data_4OIP
# 
_entry.id   4OIP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OIP         
NDB   NA2889       
RCSB  RCSB084542   
WWPDB D_1000084542 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OIN . unspecified 
PDB 4OIO . unspecified 
PDB 4OIQ . unspecified 
PDB 4OIR . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4OIP 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
'Arnold, E.'    3 
# 
_citation.id                        primary 
_citation.title                     
;GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
;
_citation.journal_abbrev            Elife 
_citation.journal_volume            3 
_citation.page_first                e02450 
_citation.page_last                 e02450 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24755292 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.'            1  
primary 'Degen, D.'            2  
primary 'Ho, M.X.'             3  
primary 'Sineva, E.'           4  
primary 'Ebright, K.Y.'        5  
primary 'Ebright, Y.W.'        6  
primary 'Mekler, V.'           7  
primary 'Vahedian-Movahed, H.' 8  
primary 'Feng, Y.'             9  
primary 'Yin, R.'              10 
primary 'Tuske, S.'            11 
primary 'Irschik, H.'          12 
primary 'Jansen, R.'           13 
primary 'Maffioli, S.'         14 
primary 'Donadio, S.'          15 
primary 'Arnold, E.'           16 
primary 'Ebright, R.H.'        17 
# 
_cell.entry_id           4OIP 
_cell.length_a           182.920 
_cell.length_b           104.391 
_cell.length_c           294.211 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.97 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4OIP 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                 35056.164  2 
2.7.7.6 ? ? ?                                 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                  125436.539 1 
2.7.7.6 ? ? ?                                 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1 2.7.7.6 ? ? ?                                 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                 11533.316  1 
2.7.7.6 ? ? ?                                 
5  polymer     man 'DNA directed RNA polymerase sigma factor A'                                                50769.398  1 ? ? ? 
?                                 
6  polymer     syn "5'-D(*CP*CP*TP*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*GP*GP*G)-3'"                   6480.172   1 ? ? ? 
'promoter DNA template strand'    
7  polymer     syn "5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G)-3'" 8421.432   1 ? ? ? 
'promoter DNA nontemplate strand' 
8  polymer     syn GE23077                                                                                     739.687    1 ? ? ? 
?                                 
9  non-polymer syn 'MAGNESIUM ION'                                                                             24.305     6 ? ? ? 
?                                 
10 non-polymer syn 'ZINC ION'                                                                                  65.409     2 ? ? ? 
?                                 
11 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                                                                 507.181    1 ? ? ? 
?                                 
12 non-polymer syn '(2Z)-2-methylbut-2-enoic acid'                                                             100.116    1 ? ? ? 
?                                 
13 water       nat water                                                                                       18.015     3 ? ? ? 
?                                 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha, RNA polymerase subunit alpha, Transcriptase subunit alpha' 
2 'RNAP subunit beta, RNA polymerase subunit beta, Transcriptase subunit beta'    
3 
;RNAP subunit beta', RNA polymerase subunit beta', Transcriptase subunit beta'
;
4 'RNAP omega subunit, RNA polymerase omega subunit, Transcriptase subunit omega' 
5 'RNA polymerase sigma factor'                                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no  
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no  
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no  
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no  
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no  
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)
(DG)
;
CCTGCATCCGTGAGTCGAGGG G   ? 
7 polydeoxyribonucleotide no no  
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H   ? 
8 'polypeptide(L)'        no yes '(2RA)(DSN)(DVA)(R2T)(2TL)(0QZ)(FGL)' XSVXTXG I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
6 20   DG  n 
6 21   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    2RA n 
8 2    DSN n 
8 3    DVA n 
8 4    R2T n 
8 5    2TL n 
8 6    0QZ n 
8 7    FGL n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rpoD, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB8 / ATCC 27634 / DSM 579' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              8 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Actinomadura sp.' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       1989 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THET8   Q5SHR6 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8   Q8RQE9 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8   Q8RQE8 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8   Q8RQE7 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 UNP Q5SKW1_THET8 Q5SKW1 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 ? 
6 PDB 4OIP         4OIP   6 CCTGCATCCGTGAGTCGAGGG 1 ? 
7 PDB 4OIP         4OIP   7 TATAATGGGAGCTGTCACGGATGCAGG 1 ? 
8 PDB 4OIP         4OIP   8 '(2RA)(DSN)(DVA)(R2T)(2TL)(0QZ)(FGL)' 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4OIP A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2 1 4OIP B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3 2 4OIP C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4 3 4OIP D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5 4 4OIP E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6 5 4OIP F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7 6 4OIP G 1  ? 21   ? 4OIP   1 ? 21   ? 1 21   
8 7 4OIP H 1  ? 27   ? 4OIP   1 ? 27   ? 1 27   
9 8 4OIP I 1  ? 7    ? 4OIP   1 ? 7    ? 1 7    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6 4OIP MET F 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 1  
6 4OIP GLY F 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 2  
6 4OIP SER F 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 3  
6 4OIP SER F 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 4  
6 4OIP HIS F 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 5  
6 4OIP HIS F 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 6  
6 4OIP HIS F 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 7  
6 4OIP HIS F 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 8  
6 4OIP HIS F 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 9  
6 4OIP HIS F 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 10 
6 4OIP SER F 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  11 
6 4OIP SER F 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  12 
6 4OIP GLY F 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  13 
6 4OIP LEU F 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  14 
6 4OIP VAL F 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  15 
6 4OIP PRO F 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  16 
6 4OIP ARG F 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  17 
6 4OIP GLY F 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  18 
6 4OIP SER F 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  19 
6 4OIP HIS F 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0QZ 'D-peptide linking' . D-Isoserine                          '(2R)-3-amino-2-hydroxypropanoic acid' 'C3 H7 N O3'        105.093 
2RA 'D-peptide linking' n 3-amino-D-alanine                    'diaminopropanoic acid'                'C3 H8 N2 O2'       104.108 
2TL 'D-peptide linking' . D-allothreonine                      ?                                      'C4 H9 N O3'        119.119 
ALA 'L-peptide linking' y ALANINE                              ?                                      'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                                      'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                                      'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                                      'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"          ?                                      'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                             ?                                      'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                                      'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                                      'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                                      'C10 H14 N5 O7 P'   347.221 
DSN 'D-peptide linking' . D-SERINE                             ?                                      'C3 H7 N O3'        105.093 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                                      'C10 H15 N2 O8 P'   322.208 
DVA 'D-peptide linking' . D-VALINE                             ?                                      'C5 H11 N O2'       117.146 
FGL 'L-peptide linking' n '2-AMINOPROPANEDIOIC ACID'           ?                                      'C3 H5 N O4'        119.076 
GLN 'L-peptide linking' y GLUTAMINE                            ?                                      'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                                      'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                                      'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                                      'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                                      'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                                      'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                                      'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                                      'C6 H15 N2 O2 1'    147.195 
MB8 non-polymer         . '(2Z)-2-methylbut-2-enoic acid'      ?                                      'C5 H8 O2'          100.116 
MET 'L-peptide linking' y METHIONINE                           ?                                      'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                                      'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                                      'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                                      'C5 H9 N O2'        115.130 
R2T 'L-peptide linking' . beta,gamma-dihydroxyglutamine        ?                                      'C5 H10 N2 O5'      178.143 
SER 'L-peptide linking' y SERINE                               ?                                      'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                                      'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                                      'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                                      'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                                      'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                                      'Zn 2'              65.409  
# 
_exptl.entry_id          4OIP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.13 
_exptl_crystal.density_percent_sol   60.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl, pH 8.4, 200 mM potassium chloride, 50 mM magnesium chloride, 9.5% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-12-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     4OIP 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.40 
_reflns.number_obs                   75549 
_reflns.number_all                   75776 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.146 
_reflns.pdbx_Rsym_value              0.146 
_reflns.pdbx_netI_over_sigmaI        7.7 
_reflns.B_iso_Wilson_estimate        95.77 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.40 
_reflns_shell.d_res_low              3.46 
_reflns_shell.percent_possible_all   96.1 
_reflns_shell.Rmerge_I_obs           0.793 
_reflns_shell.pdbx_Rsym_value        0.793 
_reflns_shell.meanI_over_sigI_obs    1.1 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3703 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4OIP 
_refine.ls_number_reflns_obs                     61656 
_refine.ls_number_reflns_all                     75633 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.122 
_refine.ls_d_res_high                            3.400 
_refine.ls_percent_reflns_obs                    81.52 
_refine.ls_R_factor_obs                          0.2086 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2076 
_refine.ls_R_factor_R_free                       0.2460 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.66 
_refine.ls_number_reflns_R_free                  1642 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               66.0 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4G7H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.40 
_refine.pdbx_overall_phase_error                 26.41 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27725 
_refine_hist.pdbx_number_atoms_nucleic_acid   826 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               28595 
_refine_hist.d_res_high                       3.400 
_refine_hist.d_res_low                        49.122 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.004  ? ? 29218 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.727  ? ? 39664 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 13.794 ? ? 11318 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.053  ? ? 4465  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.003  ? ? 5056  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.400  3.5005  1955 0.2666 33.0  0.3179 . . 72  . . . . 'X-RAY DIFFRACTION' 
. 3.5005 3.6134  2497 0.2604 41.0  0.2993 . . 73  . . . . 'X-RAY DIFFRACTION' 
. 3.6134 3.7425  3220 0.2543 52.0  0.3586 . . 79  . . . . 'X-RAY DIFFRACTION' 
. 3.7425 3.8923  4156 0.2516 68.0  0.2772 . . 110 . . . . 'X-RAY DIFFRACTION' 
. 3.8923 4.0694  5308 0.2420 87.0  0.2689 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 4.0694 4.2838  5875 0.2263 97.0  0.2310 . . 164 . . . . 'X-RAY DIFFRACTION' 
. 4.2838 4.5520  6103 0.2073 99.0  0.2782 . . 164 . . . . 'X-RAY DIFFRACTION' 
. 4.5520 4.9032  6109 0.1988 100.0 0.2744 . . 160 . . . . 'X-RAY DIFFRACTION' 
. 4.9032 5.3961  6123 0.2024 100.0 0.2193 . . 168 . . . . 'X-RAY DIFFRACTION' 
. 5.3961 6.1756  6197 0.2199 100.0 0.2481 . . 170 . . . . 'X-RAY DIFFRACTION' 
. 6.1756 7.7757  6166 0.2143 100.0 0.2911 . . 163 . . . . 'X-RAY DIFFRACTION' 
. 7.7757 49.1275 6305 0.1709 100.0 0.1868 . . 174 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OIP 
_struct.title                     
'Crystal structure of Thermus thermophilus transcription initiation complex soaked with GE23077, ATP, and CMPcPP' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase subunit alpha (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta' (E.C.2.7.7.6), DNA-directed RNA polymerase subunit omega (E.C.2.7.7.6), DNA directed RNA polymerase sigma factor A
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OIP 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/ANTIBIOTIC' 
_struct_keywords.text            
;GE23077, transcription inhibitor, transcription open complex, transcription initiation complex, i site, i+1 site, CMPcPP, RNA polymerase, DNA/RNA/NTP binding, polymerization of ribonucleotides, nucleoid, TRANSCRIPTION, TRANSFERASE-ANTIBIOTIC complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 10 ? 
M N N 9  ? 
N N N 9  ? 
O N N 9  ? 
P N N 9  ? 
Q N N 11 ? 
R N N 9  ? 
S N N 12 ? 
T N N 13 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   2   ASP A 74   ? GLU A 84   ? ASP A 74   GLU A 84   1 ? 11 
HELX_P HELX_P3   3   ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   6   TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   7   GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   8   ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   9   ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  10  PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  11  THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P12  12  TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P13  13  THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P14  14  VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P15  15  PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P16  16  LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  17  ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P18  18  VAL C 218  ? MET C 222  ? VAL C 218  MET C 222  5 ? 5  
HELX_P HELX_P19  19  ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P20  20  ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  21  LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P22  22  GLY C 270  ? LEU C 281  ? GLY C 270  LEU C 281  1 ? 12 
HELX_P HELX_P23  23  VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P24  24  THR C 335  ? MET C 361  ? THR C 335  MET C 361  1 ? 27 
HELX_P HELX_P25  25  THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P26  26  SER C 375  ? ARG C 388  ? SER C 375  ARG C 388  1 ? 14 
HELX_P HELX_P27  27  ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P28  28  GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P29  29  HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P30  30  GLU C 445  ? ILE C 449  ? GLU C 445  ILE C 449  5 ? 5  
HELX_P HELX_P31  31  THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P32  32  SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P33  33  SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P34  34  ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P35  35  PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P36  36  ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P37  37  LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P38  38  ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P39  39  GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P40  40  SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P41  41  THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P42  42  PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P43  43  LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P44  44  LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P45  45  LYS C 910  ? PHE C 926  ? LYS C 910  PHE C 926  1 ? 17 
HELX_P HELX_P46  46  PHE C 926  ? GLU C 932  ? PHE C 926  GLU C 932  1 ? 7  
HELX_P HELX_P47  47  ASP C 937  ? GLY C 951  ? ASP C 937  GLY C 951  1 ? 15 
HELX_P HELX_P48  48  THR C 958  ? GLN C 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P49  49  MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P50  50  GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P51  51  ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P52  52  ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P53  53  PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P54  54  SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P55  55  ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P56  56  ILE D 84   ? ARG D 89   ? ILE D 84   ARG D 89   1 ? 6  
HELX_P HELX_P57  57  ILE D 102  ? VAL D 105  ? ILE D 102  VAL D 105  5 ? 4  
HELX_P HELX_P58  58  SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P59  59  SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P60  60  THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P61  61  ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P62  62  ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P63  63  GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P64  64  ASP D 469  ? LYS D 482  ? ASP D 469  LYS D 482  1 ? 14 
HELX_P HELX_P65  65  SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P66  66  ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P67  67  PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P68  68  SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P69  69  PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P70  70  SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P71  71  GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P72  72  LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P73  73  PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P74  74  ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P75  75  GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P76  76  ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P77  77  HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P78  78  HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P79  79  VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P80  80  SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P81  81  LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P82  82  ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P83  83  THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P84  84  VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P85  85  ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P86  86  SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P87  87  ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P88  88  GLU D 907  ? SER D 945  ? GLU D 907  SER D 945  1 ? 39 
HELX_P HELX_P89  89  GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P90  90  PRO D 957  ? MET D 980  ? PRO D 957  MET D 980  1 ? 24 
HELX_P HELX_P91  91  THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P92  92  ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P93  93  ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P94  94  THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P95  95  LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P96  96  SER D 1167 ? GLY D 1181 ? SER D 1167 GLY D 1181 1 ? 15 
HELX_P HELX_P97  97  GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P98  98  ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P99  99  PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P100 100 GLN D 1254 ? GLU D 1264 ? GLN D 1254 GLU D 1264 1 ? 11 
HELX_P HELX_P101 101 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P102 102 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P103 103 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P104 104 LYS D 1397 ? GLU D 1410 ? LYS D 1397 GLU D 1410 1 ? 14 
HELX_P HELX_P105 105 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P106 106 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P107 107 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P108 108 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P109 109 ALA D 1474 ? GLY D 1477 ? ALA D 1474 GLY D 1477 5 ? 4  
HELX_P HELX_P110 110 SER D 1478 ? PHE D 1483 ? SER D 1478 PHE D 1483 1 ? 6  
HELX_P HELX_P111 111 GLN D 1489 ? ALA D 1502 ? GLN D 1489 ALA D 1502 1 ? 14 
HELX_P HELX_P112 112 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P113 113 SER E 15   ? GLY E 34   ? SER E 15   GLY E 34   1 ? 20 
HELX_P HELX_P114 114 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P115 115 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P116 116 ASP F 99   ? GLN F 110  ? ASP F 79   GLN F 90   1 ? 12 
HELX_P HELX_P117 117 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P118 118 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P119 119 ASP F 172  ? SER F 185  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P120 120 PRO F 187  ? ASN F 211  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P121 121 ASN F 211  ? LYS F 220  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P122 122 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P123 123 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P124 124 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P125 125 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P126 126 THR F 307  ? MET F 315  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P127 127 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P128 128 PHE F 348  ? ILE F 353  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P129 129 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P130 130 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P131 131 THR F 402  ? PHE F 410  ? THR F 382  PHE F 390  1 ? 9  
HELX_P HELX_P132 132 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P133 133 ARG F 439  ? ASP F 443  ? ARG F 419  ASP F 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? I 2RA 1    C   ? ? ? 1_555 I DSN 2  N   ? ? I 2RA 1    I DSN 2    1_555 ? ? ? ? ? ? ?            1.478 ? 
covale2  covale ? ? I DSN 2    C   ? ? ? 1_555 I DVA 3  N   ? ? I DSN 2    I DVA 3    1_555 ? ? ? ? ? ? ?            1.481 ? 
covale3  covale ? ? I DVA 3    C   ? ? ? 1_555 I R2T 4  N   ? ? I DVA 3    I R2T 4    1_555 ? ? ? ? ? ? ?            1.457 ? 
covale4  covale ? ? I R2T 4    C   ? ? ? 1_555 I 2TL 5  N   ? ? I R2T 4    I 2TL 5    1_555 ? ? ? ? ? ? ?            1.464 ? 
covale5  covale ? ? I 2TL 5    C   ? ? ? 1_555 I 0QZ 6  N   ? ? I 2TL 5    I 0QZ 6    1_555 ? ? ? ? ? ? ?            1.461 ? 
covale6  covale ? ? I 0QZ 6    C   ? ? ? 1_555 I FGL 7  N   ? ? I 0QZ 6    I FGL 7    1_555 ? ? ? ? ? ? ?            1.440 ? 
metalc1  metalc ? ? D LYS 840  O   ? ? ? 1_555 O MG  .  MG  ? ? D LYS 840  D MG  2005 1_555 ? ? ? ? ? ? ?            2.021 ? 
metalc2  metalc ? ? D ASP 743  OD1 ? ? ? 1_555 M MG  .  MG  ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.055 ? 
metalc3  metalc ? ? M MG  .    MG  ? ? ? 1_555 T HOH .  O   ? ? D MG  2003 D HOH 2101 1_555 ? ? ? ? ? ? ?            2.069 ? 
metalc4  metalc ? ? M MG  .    MG  ? ? ? 1_555 T HOH .  O   ? ? D MG  2003 D HOH 2103 1_555 ? ? ? ? ? ? ?            2.069 ? 
metalc5  metalc ? ? M MG  .    MG  ? ? ? 1_555 T HOH .  O   ? ? D MG  2003 D HOH 2102 1_555 ? ? ? ? ? ? ?            2.072 ? 
metalc6  metalc ? ? D ASP 739  OD1 ? ? ? 1_555 M MG  .  MG  ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            2.078 ? 
metalc7  metalc ? ? D ASP 741  OD1 ? ? ? 1_555 M MG  .  MG  ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc8  metalc ? ? B ASP 191  O   ? ? ? 1_555 J MG  .  MG  ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?            2.096 ? 
metalc9  metalc ? ? B ASP 183  OD1 ? ? ? 1_555 J MG  .  MG  ? ? B ASP 183  B MG  2001 1_555 ? ? ? ? ? ? ?            2.118 ? 
metalc10 metalc ? ? B ASP 191  OD1 ? ? ? 1_555 J MG  .  MG  ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?            2.129 ? 
metalc11 metalc ? ? D ASP 739  OD2 ? ? ? 1_555 N MG  .  MG  ? ? D ASP 739  D MG  2004 1_555 ? ? ? ? ? ? ?            2.130 ? 
metalc12 metalc ? ? B ASP 193  OD1 ? ? ? 1_555 J MG  .  MG  ? ? B ASP 193  B MG  2001 1_555 ? ? ? ? ? ? ?            2.134 ? 
metalc13 metalc ? ? F GLY 316  O   ? ? ? 1_555 R MG  .  MG  ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?            2.168 ? 
metalc14 metalc ? ? N MG  .    MG  ? ? ? 1_555 Q ATP .  O2B ? ? D MG  2004 D ATP 2007 1_555 ? ? ? ? ? ? ?            2.244 ? 
metalc15 metalc ? ? N MG  .    MG  ? ? ? 1_555 Q ATP .  O2G ? ? D MG  2004 D ATP 2007 1_555 ? ? ? ? ? ? ?            2.253 ? 
metalc16 metalc ? ? D TRP 897  O   ? ? ? 1_555 P MG  .  MG  ? ? D TRP 897  D MG  2006 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc17 metalc ? ? D CYS 1201 SG  ? ? ? 1_555 K ZN  .  ZN  ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.264 ? 
metalc18 metalc ? ? F TRP 319  O   ? ? ? 1_555 R MG  .  MG  ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?            2.271 ? 
metalc19 metalc ? ? F ALA 312  O   ? ? ? 1_555 R MG  .  MG  ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?            2.276 ? 
metalc20 metalc ? ? D CYS 1112 SG  ? ? ? 1_555 K ZN  .  ZN  ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc21 metalc ? ? D CYS 76   SG  ? ? ? 1_555 L ZN  .  ZN  ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.280 ? 
metalc22 metalc ? ? D CYS 60   SG  ? ? ? 1_555 L ZN  .  ZN  ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.293 ? 
metalc23 metalc ? ? D CYS 1194 SG  ? ? ? 1_555 K ZN  .  ZN  ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc24 metalc ? ? D CYS 73   SG  ? ? ? 1_555 L ZN  .  ZN  ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc25 metalc ? ? D CYS 1204 SG  ? ? ? 1_555 K ZN  .  ZN  ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.325 ? 
metalc26 metalc ? ? D CYS 58   SG  ? ? ? 1_555 L ZN  .  ZN  ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.345 ? 
covale7  covale ? ? I 2RA 1    NG  ? ? ? 1_555 S MB8 .  C   ? ? I 2RA 1    I MB8 101  1_555 ? ? ? ? ? ? ?            1.452 ? 
covale8  covale ? ? I 2RA 1    N   ? ? ? 1_555 I FGL 7  C   ? ? I 2RA 1    I FGL 7    1_555 ? ? ? ? ? ? ?            1.455 ? 
hydrog1  hydrog ? ? G DG  4    N1  ? ? ? 1_555 H DC  24 N3  ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DG  4    N2  ? ? ? 1_555 H DC  24 O2  ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DG  4    O6  ? ? ? 1_555 H DC  24 N4  ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DC  5    N3  ? ? ? 1_555 H DG  23 N1  ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DC  5    N4  ? ? ? 1_555 H DG  23 O6  ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DC  5    O2  ? ? ? 1_555 H DG  23 N2  ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DA  6    N1  ? ? ? 1_555 H DT  22 N3  ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DA  6    N6  ? ? ? 1_555 H DT  22 O4  ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DT  7    N3  ? ? ? 1_555 H DA  21 N1  ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DT  7    O4  ? ? ? 1_555 H DA  21 N6  ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DC  8    N3  ? ? ? 1_555 H DG  20 N1  ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G DC  8    N4  ? ? ? 1_555 H DG  20 O6  ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DC  8    O2  ? ? ? 1_555 H DG  20 N2  ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DC  9    O2  ? ? ? 1_555 H DG  19 N2  ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog15 hydrog ? ? G DG  10   N2  ? ? ? 1_555 H DC  18 N3  ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog16 hydrog ? ? G DT  11   N3  ? ? ? 1_555 H DA  17 N1  ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G DT  11   O4  ? ? ? 1_555 H DA  17 N6  ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G DG  12   N1  ? ? ? 1_555 H DC  16 N3  ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G DG  12   N2  ? ? ? 1_555 H DC  16 O2  ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G DG  12   O6  ? ? ? 1_555 H DC  16 N4  ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G DA  13   N1  ? ? ? 1_555 H DT  15 N3  ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -7.68 
2 ALA 8   B . ? ALA 8   B PRO 9   B ? PRO 9   B 1 18.28 
3 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -9.33 
4 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 1.32  
5 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -4.36 
6 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -2.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 3 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 8 ? 
Y  ? 4 ? 
Z  ? 3 ? 
AA ? 2 ? 
AB ? 8 ? 
AC ? 2 ? 
AD ? 4 ? 
AE ? 2 ? 
AF ? 3 ? 
AG ? 2 ? 
AH ? 5 ? 
AI ? 4 ? 
AJ ? 3 ? 
AK ? 3 ? 
AL ? 4 ? 
AM ? 3 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 3 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 2 ? 
AW ? 2 ? 
AX ? 4 ? 
AY ? 3 ? 
AZ ? 2 ? 
BA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? parallel      
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? parallel      
X  5 6 ? anti-parallel 
X  6 7 ? parallel      
X  7 8 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? parallel      
AB 6 7 ? anti-parallel 
AB 7 8 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? parallel      
AQ 1 2 ? parallel      
AQ 2 3 ? anti-parallel 
AR 1 2 ? parallel      
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AZ 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
A  2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
A  3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
A  4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
B  1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
B  2 ARG A 137  ? VAL A 148  ? ARG A 137  VAL A 148  
B  3 PRO A 49   ? ILE A 58   ? PRO A 49   ILE A 58   
B  4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
C  1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
C  2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
D  1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
D  2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
E  1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
E  2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
F  1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
F  2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
F  3 ASP B 193  ? THR B 201  ? ASP B 193  THR B 201  
F  4 VAL B 174  ? ASP B 183  ? VAL B 174  ASP B 183  
G  1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
G  2 ARG B 137  ? GLY B 147  ? ARG B 137  GLY B 147  
G  3 GLY B 50   ? ILE B 58   ? GLY B 50   ILE B 58   
G  4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
H  1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
H  2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
I  1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
I  2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
J  1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
J  2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
K  1 ILE C 3    ? ARG C 5    ? ILE C 3    ARG C 5    
K  2 ARG C 900  ? ILE C 902  ? ARG C 900  ILE C 902  
K  3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
L  1 LEU C 64   ? LEU C 73   ? LEU C 64   LEU C 73   
L  2 GLN C 91   ? HIS C 102  ? GLN C 91   HIS C 102  
L  3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
M  1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
M  2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
M  3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
N  1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
N  2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
N  3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
N  4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
O  1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
O  2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
O  3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
O  4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
O  5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
P  1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
P  2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
Q  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
Q  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
Q  3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
R  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
R  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
R  3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
R  4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
R  5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
R  6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
S  1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
S  2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
T  1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
T  2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
T  3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
U  1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
U  2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
U  3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
U  4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
V  1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
V  2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
W  1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
W  2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
X  1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
X  2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
X  3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
X  4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
X  5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
X  6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
X  7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
X  8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
Y  1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
Y  2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
Y  3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
Y  4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
Z  1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
Z  2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
Z  3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AA 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AA 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AB 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AB 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AB 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AB 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AB 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AB 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AB 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AB 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AC 1 ARG C 1031 ? PHE C 1032 ? ARG C 1031 PHE C 1032 
AC 2 LYS D 621  ? ARG D 622  ? LYS D 621  ARG D 622  
AD 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AD 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AE 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AE 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AF 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AF 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AF 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AG 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AG 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AH 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AH 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AH 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AH 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AH 5 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AI 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AI 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AI 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AI 4 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AJ 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AJ 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AJ 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AK 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AK 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AK 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AL 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AL 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AL 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AL 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AM 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AM 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AM 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AN 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AN 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AN 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AN 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AO 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AO 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AP 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AP 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AP 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AQ 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AQ 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AQ 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AR 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AR 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AR 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AS 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AS 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AT 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AT 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AU 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AU 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AV 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AV 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AW 1 TYR D 1207 ? ASP D 1208 ? TYR D 1207 ASP D 1208 
AW 2 ARG D 1213 ? PRO D 1214 ? ARG D 1213 PRO D 1214 
AX 1 SER D 1300 ? TYR D 1303 ? SER D 1300 TYR D 1303 
AX 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AX 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AX 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AY 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AY 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AY 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AZ 1 THR D 1484 ? ASP D 1488 ? THR D 1484 ASP D 1488 
AZ 2 LEU E 73   ? GLU E 77   ? LEU E 73   GLU E 77   
BA 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
BA 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
A  2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
A  3 4 O TRP A 200  ? O TRP A 200  N ARG A 176  ? N ARG A 176  
B  1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
B  2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
B  3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
C  1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
D  1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
E  1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
F  1 2 N ARG B 14   ? N ARG B 14   O GLU B 22   ? O GLU B 22   
F  2 3 N PHE B 23   ? N PHE B 23   O LEU B 197  ? O LEU B 197  
F  3 4 O TRP B 200  ? O TRP B 200  N ARG B 175  ? N ARG B 175  
G  1 2 N VAL B 97   ? N VAL B 97   O VAL B 144  ? O VAL B 144  
G  2 3 O ARG B 143  ? O ARG B 143  N SER B 55   ? N SER B 55   
G  3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
H  1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
I  1 2 N LYS B 107  ? N LYS B 107  O LEU B 132  ? O LEU B 132  
J  1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
K  1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
K  2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
L  1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
L  2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
M  1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
M  2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
N  1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
N  2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
N  3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
O  1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
O  2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
O  3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
O  4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
P  1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
Q  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
Q  2 3 N TYR C 471  ? N TYR C 471  O VAL C 484  ? O VAL C 484  
R  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
R  2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
R  3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
R  4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
R  5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
S  1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
T  1 2 N LEU C 595  ? N LEU C 595  O ALA C 656  ? O ALA C 656  
T  2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
U  1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
U  2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
U  3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
V  1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
W  1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
X  1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
X  2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
X  3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
X  4 5 O ALA C 850  ? O ALA C 850  N ILE C 688  ? N ILE C 688  
X  5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
X  6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
X  7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
Y  1 2 N GLU C 706  ? N GLU C 706  O VAL C 827  ? O VAL C 827  
Y  2 3 O VAL C 822  ? O VAL C 822  N LEU C 806  ? N LEU C 806  
Y  3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
Z  1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
Z  2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AA 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AB 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AB 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AB 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AB 4 5 N VAL D 700  ? N VAL D 700  O PHE D 716  ? O PHE D 716  
AB 5 6 O VAL D 719  ? O VAL D 719  N LEU D 644  ? N LEU D 644  
AB 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AB 7 8 O LEU D 728  ? O LEU D 728  N VAL D 632  ? N VAL D 632  
AC 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AD 2 3 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AD 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AE 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AF 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AF 2 3 N ASP D 136  ? N ASP D 136  O ASP D 453  ? O ASP D 453  
AG 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AH 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AH 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AH 3 4 N LYS D 217  ? N LYS D 217  O TRP D 339  ? O TRP D 339  
AH 4 5 O PHE D 336  ? O PHE D 336  N GLN D 321  ? N GLN D 321  
AI 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AI 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AI 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AJ 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AJ 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AK 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AK 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AL 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AL 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AL 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AM 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AM 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AN 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AN 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AN 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AO 1 2 N ALA D 422  ? N ALA D 422  O VAL D 427  ? O VAL D 427  
AP 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AP 2 3 N THR D 537  ? N THR D 537  O VAL F 335  ? O VAL F 315  
AQ 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AQ 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AR 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AR 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AS 1 2 N VAL D 1106 ? N VAL D 1106 O VAL D 1200 ? O VAL D 1200 
AT 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AU 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AV 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AW 1 2 N ASP D 1208 ? N ASP D 1208 O ARG D 1213 ? O ARG D 1213 
AX 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AX 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AX 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AY 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AY 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AZ 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
BA 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 2001'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 2001'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 2002'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 2003'  
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG D 2004'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG D 2005'  
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG D 2006'  
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ATP D 2007' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG F 2001'  
BC1 Software ? ? ? ? 16 'BINDING SITE FOR GE23077'            
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  ASP B 183  ? ASP B 183  . ? 1_555 ? 
