120  O  O     . GLU C 2  585  ? 21.244  -22.065 97.663  1.00 29.46  ? 585  GLU C O     1 
ATOM   8121  C  CB    . GLU C 2  585  ? 19.969  -22.850 100.617 1.00 37.96  ? 585  GLU C CB    1 
ATOM   8122  C  CG    . GLU C 2  585  ? 21.447  -22.897 100.962 1.00 51.00  ? 585  GLU C CG    1 
ATOM   8123  C  CD    . GLU C 2  585  ? 21.692  -23.355 102.390 1.00 70.17  ? 585  GLU C CD    1 
ATOM   8124  O  OE1   . GLU C 2  585  ? 20.739  -23.311 103.201 1.00 50.84  ? 585  GLU C OE1   1 
ATOM   8125  O  OE2   . GLU C 2  585  ? 22.835  -23.757 102.702 1.00 90.54  ? 585  GLU C OE2   1 
ATOM   8126  N  N     . ARG C 2  586  ? 19.431  -23.413 97.560  1.00 24.29  ? 586  ARG C N     1 
ATOM   8127  C  CA    . ARG C 2  586  ? 19.824  -24.071 96.322  1.00 26.29  ? 586  ARG C CA    1 
ATOM   8128  C  C     . ARG C 2  586  ? 19.905  -23.082 95.157  1.00 27.28  ? 586  ARG C C     1 
ATOM   8129  O  O     . ARG C 2  586  ? 20.748  -23.222 94.266  1.00 30.42  ? 586  ARG C O     1 
ATOM   8130  C  CB    . ARG C 2  586  ? 18.840  -25.198 96.008  1.00 27.43  ? 586  ARG C CB    1 
ATOM   8131  C  CG    . ARG C 2  586  ? 19.186  -26.002 94.785  1.00 30.96  ? 586  ARG C CG    1 
ATOM   8132  C  CD    . ARG C 2  586  ? 20.460  -26.804 94.975  1.00 26.14  ? 586  ARG C CD    1 
ATOM   8133  N  NE    . ARG C 2  586  ? 20.892  -27.386 93.708  1.00 34.00  ? 586  ARG C NE    1 
ATOM   8134  C  CZ    . ARG C 2  586  ? 20.331  -28.452 93.145  1.00 36.23  ? 586  ARG C CZ    1 
ATOM   8135  N  NH1   . ARG C 2  586  ? 19.315  -29.066 93.739  1.00 36.04  ? 586  ARG C NH1   1 
ATOM   8136  N  NH2   . ARG C 2  586  ? 20.786  -28.907 91.985  1.00 37.00  ? 586  ARG C NH2   1 
ATOM   8137  N  N     . VAL C 2  587  ? 19.031  -22.079 95.173  1.00 28.37  ? 587  VAL C N     1 
ATOM   8138  C  CA    . VAL C 2  587  ? 19.033  -21.038 94.149  1.00 25.09  ? 587  VAL C CA    1 
ATOM   8139  C  C     . VAL C 2  587  ? 20.331  -20.234 94.203  1.00 24.96  ? 587  VAL C C     1 
ATOM   8140  O  O     . VAL C 2  587  ? 20.910  -19.913 93.167  1.00 25.97  ? 587  VAL C O     1 
ATOM   8141  C  CB    . VAL C 2  587  ? 17.808  -20.098 94.280  1.00 19.23  ? 587  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C 2  587  ? 17.969  -18.876 93.395  1.00 20.36  ? 587  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C 2  587  ? 16.529  -20.838 93.932  1.00 16.01  ? 587  VAL C CG2   1 
ATOM   8144  N  N     . VAL C 2  588  ? 20.792  -19.920 95.410  1.00 23.82  ? 588  VAL C N     1 
ATOM   8145  C  CA    . VAL C 2  588  ? 22.078  -19.252 95.575  1.00 24.91  ? 588  VAL C CA    1 
ATOM   8146  C  C     . VAL C 2  588  ? 23.203  -20.173 95.126  1.00 33.87  ? 588  VAL C C     1 
ATOM   8147  O  O     . VAL C 2  588  ? 24.147  -19.738 94.461  1.00 38.29  ? 588  VAL C O     1 
ATOM   8148  C  CB    . VAL C 2  588  ? 22.325  -18.826 97.034  1.00 20.89  ? 588  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C 2  588  ? 23.754  -18.348 97.217  1.00 27.35  ? 588  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C 2  588  ? 21.366  -17.735 97.427  1.00 23.43  ? 588  VAL C CG2   1 
ATOM   8151  N  N     . ARG C 2  589  ? 23.090  -21.449 95.485  1.00 29.14  ? 589  ARG C N     1 
ATOM   8152  C  CA    . ARG C 2  589  ? 24.110  -22.436 95.137  1.00 26.65  ? 589  ARG C CA    1 
ATOM   8153  C  C     . ARG C 2  589  ? 24.338  -22.529 93.626  1.00 30.51  ? 589  ARG C C     1 
ATOM   8154  O  O     . ARG C 2  589  ? 25.460  -22.364 93.151  1.00 34.32  ? 589  ARG C O     1 
ATOM   8155  C  CB    . ARG C 2  589  ? 23.734  -23.810 95.699  1.00 33.76  ? 589  ARG C CB    1 
ATOM   8156  C  CG    . ARG C 2  589  ? 24.747  -24.916 95.415  1.00 34.83  ? 589  ARG C CG    1 
ATOM   8157  C  CD    . ARG C 2  589  ? 26.092  -24.619 96.059  1.00 38.43  ? 589  ARG C CD    1 
ATOM   8158  N  NE    . ARG C 2  589  ? 26.000  -24.547 97.514  1.00 41.66  ? 589  ARG C NE    1 
ATOM   8159  C  CZ    . ARG C 2  589  ? 26.452  -25.483 98.339  1.00 38.50  ? 589  ARG C CZ    1 
ATOM   8160  N  NH1   . ARG C 2  589  ? 27.042  -26.566 97.854  1.00 49.77  ? 589  ARG C NH1   1 
ATOM   8161  N  NH2   . ARG C 2  589  ? 26.322  -25.334 99.651  1.00 32.55  ? 589  ARG C NH2   1 
ATOM   8162  N  N     . ASP C 2  590  ? 23.269  -22.781 92.876  1.00 31.38  ? 590  ASP C N     1 
ATOM   8163  C  CA    . ASP C 2  590  ? 23.374  -23.010 91.434  1.00 31.94  ? 590  ASP C CA    1 
ATOM   8164  C  C     . ASP C 2  590  ? 23.704  -21.759 90.617  1.00 34.25  ? 590  ASP C C     1 
ATOM   8165  O  O     . ASP C 2  590  ? 24.421  -21.833 89.618  1.00 47.37  ? 590  ASP C O     1 
ATOM   8166  C  CB    . ASP C 2  590  ? 22.096  -23.668 90.909  1.00 30.77  ? 590  ASP C CB    1 
ATOM   8167  C  CG    . ASP C 2  590  ? 22.022  -25.143 91.251  1.00 41.01  ? 590  ASP C CG    1 
ATOM   8168  O  OD1   . ASP C 2  590  ? 22.896  -25.623 92.007  1.00 50.61  ? 590  ASP C OD1   1 
ATOM   8169  O  OD2   . ASP C 2  590  ? 21.086  -25.822 90.779  1.00 42.62  ? 590  ASP C OD2   1 
ATOM   8170  N  N     . SER C 2  591  ? 23.182  -20.616 91.045  1.00 32.13  ? 591  SER C N     1 
ATOM   8171  C  CA    . SER C 2  591  ? 23.373  -19.358 90.328  1.00 36.20  ? 591  SER C CA    1 
ATOM   8172  C  C     . SER C 2  591  ? 24.808  -18.847 90.400  1.00 35.68  ? 591  SER C C     1 
ATOM   8173  O  O     . SER C 2  591  ? 25.151  -17.863 89.745  1.00 49.80  ? 591  SER C O     1 
ATOM   8174  C  CB    . SER C 2  591  ? 22.423  -18.287 90.861  1.00 38.85  ? 591  SER C CB    1 
ATOM   8175  O  OG    . SER C 2  591  ? 22.768  -17.925 92.188  1.00 45.22  ? 591  SER C OG    1 
ATOM   8176  N  N     . LEU C 2  592  ? 25.626  -19.498 91.222  1.00 36.30  ? 592  LEU C N     1 
ATOM   8177  C  CA    . LEU C 2  592  ? 27.024  -19.113 91.421  1.00 44.61  ? 592  LEU C CA    1 
ATOM   8178  C  C     . LEU C 2  592  ? 27.154  -17.712 92.004  1.00 47.73  ? 592  LEU C C     1 
ATOM   8179  O  O     . LEU C 2  592  ? 28.163  -17.032 91.805  1.00 48.95  ? 592  LEU C O     1 
ATOM   8180  C  CB    . LEU C 2  592  ? 27.833  -19.243 90.127  1.00 33.12  ? 592  LEU C CB    1 
ATOM   8181  C  CG    . LEU C 2  592  ? 28.473  -20.611 89.902  1.00 33.26  ? 592  LEU C CG    1 
ATOM   8182  C  CD1   . LEU C 2  592  ? 28.126  -21.147 88.523  1.00 34.35  ? 592  LEU C CD1   1 
ATOM   8183  C  CD2   . LEU C 2  592  ? 29.979  -20.518 90.089  1.00 40.04  ? 592  LEU C CD2   1 
ATOM   8184  N  N     . ALA C 2  593  ? 26.121  -17.289 92.724  1.00 41.97  ? 593  ALA C N     1 
ATOM   8185  C  CA    . ALA C 2  593  ? 26.141  -16.010 93.415  1.00 57.32  ? 593  ALA C CA    1 
ATOM   8186  C  C     . ALA C 2  593  ? 27.240  -15.995 94.470  1.00 58.52  ? 593  ALA C C     1 
ATOM   8187  O  O     . ALA C 2  593  ? 28.134  -15.143 94.448  1.00 45.55  ? 593  ALA C O     1 
ATOM   8188  C  CB    . ALA C 2  593  ? 24.790  -15.745 94.061  1.00 54.52  ? 593  ALA C CB    1 
ATOM   8189  N  N     . ALA C 2  594  ? 27.171  -16.963 95.379  1.00 50.93  ? 594  ALA C N     1 
ATOM   8190  C  CA    . ALA C 2  594  ? 28.067  -17.028 96.525  1.00 39.93  ? 594  ALA C CA    1 
ATOM   8191  C  C     . ALA C 2  594  ? 29.393  -17.705 96.199  1.00 41.40  ? 594  ALA C C     1 
ATOM   8192  O  O     . ALA C 2  594  ? 29.708  -17.965 95.040  1.00 47.98  ? 594  ALA C O     1 
ATOM   8193  C  CB    . ALA C 2  594  ? 27.385  -17.737 97.680  1.00 34.86  ? 594  ALA C CB    1 
ATOM   8194  N  N     . LEU C 2  595  ? 30.170  -17.970 97.242  1.00 44.46  ? 595  LEU C N     1 
ATOM   8195  C  CA    . LEU C 2  595  ? 31.454  -18.644 97.116  1.00 40.37  ? 595  LEU C CA    1 
ATOM   8196  C  C     . LEU C 2  595  ? 31.528  -19.734 98.180  1.00 44.02  ? 595  LEU C C     1 
ATOM   8197  O  O     . LEU C 2  595  ? 31.263  -19.477 99.354  1.00 43.87  ? 595  LEU C O     1 
ATOM   8198  C  CB    . LEU C 2  595  ? 32.588  -17.638 97.310  1.00 33.28  ? 595  LEU C CB    1 
ATOM   8199  C  CG    . LEU C 2  595  ? 34.023  -18.149 97.208  1.00 37.91  ? 595  LEU C CG    1 
ATOM   8200  C  CD1   . LEU C 2  595  ? 34.422  -18.353 95.755  1.00 50.56  ? 595  LEU C CD1   1 
ATOM   8201  C  CD2   . LEU C 2  595  ? 34.968  -17.185 97.900  1.00 41.79  ? 595  LEU C CD2   1 
ATOM   8202  N  N     . TYR C 2  596  ? 31.877  -20.952 97.777  1.00 47.34  ? 596  TYR C N     1 
ATOM   8203  C  CA    . TYR C 2  596  ? 31.880  -22.080 98.707  1.00 45.51  ? 596  TYR C CA    1 
ATOM   8204  C  C     . TYR C 2  596  ? 33.233  -22.783 98.780  1.00 53.73  ? 596  TYR C C     1 
ATOM   8205  O  O     . TYR C 2  596  ? 34.070  -22.632 97.890  1.00 66.85  ? 596  TYR C O     1 
ATOM   8206  C  CB    . TYR C 2  596  ? 30.793  -23.084 98.324  1.00 48.02  ? 596  TYR C CB    1 
ATOM   8207  C  CG    . TYR C 2  596  ? 29.401  -22.497 98.288  1.00 48.92  ? 596  TYR C CG    1 
ATOM   8208  C  CD1   . TYR C 2  596  ? 28.840  -22.054 97.095  1.00 45.97  ? 596  TYR C CD1   1 
ATOM   8209  C  CD2   . TYR C 2  596  ? 28.646  -22.382 99.448  1.00 47.88  ? 596  TYR C CD2   1 
ATOM   8210  C  CE1   . TYR C 2  596  ? 27.566  -21.518 97.059  1.00 37.31  ? 596  TYR C CE1   1 
ATOM   8211  C  CE2   . TYR C 2  596  ? 27.373  -21.847 99.422  1.00 40.83  ? 596  TYR C CE2   1 
ATOM   8212  C  CZ    . TYR C 2  596  ? 26.839  -21.417 98.227  1.00 37.46  ? 596  TYR C CZ    1 
ATOM   8213  O  OH    . TYR C 2  596  ? 25.573  -20.884 98.205  1.00 38.57  ? 596  TYR C OH    1 
ATOM   8214  N  N     . ALA C 2  597  ? 33.437  -23.554 99.845  1.00 50.29  ? 597  ALA C N     1 
ATOM   8215  C  CA    . ALA C 2  597  ? 34.673  -24.309 100.027 1.00 58.13  ? 597  ALA C CA    1 
ATOM   8216  C  C     . ALA C 2  597  ? 34.697  -25.554 99.142  1.00 66.98  ? 597  ALA C C     1 
ATOM   8217  O  O     . ALA C 2  597  ? 33.720  -26.303 99.083  1.00 62.14  ? 597  ALA C O     1 
ATOM   8218  C  CB    . ALA C 2  597  ? 34.851  -24.688 101.486 1.00 58.09  ? 597  ALA C CB    1 
ATOM   8219  N  N     . GLU C 2  598  ? 35.818  -25.768 98.455  1.00 68.54  ? 598  GLU C N     1 
ATOM   8220  C  CA    . GLU C 2  598  ? 35.953  -26.881 97.517  1.00 70.38  ? 598  GLU C CA    1 
ATOM   8221  C  C     . GLU C 2  598  ? 36.222  -28.210 98.218  1.00 76.64  ? 598  GLU C C     1 
ATOM   8222  O  O     . GLU C 2  598  ? 35.676  -29.245 97.836  1.00 80.79  ? 598  GLU C O     1 
ATOM   8223  C  CB    . GLU C 2  598  ? 37.062  -26.595 96.506  1.00 74.45  ? 598  GLU C CB    1 
ATOM   8224  C  CG    . GLU C 2  598  ? 37.297  -27.721 95.516  1.00 78.68  ? 598  GLU C CG    1 
ATOM   8225  C  CD    . GLU C 2  598  ? 38.525  -27.491 94.661  1.00 89.34  ? 598  GLU C CD    1 
ATOM   8226  O  OE1   . GLU C 2  598  ? 39.043  -26.354 94.660  1.00 91.01  ? 598  GLU C OE1   1 
ATOM   8227  O  OE2   . GLU C 2  598  ? 38.974  -28.449 93.997  1.00 88.17  ? 598  GLU C OE2   1 
ATOM   8228  N  N     . GLU C 2  599  ? 37.080  -28.174 99.232  1.00 73.30  ? 599  GLU C N     1 
ATOM   8229  C  CA    . GLU C 2  599  ? 37.403  -29.353 100.028 1.00 73.78  ? 599  GLU C CA    1 
ATOM   8230  C  C     . GLU C 2  599  ? 37.357  -28.988 101.505 1.00 70.40  ? 599  GLU C C     1 
ATOM   8231  O  O     . GLU C 2  599  ? 37.275  -27.810 101.848 1.00 75.71  ? 599  GLU C O     1 
ATOM   8232  C  CB    . GLU C 2  599  ? 38.789  -29.891 99.661  1.00 81.80  ? 599  GLU C CB    1 
ATOM   8233  C  CG    . GLU C 2  599  ? 38.896  -30.451 98.248  1.00 87.79  ? 599  GLU C CG    1 
ATOM   8234  C  CD    . GLU C 2  599  ? 38.106  -31.735 98.063  1.00 91.30  ? 599  GLU C CD    1 
ATOM   8235  O  OE1   . GLU C 2  599  ? 37.559  -31.944 96.958  1.00 85.40  ? 599  GLU C OE1   1 
ATOM   8236  O  OE2   . GLU C 2  599  ? 38.037  -32.538 99.018  1.00 93.59  ? 599  GLU C OE2   1 
ATOM   8237  N  N     . ASP C 2  600  ? 37.382  -29.991 102.379 1.00 68.03  ? 600  ASP C N     1 
ATOM   8238  C  CA    . ASP C 2  600  ? 37.488  -29.733 103.811 1.00 58.99  ? 600  ASP C CA    1 
ATOM   8239  C  C     . ASP C 2  600  ? 38.799  -29.000 104.059 1.00 64.57  ? 600  ASP C C     1 
ATOM   8240  O  O     . ASP C 2  600  ? 39.779  -29.226 103.350 1.00 73.87  ? 600  ASP C O     1 
ATOM   8241  C  CB    . ASP C 2  600  ? 37.469  -31.040 104.605 1.00 67.13  ? 600  ASP C CB    1 
ATOM   8242  C  CG    . ASP C 2  600  ? 36.284  -31.922 104.257 1.00 77.54  ? 600  ASP C CG    1 
ATOM   8243  O  OD1   . ASP C 2  600  ? 35.224  -31.786 104.906 1.00 68.52  ? 600  ASP C OD1   1 
ATOM   8244  O  OD2   . ASP C 2  600  ? 36.417  -32.759 103.339 1.00 85.66  ? 600  ASP C OD2   1 
ATOM   8245  N  N     . GLY C 2  601  ? 38.823  -28.114 105.048 1.00 57.37  ? 601  GLY C N     1 
ATOM   8246  C  CA    . GLY C 2  601  ? 40.035  -27.369 105.331 1.00 62.55  ? 601  GLY C CA    1 
ATOM   8247  C  C     . GLY C 2  601  ? 39.887  -26.274 106.366 1.00 61.55  ? 601  GLY C C     1 
ATOM   8248  O  O     . GLY C 2  601  ? 38.817  -26.081 106.941 1.00 61.12  ? 601  GLY C O     1 
ATOM   8249  N  N     . GLU C 2  602  ? 40.977  -25.552 106.602 1.00 62.70  ? 602  GLU C N     1 
ATOM   8250  C  CA    . GLU C 2  602  ? 40.987  -24.474 107.581 1.00 66.35  ? 602  GLU C CA    1 
ATOM   8251  C  C     . GLU C 2  602  ? 41.221  -23.135 106.893 1.00 66.76  ? 602  GLU C C     1 
ATOM   8252  O  O     . GLU C 2  602  ? 42.096  -23.011 106.034 1.00 65.50  ? 602  GLU C O     1 
ATOM   8253  C  CB    . GLU C 2  602  ? 42.062  -24.725 108.641 1.00 69.02  ? 602  GLU C CB    1 
ATOM   8254  C  CG    . GLU C 2  602  ? 42.088  -23.703 109.769 1.00 70.60  ? 602  GLU C CG    1 
ATOM   8255  C  CD    . GLU C 2  602  ? 43.140  -24.019 110.816 1.00 81.35  ? 602  GLU C CD    1 
ATOM   8256  O  OE1   . GLU C 2  602  ? 43.289  -23.229 111.774 1.00 78.46  ? 602  GLU C OE1   1 
ATOM   8257  O  OE2   . GLU C 2  602  ? 43.820  -25.058 110.682 1.00 93.27  ? 602  GLU C OE2   1 
ATOM   8258  N  N     . VAL C 2  603  ? 40.433  -22.134 107.271 1.00 64.19  ? 603  VAL C N     1 
ATOM   8259  C  CA    . VAL C 2  603  ? 40.544  -20.814 106.669 1.00 62.12  ? 603  VAL C CA    1 
ATOM   8260  C  C     . VAL C 2  603  ? 41.765  -20.082 107.212 1.00 58.91  ? 603  VAL C C     1 
ATOM   8261  O  O     . VAL C 2  603  ? 41.905  -19.890 108.420 1.00 54.94  ? 603  VAL C O     1 
ATOM   8262  C  CB    . VAL C 2  603  ? 39.280  -19.972 106.922 1.00 59.91  ? 603  VAL C CB    1 
ATOM   8263  C  CG1   . VAL C 2  603  ? 39.433  -18.590 106.310 1.00 57.41  ? 603  VAL C CG1   1 
ATOM   8264  C  CG2   . VAL C 2  603  ? 38.058  -20.675 106.355 1.00 57.91  ? 603  VAL C CG2   1 
ATOM   8265  N  N     . ALA C 2  604  ? 42.645  -19.677 106.305 1.00 54.47  ? 604  ALA C N     1 
ATOM   8266  C  CA    . ALA C 2  604  ? 43.884  -19.010 106.678 1.00 52.14  ? 604  ALA C CA    1 
ATOM   8267  C  C     . ALA C 2  604  ? 43.677  -17.514 106.856 1.00 49.51  ? 604  ALA C C     1 
ATOM   8268  O  O     . ALA C 2  604  ? 43.841  -16.980 107.953 1.00 53.92  ? 604  ALA C O     1 
ATOM   8269  C  CB    . ALA C 2  604  ? 44.962  -19.277 105.639 1.00 60.90  ? 604  ALA C CB    1 
ATOM   8270  N  N     . LYS C 2  605  ? 43.329  -16.836 105.769 1.00 50.27  ? 605  LYS C N     1 
ATOM   8271  C  CA    . LYS C 2  605  ? 43.202  -15.386 105.800 1.00 50.08  ? 605  LYS C CA    1 
ATOM   8272  C  C     . LYS C 2  605  ? 41.790  -14.910 105.449 1.00 50.29  ? 605  LYS C C     1 
ATOM   8273  O  O     . LYS C 2  605  ? 41.122  -15.496 104.598 1.00 55.35  ? 605  LYS C O     1 
ATOM   8274  C  CB    . LYS C 2  605  ? 44.231  -14.753 104.860 1.00 55.05  ? 605  LYS C CB    1 
ATOM   8275  C  CG    . LYS C 2  605  ? 45.629  -15.339 105.001 1.00 54.34  ? 605  LYS C CG    1 
ATOM   8276  C  CD    . LYS C 2  605  ? 46.657  -14.551 104.203 1.00 58.78  ? 605  LYS C CD    1 
ATOM   8277  C  CE    . LYS C 2  605  ? 47.000  -13.234 104.885 1.00 66.91  ? 605  LYS C CE    1 
ATOM   8278  N  NZ    . LYS C 2  605  ? 47.987  -12.437 104.100 1.00 64.06  ? 605  LYS C NZ    1 
ATOM   8279  N  N     . VAL C 2  606  ? 41.337  -13.852 106.117 1.00 48.33  ? 606  VAL C N     1 
ATOM   8280  C  CA    . VAL C 2  606  ? 40.028  -13.264 105.830 1.00 44.41  ? 606  VAL C CA    1 
ATOM   8281  C  C     . VAL C 2  606  ? 40.098  -11.746 105.677 1.00 45.47  ? 606  VAL C C     1 
ATOM   8282  O  O     . VAL C 2  606  ? 40.439  -11.022 106.612 1.00 43.73  ? 606  VAL C O     1 
ATOM   8283  C  CB    . VAL C 2  606  ? 38.984  -13.611 106.906 1.00 42.35  ? 606  VAL C CB    1 
ATOM   8284  C  CG1   . VAL C 2  606  ? 37.713  -12.806 106.683 1.00 40.96  ? 606  VAL C CG1   1 
ATOM   8285  C  CG2   . VAL C 2  606  ? 38.683  -15.097 106.889 1.00 45.75  ? 606  VAL C CG2   1 
ATOM   8286  N  N     . ASP C 2  607  ? 39.752  -11.276 104.486 1.00 53.25  ? 607  ASP C N     1 
ATOM   8287  C  CA    . ASP C 2  607  ? 39.846  -9.867  104.147 1.00 49.06  ? 607  ASP C CA    1 
ATOM   8288  C  C     . ASP C 2  607  ? 38.558  -9.465  103.442 1.00 46.67  ? 607  ASP C C     1 
ATOM   8289  O  O     . ASP C 2  607  ? 37.773  -10.323 103.038 1.00 47.04  ? 607  ASP C O     1 
ATOM   8290  C  CB    . ASP C 2  607  ? 41.044  -9.647  103.219 1.00 50.95  ? 607  ASP C CB    1 
ATOM   8291  C  CG    . ASP C 2  607  ? 41.476  -8.198  103.145 1.00 60.55  ? 607  ASP C CG    1 
ATOM   8292  O  OD1   . ASP C 2  607  ? 41.180  -7.439  104.092 1.00 61.49  ? 607  ASP C OD1   1 
ATOM   8293  O  OD2   . ASP C 2  607  ? 42.121  -7.822  102.140 1.00 55.55  ? 607  ASP C OD2   1 
ATOM   8294  N  N     . GLY C 2  608  ? 38.328  -8.165  103.305 1.00 44.41  ? 608  GLY C N     1 
ATOM   8295  C  CA    . GLY C 2  608  ? 37.210  -7.693  102.512 1.00 44.22  ? 608  GLY C CA    1 
ATOM   8296  C  C     . GLY C 2  608  ? 37.452  -8.016  101.050 1.00 45.47  ? 608  GLY C C     1 
ATOM   8297  O  O     . GLY C 2  608  ? 36.526  -8.341  100.306 1.00 46.89  ? 608  GLY C O     1 
ATOM   8298  N  N     . ASN C 2  609  ? 38.711  -7.909  100.641 1.00 40.42  ? 609  ASN C N     1 
ATOM   8299  C  CA    . ASN C 2  609  ? 39.114  -8.188  99.268  1.00 34.03  ? 609  ASN C CA    1 
ATOM   8300  C  C     . ASN C 2  609  ? 39.322  -9.663  98.915  1.00 35.42  ? 609  ASN C C     1 
ATOM   8301  O  O     . ASN C 2  609  ? 39.106  -10.060 97.772  1.00 37.04  ? 609  ASN C O     1 
ATOM   8302  C  CB    . ASN C 2  609  ? 40.354  -7.368  98.911  1.00 38.90  ? 609  ASN C CB    1 
ATOM   8303  C  CG    . ASN C 2  609  ? 40.105  -5.876  99.009  1.00 44.64  ? 609  ASN C CG    1 
ATOM   8304  O  OD1   . ASN C 2  609  ? 39.025  -5.394  98.669  1.00 44.03  ? 609  ASN C OD1   1 
ATOM   8305  N  ND2   . ASN C 2  609  ? 41.101  -5.137  99.484  1.00 50.00  ? 609  ASN C ND2   1 
ATOM   8306  N  N     . ARG C 2  610  ? 39.748  -10.473 99.880  1.00 39.72  ? 610  ARG C N     1 
ATOM   8307  C  CA    . ARG C 2  610  ? 40.109  -11.860 99.580  1.00 44.01  ? 610  ARG C CA    1 
ATOM   8308  C  C     . ARG C 2  610  ? 39.939  -12.828 100.745 1.00 42.96  ? 610  ARG C C     1 
ATOM   8309  O  O     . ARG C 2  610  ? 39.955  -12.428 101.905 1.00 46.10  ? 610  ARG C O     1 
ATOM   8310  C  CB    . ARG C 2  610  ? 41.552  -11.930 99.075  1.00 53.88  ? 610  ARG C CB    1 
ATOM   8311  C  CG    . ARG C 2  610  ? 42.565  -11.258 99.993  1.00 59.44  ? 610  ARG C CG    1 
ATOM   8312  C  CD    . ARG C 2  610  ? 43.331  -12.255 100.856 1.00 53.87  ? 610  ARG C CD    1 
ATOM   8313  N  NE    . ARG C 2  610  ? 44.401  -11.589 101.595 1.00 55.69  ? 610  ARG C NE    1 
ATOM   8314  C  CZ    . ARG C 2  610  ? 44.384  -11.362 102.904 1.00 55.55  ? 610  ARG C CZ    1 
ATOM   8315  N  NH1   . ARG C 2  610  ? 43.359  -11.770 103.638 1.00 55.52  ? 610  ARG C NH1   1 
ATOM   8316  N  NH2   . ARG C 2  610  ? 45.401  -10.739 103.482 1.00 56.62  ? 610  ARG C NH2   1 
ATOM   8317  N  N     . ILE C 2  611  ? 39.792  -14.109 100.418 1.00 45.43  ? 611  ILE C N     1 
ATOM   8318  C  CA    . ILE C 2  611  ? 39.728  -15.164 101.425 1.00 46.90  ? 611  ILE C CA    1 
ATOM   8319  C  C     . ILE C 2  611  ? 40.687  -16.297 101.075 1.00 50.21  ? 611  ILE C C     1 
ATOM   8320  O  O     . ILE C 2  611  ? 40.532  -16.952 100.044 1.00 48.60  ? 611  ILE C O     1 
ATOM   8321  C  CB    . ILE C 2  611  ? 38.305  -15.746 101.555 1.00 44.23  ? 611  ILE C CB    1 
ATOM   8322  C  CG1   . ILE C 2  611  ? 37.330  -14.684 102.061 1.00 43.02  ? 611  ILE C CG1   1 
ATOM   8323  C  CG2   . ILE C 2  611  ? 38.300  -16.945 102.491 1.00 41.86  ? 611  ILE C CG2   1 
ATOM   8324  C  CD1   . ILE C 2  611  ? 35.922  -15.201 102.254 1.00 39.82  ? 611  ILE C CD1   1 
ATOM   8325  N  N     . VAL C 2  612  ? 41.671  -16.532 101.940 1.00 56.17  ? 612  VAL C N     1 
ATOM   8326  C  CA    . VAL C 2  612  ? 42.661  -17.583 101.713 1.00 51.24  ? 612  VAL C CA    1 
ATOM   8327  C  C     . VAL C 2  612  ? 42.376  -18.819 102.560 1.00 49.88  ? 612  VAL C C     1 
ATOM   8328  O  O     . VAL C 2  612  ? 42.350  -18.749 103.789 1.00 52.31  ? 612  VAL C O     1 
ATOM   8329  C  CB    . VAL C 2  612  ? 44.085  -17.097 102.022 1.00 45.59  ? 612  VAL C CB    1 
ATOM   8330  C  CG1   . VAL C 2  612  ? 45.094  -18.160 101.631 1.00 44.94  ? 612  VAL C CG1   1 
ATOM   8331  C  CG2   . VAL C 2  612  ? 44.368  -15.792 101.294 1.00 50.91  ? 612  VAL C CG2   1 
ATOM   8332  N  N     . VAL C 2  613  ? 42.171  -19.949 101.891 1.00 53.95  ? 613  VAL C N     1 
ATOM   8333  C  CA    . VAL C 2  613  ? 41.819  -21.195 102.562 1.00 58.74  ? 613  VAL C CA    1 
ATOM   8334  C  C     . VAL C 2  613  ? 42.852  -22.288 102.312 1.00 70.00  ? 613  VAL C C     1 
ATOM   8335  O  O     . VAL C 2  613  ? 43.176  -22.601 101.165 1.00 76.73  ? 613  VAL C O     1 
ATOM   8336  C  CB    . VAL C 2  613  ? 40.441  -21.708 102.096 1.00 63.47  ? 613  VAL C CB    1 
ATOM   8337  C  CG1   . VAL C 2  613  ? 40.164  -23.093 102.659 1.00 67.99  ? 613  VAL C CG1   1 
ATOM   8338  C  CG2   . VAL C 2  613  ? 39.348  -20.736 102.500 1.00 72.44  ? 613  VAL C CG2   1 
ATOM   8339  N  N     . ARG C 2  614  ? 43.369  -22.863 103.393 1.00 66.84  ? 614  ARG C N     1 
ATOM   8340  C  CA    . ARG C 2  614  ? 44.265  -24.006 103.294 1.00 71.00  ? 614  ARG C CA    1 
ATOM   8341  C  C     . ARG C 2  614  ? 43.464  -25.295 103.420 1.00 70.41  ? 614  ARG C C     1 
ATOM   8342  O  O     . ARG C 2  614  ? 42.714  -25.474 104.380 1.00 66.07  ? 614  ARG C O     1 
ATOM   8343  C  CB    . ARG C 2  614  ? 45.328  -23.948 104.390 1.00 81.30  ? 614  ARG C CB    1 
ATOM   8344  C  CG    . ARG C 2  614  ? 46.271  -25.138 104.397 1.00 80.30  ? 614  ARG C CG    1 
ATOM   8345  C  CD    . ARG C 2  614  ? 47.235  -25.066 105.567 1.00 77.51  ? 614  ARG C CD    1 
ATOM   8346  N  NE    . ARG C 2  614  ? 47.920  -23.778 105.627 1.00 92.07  ? 614  ARG C NE    1 
ATOM   8347  C  CZ    . ARG C 2  614  ? 48.978  -23.459 104.889 1.00 92.96  ? 614  ARG C CZ    1 
ATOM   8348  N  NH1   . ARG C 2  614  ? 49.536  -22.262 105.012 1.00 76.69  ? 614  ARG C NH1   1 
ATOM   8349  N  NH2   . ARG C 2  614  ? 49.476  -24.334 104.025 1.00 89.12  ? 614  ARG C NH2   1 
ATOM   8350  N  N     . TYR C 2  615  ? 43.621  -26.191 102.451 1.00 74.36  ? 615  TYR C N     1 
ATOM   8351  C  CA    . TYR C 2  615  ? 42.883  -27.451 102.464 1.00 78.98  ? 615  TYR C CA    1 
ATOM   8352  C  C     . TYR C 2  615  ? 43.651  -28.560 103.185 1.00 87.09  ? 615  TYR C C     1 
ATOM   8353  O  O     . TYR C 2  615  ? 44.769  -28.346 103.657 1.00 91.66  ? 615  TYR C O     1 
ATOM   8354  C  CB    . TYR C 2  615  ? 42.497  -27.874 101.041 1.00 81.89  ? 615  TYR C CB    1 
ATOM   8355  C  CG    . TYR C 2  615  ? 41.459  -26.970 100.407 1.00 82.65  ? 615  TYR C CG    1 
ATOM   8356  C  CD1   . TYR C 2  615  ? 41.751  -26.223 99.272  1.00 80.66  ? 615  TYR C CD1   1 
ATOM   8357  C  CD2   . TYR C 2  615  ? 40.189  -26.850 100.958 1.00 80.16  ? 615  TYR C CD2   1 
ATOM   8358  C  CE1   . TYR C 2  615  ? 40.800  -25.392 98.699  1.00 81.13  ? 615  TYR C CE1   1 
ATOM   8359  C  CE2   . TYR C 2  615  ? 39.237  -26.021 100.393 1.00 75.40  ? 615  TYR C CE2   1 
ATOM   8360  C  CZ    . TYR C 2  615  ? 39.545  -25.296 99.265  1.00 79.06  ? 615  TYR C CZ    1 
ATOM   8361  O  OH    . TYR C 2  615  ? 38.591  -24.475 98.709  1.00 67.51  ? 615  TYR C OH    1 
ATOM   8362  N  N     . GLU C 2  616  ? 43.045  -29.741 103.265 1.00 89.93  ? 616  GLU C N     1 
ATOM   8363  C  CA    . GLU C 2  616  ? 43.595  -30.840 104.058 1.00 89.02  ? 616  GLU C CA    1 
ATOM   8364  C  C     . GLU C 2  616  ? 44.828  -31.476 103.422 1.00 97.22  ? 616  GLU C C     1 
ATOM   8365  O  O     . GLU C 2  616  ? 45.620  -32.126 104.104 1.00 103.34 ? 616  GLU C O     1 
ATOM   8366  C  CB    . GLU C 2  616  ? 42.525  -31.906 104.314 1.00 82.93  ? 616  GLU C CB    1 
ATOM   8367  C  CG    . GLU C 2  616  ? 41.964  -32.542 103.051 1.00 95.90  ? 616  GLU C CG    1 
ATOM   8368  C  CD    . GLU C 2  616  ? 40.805  -33.481 103.335 1.00 101.55 ? 616  GLU C CD    1 
ATOM   8369  O  OE1   . GLU C 2  616  ? 40.275  -34.080 102.374 1.00 112.38 ? 616  GLU C OE1   1 
ATOM   8370  O  OE2   . GLU C 2  616  ? 40.423  -33.618 104.517 1.00 88.47  ? 616  GLU C OE2   1 
ATOM   8371  N  N     . ASP C 2  617  ? 44.989  -31.280 102.118 1.00 98.19  ? 617  ASP C N     1 
ATOM   8372  C  CA    . ASP C 2  617  ? 46.110  -31.867 101.389 1.00 94.78  ? 617  ASP C CA    1 
ATOM   8373  C  C     . ASP C 2  617  ? 47.338  -30.957 101.367 1.00 90.90  ? 617  ASP C C     1 
ATOM   8374  O  O     . ASP C 2  617  ? 48.343  -31.273 100.732 1.00 87.24  ? 617  ASP C O     1 
ATOM   8375  C  CB    . ASP C 2  617  ? 45.687  -32.258 99.969  1.00 88.32  ? 617  ASP C CB    1 
ATOM   8376  C  CG    . ASP C 2  617  ? 44.669  -31.303 99.378  1.00 96.36  ? 617  ASP C CG    1 
ATOM   8377  O  OD1   . ASP C 2  617  ? 44.921  -30.080 99.384  1.00 99.76  ? 617  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP C 2  617  ? 43.609  -31.776 98.913  1.00 95.08  ? 617  ASP C OD2   1 
ATOM   8379  N  N     . GLY C 2  618  ? 47.245  -29.825 102.061 1.00 90.58  ? 618  GLY C N     1 
ATOM   8380  C  CA    . GLY C 2  618  ? 48.358  -28.898 102.174 1.00 94.04  ? 618  GLY C CA    1 
ATOM   8381  C  C     . GLY C 2  618  ? 48.278  -27.762 101.173 1.00 93.94  ? 618  GLY C C     1 
ATOM   8382  O  O     . GLY C 2  618  ? 48.898  -26.712 101.356 1.00 88.91  ? 618  GLY C O     1 
ATOM   8383  N  N     . ARG C 2  619  ? 47.507  -27.978 100.113 1.00 84.59  ? 619  ARG C N     1 
ATOM   8384  C  CA    . ARG C 2  619  ? 47.321  -26.979 99.068  1.00 79.61  ? 619  ARG C CA    1 
ATOM   8385  C  C     . ARG C 2  619  ? 46.613  -25.742 99.609  1.00 77.98  ? 619  ARG C C     1 
ATOM   8386  O  O     . ARG C 2  619  ? 45.550  -25.840 100.221 1.00 82.37  ? 619  ARG C O     1 
ATOM   8387  C  CB    . ARG C 2  619  ? 46.520  -27.576 97.911  1.00 83.15  ? 619  ARG C CB    1 
ATOM   8388  C  CG    . ARG C 2  619  ? 46.084  -26.572 96.862  1.00 78.83  ? 619  ARG C CG    1 
ATOM   8389  C  CD    . ARG C 2  619  ? 44.990  -27.162 95.993  1.00 76.36  ? 619  ARG C CD    1 
ATOM   8390  N  NE    . ARG C 2  619  ? 43.936  -27.759 96.807  1.00 76.92  ? 619  ARG C NE    1 
ATOM   8391  C  CZ    . ARG C 2  619  ? 42.797  -28.241 96.322  1.00 82.81  ? 619  ARG C CZ    1 
ATOM   8392  N  NH1   . ARG C 2  619  ? 42.557  -28.194 95.019  1.00 81.34  ? 619  ARG C NH1   1 
ATOM   8393  N  NH2   . ARG C 2  619  ? 41.897  -28.768 97.141  1.00 84.33  ? 619  ARG C NH2   1 
ATOM   8394  N  N     . LEU C 2  620  ? 47.209  -24.579 99.376  1.00 82.01  ? 620  LEU C N     1 
ATOM   8395  C  CA    . LEU C 2  620  ? 46.647  -23.319 99.846  1.00 81.50  ? 620  LEU C CA    1 
ATOM   8396  C  C     . LEU C 2  620  ? 46.028  -22.541 98.686  1.00 76.37  ? 620  LEU C C     1 
ATOM   8397  O  O     . LEU C 2  620  ? 46.738  -22.056 97.804  1.00 74.07  ? 620  LEU C O     1 
ATOM   8398  C  CB    . LEU C 2  620  ? 47.730  -22.492 100.543 1.00 78.06  ? 620  LEU C CB    1 
ATOM   8399  C  CG    . LEU C 2  620  ? 47.371  -21.101 101.063 1.00 68.68  ? 620  LEU C CG    1 
ATOM   8400  C  CD1   . LEU C 2  620  ? 47.919  -20.911 102.464 1.00 59.95  ? 620  LEU C CD1   1 
ATOM   8401  C  CD2   . LEU C 2  620  ? 47.918  -20.034 100.129 1.00 72.24  ? 620  LEU C CD2   1 
ATOM   8402  N  N     . VAL C 2  621  ? 44.703  -22.426 98.694  1.00 72.85  ? 621  VAL C N     1 
ATOM   8403  C  CA    . VAL C 2  621  ? 43.979  -21.776 97.604  1.00 68.45  ? 621  VAL C CA    1 
ATOM   8404  C  C     . VAL C 2  621  ? 43.490  -20.388 98.014  1.00 58.00  ? 621  VAL C C     1 
ATOM   8405  O  O     . VAL C 2  621  ? 43.056  -20.182 99.146  1.00 55.74  ? 621  VAL C O     1 
ATOM   8406  C  CB    . VAL C 2  621  ? 42.789  -22.641 97.129  1.00 61.00  ? 621  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C 2  621  ? 42.050  -21.969 95.982  1.00 59.16  ? 621  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C 2  621  ? 43.277  -24.013 96.704  1.00 69.81  ? 621  VAL C CG2   1 
ATOM   8409  N  N     . GLU C 2  622  ? 43.573  -19.435 97.090  1.00 48.11  ? 622  GLU C N     1 
ATOM   8410  C  CA    . GLU C 2  622  ? 43.150  -18.069 97.369  1.00 52.05  ? 622  GLU C CA    1 
ATOM   8411  C  C     . GLU C 2  622  ? 41.945  -17.667 96.523  1.00 59.88  ? 622  GLU C C     1 
ATOM   8412  O  O     . GLU C 2  622  ? 41.935  -17.849 95.304  1.00 56.58  ? 622  GLU C O     1 
ATOM   8413  C  CB    . GLU C 2  622  ? 44.306  -17.095 97.142  1.00 48.97  ? 622  GLU C CB    1 
ATOM   8414  C  CG    . GLU C 2  622  ? 43.995  -15.665 97.536  1.00 47.34  ? 622  GLU C CG    1 
ATOM   8415  C  CD    . GLU C 2  622  ? 45.222  -14.778 97.494  1.00 69.24  ? 622  GLU C CD    1 
ATOM   8416  O  OE1   . GLU C 2  622  ? 46.309  -15.284 97.142  1.00 69.71  ? 622  GLU C OE1   1 
ATOM   8417  O  OE2   . GLU C 2  622  ? 45.099  -13.577 97.817  1.00 72.14  ? 622  GLU C OE2   1 
ATOM   8418  N  N     . TYR C 2  623  ? 40.931  -17.117 97.182  1.00 60.44  ? 623  TYR C N     1 
ATOM   8419  C  CA    . TYR C 2  623  ? 39.708  -16.709 96.508  1.00 43.21  ? 623  TYR C CA    1 
ATOM   8420  C  C     . TYR C 2  623  ? 39.544  -15.194 96.531  1.00 42.76  ? 623  TYR C C     1 
ATOM   8421  O  O     . TYR C 2  623  ? 39.281  -14.607 97.584  1.00 39.43  ? 623  TYR C O     1 
ATOM   8422  C  CB    . TYR C 2  623  ? 38.497  -17.365 97.171  1.00 44.36  ? 623  TYR C CB    1 
ATOM   8423  C  CG    . TYR C 2  623  ? 38.506  -18.877 97.135  1.00 53.63  ? 623  TYR C CG    1 
ATOM   8424  C  CD1   . TYR C 2  623  ? 38.314  -19.563 95.942  1.00 53.97  ? 623  TYR C CD1   1 
ATOM   8425  C  CD2   . TYR C 2  623  ? 38.687  -19.619 98.295  1.00 53.51  ? 623  TYR C CD2   1 
ATOM   8426  C  CE1   . TYR C 2  623  ? 38.316  -20.943 95.903  1.00 50.73  ? 623  TYR C CE1   1 
ATOM   8427  C  CE2   . TYR C 2  623  ? 38.688  -21.002 98.265  1.00 55.81  ? 623  TYR C CE2   1 