2  AC1 3  ASP B 191  ? ASP B 191  . ? 1_555 ? 
3  AC1 3  ASP B 193  ? ASP B 193  . ? 1_555 ? 
4  AC2 4  CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
5  AC2 4  CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
6  AC2 4  CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
7  AC2 4  CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
8  AC3 4  CYS D 58   ? CYS D 58   . ? 1_555 ? 
9  AC3 4  CYS D 60   ? CYS D 60   . ? 1_555 ? 
10 AC3 4  CYS D 73   ? CYS D 73   . ? 1_555 ? 
11 AC3 4  CYS D 76   ? CYS D 76   . ? 1_555 ? 
12 AC4 6  ASP D 739  ? ASP D 739  . ? 1_555 ? 
13 AC4 6  ASP D 741  ? ASP D 741  . ? 1_555 ? 
14 AC4 6  ASP D 743  ? ASP D 743  . ? 1_555 ? 
15 AC4 6  HOH T .    ? HOH D 2101 . ? 1_555 ? 
16 AC4 6  HOH T .    ? HOH D 2102 . ? 1_555 ? 
17 AC4 6  HOH T .    ? HOH D 2103 . ? 1_555 ? 
18 AC5 2  ASP D 739  ? ASP D 739  . ? 1_555 ? 
19 AC5 2  ATP Q .    ? ATP D 2007 . ? 1_555 ? 
20 AC6 2  ASP B 168  ? ASP B 168  . ? 1_555 ? 
21 AC6 2  LYS D 840  ? LYS D 840  . ? 1_555 ? 
22 AC7 2  TRP D 897  ? TRP D 897  . ? 1_555 ? 
23 AC7 2  ILE D 900  ? ILE D 900  . ? 1_555 ? 
24 AC8 5  SER C 878  ? SER C 878  . ? 1_555 ? 
25 AC8 5  ARG C 879  ? ARG C 879  . ? 1_555 ? 
26 AC8 5  ARG D 783  ? ARG D 783  . ? 1_555 ? 
27 AC8 5  ARG D 1029 ? ARG D 1029 . ? 1_555 ? 
28 AC8 5  MG  N .    ? MG  D 2004 . ? 1_555 ? 
29 AC9 3  ALA F 312  ? ALA F 292  . ? 1_555 ? 
30 AC9 3  GLY F 316  ? GLY F 296  . ? 1_555 ? 
31 AC9 3  TRP F 319  ? TRP F 299  . ? 1_555 ? 
32 BC1 16 THR A 54   ? THR A 54   . ? 1_555 ? 
33 BC1 16 ARG A 146  ? ARG A 146  . ? 1_555 ? 
34 BC1 16 ILE A 158  ? ILE A 158  . ? 1_555 ? 
35 BC1 16 PHE A 171  ? PHE A 171  . ? 1_555 ? 
36 BC1 16 ALA B 8    ? ALA B 8    . ? 1_555 ? 
37 BC1 16 ARG B 189  ? ARG B 189  . ? 1_555 ? 
38 BC1 16 PRO C 444  ? PRO C 444  . ? 1_555 ? 
39 BC1 16 GLU C 445  ? GLU C 445  . ? 1_555 ? 
40 BC1 16 ASN C 448  ? ASN C 448  . ? 1_555 ? 
41 BC1 16 ARG C 557  ? ARG C 557  . ? 1_555 ? 
42 BC1 16 MET C 560  ? MET C 560  . ? 1_555 ? 
43 BC1 16 ASN C 563  ? ASN C 563  . ? 1_555 ? 
44 BC1 16 GLN C 567  ? GLN C 567  . ? 1_555 ? 
45 BC1 16 LYS C 838  ? LYS C 838  . ? 1_555 ? 
46 BC1 16 LYS C 846  ? LYS C 846  . ? 1_555 ? 
47 BC1 16 HOH T .    ? HOH D 2103 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4OIP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4OIP 
_atom_sites.fract_transf_matrix[1][1]   0.005467 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000863 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009579 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003441 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? -15.827 18.678  144.148 1.00   77.12  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? -15.898 17.575  143.198 1.00   86.50  ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? -14.882 17.758  142.072 1.00   93.76  ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? -14.868 16.997  141.103 1.00   88.78  ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? -17.311 17.449  142.625 1.00   88.32  ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? -17.434 16.293  141.814 1.00   85.36  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? -14.036 18.774  142.208 1.00   96.61  ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? -12.977 19.036  141.240 1.00   88.58  ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? -11.727 18.231  141.582 1.00   84.55  ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? -11.187 18.352  142.683 1.00   90.80  ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? -12.648 20.531  141.206 1.00   85.42  ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? -11.324 20.873  140.538 1.00   79.22  ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? -11.346 20.570  139.050 1.00   73.54  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? -10.004 20.887  138.407 1.00   77.79  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? -9.615  22.312  138.599 1.00   71.61  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? -11.272 17.410  140.640 1.00   70.30  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? -10.078 16.598  140.848 1.00   65.49  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? -8.846  17.491  140.954 1.00   64.33  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? -8.685  18.438  140.185 1.00   66.33  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? -9.909  15.585  139.714 1.00   66.69  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? -9.450  14.175  140.101 1.00   64.74  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? -8.001  14.156  140.569 1.00   62.01  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? -10.365 13.595  141.163 1.00   69.35  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? -7.978  17.180  141.910 1.00   60.95  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? -6.816  18.012  142.196 1.00   62.18  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? -5.519  17.283  141.858 1.00   54.74  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? -5.546  16.178  141.317 1.00   52.29  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? -6.820  18.446  143.662 1.00   70.89  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? -8.108  19.128  144.104 1.00   73.88  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? -7.973  20.645  144.146 1.00   76.35  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? -9.240  21.289  144.696 1.00   78.26  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? -9.054  22.731  145.020 1.00   71.40  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? -4.392  17.914  142.182 1.00   52.69  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? -3.071  17.416  141.803 1.00   57.22  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? -2.818  15.963  142.213 1.00   61.23  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? -2.892  15.622  143.393 1.00   64.35  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? -1.985  18.323  142.369 1.00   58.38  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? -2.522  15.107  141.222 1.00   63.34  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? -2.259  13.670  141.362 1.00   57.91  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? -0.851  13.359  141.855 1.00   53.66  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? 0.072   14.146  141.645 1.00   42.28  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? -2.409  13.142  139.928 1.00   49.58  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? -2.995  14.272  139.133 1.00   58.66  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? -2.539  15.510  139.809 1.00   60.30  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? -0.696  12.204  142.494 1.00   65.29  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 0.619   11.712  142.875 1.00   63.00  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 1.406   11.263  141.640 1.00   60.48  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 0.849   10.688  140.682 1.00   58.69  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? 0.545   10.582  143.945 1.00   60.29  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? -0.014  9.295   143.356 1.00   60.35  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 1.915   10.334  144.562 1.00   59.77  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 2.703   11.560  141.683 1.00   58.11  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 3.636   11.295  140.600 1.00   56.29  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 4.690   10.298  141.072 1.00   55.66  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 5.384   10.536  142.059 1.00   61.58  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 4.291   12.611  140.168 1.00   56.03  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 5.379   12.453  139.143 1.00   65.13  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 6.631   13.006  139.356 1.00   68.46  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 5.150   11.760  137.966 1.00   65.23  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 7.635   12.870  138.414 1.00   68.43  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 6.149   11.620  137.021 1.00   59.23  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 7.393   12.176  137.245 1.00   61.00  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 4.798   9.176   140.369 1.00   55.03  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 5.724   8.114   140.744 1.00   53.20  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 6.806   7.939   139.680 1.00   55.47  ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 6.541   8.075   138.486 1.00   52.58  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 4.979   6.779   140.948 1.00   51.22  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 3.875   6.979   141.840 1.00   51.52  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 5.908   5.717   141.524 1.00   46.87  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 8.026   7.650   140.121 1.00   56.77  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 9.146   7.453   139.209 1.00   48.11  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 9.860   6.136   139.498 1.00   45.13  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 10.277  5.883   140.628 1.00   47.82  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 10.165  8.605   139.317 1.00   46.40  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 11.368  8.338   138.429 1.00   51.52  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 9.515   9.928   138.954 1.00   40.60  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 9.995   5.297   138.476 1.00   44.86  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 10.731  4.043   138.613 1.00   53.22  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 11.802  3.916   137.534 1.00   50.33  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 11.491  3.815   136.354 1.00   51.17  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 9.777   2.849   138.557 1.00   55.34  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 8.834   2.756   139.744 1.00   69.75  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 8.017   1.474   139.701 1.00   81.84  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 7.080   1.455   138.581 1.00   72.60  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 5.799   1.797   138.675 1.00   76.10  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 5.298   2.183   139.841 1.00   83.02  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 5.017   1.750   137.605 1.00   69.01  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 13.067  3.908   137.942 1.00   52.21  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 14.163  3.929   136.980 1.00   49.23  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 15.093  2.722   137.082 1.00   55.55  ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 15.453  2.289   138.176 1.00   56.38  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 15.008  5.212   137.127 1.00   54.01  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 15.613  5.245   138.425 1.00   51.22  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 14.141  6.448   136.945 1.00   49.45  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 15.473  2.184   135.926 1.00   66.26  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 16.526  1.179   135.852 1.00   67.08  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 17.651  1.734   134.991 1.00   62.07  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 17.500  1.870   133.777 1.00   61.42  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 16.001  -0.114  135.229 1.00   63.84  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 14.793  -0.710  135.929 1.00   81.19  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 14.301  -1.973  135.251 1.00   86.57  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 15.001  -2.559  134.424 1.00   75.12  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 13.090  -2.398  135.594 1.00   86.13  ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 18.779  2.042   135.623 1.00   64.11  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 19.904  2.649   134.934 1.00   63.41  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 19.534  3.954   134.253 1.00   55.87  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 18.569  4.615   134.638 1.00   48.32  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 20.302  4.323   133.232 1.00   58.67  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 20.003  5.508   132.437 1.00   57.03  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 19.215  5.110   131.195 1.00   61.59  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 18.796  5.961   130.410 1.00   58.17  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 21.296  6.211   132.021 1.00   49.80  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 22.200  6.608   133.176 1.00   45.28  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 23.499  7.216   132.670 1.00   42.11  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 23.259  8.372   131.811 1.00   50.88  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 23.164  9.623   132.249 1.00   58.96  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 23.290  9.887   133.543 1.00   63.71  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 22.941  10.613  131.395 1.00   56.37  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 19.020  3.806   131.027 1.00   64.63  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 18.404  3.260   129.823 1.00   65.62  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 16.877  3.348   129.816 1.00   62.16  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 16.273  3.710   128.806 1.00   64.85  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 18.828  1.798   129.636 1.00   65.90  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 20.313  1.528   129.862 1.00   66.44  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 21.175  1.863   128.656 1.00   73.18  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 21.058  2.987   128.123 1.00   70.64  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 21.974  0.995   128.240 1.00   71.18  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 16.259  3.022   130.946 1.00   55.15  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 14.814  2.830   130.994 1.00   51.24  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 14.167  3.565   132.161 1.00   55.10  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 14.805  3.798   133.188 1.00   56.64  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 14.502  1.332   131.071 1.00   52.51  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 13.033  0.993   131.189 1.00   55.22  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 12.549  0.290   132.283 1.00   57.46  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 12.131  1.377   130.206 1.00   55.75  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 11.208  -0.026  132.394 1.00   58.28  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 10.788  1.068   130.309 1.00   52.97  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 10.333  0.366   131.403 1.00   54.58  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 8.998   0.056   131.505 1.00   52.72  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 12.899  3.932   131.995 1.00   55.90  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 12.153  4.593   133.051 1.00   55.17  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 10.648  4.437   132.929 1.00   48.77  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 10.122  4.200   131.843 1.00   56.46  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 9.959   4.571   134.057 1.00   45.30  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 8.504   4.496   134.112 1.00   44.63  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 7.994   5.653   134.950 1.00   46.26  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 8.490   5.895   136.052 1.00   56.53  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 8.045   3.182   134.741 1.00   41.01  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 8.437   1.940   133.973 1.00   43.82  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 7.805   0.691   134.548 1.00   51.96  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 6.975   0.820   135.472 1.00   54.30  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 8.136   -0.419  134.079 1.00   58.92  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 7.002   6.366   134.432 1.00   42.87  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 6.504   7.552   135.113 1.00   49.28  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 4.990   7.505   135.272 1.00   52.30  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 4.252   7.582   134.296 1.00   52.49  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 6.945   8.803   134.352 1.00   44.85  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 8.421   8.842   134.076 1.00   46.92  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 9.293   9.426   134.978 1.00   55.83  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 8.940   8.269   132.927 1.00   48.19  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 10.652  9.451   134.731 1.00   50.01  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 10.298  8.290   132.678 1.00   50.04  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 11.154  8.882   133.581 1.00   46.79  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 4.533   7.396   136.514 1.00   49.52  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 3.111   7.234   136.782 1.00   46.31  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 2.474   8.531   137.278 1.00   48.58  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 3.063   9.263   138.069 1.00   51.22  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 2.857   6.095   137.795 1.00   46.44  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 1.365   5.826   137.945 1.00   46.64  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 3.581   4.832   137.357 1.00   37.52  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 1.275   8.817   136.784 1.00   45.49  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? 0.486   9.938   137.265 1.00   48.14  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? -0.903  9.419   137.620 1.00   53.29  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? -1.639  8.956   136.736 1.00   46.99  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? 0.382   11.009  136.180 1.00   42.89  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? 0.526   12.467  136.614 1.00   49.57  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 1.968   12.775  136.972 1.00   46.53  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? 0.030   13.403  135.525 1.00   57.88  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? -1.249  9.452   138.909 1.00   62.09  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? -2.599  9.042   139.322 1.00   57.73  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? -3.113  9.764   140.567 1.00   52.75  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? -2.332  10.108  141.441 1.00   56.68  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? -2.674  7.525   139.525 1.00   48.98  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? -1.813  6.988   140.653 1.00   43.90  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? -2.134  5.541   140.979 1.00   53.76  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? -3.305  5.140   140.807 1.00   49.75  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? -1.218  4.803   141.400 1.00   56.50  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? -4.437  9.975   140.668 1.00   52.96  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? -5.487  9.744   139.671 1.00   53.02  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? -5.586  10.889  138.669 1.00   57.51  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? -5.254  12.027  139.001 1.00   56.63  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? -6.753  9.696   140.522 1.00   55.64  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? -6.470  10.652  141.624 1.00   60.46  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? -4.994  10.513  141.922 1.00   62.06  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? -6.056  10.592  137.463 1.00   54.82  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? -6.321  11.626  136.471 1.00   51.72  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? -7.779  11.559  136.035 1.00   53.71  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? -8.394  10.493  136.075 1.00   53.84  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? -5.399  11.466  135.261 1.00   49.20  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? -3.939  11.886  135.444 1.00   45.90  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? -3.111  11.484  134.235 1.00   45.77  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? -3.845  13.384  135.676 1.00   49.78  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? -8.328  12.700  135.627 1.00   52.07  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? -9.699  12.750  135.132 1.00   53.05  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? -9.846  11.867  133.900 1.00   52.01  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? -8.881  11.652  133.168 1.00   56.78  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? -10.111 14.187  134.807 1.00   52.84  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? -10.609 14.981  136.007 1.00   64.14  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? -11.972 14.516  136.492 1.00   76.75  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? -12.681 13.830  135.724 1.00   69.72  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? -12.336 14.837  137.644 1.00   86.77  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? -11.049 11.343  133.689 1.00   51.99  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? -11.309 10.433  132.579 1.00   53.14  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? -10.938 11.052  131.233 1.00   59.69  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? -11.370 12.157  130.905 1.00   62.93  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? -12.779 10.009  132.574 1.00   56.83  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? -13.176 9.152   131.383 1.00   61.86  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? -14.680 8.945   131.336 1.00   66.94  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? -15.403 10.214  131.365 1.00   73.41  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? -15.738 10.911  130.284 1.00   65.09  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? -15.416 10.464  129.077 1.00   54.56  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? -16.396 12.056  130.409 1.00   62.41  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? -10.126 10.332  130.464 1.00   56.76  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? -9.719  10.785  129.148 1.00   47.35  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? -8.404  11.540  129.144 1.00   48.07  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? -7.846  11.819  128.084 1.00   55.30  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? -7.902  11.871  130.329 1.00   48.57  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? -6.652  12.618  130.442 1.00   47.02  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? -5.418  11.729  130.371 1.00   47.81  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? -4.299  12.221  130.220 1.00   43.92  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? -6.630  13.453  131.720 1.00   48.48  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? -7.288  14.787  131.573 1.00   47.74  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? -8.665  14.888  131.501 1.00   50.38  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? -6.530  15.942  131.499 1.00   50.60  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? -9.272  16.113  131.361 1.00   50.81  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? -7.132  17.174  131.360 1.00   51.03  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? -8.504  17.261  131.290 1.00   51.93  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? -5.624  10.421  130.489 1.00   46.94  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? -4.541  9.472   130.325 1.00   44.75  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? -3.974  9.580   128.925 1.00   44.87  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? -2.759  9.600   128.732 1.00   48.82  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? -4.868  9.660   127.945 1.00   45.40  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? -4.480  9.831   126.552 1.00   42.66  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? -4.073  11.275  126.271 1.00   42.97  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? -3.065  11.528  125.603 1.00   47.01  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? -5.621  9.419   125.602 1.00   40.84  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? -5.332  9.876   124.182 1.00   44.50  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? -5.831  7.914   125.653 1.00   43.02  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? -4.860  12.213  126.794 1.00   38.26  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? -4.627  13.641  126.588 1.00   43.44  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? -3.223  14.070  127.011 1.00   42.45  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? -2.564  14.836  126.313 1.00   39.98  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? -5.677  14.497  127.328 1.00   43.63  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? -6.984  14.181  126.834 1.00   44.72  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? -5.412  15.981  127.116 1.00   39.37  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? -2.773  13.586  128.163 1.00   43.78  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? -1.398  13.823  128.589 1.00   48.84  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? -0.419  12.852  127.935 1.00   41.59  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 0.661   13.245  127.495 1.00   38.06  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? -1.277  13.743  130.113 1.00   55.39  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? -1.605  15.018  130.891 1.00   55.22  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? -1.491  14.779  132.389 1.00   54.01  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? -0.694  16.158  130.452 1.00   48.77  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? -0.813  11.585  127.869 1.00   43.55  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? 0.079   10.522  127.444 1.00   45.77  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 0.597   10.612  126.023 1.00   44.65  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 1.807   10.587  125.800 1.00   44.75  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? -0.314  10.711  125.059 1.00   45.30  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? 0.075   10.684  123.647 1.00   44.97  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 0.905   11.873  123.132 1.00   38.22  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 1.929   11.656  122.490 1.00   36.95  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? -1.131  10.417  122.738 1.00   43.78  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? -0.735  10.239  121.285 1.00   42.70  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? -0.853  11.163  120.481 1.00   44.94  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? -0.261  9.045   120.941 1.00   38.23  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 0.472   13.123  123.400 1.00   37.84  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 1.273   14.264  122.937 1.00   33.85  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 2.701   14.205  123.455 1.00   33.58  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 3.633   14.513  122.715 1.00   42.58  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 0.555   15.467  123.551 1.00   31.57  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? -0.819  15.014  123.726 1.00   40.36  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? -0.745  13.574  124.093 1.00   45.10  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 2.861   13.807  124.711 1.00   35.53  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 4.187   13.589  125.266 1.00   42.43  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 4.924   12.539  124.444 1.00   40.86  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 6.062   12.765  124.044 1.00   44.17  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 4.115   13.172  126.736 1.00   46.71  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 3.783   14.299  127.714 1.00   42.93  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 3.698   13.777  129.133 1.00   49.60  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 4.833   15.389  127.604 1.00   37.66  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 4.273   11.408  124.174 1.00   40.60  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 4.886   10.355  123.361 1.00   40.14  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 5.362   10.877  122.001 1.00   40.97  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 6.438   10.519  121.526 1.00   45.22  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 3.940   9.162   123.166 1.00   41.69  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 4.502   8.111   122.222 1.00   30.24  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 3.509   7.012   121.940 1.00   33.21  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 4.104   5.971   121.113 1.00   37.42  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 4.079   5.968   119.786 1.00   39.74  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 3.486   6.956   119.128 1.00   43.11  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 4.648   4.974   119.121 1.00   38.25  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 4.566   11.743  121.386 1.00   39.85  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 4.916   12.273  120.076 1.00   42.01  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 6.049   13.292  120.163 1.00   44.86  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 6.890   13.375  119.264 1.00   53.22  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 3.691   12.892  119.406 1.00   38.69  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 2.461   12.006  119.448 1.00   37.01  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 1.645   12.172  118.196 1.00   37.12  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 1.767   13.518  117.661 1.00   38.49  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 1.812   13.796  116.366 1.00   42.28  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 1.742   12.819  115.471 1.00   36.52  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 1.928   15.051  115.968 1.00   54.29  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 6.071   14.059  121.249 1.00   40.95  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 7.085   15.096  121.436 1.00   43.53  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 8.494   14.543  121.681 1.00   44.09  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 9.465   15.004  121.077 1.00   51.72  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 6.695   16.079  122.573 1.00   43.17  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 5.551   16.990  122.110 1.00   41.87  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 7.896   16.895  123.000 1.00   45.30  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 5.395   18.252  122.908 1.00   47.17  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 8.613   13.553  122.555 1.00   40.26  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 9.938   13.037  122.868 1.00   46.44  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 10.495  12.049  121.810 1.00   43.72  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 11.707  11.841  121.718 1.00   48.21  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 10.017  12.524  124.322 1.00   51.81  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 8.833   11.775  124.959 1.00   41.51  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 8.391   10.554  124.169 1.00   49.03  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 9.145   11.386  126.396 1.00   36.70  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 9.621   11.482  120.980 1.00   40.42  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 10.081  10.687  119.836 1.00   46.34  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 10.675  11.594  118.757 1.00   48.25  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 11.673  11.257  118.115 1.00   48.00  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 8.942   9.843   119.251 1.00   36.02  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 8.550   8.619   120.080 1.00   38.46  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 7.491   7.798   119.369 1.00   31.93  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 9.773   7.766   120.397 1.00   42.27  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 10.059  12.756  118.578 1.00   49.25  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 10.458  13.686  117.529 1.00   47.91  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 11.522  14.686  117.974 1.00   49.30  ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 12.645  14.674  117.476 1.00   55.49  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 9.235   14.448  117.011 1.00   49.96  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 8.750   15.358  117.984 1.00   51.17  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 11.159  15.545  118.920 1.00   