ATOM   8428  C  CZ    . TYR C 2  623  ? 38.502  -21.658 97.066  1.00 57.45  ? 623  TYR C CZ    1 
ATOM   8429  O  OH    . TYR C 2  623  ? 38.503  -23.034 97.028  1.00 70.07  ? 623  TYR C OH    1 
ATOM   8430  N  N     . PRO C 2  624  ? 39.713  -14.554 95.366  1.00 46.07  ? 624  PRO C N     1 
ATOM   8431  C  CA    . PRO C 2  624  ? 39.438  -13.121 95.231  1.00 46.70  ? 624  PRO C CA    1 
ATOM   8432  C  C     . PRO C 2  624  ? 37.942  -12.863 95.319  1.00 44.17  ? 624  PRO C C     1 
ATOM   8433  O  O     . PRO C 2  624  ? 37.159  -13.581 94.695  1.00 41.95  ? 624  PRO C O     1 
ATOM   8434  C  CB    . PRO C 2  624  ? 39.938  -12.796 93.818  1.00 38.20  ? 624  PRO C CB    1 
ATOM   8435  C  CG    . PRO C 2  624  ? 40.824  -13.936 93.436  1.00 41.32  ? 624  PRO C CG    1 
ATOM   8436  C  CD    . PRO C 2  624  ? 40.244  -15.130 94.122  1.00 48.47  ? 624  PRO C CD    1 
ATOM   8437  N  N     . LEU C 2  625  ? 37.549  -11.846 96.077  1.00 41.23  ? 625  LEU C N     1 
ATOM   8438  C  CA    . LEU C 2  625  ? 36.144  -11.482 96.175  1.00 38.50  ? 625  LEU C CA    1 
ATOM   8439  C  C     . LEU C 2  625  ? 35.819  -10.331 95.233  1.00 36.83  ? 625  LEU C C     1 
ATOM   8440  O  O     . LEU C 2  625  ? 36.549  -9.342  95.167  1.00 33.89  ? 625  LEU C O     1 
ATOM   8441  C  CB    . LEU C 2  625  ? 35.775  -11.112 97.614  1.00 36.07  ? 625  LEU C CB    1 
ATOM   8442  C  CG    . LEU C 2  625  ? 35.910  -12.230 98.651  1.00 40.69  ? 625  LEU C CG    1 
ATOM   8443  C  CD1   . LEU C 2  625  ? 35.381  -11.785 100.008 1.00 35.55  ? 625  LEU C CD1   1 
ATOM   8444  C  CD2   . LEU C 2  625  ? 35.203  -13.496 98.181  1.00 35.90  ? 625  LEU C CD2   1 
ATOM   8445  N  N     . ARG C 2  626  ? 34.715  -10.466 94.508  1.00 36.37  ? 626  ARG C N     1 
ATOM   8446  C  CA    . ARG C 2  626  ? 34.255  -9.403  93.632  1.00 37.67  ? 626  ARG C CA    1 
ATOM   8447  C  C     . ARG C 2  626  ? 33.566  -8.357  94.498  1.00 43.55  ? 626  ARG C C     1 
ATOM   8448  O  O     . ARG C 2  626  ? 32.589  -8.656  95.182  1.00 43.98  ? 626  ARG C O     1 
ATOM   8449  C  CB    . ARG C 2  626  ? 33.282  -9.969  92.595  1.00 40.60  ? 626  ARG C CB    1 
ATOM   8450  C  CG    . ARG C 2  626  ? 32.549  -8.922  91.776  1.00 49.34  ? 626  ARG C CG    1 
ATOM   8451  C  CD    . ARG C 2  626  ? 31.628  -9.556  90.737  1.00 57.14  ? 626  ARG C CD    1 
ATOM   8452  N  NE    . ARG C 2  626  ? 32.368  -10.295 89.715  1.00 72.96  ? 626  ARG C NE    1 
ATOM   8453  C  CZ    . ARG C 2  626  ? 32.416  -11.621 89.635  1.00 76.34  ? 626  ARG C CZ    1 
ATOM   8454  N  NH1   . ARG C 2  626  ? 33.119  -12.203 88.671  1.00 69.81  ? 626  ARG C NH1   1 
ATOM   8455  N  NH2   . ARG C 2  626  ? 31.759  -12.366 90.514  1.00 67.71  ? 626  ARG C NH2   1 
ATOM   8456  N  N     . ARG C 2  627  ? 34.079  -7.130  94.467  1.00 46.11  ? 627  ARG C N     1 
ATOM   8457  C  CA    . ARG C 2  627  ? 33.587  -6.074  95.349  1.00 39.92  ? 627  ARG C CA    1 
ATOM   8458  C  C     . ARG C 2  627  ? 33.046  -4.866  94.592  1.00 38.00  ? 627  ARG C C     1 
ATOM   8459  O  O     . ARG C 2  627  ? 33.786  -4.184  93.886  1.00 43.46  ? 627  ARG C O     1 
ATOM   8460  C  CB    . ARG C 2  627  ? 34.687  -5.632  96.316  1.00 36.35  ? 627  ARG C CB    1 
ATOM   8461  C  CG    . ARG C 2  627  ? 34.809  -6.500  97.554  1.00 44.22  ? 627  ARG C CG    1 
ATOM   8462  C  CD    . ARG C 2  627  ? 33.580  -6.360  98.431  1.00 41.81  ? 627  ARG C CD    1 
ATOM   8463  N  NE    . ARG C 2  627  ? 33.778  -6.937  99.757  1.00 39.78  ? 627  ARG C NE    1 
ATOM   8464  C  CZ    . ARG C 2  627  ? 32.929  -6.780  100.768 1.00 47.33  ? 627  ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C 2  627  ? 31.827  -6.061  100.600 1.00 46.37  ? 627  ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C 2  627  ? 33.180  -7.337  101.946 1.00 45.44  ? 627  ARG C NH2   1 
ATOM   8467  N  N     . PHE C 2  628  ? 31.750  -4.615  94.755  1.00 37.24  ? 628  PHE C N     1 
ATOM   8468  C  CA    . PHE C 2  628  ? 31.074  -3.469  94.151  1.00 39.43  ? 628  PHE C CA    1 
ATOM   8469  C  C     . PHE C 2  628  ? 31.234  -3.388  92.632  1.00 43.97  ? 628  PHE C C     1 
ATOM   8470  O  O     . PHE C 2  628  ? 31.646  -2.358  92.098  1.00 47.44  ? 628  PHE C O     1 
ATOM   8471  C  CB    . PHE C 2  628  ? 31.531  -2.163  94.807  1.00 36.61  ? 628  PHE C CB    1 
ATOM   8472  C  CG    . PHE C 2  628  ? 31.335  -2.133  96.296  1.00 42.84  ? 628  PHE C CG    1 
ATOM   8473  C  CD1   . PHE C 2  628  ? 30.141  -1.699  96.842  1.00 35.81  ? 628  PHE C CD1   1 
ATOM   8474  C  CD2   . PHE C 2  628  ? 32.348  -2.541  97.150  1.00 51.22  ? 628  PHE C CD2   1 
ATOM   8475  C  CE1   . PHE C 2  628  ? 29.960  -1.673  98.211  1.00 39.36  ? 628  PHE C CE1   1 
ATOM   8476  C  CE2   . PHE C 2  628  ? 32.171  -2.517  98.521  1.00 43.21  ? 628  PHE C CE2   1 
ATOM   8477  C  CZ    . PHE C 2  628  ? 30.976  -2.082  99.051  1.00 40.01  ? 628  PHE C CZ    1 
ATOM   8478  N  N     . TYR C 2  629  ? 30.907  -4.476  91.941  1.00 37.72  ? 629  TYR C N     1 
ATOM   8479  C  CA    . TYR C 2  629  ? 30.948  -4.496  90.482  1.00 38.77  ? 629  TYR C CA    1 
ATOM   8480  C  C     . TYR C 2  629  ? 29.579  -4.139  89.912  1.00 36.01  ? 629  TYR C C     1 
ATOM   8481  O  O     . TYR C 2  629  ? 28.547  -4.504  90.476  1.00 31.68  ? 629  TYR C O     1 
ATOM   8482  C  CB    . TYR C 2  629  ? 31.402  -5.861  89.950  1.00 51.82  ? 629  TYR C CB    1 
ATOM   8483  C  CG    . TYR C 2  629  ? 32.907  -6.041  89.859  1.00 62.72  ? 629  TYR C CG    1 
ATOM   8484  C  CD1   . TYR C 2  629  ? 33.461  -6.977  88.992  1.00 66.89  ? 629  TYR C CD1   1 
ATOM   8485  C  CD2   . TYR C 2  629  ? 33.771  -5.285  90.643  1.00 59.79  ? 629  TYR C CD2   1 
ATOM   8486  C  CE1   . TYR C 2  629  ? 34.833  -7.151  88.904  1.00 63.93  ? 629  TYR C CE1   1 
ATOM   8487  C  CE2   . TYR C 2  629  ? 35.146  -5.453  90.562  1.00 65.64  ? 629  TYR C CE2   1 
ATOM   8488  C  CZ    . TYR C 2  629  ? 35.670  -6.387  89.690  1.00 70.56  ? 629  TYR C CZ    1 
ATOM   8489  O  OH    . TYR C 2  629  ? 37.034  -6.558  89.605  1.00 67.84  ? 629  TYR C OH    1 
ATOM   8490  N  N     . ARG C 2  630  ? 29.581  -3.412  88.799  1.00 36.19  ? 630  ARG C N     1 
ATOM   8491  C  CA    . ARG C 2  630  ? 28.347  -2.957  88.168  1.00 24.97  ? 630  ARG C CA    1 
ATOM   8492  C  C     . ARG C 2  630  ? 27.725  -4.039  87.288  1.00 23.28  ? 630  ARG C C     1 
ATOM   8493  O  O     . ARG C 2  630  ? 28.349  -4.514  86.342  1.00 25.43  ? 630  ARG C O     1 
ATOM   8494  C  CB    . ARG C 2  630  ? 28.629  -1.712  87.328  1.00 22.65  ? 630  ARG C CB    1 
ATOM   8495  C  CG    . ARG C 2  630  ? 27.405  -1.115  86.675  1.00 23.50  ? 630  ARG C CG    1 
ATOM   8496  C  CD    . ARG C 2  630  ? 27.782  -0.067  85.645  1.00 20.52  ? 630  ARG C CD    1 
ATOM   8497  N  NE    . ARG C 2  630  ? 26.599  0.617   85.138  1.00 21.41  ? 630  ARG C NE    1 
ATOM   8498  C  CZ    . ARG C 2  630  ? 25.827  0.149   84.164  1.00 26.92  ? 630  ARG C CZ    1 
ATOM   8499  N  NH1   . ARG C 2  630  ? 26.116  -1.009  83.584  1.00 27.98  ? 630  ARG C NH1   1 
ATOM   8500  N  NH2   . ARG C 2  630  ? 24.765  0.838   83.770  1.00 35.59  ? 630  ARG C NH2   1 
ATOM   8501  N  N     . SER C 2  631  ? 26.488  -4.417  87.590  1.00 21.50  ? 631  SER C N     1 
ATOM   8502  C  CA    . SER C 2  631  ? 25.803  -5.429  86.797  1.00 24.20  ? 631  SER C CA    1 
ATOM   8503  C  C     . SER C 2  631  ? 25.197  -4.795  85.559  1.00 24.19  ? 631  SER C C     1 
ATOM   8504  O  O     . SER C 2  631  ? 25.280  -3.580  85.375  1.00 25.12  ? 631  SER C O     1 
ATOM   8505  C  CB    . SER C 2  631  ? 24.694  -6.089  87.608  1.00 26.41  ? 631  SER C CB    1 
ATOM   8506  O  OG    . SER C 2  631  ? 23.546  -5.260  87.654  1.00 24.92  ? 631  SER C OG    1 
ATOM   8507  N  N     . ASN C 2  632  ? 24.565  -5.616  84.726  1.00 22.91  ? 632  ASN C N     1 
ATOM   8508  C  CA    . ASN C 2  632  ? 23.964  -5.128  83.489  1.00 26.55  ? 632  ASN C CA    1 
ATOM   8509  C  C     . ASN C 2  632  ? 22.853  -4.120  83.751  1.00 22.97  ? 632  ASN C C     1 
ATOM   8510  O  O     . ASN C 2  632  ? 22.635  -3.200  82.965  1.00 25.31  ? 632  ASN C O     1 
ATOM   8511  C  CB    . ASN C 2  632  ? 23.434  -6.288  82.642  1.00 29.23  ? 632  ASN C CB    1 
ATOM   8512  C  CG    . ASN C 2  632  ? 24.513  -6.937  81.794  1.00 25.48  ? 632  ASN C CG    1 
ATOM   8513  O  OD1   . ASN C 2  632  ? 25.561  -6.342  81.541  1.00 25.71  ? 632  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN C 2  632  ? 24.255  -8.159  81.340  1.00 24.95  ? 632  ASN C ND2   1 
ATOM   8515  N  N     . GLN C 2  633  ? 22.158  -4.299  84.868  1.00 21.34  ? 633  GLN C N     1 
ATOM   8516  C  CA    . GLN C 2  633  ? 21.078  -3.402  85.249  1.00 17.72  ? 633  GLN C CA    1 
ATOM   8517  C  C     . GLN C 2  633  ? 21.576  -2.312  86.188  1.00 17.80  ? 633  GLN C C     1 
ATOM   8518  O  O     . GLN C 2  633  ? 20.799  -1.479  86.650  1.00 19.62  ? 633  GLN C O     1 
ATOM   8519  C  CB    . GLN C 2  633  ? 19.932  -4.186  85.890  1.00 17.88  ? 633  GLN C CB    1 
ATOM   8520  C  CG    . GLN C 2  633  ? 19.068  -4.949  84.892  1.00 23.29  ? 633  GLN C CG    1 
ATOM   8521  C  CD    . GLN C 2  633  ? 19.828  -6.035  84.150  1.00 20.13  ? 633  GLN C CD    1 
ATOM   8522  O  OE1   . GLN C 2  633  ? 20.840  -6.541  84.631  1.00 20.35  ? 633  GLN C OE1   1 
ATOM   8523  N  NE2   . GLN C 2  633  ? 19.343  -6.392  82.968  1.00 25.67  ? 633  GLN C NE2   1 
ATOM   8524  N  N     . GLY C 2  634  ? 22.876  -2.325  86.467  1.00 19.81  ? 634  GLY C N     1 
ATOM   8525  C  CA    . GLY C 2  634  ? 23.487  -1.300  87.293  1.00 20.07  ? 634  GLY C CA    1 
ATOM   8526  C  C     . GLY C 2  634  ? 23.433  -1.571  88.787  1.00 23.39  ? 634  GLY C C     1 
ATOM   8527  O  O     . GLY C 2  634  ? 23.885  -0.753  89.587  1.00 23.33  ? 634  GLY C O     1 
ATOM   8528  N  N     . THR C 2  635  ? 22.867  -2.710  89.173  1.00 23.08  ? 635  THR C N     1 
ATOM   8529  C  CA    . THR C 2  635  ? 22.815  -3.080  90.581  1.00 17.69  ? 635  THR C CA    1 
ATOM   8530  C  C     . THR C 2  635  ? 24.183  -3.582  91.021  1.00 21.89  ? 635  THR C C     1 
ATOM   8531  O  O     . THR C 2  635  ? 24.813  -4.369  90.319  1.00 25.23  ? 635  THR C O     1 
ATOM   8532  C  CB    . THR C 2  635  ? 21.742  -4.150  90.853  1.00 17.31  ? 635  THR C CB    1 
ATOM   8533  O  OG1   . THR C 2  635  ? 22.002  -5.311  90.054  1.00 20.34  ? 635  THR C OG1   1 
ATOM   8534  C  CG2   . THR C 2  635  ? 20.364  -3.612  90.514  1.00 16.56  ? 635  THR C CG2   1 
ATOM   8535  N  N     . ALA C 2  636  ? 24.644  -3.120  92.179  1.00 24.98  ? 636  ALA C N     1 
ATOM   8536  C  CA    . ALA C 2  636  ? 25.984  -3.453  92.654  1.00 22.34  ? 636  ALA C CA    1 
ATOM   8537  C  C     . ALA C 2  636  ? 26.095  -4.912  93.080  1.00 24.71  ? 636  ALA C C     1 
ATOM   8538  O  O     . ALA C 2  636  ? 25.339  -5.382  93.930  1.00 27.34  ? 636  ALA C O     1 
ATOM   8539  C  CB    . ALA C 2  636  ? 26.382  -2.537  93.794  1.00 19.88  ? 636  ALA C CB    1 
ATOM   8540  N  N     . LEU C 2  637  ? 27.051  -5.623  92.490  1.00 28.12  ? 637  LEU C N     1 
ATOM   8541  C  CA    . LEU C 2  637  ? 27.274  -7.022  92.827  1.00 32.32  ? 637  LEU C CA    1 
ATOM   8542  C  C     . LEU C 2  637  ? 28.548  -7.151  93.642  1.00 40.29  ? 637  LEU C C     1 
ATOM   8543  O  O     . LEU C 2  637  ? 29.645  -6.976  93.113  1.00 45.77  ? 637  LEU C O     1 
ATOM   8544  C  CB    . LEU C 2  637  ? 27.407  -7.865  91.558  1.00 30.66  ? 637  LEU C CB    1 
ATOM   8545  C  CG    . LEU C 2  637  ? 26.371  -7.659  90.452  1.00 31.12  ? 637  LEU C CG    1 
ATOM   8546  C  CD1   . LEU C 2  637  ? 26.667  -8.585  89.279  1.00 25.43  ? 637  LEU C CD1   1 
ATOM   8547  C  CD2   . LEU C 2  637  ? 24.949  -7.859  90.974  1.00 23.81  ? 637  LEU C CD2   1 
ATOM   8548  N  N     . ASP C 2  638  ? 28.408  -7.472  94.924  1.00 45.86  ? 638  ASP C N     1 
ATOM   8549  C  CA    . ASP C 2  638  ? 29.577  -7.647  95.776  1.00 46.51  ? 638  ASP C CA    1 
ATOM   8550  C  C     . ASP C 2  638  ? 29.450  -8.846  96.705  1.00 41.46  ? 638  ASP C C     1 
ATOM   8551  O  O     . ASP C 2  638  ? 28.368  -9.163  97.200  1.00 42.04  ? 638  ASP C O     1 
ATOM   8552  C  CB    . ASP C 2  638  ? 29.890  -6.373  96.573  1.00 44.16  ? 638  ASP C CB    1 
ATOM   8553  C  CG    . ASP C 2  638  ? 28.949  -6.162  97.738  1.00 53.86  ? 638  ASP C CG    1 
ATOM   8554  O  OD1   . ASP C 2  638  ? 27.734  -6.407  97.580  1.00 70.29  ? 638  ASP C OD1   1 
ATOM   8555  O  OD2   . ASP C 2  638  ? 29.432  -5.748  98.815  1.00 48.99  ? 638  ASP C OD2   1 
ATOM   8556  N  N     . GLN C 2  639  ? 30.574  -9.513  96.922  1.00 42.36  ? 639  GLN C N     1 
ATOM   8557  C  CA    . GLN C 2  639  ? 30.638  -10.652 97.818  1.00 40.25  ? 639  GLN C CA    1 
ATOM   8558  C  C     . GLN C 2  639  ? 31.253  -10.203 99.130  1.00 37.34  ? 639  GLN C C     1 
ATOM   8559  O  O     . GLN C 2  639  ? 32.235  -9.462  99.136  1.00 44.47  ? 639  GLN C O     1 
ATOM   8560  C  CB    . GLN C 2  639  ? 31.486  -11.757 97.189  1.00 39.39  ? 639  GLN C CB    1 
ATOM   8561  C  CG    . GLN C 2  639  ? 30.975  -12.225 95.833  1.00 40.76  ? 639  GLN C CG    1 
ATOM   8562  C  CD    . GLN C 2  639  ? 31.991  -13.058 95.079  1.00 35.40  ? 639  GLN C CD    1 
ATOM   8563  O  OE1   . GLN C 2  639  ? 33.072  -12.578 94.739  1.00 36.60  ? 639  GLN C OE1   1 
ATOM   8564  N  NE2   . GLN C 2  639  ? 31.649  -14.314 94.814  1.00 36.19  ? 639  GLN C NE2   1 
ATOM   8565  N  N     . ARG C 2  640  ? 30.679  -10.643 100.243 1.00 39.73  ? 640  ARG C N     1 
ATOM   8566  C  CA    . ARG C 2  640  ? 31.224  -10.290 101.545 1.00 42.79  ? 640  ARG C CA    1 
ATOM   8567  C  C     . ARG C 2  640  ? 31.619  -11.578 102.262 1.00 43.10  ? 640  ARG C C     1 
ATOM   8568  O  O     . ARG C 2  640  ? 30.926  -12.588 102.143 1.00 43.25  ? 640  ARG C O     1 
ATOM   8569  C  CB    . ARG C 2  640  ? 30.179  -9.515  102.358 1.00 40.79  ? 640  ARG C CB    1 
ATOM   8570  C  CG    . ARG C 2  640  ? 29.489  -8.378  101.590 1.00 40.21  ? 640  ARG C CG    1 
ATOM   8571  C  CD    . ARG C 2  640  ? 28.649  -7.492  102.519 1.00 60.68  ? 640  ARG C CD    1 
ATOM   8572  N  NE    . ARG C 2  640  ? 28.164  -6.274  101.862 1.00 61.77  ? 640  ARG C NE    1 
ATOM   8573  C  CZ    . ARG C 2  640  ? 27.684  -5.211  102.506 1.00 40.01  ? 640  ARG C CZ    1 
ATOM   8574  N  NH1   . ARG C 2  640  ? 27.268  -4.150  101.826 1.00 24.09  ? 640  ARG C NH1   1 
ATOM   8575  N  NH2   . ARG C 2  640  ? 27.624  -5.202  103.831 1.00 30.46  ? 640  ARG C NH2   1 
ATOM   8576  N  N     . PRO C 2  641  ? 32.745  -11.554 102.997 1.00 38.10  ? 641  PRO C N     1 
ATOM   8577  C  CA    . PRO C 2  641  ? 33.202  -12.772 103.681 1.00 35.78  ? 641  PRO C CA    1 
ATOM   8578  C  C     . PRO C 2  641  ? 32.296  -13.195 104.839 1.00 39.01  ? 641  PRO C C     1 
ATOM   8579  O  O     . PRO C 2  641  ? 31.979  -12.385 105.710 1.00 40.02  ? 641  PRO C O     1 
ATOM   8580  C  CB    . PRO C 2  641  ? 34.590  -12.380 104.196 1.00 36.67  ? 641  PRO C CB    1 
ATOM   8581  C  CG    . PRO C 2  641  ? 34.554  -10.894 104.294 1.00 39.99  ? 641  PRO C CG    1 