46.19  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 11.934  16.751  119.205 1.00   50.39  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 12.987  16.691  120.321 1.00   48.21  ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 13.580  17.718  120.649 1.00   40.74  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 10.992  17.933  119.450 1.00   53.62  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 10.226  18.228  118.292 1.00   55.32  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 13.222  15.527  120.919 1.00   46.62  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 14.264  15.454  121.948 1.00   47.67  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 15.672  15.480  121.363 1.00   50.28  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 16.038  14.612  120.568 1.00   52.04  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 14.119  14.240  122.877 1.00   46.04  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 12.922  14.430  123.797 1.00   45.92  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 15.359  14.074  123.735 1.00   49.09  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 12.812  15.808  124.392 1.00   53.74  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 16.467  16.484  121.767 1.00   49.10  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 17.844  16.655  121.295 1.00   49.30  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 18.754  15.530  121.778 1.00   48.16  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 18.529  14.965  122.848 1.00   46.12  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 18.272  17.983  121.933 1.00   45.48  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 16.998  18.670  122.306 1.00   42.12  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 16.062  17.569  122.676 1.00   42.54  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 19.778  15.219  120.991 1.00   45.99  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 20.704  14.156  121.327 1.00   47.07  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 21.945  14.205  120.458 1.00   55.25  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 22.192  15.194  119.769 1.00   56.99  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 22.728  13.133  120.488 1.00   55.08  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 23.977  13.095  119.741 1.00   54.57  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 24.013  11.976  118.705 1.00   53.71  ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 23.403  10.919  118.887 1.00   43.76  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 25.185  12.956  120.682 1.00   53.19  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 25.004  11.810  121.522 1.00   49.83  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 25.325  14.195  121.551 1.00   55.58  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 24.729  12.231  117.613 1.00   58.63  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 24.922  11.254  116.548 1.00   61.70  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 26.182  11.591  115.752 1.00   57.32  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 26.666  12.723  115.798 1.00   54.02  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 23.707  11.218  115.637 1.00   61.60  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 26.704  10.616  115.012 1.00   55.99  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 27.934  10.820  114.255 1.00   54.70  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 27.621  11.458  112.909 1.00   55.27  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 26.966  10.849  112.063 1.00   62.82  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 28.653  9.480   113.994 1.00   54.77  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 29.937  9.707   113.211 1.00   54.91  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 28.937  8.763   115.304 1.00   59.80  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 28.096  12.683  112.709 1.00   50.41  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 27.789  13.415  111.484 1.00   53.64  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 28.840  13.281  110.383 1.00   59.51  ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 28.585  13.657  109.238 1.00   59.48  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 27.553  14.910  111.769 1.00   53.46  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 28.806  15.559  112.024 1.00   54.60  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 26.641  15.075  112.971 1.00   59.24  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 30.011  12.742  110.712 1.00   58.22  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 31.037  12.561  109.681 1.00   49.64  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 32.044  11.462  110.005 1.00   46.86  ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 32.245  11.115  111.166 1.00   50.87  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 31.768  13.880  109.409 1.00   52.55  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 32.682  13.748  108.334 1.00   47.06  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 32.667  10.913  108.966 1.00   48.56  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 33.713  9.905   109.125 1.00   48.34  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 34.838  10.124  108.121 1.00   55.15  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 34.589  10.242  106.922 1.00   62.59  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 33.174  8.471   108.918 1.00   44.58  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 34.315  7.465   108.936 1.00   35.55  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 32.139  8.121   109.973 1.00   59.64  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 36.073  10.177  108.607 1.00   59.83  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 37.230  10.163  107.717 1.00   65.50  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 38.148  8.991   108.032 1.00   64.64  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 38.511  8.768   109.185 1.00   66.68  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 38.022  11.469  107.791 1.00   62.82  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 39.380  11.366  107.128 1.00   67.32  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 39.495  11.285  105.746 1.00   73.56  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 40.546  11.338  107.884 1.00   68.90  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 40.732  11.184  105.134 1.00   76.91  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 41.788  11.237  107.280 1.00   72.33  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 41.874  11.162  105.905 1.00   75.86  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 43.105  11.062  105.298 1.00   77.02  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 38.519  8.241   107.001 1.00   57.99  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 39.466  7.149   107.165 1.00   58.46  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 40.667  7.375   106.256 1.00   63.13  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 40.513  7.768   105.099 1.00   72.14  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 38.824  5.786   106.851 1.00   59.37  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 37.512  5.625   107.623 1.00   55.30  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 39.785  4.655   107.184 1.00   59.51  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 36.835  4.288   107.409 1.00   57.75  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 41.862  7.140   106.787 1.00   61.18  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 43.085  7.309   106.016 1.00   65.36  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 43.121  6.337   104.840 1.00   65.72  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 42.756  5.167   104.980 1.00   61.25  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 44.313  7.121   106.910 1.00   71.27  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 45.642  7.339   106.203 1.00   81.97  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 46.814  7.380   107.163 1.00   79.55  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 46.582  7.570   108.376 1.00   82.29  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 47.967  7.223   106.706 1.00   78.35  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 43.549  6.842   103.685 1.00   63.04  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 43.615  6.065   102.447 1.00   59.51  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 42.241  5.570   101.993 1.00   57.71  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 42.130  4.529   101.344 1.00   54.23  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 44.600  4.897   102.575 1.00   60.96  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 45.996  5.352   102.958 1.00   65.31  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 46.369  6.492   102.609 1.00   63.70  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 46.720  4.570   103.609 1.00   65.18  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 41.201  6.321   102.346 1.00   57.69  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 39.846  6.044   101.877 1.00   54.98  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 39.220  7.310   101.295 1.00   53.34  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 39.004  8.292   102.006 1.00   51.62  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 38.949  5.491   103.000 1.00   50.44  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 37.510  5.392   102.527 1.00   46.77  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 39.455  4.133   103.463 1.00   50.35  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 38.933  7.278   99.997  1.00   53.88  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 38.476  8.465   99.282  1.00   50.85  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 36.961  8.666   99.316  1.00   48.02  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 36.476  9.760   99.019  1.00   45.12  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 38.962  8.416   97.832  1.00   53.23  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 40.464  8.184   97.649  1.00   55.54  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 40.818  8.034   96.177  1.00   52.75  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 41.259  9.314   98.286  1.00   64.94  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 36.226  7.628   99.711  1.00   49.47  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 34.761  7.660   99.696  1.00   47.52  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 34.140  6.401   100.297 1.00   46.10  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 34.836  5.435   100.608 1.00   48.86  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 34.225  7.866   98.274  1.00   46.99  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 34.638  6.799   97.307  1.00   46.13  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 34.254  5.482   97.440  1.00   42.11  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 35.397  6.858   96.188  1.00   45.81  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 34.762  4.775   96.447  1.00   45.78  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 35.460  5.587   95.672  1.00   51.01  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 32.818  6.424   100.437 1.00   42.95  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 32.083  5.394   101.169 1.00   46.44  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 32.103  4.019   100.502 1.00   45.18  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 31.965  2.995   101.170 1.00   44.66  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 30.636  5.848   101.389 1.00   47.72  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 29.810  4.923   102.269 1.00   48.76  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 28.423  5.469   102.545 1.00   57.10  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 28.085  6.543   102.001 1.00   60.43  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 27.670  4.824   103.307 1.00   52.24  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 32.294  3.994   99.189  1.00   44.42  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 32.170  2.751   98.435  1.00   44.92  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 33.476  1.965   98.355  1.00   45.24  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 33.552  0.947   97.669  1.00   41.97  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 31.621  3.028   97.035  1.00   41.13  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 30.314  3.768   97.038  1.00   39.03  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 30.272  5.128   96.775  1.00   42.36  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 29.129  3.107   97.316  1.00   36.69  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 29.071  5.813   96.780  1.00   40.81  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 27.925  3.787   97.324  1.00   36.09  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 27.896  5.141   97.056  1.00   38.96  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 34.500  2.443   99.056  1.00   47.12  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 35.809  1.798   99.042  1.00   51.74  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 35.873  0.588   99.974  1.00   49.21  ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 34.903  0.262   100.658 1.00   44.95  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 36.892  2.802   99.443  1.00   53.97  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 36.717  4.040   98.777  1.00   51.35  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 37.028  -0.073  99.985  1.00   51.55  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 37.309  -1.153  100.926 1.00   50.04  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 38.726  -0.988  101.461 1.00   54.89  ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 39.616  -0.527  100.745 1.00   60.85  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 37.183  -2.548  100.276 1.00   47.26  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 37.971  -2.595  99.080  1.00   58.00  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 35.734  -2.865  99.941  1.00   41.12  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 38.935  -1.365  102.719 1.00   48.20  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 40.249  -1.241  103.341 1.00   53.44  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 40.931  -2.599  103.470 1.00   57.47  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 40.359  -3.530  104.036 1.00   57.56  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 40.157  -0.590  104.732 1.00   53.66  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 39.307  0.679   104.670 1.00   54.25  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 41.548  -0.284  105.271 1.00   54.32  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 39.069  1.315   106.018 1.00   48.81  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 42.155  -2.716  102.929 1.00   58.01  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 42.953  -3.944  103.012 1.00   49.98  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 43.196  -4.362  104.458 1.00   51.03  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 43.546  -3.527  105.293 1.00   51.94  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 44.275  -3.543  102.353 1.00   52.47  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 43.912  -2.433  101.432 1.00   53.54  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 42.829  -1.674  102.134 1.00   54.19  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 43.002  -5.645  104.746 1.00   53.33  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 43.166  -6.157  106.094 1.00   57.41  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 41.918  -5.973  106.936 1.00   60.24  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 41.849  -6.439  108.072 1.00   62.28  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 40.927  -5.287  106.377 1.00   62.10  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 39.666  -5.062  107.070 1.00   51.58  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 38.538  -5.833  106.391 1.00   52.17  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 38.308  -5.691  105.189 1.00   52.55  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 39.312  -3.562  107.132 1.00   48.45  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 37.974  -3.357  107.821 1.00   48.38  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 40.408  -2.790  107.849 1.00   52.15  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 37.843  -6.655  107.170 1.00   53.79  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 36.749  -7.470  106.659 1.00   52.08  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 35.586  -6.616  106.159 1.00   55.99  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 35.136  -6.768  105.022 1.00   56.97  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 36.263  -8.437  107.742 1.00   45.96  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 35.067  -9.278  107.335 1.00   48.70  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 34.712  -10.294 108.407 1.00   49.15  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 33.562  -11.180 107.962 1.00   42.49  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 33.263  -12.244 108.957 1.00   50.25  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 35.107  -5.716  107.014 1.00   57.08  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 33.968  -4.864  106.683 1.00   51.73  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 34.303  -3.811  105.629 1.00   48.06  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 35.360  -3.182  105.672 1.00   46.12  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 33.421  -4.171  107.938 1.00   47.65  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 32.660  -5.079  108.897 1.00   51.80  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 33.571  -5.855  109.830 1.00   54.96  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 34.793  -5.599  109.822 1.00   58.84  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 33.063  -6.720  110.573 1.00   54.19  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 33.388  -3.629  104.684 1.00   43.83  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 33.478  -2.541  103.722 1.00   40.54  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 33.153  -1.234  104.431 1.00   41.56  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 32.525  -1.242  105.489 1.00   49.15  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 32.498  -2.773  102.576 1.00   44.93  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 31.109  -3.130  103.067 1.00   54.00  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 30.283  -2.210  103.236 1.00   49.43  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 30.845  -4.332  103.290 1.00   58.47  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 33.582  -0.116  103.852 1.00   39.83  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 33.383  1.198   104.467 1.00   45.47  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 31.903  1.498   104.729 1.00   48.37  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 31.560  2.176   105.701 1.00   45.53  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 34.016  2.326   103.616 1.00   40.11  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 33.914  3.666   104.331 1.00   34.87  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 35.467  2.005   103.315 1.00   48.78  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 31.030  0.979   103.870 1.00   45.99  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 29.592  1.148   104.046 1.00   42.40  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 29.131  0.510   105.355 1.00   46.53  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 28.422  1.134   106.149 1.00   51.16  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 28.798  0.541   102.871 1.00   36.01  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 27.304  0.652   103.121 1.00   39.33  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 29.173  1.224   101.569 1.00   39.50  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 29.550  -0.732  105.580 1.00   45.00  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 29.179  -1.454  106.793 1.00   43.27  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 29.819  -0.825  108.026 1.00   44.81  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 29.243  -0.850  109.113 1.00   49.24  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 29.565  -2.931  106.686 1.00   44.74  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 29.087  -3.780  107.854 1.00   38.79  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 29.300  -5.262  107.623 1.00   47.23  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 28.999  -6.056  108.540 1.00   38.04  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 29.766  -5.634  106.524 1.00   52.32  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 31.011  -0.263  107.849 1.00   45.57  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 31.699  0.428   108.935 1.00   46.73  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 30.916  1.666   109.361 1.00   49.37  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 30.705  1.897   110.553 1.00   51.61  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 33.135  0.823   108.538 1.00   39.24  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 33.989  -0.430  108.333 1.00   43.32  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 33.758  1.719   109.597 1.00   34.30  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 35.419  -0.143  107.934 1.00   46.78  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 30.480  2.450   108.380 1.00   49.54  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 29.648  3.620   108.640 1.00   46.60  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 28.332  3.217   109.300 1.00   42.93  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 27.892  3.850   110.261 1.00   41.16  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 29.370  4.413   107.347 1.00   45.34  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 30.653  5.088   106.861 1.00   43.15  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 28.285  5.451   107.571 1.00   39.60  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 30.459  5.973   105.658 1.00   44.51  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 27.716  2.154   108.787 1.00   43.60  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 26.503  1.609   109.391 1.00   44.78  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 26.721  1.257   110.859 1.00   42.67  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 25.853  1.495   111.697 1.00   42.64  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 26.018  0.377   108.626 1.00   38.49  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 25.316  0.631   107.293 1.00   34.70  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 24.780  -0.671  106.726 1.00   36.00  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 24.197  1.645   107.465 1.00   37.67  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 27.884  0.688   111.161 1.00   44.78  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 28.246  0.365   112.535 1.00   43.79  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 28.436  1.623   113.375 1.00   49.03  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 28.097  1.649   114.558 1.00   57.87  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 29.519  -0.484  112.573 1.00   44.22  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 29.297  -1.894  112.061 1.00   49.70  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 28.197  -2.439  112.167 1.00   51.95  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 30.344  -2.495  111.507 1.00   47.68  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 28.972  2.667   112.752 1.00   45.67  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 29.225  3.924   113.446 1.00   49.05  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 27.942  4.719   113.683 1.00   50.97  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 27.906  5.613   114.529 1.00   52.72  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 30.242  4.768   112.673 1.00   52.23  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 31.657  4.187   112.606 1.00   55.09  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 32.512  4.944   111.602 1.00   48.81  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 32.308  4.195   113.983 1.00   51.25  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 26.891  4.391   112.935 1.00   49.07  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 25.602  5.055   113.102 1.00   45.18  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 24.991  4.731   114.459 1.00   47.91  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 24.223  5.520   115.008 1.00   55.31  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 24.632  4.652   111.990 1.00   41.94  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 24.971  5.224   110.627 1.00   47.49  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 23.952  4.804   109.577 1.00   51.00  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 22.575  5.379   109.869 1.00   43.13  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 21.597  5.036   108.798 1.00   36.72  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 25.340  3.566   114.995 1.00   49.00  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 24.782  3.108   116.261 1.00   56.97  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 25.623  3.538   117.460 1.00   58.66  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 25.305  3.205   118.602 1.00   56.07  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 24.608  1.589   116.248 1.00   53.83  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 23.569  1.103   115.254 1.00   50.30  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 23.359  -0.395  115.319 1.00   71.14  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 22.251  -0.856  114.973 1.00   82.37  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 24.303  -1.112  115.714 1.00   73.61  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 26.693  4.281   117.195 1.00   57.56  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 27.545  4.795   118.262 1.00   56.23  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 26.789  5.795   119.130 1.00   56.31  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 26.205  6.756   118.626 1.00   53.26  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 28.799  5.449   117.682 1.00   55.30  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 29.792  5.995   118.710 1.00   57.05  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 30.371  4.863   119.545 1.00   57.45  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 30.897  6.790   118.030 1.00   57.34  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 26.805  5.561   120.438 1.00   55.86  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 26.120  6.431   121.385 1.00   54.14  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 27.125  7.260   122.179 1.00   50.82  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 27.872  6.726   122.997 1.00   56.86  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 25.250  5.618   122.361 1.00   55.16  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 24.502  6.546   123.304 1.00   62.67  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 24.280  4.729   121.594 1.00   51.52  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 27.139  8.566   121.937 1.00   45.29  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 28.106  9.445   122.584 1.00   49.91  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 27.438  10.478  123.486 1.00   59.05  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 26.637  11.292  123.029 1.00   64.01  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 28.983  10.172  121.551 1.00   51.61  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 29.984  11.072  122.253 1.00   55.51  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 29.699  9.167   120.663 1.00   50.70  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 27.782  10.440  124.769 1.00   58.96  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 27.228  11.363  125.752 1.00   60.46  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 28.178  12.524  126.035 1.00   60.65  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 29.370  12.319  126.293 1.00   57.19  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 26.911  10.630  127.058 1.00   58.11  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 26.375  11.537  128.153 1.00   57.36  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 26.396  10.856  129.510 1.00   56.80  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 25.912  11.743  130.565 1.00   63.99  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 25.916  11.441  131.859 1.00   62.04  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 26.381  10.268  132.268 1.00   55.25  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 25.452  12.312  132.745 1.00   56.97  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 27.639  13.739  125.984 1.00   61.98  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 28.398  14.938  126.320 1.00   65.94  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 28.071  15.373  127.742 1.00   70.38  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 26.907  15.589  128.079 1.00   70.12  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 28.066  16.088  125.365 1.00   69.76  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 28.463  15.839  123.937 1.00   72.26  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 29.276  14.772  123.596 1.00   66.02  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 28.025  16.689  122.934 1.00   71.92  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 29.633  14.551  122.281 1.00   66.94  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 28.382  16.475  121.619 1.00   66.64  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 29.188  15.405  121.292 1.00   71.04  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 29.099  15.503  128.573 1.00   71.20  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 28.911  15.970  129.941 1.00   68.34  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 28.761  17.490  129.989 1.00   65.64  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 28.000  18.022  130.796 1.00   62.33  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 30.064  15.512  130.839 1.00   66.12  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 30.012  14.073  131.366 1.00   64.42  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 28.649  13.786  131.982 1.00   65.86  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 30.333  13.053  130.282 1.00   58.01  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 29.486  18.181  129.115 1.00   65.63  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 29.418  19.635  129.045 1.00   68.59  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 28.319  20.090  128.086 1.00   73.35  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 28.345  19.754  126.902 1.00   76.57  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 30.773  20.209  128.619 1.00   73.74  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 30.917  21.687  128.946 1.00   74.67  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 29.976  22.467  128.799 1.00   73.69  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 32.105  22.076  129.395 1.00   71.62  ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 27.345  20.856  128.603 1.00   67.73  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 26.208  21.362  127.823 1.00   64.81  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 26.630  22.354  126.745 1.00   66.49  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 25.914  22.533  125.760 1.00   67.29  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 25.357  22.084  128.873 1.00   64.94  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 25.787  21.516  130.182 1.00   72.34  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 27.241  21.222  130.024 1.00   65.15  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 27.780  22.991  126.935 1.00   67.93  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 28.254  24.014  126.010 1.00   75.14  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 28.898  23.413  124.764 1.00   81.54  ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 29.069  24.097  123.753 1.00   77.84  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 29.252  24.937  126.712 1.00   73.54  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 28.710  25.452  127.915 1.00   73.58  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 29.253  22.134  124.840 1.00   82.44  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 29.986  21.478  123.764 1.00   77.84  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 29.051  21.041  122.641 1.00   75.26  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 28.187  20.188  122.842 1.00   72.65  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 30.722  20.266  124.335 1.00   70.08  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 31.736  19.525  123.470 1.00   73.11  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 32.764  20.490  122.902 1.00   76.80  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 32.406  18.448  124.306 1.00   74.99  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 29.230  21.624  121.458 1.00   77.14  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 28.385  21.297  120.312 1.00   79.48  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 28.964  20.230  119.381 1.00   76.19  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 28.249  19.689  118.537 1.00   72.96  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 28.097  22.563  119.499 1.00   83.19  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 27.434  23.683  120.283 1.00   89.27  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 25.934  23.509  120.399 1.00   94.06  ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 25.362  22.564  119.853 1.00   94.07  ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 25.285  24.426  121.107 1.00   97.95  ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 30.251  19.925  119.530 1.00   75.60  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 30.904  18.973  118.632 1.00   66.50  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 32.125  18.285  119.238 1.00   64.20  ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 32.856  18.880  120.031 1.00   63.35  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 31.315  19.641  117.305 1.00   59.31  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 32.076  18.715  116.519 1.00   57.80  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 32.151  20.882  117.567 1.00   62.35  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 32.349  17.034  118.844 1.00   60.88  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 33.533  16.284  119.259 1.00   62.92  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 34.056  15.450  118.093 1.00   62.17  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 33.275  14.847  117.358 1.00   69.80  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 33.236  15.334  120.446 1.00   57.35  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 34.492  14.583  120.860 1.00   57.43  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 32.685  16.099  121.628 1.00   68.14  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 35.373  15.421  117.917 1.00   51.81  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 35.976  14.547  116.918 1.00   55.68  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 36.780  13.431  117.581 1.00   58.19  ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 37.845  13.671  118.149 1.00   61.74  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 36.879  15.330  115.948 1.00   61.60  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 36.094  16.295  115.236 1.00   55.81  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 37.537  14.384  114.953 1.00   54.22  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 36.263  12.209  117.498 1.00   60.48  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 36.929  11.049  118.082 1.00   59.12  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 38.009  10.519  117.150 1.00   57.80  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 37.863  10.565  115.928 1.00   60.89  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 35.923  9.936   118.391 1.00   57.80  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 35.157  9.955   119.717 1.00   62.68  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 34.253  11.169  119.827 1.00   62.13  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 34.350  8.675   119.874 1.00   60.58  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 39.089  10.014  117.736 1.00   64.82  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 40.202  9.475   116.966 1.00   59.36  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 40.408  8.000   117.292 1.00   59.83  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 40.492  7.622   118.461 1.00   69.33  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 41.481  10.258  117.267 1.00   53.97  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 41.352  11.784  117.272 1.00   62.22  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 42.684  12.437  117.608 1.00   68.50  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 40.822  12.292  115.938 1.00   63.01  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 40.485  7.166   116.260 1.00   54.47  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 40.699  5.736   116.464 1.00   58.00  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 41.889  5.246   115.649 1.00   60.96  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 41.869  5.279   114.423 1.00   59.62  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 39.436  4.941   116.107 1.00   56.41  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 39.356  3.463   116.511 1.00   55.82  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 37.911  3.071   116.770 1.00   60.19  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 39.962  2.544   115.456 1.00   49.51  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 42.928  4.791   116.337 1.00   65.57  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 44.099  4.254   115.663 1.00   56.58  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 44.311  2.811   116.100 1.00   60.89  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 44.635  2.545   117.258 1.00   67.13  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 45.326  5.106   115.984 1.00   59.93  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 46.304  5.250   114.835 1.00   69.01  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 47.176  6.483   115.016 1.00   78.45  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 46.332  7.749   115.054 1.00   71.12  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 47.163  8.974   115.215 1.00   70.63  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 44.121  1.880   115.172 1.00   59.16  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 44.217  0.462   115.496 1.00   67.09  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 44.905  -0.325  114.388 1.00   69.39  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 44.911  0.091   113.227 1.00   71.52  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 42.837  -0.110  115.781 1.00   66.99  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 45.478  -1.466  114.755 1.00   67.36  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 46.218  -2.292  113.810 1.00   71.22  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 46.407  -3.711  114.341 1.00   71.67  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 45.958  -4.035  115.441 1.00   71.71  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 47.575  -1.657  113.504 1.00   81.94  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 48.392  -1.319  114.740 1.00   81.91  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 49.632  -0.511  114.416 1.00   91.62  ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 50.442  -0.265  115.335 1.00   95.95  ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 49.794  -0.119  113.241 1.00   95.09  ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 47.065  -4.554  113.547 1.00   75.61  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 47.307  -5.937  113.921 1.00   71.34  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 46.017  -6.730  113.909 1.00   65.98  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 44.946  -6.159  113.703 1.00   64.87  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 46.103  -8.059  114.094 1.00   63.90  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 44.830  -8.771  114.235 1.00   62.85  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 44.128  -8.309  115.503 1.00   62.75  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 44.703  -8.422  116.586 1.00   63.69  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 45.262  -10.233 114.397 1.00   64.15  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 46.645  -10.296 113.844 1.00   70.09  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 47.262  -8.963  114.115 1.00   66.77  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 42.905  -7.806  115.367 1.00   63.84  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 42.089  -7.434  116.520 1.00   63.42  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 40.638  -7.266  116.090 1.00   62.05  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 40.356  -7.125  114.903 1.00   58.68  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 42.618  -6.161  117.194 1.00   69.20  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 41.984  -4.865  116.712 1.00   68.52  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 42.798  -3.654  117.158 1.00   66.41  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 43.005  -3.619  118.669 1.00   67.32  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 41.759  -3.304  119.426 1.00   60.58  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 39.716  -7.277  117.044 1.00   67.05  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 38.357  -6.857  116.740 1.00   63.14  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 38.114  -5.483  117.350 1.00   61.12  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 37.983  -5.344  118.566 1.00   63.77  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 37.336  -7.872  117.254 1.00   60.34  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 37.495  -9.251  116.639 1.00   62.43  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 36.224  -10.075 116.709 1.00   81.18  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 35.209  -9.568  117.233 1.00   78.13  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 36.241  -11.229 116.233 1.00   91.59  ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 38.044  -4.470  116.492 1.00   57.26  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 37.945  -3.090  116.950 1.00   58.68  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 36.545  -2.763  117.452 1.00   60.98  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 35.557  -2.966  116.745 1.00   61.63  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 38.338  -2.095  115.843 1.00   58.98  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 38.224  -0.665  116.349 1.00   55.95  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 39.748  -2.377  115.350 1.00   54.08  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 36.470  -2.256  118.678 1.00   60.48  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 35.202  -1.854  119.269 1.00   55.93  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 35.180  -0.344  119.471 1.00   54.02  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 36.141  0.350   119.138 1.00   55.34  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 34.990  -2.561  120.607 1.00   56.77  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 35.259  -4.057  120.573 1.00   57.59  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 34.284  -4.784  119.664 1.00   57.02  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 34.564  -6.279  119.651 1.00   62.36  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 33.540  -7.036  118.880 1.00   67.64  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 34.082  0.161   120.023 1.00   53.65  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 33.944  1.590   120.283 1.00   64.45  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 34.799  2.017   121.473 1.00   72.45  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 34.983  3.208   121.727 1.00   73.56  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 32.485  1.945   120.522 1.00   68.63  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 35.316  1.030   122.197 1.00   75.73  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 36.152  1.270   123.366 1.00   71.28  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 37.522  1.794   122.952 1.00   72.90  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 38.177  2.515   123.705 1.00   71.99  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 36.323  -0.033  124.147 1.00   67.37  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 36.371  0.125   125.655 1.00   75.24  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 36.725  -1.198  126.314 1.00   81.05  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 36.324  -2.336  125.490 1.00   77.77  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 35.155  -2.961  125.590 1.00   76.18  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 34.262  -2.562  126.486 1.00   74.12  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 34.880  -3.986  124.795 1.00   68.06  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 37.945  1.427   121.745 1.00   70.97  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 39.285  1.744   121.257 1.00   65.47  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 39.469  3.214   120.879 1.00   64.12  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 40.578  3.643   120.561 1.00   64.03  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 39.656  0.839   120.079 1.00   62.83  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 39.683  -0.631  120.459 1.00   64.19  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 40.732  -1.104  120.946 1.00   65.45  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 38.656  -1.315  120.270 1.00   61.90  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 38.382  3.978   120.905 1.00   63.02  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 38.459  5.412   120.650 1.00   63.85  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 39.258  6.120   121.737 1.00   64.63  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 39.162  5.775   122.916 1.00   64.21  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 37.061  6.025   120.560 1.00   68.56  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 36.396  5.826   119.230 1.00   67.41  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 35.356  4.922   119.089 1.00   63.00  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 36.810  6.545   118.121 1.00   62.18  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 34.740  4.741   117.867 1.00   66.61  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 36.199  6.368   116.895 1.00   64.11  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 35.163  5.464   116.767 1.00   69.46  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 40.048  7.109   121.335 1.00   62.49  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 40.836  7.888   122.281 1.00   62.35  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 39.927  8.728   123.171 1.00   63.25  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 39.121  9.515   122.672 1.00   59.62  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 41.835  8.784   121.547 1.00   64.67  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 42.887  8.067   120.696 1.00   65.88  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 43.868  9.065   120.095 1.00   61.78  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 43.617  7.011   121.512 1.00   59.39  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 40.052  8.552   124.496 1.00   64.76  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 39.235  9.245   125.501 1.00   61.51  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 39.335  10.765  125.400 1.00   58.86  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 40.437  11.306  125.308 1.00   56.50  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 39.839  8.770   126.826 1.00   60.40  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 40.464  7.456   126.506 1.00   58.93  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 40.994  7.601   125.113 1.00   57.12  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 38.189  11.438  125.416 1.00   61.14  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 38.146  12.897  125.367 1.00   67.71  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 37.427  13.441  126.602 1.00   72.64  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 36.490  12.820  127.108 1.00   66.35  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 37.445  13.401  124.086 1.00   59.73  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 37.586  14.912  123.950 1.00   52.84  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 38.018  12.707  122.863 1.00   62.75  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 37.879  14.596  127.085 1.00   71.88  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 37.306  15.225  128.271 1.00   76.79  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 35.819  15.528  128.104 1.00   75.71  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 35.391  16.019  127.057 1.00   69.45  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 38.073  16.495  128.615 1.00   72.72  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 35.046  15.227  129.146 1.00   75.62  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 33.599  15.453  129.161 1.00   79.36  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 32.866  14.716  128.038 1.00   80.52  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 31.850  15.192  127.530 1.00   80.15  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 33.276  16.951  129.124 1.00   78.33  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 33.805  17.691  130.337 1.00   77.39  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 33.966  17.054  131.400 1.00   70.41  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 34.057  18.909  130.227 1.00   77.03  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 33.392  13.556  127.656 1.00   71.57  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 32.780  12.727  126.624 1.00   62.95  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 32.801  11.262  127.045 1.00   57.65  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 33.859  10.724  127.369 1.00   57.32  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 33.517  12.865  125.275 1.00   71.47  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 33.007  11.835  124.277 1.00   66.96  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 33.367  14.276  124.720 1.00   69.98  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 31.637  10.618  127.043 1.00   59.33  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 31.564  9.205   127.417 1.00   63.95  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 30.820  8.356   126.391 1.00   63.41  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 29.711  8.693   125.984 1.00   60.92  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 30.900  9.038   128.786 1.00   63.18  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 30.733  7.583   129.201 1.00   60.52  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 29.753  7.404   130.342 1.00   66.73  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 29.187  8.416   130.808 1.00   73.93  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 29.545  6.248   130.770 1.00   55.39  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 31.427  7.244   125.987 1.00   59.54  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 30.771  6.311   125.077 1.00   59.46  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 29.902  5.339   125.871 1.00   60.66  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 30.400  4.593   126.715 1.00   60.15  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 31.785  5.530   124.211 1.00   56.51  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 32.342  6.416   123.093 1.00   48.35  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 31.130  4.302   123.599 1.00   61.84  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 33.441  7.364   123.527 1.00   53.98  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 28.602  5.355   125.592 1.00   61.50  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 27.632  4.585   126.366 1.00   57.16  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 27.559  3.122   125.940 1.00   56.49  ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 26.920  2.309   126.608 1.00   55.66  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 26.245  5.223   126.271 1.00   61.25  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 26.211  6.701   126.633 1.00   65.98  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 26.759  7.021   128.319 1.00   70.86  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 25.609  6.003   129.242 1.00   65.21  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 28.203  2.792   124.825 1.00   58.22  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 28.243  1.411   124.350 1.00   65.74  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 29.621  1.004   123.831 1.00   64.86  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 29.841  0.930   122.622 1.00   67.78  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 27.163  1.164   123.289 1.00   74.43  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 27.185  2.194   122.174 1.00   62.70  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 27.646  3.320   122.361 1.00   62.04  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 26.681  1.811   121.006 1.00   58.63  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 30.555  0.732   124.754 1.00   61.52  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 31.938  0.386   124.410 1.00   69.32  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 32.070  -0.983  123.744 1.00   71.85  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 33.080  -1.241  123.089 1.00   74.47  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 32.641  0.384   125.769 1.00   72.81  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 31.568  0.057   126.740 1.00   70.78  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 30.331  0.720   126.210 1.00   63.43  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 31.068  -1.842  123.906 1.00   75.10  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 31.117  -3.185  123.332 1.00   77.01  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 30.628  -3.225  121.886 1.00   78.08  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 30.628  -4.282  121.253 1.00   74.02  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 30.313  -4.170  124.183 1.00   76.36  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 31.032  -4.558  125.458 1.00   89.39  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 30.817  -5.690  125.940 1.00   95.55  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 31.816  -3.733  125.975 1.00   88.27  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 30.211  -2.071  121.372 1.00   76.83  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 29.754  -1.966  119.991 1.00   67.95  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 30.886  -2.290  119.025 1.00   64.11  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 31.967  -1.708  119.107 1.00   66.05  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 29.212  -0.562  119.713 1.00   65.49  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 28.888  -0.222  118.256 1.00   61.39  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 27.850  -1.178  117.685 1.00   63.30  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 28.419  1.221   118.135 1.00   51.27  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 30.633  -3.222  118.112 1.00   58.47  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 31.642  -3.623  117.139 1.00   61.07  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 31.733  -2.622  115.993 1.00   56.21  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 30.729  -2.040  115.584 1.00   59.21  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 31.338  -5.018  116.590 1.00   56.75  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 32.358  -5.516  115.615 1.00   51.36  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 33.554  -6.076  116.009 1.00   54.69  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 32.366  -5.530  114.261 1.00   56.72  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 34.252  -6.419  114.942 1.00   55.52  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 33.553  -6.097  113.867 1.00   55.85  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 32.943  -2.424  115.478 1.00   52.28  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 33.156  -1.518  114.355 1.00   56.01  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 33.705  -2.264  113.146 1.00   55.73  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 33.041  -2.365  112.114 1.00   54.59  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 34.117  -0.371  114.720 1.00   52.78  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 33.504  0.509   115.808 1.00   49.52  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 34.443  0.466   113.491 1.00   46.07  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 34.348  1.707   116.159 1.00   53.90  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 34.919  -2.787  113.279 1.00   52.80  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 35.565  -3.495  112.183 1.00   52.88  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 36.417  -4.652  112.689 1.00   52.09  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 36.872  -4.647  113.834 1.00   56.74  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 36.410  -2.534  111.356 1.00   48.16  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 36.623  -5.643  111.829 1.00   50.52  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 37.487  -6.772  112.148 1.00   55.21  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 38.814  -6.636  111.406 1.00   53.59  ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 38.866  -6.756  110.183 1.00   53.66  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 36.824  -8.115  111.780 1.00   51.58  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 35.596  -8.260  112.505 1.00   47.85  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 37.747  -9.278  112.117 1.00   51.66  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 39.883  -6.384  112.154 1.00   55.67  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 41.197  -6.157  111.561 1.00   54.12  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 42.072  -7.408  111.541 1.00   59.91  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 42.182  -8.130  112.537 1.00   61.52  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 41.922  -5.004  112.260 1.00   58.56  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 41.718  -3.609  111.663 1.00   58.51  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 40.255  -3.185  111.714 1.00   49.68  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 42.601  -2.592  112.371 1.00   65.55  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 42.700  -7.629  110.391 1.00   63.21  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 43.492  -8.818  110.108 1.00   60.61  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 44.966  -8.532  110.386 1.00   65.88  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 45.317  -7.432  110.814 1.00   66.11  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 43.306  -9.175  108.634 1.00   59.55  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 43.600  -10.605 108.245 1.00   64.05  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 43.547  -10.795 106.743 1.00   62.79  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 43.516  -9.782  106.012 1.00   57.57  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 43.530  -11.954 106.292 1.00   61.01  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 45.824  -9.521  110.148 1.00   67.79  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 47.265  -9.317  110.233 1.00   72.04  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 47.678  -8.272  109.209 1.00   63.40  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 47.394  -8.412  108.021 1.00   60.85  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 48.014  -10.624 109.960 1.00   80.58  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 48.742  -11.203 111.165 1.00   84.77  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 49.812  -10.274 111.711 1.00   88.55  ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 50.029  -10.280 112.940 1.00   89.25  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 50.441  -9.545  110.914 1.00   87.90  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 48.349  -7.222  109.671 1.00   61.78  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 48.731  -6.129  108.798 1.00   68.19  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 47.566  -5.210  108.483 1.00   64.15  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 47.741  -4.165  107.856 1.00   63.58  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 46.371  -5.604  108.911 1.00   62.24  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 45.190  -4.780  108.737 1.00   66.37  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 45.307  -3.524  109.575 1.00   70.73  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 45.516  -3.596  110.785 1.00   76.61  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 45.167  -2.370  108.932 1.00   68.35  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 45.407  -1.100  109.602 1.00   75.65  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 44.216  -0.158  109.455 1.00   74.88  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 43.656  -0.016  108.367 1.00   79.35  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 46.678  -0.457  109.047 1.00   80.57  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 47.306  0.593   109.944 1.00   81.65  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 48.821  0.573   109.809 1.00   87.14  ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 49.238  0.211   108.456 1.00   104.00 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 49.407  1.082   107.466 1.00   105.29 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 49.198  2.375   107.674 1.00   108.18 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 49.787  0.659   106.268 1.00   87.96  ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 43.831  0.479   110.557 1.00   71.10  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 42.685  1.379   110.555 1.00   64.78  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 42.970  2.682   111.303 1.00   66.31  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 43.351  2.670   112.476 1.00   68.92  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 41.461  0.682   111.155 1.00   55.60  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 40.156  1.479   111.174 1.00   54.98  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 39.705  1.802   109.758 1.00   54.11  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 39.074  0.721   111.928 1.00   55.88  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 42.784  3.802   110.611 1.00   61.52  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1  139  ? 42.915  5.120   111.218 1.00   62.49  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1  139  ? 41.696  5.981   110.896 1.00   59.61  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1  139  ? 41.441  6.295   109.733 1.00   66.05  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1  139  ? 44.195  5.807   110.735 1.00   62.79  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1  139  ? 44.467  7.115   111.457 1.00   77.85  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1  139  ? 43.969  7.346   112.560 1.00   79.85  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1  139  ? 45.263  7.979   110.836 1.00   76.05  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1  140  ? 40.949  6.366   111.926 1.00   50.17  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1  140  ? 39.694  7.086   111.736 1.00   52.17  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1  140  ? 39.584  8.362   112.557 1.00   52.90  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1  140  ? 40.112  8.455   113.667 1.00   64.48  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1  140  ? 38.498  6.191   112.075 1.00   55.04  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1  140  ? 38.283  5.024   111.137 1.00   63.88  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1  140  ? 36.627  4.337   111.327 1.00   58.72  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1  140  ? 36.564  4.099   113.101 1.00   55.12  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1  141  ? 38.882  9.338   111.993 1.00   50.48  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1  141  ? 38.458  10.527  112.715 1.00   56.00  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1  141  ? 36.960  10.701  112.494 1.00   55.98  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1  141  ? 36.523  10.952  111.370 1.00   58.48  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1  141  ? 39.202  11.759  112.202 1.00   53.71  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1  141  ? 40.714  11.649  112.257 1.00   52.74  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1  141  ? 41.402  12.848  111.638 1.00   66.78  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1  141  ? 40.693  13.777  111.193 1.00   62.79  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1  141  ? 42.651  12.861  111.592 1.00   73.26  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1  142  ? 36.170  10.567  113.555 1.00   55.40  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1  142  ? 34.716  10.668  113.419 1.00   55.81  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1  142  ? 34.132  11.912  114.096 1.00   58.77  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1  142  ? 34.416  12.197  115.260 1.00   63.43  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1  142  ? 33.992  9.382   113.906 1.00   50.85  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1  142  ? 34.444  8.182   113.090 1.00   56.65  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1  142  ? 