ATOM   8582  C  CD    . PRO C 2  641  ? 33.675  -10.428 103.178 1.00 37.54  ? 641  PRO C CD    1 
ATOM   8583  N  N     . ARG C 2  642  ? 31.900  -14.463 104.844 1.00 39.98  ? 642  ARG C N     1 
ATOM   8584  C  CA    . ARG C 2  642  ? 31.078  -15.025 105.916 1.00 39.24  ? 642  ARG C CA    1 
ATOM   8585  C  C     . ARG C 2  642  ? 31.835  -15.827 106.980 1.00 42.13  ? 642  ARG C C     1 
ATOM   8586  O  O     . ARG C 2  642  ? 31.224  -16.390 107.890 1.00 37.80  ? 642  ARG C O     1 
ATOM   8587  C  CB    . ARG C 2  642  ? 29.900  -15.815 105.343 1.00 41.91  ? 642  ARG C CB    1 
ATOM   8588  C  CG    . ARG C 2  642  ? 28.809  -14.914 104.785 1.00 33.87  ? 642  ARG C CG    1 
ATOM   8589  C  CD    . ARG C 2  642  ? 28.321  -13.945 105.853 1.00 35.98  ? 642  ARG C CD    1 
ATOM   8590  N  NE    . ARG C 2  642  ? 27.448  -12.907 105.313 1.00 38.78  ? 642  ARG C NE    1 
ATOM   8591  C  CZ    . ARG C 2  642  ? 27.834  -11.661 105.058 1.00 34.76  ? 642  ARG C CZ    1 
ATOM   8592  N  NH1   . ARG C 2  642  ? 29.083  -11.287 105.296 1.00 38.00  ? 642  ARG C NH1   1 
ATOM   8593  N  NH2   . ARG C 2  642  ? 26.969  -10.785 104.567 1.00 38.35  ? 642  ARG C NH2   1 
ATOM   8594  N  N     . VAL C 2  643  ? 33.158  -15.888 106.853 1.00 48.85  ? 643  VAL C N     1 
ATOM   8595  C  CA    . VAL C 2  643  ? 33.987  -16.676 107.763 1.00 38.01  ? 643  VAL C CA    1 
ATOM   8596  C  C     . VAL C 2  643  ? 35.038  -15.809 108.440 1.00 41.15  ? 643  VAL C C     1 
ATOM   8597  O  O     . VAL C 2  643  ? 35.304  -14.687 108.010 1.00 36.22  ? 643  VAL C O     1 
ATOM   8598  C  CB    . VAL C 2  643  ? 34.705  -17.826 107.037 1.00 31.87  ? 643  VAL C CB    1 
ATOM   8599  C  CG1   . VAL C 2  643  ? 33.697  -18.751 106.378 1.00 41.70  ? 643  VAL C CG1   1 
ATOM   8600  C  CG2   . VAL C 2  643  ? 35.679  -17.275 106.013 1.00 37.37  ? 643  VAL C CG2   1 
ATOM   8601  N  N     . VAL C 2  644  ? 35.627  -16.334 109.510 1.00 51.42  ? 644  VAL C N     1 
ATOM   8602  C  CA    . VAL C 2  644  ? 36.649  -15.607 110.254 1.00 56.71  ? 644  VAL C CA    1 
ATOM   8603  C  C     . VAL C 2  644  ? 37.962  -16.398 110.259 1.00 50.06  ? 644  VAL C C     1 
ATOM   8604  O  O     . VAL C 2  644  ? 37.969  -17.601 109.987 1.00 37.03  ? 644  VAL C O     1 
ATOM   8605  C  CB    . VAL C 2  644  ? 36.186  -15.307 111.700 1.00 50.39  ? 644  VAL C CB    1 
ATOM   8606  C  CG1   . VAL C 2  644  ? 36.380  -16.527 112.589 1.00 51.70  ? 644  VAL C CG1   1 
ATOM   8607  C  CG2   . VAL C 2  644  ? 36.919  -14.093 112.268 1.00 49.47  ? 644  VAL C CG2   1 
ATOM   8608  N  N     . VAL C 2  645  ? 39.068  -15.710 110.538 1.00 55.58  ? 645  VAL C N     1 
ATOM   8609  C  CA    . VAL C 2  645  ? 40.395  -16.323 110.530 1.00 53.13  ? 645  VAL C CA    1 
ATOM   8610  C  C     . VAL C 2  645  ? 40.500  -17.459 111.541 1.00 50.38  ? 645  VAL C C     1 
ATOM   8611  O  O     . VAL C 2  645  ? 40.206  -17.279 112.722 1.00 43.04  ? 645  VAL C O     1 
ATOM   8612  C  CB    . VAL C 2  645  ? 41.497  -15.286 110.843 1.00 49.51  ? 645  VAL C CB    1 
ATOM   8613  C  CG1   . VAL C 2  645  ? 42.853  -15.963 110.955 1.00 42.07  ? 645  VAL C CG1   1 
ATOM   8614  C  CG2   . VAL C 2  645  ? 41.525  -14.196 109.781 1.00 48.31  ? 645  VAL C CG2   1 
ATOM   8615  N  N     . GLY C 2  646  ? 40.928  -18.625 111.067 1.00 55.91  ? 646  GLY C N     1 
ATOM   8616  C  CA    . GLY C 2  646  ? 41.092  -19.786 111.922 1.00 50.23  ? 646  GLY C CA    1 
ATOM   8617  C  C     . GLY C 2  646  ? 39.882  -20.702 111.952 1.00 51.42  ? 646  GLY C C     1 
ATOM   8618  O  O     . GLY C 2  646  ? 39.944  -21.802 112.498 1.00 59.58  ? 646  GLY C O     1 
ATOM   8619  N  N     . GLN C 2  647  ? 38.777  -20.251 111.367 1.00 55.43  ? 647  GLN C N     1 
ATOM   8620  C  CA    . GLN C 2  647  ? 37.560  -21.054 111.329 1.00 55.27  ? 647  GLN C CA    1 
ATOM   8621  C  C     . GLN C 2  647  ? 37.743  -22.292 110.461 1.00 54.69  ? 647  GLN C C     1 
ATOM   8622  O  O     . GLN C 2  647  ? 38.165  -22.194 109.310 1.00 60.68  ? 647  GLN C O     1 
ATOM   8623  C  CB    . GLN C 2  647  ? 36.382  -20.227 110.810 1.00 58.24  ? 647  GLN C CB    1 
ATOM   8624  C  CG    . GLN C 2  647  ? 35.135  -21.048 110.512 1.00 57.51  ? 647  GLN C CG    1 
ATOM   8625  C  CD    . GLN C 2  647  ? 33.975  -20.200 110.031 1.00 51.67  ? 647  GLN C CD    1 
ATOM   8626  O  OE1   . GLN C 2  647  ? 34.010  -18.970 110.112 1.00 44.85  ? 647  GLN C OE1   1 
ATOM   8627  N  NE2   . GLN C 2  647  ? 32.936  -20.856 109.522 1.00 44.74  ? 647  GLN C NE2   1 
ATOM   8628  N  N     . ARG C 2  648  ? 37.423  -23.456 111.016 1.00 51.68  ? 648  ARG C N     1 
ATOM   8629  C  CA    . ARG C 2  648  ? 37.506  -24.700 110.259 1.00 65.55  ? 648  ARG C CA    1 
ATOM   8630  C  C     . ARG C 2  648  ? 36.221  -24.968 109.484 1.00 60.34  ? 648  ARG C C     1 
ATOM   8631  O  O     . ARG C 2  648  ? 35.135  -25.020 110.060 1.00 57.51  ? 648  ARG C O     1 
ATOM   8632  C  CB    . ARG C 2  648  ? 37.840  -25.880 111.175 1.00 71.39  ? 648  ARG C CB    1 
ATOM   8633  C  CG    . ARG C 2  648  ? 39.290  -25.909 111.628 1.00 77.53  ? 648  ARG C CG    1 
ATOM   8634  C  CD    . ARG C 2  648  ? 39.708  -27.305 112.057 1.00 94.96  ? 648  ARG C CD    1 
ATOM   8635  N  NE    . ARG C 2  648  ? 41.160  -27.430 112.162 1.00 110.14 ? 648  ARG C NE    1 
ATOM   8636  C  CZ    . ARG C 2  648  ? 41.957  -27.763 111.151 1.00 100.66 ? 648  ARG C CZ    1 
ATOM   8637  N  NH1   . ARG C 2  648  ? 41.447  -28.006 109.951 1.00 80.88  ? 648  ARG C NH1   1 
ATOM   8638  N  NH2   . ARG C 2  648  ? 43.268  -27.853 111.339 1.00 96.18  ? 648  ARG C NH2   1 
ATOM   8639  N  N     . VAL C 2  649  ? 36.354  -25.135 108.172 1.00 58.27  ? 649  VAL C N     1 
ATOM   8640  C  CA    . VAL C 2  649  ? 35.200  -25.339 107.306 1.00 59.41  ? 649  VAL C CA    1 
ATOM   8641  C  C     . VAL C 2  649  ? 35.266  -26.682 106.583 1.00 64.42  ? 649  VAL C C     1 
ATOM   8642  O  O     . VAL C 2  649  ? 36.347  -27.174 106.260 1.00 70.81  ? 649  VAL C O     1 
ATOM   8643  C  CB    . VAL C 2  649  ? 35.069  -24.203 106.268 1.00 62.90  ? 649  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C 2  649  ? 34.897  -22.861 106.968 1.00 59.49  ? 649  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C 2  649  ? 36.281  -24.174 105.346 1.00 51.75  ? 649  VAL C CG2   1 
ATOM   8646  N  N     . ARG C 2  650  ? 34.103  -27.278 106.342 1.00 68.03  ? 650  ARG C N     1 
ATOM   8647  C  CA    . ARG C 2  650  ? 34.032  -28.524 105.589 1.00 67.81  ? 650  ARG C CA    1 
ATOM   8648  C  C     . ARG C 2  650  ? 33.723  -28.244 104.125 1.00 60.69  ? 650  ARG C C     1 
ATOM   8649  O  O     . ARG C 2  650  ? 33.633  -27.088 103.715 1.00 63.28  ? 650  ARG C O     1 
ATOM   8650  C  CB    . ARG C 2  650  ? 32.993  -29.472 106.193 1.00 67.89  ? 650  ARG C CB    1 
ATOM   8651  C  CG    . ARG C 2  650  ? 33.474  -30.180 107.451 1.00 84.03  ? 650  ARG C CG    1 
ATOM   8652  C  CD    . ARG C 2  650  ? 32.433  -31.148 107.996 1.00 98.11  ? 650  ARG C CD    1 
ATOM   8653  N  NE    . ARG C 2  650  ? 31.292  -30.457 108.590 1.00 108.19 ? 650  ARG C NE    1 
ATOM   8654  C  CZ    . ARG C 2  650  ? 30.128  -30.269 107.978 1.00 113.28 ? 650  ARG C CZ    1 
ATOM   8655  N  NH1   . ARG C 2  650  ? 29.942  -30.726 106.746 1.00 117.16 ? 650  ARG C NH1   1 
ATOM   8656  N  NH2   . ARG C 2  650  ? 29.146  -29.627 108.598 1.00 112.75 ? 650  ARG C NH2   1 
ATOM   8657  N  N     . LYS C 2  651  ? 33.571  -29.303 103.338 1.00 66.27  ? 651  LYS C N     1 
ATOM   8658  C  CA    . LYS C 2  651  ? 33.330  -29.159 101.907 1.00 69.76  ? 651  LYS C CA    1 
ATOM   8659  C  C     . LYS C 2  651  ? 31.927  -28.629 101.629 1.00 71.00  ? 651  LYS C C     1 
ATOM   8660  O  O     . LYS C 2  651  ? 30.935  -29.196 102.090 1.00 73.33  ? 651  LYS C O     1 
ATOM   8661  C  CB    . LYS C 2  651  ? 33.551  -30.494 101.188 1.00 64.67  ? 651  LYS C CB    1 
ATOM   8662  C  CG    . LYS C 2  651  ? 33.345  -30.439 99.683  1.00 59.28  ? 651  LYS C CG    1 
ATOM   8663  C  CD    . LYS C 2  651  ? 33.760  -31.746 99.025  1.00 70.78  ? 651  LYS C CD    1 
ATOM   8664  C  CE    . LYS C 2  651  ? 33.573  -31.699 97.516  1.00 75.93  ? 651  LYS C CE    1 
ATOM   8665  N  NZ    . LYS C 2  651  ? 34.066  -32.942 96.856  1.00 69.90  ? 651  LYS C NZ    1 
ATOM   8666  N  N     . GLY C 2  652  ? 31.852  -27.535 100.876 1.00 62.17  ? 652  GLY C N     1 
ATOM   8667  C  CA    . GLY C 2  652  ? 30.577  -26.945 100.514 1.00 60.93  ? 652  GLY C CA    1 
ATOM   8668  C  C     . GLY C 2  652  ? 30.106  -25.858 101.463 1.00 65.22  ? 652  GLY C C     1 
ATOM   8669  O  O     . GLY C 2  652  ? 29.090  -25.210 101.211 1.00 63.81  ? 652  GLY C O     1 
ATOM   8670  N  N     . ASP C 2  653  ? 30.837  -25.659 102.557 1.00 71.79  ? 653  ASP C N     1 
ATOM   8671  C  CA    . ASP C 2  653  ? 30.506  -24.606 103.515 1.00 63.98  ? 653  ASP C CA    1 
ATOM   8672  C  C     . ASP C 2  653  ? 30.738  -23.224 102.913 1.00 52.24  ? 653  ASP C C     1 
ATOM   8673  O  O     . ASP C 2  653  ? 31.658  -23.026 102.118 1.00 50.60  ? 653  ASP C O     1 
ATOM   8674  C  CB    . ASP C 2  653  ? 31.303  -24.770 104.811 1.00 62.36  ? 653  ASP C CB    1 
ATOM   8675  C  CG    . ASP C 2  653  ? 30.717  -25.830 105.726 1.00 73.29  ? 653  ASP C CG    1 
ATOM   8676  O  OD1   . ASP C 2  653  ? 30.889  -25.713 106.959 1.00 74.00  ? 653  ASP C OD1   1 
ATOM   8677  O  OD2   . ASP C 2  653  ? 30.079  -26.775 105.213 1.00 77.77  ? 653  ASP C OD2   1 
ATOM   8678  N  N     . LEU C 2  654  ? 29.897  -22.270 103.296 1.00 49.52  ? 654  LEU C N     1 
ATOM   8679  C  CA    . LEU C 2  654  ? 29.925  -20.952 102.683 1.00 43.89  ? 654  LEU C CA    1 
ATOM   8680  C  C     . LEU C 2  654  ? 31.161  -20.161 103.100 1.00 37.93  ? 654  LEU C C     1 
ATOM   8681  O  O     . LEU C 2  654  ? 31.378  -19.913 104.286 1.00 38.09  ? 654  LEU C O     1 
ATOM   8682  C  CB    . LEU C 2  654  ? 28.668  -20.193 103.104 1.00 36.18  ? 654  LEU C CB    1 
ATOM   8683  C  CG    . LEU C 2  654  ? 28.458  -18.776 102.586 1.00 33.60  ? 654  LEU C CG    1 
ATOM   8684  C  CD1   . LEU C 2  654  ? 27.945  -18.817 101.162 1.00 37.73  ? 654  LEU C CD1   1 
ATOM   8685  C  CD2   . LEU C 2  654  ? 27.495  -18.032 103.493 1.00 35.34  ? 654  LEU C CD2   1 
ATOM   8686  N  N     . LEU C 2  655  ? 31.969  -19.773 102.117 1.00 37.44  ? 655  LEU C N     1 
ATOM   8687  C  CA    . LEU C 2  655  ? 33.078  -18.844 102.333 1.00 37.95  ? 655  LEU C CA    1 
ATOM   8688  C  C     . LEU C 2  655  ? 32.668  -17.369 102.301 1.00 38.54  ? 655  LEU C C     1 
ATOM   8689  O  O     . LEU C 2  655  ? 33.129  -16.570 103.116 1.00 37.98  ? 655  LEU C O     1 
ATOM   8690  C  CB    . LEU C 2  655  ? 34.222  -19.128 101.358 1.00 39.70  ? 655  LEU C CB    1 
ATOM   8691  C  CG    . LEU C 2  655  ? 34.895  -20.483 101.598 1.00 42.02  ? 655  LEU C CG    1 
ATOM   8692  C  CD1   . LEU C 2  655  ? 35.892  -20.807 100.500 1.00 51.40  ? 655  LEU C CD1   1 
ATOM   8693  C  CD2   . LEU C 2  655  ? 35.570  -20.505 102.961 1.00 38.80  ? 655  LEU C CD2   1 
ATOM   8694  N  N     . ALA C 2  656  ? 31.807  -17.016 101.348 1.00 41.91  ? 656  ALA C N     1 
ATOM   8695  C  CA    . ALA C 2  656  ? 31.365  -15.633 101.175 1.00 38.26  ? 656  ALA C CA    1 
ATOM   8696  C  C     . ALA C 2  656  ? 29.954  -15.560 100.601 1.00 34.23  ? 656  ALA C C     1 
ATOM   8697  O  O     . ALA C 2  656  ? 29.555  -16.410 99.808  1.00 29.09  ? 656  ALA C O     1 
ATOM   8698  C  CB    . ALA C 2  656  ? 32.337  -14.871 100.289 1.00 37.13  ? 656  ALA C CB    1 
ATOM   8699  N  N     . ASP C 2  657  ? 29.211  -14.528 100.991 1.00 35.88  ? 657  ASP C N     1 
ATOM   8700  C  CA    . ASP C 2  657  ? 27.818  -14.378 100.575 1.00 34.40  ? 657  ASP C CA    1 
ATOM   8701  C  C     . ASP C 2  657  ? 27.667  -13.642 99.241  1.00 38.16  ? 657  ASP C C     1 
ATOM   8702  O  O     . ASP C 2  657  ? 28.360  -12.658 98.983  1.00 33.81  ? 657  ASP C O     1 
ATOM   8703  C  CB    . ASP C 2  657  ? 27.013  -13.655 101.657 1.00 31.81  ? 657  ASP C CB    1 
ATOM   8704  C  CG    . ASP C 2  657  ? 25.972  -14.547 102.307 1.00 34.01  ? 657  ASP C CG    1 
ATOM   8705  O  OD1   . ASP C 2  657  ? 25.611  -15.583 101.709 1.00 33.68  ? 657  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP C 2  657  ? 25.505  -14.208 103.415 1.00 35.13  ? 657  ASP C OD2   1 
ATOM   8707  N  N     . GLY C 2  658  ? 26.734  -14.113 98.414  1.00 42.93  ? 658  GLY C N     1 
ATOM   8708  C  CA    . GLY C 2  658  ? 26.499  -13.543 97.097  1.00 42.87  ? 658  GLY C CA    1 
ATOM   8709  C  C     . GLY C 2  658  ? 25.918  -12.142 97.166  1.00 43.80  ? 658  GLY C C     1 
ATOM   8710  O  O     . GLY C 2  658  ? 25.732  -11.606 98.261  1.00 34.19  ? 658  GLY C O     1 
ATOM   8711  N  N     . PRO C 2  659  ? 25.639  -11.534 95.999  1.00 46.12  ? 659  PRO C N     1 
ATOM   8712  C  CA    . PRO C 2  659  ? 25.222  -10.129 96.026  1.00 39.06  ? 659  PRO C CA    1 
ATOM   8713  C  C     . PRO C 2  659  ? 23.948  -9.909  96.834  1.00 43.23  ? 659  PRO C C     1 
ATOM   8714  O  O     . PRO C 2  659  ? 23.952  -9.037  97.704  1.00 51.83  ? 659  PRO C O     1 
ATOM   8715  C  CB    . PRO C 2  659  ? 24.964  -9.817  94.548  1.00 30.79  ? 659  PRO C CB    1 
ATOM   8716  C  CG    . PRO C 2  659  ? 25.805  -10.796 93.802  1.00 33.69  ? 659  PRO C CG    1 
ATOM   8717  C  CD    . PRO C 2  659  ? 25.782  -12.047 94.626  1.00 45.34  ? 659  PRO C CD    1 
ATOM   8718  N  N     . ALA C 2  660  ? 22.890  -10.679 96.590  1.00 28.58  ? 660  ALA C N     1 
ATOM   8719  C  CA    . ALA C 2  660  ? 21.816  -10.721 97.569  1.00 27.74  ? 660  ALA C CA    1 
ATOM   8720  C  C     . ALA C 2  660  ? 21.649  -12.124 98.125  1.00 32.96  ? 660  ALA C C     1 
ATOM   8721  O  O     . ALA C 2  660  ? 21.053  -12.987 97.481  1.00 28.47  ? 660  ALA C O     1 
ATOM   8722  C  CB    . ALA C 2  660  ? 20.525  -10.245 96.940  1.00 25.51  ? 660  ALA C CB    1 
ATOM   8723  N  N     . SER C 2  661  ? 22.116  -12.327 99.349  1.00 37.40  ? 661  SER C N     1 
ATOM   8724  C  CA    . SER C 2  661  ? 21.855  -13.553 100.088 1.00 28.80  ? 661  SER C CA    1 
ATOM   8725  C  C     . SER C 2  661  ? 22.123  -13.308 101.567 1.00 30.33  ? 661  SER C C     1 
ATOM   8726  O  O     . SER C 2  661  ? 22.871  -12.394 101.922 1.00 28.90  ? 661  SER C O     1 
ATOM   8727  C  CB    . SER C 2  661  ? 22.707  -14.713 99.561  1.00 28.92  ? 661  SER C CB    1 
ATOM   8728  O  OG    . SER C 2  661  ? 24.086  -14.488 99.781  1.00 35.36  ? 661  SER C OG    1 
ATOM   8729  N  N     . GLU C 2  662  ? 21.553  -14.141 102.428 1.00 26.11  ? 662  GLU C N     1 
ATOM   8730  C  CA    . GLU C 2  662  ? 21.854  -14.047 103.848 1.00 29.77  ? 662  GLU C CA    1 
ATOM   8731  C  C     . GLU C 2  662  ? 22.287  -15.409 104.356 1.00 33.95  ? 662  GLU C C     1 
ATOM   8732  O  O     . GLU C 2  662  ? 21.480  -16.338 104.422 1.00 34.94  ? 662  GLU C O     1 
ATOM   8733  C  CB    . GLU C 2  662  ? 20.635  -13.554 104.630 1.00 28.77  ? 662  GLU C CB    1 
ATOM   8734  C  CG    . GLU C 2  662  ? 20.906  -13.254 106.096 1.00 25.47  ? 662  GLU C CG    1 
ATOM   8735  C  CD    . GLU C 2  662  ? 19.631  -13.178 106.914 1.00 29.52  ? 662  GLU C CD    1 
ATOM   8736  O  OE1   . GLU C 2  662  ? 18.560  -13.512 106.368 1.00 27.45  ? 662  GLU C OE1   1 
ATOM   8737  O  OE2   . GLU C 2  662  ? 19.697  -12.793 108.102 1.00 35.13  ? 662  GLU C OE2   1 
ATOM   8738  N  N     . ASN C 2  663  ? 23.561  -15.505 104.735 1.00 35.54  ? 663  ASN C N     1 
ATOM   8739  C  CA    . ASN C 2  663  ? 24.164  -16.750 105.204 1.00 31.63  ? 663  ASN C CA    1 
ATOM   8740  C  C     . ASN C 2  663  ? 23.903  -17.941 104.280 1.00 27.90  ? 663  ASN C C     1 
ATOM   8741  O  O     . ASN C 2  663  ? 23.628  -19.047 104.743 1.00 28.82  ? 663  ASN C O     1 
ATOM   8742  C  CB    . ASN C 2  663  ? 23.703  -17.065 106.631 1.00 31.27  ? 663  ASN C CB    1 
ATOM   8743  C  CG    . ASN C 2  663  ? 23.921  -15.902 107.587 1.00 38.67  ? 663  ASN C CG    1 
ATOM   8744  O  OD1   . ASN C 2  663  ? 24.936  -15.204 107.516 1.00 40.21  ? 663  ASN C OD1   1 
ATOM   8745  N  ND2   . ASN C 2  663  ? 22.964  -15.687 108.486 1.00 39.53  ? 663  ASN C ND2   1 
ATOM   8746  N  N     . GLY C 2  664  ? 23.983  -17.705 102.973 1.00 22.51  ? 664  GLY C N     1 
ATOM   8747  C  CA    . GLY C 2  664  ? 23.785  -18.759 101.993 1.00 23.74  ? 664  GLY C CA    1 
ATOM   8748  C  C     . GLY C 2  664  ? 22.359  -18.879 101.472 1.00 30.78  ? 664  GLY C C     1 
ATOM   8749  O  O     . GLY C 2  664  ? 22.137  -19.450 100.403 1.00 31.65  ? 664  GLY C O     1 
ATOM   8750  N  N     . PHE C 2  665  ? 21.394  -18.350 102.225 1.00 29.97  ? 665  PHE C N     1 
ATOM   8751  C  CA    . PHE C 2  665  ? 19.992  -18.323 101.801 1.00 25.61  ? 665  PHE C CA    1 
ATOM   8752  C  C     . PHE C 2  665  ? 19.722  -17.150 100.875 1.00 26.63  ? 665  PHE C C     1 
ATOM   8753  O  O     . PHE C 2  665  ? 20.321  -16.092 101.027 1.00 28.60  ? 665  PHE C O     1 
ATOM   8754  C  CB    . PHE C 2  665  ? 19.055  -18.237 103.006 1.00 25.60  ? 665  PHE C CB    1 
ATOM   8755  C  CG    . PHE C 2  665  ? 19.033  -19.475 103.848 1.00 34.50  ? 665  PHE C CG    1 
ATOM   8756  C  CD1   . PHE C 2  665  ? 18.167  -20.517 103.551 1.00 36.53  ? 665  PHE C CD1   1 
ATOM   8757  C  CD2   . PHE C 2  665  ? 19.869  -19.594 104.945 1.00 35.13  ? 665  PHE C CD2   1 
ATOM   8758  C  CE1   . PHE C 2  665  ? 18.143  -21.661 104.332 1.00 37.07  ? 665  PHE C CE1   1 
ATOM   8759  C  CE2   . PHE C 2  665  ? 19.849  -20.732 105.730 1.00 39.28  ? 665  PHE C CE2   1 
ATOM   8760  C  CZ    . PHE C 2  665  ? 18.985  -21.767 105.423 1.00 42.92  ? 665  PHE C CZ    1 
ATOM   8761  N  N     . LEU C 2  666  ? 18.806  -17.330 99.928  1.00 22.83  ? 666  LEU C N     1 
ATOM   8762  C  CA    . LEU C 2  666  ? 18.545  -16.298 98.929  1.00 18.96  ? 666  LEU C CA    1 
ATOM   8763  C  C     . LEU C 2  666  ? 17.688  -15.196 99.531  1.00 20.98  ? 666  LEU C C     1 
ATOM   8764  O  O     . LEU C 2  666  ? 16.550  -15.438 99.929  1.00 23.09  ? 666  LEU C O     1 
ATOM   8765  C  CB    . LEU C 2  666  ? 17.845  -16.926 97.720  1.00 17.34  ? 666  LEU C CB    1 
ATOM   8766  C  CG    . LEU C 2  666  ? 17.379  -16.150 96.492  1.00 17.61  ? 666  LEU C CG    1 
ATOM   8767  C  CD1   . LEU C 2  666  ? 15.899  -15.821 96.602  1.00 15.54  ? 666  LEU C CD1   1 
ATOM   8768  C  CD2   . LEU C 2  666  ? 18.222  -14.895 96.234  1.00 21.69  ? 666  LEU C CD2   1 
ATOM   8769  N  N     . ALA C 2  667  ? 18.224  -13.978 99.555  1.00 23.99  ? 667  ALA C N     1 
ATOM   8770  C  CA    . ALA C 2  667  ? 17.516  -12.859 100.161 1.00 23.79  ? 667  ALA C CA    1 
ATOM   8771  C  C     . ALA C 2  667  ? 17.236  -11.745 99.159  1.00 23.11  ? 667  ALA C C     1 
ATOM   8772  O  O     . ALA C 2  667  ? 18.143  -11.018 98.757  1.00 31.25  ? 667  ALA C O     1 
ATOM   8773  C  CB    . ALA C 2  667  ? 18.345  -12.315 101.299 1.00 23.67  ? 667  ALA C CB    1 
ATOM   8774  N  N     . LEU C 2  668  ? 15.970  -11.591 98.788  1.00 15.46  ? 668  LEU C N     1 
ATOM   8775  C  CA    . LEU C 2  668  ? 15.585  -10.609 97.783  1.00 13.30  ? 668  LEU C CA    1 
ATOM   8776  C  C     . LEU C 2  668  ? 15.049  -9.317  98.370  1.00 15.42  ? 668  LEU C C     1 
ATOM   8777  O  O     . LEU C 2  668  ? 14.692  -8.399  97.638  1.00 23.92  ? 668  LEU C O     1 
ATOM   8778  C  CB    . LEU C 2  668  ? 14.582  -11.209 96.798  1.00 13.72  ? 668  LEU C CB    1 
ATOM   8779  C  CG    . LEU C 2  668  ? 15.196  -12.322 95.955  1.00 15.50  ? 668  LEU C CG    1 
ATOM   8780  C  CD1   . LEU C 2  668  ? 14.179  -12.870 94.966  1.00 16.92  ? 668  LEU C CD1   1 
ATOM   8781  C  CD2   . LEU C 2  668  ? 16.449  -11.815 95.246  1.00 16.03  ? 668  LEU C CD2   1 
ATOM   8782  N  N     . GLY C 2  669  ? 15.006  -9.236  99.692  1.00 14.43  ? 669  GLY C N     1 
ATOM   8783  C  CA    . GLY C 2  669  ? 14.274  -8.165  100.334 1.00 11.05  ? 669  GLY C CA    1 
ATOM   8784  C  C     . GLY C 2  669  ? 14.416  -8.125  101.836 1.00 9.96   ? 669  GLY C C     1 
ATOM   8785  O  O     . GLY C 2  669  ? 15.365  -8.657  102.403 1.00 10.83  ? 669  GLY C O     1 
ATOM   8786  N  N     . GLN C 2  670  ? 13.471  -7.455  102.478 1.00 11.77  ? 670  GLN C N     1 
ATOM   8787  C  CA    . GLN C 2  670  ? 13.480  -7.302  103.921 1.00 12.48  ? 670  GLN C CA    1 
ATOM   8788  C  C     . GLN C 2  670  ? 12.288  -8.002  104.571 1.00 17.55  ? 670  GLN C C     1 
ATOM   8789  O  O     . GLN C 2  670  ? 11.253  -8.224  103.927 1.00 19.12  ? 670  GLN C O     1 
ATOM   8790  C  CB    . GLN C 2  670  ? 13.460  -5.820  104.282 1.00 11.75  ? 670  GLN C CB    1 
ATOM   8791  C  CG    . GLN C 2  670  ? 14.625  -5.379  105.130 1.00 19.67  ? 670  GLN C CG    1 
ATOM   8792  C  CD    . GLN C 2  670  ? 15.892  -5.201  104.329 1.00 19.60  ? 670  GLN C CD    1 
ATOM   8793  O  OE1   . GLN C 2  670  ? 16.052  -4.214  103.609 1.00 17.96  ? 670  GLN C OE1   1 
ATOM   8794  N  NE2   . GLN C 2  670  ? 16.807  -6.156  104.451 1.00 22.76  ? 670  GLN C NE2   1 
ATOM   8795  N  N     . ASN C 2  671  ? 12.446  -8.362  105.842 1.00 12.70  ? 671  ASN C N     1 
ATOM   8796  C  CA    . ASN C 2  671  ? 11.338  -8.873  106.632 1.00 12.95  ? 671  ASN C CA    1 
ATOM   8797  C  C     . ASN C 2  671  ? 10.837  -7.742  107.502 1.00 14.95  ? 671  ASN C C     1 
ATOM   8798  O  O     . ASN C 2  671  ? 11.527  -7.314  108.423 1.00 19.95  ? 671  ASN C O     1 
ATOM   8799  C  CB    . ASN C 2  671  ? 11.786  -10.037 107.515 1.00 13.07  ? 671  ASN C CB    1 
ATOM   8800  C  CG    . ASN C 2  671  ? 11.991  -11.319 106.735 1.00 18.05  ? 671  ASN C CG    1 
ATOM   8801  O  OD1   . ASN C 2  671  ? 11.156  -11.700 105.914 1.00 17.83  ? 671  ASN C OD1   1 
ATOM   8802  N  ND2   . ASN C 2  671  ? 13.106  -11.996 106.990 1.00 19.51  ? 671  ASN C ND2   1 
ATOM   8803  N  N     . VAL C 2  672  ? 9.635   -7.256  107.216 1.00 14.12  ? 672  VAL C N     1 
ATOM   8804  C  CA    . VAL C 2  672  ? 9.119   -6.095  107.928 1.00 14.70  ? 672  VAL C CA    1 
ATOM   8805  C  C     . VAL C 2  672  ? 7.837   -6.412  108.682 1.00 17.99  ? 672  VAL C C     1 
ATOM   8806  O  O     . VAL C 2  672  ? 7.133   -7.369  108.364 1.00 14.91  ? 672  VAL C O     1 
ATOM   8807  C  CB    . VAL C 2  672  ? 8.871   -4.907  106.982 1.00 11.02  ? 672  VAL C CB    1 
ATOM   8808  C  CG1   . VAL C 2  672  ? 10.190  -4.342  106.486 1.00 11.46  ? 672  VAL C CG1   1 
ATOM   8809  C  CG2   . VAL C 2  672  ? 7.993   -5.332  105.821 1.00 10.41  ? 672  VAL C CG2   1 
ATOM   8810  N  N     . LEU C 2  673  ? 7.538   -5.593  109.684 1.00 17.88  ? 673  LEU C N     1 
ATOM   8811  C  CA    . LEU C 2  673  ? 6.353   -5.794  110.500 1.00 17.84  ? 673  LEU C CA    1 
ATOM   8812  C  C     . LEU C 2  673  ? 5.213   -4.987  109.895 1.00 17.07  ? 673  LEU C C     1 
ATOM   8813  O  O     . LEU C 2  673  ? 5.249   -3.758  109.883 1.00 14.92  ? 673  LEU C O     1 
ATOM   8814  C  CB    . LEU C 2  673  ? 6.626   -5.333  111.933 1.00 18.68  ? 673  LEU C CB    1 
ATOM   8815  C  CG    . LEU C 2  673  ? 5.655   -5.768  113.029 1.00 21.44  ? 673  LEU C CG    1 
ATOM   8816  C  CD1   . LEU C 2  673  ? 5.664   -7.281  113.179 1.00 21.34  ? 673  LEU C CD1   1 
ATOM   8817  C  CD2   . LEU C 2  673  ? 6.013   -5.097  114.343 1.00 19.24  ? 673  LEU C CD2   1 
ATOM   8818  N  N     . VAL C 2  674  ? 4.204   -5.683  109.384 1.00 15.09  ? 674  VAL C N     1 
ATOM   8819  C  CA    . VAL C 2  674  ? 3.110   -5.015  108.696 1.00 12.15  ? 674  VAL C CA    1 
ATOM   8820  C  C     . VAL C 2  674  ? 1.809   -5.069  109.477 1.00 14.00  ? 674  VAL C C     1 
ATOM   8821  O  O     . VAL C 2  674  ? 1.545   -6.019  110.220 1.00 19.52  ? 674  VAL C O     1 
ATOM   8822  C  CB    . VAL C 2  674  ? 2.865   -5.594  107.286 1.00 11.52  ? 674  VAL C CB    1 
ATOM   8823  C  CG1   . VAL C 2  674  ? 4.169   -5.678  106.514 1.00 18.89  ? 674  VAL C CG1   1 
ATOM   8824  C  CG2   . VAL C 2  674  ? 2.203   -6.958  107.369 1.00 12.28  ? 674  VAL C CG2   1 
ATOM   8825  N  N     . ALA C 2  675  ? 1.012   -4.020  109.315 1.00 11.28  ? 675  ALA C N     1 
ATOM   8826  C  CA    . ALA C 2  675  ? -0.360  -4.008  109.791 1.00 10.70  ? 675  ALA C CA    1 
ATOM   8827  C  C     . ALA C 2  675  ? -1.270  -3.899  108.577 1.00 10.12  ? 675  ALA C C     1 
ATOM   8828  O  O     . ALA C 2  675  ? -1.033  -3.085  107.686 1.00 8.99   ? 675  ALA C O     1 
ATOM   8829  C  CB    . ALA C 2  675  ? -0.586  -2.846  110.733 1.00 12.53  ? 675  ALA C CB    1 
ATOM   8830  N  N     . ILE C 2  676  ? -2.306  -4.727  108.534 1.00 12.12  ? 676  ILE C N     1 
ATOM   8831  C  CA    . ILE C 2  676  ? -3.229  -4.706  107.413 1.00 10.96  ? 676  ILE C CA    1 
ATOM   8832  C  C     . ILE C 2  676  ? -4.491  -3.953  107.816 1.00 12.96  ? 676  ILE C C     1 
ATOM   8833  O  O     . ILE C 2  676  ? -5.298  -4.448  108.600 1.00 13.19  ? 676  ILE C O     1 
ATOM   8834  C  CB    . ILE C 2  676  ? -3.577  -6.131  106.962 1.00 8.72   ? 676  ILE C CB    1 
ATOM   8835  C  CG1   . ILE C 2  676  ? -2.293  -6.920  106.701 1.00 7.66   ? 676  ILE C CG1   1 
ATOM   8836  C  CG2   . ILE C 2  676  ? -4.450  -6.101  105.722 1.00 10.02  ? 676  ILE C CG2   1 
ATOM   8837  C  CD1   . ILE C 2  676  ? -2.528  -8.324  106.204 1.00 9.86   ? 676  ILE C CD1   1 
ATOM   8838  N  N     . MET C 2  677  ? -4.655  -2.763  107.244 1.00 10.80  ? 677  MET C N     1 
ATOM   8839  C  CA    . MET C 2  677  ? -5.700  -1.826  107.635 1.00 9.86   ? 677  MET C CA    1 
ATOM   8840  C  C     . MET C 2  677  ? -5.590  -0.594  106.747 1.00 11.52  ? 677  MET C C     1 
ATOM   8841  O  O     . MET C 2  677  ? -4.492  -0.230  106.329 1.00 12.49  ? 677  MET C O     1 
ATOM   8842  C  CB    . MET C 2  677  ? -5.534  -1.411  109.100 1.00 8.62   ? 677  MET C CB    1 
ATOM   8843  C  CG    . MET C 2  677  ? -4.205  -0.740  109.409 1.00 10.34  ? 677  MET C CG    1 
ATOM   8844  S  SD    . MET C 2  677  ? -4.151  0.128   110.994 1.00 24.99  ? 677  MET C SD    1 
ATOM   8845  C  CE    . MET C 2  677  ? -5.384  1.407   110.757 1.00 13.48  ? 677  MET C CE    1 
ATOM   8846  N  N     . PRO C 2  678  ? -6.728  0.051   106.443 1.00 10.12  ? 678  PRO C N     1 
ATOM   8847  C  CA    . PRO C 2  678  ? -6.672  1.278   105.647 1.00 10.53  ? 678  PRO C CA    1 
ATOM   8848  C  C     . PRO C 2  678  ? -6.044  2.385   106.473 1.00 11.32  ? 678  PRO C C     1 
ATOM   8849  O  O     . PRO C 2  678  ? -6.331  2.465   107.664 1.00 14.37  ? 678  PRO C O     1 
ATOM   8850  C  CB    . PRO C 2  678  ? -8.150  1.611   105.407 1.00 10.93  ? 678  PRO C CB    1 
ATOM   8851  C  CG    . PRO C 2  678  ? -8.914  0.395   105.801 1.00 9.51   ? 678  PRO C CG    1 
ATOM   8852  C  CD    . PRO C 2  678  ? -8.102  -0.285  106.841 1.00 9.41   ? 678  PRO C CD    1 
ATOM   8853  N  N     . PHE C 2  679  ? -5.194  3.216   105.885 1.00 10.53  ? 679  PHE C N     1 
ATOM   8854  C  CA    . PHE C 2  679  ? -4.724  4.366   106.632 1.00 12.50  ? 679  PHE C CA    1 
ATOM   8855  C  C     . PHE C 2  679  ? -4.932  5.644   105.826 1.00 14.64  ? 679  PHE C C     1 
ATOM   8856  O  O     . PHE C 2  679  ? -4.207  5.906   104.869 1.00 16.60  ? 679  PHE C O     1 
ATOM   8857  C  CB    . PHE C 2  679  ? -3.234  4.164   106.911 1.00 13.87  ? 679  PHE C CB    1 
ATOM   8858  C  CG    . PHE C 2  679  ? -2.683  5.044   107.989 1.00 19.64  ? 679  PHE C CG    1 
ATOM   8859  C  CD1   . PHE C 2  679  ? -2.710  4.636   109.314 1.00 23.21  ? 679  PHE C CD1   1 
ATOM   8860  C  CD2   . PHE C 2  679  ? -2.118  6.268   107.679 1.00 16.37  ? 679  PHE C CD2   1 
ATOM   8861  C  CE1   . PHE C 2  679  ? -2.196  5.443   110.313 1.00 20.25  ? 679  PHE C CE1   1 
ATOM   8862  C  CE2   . PHE C 2  679  ? -1.606  7.078   108.671 1.00 17.96  ? 679  PHE C CE2   1 
ATOM   8863  C  CZ    . PHE C 2  679  ? -1.642  6.665   109.989 1.00 20.57  ? 679  PHE C CZ    1 
ATOM   8864  N  N     . ASP C 2  680  ? -5.903  6.449   106.254 1.00 14.25  ? 680  ASP C N     1 
ATOM   8865  C  CA    . ASP C 2  680  ? -6.109  7.830   105.794 1.00 12.94  ? 680  ASP C CA    1 
ATOM   8866  C  C     . ASP C 2  680  ? -6.003  8.109   104.291 1.00 12.34  ? 680  ASP C C     1 
ATOM   8867  O  O     . ASP C 2  680  ? -5.597  9.197   103.894 1.00 12.41  ? 680  ASP C O     1 
ATOM   8868  C  CB    . ASP C 2  680  ? -5.240  8.802   106.588 1.00 15.83  ? 680  ASP C CB    1 
ATOM   8869  C  CG    . ASP C 2  680  ? -5.815  9.095   107.953 1.00 25.90  ? 680  ASP C CG    1 
ATOM   8870  O  OD1   . ASP C 2  680  ? -7.040  8.909   108.128 1.00 22.81  ? 680  ASP C OD1   1 
ATOM   8871  O  OD2   . ASP C 2  680  ? -5.048  9.509   108.847 1.00 37.99  ? 680  ASP C OD2   1 
ATOM   8872  N  N     . GLY C 2  681  ? -6.402  7.153   103.460 1.00 13.81  ? 681  GLY C N     1 
ATOM   8873  C  CA    . GLY C 2  681  ? -6.277  7.305   102.021 1.00 9.89   ? 681  GLY C CA    1 
ATOM   8874  C  C     . GLY C 2  681  ? -4.861  7.259   101.469 1.00 10.99  ? 681  GLY C C     1 
ATOM   8875  O  O     . GLY C 2  681  ? -4.667  7.381   100.264 1.00 13.72  ? 681  GLY C O     1 
ATOM   8876  N  N     . TYR C 2  682  ? -3.864  7.084   102.331 1.00 12.07  ? 682  TYR C N     1 
ATOM   8877  C  CA    . TYR C 2  682  ? -2.480  7.010   101.865 1.00 10.22  ? 682  TYR C CA    1 
ATOM   8878  C  C     . TYR C 2  682  ? -2.117  5.651   101.265 1.00 10.67  ? 682  TYR C C     1 
ATOM   8879  O  O     . TYR C 2  682  ? -1.183  5.548   100.474 1.00 13.89  ? 682  TYR C O     1 
ATOM   8880  C  CB    . TYR C 2  682  ? -1.502  7.390   102.973 1.00 10.09  ? 682  TYR C CB    1 
ATOM   8881  C  CG    . TYR C 2  682  ? -1.458  8.875   103.245 1.00 15.15  ? 682  TYR C CG    1 
ATOM   8882  C  CD1   . TYR C 2  682  ? -0.733  9.729   102.422 1.00 14.62  ? 682  TYR C CD1   1 
ATOM   8883  C  CD2   . TYR C 2  682  ? -2.138  9.426   104.324 1.00 12.83  ? 682  TYR C CD2   1 
ATOM   8884  C  CE1   . TYR C 2  682  ? -0.688  11.090  102.665 1.00 12.27  ? 682  TYR C CE1   1 
ATOM   8885  C  CE2   . TYR C 2  682  ? -2.096  10.786  104.575 1.00 11.10  ? 682  TYR C CE2   1 
ATOM   8886  C  CZ    . TYR C 2  682  ? -1.371  11.612  103.742 1.00 12.22  ? 682  TYR C CZ    1 
ATOM   8887  O  OH    . TYR C 2  682  ? -1.328  12.965  103.985 1.00 17.31  ? 682  TYR C OH    1 
ATOM   8888  N  N     . ASN C 2  683  ? -2.831  4.607   101.667 1.00 8.94   ? 683  ASN C N     1 
ATOM   8889  C  CA    . ASN C 2  683  ? -2.722  3.311   101.003 1.00 9.24   ? 683  ASN C CA    1 