34.242  9.135   115.381 1.00   52.53  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1  143  ? 33.325  12.660  113.351 1.00   57.82  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1  143  ? 32.708  13.872  113.878 1.00   53.29  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1  143  ? 31.290  13.630  114.386 1.00   56.23  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1  143  ? 30.403  13.212  113.628 1.00   60.46  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1  143  ? 32.711  14.995  112.839 1.00   43.90  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1  143  ? 31.850  16.179  113.240 1.00   45.94  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1  143  ? 32.126  17.400  112.389 1.00   51.55  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1  143  ? 31.211  18.495  112.698 1.00   53.92  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1  143  ? 31.386  19.751  112.298 1.00   56.77  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1  143  ? 32.449  20.077  111.576 1.00   64.48  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1  143  ? 30.501  20.682  112.623 1.00   52.75  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1  144  ? 31.105  13.910  115.675 1.00   58.15  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1  144  ? 29.830  13.762  116.367 1.00   56.97  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1  144  ? 29.322  15.128  116.826 1.00   58.06  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1  144  ? 30.053  15.884  117.468 1.00   60.13  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1  144  ? 29.985  12.867  117.610 1.00   47.90  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1  144  ? 28.664  12.746  118.352 1.00   51.16  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1  144  ? 30.518  11.497  117.219 1.00   50.78  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1  145  ? 28.068  15.438  116.504 1.00   55.97  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1  145  ? 27.486  16.734  116.846 1.00   58.30  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1  145  ? 26.209  16.608  117.672 1.00   64.61  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1  145  ? 25.594  15.543  117.731 1.00   64.99  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1  145  ? 27.180  17.541  115.579 1.00   56.03  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1  145  ? 28.428  18.095  114.921 1.00   62.47  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1  145  ? 28.816  19.236  115.250 1.00   62.54  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1  145  ? 29.014  17.396  114.068 1.00   61.44  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1  146  ? 25.826  17.706  118.316 1.00   63.88  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1  146  ? 24.524  17.805  118.961 1.00   57.03  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1  146  ? 23.484  18.161  117.911 1.00   58.21  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1  146  ? 23.757  18.938  116.995 1.00   61.74  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1  146  ? 24.533  18.882  120.044 1.00   69.60  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1  146  ? 25.267  18.509  121.319 1.00   72.66  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1  146  ? 25.087  19.599  122.366 1.00   71.93  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1  146  ? 25.680  19.246  123.652 1.00   69.22  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1  146  ? 25.048  18.561  124.600 1.00   69.50  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1  146  ? 23.803  18.150  124.403 1.00   63.77  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1  146  ? 25.659  18.286  125.744 1.00   66.40  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1  147  ? 22.289  17.598  118.043 1.00   55.53  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1  147  ? 21.229  17.862  117.090 1.00   59.29  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1  147  ? 19.892  17.289  117.511 1.00   56.86  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1  147  ? 19.768  16.683  118.575 1.00   54.42  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1  148  ? 18.888  17.476  116.663 1.00   58.36  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1  148  ? 17.540  17.017  116.962 1.00   54.62  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1  148  ? 16.879  16.415  115.723 1.00   57.75  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1  148  ? 17.022  16.934  114.613 1.00   52.39  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1  148  ? 16.676  18.167  117.540 1.00   50.31  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1  148  ? 16.676  19.369  116.602 1.00   52.47  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1  148  ? 15.258  17.696  117.818 1.00   55.55  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1  149  ? 16.175  15.304  115.916 1.00   57.94  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1  149  ? 15.450  14.664  114.835 1.00   59.04  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1  149  ? 16.338  13.824  113.940 1.00   56.04  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1  149  ? 17.405  13.370  114.354 1.00   51.23  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1  150  ? 15.888  13.617  112.707 1.00   54.80  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1  150  ? 16.615  12.794  111.747 1.00   53.52  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1  150  ? 17.115  13.622  110.570 1.00   49.27  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1  150  ? 16.324  14.105  109.761 1.00   52.69  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1  150  ? 15.724  11.653  111.251 1.00   49.88  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1  150  ? 16.251  10.935  110.030 1.00   45.32  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1  150  ? 17.302  10.032  110.128 1.00   45.15  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1  150  ? 15.687  11.151  108.779 1.00   53.75  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1  150  ? 17.782  9.370   109.012 1.00   50.89  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1  150  ? 16.160  10.494  107.657 1.00   57.25  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1  150  ? 17.208  9.606   107.779 1.00   53.01  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1  150  ? 17.680  8.953   106.663 1.00   52.12  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1  151  ? 18.432  13.781  110.480 1.00   48.94  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1  151  ? 19.037  14.545  109.396 1.00   53.21  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1  151  ? 19.881  13.650  108.495 1.00   53.20  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1  151  ? 20.945  13.183  108.902 1.00   54.28  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1  151  ? 19.917  15.689  109.934 1.00   54.62  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1  151  ? 20.556  16.450  108.785 1.00   59.44  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1  151  ? 19.097  16.624  110.808 1.00   60.41  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1  152  ? 19.405  13.407  107.264 1.00   53.84  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1  152  ? 20.120  12.572  106.294 1.00   55.48  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1  152  ? 21.446  13.204  105.895 1.00   60.18  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1  152  ? 21.598  14.422  105.995 1.00   60.46  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1  152  ? 19.173  12.545  105.088 1.00   58.14  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1  152  ? 17.836  12.904  105.635 1.00   53.05  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1  152  ? 18.112  13.874  106.738 1.00   57.53  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1  153  ? 22.389  12.381  105.446 1.00   58.74  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  153  ? 23.706  12.863  105.047 1.00   56.87  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  153  ? 23.609  13.860  103.899 1.00   55.76  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  153  ? 24.406  14.793  103.805 1.00   56.48  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  153  ? 24.603  11.695  104.662 1.00   56.35  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  154  ? 22.622  13.659  103.033 1.00   60.49  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  154  ? 22.445  14.506  101.860 1.00   58.56  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  154  ? 22.092  15.937  102.248 1.00   59.83  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  154  ? 22.428  16.879  101.533 1.00   68.79  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  154  ? 21.367  13.933  100.933 1.00   57.47  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1  154  ? 21.563  12.467  100.565 1.00   65.15  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1  154  ? 20.951  11.518  101.583 1.00   75.84  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1  154  ? 19.757  11.687  101.915 1.00   67.33  ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1  154  ? 21.665  10.606  102.055 1.00   72.12  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1  155  ? 21.407  16.098  103.377 1.00   61.37  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1  155  ? 20.965  17.421  103.809 1.00   62.41  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1  155  ? 22.055  18.269  104.468 1.00   63.35  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1  155  ? 22.220  19.441  104.128 1.00   69.25  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1  155  ? 19.749  17.317  104.732 1.00   65.73  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1  155  ? 19.122  18.663  105.055 1.00   77.38  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1  155  ? 18.811  19.434  103.779 1.00   77.46  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1  155  ? 18.329  20.843  104.079 1.00   79.60  ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1  155  ? 18.094  21.620  102.830 1.00   71.41  ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1  156  ? 22.786  17.689  105.417 1.00   59.31  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1  156  ? 23.817  18.445  106.131 1.00   65.07  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1  156  ? 25.147  18.550  105.378 1.00   64.33  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1  156  ? 25.765  19.615  105.350 1.00   63.94  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1  156  ? 24.018  17.920  107.561 1.00   61.89  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1  156  ? 24.576  16.533  107.635 1.00   52.68  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1  156  ? 25.927  16.270  107.573 1.00   51.52  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1  156  ? 23.966  15.334  107.786 1.00   54.06  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1  156  ? 26.126  14.968  107.673 1.00   53.68  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1  156  ? 24.952  14.377  107.804 1.00   53.81  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1  157  ? 25.576  17.448  104.768 1.00   65.02  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1  157  ? 26.801  17.421  103.985 1.00   55.71  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1  157  ? 28.036  17.865  104.749 1.00   54.84  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1  157  ? 28.874  18.595  104.219 1.00   49.63  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1  158  ? 28.149  17.424  105.998 1.00   63.97  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1  158  ? 29.258  17.834  106.853 1.00   66.27  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1  158  ? 30.557  17.106  106.522 1.00   60.93  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1  158  ? 30.630  15.877  106.574 1.00   55.53  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1  158  ? 28.928  17.632  108.346 1.00   60.25  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1  158  ? 27.902  18.669  108.805 1.00   53.09  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1  158  ? 30.187  17.733  109.193 1.00   62.32  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1  158  ? 27.672  18.670  110.297 1.00   60.38  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1  159  ? 31.579  17.884  106.182 1.00   67.43  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1  159  ? 32.902  17.351  105.893 1.00   71.75  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1  159  ? 33.972  18.206  106.564 1.00   71.77  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1  159  ? 34.058  19.411  106.321 1.00   63.50  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1  159  ? 33.141  17.291  104.381 1.00   67.23  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1  159  ? 32.209  16.344  103.640 1.00   60.84  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1  159  ? 32.371  16.458  102.131 1.00   62.52  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1  159  ? 33.758  16.028  101.685 1.00   67.36  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1  159  ? 33.895  16.063  100.202 1.00   65.48  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1  160  ? 34.778  17.582  107.418 1.00   69.72  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1  160  ? 35.874  18.281  108.080 1.00   70.14  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1  160  ? 37.083  18.443  107.160 1.00   71.44  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1  160  ? 37.808  19.434  107.245 1.00   71.74  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1  160  ? 36.264  17.571  109.376 1.00   70.07  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1  160  ? 35.317  17.889  110.515 1.00   72.04  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1  160  ? 34.240  18.460  110.242 1.00   64.91  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1  160  ? 35.646  17.572  111.679 1.00   72.75  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1  161  ? 37.295  17.467  106.283 1.00   72.13  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1  161  ? 38.350  17.564  105.279 1.00   71.20  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1  161  ? 37.857  17.124  103.902 1.00   69.11  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1  161  ? 36.688  16.776  103.734 1.00   73.89  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1  161  ? 39.588  16.766  105.698 1.00   69.79  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1  161  ? 39.338  15.294  105.965 1.00   64.44  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1  161  ? 40.622  14.608  106.403 1.00   70.33  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1  161  ? 41.138  15.165  107.651 1.00   80.63  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1  161  ? 42.351  14.916  108.138 1.00   86.64  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1  161  ? 43.184  14.123  107.478 1.00   77.57  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1  161  ? 42.733  15.468  109.282 1.00   86.06  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1  162  ? 38.754  17.145  102.922 1.00   65.97  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1  162  ? 38.398  16.853  101.536 1.00   66.58  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1  162  ? 37.861  15.433  101.345 1.00   63.22  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1  162  ? 36.877  15.224  100.635 1.00   66.27  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1  162  ? 39.598  17.084  100.592 1.00   70.68  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1  162  ? 40.099  18.528  100.705 1.00   64.72  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1  162  ? 39.222  16.766  99.156  1.00   67.63  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1  162  ? 39.103  19.565  100.230 1.00   49.62  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1  163  ? 38.502  14.463  101.989 1.00   58.72  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1  163  ? 38.119  13.062  101.833 1.00   65.28  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1  163  ? 37.069  12.588  102.838 1.00   60.23  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1  163  ? 36.731  11.404  102.875 1.00   59.14  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1  163  ? 39.350  12.152  101.881 1.00   73.03  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1  163  ? 40.133  12.157  100.579 1.00   73.77  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1  163  ? 39.567  12.335  99.500  1.00   64.98  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1  163  ? 41.442  11.954  100.675 1.00   74.17  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1  164  ? 36.565  13.510  103.652 1.00   58.98  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1  164  ? 35.575  13.177  104.676 1.00   59.42  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1  164  ? 34.272  12.646  104.077 1.00   58.00  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1  164  ? 33.883  13.029  102.975 1.00   59.54  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1  164  ? 35.301  14.384  105.562 1.00   60.01  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1  165  ? 33.606  11.761  104.814 1.00   57.69  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1  165  ? 32.352  11.164  104.363 1.00   51.19  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1  165  ? 31.175  11.555  105.253 1.00   53.63  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1  165  ? 31.130  11.183  106.426 1.00   54.06  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1  165  ? 32.439  9.629   104.347 1.00   41.36  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1  165  ? 33.682  9.169   103.586 1.00   42.11  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1  165  ? 31.180  9.034   103.741 1.00   47.71  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1  165  ? 33.888  7.673   103.620 1.00   48.06  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1  166  ? 30.217  12.312  104.697 1.00   48.79  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1  166  ? 28.981  12.647  105.413 1.00   54.53  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1  166  ? 28.187  11.393  105.773 1.00   59.91  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1  166  ? 28.073  10.478  104.954 1.00   53.33  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1  166  ? 28.209  13.488  104.394 1.00   51.33  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1  166  ? 29.261  14.084  103.532 1.00   47.13  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1  166  ? 30.316  13.024  103.412 1.00   50.46  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1  167  ? 27.650  11.359  106.990 1.00   59.79  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1  167  ? 26.938  10.188  107.494 1.00   56.79  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1  167  ? 25.547  10.560  108.001 1.00   55.75  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1  167  ? 25.370  11.601  108.635 1.00   55.92  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1  167  ? 27.734  9.506   108.632 1.00   52.80  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1  167  ? 26.930  8.383   109.270 1.00   47.76  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1  167  ? 29.062  8.984   108.109 1.00   55.44  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1  168  ? 24.563  9.713   107.704 1.00   56.47  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1  168  ? 23.208  9.890   108.213 1.00   55.26  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1  168  ? 23.204  9.896   109.736 1.00   60.58  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1  168  ? 23.732  8.984   110.375 1.00   54.27  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1  168  ? 22.292  8.779   107.701 1.00   49.77  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1  168  ? 22.180  8.768   106.194 1.00   63.41  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1  168  ? 22.020  9.856   105.601 1.00   65.47  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1  168  ? 22.259  7.672   105.602 1.00   71.13  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1  169  ? 22.602  10.930  110.312 1.00   58.68  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1  169  ? 22.592  11.091  111.757 1.00   49.69  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1  169  ? 21.181  11.052  112.324 1.00   49.83  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1  169  ? 20.337  11.878  111.972 1.00   47.81  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1  169  ? 23.281  12.391  112.144 1.00   52.16  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1  170  ? 20.928  10.086  113.201 1.00   46.09  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1  170  ? 19.696  10.077  113.971 1.00   42.69  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1  170  ? 20.035  10.583  115.361 1.00   46.63  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1  170  ? 20.662  9.881   116.155 1.00   52.93  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1  170  ? 19.107  8.666   114.082 1.00   42.77  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1  170  ? 17.783  8.704   114.838 1.00   45.03  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1  170  ? 18.928  8.059   112.700 1.00   42.96  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1  171  ? 19.607  11.804  115.655 1.00   47.85  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1  171  ? 20.009  12.463  116.888 1.00   54.66  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1  171  ? 19.223  11.980  118.094 1.00   51.82  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1  171  ? 19.744  11.967  119.207 1.00   52.20  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1  171  ? 19.884  13.980  116.754 1.00   50.70  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1  171  ? 20.883  14.585  115.812 1.00   58.23  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1  171  ? 22.234  14.569  116.114 1.00   56.28  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1  171  ? 20.472  15.176  114.629 1.00   65.54  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1  171  ? 23.158  15.126  115.250 1.00   57.68  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1  171  ? 21.392  15.736  113.761 1.00   57.99  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1  171  ? 22.735  15.711  114.073 1.00   53.67  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1  172  ? 17.979  11.571  117.864 1.00   53.13  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1  172  ? 17.068  11.238  118.952 1.00   51.25  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1  172  ? 17.638  10.152  119.854 1.00   57.72  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1  172  ? 17.873  9.026   119.413 1.00   56.82  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1  172  ? 15.710  10.798  118.402 1.00   58.42  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1  172  ? 14.831  10.432  119.452 1.00   55.38  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1  173  ? 17.879  10.505  121.126 1.00   60.38  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1  173  ? 18.368  9.593   122.164 1.00   57.78  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1  173  ? 17.293  8.602   122.592 1.00   53.61  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1  173  ? 17.599  7.589   123.219 1.00   51.72  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1  173  ? 18.724  10.536  123.314 1.00   45.56  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1  173  ? 17.836  11.693  123.128 1.00   43.35  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1  173  ? 17.665  11.866  121.651 1.00   46.42  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1  174  ? 16.043  8.899   122.253 1.00   51.88  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1  174  ? 14.924  8.069   122.673 1.00   51.07  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1  174  ? 14.732  6.890   121.728 1.00   50.12  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1  174  ? 14.451  7.071   120.542 1.00   47.40  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1  174  ? 13.621  8.883   122.709 1.00   49.03  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1  174  ? 12.455  7.990   123.073 1.00   45.15  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1  174  ? 13.745  10.041  123.689 1.00   54.87  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1  175  ? 14.894  5.681   122.259 1.00   46.11  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1  175  ? 14.716  4.468   121.469 1.00   44.61  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1  175  ? 13.252  4.067   121.295 1.00   45.76  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1  175  ? 12.815  3.776   120.182 1.00   47.76  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1  175  ? 15.530  3.312   122.055 1.00   43.09  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1  175  ? 17.028  3.560   122.034 1.00   52.94  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1  175  ? 17.817  2.261   122.017 1.00   67.45  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1  175  ? 19.239  2.498   121.776 1.00   81.92  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1  175  ? 19.784  2.623   120.569 1.00   85.14  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1  175  ? 19.027  2.535   119.483 1.00   82.66  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1  175  ? 21.087  2.839   120.446 1.00   77.63  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1  176  ? 12.495  4.051   122.390 1.00   45.53  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1  176  ? 11.083  3.666   122.308 1.00   47.49  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1  176  ? 10.245  4.315   123.403 1.00   43.23  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1  176  ? 10.735  4.537   124.504 1.00   44.32  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1  176  ? 10.943  2.139   122.354 1.00   47.02  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1  176  ? 9.507   1.621   122.361 1.00   41.10  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1  176  ? 9.376   0.340   121.547 1.00   47.88  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1  176  ? 10.340  -0.678  121.955 1.00   58.46  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1  176  ? 10.082  -1.645  122.828 1.00   64.07  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1  176  ? 8.883   -1.732  123.389 1.00   57.65  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1  176  ? 11.022  -2.528  123.141 1.00   73.73  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1  177  ? 8.988   4.628   123.099 1.00   40.73  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1  177  ? 8.083   5.194   124.099 1.00   42.87  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1  177  ? 6.664   4.643   124.015 1.00   41.44  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1  177  ? 6.041   4.656   122.953 1.00   42.87  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1  177  ? 8.041   6.730   124.023 1.00   35.83  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1  177  ? 6.843   7.271   124.790 1.00   37.28  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1  177  ? 9.328   7.303   124.572 1.00   38.58  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1  178  ? 6.158   4.162   125.147 1.00   41.39  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1  178  ? 4.787   3.671   125.221 1.00   43.08  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1  178  ? 4.077   4.293   126.413 1.00   49.30  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1  178  ? 4.720   4.853   127.297 1.00   51.42  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1  178  ? 4.771   2.159   125.330 1.00   37.46  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1  179  ? 2.751   4.208   126.436 1.00   47.64  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1  179  ? 2.013   4.662   127.609 1.00   46.81  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1  179  ? 0.768   3.828   127.908 1.00   50.22  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1  179  ? 0.064   3.373   127.005 1.00   48.12  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1  179  ? 1.708   6.167   127.555 1.00   42.55  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1  179  ? 0.633   6.546   126.581 1.00   38.59  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1  179  ? -0.643  6.845   127.027 1.00   39.07  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1  179  ? 0.900   6.623   125.226 1.00   42.60  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1  179  ? -1.636  7.202   126.140 1.00   41.60  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1  179  ? -0.090  6.980   124.331 1.00   48.05  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1  179  ? -1.360  7.271   124.790 1.00   48.61  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1  180  ? 0.524   3.631   129.199 1.00   49.78  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1  180  ? -0.513  2.739   129.683 1.00   46.27  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1  180  ? -1.554  3.521   130.471 1.00   43.95  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1  180  ? -1.245  4.124   131.499 1.00   44.04  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1  180  ? 0.111   1.675   130.588 1.00   50.82  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1  180  ? -0.719  0.419   130.755 1.00   55.17  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1  180  ? -0.547  -0.543  129.598 1.00   61.71  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1  180  ? 