ATOM   8890  C  C     . ASN C 2  683  ? -3.789  3.049   99.932  1.00 11.17  ? 683  ASN C C     1 
ATOM   8891  O  O     . ASN C 2  683  ? -3.891  1.941   99.410  1.00 15.90  ? 683  ASN C O     1 
ATOM   8892  C  CB    . ASN C 2  683  ? -2.591  2.149   101.994 1.00 9.67   ? 683  ASN C CB    1 
ATOM   8893  C  CG    . ASN C 2  683  ? -3.687  2.130   103.026 1.00 13.08  ? 683  ASN C CG    1 
ATOM   8894  O  OD1   . ASN C 2  683  ? -4.745  2.735   102.845 1.00 17.94  ? 683  ASN C OD1   1 
ATOM   8895  N  ND2   . ASN C 2  683  ? -3.443  1.424   104.123 1.00 10.90  ? 683  ASN C ND2   1 
ATOM   8896  N  N     . PHE C 2  684  ? -4.601  4.062   99.640  1.00 10.69  ? 684  PHE C N     1 
ATOM   8897  C  CA    . PHE C 2  684  ? -5.682  3.958   98.656  1.00 11.86  ? 684  PHE C CA    1 
ATOM   8898  C  C     . PHE C 2  684  ? -5.206  3.409   97.311  1.00 11.55  ? 684  PHE C C     1 
ATOM   8899  O  O     . PHE C 2  684  ? -4.230  3.898   96.745  1.00 10.08  ? 684  PHE C O     1 
ATOM   8900  C  CB    . PHE C 2  684  ? -6.311  5.343   98.452  1.00 11.72  ? 684  PHE C CB    1 
ATOM   8901  C  CG    . PHE C 2  684  ? -7.350  5.402   97.360  1.00 9.19   ? 684  PHE C CG    1 
ATOM   8902  C  CD1   . PHE C 2  684  ? -8.676  5.106   97.628  1.00 12.03  ? 684  PHE C CD1   1 
ATOM   8903  C  CD2   . PHE C 2  684  ? -7.006  5.783   96.074  1.00 7.91   ? 684  PHE C CD2   1 
ATOM   8904  C  CE1   . PHE C 2  684  ? -9.633  5.166   96.629  1.00 11.21  ? 684  PHE C CE1   1 
ATOM   8905  C  CE2   . PHE C 2  684  ? -7.959  5.845   95.075  1.00 8.19   ? 684  PHE C CE2   1 
ATOM   8906  C  CZ    . PHE C 2  684  ? -9.272  5.536   95.353  1.00 7.54   ? 684  PHE C CZ    1 
ATOM   8907  N  N     . GLU C 2  685  ? -5.913  2.397   96.810  1.00 13.18  ? 685  GLU C N     1 
ATOM   8908  C  CA    . GLU C 2  685  ? -5.614  1.771   95.516  1.00 12.24  ? 685  GLU C CA    1 
ATOM   8909  C  C     . GLU C 2  685  ? -4.190  1.258   95.342  1.00 10.43  ? 685  GLU C C     1 
ATOM   8910  O  O     . GLU C 2  685  ? -3.495  1.652   94.406  1.00 10.14  ? 685  GLU C O     1 
ATOM   8911  C  CB    . GLU C 2  685  ? -6.022  2.660   94.336  1.00 9.59   ? 685  GLU C CB    1 
ATOM   8912  C  CG    . GLU C 2  685  ? -7.497  2.542   93.942  1.00 13.50  ? 685  GLU C CG    1 
ATOM   8913  C  CD    . GLU C 2  685  ? -7.865  1.189   93.322  1.00 31.87  ? 685  GLU C CD    1 
ATOM   8914  O  OE1   . GLU C 2  685  ? -6.995  0.293   93.246  1.00 31.84  ? 685  GLU C OE1   1 
ATOM   8915  O  OE2   . GLU C 2  685  ? -9.031  1.017   92.899  1.00 33.72  ? 685  GLU C OE2   1 
ATOM   8916  N  N     . ASP C 2  686  ? -3.770  0.404   96.273  1.00 11.28  ? 686  ASP C N     1 
ATOM   8917  C  CA    . ASP C 2  686  ? -2.501  -0.332  96.199  1.00 14.07  ? 686  ASP C CA    1 
ATOM   8918  C  C     . ASP C 2  686  ? -1.286  0.476   96.645  1.00 13.26  ? 686  ASP C C     1 
ATOM   8919  O  O     . ASP C 2  686  ? -0.172  -0.046  96.677  1.00 16.42  ? 686  ASP C O     1 
ATOM   8920  C  CB    . ASP C 2  686  ? -2.247  -0.951  94.815  1.00 18.56  ? 686  ASP C CB    1 
ATOM   8921  C  CG    . ASP C 2  686  ? -3.405  -1.807  94.331  1.00 30.76  ? 686  ASP C CG    1 
ATOM   8922  O  OD1   . ASP C 2  686  ? -3.490  -2.053  93.107  1.00 33.44  ? 686  ASP C OD1   1 
ATOM   8923  O  OD2   . ASP C 2  686  ? -4.241  -2.220  95.164  1.00 30.91  ? 686  ASP C OD2   1 
ATOM   8924  N  N     . ALA C 2  687  ? -1.486  1.747   96.971  1.00 9.45   ? 687  ALA C N     1 
ATOM   8925  C  CA    . ALA C 2  687  ? -0.404  2.546   97.531  1.00 8.99   ? 687  ALA C CA    1 
ATOM   8926  C  C     . ALA C 2  687  ? 0.003   1.980   98.895  1.00 12.25  ? 687  ALA C C     1 
ATOM   8927  O  O     . ALA C 2  687  ? -0.774  1.276   99.541  1.00 13.46  ? 687  ALA C O     1 
ATOM   8928  C  CB    . ALA C 2  687  ? -0.824  3.995   97.655  1.00 8.54   ? 687  ALA C CB    1 
ATOM   8929  N  N     . ILE C 2  688  ? 1.229   2.268   99.319  1.00 11.82  ? 688  ILE C N     1 
ATOM   8930  C  CA    . ILE C 2  688  ? 1.767   1.695   100.550 1.00 9.90   ? 688  ILE C CA    1 
ATOM   8931  C  C     . ILE C 2  688  ? 2.259   2.778   101.509 1.00 11.08  ? 688  ILE C C     1 
ATOM   8932  O  O     . ILE C 2  688  ? 2.840   3.774   101.084 1.00 11.24  ? 688  ILE C O     1 
ATOM   8933  C  CB    . ILE C 2  688  ? 2.928   0.728   100.240 1.00 8.54   ? 688  ILE C CB    1 
ATOM   8934  C  CG1   . ILE C 2  688  ? 2.465   -0.383  99.302  1.00 10.16  ? 688  ILE C CG1   1 
ATOM   8935  C  CG2   . ILE C 2  688  ? 3.492   0.118   101.507 1.00 8.85   ? 688  ILE C CG2   1 
ATOM   8936  C  CD1   . ILE C 2  688  ? 3.509   -1.446  99.076  1.00 12.71  ? 688  ILE C CD1   1 
ATOM   8937  N  N     . VAL C 2  689  ? 2.026   2.579   102.804 1.00 13.55  ? 689  VAL C N     1 
ATOM   8938  C  CA    . VAL C 2  689  ? 2.546   3.490   103.820 1.00 14.21  ? 689  VAL C CA    1 
ATOM   8939  C  C     . VAL C 2  689  ? 3.778   2.925   104.536 1.00 14.92  ? 689  VAL C C     1 
ATOM   8940  O  O     . VAL C 2  689  ? 3.755   1.807   105.053 1.00 15.55  ? 689  VAL C O     1 
ATOM   8941  C  CB    . VAL C 2  689  ? 1.472   3.850   104.849 1.00 9.14   ? 689  VAL C CB    1 
ATOM   8942  C  CG1   . VAL C 2  689  ? 2.024   4.844   105.840 1.00 11.73  ? 689  VAL C CG1   1 
ATOM   8943  C  CG2   . VAL C 2  689  ? 0.263   4.425   104.150 1.00 13.08  ? 689  VAL C CG2   1 
ATOM   8944  N  N     . ILE C 2  690  ? 4.844   3.718   104.564 1.00 12.99  ? 690  ILE C N     1 
ATOM   8945  C  CA    . ILE C 2  690  ? 6.134   3.304   105.110 1.00 13.16  ? 690  ILE C CA    1 
ATOM   8946  C  C     . ILE C 2  690  ? 6.484   4.117   106.352 1.00 16.73  ? 690  ILE C C     1 
ATOM   8947  O  O     . ILE C 2  690  ? 6.170   5.305   106.428 1.00 17.73  ? 690  ILE C O     1 
ATOM   8948  C  CB    . ILE C 2  690  ? 7.246   3.472   104.038 1.00 15.88  ? 690  ILE C CB    1 
ATOM   8949  C  CG1   . ILE C 2  690  ? 7.212   2.301   103.065 1.00 17.72  ? 690  ILE C CG1   1 
ATOM   8950  C  CG2   . ILE C 2  690  ? 8.629   3.571   104.654 1.00 15.03  ? 690  ILE C CG2   1 
ATOM   8951  C  CD1   . ILE C 2  690  ? 7.295   0.968   103.748 1.00 24.05  ? 690  ILE C CD1   1 
ATOM   8952  N  N     . SER C 2  691  ? 7.121   3.477   107.331 1.00 16.25  ? 691  SER C N     1 
ATOM   8953  C  CA    . SER C 2  691  ? 7.633   4.194   108.495 1.00 17.48  ? 691  SER C CA    1 
ATOM   8954  C  C     . SER C 2  691  ? 9.070   4.663   108.270 1.00 21.37  ? 691  SER C C     1 
ATOM   8955  O  O     . SER C 2  691  ? 9.886   3.943   107.691 1.00 18.78  ? 691  SER C O     1 
ATOM   8956  C  CB    . SER C 2  691  ? 7.550   3.323   109.750 1.00 19.22  ? 691  SER C CB    1 
ATOM   8957  O  OG    . SER C 2  691  ? 8.832   2.888   110.156 1.00 30.52  ? 691  SER C OG    1 
ATOM   8958  N  N     . GLU C 2  692  ? 9.369   5.875   108.734 1.00 23.86  ? 692  GLU C N     1 
ATOM   8959  C  CA    . GLU C 2  692  ? 10.706  6.459   108.623 1.00 24.26  ? 692  GLU C CA    1 
ATOM   8960  C  C     . GLU C 2  692  ? 11.751  5.596   109.337 1.00 24.58  ? 692  GLU C C     1 
ATOM   8961  O  O     . GLU C 2  692  ? 12.953  5.677   109.057 1.00 25.44  ? 692  GLU C O     1 
ATOM   8962  C  CB    . GLU C 2  692  ? 10.698  7.878   109.199 1.00 24.94  ? 692  GLU C CB    1 
ATOM   8963  C  CG    . GLU C 2  692  ? 11.919  8.718   108.858 1.00 31.43  ? 692  GLU C CG    1 
ATOM   8964  C  CD    . GLU C 2  692  ? 11.782  10.157  109.329 1.00 40.78  ? 692  GLU C CD    1 
ATOM   8965  O  OE1   . GLU C 2  692  ? 10.855  10.439  110.115 1.00 39.60  ? 692  GLU C OE1   1 
ATOM   8966  O  OE2   . GLU C 2  692  ? 12.597  11.009  108.912 1.00 42.84  ? 692  GLU C OE2   1 
ATOM   8967  N  N     . GLU C 2  693  ? 11.275  4.760   110.256 1.00 26.63  ? 693  GLU C N     1 
ATOM   8968  C  CA    . GLU C 2  693  ? 12.126  3.838   110.994 1.00 29.31  ? 693  GLU C CA    1 
ATOM   8969  C  C     . GLU C 2  693  ? 12.814  2.849   110.057 1.00 29.23  ? 693  GLU C C     1 
ATOM   8970  O  O     . GLU C 2  693  ? 13.812  2.227   110.424 1.00 34.03  ? 693  GLU C O     1 
ATOM   8971  C  CB    . GLU C 2  693  ? 11.306  3.087   112.048 1.00 31.51  ? 693  GLU C CB    1 
ATOM   8972  C  CG    . GLU C 2  693  ? 12.134  2.526   113.189 1.00 50.63  ? 693  GLU C CG    1 
ATOM   8973  C  CD    . GLU C 2  693  ? 12.799  3.617   114.010 1.00 62.26  ? 693  GLU C CD    1 
ATOM   8974  O  OE1   . GLU C 2  693  ? 12.197  4.705   114.155 1.00 54.63  ? 693  GLU C OE1   1 
ATOM   8975  O  OE2   . GLU C 2  693  ? 13.926  3.391   114.504 1.00 67.15  ? 693  GLU C OE2   1 
ATOM   8976  N  N     . LEU C 2  694  ? 12.275  2.703   108.849 1.00 26.37  ? 694  LEU C N     1 
ATOM   8977  C  CA    . LEU C 2  694  ? 12.898  1.866   107.831 1.00 25.13  ? 694  LEU C CA    1 
ATOM   8978  C  C     . LEU C 2  694  ? 14.113  2.558   107.227 1.00 22.32  ? 694  LEU C C     1 
ATOM   8979  O  O     . LEU C 2  694  ? 15.120  1.916   106.933 1.00 25.42  ? 694  LEU C O     1 
ATOM   8980  C  CB    . LEU C 2  694  ? 11.898  1.505   106.731 1.00 18.54  ? 694  LEU C CB    1 
ATOM   8981  C  CG    . LEU C 2  694  ? 10.804  0.505   107.101 1.00 15.11  ? 694  LEU C CG    1 
ATOM   8982  C  CD1   . LEU C 2  694  ? 10.105  0.011   105.856 1.00 13.66  ? 694  LEU C CD1   1 
ATOM   8983  C  CD2   . LEU C 2  694  ? 11.385  -0.659  107.878 1.00 20.48  ? 694  LEU C CD2   1 
ATOM   8984  N  N     . LEU C 2  695  ? 14.015  3.870   107.045 1.00 21.66  ? 695  LEU C N     1 
ATOM   8985  C  CA    . LEU C 2  695  ? 15.126  4.649   106.512 1.00 22.86  ? 695  LEU C CA    1 
ATOM   8986  C  C     . LEU C 2  695  ? 16.208  4.856   107.566 1.00 31.55  ? 695  LEU C C     1 
ATOM   8987  O  O     . LEU C 2  695  ? 17.397  4.894   107.245 1.00 31.38  ? 695  LEU C O     1 
ATOM   8988  C  CB    . LEU C 2  695  ? 14.637  6.000   105.990 1.00 16.40  ? 695  LEU C CB    1 
ATOM   8989  C  CG    . LEU C 2  695  ? 13.571  5.916   104.902 1.00 12.95  ? 695  LEU C CG    1 
ATOM   8990  C  CD1   . LEU C 2  695  ? 13.218  7.293   104.373 1.00 14.00  ? 695  LEU C CD1   1 
ATOM   8991  C  CD2   . LEU C 2  695  ? 14.057  5.024   103.788 1.00 16.53  ? 695  LEU C CD2   1 
ATOM   8992  N  N     . LYS C 2  696  ? 15.791  4.994   108.823 1.00 31.92  ? 696  LYS C N     1 
ATOM   8993  C  CA    . LYS C 2  696  ? 16.741  5.193   109.914 1.00 25.22  ? 696  LYS C CA    1 
ATOM   8994  C  C     . LYS C 2  696  ? 17.700  4.015   110.045 1.00 29.63  ? 696  LYS C C     1 
ATOM   8995  O  O     . LYS C 2  696  ? 18.907  4.206   110.188 1.00 35.38  ? 696  LYS C O     1 
ATOM   8996  C  CB    . LYS C 2  696  ? 16.015  5.422   111.240 1.00 26.66  ? 696  LYS C CB    1 
ATOM   8997  C  CG    . LYS C 2  696  ? 15.256  6.731   111.326 1.00 27.83  ? 696  LYS C CG    1 
ATOM   8998  C  CD    . LYS C 2  696  ? 14.454  6.806   112.615 1.00 32.76  ? 696  LYS C CD    1 
ATOM   8999  C  CE    . LYS C 2  696  ? 13.449  7.947   112.584 1.00 36.24  ? 696  LYS C CE    1 
ATOM   9000  N  NZ    . LYS C 2  696  ? 12.557  7.932   113.777 1.00 34.02  ? 696  LYS C NZ    1 
ATOM   9001  N  N     . ARG C 2  697  ? 17.162  2.800   109.990 1.00 23.94  ? 697  ARG C N     1 
ATOM   9002  C  CA    . ARG C 2  697  ? 17.982  1.597   110.147 1.00 30.94  ? 697  ARG C CA    1 
ATOM   9003  C  C     . ARG C 2  697  ? 18.534  1.037   108.829 1.00 34.21  ? 697  ARG C C     1 
ATOM   9004  O  O     . ARG C 2  697  ? 19.109  -0.053  108.800 1.00 32.44  ? 697  ARG C O     1 
ATOM   9005  C  CB    . ARG C 2  697  ? 17.308  0.525   111.023 1.00 35.51  ? 697  ARG C CB    1 
ATOM   9006  C  CG    . ARG C 2  697  ? 16.113  -0.212  110.439 1.00 34.31  ? 697  ARG C CG    1 
ATOM   9007  C  CD    . ARG C 2  697  ? 15.652  -1.267  111.447 1.00 33.49  ? 697  ARG C CD    1 
ATOM   9008  N  NE    . ARG C 2  697  ? 14.555  -2.108  110.971 1.00 40.65  ? 697  ARG C NE    1 
ATOM   9009  C  CZ    . ARG C 2  697  ? 13.275  -1.920  111.283 1.00 36.93  ? 697  ARG C CZ    1 
ATOM   9010  N  NH1   . ARG C 2  697  ? 12.924  -0.909  112.067 1.00 39.35  ? 697  ARG C NH1   1 
ATOM   9011  N  NH2   . ARG C 2  697  ? 12.345  -2.742  110.811 1.00 19.49  ? 697  ARG C NH2   1 
ATOM   9012  N  N     . ASP C 2  698  ? 18.324  1.789   107.748 1.00 32.31  ? 698  ASP C N     1 
ATOM   9013  C  CA    . ASP C 2  698  ? 18.846  1.462   106.415 1.00 27.95  ? 698  ASP C CA    1 
ATOM   9014  C  C     . ASP C 2  698  ? 18.240  0.209   105.795 1.00 25.26  ? 698  ASP C C     1 
ATOM   9015  O  O     . ASP C 2  698  ? 18.883  -0.470  104.992 1.00 22.34  ? 698  ASP C O     1 
ATOM   9016  C  CB    . ASP C 2  698  ? 20.378  1.359   106.422 1.00 30.13  ? 698  ASP C CB    1 
ATOM   9017  C  CG    . ASP C 2  698  ? 21.057  2.699   106.204 1.00 40.72  ? 698  ASP C CG    1 
ATOM   9018  O  OD1   . ASP C 2  698  ? 21.886  3.092   107.053 1.00 44.08  ? 698  ASP C OD1   1 
ATOM   9019  O  OD2   . ASP C 2  698  ? 20.770  3.354   105.177 1.00 39.15  ? 698  ASP C OD2   1 
ATOM   9020  N  N     . PHE C 2  699  ? 16.998  -0.085  106.165 1.00 25.48  ? 699  PHE C N     1 
ATOM   9021  C  CA    . PHE C 2  699  ? 16.227  -1.102  105.470 1.00 19.06  ? 699  PHE C CA    1 
ATOM   9022  C  C     . PHE C 2  699  ? 15.858  -0.555  104.101 1.00 17.39  ? 699  PHE C C     1 
ATOM   9023  O  O     . PHE C 2  699  ? 15.639  0.646   103.950 1.00 21.22  ? 699  PHE C O     1 
ATOM   9024  C  CB    . PHE C 2  699  ? 14.966  -1.464  106.255 1.00 18.13  ? 699  PHE C CB    1 
ATOM   9025  C  CG    . PHE C 2  699  ? 15.135  -2.655  107.157 1.00 24.20  ? 699  PHE C CG    1 
ATOM   9026  C  CD1   . PHE C 2  699  ? 16.393  -3.169  107.422 1.00 23.87  ? 699  PHE C CD1   1 
ATOM   9027  C  CD2   . PHE C 2  699  ? 14.033  -3.273  107.724 1.00 23.65  ? 699  PHE C CD2   1 
ATOM   9028  C  CE1   . PHE C 2  699  ? 16.549  -4.265  108.244 1.00 18.11  ? 699  PHE C CE1   1 
ATOM   9029  C  CE2   . PHE C 2  699  ? 14.186  -4.374  108.543 1.00 19.19  ? 699  PHE C CE2   1 
ATOM   9030  C  CZ    . PHE C 2  699  ? 15.445  -4.867  108.803 1.00 19.43  ? 699  PHE C CZ    1 
ATOM   9031  N  N     . TYR C 2  700  ? 15.800  -1.436  103.108 1.00 17.66  ? 700  TYR C N     1 
ATOM   9032  C  CA    . TYR C 2  700  ? 15.499  -1.042  101.734 1.00 16.55  ? 700  TYR C CA    1 
ATOM   9033  C  C     . TYR C 2  700  ? 16.410  0.080   101.249 1.00 19.04  ? 700  TYR C C     1 
ATOM   9034  O  O     . TYR C 2  700  ? 15.944  1.112   100.768 1.00 22.85  ? 700  TYR C O     1 
ATOM   9035  C  CB    . TYR C 2  700  ? 14.026  -0.657  101.582 1.00 14.33  ? 700  TYR C CB    1 
ATOM   9036  C  CG    . TYR C 2  700  ? 13.094  -1.805  101.872 1.00 16.33  ? 700  TYR C CG    1 
ATOM   9037  C  CD1   . TYR C 2  700  ? 12.375  -1.860  103.057 1.00 16.15  ? 700  TYR C CD1   1 
ATOM   9038  C  CD2   . TYR C 2  700  ? 12.954  -2.851  100.968 1.00 18.18  ? 700  TYR C CD2   1 
ATOM   9039  C  CE1   . TYR C 2  700  ? 11.532  -2.919  103.328 1.00 14.22  ? 700  TYR C CE1   1 
ATOM   9040  C  CE2   . TYR C 2  700  ? 12.113  -3.911  101.229 1.00 12.39  ? 700  TYR C CE2   1 
ATOM   9041  C  CZ    . TYR C 2  700  ? 11.406  -3.938  102.409 1.00 13.80  ? 700  TYR C CZ    1 
ATOM   9042  O  OH    . TYR C 2  700  ? 10.571  -4.992  102.674 1.00 14.44  ? 700  TYR C OH    1 
ATOM   9043  N  N     . THR C 2  701  ? 17.712  -0.125  101.409 1.00 17.52  ? 701  THR C N     1 
ATOM   9044  C  CA    . THR C 2  701  ? 18.707  0.772   100.843 1.00 17.21  ? 701  THR C CA    1 
ATOM   9045  C  C     . THR C 2  701  ? 19.610  -0.034  99.916  1.00 16.10  ? 701  THR C C     1 
ATOM   9046  O  O     . THR C 2  701  ? 20.076  -1.114  100.277 1.00 17.01  ? 701  THR C O     1 
ATOM   9047  C  CB    . THR C 2  701  ? 19.533  1.472   101.936 1.00 16.31  ? 701  THR C CB    1 
ATOM   9048  O  OG1   . THR C 2  701  ? 18.670  2.302   102.723 1.00 17.89  ? 701  THR C OG1   1 
ATOM   9049  C  CG2   . THR C 2  701  ? 20.618  2.336   101.316 1.00 15.86  ? 701  THR C CG2   1 
ATOM   9050  N  N     . SER C 2  702  ? 19.842  0.480   98.715  1.00 13.96  ? 702  SER C N     1 
ATOM   9051  C  CA    . SER C 2  702  ? 20.573  -0.286  97.714  1.00 14.86  ? 702  SER C CA    1 
ATOM   9052  C  C     . SER C 2  702  ? 21.665  0.535   97.046  1.00 16.06  ? 702  SER C C     1 
ATOM   9053  O  O     . SER C 2  702  ? 21.550  1.744   96.933  1.00 16.99  ? 702  SER C O     1 
ATOM   9054  C  CB    . SER C 2  702  ? 19.603  -0.818  96.663  1.00 16.86  ? 702  SER C CB    1 
ATOM   9055  O  OG    . SER C 2  702  ? 18.771  0.220   96.176  1.00 12.22  ? 702  SER C OG    1 
ATOM   9056  N  N     . ILE C 2  703  ? 22.727  -0.127  96.602  1.00 17.67  ? 703  ILE C N     1 
ATOM   9057  C  CA    . ILE C 2  703  ? 23.815  0.566   95.920  1.00 17.15  ? 703  ILE C CA    1 
ATOM   9058  C  C     . ILE C 2  703  ? 23.681  0.421   94.411  1.00 15.25  ? 703  ILE C C     1 
ATOM   9059  O  O     . ILE C 2  703  ? 23.459  -0.675  93.901  1.00 14.58  ? 703  ILE C O     1 
ATOM   9060  C  CB    . ILE C 2  703  ? 25.190  0.035   96.365  1.00 17.60  ? 703  ILE C CB    1 
ATOM   9061  C  CG1   . ILE C 2  703  ? 25.396  0.282   97.856  1.00 17.34  ? 703  ILE C CG1   1 
ATOM   9062  C  CG2   . ILE C 2  703  ? 26.303  0.699   95.580  1.00 17.42  ? 703  ILE C CG2   1 
ATOM   9063  C  CD1   . ILE C 2  703  ? 26.682  -0.285  98.385  1.00 24.24  ? 703  ILE C CD1   1 
ATOM   9064  N  N     . HIS C 2  704  ? 23.812  1.534   93.697  1.00 19.07  ? 704  HIS C N     1 
ATOM   9065  C  CA    . HIS C 2  704  ? 23.700  1.517   92.244  1.00 20.35  ? 704  HIS C CA    1 
ATOM   9066  C  C     . HIS C 2  704  ? 24.858  2.254   91.581  1.00 20.40  ? 704  HIS C C     1 
ATOM   9067  O  O     . HIS C 2  704  ? 25.116  3.416   91.883  1.00 25.81  ? 704  HIS C O     1 
ATOM   9068  C  CB    . HIS C 2  704  ? 22.366  2.126   91.811  1.00 24.51  ? 704  HIS C CB    1 
ATOM   9069  C  CG    . HIS C 2  704  ? 21.173  1.419   92.371  1.00 23.84  ? 704  HIS C CG    1 
ATOM   9070  N  ND1   . HIS C 2  704  ? 20.389  0.568   91.619  1.00 25.91  ? 704  HIS C ND1   1 
ATOM   9071  C  CD2   . HIS C 2  704  ? 20.634  1.425   93.614  1.00 18.73  ? 704  HIS C CD2   1 
ATOM   9072  C  CE1   . HIS C 2  704  ? 19.418  0.089   92.372  1.00 23.88  ? 704  HIS C CE1   1 
ATOM   9073  N  NE2   . HIS C 2  704  ? 19.542  0.592   93.587  1.00 19.41  ? 704  HIS C NE2   1 
ATOM   9074  N  N     . ILE C 2  705  ? 25.552  1.574   90.674  1.00 20.74  ? 705  ILE C N     1 
ATOM   9075  C  CA    . ILE C 2  705  ? 26.687  2.165   89.974  1.00 20.60  ? 705  ILE C CA    1 
ATOM   9076  C  C     . ILE C 2  705  ? 26.362  2.432   88.508  1.00 22.19  ? 705  ILE C C     1 
ATOM   9077  O  O     . ILE C 2  705  ? 25.928  1.535   87.788  1.00 25.22  ? 705  ILE C O     1 
ATOM   9078  C  CB    . ILE C 2  705  ? 27.925  1.254   90.047  1.00 24.36  ? 705  ILE C CB    1 
ATOM   9079  C  CG1   . ILE C 2  705  ? 28.270  0.931   91.503  1.00 26.28  ? 705  ILE C CG1   1 
ATOM   9080  C  CG2   . ILE C 2  705  ? 29.106  1.905   89.350  1.00 24.60  ? 705  ILE C CG2   1 
ATOM   9081  C  CD1   . ILE C 2  705  ? 29.481  0.036   91.659  1.00 24.41  ? 705  ILE C CD1   1 
ATOM   9082  N  N     . GLU C 2  706  ? 26.573  3.669   88.071  1.00 22.49  ? 706  GLU C N     1 
ATOM   9083  C  CA    . GLU C 2  706  ? 26.359  4.036   86.678  1.00 22.46  ? 706  GLU C CA    1 
ATOM   9084  C  C     . GLU C 2  706  ? 27.691  4.330   85.995  1.00 20.18  ? 706  GLU C C     1 
ATOM   9085  O  O     . GLU C 2  706  ? 28.616  4.837   86.621  1.00 22.96  ? 706  GLU C O     1 
ATOM   9086  C  CB    . GLU C 2  706  ? 25.430  5.247   86.582  1.00 28.01  ? 706  GLU C CB    1 
ATOM   9087  C  CG    . GLU C 2  706  ? 24.962  5.553   85.168  1.00 35.40  ? 706  GLU C CG    1 
ATOM   9088  C  CD    . GLU C 2  706  ? 24.295  4.360   84.506  1.00 37.00  ? 706  GLU C CD    1 
ATOM   9089  O  OE1   . GLU C 2  706  ? 23.191  3.975   84.951  1.00 42.10  ? 706  GLU C OE1   1 
ATOM   9090  O  OE2   . GLU C 2  706  ? 24.876  3.806   83.546  1.00 32.13  ? 706  GLU C OE2   1 
ATOM   9091  N  N     . ARG C 2  707  ? 27.780  4.011   84.708  1.00 24.85  ? 707  ARG C N     1 
ATOM   9092  C  CA    . ARG C 2  707  ? 29.009  4.202   83.942  1.00 24.79  ? 707  ARG C CA    1 
ATOM   9093  C  C     . ARG C 2  707  ? 28.867  5.305   82.890  1.00 22.88  ? 707  ARG C C     1 
ATOM   9094  O  O     . ARG C 2  707  ? 27.906  5.325   82.117  1.00 22.59  ? 707  ARG C O     1 
ATOM   9095  C  CB    . ARG C 2  707  ? 29.428  2.882   83.288  1.00 28.59  ? 707  ARG C CB    1 
ATOM   9096  C  CG    . ARG C 2  707  ? 30.286  3.025   82.048  1.00 31.23  ? 707  ARG C CG    1 
ATOM   9097  C  CD    . ARG C 2  707  ? 30.372  1.703   81.301  1.00 46.02  ? 707  ARG C CD    1 
ATOM   9098  N  NE    . ARG C 2  707  ? 30.793  1.885   79.915  1.00 64.88  ? 707  ARG C NE    1 
ATOM   9099  C  CZ    . ARG C 2  707  ? 30.787  0.921   78.999  1.00 74.44  ? 707  ARG C CZ    1 
ATOM   9100  N  NH1   . ARG C 2  707  ? 30.381  -0.299  79.323  1.00 83.03  ? 707  ARG C NH1   1 
ATOM   9101  N  NH2   . ARG C 2  707  ? 31.186  1.177   77.760  1.00 71.78  ? 707  ARG C NH2   1 
ATOM   9102  N  N     . TYR C 2  708  ? 29.831  6.222   82.875  1.00 19.60  ? 708  TYR C N     1 
ATOM   9103  C  CA    . TYR C 2  708  ? 29.843  7.335   81.931  1.00 19.05  ? 708  TYR C CA    1 
ATOM   9104  C  C     . TYR C 2  708  ? 31.082  7.238   81.059  1.00 20.14  ? 708  TYR C C     1 
ATOM   9105  O  O     . TYR C 2  708  ? 32.170  6.999   81.561  1.00 22.04  ? 708  TYR C O     1 
ATOM   9106  C  CB    . TYR C 2  708  ? 29.828  8.666   82.679  1.00 13.98  ? 708  TYR C CB    1 
ATOM   9107  C  CG    . TYR C 2  708  ? 28.598  8.853   83.530  1.00 17.52  ? 708  TYR C CG    1 
ATOM   9108  C  CD1   . TYR C 2  708  ? 28.523  8.307   84.804  1.00 22.19  ? 708  TYR C CD1   1 
ATOM   9109  C  CD2   . TYR C 2  708  ? 27.508  9.570   83.060  1.00 22.96  ? 708  TYR C CD2   1 
ATOM   9110  C  CE1   . TYR C 2  708  ? 27.399  8.469   85.587  1.00 23.44  ? 708  TYR C CE1   1 
ATOM   9111  C  CE2   . TYR C 2  708  ? 26.377  9.739   83.836  1.00 24.85  ? 708  TYR C CE2   1 
ATOM   9112  C  CZ    . TYR C 2  708  ? 26.329  9.186   85.098  1.00 29.08  ? 708  TYR C CZ    1 
ATOM   9113  O  OH    . TYR C 2  708  ? 25.207  9.349   85.877  1.00 38.25  ? 708  TYR C OH    1 
ATOM   9114  N  N     . GLU C 2  709  ? 30.920  7.420   79.753  1.00 22.92  ? 709  GLU C N     1 
ATOM   9115  C  CA    . GLU C 2  709  ? 32.012  7.185   78.814  1.00 21.50  ? 709  GLU C CA    1 
ATOM   9116  C  C     . GLU C 2  709  ? 32.152  8.348   77.841  1.00 22.49  ? 709  GLU C C     1 
ATOM   9117  O  O     . GLU C 2  709  ? 31.157  8.893   77.366  1.00 23.67  ? 709  GLU C O     1 
ATOM   9118  C  CB    . GLU C 2  709  ? 31.768  5.879   78.051  1.00 26.65  ? 709  GLU C CB    1 
ATOM   9119  C  CG    . GLU C 2  709  ? 32.896  5.446   77.125  1.00 38.94  ? 709  GLU C CG    1 
ATOM   9120  C  CD    . GLU C 2  709  ? 32.576  4.155   76.377  1.00 58.96  ? 709  GLU C CD    1 
ATOM   9121  O  OE1   . GLU C 2  709  ? 31.391  3.929   76.048  1.00 59.19  ? 709  GLU C OE1   1 
ATOM   9122  O  OE2   . GLU C 2  709  ? 33.509  3.362   76.123  1.00 57.12  ? 709  GLU C OE2   1 
ATOM   9123  N  N     . ILE C 2  710  ? 33.389  8.732   77.549  1.00 22.39  ? 710  ILE C N     1 
ATOM   9124  C  CA    . ILE C 2  710  ? 33.629  9.812   76.598  1.00 24.68  ? 710  ILE C CA    1 
ATOM   9125  C  C     . ILE C 2  710  ? 34.847  9.543   75.711  1.00 25.71  ? 710  ILE C C     1 
ATOM   9126  O  O     . ILE C 2  710  ? 35.857  9.007   76.169  1.00 30.19  ? 710  ILE C O     1 
ATOM   9127  C  CB    . ILE C 2  710  ? 33.760  11.178  77.313  1.00 20.10  ? 710  ILE C CB    1 
ATOM   9128  C  CG1   . ILE C 2  710  ? 33.926  12.307  76.294  1.00 20.55  ? 710  ILE C CG1   1 
ATOM   9129  C  CG2   . ILE C 2  710  ? 34.909  11.159  78.303  1.00 24.68  ? 710  ILE C CG2   1 
ATOM   9130  C  CD1   . ILE C 2  710  ? 34.005  13.678  76.909  1.00 24.36  ? 710  ILE C CD1   1 
ATOM   9131  N  N     . GLU C 2  711  ? 34.732  9.900   74.434  1.00 27.87  ? 711  GLU C N     1 
ATOM   9132  C  CA    . GLU C 2  711  ? 35.820  9.721   73.479  1.00 30.11  ? 711  GLU C CA    1 
ATOM   9133  C  C     . GLU C 2  711  ? 36.406  11.051  73.020  1.00 31.20  ? 711  GLU C C     1 
ATOM   9134  O  O     . GLU C 2  711  ? 35.677  12.000  72.734  1.00 32.94  ? 711  GLU C O     1 
ATOM   9135  C  CB    . GLU C 2  711  ? 35.341  8.938   72.255  1.00 29.72  ? 711  GLU C CB    1 
ATOM   9136  C  CG    . GLU C 2  711  ? 34.987  7.490   72.531  1.00 39.12  ? 711  GLU C CG    1 
ATOM   9137  C  CD    . GLU C 2  711  ? 34.501  6.765   71.291  1.00 44.52  ? 711  GLU C CD    1 
ATOM   9138  O  OE1   . GLU C 2  711  ? 34.316  7.427   70.247  1.00 44.84  ? 711  GLU C OE1   1 
ATOM   9139  O  OE2   . GLU C 2  711  ? 34.304  5.533   71.362  1.00 48.47  ? 711  GLU C OE2   1 
ATOM   9140  N  N     . ALA C 2  712  ? 37.730  11.110  72.953  1.00 32.93  ? 712  ALA C N     1 
ATOM   9141  C  CA    . ALA C 2  712  ? 38.419  12.218  72.309  1.00 34.04  ? 712  ALA C CA    1 
ATOM   9142  C  C     . ALA C 2  712  ? 39.013  11.697  71.008  1.00 34.58  ? 712  ALA C C     1 
ATOM   9143  O  O     . ALA C 2  712  ? 39.869  10.809  71.020  1.00 37.22  ? 712  ALA C O     1 
ATOM   9144  C  CB    . ALA C 2  712  ? 39.501  12.762  73.210  1.00 42.42  ? 712  ALA C CB    1 
ATOM   9145  N  N     . ARG C 2  713  ? 38.548  12.240  69.888  1.00 31.47  ? 713  ARG C N     1 
ATOM   9146  C  CA    . ARG C 2  713  ? 38.907  11.706  68.581  1.00 33.40  ? 713  ARG C CA    1 
ATOM   9147  C  C     . ARG C 2  713  ? 39.746  12.678  67.763  1.00 42.14  ? 713  ARG C C     1 
ATOM   9148  O  O     . ARG C 2  713  ? 40.045  13.787  68.204  1.00 42.99  ? 713  ARG C O     1 
ATOM   9149  C  CB    . ARG C 2  713  ? 37.643  11.346  67.797  1.00 39.44  ? 713  ARG C CB    1 
ATOM   9150  C  CG    . ARG C 2  713  ? 36.676  12.511  67.623  1.00 46.26  ? 713  ARG C CG    1 
ATOM   9151  C  CD    . ARG C 2  713  ? 35.518  12.159  66.700  1.00 56.25  ? 713  ARG C CD    1 
ATOM   9152  N  NE    . ARG C 2  713  ? 35.927  12.052  65.300  1.00 62.73  ? 713  ARG C NE    1 
ATOM   9153  C  CZ    . ARG C 2  713  ? 35.726  12.996  64.384  1.00 57.30  ? 713  ARG C CZ    1 
ATOM   9154  N  NH1   . ARG C 2  713  ? 35.114  14.126  64.715  1.00 51.91  ? 713  ARG C NH1   1 
ATOM   9155  N  NH2   . ARG C 2  713  ? 36.132  12.808  63.136  1.00 51.96  ? 713  ARG C NH2   1 
ATOM   9156  N  N     . ASP C 2  714  ? 40.120  12.246  66.563  1.00 46.06  ? 714  ASP C N     1 
ATOM   9157  C  CA    . ASP C 2  714  ? 40.843  13.091  65.623  1.00 41.59  ? 714  ASP C CA    1 
ATOM   9158  C  C     . ASP C 2  714  ? 39.868  13.702  64.628  1.00 45.52  ? 714  ASP C C     1 
ATOM   9159  O  O     . ASP C 2  714  ? 39.056  12.995  64.031  1.00 47.65  ? 714  ASP C O     1 
ATOM   9160  C  CB    . ASP C 2  714  ? 41.908  12.279  64.884  1.00 40.13  ? 714  ASP C CB    1 
ATOM   9161  C  CG    . ASP C 2  714  ? 43.288  12.441  65.488  1.00 42.48  ? 714  ASP C CG    1 
ATOM   9162  O  OD1   . ASP C 2  714  ? 43.638  13.574  65.884  1.00 41.94  ? 714  ASP C OD1   1 
ATOM   9163  O  OD2   . ASP C 2  714  ? 44.025  11.436  65.561  1.00 37.64  ? 714  ASP C OD2   1 
ATOM   9164  N  N     . THR C 2  715  ? 39.947  15.016  64.453  1.00 45.80  ? 715  THR C N     1 
ATOM   9165  C  CA    . THR C 2  715  ? 39.056  15.711  63.533  1.00 48.71  ? 715  THR C CA    1 
ATOM   9166  C  C     . THR C 2  715  ? 39.865  16.460  62.482  1.00 52.81  ? 715  THR C C     1 
ATOM   9167  O  O     . THR C 2  715  ? 41.052  16.727  62.676  1.00 53.86  ? 715  THR C O     1 
ATOM   9168  C  CB    . THR C 2  715  ? 38.153  16.711  64.277  1.00 46.36  ? 715  THR C CB    1 
ATOM   9169  O  OG1   . THR C 2  715  ? 37.849  16.202  65.580  1.00 51.49  ? 715  THR C OG1   1 
ATOM   9170  C  CG2   . THR C 2  715  ? 36.857  16.946  63.510  1.00 52.89  ? 715  THR C CG2   1 
ATOM   9171  N  N     . LYS C 2  716  ? 39.220  16.792  61.368  1.00 50.12  ? 716  LYS C N     1 
ATOM   9172  C  CA    . LYS C 2  716  ? 39.859  17.570  60.315  1.00 49.44  ? 716  LYS C CA    1 
ATOM   9173  C  C     . LYS C 2  716  ? 40.142  18.991  60.789  1.00 51.88  ? 716  LYS C C     1 
ATOM   9174  O  O     . LYS C 2  716  ? 40.968  19.696  60.212  1.00 62.73  ? 716  LYS C O     1 
ATOM   9175  C  CB    . LYS C 2  716  ? 38.981  17.593  59.064  1.00 44.06  ? 716  LYS C CB    1 
ATOM   9176  C  CG    . LYS C 2  716  ? 38.609  16.211  58.562  1.00 42.93  ? 716  LYS C CG    1 
ATOM   9177  C  CD    . LYS C 2  716  ? 37.951  16.273  57.198  1.00 41.50  ? 716  LYS C CD    1 
ATOM   9178  C  CE    . LYS C 2  716  ? 37.596  14.880  56.706  1.00 46.79  ? 716  LYS C CE    1 
ATOM   9179  N  NZ    . LYS C 2  716  ? 38.783  13.979  56.679  1.00 41.03  ? 716  LYS C NZ    1 
ATOM   9180  N  N     . LEU C 2  717  ? 39.449  19.401  61.845  1.00 51.14  ? 717  LEU C N     1 
ATOM   9181  C  CA    . LEU C 2  717  ? 39.640  20.718  62.441  1.00 47.80  ? 717  LEU C CA    1 
ATOM   9182  C  C     . LEU C 2  717  ? 40.682  20.684  63.556  1.00 48.41  ? 717  LEU C C     1 
ATOM   9183  O  O     . LEU C 2  717  ? 40.911  21.686  64.232  1.00 48.34  ? 717  LEU C O     1 
ATOM   9184  C  CB    . LEU C 2  717  ? 38.312  21.257  62.967  1.00 44.11  ? 717  LEU C CB    1 
ATOM   9185  C  CG    . LEU C 2  717  ? 37.186  21.248  61.934  1.00 49.01  ? 717  LEU C CG    1 
ATOM   9186  C  CD1   . LEU C 2  717  ? 35.873  21.654  62.570  1.00 59.22  ? 717  LEU C CD1   1 
ATOM   9187  C  CD2   . LEU C 2  717  ? 37.526  22.157  60.766  1.00 54.21  ? 717  LEU C CD2   1 
ATOM   9188  N  N     . GLY C 2  718  ? 41.308  19.525  63.742  1.00 50.97  ? 718  GLY C N     1 
ATOM   9189  C  CA    . GLY C 2  718  ? 42.259  19.327  64.822  1.00 45.74  ? 718  GLY C CA    1 
ATOM   9190  C  C     . GLY C 2  718  ? 41.732  18.417  65.917  1.00 46.89  ? 718  GLY C C     1 
ATOM   9191  O  O     . GLY C 2  718  ? 40.543  18.109  65.955  1.00 50.59  ? 718  GLY C O     1 
ATOM   9192  N  N     . PRO C 2  719  ? 42.623  17.976  66.817  1.00 51.01  ? 719  PRO C N     1 
ATOM   9193  C  CA    . PRO C 2  719  ? 42.308  16.973  67.840  1.00 51.04  ? 719  PRO C CA    1 
ATOM   9194  C  C     . PRO C 2  719  ? 41.344  17.461  68.917  1.00 52.38  ? 719  PRO C C     1 
ATOM   9195  O  O     . PRO C 2  719  ? 41.406  18.618  69.333  1.00 49.69  ? 719  PRO C O     1 
ATOM   9196  C  CB    . PRO C 2  719  ? 43.674  16.686  68.483  1.00 45.00  ? 719  PRO C CB    1 
ATOM   9197  C  CG    . PRO C 2  719  ? 44.686  17.214  67.530  1.00 50.43  ? 719  PRO C CG    1 