0.123   -0.233  128.612 1.00   56.29  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1  180  ? -1.146  -1.722  129.716 1.00   68.29  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1  181  ? -2.787  3.513   129.982 1.00   38.21  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1  181  ? -3.888  4.132   130.700 1.00   37.85  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1  181  ? -4.709  3.044   131.374 1.00   50.31  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1  181  ? -5.376  2.255   130.704 1.00   45.09  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1  181  ? -4.786  4.950   129.760 1.00   39.19  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1  181  ? -5.982  5.507   130.518 1.00   47.73  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1  181  ? -3.989  6.069   129.113 1.00   40.37  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1  182  ? -4.656  2.996   132.701 1.00   59.39  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1  182  ? -5.350  1.944   133.437 1.00   48.81  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1  182  ? -6.465  2.503   134.311 1.00   46.12  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1  182  ? -6.414  3.655   134.731 1.00   46.95  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1  182  ? -4.356  1.122   134.261 1.00   47.76  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1  182  ? -3.482  0.211   133.406 1.00   55.25  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1  182  ? -2.271  -0.317  134.146 1.00   59.48  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1  182  ? -1.781  -1.407  133.779 1.00   55.63  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1  182  ? -1.802  0.362   135.084 1.00   61.53  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1  183  ? -7.476  1.683   134.573 1.00   51.34  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1  183  ? -8.642  2.125   135.332 1.00   54.27  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1  183  ? -8.317  2.335   136.809 1.00   45.68  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1  183  ? -7.802  1.436   137.474 1.00   35.38  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1  183  ? -9.786  1.119   135.179 1.00   59.63  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1  183  ? -11.126 1.689   135.607 1.00   61.45  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1  183  ? -11.324 2.914   135.462 1.00   57.46  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1  183  ? -11.981 0.912   136.082 1.00   57.64  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1  184  ? -8.619  3.526   137.319 1.00   47.41  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1  184  ? -8.401  3.813   138.735 1.00   49.88  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1  184  ? -9.587  4.562   139.339 1.00   57.54  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1  184  ? -10.458 5.049   138.618 1.00   54.76  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1  184  ? -7.106  4.619   138.968 1.00   47.33  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1  184  ? -6.764  4.594   140.359 1.00   43.74  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1  184  ? -7.283  6.061   138.520 1.00   53.70  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1  185  ? -9.622  4.643   140.666 1.00   62.81  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1  185  ? -10.712 5.320   141.361 1.00   60.26  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1  185  ? -10.209 6.150   142.539 1.00   58.85  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1  185  ? -9.208  5.808   143.170 1.00   62.76  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1  185  ? -11.753 4.306   141.845 1.00   60.54  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1  185  ? -11.213 3.264   142.814 1.00   65.43  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1  185  ? -12.337 2.465   143.462 1.00   73.78  ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1  185  ? -13.169 3.289   144.336 1.00   79.91  ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1  185  ? -14.499 3.307   144.307 1.00   77.72  ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1  185  ? -15.156 2.542   143.447 1.00   78.47  ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1  185  ? -15.172 4.089   145.140 1.00   69.24  ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1  186  ? -10.906 7.247   142.823 1.00   58.41  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1  186  ? -10.621 8.062   144.000 1.00   66.30  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1  186  ? -11.909 8.356   144.753 1.00   64.81  ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1  186  ? -12.797 9.031   144.233 1.00   70.15  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1  186  ? -9.950  9.378   143.607 1.00   66.32  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1  186  ? -9.796  10.385  144.752 1.00   55.80  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1  186  ? -8.881  9.828   145.830 1.00   54.89  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1  186  ? -9.281  11.723  144.244 1.00   54.54  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1  187  ? -12.004 7.861   145.982 1.00   56.67  ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1  187  ? -13.219 8.026   146.755 1.00   69.73  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1  187  ? -14.377 7.332   146.066 1.00   74.69  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1  187  ? -14.313 6.135   145.784 1.00   65.66  ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1  188  ? -15.434 8.088   145.786 1.00   80.36  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1  188  ? -16.614 7.541   145.125 1.00   80.97  ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1  188  ? -16.560 7.699   143.605 1.00   75.84  ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1  188  ? -17.459 7.244   142.897 1.00   78.09  ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1  188  ? -17.888 8.186   145.680 1.00   88.53  ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1  188  ? -18.217 7.777   147.109 1.00   85.74  ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1  188  ? -18.570 6.306   147.226 1.00   87.85  ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1  188  ? -19.456 5.811   146.528 1.00   87.42  ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1  188  ? -17.872 5.598   148.107 1.00   78.22  ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1  189  ? -15.505 8.339   143.108 1.00   74.69  ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1  189  ? -15.333 8.521   141.669 1.00   65.44  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1  189  ? -14.791 7.249   141.032 1.00   64.28  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1  189  ? -13.818 6.674   141.518 1.00   62.61  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1  189  ? -14.363 9.667   141.377 1.00   58.58  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1  189  ? -14.551 10.908  142.227 1.00   65.37  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1  189  ? -13.425 11.889  141.954 1.00   62.73  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1  189  ? -13.310 12.918  142.983 1.00   70.93  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1  189  ? -13.743 14.166  142.844 1.00   80.84  ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1  189  ? -13.594 15.036  143.834 1.00   82.62  ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1  189  ? -14.322 14.547  141.713 1.00   87.06  ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1  190  ? -15.413 6.815   139.941 1.00   66.64  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1  190  ? -14.919 5.660   139.199 1.00   64.84  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1  190  ? -14.541 6.054   137.776 1.00   59.10  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1  190  ? -14.707 7.207   137.377 1.00   59.02  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1  190  ? -15.960 4.528   139.136 1.00   65.67  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1  190  ? -17.094 4.959   138.373 1.00   77.79  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1  190  ? -16.408 4.133   140.536 1.00   68.41  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1  191  ? -14.043 5.080   137.020 1.00   57.03  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  191  ? -13.615 5.290   135.639 1.00   61.42  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  191  ? -12.618 6.443   135.507 1.00   64.17  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  191  ? -12.705 7.249   134.580 1.00   62.30  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  191  ? -14.824 5.508   134.720 1.00   63.50  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  191  ? -14.484 5.323   133.250 1.00   68.36  ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  191  ? -13.530 4.575   132.945 1.00   64.83  ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  191  ? -15.172 5.926   132.398 1.00   66.81  ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1  192  ? -11.678 6.526   136.444 1.00   60.46  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1  192  ? -10.623 7.525   136.346 1.00   56.96  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1  192  ? -9.383  6.920   135.696 1.00   52.60  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1  192  ? -9.317  5.707   135.470 1.00   51.80  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1  192  ? -10.282 8.091   137.726 1.00   50.80  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1  192  ? -11.383 8.897   138.415 1.00   53.09  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1  192  ? -10.923 9.365   139.785 1.00   60.45  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1  192  ? -11.799 10.080  137.553 1.00   53.65  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1  193  ? -8.384  7.760   135.443 1.00   46.86  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1  193  ? -7.221  7.341   134.669 1.00   48.59  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1  193  ? -5.924  7.311   135.468 1.00   46.10  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1  193  ? -5.580  8.268   136.161 1.00   45.24  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1  193  ? -7.043  8.230   133.433 1.00   54.64  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1  193  ? -8.070  7.946   132.353 1.00   53.81  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1  193  ? -8.296  8.830   131.499 1.00   48.64  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1  193  ? -8.651  6.841   132.358 1.00   53.97  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1  194  ? -5.214  6.193   135.357 1.00   44.65  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1  194  ? -3.872  6.051   135.900 1.00   45.59  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1  194  ? -2.906  5.963   134.730 1.00   48.94  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1  194  ? -2.906  4.971   133.992 1.00   51.64  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1  194  ? -3.772  4.785   136.750 1.00   46.12  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1  194  ? -2.366  4.467   137.230 1.00   48.68  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1  194  ? -2.342  3.179   138.036 1.00   54.77  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1  194  ? -0.939  2.854   138.521 1.00   54.91  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1  194  ? -0.910  1.598   139.318 1.00   58.60  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1  195  ? -2.092  7.001   134.555 1.00   47.29  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1  195  ? -1.213  7.079   133.390 1.00   41.84  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1  195  ? 0.182   6.561   133.702 1.00   45.42  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1  195  ? 0.728   6.849   134.760 1.00   50.89  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1  195  ? -1.130  8.518   132.875 1.00   38.45  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1  195  ? -0.159  8.761   131.718 1.00   43.57  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1  195  ? -0.562  7.947   130.496 1.00   41.53  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1  195  ? -0.070  10.242  131.380 1.00   44.55  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1  196  ? 0.756   5.786   132.788 1.00   42.56  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1  196  ? 2.130   5.327   132.955 1.00   45.12  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1  196  ? 2.947   5.501   131.677 1.00   52.02  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1  196  ? 2.659   4.879   130.663 1.00   57.50  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1  196  ? 2.189   3.849   133.380 1.00   48.27  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1  196  ? 1.216   3.598   134.402 1.00   50.13  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1  196  ? 3.576   3.511   133.903 1.00   52.20  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1  197  ? 3.976   6.338   131.735 1.00   49.79  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1  197  ? 4.863   6.544   130.597 1.00   44.87  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1  197  ? 6.095   5.650   130.686 1.00   46.26  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1  197  ? 6.924   5.813   131.580 1.00   56.59  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1  197  ? 5.292   8.010   130.511 1.00   44.22  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1  197  ? 4.370   8.954   129.741 1.00   47.22  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1  197  ? 4.837   10.391  129.888 1.00   45.04  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1  197  ? 4.323   8.558   128.276 1.00   44.34  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1  198  ? 6.205   4.704   129.760 1.00   41.24  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1  198  ? 7.379   3.844   129.674 1.00   43.49  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1  198  ? 8.340   4.374   128.614 1.00   49.14  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1  198  ? 7.987   4.470   127.432 1.00   47.73  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1  198  ? 6.973   2.407   129.356 1.00   38.70  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1  198  ? 5.843   1.889   130.221 1.00   41.69  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1  198  ? 6.024   0.418   130.535 1.00   48.10  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1  198  ? 6.101   -0.403  129.332 1.00   51.19  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1  198  ? 6.422   -1.692  129.334 1.00   53.87  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1  198  ? 6.468   -2.370  128.194 1.00   54.87  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1  198  ? 6.701   -2.304  130.476 1.00   53.99  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1  199  ? 9.553   4.714   129.047 1.00   49.96  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1  199  ? 10.535  5.367   128.186 1.00   47.24  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1  199  ? 11.872  4.621   128.120 1.00   51.60  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1  199  ? 12.516  4.380   129.144 1.00   55.28  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1  199  ? 10.790  6.822   128.640 1.00   37.77  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1  199  ? 9.475   7.601   128.700 1.00   33.69  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1  199  ? 11.775  7.511   127.710 1.00   41.84  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1  199  ? 9.633   9.029   129.156 1.00   38.93  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1  200  ? 12.272  4.263   126.902 1.00   47.15  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1  200  ? 13.556  3.626   126.629 1.00   44.21  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1  200  ? 14.447  4.572   125.832 1.00   49.66  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1  200  ? 14.102  4.955   124.706 1.00   56.55  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1  200  ? 13.363  2.356   125.798 1.00   48.67  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1  200  ? 12.630  1.243   126.476 1.00   51.38  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1  200  ? 13.179  0.208   127.173 1.00   51.61  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1  200  ? 11.213  1.033   126.495 1.00   51.73  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1  200  ? 12.192  -0.628  127.636 1.00   53.63  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1  200  ? 10.975  -0.144  127.232 1.00   51.14  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1  200  ? 10.122  1.728   125.964 1.00   48.72  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1  200  ? 9.693   -0.639  127.456 1.00   52.55  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1  200  ? 8.849   1.234   126.187 1.00   48.50  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1  200  ? 8.645   0.062   126.926 1.00   49.83  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1  201  ? 15.594  4.929   126.406 1.00   48.86  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1  201  ? 16.569  5.780   125.725 1.00   53.33  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1  201  ? 17.884  5.045   125.474 1.00   54.53  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1  201  ? 18.023  3.868   125.810 1.00   51.96  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1  201  ? 16.861  7.070   126.516 1.00   52.11  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1  201  ? 17.441  6.738   127.784 1.00   57.30  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1  201  ? 15.583  7.866   126.734 1.00   51.07  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1  202  ? 18.847  5.749   124.884 1.00   56.80  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1  202  ? 20.128  5.152   124.511 1.00   63.20  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1  202  ? 21.196  5.304   125.591 1.00   60.63  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1  202  ? 22.294  4.760   125.468 1.00   56.32  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1  202  ? 20.635  5.762   123.200 1.00   65.46  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1  202  ? 20.898  7.254   123.314 1.00   59.23  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1  202  ? 20.334  7.889   124.228 1.00   60.53  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1  202  ? 21.663  7.794   122.486 1.00   52.11  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1  203  ? 20.874  6.042   126.648 1.00   61.27  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1  203  ? 21.831  6.298   127.707 1.00   60.21  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1  203  ? 22.498  7.653   127.574 1.00   58.12  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1  203  ? 23.095  8.152   128.528 1.00   58.17  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1  204  ? 22.407  8.243   126.384 1.00   56.79  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1  204  ? 22.912  9.592   126.153 1.00   59.99  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1  204  ? 22.229  10.555  127.118 1.00   59.04  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1  204  ? 22.885  11.330  127.815 1.00   56.72  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1  204  ? 22.659  10.019  124.705 1.00   59.06  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1  204  ? 23.129  11.334  124.463 1.00   65.22  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1  205  ? 20.903  10.496  127.150 1.00   59.50  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1  205  ? 20.126  11.186  128.170 1.00   63.98  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1  205  ? 19.220  10.170  128.861 1.00   62.53  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1  205  ? 18.897  9.126   128.291 1.00   55.53  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1  205  ? 19.283  12.345  127.585 1.00   55.14  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1  205  ? 20.160  13.287  126.767 1.00   43.75  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1  205  ? 18.135  11.808  126.744 1.00   51.99  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1  206  ? 18.826  10.467  130.094 1.00   61.86  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1  206  ? 17.963  9.569   130.848 1.00   55.95  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1  206  ? 16.502  9.842   130.500 1.00   57.88  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1  206  ? 16.157  10.960  130.115 1.00   54.59  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1  206  ? 18.176  9.728   132.367 1.00   57.20  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1  206  ? 17.568  10.945  132.815 1.00   61.88  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1  206  ? 19.661  9.746   132.698 1.00   54.08  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1  207  ? 15.642  8.814   130.617 1.00   60.96  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1  207  ? 14.208  8.951   130.337 1.00   58.15  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1  207  ? 13.559  10.119  131.081 1.00   57.52  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1  207  ? 12.671  10.772  130.533 1.00   54.89  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1  207  ? 13.634  7.624   130.837 1.00   49.95  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1  207  ? 14.741  6.655   130.640 1.00   46.35  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1  207  ? 16.005  7.418   130.929 1.00   53.08  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1  208  ? 14.003  10.377  132.308 1.00   56.75  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1  208  ? 13.443  11.460  133.112 1.00   57.99  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1  208  ? 13.795  12.828  132.533 1.00   57.66  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1  208  ? 12.959  13.733  132.512 1.00   60.02  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1  208  ? 13.907  11.349  134.568 1.00   60.44  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1  208  ? 13.436  12.430  135.545 1.00   53.45  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1  208  ? 11.927  12.605  135.485 1.00   50.01  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1  208  ? 13.878  12.098  136.963 1.00   47.25  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1  209  ? 15.032  12.971  132.066 1.00   53.51  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1  209  ? 15.464  14.203  131.419 1.00   53.79  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1  209  ? 14.616  14.455  130.182 1.00   54.49  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1  209  ? 14.053  15.539  130.011 1.00   54.32  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1  209  ? 16.939  14.116  131.025 1.00   55.22  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1  209  ? 17.898  14.001  132.196 1.00   54.16  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1  209  ? 19.308  13.663  131.755 1.00   53.44  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1  209  ? 20.133  13.294  132.617 1.00   51.70  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1  209  ? 19.590  13.764  130.544 1.00   58.24  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1  210  ? 14.524  13.434  129.334 1.00   55.50  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1  210  ? 13.740  13.500  128.106 1.00   61.18  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1  210  ? 12.297  13.888  128.398 1.00   53.99  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1  210  ? 11.719  14.724  127.705 1.00   50.62  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1  210  ? 13.793  12.167  127.372 1.00   60.19  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1  211  ? 11.727  13.277  129.431 1.00   50.38  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1  211  ? 10.373  13.594  129.860 1.00   50.34  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1  211  ? 10.259  15.063  130.244 1.00   54.68  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1  211  ? 9.329   15.754  129.827 1.00   55.40  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1  211  ? 9.969   12.715  131.044 1.00   47.50  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1  211  ? 8.619   13.044  131.684 1.00   49.36  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1  211  ? 7.495   12.896  130.671 1.00   52.59  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1  211  ? 8.371   12.166  132.899 1.00   48.78  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1  212  ? 11.220  15.535  131.033 1.00   59.63  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1  212  ? 11.222  16.917  131.502 1.00   62.45  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1  212  ? 11.289  17.939  130.370 1.00   57.06  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1  212  ? 10.514  18.897  130.346 1.00   57.95  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1  212  ? 12.360  17.149  132.499 1.00   62.67  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1  212  ? 12.097  16.499  133.845 1.00   57.83  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1  212  ? 10.971  16.508  134.343 1.00   51.96  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1  212  ? 13.138  15.928  134.441 1.00   57.18  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1  213  ? 12.209  17.736  129.432 1.00   53.04  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1  213  ? 12.343  18.669  128.317 1.00   57.08  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1  213  ? 11.220  18.517  127.291 1.00   57.54  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1  213  ? 10.942  19.444  126.532 1.00   58.41  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1  213  ? 13.723  18.563  127.660 1.00   56.15  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1  213  ? 14.189  17.147  127.393 1.00   53.98  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1  213  ? 15.676  17.069  127.110 1.00   58.18  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1  213  ? 16.227  17.898  126.385 1.00   60.82  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1  213  ? 16.338  16.076  127.693 1.00   56.97  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1  214  ? 10.572  17.356  127.277 1.00   52.59  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1  214  ? 9.404   17.151  126.424 1.00   52.12  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1  214  ? 8.224   17.946  126.971 1.00   52.51  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1  214  ? 7.518   18.634  126.227 1.00   51.85  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1  214  ? 9.055   15.676  126.337 1.00   45.19  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1  215  ? 8.019   17.840  128.280 1.00   52.92  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1  215  ? 7.010   18.633  128.969 1.00   55.41  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1  215  ? 7.296   20.117  128.765 1.00   57.74  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1  215  ? 6.388   20.906  128.489 1.00   59.88  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1  215  ? 6.981   18.311  130.477 1.00   49.87  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1  215  ? 6.116   19.311  131.224 1.00   54.89  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1  215  ? 6.482   16.893  130.707 1.00   50.16  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1  216  ? 8.568   20.485  128.886 1.00   54.96  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1  216  ? 8.995   21.861  128.666 1.00   58.02  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1  216  ? 8.630   22.335  127.263 1.00   61.96  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1  216  ? 8.116   23.441  127.090 1.00   66.01  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1  216  ? 10.502  22.000  128.898 1.00   63.41  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1  216  ? 11.063  23.370  128.542 1.00   73.53  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1  216  ? 10.439  24.490  129.354 1.00   75.39  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1  216  ? 10.107  24.260  130.536 1.00   69.88  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1  216  ? 10.279  25.602  128.806 1.00   78.99  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1  217  ? 8.891   21.491  126.268 1.00   60.82  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1  217  ? 8.557   21.809  124.882 1.00   59.48  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1  217  ? 7.053   22.009  124.701 1.00   57.61  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1  217  ? 6.617   22.981  124.077 1.00   56.96  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1  217  ? 9.059   20.719  123.909 1.00   52.19  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1  217  ? 10.580  20.787  123.775 1.00   52.67  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1  217  ? 8.421   20.885  122.540 1.00   55.60  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1  217  ? 11.167  19.679  122.928 1.00   61.22  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1  218  ? 6.264   21.095  125.259 1.00   53.53  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1  218  ? 4.812   21.185  125.152 1.00   49.80  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1  218  ? 4.281   22.471  125.782 1.00   57.64  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1  218  ? 3.425   23.147  125.208 1.00   59.34  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1  218  ? 4.147   19.967  125.793 1.00   43.88  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1  218  ? 2.623   19.906  125.684 1.00   45.79  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1  218  ? 2.185   20.098  124.243 1.00   38.46  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1  218  ? 2.103   18.587  126.231 1.00   49.03  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1  219  ? 4.803   22.804  126.960 1.00   57.11  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1  219  ? 4.403   24.013  127.672 1.00   54.51  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1  219  ? 4.761   25.249  126.853 1.00   58.49  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1  219  ? 3.943   26.161  126.681 1.00   63.23  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1  219  ? 5.083   24.061  129.044 1.00   60.56  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1  219  ? 4.487   25.061  130.031 1.00   71.98  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1  219  ? 5.138   26.429  129.911 1.00   70.11  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1  219  ? 6.593   26.346  130.011 1.00   63.17  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1  219  ? 7.413   27.376  129.830 1.00   62.14  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1  219  ? 6.922   28.573  129.537 1.00   62.56  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1  219  ? 8.723   27.210  129.940 1.00   57.15  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1  220  ? 5.989   25.264  126.345 1.00   56.93  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1  220  ? 6.470   26.359  125.514 1.00   60.87  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1  220  ? 5.600   26.517  124.270 1.00   63.14  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1  220  ? 5.444   27.620  123.747 1.00   64.89  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1  220  ? 7.929   26.124  125.117 1.00   63.81  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1  220  ? 8.544   27.248  124.302 1.00   69.16  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1  220  ? 9.962   26.940  123.867 1.00   84.13  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1  220  ? 10.499  25.894  124.290 1.00   85.64  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1  220  ? 10.539  27.741  123.102 1.00   96.67  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1  221  ? 5.032   25.411  123.800 1.00   58.38  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1  221  ? 4.113   25.463  122.667 1.00   60.76  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1  221  ? 2.740   25.981  123.081 1.00   60.76  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1  221  ? 2.042   26.616  122.289 1.00   61.02  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1  221  ? 3.998   24.100  121.986 1.00   56.88  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1  221  ? 5.033   23.870  120.930 1.00   52.64  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1  221  ? 6.308   23.436  121.220 1.00   54.01  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1  221  ? 4.986   24.032  119.587 1.00   52.45  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1  221  ? 7.000   23.331  120.099 1.00   57.44  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1  221  ? 6.220   23.687  119.094 1.00   59.41  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1  222  ? 2.356   25.712  124.324 1.00   63.29  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1  222  ? 1.115   26.256  124.860 1.00   57.00  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1  222  ? 1.246   27.762  125.054 1.00   62.12  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1  222  ? 0.248   28.483  125.087 1.00   62.88  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1  222  ? 0.750   25.574  126.179 1.00   48.56  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1  222  ? 0.398   24.090  126.070 1.00   46.04  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1  222  ? 0.058   23.515  127.435 1.00   50.79  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1  222  ? -0.751  23.890  125.097 1.00   44.58  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1  223  ? 2.485   28.229  125.177 1.00   64.88  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1  223  ? 2.765   29.658  125.296 1.00   63.01  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1  223  ? 2.338   30.419  124.042 1.00   66.41  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1  223  ? 1.960   31.589  124.112 1.00   71.26  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1  223  ? 4.267   29.913  125.550 1.00   61.38  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1  223  ? 4.703   29.142  126.675 1.00   71.02  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1  223  ? 4.537   31.389  125.813 1.00   66.28  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1  224  ? 2.377   29.742  122.898 1.00   66.15  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1  224  ? 2.146   30.386  121.605 1.00   70.39  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1  224  ? 0.729   30.933  121.415 1.00   74.63  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1  224  ? 0.460   31.648  120.449 1.00   76.23  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1  224  ? 2.497   29.428  120.462 1.00   65.87  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1  224  ? 3.953   29.019  120.437 1.00   73.05  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1  224  ? 4.939   29.858  120.940 1.00   73.02  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1  224  ? 4.342   27.792  119.912 1.00   70.99  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1  224  ? 6.271   29.488  120.921 1.00   76.88  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1  224  ? 5.672   27.413  119.889 1.00   69.45  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1  224  ? 6.632   28.266  120.395 1.00   73.01  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1  224  ? 7.957   27.894  120.375 1.00   75.27  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1  225  ? -0.171  30.597  122.333 1.00   70.60  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1  225  ? -1.550  31.068  122.260 1.00   72.85  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1  225  ? -1.753  32.363  123.046 1.00   81.33  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1  225  ? -2.851  32.918  123.067 1.00   86.95  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1  225  ? -2.510  29.996  122.785 1.00   70.04  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1  225  ? -2.598  28.774  121.914 1.00   65.99  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1  225  ? -1.678  27.746  122.040 1.00   63.67  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1  225  ? -3.611  28.648  120.978 1.00   59.82  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1  225  ? -1.762  26.618  121.242 1.00   54.71  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1  225  ? -3.700  27.524  120.178 1.00   51.33  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1  225  ? -2.774  26.508  120.311 1.00   46.83  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1  226  ? -0.691  32.842  123.686 1.00   84.06  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1  226  ? -0.790  33.985  124.593 1.00   91.09  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1  226  ? -1.036  35.321  123.891 1.00   97.31  ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1  226  ? -1.598  36.243  124.483 1.00   103.40 ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1  226  ? 0.458   34.078  125.476 1.00   87.84  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1  226  ? 1.632   34.196  124.690 1.00   91.41  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1  227  ? -0.616  35.428  122.635 1.00   89.62  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1  227  ? -0.760  36.679  121.896 1.00   89.93  ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1  227  ? -1.569  36.524  120.611 1.00   93.35  ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1  227  ? -1.006  36.262  119.547 1.00   97.62  ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1  227  ? 0.611   37.282  121.582 1.00   93.17  ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1  227  ? 0.511   38.622  120.877 1.00   90.92  ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1  227  ? -0.452  39.366  121.067 1.00   94.37  ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1  227  ? 1.505   38.933  120.054 1.00   87.09  ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1  228  ? -2.898  36.685  120.710 1.00   86.54  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1  228  ? -3.796  36.581  119.554 1.00   84.21  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1  228  ? -3.569  37.678  118.516 1.00   88.73  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1  228  ? -2.754  38.577  118.723 1.00   96.56  ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1  228  ? -5.185  36.744  120.181 1.00   74.68  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1  228  ? -5.009  36.360  121.609 1.00   77.33  ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1  228  ? -3.641  36.843  121.971 1.00   80.44  ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1  229  ? -4.297  37.596  117.407 1.00   85.72  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1  229  ? -4.222  38.601  116.353 1.00   94.04  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1  229  ? -5.561  38.685  115.632 1.00   93.11  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1  229  ? -6.231  37.672  115.433 1.00   89.09  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1  229  ? -3.120  38.250  115.351 1.00   90.29  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1  229  ? -2.469  39.447  114.681 1.00   94.58  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1  229  ? -1.281  39.971  115.462 1.00   94.20  ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1  229  ? -0.775  39.305  116.367 1.00   89.08  ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1  229  ? -0.826  41.170  115.116 1.00   97.10  ? 229  GLN A NE2   1 