ATOM   9198  C  CD    . PRO C 2  719  ? 44.035  18.385  66.873  1.00 57.80  ? 719  PRO C CD    1 
ATOM   9199  N  N     . GLU C 2  720  ? 40.460  16.572  69.357  1.00 52.02  ? 720  GLU C N     1 
ATOM   9200  C  CA    . GLU C 2  720  ? 39.707  16.791  70.581  1.00 41.89  ? 720  GLU C CA    1 
ATOM   9201  C  C     . GLU C 2  720  ? 40.643  16.429  71.719  1.00 42.26  ? 720  GLU C C     1 
ATOM   9202  O  O     . GLU C 2  720  ? 41.153  15.313  71.774  1.00 43.73  ? 720  GLU C O     1 
ATOM   9203  C  CB    . GLU C 2  720  ? 38.469  15.893  70.635  1.00 35.67  ? 720  GLU C CB    1 
ATOM   9204  C  CG    . GLU C 2  720  ? 37.341  16.289  69.692  1.00 42.16  ? 720  GLU C CG    1 
ATOM   9205  C  CD    . GLU C 2  720  ? 36.144  15.353  69.789  1.00 51.93  ? 720  GLU C CD    1 
ATOM   9206  O  OE1   . GLU C 2  720  ? 36.310  14.224  70.299  1.00 49.17  ? 720  GLU C OE1   1 
ATOM   9207  O  OE2   . GLU C 2  720  ? 35.036  15.746  69.359  1.00 49.34  ? 720  GLU C OE2   1 
ATOM   9208  N  N     . ARG C 2  721  ? 40.888  17.372  72.619  1.00 49.69  ? 721  ARG C N     1 
ATOM   9209  C  CA    . ARG C 2  721  ? 41.779  17.115  73.744  1.00 47.00  ? 721  ARG C CA    1 
ATOM   9210  C  C     . ARG C 2  721  ? 41.021  17.016  75.063  1.00 43.77  ? 721  ARG C C     1 
ATOM   9211  O  O     . ARG C 2  721  ? 40.064  17.754  75.302  1.00 40.45  ? 721  ARG C O     1 
ATOM   9212  C  CB    . ARG C 2  721  ? 42.870  18.187  73.832  1.00 44.04  ? 721  ARG C CB    1 
ATOM   9213  C  CG    . ARG C 2  721  ? 44.027  17.972  72.870  1.00 50.02  ? 721  ARG C CG    1 
ATOM   9214  C  CD    . ARG C 2  721  ? 45.096  19.040  73.034  1.00 59.99  ? 721  ARG C CD    1 
ATOM   9215  N  NE    . ARG C 2  721  ? 46.317  18.705  72.304  1.00 77.43  ? 721  ARG C NE    1 
ATOM   9216  C  CZ    . ARG C 2  721  ? 46.548  19.034  71.036  1.00 80.14  ? 721  ARG C CZ    1 
ATOM   9217  N  NH1   . ARG C 2  721  ? 45.639  19.713  70.347  1.00 66.87  ? 721  ARG C NH1   1 
ATOM   9218  N  NH2   . ARG C 2  721  ? 47.689  18.683  70.456  1.00 73.48  ? 721  ARG C NH2   1 
ATOM   9219  N  N     . ILE C 2  722  ? 41.455  16.094  75.915  1.00 42.52  ? 722  ILE C N     1 
ATOM   9220  C  CA    . ILE C 2  722  ? 40.905  15.984  77.257  1.00 36.02  ? 722  ILE C CA    1 
ATOM   9221  C  C     . ILE C 2  722  ? 41.884  16.625  78.228  1.00 35.70  ? 722  ILE C C     1 
ATOM   9222  O  O     . ILE C 2  722  ? 42.962  16.090  78.481  1.00 42.63  ? 722  ILE C O     1 
ATOM   9223  C  CB    . ILE C 2  722  ? 40.680  14.513  77.638  1.00 36.53  ? 722  ILE C CB    1 
ATOM   9224  C  CG1   . ILE C 2  722  ? 39.518  13.938  76.827  1.00 36.71  ? 722  ILE C CG1   1 
ATOM   9225  C  CG2   . ILE C 2  722  ? 40.410  14.375  79.125  1.00 42.07  ? 722  ILE C CG2   1 
ATOM   9226  C  CD1   . ILE C 2  722  ? 39.168  12.520  77.182  1.00 31.67  ? 722  ILE C CD1   1 
ATOM   9227  N  N     . THR C 2  723  ? 41.507  17.776  78.773  1.00 36.63  ? 723  THR C N     1 
ATOM   9228  C  CA    . THR C 2  723  ? 42.427  18.540  79.605  1.00 47.31  ? 723  THR C CA    1 
ATOM   9229  C  C     . THR C 2  723  ? 41.754  19.152  80.825  1.00 46.96  ? 723  THR C C     1 
ATOM   9230  O  O     . THR C 2  723  ? 40.542  19.047  81.001  1.00 35.11  ? 723  THR C O     1 
ATOM   9231  C  CB    . THR C 2  723  ? 43.058  19.681  78.802  1.00 47.99  ? 723  THR C CB    1 
ATOM   9232  O  OG1   . THR C 2  723  ? 43.972  20.404  79.636  1.00 59.96  ? 723  THR C OG1   1 
ATOM   9233  C  CG2   . THR C 2  723  ? 41.974  20.627  78.301  1.00 40.03  ? 723  THR C CG2   1 
ATOM   9234  N  N     . ARG C 2  724  ? 42.549  19.806  81.664  1.00 52.63  ? 724  ARG C N     1 
ATOM   9235  C  CA    . ARG C 2  724  ? 42.000  20.459  82.842  1.00 50.45  ? 724  ARG C CA    1 
ATOM   9236  C  C     . ARG C 2  724  ? 41.396  21.829  82.558  1.00 51.10  ? 724  ARG C C     1 
ATOM   9237  O  O     . ARG C 2  724  ? 40.403  22.204  83.177  1.00 59.20  ? 724  ARG C O     1 
ATOM   9238  C  CB    . ARG C 2  724  ? 43.023  20.556  83.972  1.00 52.07  ? 724  ARG C CB    1 
ATOM   9239  C  CG    . ARG C 2  724  ? 42.352  20.674  85.328  1.00 51.49  ? 724  ARG C CG    1 
ATOM   9240  C  CD    . ARG C 2  724  ? 43.308  21.078  86.427  1.00 59.16  ? 724  ARG C CD    1 
ATOM   9241  N  NE    . ARG C 2  724  ? 42.646  21.047  87.728  1.00 56.29  ? 724  ARG C NE    1 
ATOM   9242  C  CZ    . ARG C 2  724  ? 41.821  21.990  88.170  1.00 56.70  ? 724  ARG C CZ    1 
ATOM   9243  N  NH1   . ARG C 2  724  ? 41.552  23.046  87.415  1.00 68.25  ? 724  ARG C NH1   1 
ATOM   9244  N  NH2   . ARG C 2  724  ? 41.264  21.878  89.368  1.00 60.18  ? 724  ARG C NH2   1 
ATOM   9245  N  N     . ASP C 2  725  ? 41.988  22.584  81.636  1.00 49.66  ? 725  ASP C N     1 
ATOM   9246  C  CA    . ASP C 2  725  ? 41.501  23.942  81.407  1.00 58.73  ? 725  ASP C CA    1 
ATOM   9247  C  C     . ASP C 2  725  ? 40.485  24.038  80.270  1.00 54.99  ? 725  ASP C C     1 
ATOM   9248  O  O     . ASP C 2  725  ? 40.798  23.860  79.092  1.00 52.96  ? 725  ASP C O     1 
ATOM   9249  C  CB    . ASP C 2  725  ? 42.654  24.944  81.229  1.00 69.51  ? 725  ASP C CB    1 
ATOM   9250  C  CG    . ASP C 2  725  ? 43.418  24.745  79.936  1.00 72.78  ? 725  ASP C CG    1 
ATOM   9251  O  OD1   . ASP C 2  725  ? 43.579  23.582  79.509  1.00 80.80  ? 725  ASP C OD1   1 
ATOM   9252  O  OD2   . ASP C 2  725  ? 43.854  25.757  79.345  1.00 72.64  ? 725  ASP C OD2   1 
ATOM   9253  N  N     . ILE C 2  726  ? 39.251  24.317  80.664  1.00 50.42  ? 726  ILE C N     1 
ATOM   9254  C  CA    . ILE C 2  726  ? 38.148  24.523  79.746  1.00 47.83  ? 726  ILE C CA    1 
ATOM   9255  C  C     . ILE C 2  726  ? 37.875  26.015  79.618  1.00 59.17  ? 726  ILE C C     1 
ATOM   9256  O  O     . ILE C 2  726  ? 37.771  26.712  80.627  1.00 68.36  ? 726  ILE C O     1 
ATOM   9257  C  CB    . ILE C 2  726  ? 36.881  23.806  80.234  1.00 53.52  ? 726  ILE C CB    1 
ATOM   9258  C  CG1   . ILE C 2  726  ? 36.930  22.319  79.870  1.00 48.14  ? 726  ILE C CG1   1 
ATOM   9259  C  CG2   . ILE C 2  726  ? 35.649  24.451  79.642  1.00 60.96  ? 726  ILE C CG2   1 
ATOM   9260  C  CD1   . ILE C 2  726  ? 37.758  21.476  80.811  1.00 42.91  ? 726  ILE C CD1   1 
ATOM   9261  N  N     . PRO C 2  727  ? 37.781  26.513  78.378  1.00 55.67  ? 727  PRO C N     1 
ATOM   9262  C  CA    . PRO C 2  727  ? 37.498  27.928  78.114  1.00 64.09  ? 727  PRO C CA    1 
ATOM   9263  C  C     . PRO C 2  727  ? 36.272  28.440  78.870  1.00 69.38  ? 727  PRO C C     1 
ATOM   9264  O  O     . PRO C 2  727  ? 35.258  27.742  78.950  1.00 55.95  ? 727  PRO C O     1 
ATOM   9265  C  CB    . PRO C 2  727  ? 37.223  27.949  76.610  1.00 63.91  ? 727  PRO C CB    1 
ATOM   9266  C  CG    . PRO C 2  727  ? 38.010  26.808  76.077  1.00 65.98  ? 727  PRO C CG    1 
ATOM   9267  C  CD    . PRO C 2  727  ? 37.960  25.743  77.135  1.00 57.85  ? 727  PRO C CD    1 
ATOM   9268  N  N     . HIS C 2  728  ? 36.392  29.643  79.426  1.00 78.06  ? 728  HIS C N     1 
ATOM   9269  C  CA    . HIS C 2  728  ? 35.288  30.342  80.086  1.00 74.65  ? 728  HIS C CA    1 
ATOM   9270  C  C     . HIS C 2  728  ? 34.703  29.585  81.279  1.00 77.59  ? 728  HIS C C     1 
ATOM   9271  O  O     . HIS C 2  728  ? 33.486  29.433  81.386  1.00 90.76  ? 728  HIS C O     1 
ATOM   9272  C  CB    . HIS C 2  728  ? 34.177  30.681  79.081  1.00 72.45  ? 728  HIS C CB    1 
ATOM   9273  C  CG    . HIS C 2  728  ? 34.665  31.372  77.844  1.00 82.22  ? 728  HIS C CG    1 
ATOM   9274  N  ND1   . HIS C 2  728  ? 33.916  31.446  76.690  1.00 79.90  ? 728  HIS C ND1   1 
ATOM   9275  C  CD2   . HIS C 2  728  ? 35.825  32.019  77.581  1.00 89.80  ? 728  HIS C CD2   1 
ATOM   9276  C  CE1   . HIS C 2  728  ? 34.593  32.107  75.768  1.00 80.64  ? 728  HIS C CE1   1 
ATOM   9277  N  NE2   . HIS C 2  728  ? 35.755  32.465  76.283  1.00 86.49  ? 728  HIS C NE2   1 
ATOM   9278  N  N     . LEU C 2  729  ? 35.565  29.112  82.174  1.00 73.42  ? 729  LEU C N     1 
ATOM   9279  C  CA    . LEU C 2  729  ? 35.099  28.428  83.379  1.00 78.81  ? 729  LEU C CA    1 
ATOM   9280  C  C     . LEU C 2  729  ? 35.782  28.916  84.654  1.00 90.24  ? 729  LEU C C     1 
ATOM   9281  O  O     . LEU C 2  729  ? 36.990  29.156  84.676  1.00 89.75  ? 729  LEU C O     1 
ATOM   9282  C  CB    . LEU C 2  729  ? 35.259  26.911  83.254  1.00 66.00  ? 729  LEU C CB    1 
ATOM   9283  C  CG    . LEU C 2  729  ? 34.100  26.145  82.615  1.00 64.50  ? 729  LEU C CG    1 
ATOM   9284  C  CD1   . LEU C 2  729  ? 34.229  24.667  82.922  1.00 47.17  ? 729  LEU C CD1   1 
ATOM   9285  C  CD2   . LEU C 2  729  ? 32.756  26.679  83.094  1.00 73.70  ? 729  LEU C CD2   1 
ATOM   9286  N  N     . SER C 2  730  ? 34.992  29.053  85.714  1.00 94.18  ? 730  SER C N     1 
ATOM   9287  C  CA    . SER C 2  730  ? 35.495  29.466  87.018  1.00 84.19  ? 730  SER C CA    1 
ATOM   9288  C  C     . SER C 2  730  ? 36.276  28.341  87.685  1.00 74.31  ? 730  SER C C     1 
ATOM   9289  O  O     . SER C 2  730  ? 36.120  27.173  87.333  1.00 77.90  ? 730  SER C O     1 
ATOM   9290  C  CB    . SER C 2  730  ? 34.338  29.899  87.923  1.00 94.60  ? 730  SER C CB    1 
ATOM   9291  O  OG    . SER C 2  730  ? 33.426  28.834  88.139  1.00 83.41  ? 730  SER C OG    1 
ATOM   9292  N  N     . GLU C 2  731  ? 37.122  28.701  88.645  1.00 80.69  ? 731  GLU C N     1 
ATOM   9293  C  CA    . GLU C 2  731  ? 37.843  27.717  89.445  1.00 87.01  ? 731  GLU C CA    1 
ATOM   9294  C  C     . GLU C 2  731  ? 36.864  26.835  90.220  1.00 80.91  ? 731  GLU C C     1 
ATOM   9295  O  O     . GLU C 2  731  ? 37.159  25.680  90.531  1.00 73.89  ? 731  GLU C O     1 
ATOM   9296  C  CB    . GLU C 2  731  ? 38.810  28.422  90.404  1.00 92.16  ? 731  GLU C CB    1 
ATOM   9297  C  CG    . GLU C 2  731  ? 39.498  27.507  91.409  1.00 101.26 ? 731  GLU C CG    1 
ATOM   9298  C  CD    . GLU C 2  731  ? 40.317  26.414  90.748  1.00 110.27 ? 731  GLU C CD    1 
ATOM   9299  O  OE1   . GLU C 2  731  ? 40.897  26.669  89.670  1.00 107.00 ? 731  GLU C OE1   1 
ATOM   9300  O  OE2   . GLU C 2  731  ? 40.377  25.297  91.307  1.00 103.41 ? 731  GLU C OE2   1 
ATOM   9301  N  N     . ALA C 2  732  ? 35.692  27.390  90.515  1.00 78.95  ? 732  ALA C N     1 
ATOM   9302  C  CA    . ALA C 2  732  ? 34.646  26.672  91.232  1.00 74.25  ? 732  ALA C CA    1 
ATOM   9303  C  C     . ALA C 2  732  ? 34.221  25.402  90.500  1.00 67.80  ? 732  ALA C C     1 
ATOM   9304  O  O     . ALA C 2  732  ? 33.923  24.385  91.124  1.00 67.86  ? 732  ALA C O     1 
ATOM   9305  C  CB    . ALA C 2  732  ? 33.445  27.580  91.457  1.00 81.61  ? 732  ALA C CB    1 
ATOM   9306  N  N     . ALA C 2  733  ? 34.199  25.466  89.174  1.00 66.46  ? 733  ALA C N     1 
ATOM   9307  C  CA    . ALA C 2  733  ? 33.769  24.335  88.362  1.00 58.15  ? 733  ALA C CA    1 
ATOM   9308  C  C     . ALA C 2  733  ? 34.826  23.235  88.295  1.00 59.30  ? 733  ALA C C     1 
ATOM   9309  O  O     . ALA C 2  733  ? 34.499  22.049  88.271  1.00 63.42  ? 733  ALA C O     1 
ATOM   9310  C  CB    . ALA C 2  733  ? 33.404  24.803  86.963  1.00 53.64  ? 733  ALA C CB    1 
ATOM   9311  N  N     . LEU C 2  734  ? 36.092  23.634  88.270  1.00 62.25  ? 734  LEU C N     1 
ATOM   9312  C  CA    . LEU C 2  734  ? 37.187  22.691  88.061  1.00 60.88  ? 734  LEU C CA    1 
ATOM   9313  C  C     . LEU C 2  734  ? 37.821  22.170  89.352  1.00 62.08  ? 734  LEU C C     1 
ATOM   9314  O  O     . LEU C 2  734  ? 38.795  21.420  89.302  1.00 63.10  ? 734  LEU C O     1 
ATOM   9315  C  CB    . LEU C 2  734  ? 38.271  23.322  87.182  1.00 61.20  ? 734  LEU C CB    1 
ATOM   9316  C  CG    . LEU C 2  734  ? 37.839  23.956  85.860  1.00 54.87  ? 734  LEU C CG    1 
ATOM   9317  C  CD1   . LEU C 2  734  ? 39.050  24.473  85.103  1.00 57.82  ? 734  LEU C CD1   1 
ATOM   9318  C  CD2   . LEU C 2  734  ? 37.054  22.973  85.011  1.00 59.62  ? 734  LEU C CD2   1 
ATOM   9319  N  N     . ARG C 2  735  ? 37.282  22.570  90.500  1.00 65.30  ? 735  ARG C N     1 
ATOM   9320  C  CA    . ARG C 2  735  ? 37.908  22.242  91.783  1.00 66.54  ? 735  ARG C CA    1 
ATOM   9321  C  C     . ARG C 2  735  ? 38.019  20.736  92.040  1.00 60.70  ? 735  ARG C C     1 
ATOM   9322  O  O     . ARG C 2  735  ? 38.943  20.284  92.715  1.00 66.74  ? 735  ARG C O     1 
ATOM   9323  C  CB    . ARG C 2  735  ? 37.191  22.943  92.946  1.00 70.27  ? 735  ARG C CB    1 
ATOM   9324  C  CG    . ARG C 2  735  ? 35.869  22.315  93.364  1.00 69.94  ? 735  ARG C CG    1 
ATOM   9325  C  CD    . ARG C 2  735  ? 35.272  23.035  94.567  1.00 72.27  ? 735  ARG C CD    1 
ATOM   9326  N  NE    . ARG C 2  735  ? 34.236  22.242  95.225  1.00 85.14  ? 735  ARG C NE    1 
ATOM   9327  C  CZ    . ARG C 2  735  ? 32.935  22.346  94.974  1.00 90.43  ? 735  ARG C CZ    1 
ATOM   9328  N  NH1   . ARG C 2  735  ? 32.072  21.578  95.627  1.00 94.36  ? 735  ARG C NH1   1 
ATOM   9329  N  NH2   . ARG C 2  735  ? 32.495  23.216  94.075  1.00 81.04  ? 735  ARG C NH2   1 
ATOM   9330  N  N     . ASP C 2  736  ? 37.090  19.965  91.486  1.00 58.35  ? 736  ASP C N     1 
ATOM   9331  C  CA    . ASP C 2  736  ? 37.075  18.518  91.686  1.00 57.86  ? 736  ASP C CA    1 
ATOM   9332  C  C     . ASP C 2  736  ? 37.828  17.773  90.589  1.00 57.52  ? 736  ASP C C     1 
ATOM   9333  O  O     . ASP C 2  736  ? 37.847  16.542  90.570  1.00 51.16  ? 736  ASP C O     1 
ATOM   9334  C  CB    . ASP C 2  736  ? 35.636  18.000  91.777  1.00 63.01  ? 736  ASP C CB    1 
ATOM   9335  C  CG    . ASP C 2  736  ? 35.032  18.189  93.156  1.00 69.88  ? 736  ASP C CG    1 
ATOM   9336  O  OD1   . ASP C 2  736  ? 35.770  18.039  94.154  1.00 69.10  ? 736  ASP C OD1   1 
ATOM   9337  O  OD2   . ASP C 2  736  ? 33.819  18.485  93.243  1.00 62.38  ? 736  ASP C OD2   1 
ATOM   9338  N  N     . LEU C 2  737  ? 38.440  18.519  89.675  1.00 58.11  ? 737  LEU C N     1 
ATOM   9339  C  CA    . LEU C 2  737  ? 39.101  17.914  88.520  1.00 47.77  ? 737  LEU C CA    1 
ATOM   9340  C  C     . LEU C 2  737  ? 40.530  17.443  88.763  1.00 50.95  ? 737  LEU C C     1 
ATOM   9341  O  O     . LEU C 2  737  ? 41.313  18.092  89.453  1.00 60.62  ? 737  LEU C O     1 
ATOM   9342  C  CB    . LEU C 2  737  ? 39.079  18.855  87.316  1.00 47.49  ? 737  LEU C CB    1 
ATOM   9343  C  CG    . LEU C 2  737  ? 37.763  18.960  86.550  1.00 54.02  ? 737  LEU C CG    1 
ATOM   9344  C  CD1   . LEU C 2  737  ? 38.032  19.390  85.116  1.00 48.31  ? 737  LEU C CD1   1 
ATOM   9345  C  CD2   . LEU C 2  737  ? 36.999  17.643  86.593  1.00 49.28  ? 737  LEU C CD2   1 
ATOM   9346  N  N     . ASP C 2  738  ? 40.846  16.299  88.168  1.00 56.92  ? 738  ASP C N     1 
ATOM   9347  C  CA    . ASP C 2  738  ? 42.191  15.744  88.152  1.00 54.79  ? 738  ASP C CA    1 
ATOM   9348  C  C     . ASP C 2  738  ? 43.087  16.624  87.287  1.00 55.54  ? 738  ASP C C     1 
ATOM   9349  O  O     . ASP C 2  738  ? 42.600  17.397  86.463  1.00 53.37  ? 738  ASP C O     1 
ATOM   9350  C  CB    . ASP C 2  738  ? 42.144  14.316  87.596  1.00 50.05  ? 738  ASP C CB    1 
ATOM   9351  C  CG    . ASP C 2  738  ? 43.480  13.613  87.665  1.00 61.00  ? 738  ASP C CG    1 
ATOM   93