ATOM   1783  N  N     . ALA A 1  230  ? -5.947  39.891  115.232 1.00   96.82  ? 230  ALA A N     1 
ATOM   1784  C  CA    . ALA A 1  230  ? -7.175  40.074  114.472 1.00   96.55  ? 230  ALA A CA    1 
ATOM   1785  C  C     . ALA A 1  230  ? -6.946  39.684  113.015 1.00   105.67 ? 230  ALA A C     1 
ATOM   1786  O  O     . ALA A 1  230  ? -5.918  40.025  112.428 1.00   107.26 ? 230  ALA A O     1 
ATOM   1787  C  CB    . ALA A 1  230  ? -7.657  41.513  114.574 1.00   93.69  ? 230  ALA A CB    1 
ATOM   1788  N  N     . ALA A 1  231  ? -7.902  38.964  112.436 1.00   104.46 ? 231  ALA A N     1 
ATOM   1789  C  CA    . ALA A 1  231  ? -7.788  38.527  111.050 1.00   106.83 ? 231  ALA A CA    1 
ATOM   1790  C  C     . ALA A 1  231  ? -8.136  39.664  110.096 1.00   119.81 ? 231  ALA A C     1 
ATOM   1791  O  O     . ALA A 1  231  ? -9.241  40.203  110.132 1.00   121.15 ? 231  ALA A O     1 
ATOM   1792  C  CB    . ALA A 1  231  ? -8.682  37.324  110.797 1.00   99.39  ? 231  ALA A CB    1 
ATOM   1793  N  N     . ALA A 1  232  ? -7.184  40.017  109.238 1.00   127.50 ? 232  ALA A N     1 
ATOM   1794  C  CA    . ALA A 1  232  ? -7.348  41.137  108.319 1.00   123.71 ? 232  ALA A CA    1 
ATOM   1795  C  C     . ALA A 1  232  ? -7.949  40.699  106.987 1.00   134.05 ? 232  ALA A C     1 
ATOM   1796  O  O     . ALA A 1  232  ? -8.069  41.500  106.060 1.00   144.50 ? 232  ALA A O     1 
ATOM   1797  C  CB    . ALA A 1  232  ? -6.016  41.842  108.098 1.00   109.55 ? 232  ALA A CB    1 
ATOM   1798  N  N     . VAL A 1  233  ? -8.311  39.422  106.897 1.00   132.32 ? 233  VAL A N     1 
ATOM   1799  C  CA    . VAL A 1  233  ? -8.879  38.855  105.676 1.00   137.16 ? 233  VAL A CA    1 
ATOM   1800  C  C     . VAL A 1  233  ? -10.146 39.591  105.238 1.00   137.27 ? 233  VAL A C     1 
ATOM   1801  O  O     . VAL A 1  233  ? -10.379 39.789  104.045 1.00   127.55 ? 233  VAL A O     1 
ATOM   1802  C  CB    . VAL A 1  233  ? -9.194  37.355  105.852 1.00   136.33 ? 233  VAL A CB    1 
ATOM   1803  C  CG1   . VAL A 1  233  ? -9.611  36.736  104.526 1.00   128.12 ? 233  VAL A CG1   1 
ATOM   1804  C  CG2   . VAL A 1  233  ? -7.990  36.626  106.426 1.00   132.99 ? 233  VAL A CG2   1 
ATOM   1805  N  N     . ALA A 1  234  ? -10.954 40.000  106.212 1.00   133.01 ? 234  ALA A N     1 
ATOM   1806  C  CA    . ALA A 1  234  ? -12.188 40.726  105.932 1.00   129.93 ? 234  ALA A CA    1 
ATOM   1807  C  C     . ALA A 1  234  ? -11.904 42.102  105.334 1.00   132.48 ? 234  ALA A C     1 
ATOM   1808  O  O     . ALA A 1  234  ? -11.546 43.039  106.048 1.00   127.36 ? 234  ALA A O     1 
ATOM   1809  C  CB    . ALA A 1  234  ? -13.024 40.857  107.196 1.00   120.15 ? 234  ALA A CB    1 
ATOM   1810  N  N     . LEU B 1  2    ? 20.894  20.049  110.015 1.00   81.25  ? 2    LEU B N     1 
ATOM   1811  C  CA    . LEU B 1  2    ? 21.421  19.886  111.365 1.00   99.12  ? 2    LEU B CA    1 
ATOM   1812  C  C     . LEU B 1  2    ? 21.242  21.169  112.169 1.00   115.03 ? 2    LEU B C     1 
ATOM   1813  O  O     . LEU B 1  2    ? 20.486  21.203  113.141 1.00   117.45 ? 2    LEU B O     1 
ATOM   1814  C  CB    . LEU B 1  2    ? 22.899  19.487  111.317 1.00   88.75  ? 2    LEU B CB    1 
ATOM   1815  C  CG    . LEU B 1  2    ? 23.540  18.920  112.588 1.00   77.57  ? 2    LEU B CG    1 
ATOM   1816  C  CD1   . LEU B 1  2    ? 24.674  17.993  112.210 1.00   69.87  ? 2    LEU B CD1   1 
ATOM   1817  C  CD2   . LEU B 1  2    ? 24.054  20.018  113.508 1.00   79.33  ? 2    LEU B CD2   1 
ATOM   1818  N  N     . ASP B 1  3    ? 21.948  22.220  111.764 1.00   114.27 ? 3    ASP B N     1 
ATOM   1819  C  CA    . ASP B 1  3    ? 21.819  23.516  112.416 1.00   112.71 ? 3    ASP B CA    1 
ATOM   1820  C  C     . ASP B 1  3    ? 20.449  24.093  112.090 1.00   113.38 ? 3    ASP B C     1 
ATOM   1821  O  O     . ASP B 1  3    ? 20.094  24.247  110.922 1.00   107.65 ? 3    ASP B O     1 
ATOM   1822  C  CB    . ASP B 1  3    ? 22.922  24.465  111.948 1.00   118.36 ? 3    ASP B CB    1 
ATOM   1823  C  CG    . ASP B 1  3    ? 24.310  23.968  112.307 1.00   120.60 ? 3    ASP B CG    1 
ATOM   1824  O  OD1   . ASP B 1  3    ? 24.489  23.453  113.430 1.00   110.98 ? 3    ASP B OD1   1 
ATOM   1825  O  OD2   . ASP B 1  3    ? 25.223  24.090  111.463 1.00   129.68 ? 3    ASP B OD2   1 
ATOM   1826  N  N     . SER B 1  4    ? 19.684  24.413  113.128 1.00   119.89 ? 4    SER B N     1 
ATOM   1827  C  CA    . SER B 1  4    ? 18.293  24.811  112.950 1.00   122.89 ? 4    SER B CA    1 
ATOM   1828  C  C     . SER B 1  4    ? 17.965  26.137  113.626 1.00   124.00 ? 4    SER B C     1 
ATOM   1829  O  O     . SER B 1  4    ? 18.461  26.434  114.714 1.00   119.73 ? 4    SER B O     1 
ATOM   1830  C  CB    . SER B 1  4    ? 17.362  23.718  113.478 1.00   114.22 ? 4    SER B CB    1 
ATOM   1831  O  OG    . SER B 1  4    ? 17.643  23.429  114.836 1.00   102.74 ? 4    SER B OG    1 
ATOM   1832  N  N     . LYS B 1  5    ? 17.126  26.928  112.967 1.00   123.30 ? 5    LYS B N     1 
ATOM   1833  C  CA    . LYS B 1  5    ? 16.619  28.166  113.542 1.00   127.17 ? 5    LYS B CA    1 
ATOM   1834  C  C     . LYS B 1  5    ? 15.104  28.232  113.381 1.00   123.52 ? 5    LYS B C     1 
ATOM   1835  O  O     . LYS B 1  5    ? 14.567  27.967  112.303 1.00   118.27 ? 5    LYS B O     1 
ATOM   1836  C  CB    . LYS B 1  5    ? 17.287  29.391  112.903 1.00   122.67 ? 5    LYS B CB    1 
ATOM   1837  C  CG    . LYS B 1  5    ? 17.034  29.555  111.411 1.00   118.64 ? 5    LYS B CG    1 
ATOM   1838  C  CD    . LYS B 1  5    ? 17.580  30.879  110.900 1.00   116.44 ? 5    LYS B CD    1 
ATOM   1839  C  CE    . LYS B 1  5    ? 17.197  31.113  109.446 1.00   101.64 ? 5    LYS B CE    1 
ATOM   1840  N  NZ    . LYS B 1  5    ? 15.721  31.215  109.267 1.00   90.65  ? 5    LYS B NZ    1 
ATOM   1841  N  N     . LEU B 1  6    ? 14.413  28.559  114.466 1.00   119.57 ? 6    LEU B N     1 
ATOM   1842  C  CA    . LEU B 1  6    ? 12.967  28.687  114.411 1.00   116.64 ? 6    LEU B CA    1 
ATOM   1843  C  C     . LEU B 1  6    ? 12.475  29.882  115.218 1.00   115.98 ? 6    LEU B C     1 
ATOM   1844  O  O     . LEU B 1  6    ? 12.768  30.014  116.406 1.00   110.61 ? 6    LEU B O     1 
ATOM   1845  C  CB    . LEU B 1  6    ? 12.293  27.399  114.890 1.00   114.10 ? 6    LEU B CB    1 
ATOM   1846  C  CG    . LEU B 1  6    ? 10.873  27.150  114.376 1.00   113.42 ? 6    LEU B CG    1 
ATOM   1847  C  CD1   . LEU B 1  6    ? 10.831  27.260  112.859 1.00   98.02  ? 6    LEU B CD1   1 
ATOM   1848  C  CD2   . LEU B 1  6    ? 10.362  25.788  114.826 1.00   102.46 ? 6    LEU B CD2   1 
ATOM   1849  N  N     . LYS B 1  7    ? 11.708  30.736  114.551 1.00   117.97 ? 7    LYS B N     1 
ATOM   1850  C  CA    . LYS B 1  7    ? 11.061  31.887  115.165 1.00   115.81 ? 7    LYS B CA    1 
ATOM   1851  C  C     . LYS B 1  7    ? 9.596   31.696  114.796 1.00   114.82 ? 7    LYS B C     1 
ATOM   1852  O  O     . LYS B 1  7    ? 9.302   30.790  114.008 1.00   109.79 ? 7    LYS B O     1 
ATOM   1853  C  CB    . LYS B 1  7    ? 11.625  33.190  114.596 1.00   107.03 ? 7    LYS B CB    1 
ATOM   1854  C  CG    . LYS B 1  7    ? 11.442  34.401  115.502 1.00   99.36  ? 7    LYS B CG    1 
ATOM   1855  C  CD    . LYS B 1  7    ? 10.352  35.325  114.984 1.00   95.52  ? 7    LYS B CD    1 
ATOM   1856  C  CE    . LYS B 1  7    ? 10.773  36.017  113.695 1.00   90.24  ? 7    LYS B CE    1 
ATOM   1857  N  NZ    . LYS B 1  7    ? 11.056  37.466  113.904 1.00   81.22  ? 7    LYS B NZ    1 
ATOM   1858  N  N     . ALA B 1  8    ? 8.685   32.467  115.402 1.00   107.73 ? 8    ALA B N     1 
ATOM   1859  C  CA    . ALA B 1  8    ? 7.246   32.310  115.152 1.00   99.31  ? 8    ALA B CA    1 
ATOM   1860  C  C     . ALA B 1  8    ? 6.750   31.046  115.881 1.00   91.74  ? 8    ALA B C     1 
ATOM   1861  O  O     . ALA B 1  8    ? 7.564   30.327  116.459 1.00   92.50  ? 8    ALA B O     1 
ATOM   1862  C  CB    . ALA B 1  8    ? 6.936   32.311  113.638 1.00   94.78  ? 8    ALA B CB    1 
ATOM   1863  N  N     . PRO B 1  9    ? 5.428   30.767  115.903 1.00   77.87  ? 9    PRO B N     1 
ATOM   1864  C  CA    . PRO B 1  9    ? 4.247   31.182  115.130 1.00   69.39  ? 9    PRO B CA    1 
ATOM   1865  C  C     . PRO B 1  9    ? 3.589   32.483  115.564 1.00   67.02  ? 9    PRO B C     1 
ATOM   1866  O  O     . PRO B 1  9    ? 3.987   33.106  116.546 1.00   73.89  ? 9    PRO B O     1 
ATOM   1867  C  CB    . PRO B 1  9    ? 3.275   30.026  115.362 1.00   66.89  ? 9    PRO B CB    1 
ATOM   1868  C  CG    . PRO B 1  9    ? 3.595   29.563  116.725 1.00   70.82  ? 9    PRO B CG    1 
ATOM   1869  C  CD    . PRO B 1  9    ? 5.067   29.782  116.938 1.00   67.95  ? 9    PRO B CD    1 
ATOM   1870  N  N     . VAL B 1  10   ? 2.568   32.875  114.810 1.00   64.05  ? 10   VAL B N     1 
ATOM   1871  C  CA    . VAL B 1  10   ? 1.730   34.005  115.166 1.00   72.55  ? 10   VAL B CA    1 
ATOM   1872  C  C     . VAL B 1  10   ? 0.312   33.478  115.342 1.00   79.33  ? 10   VAL B C     1 
ATOM   1873  O  O     . VAL B 1  10   ? -0.173  32.679  114.537 1.00   77.84  ? 10   VAL B O     1 
ATOM   1874  C  CB    . VAL B 1  10   ? 1.797   35.130  114.104 1.00   67.07  ? 10   VAL B CB    1 
ATOM   1875  C  CG1   . VAL B 1  10   ? 1.516   34.581  112.709 1.00   58.68  ? 10   VAL B CG1   1 
ATOM   1876  C  CG2   . VAL B 1  10   ? 0.849   36.271  114.459 1.00   72.27  ? 10   VAL B CG2   1 
ATOM   1877  N  N     . PHE B 1  11   ? -0.332  33.892  116.424 1.00   76.79  ? 11   PHE B N     1 
ATOM   1878  C  CA    . PHE B 1  11   ? -1.647  33.378  116.767 1.00   75.14  ? 11   PHE B CA    1 
ATOM   1879  C  C     . PHE B 1  11   ? -2.734  34.268  116.177 1.00   73.96  ? 11   PHE B C     1 
ATOM   1880  O  O     . PHE B 1  11   ? -2.856  35.431  116.547 1.00   76.48  ? 11   PHE B O     1 
ATOM   1881  C  CB    . PHE B 1  11   ? -1.782  33.284  118.288 1.00   82.93  ? 11   PHE B CB    1 
ATOM   1882  C  CG    . PHE B 1  11   ? -3.054  32.637  118.746 1.00   81.43  ? 11   PHE B CG    1 
ATOM   1883  C  CD1   . PHE B 1  11   ? -3.565  31.537  118.079 1.00   75.04  ? 11   PHE B CD1   1 
ATOM   1884  C  CD2   . PHE B 1  11   ? -3.728  33.115  119.857 1.00   77.90  ? 11   PHE B CD2   1 
ATOM   1885  C  CE1   . PHE B 1  11   ? -4.734  30.936  118.503 1.00   77.12  ? 11   PHE B CE1   1 
ATOM   1886  C  CE2   . PHE B 1  11   ? -4.898  32.519  120.286 1.00   74.69  ? 11   PHE B CE2   1 
ATOM   1887  C  CZ    . PHE B 1  11   ? -5.401  31.427  119.608 1.00   74.31  ? 11   PHE B CZ    1 
ATOM   1888  N  N     . THR B 1  12   ? -3.519  33.713  115.257 1.00   73.89  ? 12   THR B N     1 
ATOM   1889  C  CA    . THR B 1  12   ? -4.551  34.479  114.560 1.00   78.71  ? 12   THR B CA    1 
ATOM   1890  C  C     . THR B 1  12   ? -5.962  34.081  114.997 1.00   76.63  ? 12   THR B C     1 
ATOM   1891  O  O     . THR B 1  12   ? -6.278  32.895  115.103 1.00   67.88  ? 12   THR B O     1 
ATOM   1892  C  CB    . THR B 1  12   ? -4.430  34.319  113.032 1.00   76.48  ? 12   THR B CB    1 
ATOM   1893  O  OG1   . THR B 1  12   ? -3.102  34.660  112.617 1.00   79.71  ? 12   THR B OG1   1 
ATOM   1894  C  CG2   . THR B 1  12   ? -5.427  35.219  112.316 1.00   77.66  ? 12   THR B CG2   1 
ATOM   1895  N  N     . VAL B 1  13   ? -6.805  35.082  115.239 1.00   79.23  ? 13   VAL B N     1 
ATOM   1896  C  CA    . VAL B 1  13   ? -8.158  34.853  115.738 1.00   71.91  ? 13   VAL B CA    1 
ATOM   1897  C  C     . VAL B 1  13   ? -9.228  35.440  114.813 1.00   74.59  ? 13   VAL B C     1 
ATOM   1898  O  O     . VAL B 1  13   ? -9.087  36.554  114.308 1.00   72.18  ? 13   VAL B O     1 
ATOM   1899  C  CB    . VAL B 1  13   ? -8.326  35.434  117.161 1.00   68.53  ? 13   VAL B CB    1 
ATOM   1900  C  CG1   . VAL B 1  13   ? -9.746  35.241  117.663 1.00   72.81  ? 13   VAL B CG1   1 
ATOM   1901  C  CG2   . VAL B 1  13   ? -7.338  34.787  118.114 1.00   70.18  ? 13   VAL B CG2   1 
ATOM   1902  N  N     . ARG B 1  14   ? -10.292 34.673  114.592 1.00   79.38  ? 14   ARG B N     1 
ATOM   1903  C  CA    . ARG B 1  14   ? -11.413 35.099  113.764 1.00   78.35  ? 14   ARG B CA    1 
ATOM   1904  C  C     . ARG B 1  14   ? -12.710 34.759  114.494 1.00   83.58  ? 14   ARG B C     1 
ATOM   1905  O  O     . ARG B 1  14   ? -12.992 33.587  114.734 1.00   84.64  ? 14   ARG B O     1 
ATOM   1906  C  CB    . ARG B 1  14   ? -11.352 34.361  112.430 1.00   81.08  ? 14   ARG B CB    1 
ATOM   1907  C  CG    . ARG B 1  14   ? -11.919 35.109  111.238 1.00   88.87  ? 14   ARG B CG    1 
ATOM   1908  C  CD    . ARG B 1  14   ? -11.150 34.761  109.960 1.00   100.92 ? 14   ARG B CD    1 
ATOM   1909  N  NE    . ARG B 1  14   ? -10.939 33.323  109.792 1.00   104.97 ? 14   ARG B NE    1 
ATOM   1910  C  CZ    . ARG B 1  14   ? -9.793  32.693  110.045 1.00   93.89  ? 14   ARG B CZ    1 
ATOM   1911  N  NH1   . ARG B 1  14   ? -8.742  33.371  110.487 1.00   90.86  ? 14   ARG B NH1   1 
ATOM   1912  N  NH2   . ARG B 1  14   ? -9.700  31.382  109.863 1.00   84.09  ? 14   ARG B NH2   1 
ATOM   1913  N  N     . THR B 1  15   ? -13.502 35.771  114.843 1.00   85.49  ? 15   THR B N     1 
ATOM   1914  C  CA    . THR B 1  15   ? -14.673 35.550  115.696 1.00   85.23  ? 15   THR B CA    1 
ATOM   1915  C  C     . THR B 1  15   ? -15.987 36.106  115.149 1.00   84.15  ? 15   THR B C     1 
ATOM   1916  O  O     . THR B 1  15   ? -16.047 37.240  114.671 1.00   86.14  ? 15   THR B O     1 
ATOM   1917  C  CB    . THR B 1  15   ? -14.465 36.146  117.105 1.00   89.05  ? 15   THR B CB    1 
ATOM   1918  O  OG1   . THR B 1  15   ? -14.124 37.534  116.995 1.00   93.44  ? 15   THR B OG1   1 
ATOM   1919  C  CG2   . THR B 1  15   ? -13.359 35.412  117.844 1.00   87.40  ? 15   THR B CG2   1 
ATOM   1920  N  N     . GLN B 1  16   ? -17.039 35.296  115.232 1.00   78.99  ? 16   GLN B N     1 
ATOM   1921  C  CA    . GLN B 1  16   ? -18.391 35.759  114.949 1.00   84.82  ? 16   GLN B CA    1 
ATOM   1922  C  C     . GLN B 1  16   ? -19.206 35.709  116.234 1.00   95.51  ? 16   GLN B C     1 
ATOM   1923  O  O     . GLN B 1  16   ? -19.572 34.628  116.698 1.00   95.02  ? 16   GLN B O     1 
ATOM   1924  C  CB    . GLN B 1  16   ? -19.057 34.868  113.902 1.00   81.51  ? 16   GLN B CB    1 
ATOM   1925  C  CG    . GLN B 1  16   ? -18.256 34.675  112.630 1.00   94.43  ? 16   GLN B CG    1 
ATOM   1926  C  CD    . GLN B 1  16   ? -18.910 33.685  111.687 1.00   98.18  ? 16   GLN B CD    1 
ATOM   1927  O  OE1   . GLN B 1  16   ? -20.044 33.260  111.907 1.00   94.68  ? 16   GLN B OE1   1 
ATOM   1928  N  NE2   . GLN B 1  16   ? -18.194 33.307  110.633 1.00   94.96  ? 16   GLN B NE2   1 
ATOM   1929  N  N     . GLY B 1  17   ? -19.503 36.878  116.794 1.00   102.26 ? 17   GLY B N     1 
ATOM   1930  C  CA    . GLY B 1  17   ? -20.249 36.962  118.038 1.00   89.56  ? 17   GLY B CA    1 
ATOM   1931  C  C     . GLY B 1  17   ? -19.591 36.189  119.166 1.00   72.44  ? 17   GLY B C     1 
ATOM   1932  O  O     . GLY B 1  17   ? -18.371 36.020  119.191 1.00   65.84  ? 17   GLY B O     1 
ATOM   1933  N  N     . ARG B 1  18   ? -20.404 35.721  120.107 1.00   69.60  ? 18   ARG B N     1 
ATOM   1934  C  CA    . ARG B 1  18   ? -19.910 34.888  121.195 1.00   70.04  ? 18   ARG B CA    1 
ATOM   1935  C  C     . ARG B 1  18   ? -20.111 33.411  120.878 1.00   73.67  ? 18   ARG B C     1 
ATOM   1936  O  O     . ARG B 1  18   ? -19.694 32.541  121.641 1.00   74.48  ? 18   ARG B O     1 
ATOM   1937  C  CB    . ARG B 1  18   ? -20.638 35.234  122.494 1.00   69.06  ? 18   ARG B CB    1 
ATOM   1938  C  CG    . ARG B 1  18   ? -20.519 36.690  122.909 1.00   71.23  ? 18   ARG B CG    1 
ATOM   1939  C  CD    . ARG B 1  18   ? -21.391 36.988  124.118 1.00   64.75  ? 18   ARG B CD    1 
ATOM   1940  N  NE    . ARG B 1  18   ? -21.144 36.053  125.211 1.00   58.78  ? 18   ARG B NE    1 
ATOM   1941  C  CZ    . ARG B 1  18   ? -20.160 36.183  126.095 1.00   60.61  ? 18   ARG B CZ    1 
ATOM   1942  N  NH1   . ARG B 1  18   ? -20.008 35.283  127.057 1.00   61.10  ? 18   ARG B NH1   1 
ATOM   1943  N  NH2   . ARG B 1  18   ? -19.324 37.210  126.015 1.00   53.56  ? 18   ARG B NH2   1 
ATOM   1944  N  N     . GLU B 1  19   ? -20.758 33.136  119.750 1.00   78.73  ? 19   GLU B N     1 
ATOM   1945  C  CA    . GLU B 1  19   ? -21.145 31.772  119.401 1.00   83.55  ? 19   GLU B CA    1 
ATOM   1946  C  C     . GLU B 1  19   ? -20.076 30.974  118.656 1.00   83.89  ? 19   GLU B C     1 
ATOM   1947  O  O     . GLU B 1  19   ? -20.143 29.745  118.601 1.00   78.12  ? 19   GLU B O     1 
ATOM   1948  C  CB    . GLU B 1  19   ? -22.427 31.797  118.562 1.00   84.31  ? 19   GLU B CB    1 
ATOM   1949  C  CG    . GLU B 1  19   ? -23.655 32.275  119.313 1.00   76.51  ? 19   GLU B CG    1 
ATOM   1950  C  CD    . GLU B 1  19   ? -24.192 31.225  120.261 1.00   85.94  ? 19   GLU B CD    1 
ATOM   1951  O  OE1   . GLU B 1  19   ? -24.869 31.594  121.244 1.00   100.15 ? 19   GLU B OE1   1 
ATOM   1952  O  OE2   . GLU B 1  19   ? -23.940 30.027  120.017 1.00   80.40  ? 19   GLU B OE2   1 
ATOM   1953  N  N     . TYR B 1  20   ? -19.091 31.661  118.088 1.00   82.03  ? 20   TYR B N     1 
ATOM   1954  C  CA    . TYR B 1  20   ? -18.158 30.999  117.181 1.00   77.63  ? 20   TYR B CA    1 
ATOM   1955  C  C     . TYR B 1  20   ? -16.797 31.686  117.086 1.00   79.07  ? 20   TYR B C     1 
ATOM   1956  O  O     . TYR B 1  20   ? -16.678 32.889  117.322 1.00   86.50  ? 20   TYR B O     1 
ATOM   1957  C  CB    . TYR B 1  20   ? -18.792 30.884  115.792 1.00   75.79  ? 20   TYR B CB    1 
ATOM   1958  C  CG    . TYR B 1  20   ? -17.947 30.148  114.781 1.00   75.01  ? 20   TYR B CG    1 
ATOM   1959  C  CD1   . TYR B 1  20   ? -17.283 30.833  113.772 1.00   78.05  ? 20   TYR B CD1   1 
ATOM   1960  C  CD2   . TYR B 1  20   ? -17.808 28.768  114.837 1.00   75.76  ? 20   TYR B CD2   1 
ATOM   1961  C  CE1   . TYR B 1  20   ? -16.509 30.164  112.844 1.00   77.63  ? 20   TYR B CE1   1 
ATOM   1962  C  CE2   . TYR B 1  20   ? -17.035 28.090  113.915 1.00   75.87  ? 20   TYR B CE2   1 
ATOM   1963  C  CZ    . TYR B 1  20   ? -16.388 28.792  112.921 1.00   75.47  ? 20   TYR B CZ    1 
ATOM   1964  O  OH    . TYR B 1  20   ? -15.619 28.117  112.001 1.00   72.27  ? 20   TYR B OH    1 
ATOM   1965  N  N     . GLY B 1  21   ? -15.774 30.912  116.736 1.00   70.41  ? 21   GLY B N     1 
ATOM   1966  C  CA    . GLY B 1  21   ? -14.445 31.451  116.516 1.00   75.24  ? 21   GLY B CA    1 
ATOM   1967  C  C     . GLY B 1  21   ? -13.548 30.523  115.716 1.00   81.65  ? 21   GLY B C     1 
ATOM   1968  O  O     . GLY B 1  21   ? -13.754 29.309  115.699 1.00   81.85  ? 21   GLY B O     1 
ATOM   1969  N  N     . GLU B 1  22   ? -12.547 31.097  115.053 1.00   81.73  ? 22   GLU B N     1 
ATOM   1970  C  CA    . GLU B 1  22   ? -11.558 30.318  114.312 1.00   72.33  ? 22   GLU B CA    1 
ATOM   1971  C  C     . GLU B 1  22   ? -10.152 30.726  114.724 1.00   73.47  ? 22   GLU B C     1 
ATOM   1972  O  O     . GLU B 1  22   ? -9.843  31.914  114.810 1.00   78.74  ? 22   GLU B O     1 
ATOM   1973  C  CB    . GLU B 1  22   ? -11.728 30.498  112.803 1.00   73.40  ? 22   GLU B CB    1 
ATOM   1974  C  CG    . GLU B 1  22   ? -13.021 29.933  112.249 1.00   81.13  ? 22   GLU B CG    1 
ATOM   1975  C  CD    . GLU B 1  22   ? -13.018 29.846  110.734 1.00   88.65  ? 22   GLU B CD    1 
ATOM   1976  O  OE1   . GLU B 1  22   ? -11.926 29.679  110.150 1.00   89.64  ? 22   GLU B OE1   1 
ATOM   1977  O  OE2   . GLU B 1  22   ? -14.106 29.945  110.129 1.00   81.32  ? 22   GLU B OE2   1 
ATOM   1978  N  N     . PHE B 1  23   ? -9.301  29.737  114.970 1.00   71.44  ? 23   PHE B N     1 
ATOM   1979  C  CA    . PHE B 1  23   ? -7.961  29.997  115.481 1.00   72.07  ? 23   PHE B CA    1 
ATOM   1980  C  C     . PHE B 1  23   ? -6.897  29.332  114.617 1.00   69.45  ? 23   PHE B C     1 
ATOM   1981  O  O     . PHE B 1  23   ? -6.946  28.127  114.375 1.00   69.58  ? 23   PHE B O     1 
ATOM   1982  C  CB    . PHE B 1  23   ? -7.853  29.516  116.929 1.00   66.64  ? 23   PHE B CB    1 
ATOM   1983  C  CG    . PHE B 1  23   ? -8.965  30.008  117.809 1.00   65.81  ? 23   PHE B CG    1 
ATOM   1984  C  CD1   . PHE B 1  23   ? -8.855  31.215  118.478 1.00   68.61  ? 23   PHE B CD1   1 
ATOM   1985  C  CD2   . PHE B 1  23   ? -10.126 29.268  117.960 1.00   68.30  ? 23   PHE B CD2   1 
ATOM   1986  C  CE1   . PHE B 1  23   ? -9.880  31.672  119.284 1.00   73.56  ? 23   PHE B CE1   1 
ATOM   1987  C  CE2   . PHE B 1  23   ? -11.154 29.720  118.763 1.00   72.38  ? 23   PHE B CE2   1 
ATOM   1988  C  CZ    . PHE B 1  23   ? -11.031 30.923  119.427 1.00   74.63  ? 23   PHE B CZ    1 
ATOM   1989  N  N     . VAL B 1  24   ? -5.934  30.124  114.156 1.00   66.34  ? 24   VAL B N     1 
ATOM   1990  C  CA    . VAL B 1  24   ? -4.891  29.622  113.270 1.00   65.93  ? 24   VAL B CA    1 
ATOM   1991  C  C     . VAL B 1  24   ? -3.493  29.818  113.850 1.00   66.67  ? 24   VAL B C     1 
ATOM   1992  O  O     . VAL B 1  24   ? -3.073  30.945  114.117 1.00   67.80  ? 24   VAL B O     1 
ATOM   1993  C  CB    . VAL B 1  24   ? -4.957  30.299  111.888 1.00   71.74  ? 24   VAL B CB    1 
ATOM   1994  C  CG1   . VAL B 1  24   ? -3.787  29.854  111.024 1.00   69.79  ? 24   VAL B CG1   1 
ATOM   1995  C  CG2   . VAL B 1  24   ? -6.284  29.990  111.209 1.00   68.06  ? 24   VAL B CG2   1 
ATOM   1996  N  N     . LEU B 1  25   ? -2.773  28.715  114.038 1.00   60.55  ? 25   LEU B N     1 
ATOM   1997  C  CA    . LEU B 1  25   ? -1.410  28.777  114.549 1.00   57.90  ? 25   LEU B CA    1 
ATOM   1998  C  C     . LEU B 1  25   ? -0.435  28.202  113.526 1.00   66.35  ? 25   LEU B C     1 
ATOM   1999  O  O     . LEU B 1  25   ? -0.394  26.991  113.308 1.00   59.08  ? 25   LEU B O     1 
ATOM   2000  C  CB    . LEU B 1  25   ? -1.309  27.989  115.855 1.00   49.43  ? 25   LEU B CB    1 
ATOM   2001  C  CG    . LEU B 1  25   ? -0.048  28.176  116.699 1.00   58.08  ? 25   LEU B CG    1 
ATOM   2002  C  CD1   . LEU B 1  25   ? -0.040  29.552  117.351 1.00   66.06  ? 25   LEU B CD1   1 
ATOM   2003  C  CD2   . LEU B 1  25   ? 0.067   27.079  117.745 1.00   51.18  ? 25   LEU B CD2   1 
ATOM   2004  N  N     . GLU B 1  26   ? 0.352   29.079  112.908 1.00   80.35  ? 26   GLU B N     1 
ATOM   2005  C  CA    . GLU B 1  26   ? 1.357   28.674  111.926 1.00   73.84  ? 26   GLU B CA    1 
ATOM   2006  C  C     . GLU B 1  26   ? 2.552   29.625  111.937 1.00   70.25  ? 26   GLU B C     1 
ATOM   2007  O  O     . GLU B 1  26   ? 2.402   30.802  112.267 1.00   71.31  ? 26   GLU B O     1 
ATOM   2008  C  CB    . GLU B 1  26   ? 0.741   28.633  110.526 1.00   60.06  ? 26   GLU B CB    1 
ATOM   2009  C  CG    . GLU B 1  26   ? 0.157   29.961  110.074 1.00   60.94  ? 26   GLU B CG    1 
ATOM   2010  C  CD    . GLU B 1  26   ? -0.385  29.909  108.660 1.00   70.63  ? 26   GLU B CD    1 
ATOM   2011  O  OE1   . GLU B 1  26   ? 0.018   29.003  107.901 1.00   65.51  ? 26   GLU B OE1   1 
ATOM   2012  O  OE2   . GLU B 1  26   ? -1.216  30.774  108.306 1.00   72.22  ? 26   GLU B OE2   1 
ATOM   2013  N  N     . PRO B 1  27   ? 3.743   29.129  111.559 1.00   69.91  ? 27   PRO B N     1 
ATOM   2014  C  CA    . PRO B 1  27   ? 4.105   27.730  111.305 1.00   66.12  ? 27   PRO B CA    1 
ATOM   2015  C  C     . PRO B 1  27   ? 4.427   26.965  112.587 1.00   66.39  ? 27   PRO B C     1 
ATOM   2016  O  O     . PRO B 1  27   ? 4.864   27.568  113.568 1.00   68.42  ? 27   PRO B O     1 
ATOM   2017  C  CB    . PRO B 1  27   ? 5.365   27.859  110.453 1.00   70.30  ? 27   PRO B CB    1 
ATOM   2018  C  CG    . PRO B 1  27   ? 6.010   29.095  110.965 1.00   75.56  ? 27   PRO B CG    1 
ATOM   2019  C  CD    . PRO B 1  27   ? 4.882   30.034  111.317 1.00   76.51  ? 27   PRO B CD    1 
ATOM   2020  N  N     . LEU B 1  28   ? 4.227   25.651  112.568 1.00   63.48  ? 28   LEU B N     1 
ATOM   2021  C  CA    . LEU B 1  28   ? 4.662   24.791  113.664 1.00   59.95  ? 28   LEU B CA    1 
ATOM   2022  C  C     . LEU B 1  28   ? 5.606   23.723  113.131 1.00   57.02  ? 28   LEU B C     1 
ATOM   2023  O  O     . LEU B 1  28   ? 5.558   23.381  111.949 1.00   58.64  ? 28   LEU B O     1 
ATOM   2024  C  CB    . LEU B 1  28   ? 3.467   24.127  114.351 1.00   60.45  ? 28   LEU B CB    1 
ATOM   2025  C  CG    . LEU B 1  28   ? 2.555   25.014  115.200 1.00   58.04  ? 28   LEU B CG    1 
ATOM   2026  C  CD1   . LEU B 1  28   ? 1.313   24.245  115.615 1.00   52.51  ? 28   LEU B CD1   1 
ATOM   2027  C  CD2   . LEU B 1  28   ? 3.295   25.537  116.421 1.00   57.92  ? 28   LEU B CD2   1 
ATOM   2028  N  N     . GLU B 1  29   ? 6.460   23.198  114.004 1.00   57.70  ? 29   GLU B N     1 
ATOM   2029  C  CA    . GLU B 1  29   ? 7.388   22.139  113.623 1.00   63.87  ? 29   GLU B CA    1 
ATOM   2030  C  C     . GLU B 1  29   ? 6.594   20.905  113.201 1.00   62.60  ? 29   GLU B C     1 
ATOM   2031  O  O     . GLU B 1  29   ? 5.457   20.721  113.633 1.00   68.53  ? 29   GLU B O     1 
ATOM   2032  C  CB    . GLU B 1  29   ? 8.337   21.815  114.780 1.00   65.55  ? 29   GLU B CB    1 
ATOM   2033  C  CG    . GLU B 1  29   ? 9.487   20.887  114.413 1.00   73.95  ? 29   GLU B CG    1 
ATOM   2034  C  CD    . GLU B 1  29   ? 10.316  21.414  113.255 1.00   85.29  ? 29   GLU B CD    1 
ATOM   2035  O  OE1   . GLU B 1  29   ? 10.231  20.838  112.149 1.00   69.76  ? 29   GLU B OE1   1 
ATOM   2036  O  OE2   . GLU B 1  29   ? 11.055  22.403  113.452 1.00   93.76  ? 29   GLU B OE2   1 
ATOM   2037  N  N     . ARG B 1  30   ? 7.185   20.077  112.343 1.00   55.94  ? 30   ARG B N     1 
ATOM   2038  C  CA    . ARG B 1  30   ? 6.484   18.930  111.773 1.00   58.63  ? 30   ARG B CA    1 
ATOM   2039  C  C     . ARG B 1  30   ? 5.911   17.999  112.836 1.00   60.26  ? 30   ARG B C     1 
ATOM   2040  O  O     . ARG B 1  30   ? 6.629   17.524  113.716 1.00   62.17  ? 30   ARG B O     1 
ATOM   2041  C  CB    . ARG B 1  30   ? 7.414   18.137  110.857 1.00   64.52  ? 30   ARG B CB    1 
ATOM   2042  C  CG    . ARG B 1  30   ? 6.738   16.961  110.177 1.00   66.66  ? 30   ARG B CG    1 
ATOM   2043  C  CD    . ARG B 1  30   ? 7.755   16.016  109.565 1.00   67.39  ? 30   ARG B CD    1 
ATOM   2044  N  NE    . ARG B 1  30   ? 8.466   15.249  110.583 1.00   63.14  ? 30   ARG B NE    1 
ATOM   2045  C  CZ    . ARG B 1  30   ? 9.440   14.386  110.319 1.00   59.05  ? 30   ARG B CZ    1 
ATOM   2046  N  NH1   . ARG B 1  30   ? 9.826   14.183  109.066 1.00   62.06  ? 30   ARG B NH1   1 
ATOM   2047  N  NH2   . ARG B 1  30   ? 10.032  13.728  111.307 1.00   58.41  ? 30   ARG B NH2   1 
ATOM   2048  N  N     . GLY B 1  31   ? 4.612   17.739  112.738 1.00   58.12  ? 31   GLY B N     1 
ATOM   2049  C  CA    . GLY B 1  31   ? 3.927   16.870  113.675 1.00   56.68  ? 31   GLY B CA    1 
ATOM   2050  C  C     . GLY B 1  31   ? 3.267   17.616  114.819 1.00   55.55  ? 31   GLY B C     1 
ATOM   2051  O  O     . GLY B 1  31   ? 2.317   17.122  115.421 1.00   54.49  ? 31   GLY B O     1 
ATOM   2052  N  N     . PHE B 1  32   ? 3.747   18.820  115.112 1.00   57.04  ? 32   PHE B N     1 
ATOM   2053  C  CA    . PHE B 1  32   ? 3.202   19.590  116.230 1.00   54.96  ? 32   PHE B CA    1 
ATOM   2054  C  C     . PHE B 1  32   ? 1.791   20.104  115.961 1.00   53.10  ? 32   PHE B C     1 
ATOM   2055  O  O     . PHE B 1  32   ? 1.131   20.621  116.862 1.00   52.89  ? 32   PHE B O     1 
ATOM   2056  C  CB    . PHE B 1  32   ? 4.133   20.740  116.624 1.00   55.32  ? 32   PHE B CB    1 
ATOM   2057  C  CG    . PHE B 1  32   ? 5.267   20.317  117.511 1.00   53.65  ? 32   PHE B CG    1 
ATOM   2058  C  CD1   . PHE B 1  32   ? 6.422   19.788  116.968 1.00   55.52  ? 32   PHE B CD1   1 
ATOM   2059  C  CD2   . PHE B 1  32   ? 5.172   20.434  118.889 1.00   55.22  ? 32   PHE B CD2   1 
ATOM   2060  C  CE1   . PHE B 1  32   ? 7.465   19.389  117.776 1.00   56.38  ? 32   PHE B CE1   1 
ATOM   2061  C  CE2   . PHE B 1  32   ? 6.215   20.034  119.706 1.00   53.35  ? 32   PHE B CE2   1 
ATOM   2062  C  CZ    . PHE B 1  32   ? 7.364   19.512  119.147 1.00   50.26  ? 32   PHE B CZ    1 
ATOM   2063  N  N     . GLY B 1  33   ? 1.333   19.956  114.722 1.00   54.01  ? 33   GLY B N     1 
ATOM   2064  C  CA    . GLY B 1  33   ? -0.008  20.367  114.357 1.00   51.54  ? 33   GLY B CA    1 
ATOM   2065  C  C     . GLY B 1  33   ? -1.069  19.585  115.107 1.00   46.35  ? 33   GLY B C     1 
ATOM   2066  O  O     . GLY B 1  33   ? -1.933  20.169  115.762 1.00   44.60  ? 33   GLY B O     1 
ATOM   2067  N  N     . VAL B 1  34   ? -1.003  18.261  115.016 1.00   45.55  ? 34   VAL B N     1 
ATOM   2068  C  CA    . VAL B 1  34   ? -1.976  17.414  115.694 1.00   44.83  ? 34   VAL B CA    1 
ATOM   2069  C  C     . VAL B 1  34   ? -1.546  17.129  117.130 1.00   44.68  ? 34   VAL B C     1 
ATOM   2070  O  O     . VAL B 1  34   ? -2.344  16.659  117.942 1.00   48.08  ? 34   VAL B O     1 
ATOM   2071  C  CB    . VAL B 1  34   ? -2.216  16.090  114.935 1.00   48.89  ? 34   VAL B CB    1 
ATOM   2072  C  CG1   . VAL B 1  34   ? -2.041  16.301  113.441 1.00   53.03  ? 34   VAL B CG1   1 
ATOM   2073  C  CG2   . VAL B 1  34   ? -1.276  15.009  115.428 1.00   45.25  ? 34   VAL B CG2   1 
ATOM   2074  N  N     . THR B 1  35   ? -0.288  17.431  117.441 1.00   45.61  ? 35   THR B N     1 
ATOM   2075  C  CA    . THR B 1  35   ? 0.223   17.279  118.800 1.00   45.95  ? 35   THR B CA    1 
ATOM   2076  C  C     . THR B 1  35   ? -0.454  18.276  119.737 1.00   47.79  ? 35   THR B C     1 
ATOM   2077  O  O     . THR B 1  35   ? -0.795  17.942  120.870 1.00   45.31  ? 35   THR B O     1 
ATOM   2078  C  CB    . THR B 1  35   ? 1.754   17.470  118.860 1.00   41.99  ? 35   THR B CB    1 
ATOM   2079  O  OG1   . THR B 1  35   ? 2.397   16.411  118.142 1.00   42.49  ? 35   THR B OG1   1 
ATOM   2080  C  CG2   . THR B 1  35   ? 2.244   17.459  120.299 1.00   40.19  ? 35   THR B CG2   1 
ATOM   2081  N  N     . LEU B 1  36   ? -0.634  19.504  119.262 1.00   48.17  ? 36   LEU B N     1 
ATOM   2082  C  CA    . LEU B 1  36   ? -1.373  20.515  120.010 1.00   40.84  ? 36   LEU B CA    1 
ATOM   2083  C  C     . LEU B 1  36   ? -2.883  20.362  119.841 1.00   38.73  ? 36   LEU B C     1 
ATOM   2084  O  O     . LEU B 1  36   ? -3.647  20.589  120.776 1.00   47.50  ? 36   LEU B O     1 
ATOM   2085  C  CB    . LEU B 1  36   ? -0.938  21.923  119.596 1.00   39.31  ? 36   LEU B CB    1 
ATOM   2086  C  CG    . LEU B 1  36   ? 0.487   22.325  119.979 1.00   37.49  ? 36   LEU B CG    1 
ATOM   2087  C  CD1   . LEU B 1  36   ? 0.773   23.758  119.563 1.00   42.10  ? 36   LEU B CD1   1 
ATOM   2088  C  CD2   . LEU B 1  36   ? 0.705   22.147  121.472 1.00   45.61  ? 36   LEU B CD2   1 
ATOM   2089  N  N     . GLY B 1  37   ? -3.304  19.975  118.641 1.00   41.60  ? 37   GLY B N     1 
ATOM   2090  C  CA    . GLY B 1  37   ? -4.715  19.936  118.294 1.00   51.91  ? 37   GLY B CA    1 
ATOM   2091  C  C     . GLY B 1  37   ? -5.573  18.963  119.082 1.00   52.31  ? 37   GLY B C     1 
ATOM   2092  O  O     . GLY B 1  37   ? -6.574  19.358  119.682 1.00   55.62  ? 37   GLY B O     1 
ATOM   2093  N  N     . ASN B 1  38   ? -5.188  17.691  119.078 1.00   47.02  ? 38   ASN B N     1 
ATOM   2094  C  CA    . ASN B 1  38   ? -5.958  16.651  119.764 1.00   46.13  ? 38   ASN B CA    1 
ATOM   2095  C  C     . ASN B 1  38   ? -6.212  16.833  121.268 1.00   51.67  ? 38   ASN B C     1 
ATOM   2096  O  O     . ASN B 1  38   ? -7.341  16.636  121.718 1.00   59.68  ? 38   ASN B O     1 
ATOM   2097  C  CB    . ASN B 1  38   ? -5.382  15.260  119.480 1.00   47.31  ? 38   ASN B CB    1 
ATOM   2098  C  CG    . ASN B 1  38   ? -5.935  14.656  118.207 1.00   59.54  ? 38   ASN B CG    1 
ATOM   2099  O  OD1   . ASN B 1  38   ? -7.098  14.870  117.861 1.00   63.93  ? 38   ASN B OD1   1 
ATOM   2100  N  ND2   . ASN B 1  38   ? -5.105  13.899  117.498 1.00   55.85  ? 38   ASN B ND2   1 
ATOM   2101  N  N     . PRO B 1  39   ? -5.175  17.189  122.053 1.00   48.40  ? 39   PRO B N     1 
ATOM   2102  C  CA    . PRO B 1  39   ? -5.425  17.368  123.488 1.00   47.20  ? 39   PRO B CA    1 
ATOM   2103  C  C     . PRO B 1  39   ? -6.432  18.475  123.744 1.00   50.43  ? 39   PRO B C     1 
ATOM   2104  O  O     . PRO B 1  39   ? -7.350  18.299  124.546 1.00   50.77  ? 39   PRO B O     1 
ATOM   2105  C  CB    . PRO B 1  39   ? -4.063  17.805  124.034 1.00   42.32  ? 39   PRO B CB    1 
ATOM   2106  C  CG    . PRO B 1  39   ? -3.089  17.383  123.031 1.00   47.64  ? 39   PRO B CG    1 
ATOM   2107  C  CD    . PRO B 1  39   ? -3.766  17.437  121.712 1.00   48.26  ? 39   PRO B CD    1 
ATOM   2108  N  N     . LEU B 1  40   ? -6.254  19.599  123.057 1.00   43.70  ? 40   LEU B N     1 
ATOM   2109  C  CA    . LEU B 1  40   ? -7.135  20.744  123.227 1.00   45.03  ? 40   LEU B CA    1 
ATOM   2110  C  C     . LEU B 1  40   ? -8.577  20.383  122.891 1.00   46.24  ? 40   LEU B C     1 
ATOM   2111  O  O     . LEU B 1  40   ? -9.498  20.791  123.593 1.00   50.27  ? 40   LEU B O     1 
ATOM   2112  C  CB    . LEU B 1  40   ? -6.654  21.929  122.387 1.00   39.38  ? 40   LEU B CB    1 
ATOM   2113  C  CG    . LEU B 1  40   ? -5.291  22.492  122.800 1.00   42.87  ? 40   LEU B CG    1 
ATOM   2114  C  CD1   . LEU B 1  40   ? -4.951  23.752  122.015 1.00   45.31  ? 40   LEU B CD1   1 
ATOM   2115  C  CD2   . LEU B 1  40   ? -5.248  22.760  124.298 1.00   48.41  ? 40   LEU B CD2   1 
ATOM   2116  N  N     . ARG B 1  41   ? -8.764  19.600  121.833 1.00   41.35  ? 41   ARG B N     1 
ATOM   2117  C  CA    . ARG B 1  41   ? -10.096 19.133  121.463 1.00   43.28  ? 41   ARG B CA    1 
ATOM   2118  C  C     . ARG B 1  41   ? -10.711 18.285  122.574 1.00   46.63  ? 41   ARG B C     1 
ATOM   2119  O  O     . ARG B 1  41   ? -11.882 18.448  122.914 1.00   49.68  ? 41   ARG B O     1 
ATOM   2120  C  CB    . ARG B 1  41   ? -10.055 18.333  120.161 1.00   41.97  ? 41   ARG B CB    1 
ATOM   2121  C  CG    . ARG B 1  41   ? -11.413 17.794  119.744 1.00   39.69  ? 41   ARG B CG    1 
ATOM   2122  C  CD    . ARG B 1  41   ? -11.315 16.875  118.542 1.00   39.60  ? 41   ARG B CD    1 
ATOM   2123  N  NE    . ARG B 1  41   ? -12.625 16.372  118.140 1.00   36.56  ? 41   ARG B NE    1 
ATOM   2124  C  CZ    . ARG B 1  41   ? -13.187 15.271  118.631 1.00   40.38  ? 41   ARG B CZ    1 
ATOM   2125  N  NH1   . ARG B 1  41   ? -12.553 14.552  119.547 1.00   45.93  ? 41   ARG B NH1   1 
ATOM   2126  N  NH2   . ARG B 1  41   ? -14.384 14.889  118.206 1.00   40.77  ? 41   ARG B NH2   1 
ATOM   2127  N  N     . ARG B 1  42   ? -9.913  17.381  123.135 1.00   44.25  ? 42   ARG B N     1 
ATOM   2128  C  CA    . ARG B 1  42   ? -10.370 16.530  124.230 1.00   43.07  ? 42   ARG B CA    1 
ATOM   2129  C  C     . ARG B 1  42   ? -10.712 17.360  125.463 1.00   47.45  ? 42   ARG B C     1 
ATOM   2130  O  O     . ARG B 1  42   ? -11.731 17.128  126.114 1.00   46.97  ? 42   ARG B O     1 
ATOM   2131  C  CB    . ARG B 1  42   ? -9.310  15.482  124.575 1.00   33.94  ? 42   ARG B CB    1 
ATOM   2132  C  CG    . ARG B 1  42   ? -9.071  14.467  123.474 1.00   34.01  ? 42   ARG B CG    1 
ATOM   2133  C  CD    . ARG B 1  42   ? -7.891  13.563  123.791 1.00   40.25  ? 42   ARG B CD    1 
ATOM   2134  N  NE    . ARG B 1  42   ? -8.180  12.615  124.863 1.00   31.52  ? 42   ARG B NE    1 
ATOM   2135  C  CZ    . ARG B 1  42   ? -8.677  11.397  124.669 1.00   34.03  ? 42   ARG B CZ    1 
ATOM   2136  N  NH1   . ARG B 1  42   ? -8.947  10.976  123.442 1.00   33.08  ? 42   ARG B NH1   1 
ATOM   2137  N  NH2   . ARG B 1  42   ? -8.907  10.599  125.702 1.00   42.80  ? 42   ARG B NH2   1 
ATOM   2138  N  N     . ILE B 1  43   ? -9.859  18.330  125.772 1.00   47.71  ? 43   ILE B N     1 
ATOM   2139  C  CA    . ILE B 1  43   ? -10.070 19.202  126.922 1.00   48.53  ? 43   ILE B CA    1 
ATOM   2140  C  C     . ILE B 1  43   ? -11.268 20.124  126.710 1.00   50.80  ? 43   ILE B C     1 
ATOM   2141  O  O     . ILE B 1  43   ? -12.099 20.287  127.605 1.00   55.52  ? 43   ILE B O     1 
ATOM   2142  C  CB    . ILE B 1  43   ? -8.819  20.047  127.226 1.00   47.14  ? 43   ILE B CB    1 
ATOM   2143  C  CG1   . ILE B 1  43   ? -7.638  19.140  127.573 1.00   46.39  ? 43   ILE B CG1   1 
ATOM   2144  C  CG2   . ILE B 1  43   ? -9.089  21.012  128.368 1.00   48.76  ? 43   ILE B CG2   1 
ATOM   2145  C  CD1   . ILE B 1  43   ? -6.339  19.885  127.772 1.00   45.52  ? 43   ILE B CD1   1 
ATOM   2146  N  N     . LEU B 1  44   ? -11.353 20.719  125.523 1.00   46.92  ? 44   LEU B N     1 
ATOM   2147  C  CA    . LEU B 1  44   ? -12.450 21.626  125.189 1.00   48.09  ? 44   LEU B CA    1 
ATOM   2148  C  C     . LEU B 1  44   ? -13.816 20.958  125.294 1.00   50.30  ? 44   LEU B C     1 
ATOM   2149  O  O     . LEU B 1  44   ? -14.786 21.582  125.719 1.00   58.25  ? 44   LEU B O     1 
ATOM   2150  C  CB    . LEU B 1  44   ? -12.269 22.201  123.784 1.00   47.57  ? 44   LEU B CB    1 
ATOM   2151  C  CG    . LEU B 1  44   ? -11.314 23.384  123.633 1.00   50.45  ? 44   LEU B CG    1 
ATOM   2152  C  CD1   . LEU B 1  44   ? -11.022 23.647  122.165 1.00   45.84  ? 44   LEU B CD1   1 
ATOM   2153  C  CD2   . LEU B 1  44   ? -11.900 24.618  124.294 1.00   56.99  ? 44   LEU B CD2   1 
ATOM   2154  N  N     . LEU B 1  45   ? -13.895 19.696  124.889 1.00   44.73  ? 45   LEU B N     1 
ATOM   2155  C  CA    . LEU B 1  45   ? -15.156 18.970  124.948 1.00   43.20  ? 45   LEU B CA    1 
ATOM   2156  C  C     . LEU B 1  45   ? -15.520 18.505  126.359 1.00   43.03  ? 45   LEU B C     1 
ATOM   2157  O  O     . LEU B 1  45   ? -16.634 18.735  126.823 1.00   54.52  ? 45   LEU B O     1 
ATOM   2158  C  CB    . LEU B 1  45   ? -15.140 17.782  123.983 1.00   52.18  ? 45   LEU B CB    1 
ATOM   2159  C  CG    . LEU B 1  45   ? -15.083 18.136  122.494 1.00   49.04  ? 45   LEU B CG    1 
ATOM   2160  C  CD1   . LEU B 1  45   ? -15.167 16.884  121.632 1.00   36.58  ? 45   LEU B CD1   1 
ATOM   2161  C  CD2   . LEU B 1  45   ? -16.188 19.119  122.132 1.00   50.60  ? 45   LEU B CD2   1 
ATOM   2162  N  N     . SER B 1  46   ? -14.584 17.842  127.031 1.00   41.63  ? 46   SER B N     1 
ATOM   2163  C  CA    . SER B 1  46   ? -14.859 17.272  128.350 1.00   47.43  ? 46   SER B CA    1 
ATOM   2164  C  C     . SER B 1  46   ? -14.739 18.229  129.542 1.00   50.57  ? 46   SER B C     1 
ATOM   2165  O  O     . SER B 1  46   ? -15.600 18.243  130.421 1.00   55.05  ? 46   SER B O     1 
ATOM   2166  C  CB    . SER B 1  46   ? -13.970 16.047  128.592 1.00   51.37  ? 46   SER B CB    1 
ATOM   2167  O  OG    . SER B 1  46   ? -12.603 16.413  128.667 1.00   57.32  ? 46   SER B OG    1 
ATOM   2168  N  N     . SER B 1  47   ? -13.675 19.024  129.568 1.00   51.38  ? 47   SER B N     1 
ATOM   2169  C  CA    . SER B 1  47   ? -13.262 19.696  130.803 1.00   49.56  ? 47   SER B CA    1 
ATOM   2170  C  C     . SER B 1  47   ? -13.684 21.149  131.008 1.00   49.09  ? 47   SER B C     1 
ATOM   2171  O  O     . SER B 1  47   ? -13.363 21.739  132.039 1.00   55.60  ? 47   SER B O     1 
ATOM   2172  C  CB    . SER B 1  47   ? -11.750 19.574  130.983 1.00   54.49  ? 47   SER B CB    1 
ATOM   2173  O  OG    . SER B 1  47   ? -11.378 18.213  131.054 1.00   59.44  ? 47   SER B OG    1 
ATOM   2174  N  N     . ILE B 1  48   ? -14.386 21.735  130.046 1.00   47.64  ? 48   ILE B N     1 
ATOM   2175  C  CA    . ILE B 1  48   ? -14.773 23.136  130.177 1.00   54.05  ? 48   ILE B CA    1 
ATOM   2176  C  C     . ILE B 1  48   ? -16.040 23.303  131.016 1.00   67.48  ? 48   ILE B C     1 
ATOM   2177  O  O     . ILE B 1  48   ? -17.081 22.731  130.692 1.00   65.98  ? 48   ILE B O     1 
ATOM   2178  C  CB    . ILE B 1  48   ? -14.948 23.814  128.810 1.00   54.08  ? 48   ILE B CB    1 
ATOM   2179  C  CG1   . ILE B 1  48   ? -13.677 23.646  127.977 1.00   58.10  ? 48   ILE B CG1   1 
ATOM   2180  C  CG2   . ILE B 1  48   ? -15.265 25.288  128.987 1.00   56.95  ? 48   ILE B CG2   1 
ATOM   2181  C  CD1   . ILE B 1  48   ? -12.429 24.172  128.654 1.00   53.47  ? 48   ILE B CD1   1 
ATOM   2182  N  N     . PRO B 1  49   ? -15.943 24.086  132.106 1.00   67.95  ? 49   PRO B N     1 
ATOM   2183  C  CA    . PRO B 1  49   ? -17.040 24.335  133.049 1.00   55.23  ? 49   PRO B CA    1 
ATOM   2184  C  C     . PRO B 1  49   ? -18.267 24.941  132.378 1.00   57.71  ? 49   PRO B C     1 
ATOM   2185  O  O     . PRO B 1  49   ? -18.140 25.841  131.547 1.00   53.61  ? 49   PRO B O     1 
ATOM   2186  C  CB    . PRO B 1  49   ? -16.433 25.343  134.030 1.00   58.07  ? 49   PRO B CB    1 
ATOM   2187  C  CG    . PRO B 1  49   ? -14.969 25.109  133.954 1.00   56.34  ? 49   PRO B CG    1 
ATOM   2188  C  CD    . PRO B 1  49   ? -14.700 24.759  132.525 1.00   61.43  ? 49   PRO B CD    1 
ATOM   2189  N  N     . GLY B 1  50   ? -19.444 24.446  132.745 1.00   60.21  ? 50   GLY B N     1 
ATOM   2190  C  CA    . GLY B 1  50   ? -20.689 24.937  132.185 1.00   63.09  ? 50   GLY B CA    1 
ATOM   2191  C  C     . GLY B 1  50   ? -21.878 24.602  133.062 1.00   59.75  ? 50   GLY B C     1 
ATOM   2192  O  O     . GLY B 1  50   ? -21.717 24.095  134.173 1.00   60.18  ? 50   GLY B O     1 
ATOM   2193  N  N     . THR B 1  51   ? -23.077 24.886  132.563 1.00   60.56  ? 51   THR B N     1 
ATOM   2194  C  CA    . THR B 1  51   ? -24.300 24.633  133.317 1.00   60.47  ? 51   THR B CA    1 
ATOM   2195  C  C     . THR B 1  51   ? -25.302 23.812  132.508 1.00   57.04  ? 51   THR B C     1 
ATOM   2196  O  O     . THR B 1  51   ? -25.410 23.969  131.291 1.00   58.13  ? 51   THR B O     1 
ATOM   2197  C  CB    . THR B 1  51   ? -24.967 25.946  133.754 1.00   61.84  ? 51   THR B CB    1 
ATOM   2198  O  OG1   . THR B 1  51   ? -25.277 26.730  132.596 1.00   68.91  ? 51   THR B OG1   1 
ATOM   2199  C  CG2   . THR B 1  51   ? -24.038 26.740  134.661 1.00   65.47  ? 51   THR B CG2   1 
ATOM   2200  N  N     . ALA B 1  52   ? -26.036 22.942  133.195 1.00   51.59  ? 52   ALA B N     1 
ATOM   2201  C  CA    . ALA B 1  52   ? -26.998 22.059  132.542 1.00   51.77  ? 52   ALA B CA    1 
ATOM   2202  C  C     . ALA B 1  52   ? -28.234 21.843  133.404 1.00   61.09  ? 52   ALA B C     1 
ATOM   2203  O  O     . ALA B 1  52   ? -28.216 22.102  134.607 1.00   61.41  ? 52   ALA B O     1 
ATOM   2204  C  CB    . ALA B 1  52   ? -26.351 20.727  132.228 1.00   51.41  ? 52   ALA B CB    1 
ATOM   2205  N  N     . VAL B 1  53   ? -29.305 21.354  132.784 1.00   61.65  ? 53   VAL B N     1 
ATOM   2206  C  CA    . VAL B 1  53   ? -30.508 21.007  133.526 1.00   62.28  ? 53   VAL B CA    1 
ATOM   2207  C  C     . VAL B 1  53   ? -30.443 19.529  133.878 1.00   63.08  ? 53   VAL B C     1 
ATOM   2208  O  O     . VAL B 1  53   ? -30.578 18.668  133.008 1.00   63.06  ? 53   VAL B O     1 
ATOM   2209  C  CB    . VAL B 1  53   ? -31.774 21.269  132.690 1.00   55.58  ? 53   VAL B CB    1 
ATOM   2210  C  CG1   . VAL B 1  53   ? -33.014 20.819  133.444 1.00   64.18  ? 53   VAL B CG1   1 
ATOM   2211  C  CG2   . VAL B 1  53   ? -31.872 22.740  132.322 1.00   56.16  ? 53   VAL B CG2   1 
ATOM   2212  N  N     . THR B 1  54   ? -30.229 19.238  135.158 1.00   60.43  ? 54   THR B N     1 
ATOM   2213  C  CA    . THR B 1  54   ? -30.026 17.862  135.593 1.00   59.56  ? 54   THR B CA    1 
ATOM   2214  C  C     . THR B 1  54   ? -31.286 17.143  136.088 1.00   62.21  ? 54   THR B C     1 
ATOM   2215  O  O     . THR B 1  54   ? -31.283 15.921  136.237 1.00   63.28  ? 54   THR B O     1 
ATOM   2216  C  CB    . THR B 1  54   ? -28.935 17.792  136.679 1.00   55.33  ? 54   THR B CB    1 
ATOM   2217  O  OG1   . THR B 1  54   ? -29.287 18.656  137.764 1.00   58.20  ? 54   THR B OG1   1 
ATOM   2218  C  CG2   . THR B 1  54   ? -27.600 18.242  136.116 1.00   57.45  ? 54   THR B CG2   1 
ATOM   2219  N  N     . SER B 1  55   ? -32.358 17.892  136.335 1.00   64.56  ? 55   SER B N     1 
ATOM   2220  C  CA    . SER B 1  55   ? -33.618 17.285  136.764 1.00   62.69  ? 55   SER B CA    1 
ATOM   2221  C  C     . SER B 1  55   ? -34.827 18.170  136.459 1.00   60.11  ? 55   SER B C     1 
ATOM   2222  O  O     . SER B 1  55   ? -34.714 19.396  136.410 1.00   53.49  ? 55   SER B O     1 
ATOM   2223  C  CB    . SER B 1  55   ? -33.570 16.942  138.257 1.00   66.56  ? 55   SER B CB    1 
ATOM   2224  O  OG    . SER B 1  55   ? -34.656 16.111  138.628 1.00   69.74  ? 55   SER B OG    1 
ATOM   2225  N  N     . VAL B 1  56   ? -35.984 17.542  136.266 1.00   62.09  ? 56   VAL B N     1 
ATOM   2226  C  CA    . VAL B 1  56   ? -37.223 18.265  135.984 1.00   67.15  ? 56   VAL B CA    1 
ATOM   2227  C  C     . VAL B 1  56   ? -38.418 17.646  136.708 1.00   77.95  ? 56   VAL B C     1 
ATOM   2228  O  O     . VAL B 1  56   ? -38.651 16.441  136.612 1.00   79.10  ? 56   VAL B O     1 
ATOM   2229  C  CB    . VAL B 1  56   ? -37.536 18.285  134.471 1.00   66.38  ? 56   VAL B CB    1 
ATOM   2230  C  CG1   . VAL B 1  56   ? -38.923 18.858  134.217 1.00   70.27  ? 56   VAL B CG1   1 
ATOM   2231  C  CG2   . VAL B 1  56   ? -36.486 19.075  133.711 1.00   72.11  ? 56   VAL B CG2   1 
ATOM   2232  N  N     . TYR B 1  57   ? -39.173 18.469  137.430 1.00   76.98  ? 57   TYR B N     1 
ATOM   2233  C  CA    . TYR B 1  57   ? -40.443 18.031  138.001 1.00   73.31  ? 57   TYR B CA    1 
ATOM   2234  C  C     . TYR B 1  57   ? -41.597 18.838  137.430 1.00   70.93  ? 57   TYR B C     1 
ATOM   2235  O  O     . TYR B 1  57   ? -41.550 20.064  137.407 1.00   67.68  ? 57   TYR B O     1 
ATOM   2236  C  CB    . TYR B 1  57   ? -40.451 18.157  139.525 1.00   79.34  ? 57   TYR B CB    1 
ATOM   2237  C  CG    . TYR B 1  57   ? -41.844 18.064  140.118 1.00   82.10  ? 57   TYR B CG    1 
ATOM   2238  C  CD1   . TYR B 1  57   ? -42.522 16.851  140.160 1.00   80.27  ? 57   TYR B CD1   1 
ATOM   2239  C  CD2   . TYR B 1  57   ? -42.484 19.189  140.626 1.00   78.94  ? 57   TYR B CD2   1 
ATOM   2240  C  CE1   . TYR B 1  57   ? -43.796 16.759  140.696 1.00   75.47  ? 57   TYR B CE1   1 
ATOM   2241  C  CE2   . TYR B 1  57   ? -43.759 19.108  141.163 1.00   81.08  ? 57   TYR B CE2   1 
ATOM   2242  C  CZ    . TYR B 1  57   ? -44.409 17.890  141.195 1.00   79.14  ? 57   TYR B CZ    1 
ATOM   2243  O  OH    . TYR B 1  57   ? -45.676 17.802  141.728 1.00   65.15  ? 57   TYR B OH    1 
ATOM   2244  N  N     . ILE B 1  58   ? -42.632 18.142  136.971 1.00   74.47  ? 58   ILE B N     1 
ATOM   2245  C  CA    . ILE B 1  58   ? -43.853 18.788  136.506 1.00   79.97  ? 58   ILE B CA    1 
ATOM   2246  C  C     . ILE B 1  58   ? -45.031 18.179  137.260 1.00   85.88  ? 58   ILE B C     1 
ATOM   2247  O  O     . ILE B 1  58   ? -45.051 16.975  137.514 1.00   87.57  ? 58   ILE B O     1 
ATOM   2248  C  CB    . ILE B 1  58   ? -44.051 18.604  134.987 1.00   73.48  ? 58   ILE B CB    1 
ATOM   2249  C  CG1   . ILE B 1  58   ? -42.788 19.015  134.225 1.00   77.43  ? 58   ILE B CG1   1 
ATOM   2250  C  CG2   . ILE B 1  58   ? -45.250 19.402  134.502 1.00   78.81  ? 58   ILE B CG2   1 
ATOM   2251  C  CD1   . ILE B 1  58   ? -42.839 18.693  132.749 1.00   75.43  ? 58   ILE B CD1   1 
ATOM   2252  N  N     . GLU B 1  59   ? -45.999 19.010  137.638 1.00   82.53  ? 59   GLU B N     1 
ATOM   2253  C  CA    . GLU B 1  59   ? -47.147 18.532  138.401 1.00   87.14  ? 59   GLU B CA    1 
ATOM   2254  C  C     . GLU B 1  59   ? -47.980 17.551  137.586 1.00   84.61  ? 59   GLU B C     1 
ATOM   2255  O  O     . GLU B 1  59   ? -48.061 17.661  136.363 1.00   74.67  ? 59   GLU B O     1 
ATOM   2256  C  CB    . GLU B 1  59   ? -48.023 19.700  138.870 1.00   90.37  ? 59   GLU B CB    1 
ATOM   2257  C  CG    . GLU B 1  59   ? -47.447 20.506  140.026 1.00   93.09  ? 59   GLU B CG    1 
ATOM   2258  C  CD    . GLU B 1  59   ? -48.460 21.464  140.633 1.00   88.03  ? 59   GLU B CD    1 
ATOM   2259  O  OE1   . GLU B 1  59   ? -48.069 22.281  141.494 1.00   86.94  ? 59   GLU B OE1   1 
ATOM   2260  O  OE2   . GLU B 1  59   ? -49.649 21.397  140.253 1.00   75.25  ? 59   GLU B OE2   1 
ATOM   2261  N  N     . ASP B 1  60   ? -48.570 16.581  138.281 1.00   97.55  ? 60   ASP B N     1 
ATOM   2262  C  CA    . ASP B 1  60   ? -49.527 15.639  137.696 1.00   99.25  ? 60   ASP B CA    1 
ATOM   2263  C  C     . ASP B 1  60   ? -48.957 14.641  136.677 1.00   95.53  ? 60   ASP B C     1 
ATOM   2264  O  O     . ASP B 1  60   ? -49.690 13.781  136.186 1.00   98.10  ? 60   ASP B O     1 
ATOM   2265  C  CB    . ASP B 1  60   ? -50.743 16.375  137.116 1.00   97.51  ? 60   ASP B CB    1 
ATOM   2266  C  CG    . ASP B 1  60   ? -51.481 17.197  138.158 1.00   94.51  ? 60   ASP B CG    1 
ATOM   2267  O  OD1   . ASP B 1  60   ? -51.369 16.879  139.362 1.00   92.44  ? 60   ASP B OD1   1 
ATOM   2268  O  OD2   . ASP B 1  60   ? -52.175 18.161  137.772 1.00   84.66  ? 60   ASP B OD2   1 
ATOM   2269  N  N     . VAL B 1  61   ? -47.671 14.750  136.350 1.00   87.42  ? 61   VAL B N     1 
ATOM   2270  C  CA    . VAL B 1  61   ? -47.044 13.765  135.464 1.00   84.65  ? 61   VAL B CA    1 
ATOM   2271  C  C     . VAL B 1  61   ? -46.178 12.755  136.225 1.00   81.90  ? 61   VAL B C     1 
ATOM   2272  O  O     . VAL B 1  61   ? -45.314 13.124  137.024 1.00   81.01  ? 61   VAL B O     1 
ATOM   2273  C  CB    . VAL B 1  61   ? -46.248 14.416  134.303 1.00   82.77  ? 61   VAL B CB    1 
ATOM   2274  C  CG1   . VAL B 1  61   ? -47.160 15.309  133.476 1.00   81.34  ? 61   VAL B CG1   1 
ATOM   2275  C  CG2   . VAL B 1  61   ? -45.045 15.194  134.822 1.00   74.34  ? 61   VAL B CG2   1 
ATOM   2276  N  N     . LEU B 1  62   ? -46.431 11.474  135.980 1.00   77.68  ? 62   LEU B N     1 
ATOM   2277  C  CA    . LEU B 1  62   ? -45.738 10.409  136.699 1.00   85.12  ? 62   LEU B CA    1 
ATOM   2278  C  C     . LEU B 1  62   ? -44.318 10.173  136.194 1.00   85.24  ? 62   LEU B C     1 
ATOM   2279  O  O     . LEU B 1  62   ? -43.381 10.059  136.986 1.00   82.30  ? 62   LEU B O     1 
ATOM   2280  C  CB    . LEU B 1  62   ? -46.544 9.107   136.643 1.00   88.17  ? 62   LEU B CB    1 
ATOM   2281  C  CG    . LEU B 1  62   ? -47.391 8.782   137.876 1.00   81.38  ? 62   LEU B CG    1 
ATOM   2282  C  CD1   . LEU B 1  62   ? -48.380 7.663   137.578 1.00   67.23  ? 62   LEU B CD1   1 
ATOM   2283  C  CD2   . LEU B 1  62   ? -46.492 8.405   139.043 1.00   71.58  ? 62   LEU B CD2   1 
ATOM   2284  N  N     . HIS B 1  63   ? -44.163 10.096  134.875 1.00   87.07  ? 63   HIS B N     1 
ATOM   2285  C  CA    . HIS B 1  63   ? -42.862 9.800   134.285 1.00   85.63  ? 63   HIS B CA    1 
ATOM   2286  C  C     . HIS B 1  63   ? -42.588 10.551  132.980 1.00   77.66  ? 63   HIS B C     1 
ATOM   2287  O  O     . HIS B 1  63   ? -43.365 11.411  132.565 1.00   79.25  ? 63   HIS B O     1 
ATOM   2288  C  CB    . HIS B 1  63   ? -42.694 8.290   134.089 1.00   84.60  ? 63   HIS B CB    1 
ATOM   2289  C  CG    . HIS B 1  63   ? -43.784 7.660   133.281 1.00   85.45  ? 63   HIS B CG    1 
ATOM   2290  N  ND1   . HIS B 1  63   ? -43.700 7.500   131.914 1.00   79.85  ? 63   HIS B ND1   1 
ATOM   2291  C  CD2   . HIS B 1  63   ? -44.985 7.149   133.644 1.00   86.51  ? 63   HIS B CD2   1 
ATOM   2292  C  CE1   . HIS B 1  63   ? -44.799 6.917   131.472 1.00   82.14  ? 63   HIS B CE1   1 
ATOM   2293  N  NE2   . HIS B 1  63   ? -45.596 6.694   132.502 1.00   83.37  ? 63   HIS B NE2   1 
ATOM   2294  N  N     . GLU B 1  64   ? -41.474 10.209  132.341 1.00   76.05  ? 64   GLU B N     1 
ATOM   2295  C  CA    . GLU B 1  64   ? -40.978 10.935  131.175 1.00   80.76  ? 64   GLU B CA    1 
ATOM   2296  C  C     . GLU B 1  64   ? -41.792 10.690  129.904 1.00   81.60  ? 64   GLU B C     1 
ATOM   2297  O  O     . GLU B 1  64   ? -41.913 11.572  129.054 1.00   73.19  ? 64   GLU B O     1 
ATOM   2298  C  CB    . GLU B 1  64   ? -39.507 10.579  130.930 1.00   84.03  ? 64   GLU B CB    1 
ATOM   2299  C  CG    . GLU B 1  64   ? -38.869 11.285  129.742 1.00   81.25  ? 64   GLU B CG    1 
ATOM   2300  C  CD    . GLU B 1  64   ? -37.413 10.903  129.550 1.00   79.45  ? 64   GLU B CD    1 
ATOM   2301  O  OE1   . GLU B 1  64   ? -36.715 11.585  128.769 1.00   70.99  ? 64   GLU B OE1   1 
ATOM   2302  O  OE2   . GLU B 1  64   ? -36.967 9.920   130.179 1.00   82.18  ? 64   GLU B OE2   1 
ATOM   2303  N  N     . PHE B 1  65   ? -42.353 9.493   129.776 1.00   85.29  ? 65   PHE B N     1 
ATOM   2304  C  CA    . PHE B 1  65   ? -43.057 9.119   128.554 1.00   83.21  ? 65   PHE B CA    1 
ATOM   2305  C  C     . PHE B 1  65   ? -44.551 9.419   128.611 1.00   87.34  ? 65   PHE B C     1 
ATOM   2306  O  O     . PHE B 1  65   ? -45.294 9.086   127.688 1.00   76.66  ? 65   PHE B O     1 
ATOM   2307  C  CB    . PHE B 1  65   ? -42.811 7.647   128.222 1.00   87.98  ? 65   PHE B CB    1 
ATOM   2308  C  CG    . PHE B 1  65   ? -41.365 7.317   127.997 1.00   84.82  ? 65   PHE B CG    1 
ATOM   2309  C  CD1   . PHE B 1  65   ? -40.726 7.708   126.833 1.00   73.68  ? 65   PHE B CD1   1 
ATOM   2310  C  CD2   . PHE B 1  65   ? -40.642 6.620   128.952 1.00   92.77  ? 65   PHE B CD2   1 
ATOM   2311  C  CE1   . PHE B 1  65   ? -39.395 7.410   126.623 1.00   72.19  ? 65   PHE B CE1   1 
ATOM   2312  C  CE2   . PHE B 1  65   ? -39.309 6.318   128.747 1.00   88.19  ? 65   PHE B CE2   1 
ATOM   2313  C  CZ    . PHE B 1  65   ? -38.685 6.714   127.582 1.00   77.97  ? 65   PHE B CZ    1 
ATOM   2314  N  N     . SER B 1  66   ? -44.987 10.048  129.698 1.00   98.19  ? 66   SER B N     1 
ATOM   2315  C  CA    . SER B 1  66   ? -46.381 10.452  129.834 1.00   96.53  ? 66   SER B CA    1 
ATOM   2316  C  C     . SER B 1  66   ? -46.677 11.653  128.942 1.00   87.48  ? 66   SER B C     1 
ATOM   2317  O  O     . SER B 1  66   ? -45.795 12.160  128.247 1.00   75.85  ? 66   SER B O     1 
ATOM   2318  C  CB    . SER B 1  66   ? -46.709 10.791  131.292 1.00   91.66  ? 66   SER B CB    1 
ATOM   2319  O  OG    . SER B 1  66   ? -46.583 9.654   132.129 1.00   92.19  ? 66   SER B OG    1 
ATOM   2320  N  N     . THR B 1  67   ? -47.926 12.104  128.966 1.00   91.38  ? 67   THR B N     1 
ATOM   2321  C  CA    . THR B 1  67   ? -48.328 13.281  128.210 1.00   84.43  ? 67   THR B CA    1 
ATOM   2322  C  C     . THR B 1  67   ? -48.956 14.307  129.141 1.00   87.19  ? 67   THR B C     1 
ATOM   2323  O  O     . THR B 1  67   ? -49.406 13.970  130.236 1.00   98.63  ? 67   THR B O     1 
ATOM   2324  C  CB    . THR B 1  67   ? -49.330 12.930  127.098 1.00   78.80  ? 67   THR B CB    1 
ATOM   2325  O  OG1   . THR B 1  67   ? -49.749 14.131  126.438 1.00   77.29  ? 67   THR B OG1   1 
ATOM   2326  C  CG2   . THR B 1  67   ? -50.549 12.228  127.678 1.00   78.47  ? 67   THR B CG2   1 
ATOM   2327  N  N     . ILE B 1  68   ? -48.984 15.560  128.705 1.00   79.19  ? 68   ILE B N     1 
ATOM   2328  C  CA    . ILE B 1  68   ? -49.542 16.628  129.522 1.00   91.23  ? 68   ILE B CA    1 
ATOM   2329  C  C     . ILE B 1  68   ? -50.815 17.197  128.904 1.00   96.37  ? 68   ILE B C     1 
ATOM   2330  O  O     . ILE B 1  68   ? -50.777 17.768  127.815 1.00   94.78  ? 68   ILE B O     1 
ATOM   2331  C  CB    . ILE B 1  68   ? -48.529 17.765  129.736 1.00   91.99  ? 68   ILE B CB    1 
ATOM   2332  C  CG1   . ILE B 1  68   ? -47.197 17.202  130.236 1.00   92.39  ? 68   ILE B CG1   1 
ATOM   2333  C  CG2   . ILE B 1  68   ? -49.082 18.792  130.713 1.00   102.04 ? 68   ILE B CG2   1 
ATOM   2334  C  CD1   . ILE B 1  68   ? -46.155 18.259  130.522 1.00   89.78  ? 68   ILE B CD1   1 
ATOM   2335  N  N     . PRO B 1  69   ? -51.950 17.031  129.601 1.00   101.89 ? 69   PRO B N     1 
ATOM   2336  C  CA    . PRO B 1  69   ? -53.235 17.575  129.153 1.00   90.55  ? 69   PRO B CA    1 
ATOM   2337  C  C     . PRO B 1  69   ? -53.189 19.096  129.062 1.00   91.84  ? 69   PRO B C     1 
ATOM   2338  O  O     . PRO B 1  69   ? -52.735 19.756  129.998 1.00   95.77  ? 69   PRO B O     1 
ATOM   2339  C  CB    . PRO B 1  69   ? -54.202 17.148  130.263 1.00   96.92  ? 69   PRO B CB    1 
ATOM   2340  C  CG    . PRO B 1  69   ? -53.551 15.972  130.908 1.00   96.62  ? 69   PRO B CG    1 
ATOM   2341  C  CD    . PRO B 1  69   ? -52.083 16.254  130.846 1.00   102.78 ? 69   PRO B CD    1 
ATOM   2342  N  N     . GLY B 1  70   ? -53.649 19.643  127.941 1.00   88.36  ? 70   GLY B N     1 
ATOM   2343  C  CA    . GLY B 1  70   ? -53.672 21.082  127.752 1.00   94.64  ? 70   GLY B CA    1 
ATOM   2344  C  C     . GLY B 1  70   ? -52.415 21.616  127.094 1.00   92.48  ? 70   GLY B C     1 
ATOM   2345  O  O     . GLY B 1  70   ? -52.366 22.775  126.681 1.00   88.01  ? 70   GLY B O     1 
ATOM   2346  N  N     . VAL B 1  71   ? -51.395 20.769  126.999 1.00   97.57  ? 71   VAL B N     1 
ATOM   2347  C  CA    . VAL B 1  71   ? -50.140 21.139  126.352 1.00   94.57  ? 71   VAL B CA    1 
ATOM   2348  C  C     . VAL B 1  71   ? -49.920 20.265  125.118 1.00   85.21  ? 71   VAL B C     1 
ATOM   2349  O  O     . VAL B 1  71   ? -50.158 19.056  125.157 1.00   78.89  ? 71   VAL B O     1 
ATOM   2350  C  CB    . VAL B 1  71   ? -48.945 20.997  127.318 1.00   87.42  ? 71   VAL B CB    1 
ATOM   2351  C  CG1   . VAL B 1  71   ? -47.662 21.480  126.660 1.00   75.45  ? 71   VAL B CG1   1 
ATOM   2352  C  CG2   . VAL B 1  71   ? -49.209 21.771  128.602 1.00   84.78  ? 71   VAL B CG2   1 
ATOM   2353  N  N     . LYS B 1  72   ? -49.474 20.875  124.023 1.00   78.29  ? 72   LYS B N     1 
ATOM   2354  C  CA    . LYS B 1  72   ? -49.336 20.152  122.760 1.00   82.18  ? 72   LYS B CA    1 
ATOM   2355  C  C     . LYS B 1  72   ? -48.077 19.280  122.686 1.00   75.19  ? 72   LYS B C     1 
ATOM   2356  O  O     . LYS B 1  72   ? -48.096 18.212  122.074 1.00   69.22  ? 72   LYS B O     1 
ATOM   2357  C  CB    . LYS B 1  72   ? -49.415 21.107  121.561 1.00   84.44  ? 72   LYS B CB    1 
ATOM   2358  C  CG    . LYS B 1  72   ? -48.084 21.684  121.110 1.00   82.29  ? 72   LYS B CG    1 
ATOM   2359  C  CD    . LYS B 1  72   ? -47.868 21.458  119.624 1.00   79.98  ? 72   LYS B CD    1 
ATOM   2360  C  CE    . LYS B 1  72   ? -49.009 22.043  118.808 1.00   83.39  ? 72   LYS B CE    1 
ATOM   2361  N  NZ    . LYS B 1  72   ? -48.858 21.753  117.355 1.00   80.55  ? 72   LYS B NZ    1 
ATOM   2362  N  N     . GLU B 1  73   ? -46.989 19.732  123.302 1.00   69.97  ? 73   GLU B N     1 
ATOM   2363  C  CA    . GLU B 1  73   ? -45.762 18.946  123.336 1.00   61.19  ? 73   GLU B CA    1 
ATOM   2364  C  C     . GLU B 1  73   ? -45.864 17.886  124.422 1.00   66.96  ? 73   GLU B C     1 
ATOM   2365  O  O     . GLU B 1  73   ? -46.499 18.108  125.452 1.00   79.05  ? 73   GLU B O     1 
ATOM   2366  C  CB    . GLU B 1  73   ? -44.546 19.836  123.604 1.00   57.34  ? 73   GLU B CB    1 
ATOM   2367  C  CG    . GLU B 1  73   ? -44.308 20.922  122.568 1.00   61.32  ? 73   GLU B CG    1 
ATOM   2368  C  CD    . GLU B 1  73   ? -44.997 22.225  122.916 1.00   64.62  ? 73   GLU B CD    1 
ATOM   2369  O  OE1   . GLU B 1  73   ? -45.889 22.212  123.790 1.00   75.14  ? 73   GLU B OE1   1 
ATOM   2370  O  OE2   . GLU B 1  73   ? -44.640 23.264  122.321 1.00   58.72  ? 73   GLU B OE2   1 
ATOM   2371  N  N     . ASP B 1  74   ? -45.243 16.733  124.198 1.00   63.69  ? 74   ASP B N     1 
ATOM   2372  C  CA    . ASP B 1  74   ? -45.202 15.710  125.235 1.00   70.05  ? 74   ASP B CA    1 
ATOM   2373  C  C     . ASP B 1  74   ? -44.132 16.054  126.265 1.00   72.09  ? 74   ASP B C     1 
ATOM   2374  O  O     . ASP B 1  74   ? -43.418 17.047  126.120 1.00   64.34  ? 74   ASP B O     1 
ATOM   2375  C  CB    . ASP B 1  74   ? -44.971 14.313  124.641 1.00   67.03  ? 74   ASP B CB    1 
ATOM   2376  C  CG    . ASP B 1  74   ? -43.776 14.256  123.702 1.00   67.73  ? 74   ASP B CG    1 
ATOM   2377  O  OD1   . ASP B 1  74   ? -42.870 15.106  123.818 1.00   71.13  ? 74   ASP B OD1   1 
ATOM   2378  O  OD2   . ASP B 1  74   ? -43.741 13.347  122.846 1.00   59.14  ? 74   ASP B OD2   1 
ATOM   2379  N  N     . VAL B 1  75   ? -44.020 15.228  127.300 1.00   77.62  ? 75   VAL B N     1 
ATOM   2380  C  CA    . VAL B 1  75   ? -43.029 15.449  128.343 1.00   74.71  ? 75   VAL B CA    1 
ATOM   2381  C  C     . VAL B 1  75   ? -41.629 15.356  127.746 1.00   67.22  ? 75   VAL B C     1 
ATOM   2382  O  O     . VAL B 1  75   ? -40.718 16.081  128.148 1.00   63.78  ? 75   VAL B O     1 
ATOM   2383  C  CB    . VAL B 1  75   ? -43.189 14.431  129.491 1.00   75.90  ? 75   VAL B CB    1 
ATOM   2384  C  CG1   . VAL B 1  75   ? -42.148 14.669  130.574 1.00   75.70  ? 75   VAL B CG1   1 
ATOM   2385  C  CG2   . VAL B 1  75   ? -44.592 14.506  130.073 1.00   77.44  ? 75   VAL B CG2   1 
ATOM   2386  N  N     . VAL B 1  76   ? -41.478 14.476  126.762 1.00   67.23  ? 76   VAL B N     1 
ATOM   2387  C  CA    . VAL B 1  76   ? -40.199 14.266  126.095 1.00   65.41  ? 76   VAL B CA    1 
ATOM   2388  C  C     . VAL B 1  76   ? -39.706 15.526  125.386 1.00   57.26  ? 76   VAL B C     1 
ATOM   2389  O  O     . VAL B 1  76   ? -38.547 15.914  125.531 1.00   50.09  ? 76   VAL B O     1 
ATOM   2390  C  CB    . VAL B 1  76   ? -40.289 13.120  125.070 1.00   57.68  ? 76   VAL B CB    1 
ATOM   2391  C  CG1   . VAL B 1  76   ? -38.935 12.880  124.421 1.00   53.17  ? 76   VAL B CG1   1 
ATOM   2392  C  CG2   . VAL B 1  76   ? -40.799 11.853  125.739 1.00   62.04  ? 76   VAL B CG2   1 
ATOM   2393  N  N     . GLU B 1  77   ? -40.593 16.160  124.626 1.00   60.32  ? 77   GLU B N     1 
ATOM   2394  C  CA    . GLU B 1  77   ? -40.233 17.341  123.847 1.00   59.88  ? 77   GLU B CA    1 
ATOM   2395  C  C     . GLU B 1  77   ? -39.832 18.505  124.745 1.00   57.51  ? 77   GLU B C     1 
ATOM   2396  O  O     . GLU B 1  77   ? -38.906 19.252  124.429 1.00   52.00  ? 77   GLU B O     1 
ATOM   2397  C  CB    . GLU B 1  77   ? -41.387 17.756  122.930 1.00   61.83  ? 77   GLU B CB    1 
ATOM   2398  C  CG    . GLU B 1  77   ? -41.038 18.862  121.941 1.00   65.87  ? 77   GLU B CG    1 
ATOM   2399  C  CD    . GLU B 1  77   ? -40.100 18.397  120.839 1.00   69.18  ? 77   GLU B CD    1 
ATOM   2400  O  OE1   . GLU B 1  77   ? -39.465 19.259  120.195 1.00   64.79  ? 77   GLU B OE1   1 
ATOM   2401  O  OE2   . GLU B 1  77   ? -40.002 17.173  120.609 1.00   69.86  ? 77   GLU B OE2   1 
ATOM   2402  N  N     . ILE B 1  78   ? -40.532 18.652  125.866 1.00   62.35  ? 78   ILE B N     1 
ATOM   2403  C  CA    . ILE B 1  78   ? -40.251 19.732  126.807 1.00   65.80  ? 78   ILE B CA    1 
ATOM   2404  C  C     . ILE B 1  78   ? -38.875 19.564  127.447 1.00   60.21  ? 78   ILE B C     1 
ATOM   2405  O  O     . ILE B 1  78   ? -38.142 20.536  127.631 1.00   54.31  ? 78   ILE B O     1 
ATOM   2406  C  CB    . ILE B 1  78   ? -41.330 19.824  127.903 1.00   63.31  ? 78   ILE B CB    1 
ATOM   2407  C  CG1   . ILE B 1  78   ? -42.714 19.984  127.274 1.00   58.85  ? 78   ILE B CG1   1 
ATOM   2408  C  CG2   . ILE B 1  78   ? -41.041 20.985  128.837 1.00   59.91  ? 78   ILE B CG2   1 
ATOM   2409  C  CD1   . ILE B 1  78   ? -43.838 20.021  128.279 1.00   68.75  ? 78   ILE B CD1   1 
ATOM   2410  N  N     . ILE B 1  79   ? -38.531 18.323  127.779 1.00   59.32  ? 79   ILE B N     1 
ATOM   2411  C  CA    . ILE B 1  79   ? -37.216 18.004  128.325 1.00   56.71  ? 79   ILE B CA    1 
ATOM   2412  C  C     . ILE B 1  79   ? -36.110 18.367  127.334 1.00   59.06  ? 79   ILE B C     1 
ATOM   2413  O  O     . ILE B 1  79   ? -35.080 18.928  127.715 1.00   57.08  ? 79   ILE B O     1 
ATOM   2414  C  CB    . ILE B 1  79   ? -37.114 16.510  128.693 1.00   57.91  ? 79   ILE B CB    1 
ATOM   2415  C  CG1   . ILE B 1  79   ? -38.017 16.197  129.887 1.00   56.75  ? 79   ILE B CG1   1 
ATOM   2416  C  CG2   . ILE B 1  79   ? -35.679 16.126  129.007 1.00   58.42  ? 79   ILE B CG2   1 
ATOM   2417  C  CD1   . ILE B 1  79   ? -37.994 14.746  130.304 1.00   56.70  ? 79   ILE B CD1   1 
ATOM   2418  N  N     . LEU B 1  80   ? -36.339 18.052  126.062 1.00   62.24  ? 80   LEU B N     1 
ATOM   2419  C  CA    . LEU B 1  80   ? -35.386 18.358  124.997 1.00   53.43  ? 80   LEU B CA    1 
ATOM   2420  C  C     . LEU B 1  80   ? -35.095 19.853  124.909 1.00   54.06  ? 80   LEU B C     1 
ATOM   2421  O  O     . LEU B 1  80   ? -33.938 20.266  124.833 1.00   50.26  ? 80   LEU B O     1 
ATOM   2422  C  CB    . LEU B 1  80   ? -35.909 17.854  123.651 1.00   47.56  ? 80   LEU B CB    1 
ATOM   2423  C  CG    . LEU B 1  80   ? -36.005 16.340  123.469 1.00   50.04  ? 80   LEU B CG    1 
ATOM   2424  C  CD1   . LEU B 1  80   ? -36.522 16.001  122.080 1.00   49.65  ? 80   LEU B CD1   1 
ATOM   2425  C  CD2   . LEU B 1  80   ? -34.654 15.691  123.717 1.00   48.20  ? 80   LEU B CD2   1 
ATOM   2426  N  N     . ASN B 1  81   ? -36.152 20.657  124.919 1.00   57.73  ? 81   ASN B N     1 
ATOM   2427  C  CA    . ASN B 1  81   ? -36.012 22.106  124.866 1.00   54.10  ? 81   ASN B CA    1 
ATOM   2428  C  C     . ASN B 1  81   ? -35.273 22.637  126.084 1.00   54.62  ? 81   ASN B C     1 
ATOM   2429  O  O     . ASN B 1  81   ? -34.537 23.620  125.998 1.00   54.34  ? 81   ASN B O     1 
ATOM   2430  C  CB    . ASN B 1  81   ? -37.383 22.770  124.747 1.00   49.81  ? 81   ASN B CB    1 
ATOM   2431  C  CG    . ASN B 1  81   ? -38.117 22.363  123.486 1.00   54.50  ? 81   ASN B CG    1 
ATOM   2432  O  OD1   . ASN B 1  81   ? -39.226 21.834  123.544 1.00   60.52  ? 81   ASN B OD1   1 
ATOM   2433  N  ND2   . ASN B 1  81   ? -37.500 22.609  122.336 1.00   47.81  ? 81   ASN B ND2   1 
ATOM   2434  N  N     . LEU B 1  82   ? -35.470 21.973  127.218 1.00   54.70  ? 82   LEU B N     1 
ATOM   2435  C  CA    . LEU B 1  82   ? -34.797 22.349  128.454 1.00   58.17  ? 82   LEU B CA    1 
ATOM   2436  C  C     . LEU B 1  82   ? -33.312 22.007  128.404 1.00   60.42  ? 82   LEU B C     1 
ATOM   2437  O  O     . LEU B 1  82   ? -32.510 22.592  129.133 1.00   66.00  ? 82   LEU B O     1 
ATOM   2438  C  CB    . LEU B 1  82   ? -35.463 21.679  129.657 1.00   62.43  ? 82   LEU B CB    1 
ATOM   2439  C  CG    . LEU B 1  82   ? -36.831 22.248  130.036 1.00   62.81  ? 82   LEU B CG    1 
ATOM   2440  C  CD1   . LEU B 1  82   ? -37.488 21.409  131.117 1.00   64.65  ? 82   LEU B CD1   1 
ATOM   2441  C  CD2   . LEU B 1  82   ? -36.691 23.694  130.486 1.00   64.37  ? 82   LEU B CD2   1 
ATOM   2442  N  N     . LYS B 1  83   ? -32.948 21.059  127.544 1.00   51.41  ? 83   LYS B N     1 
ATOM   2443  C  CA    . LYS B 1  83   ? -31.544 20.720  127.346 1.00   47.17  ? 83   LYS B CA    1 
ATOM   2444  C  C     . LYS B 1  83   ? -30.823 21.857  126.634 1.00   53.64  ? 83   LYS B C     1 
ATOM   2445  O  O     . LYS B 1  83   ? -29.644 22.110  126.882 1.00   51.36  ? 83   LYS B O     1 
ATOM   2446  C  CB    . LYS B 1  83   ? -31.397 19.433  126.534 1.00   41.72  ? 83   LYS B CB    1 
ATOM   2447  C  CG    . LYS B 1  83   ? -31.790 18.165  127.264 1.00   41.03  ? 83   LYS B CG    1 
ATOM   2448  C  CD    . LYS B 1  83   ? -31.511 16.950  126.394 1.00   42.96  ? 83   LYS B CD    1 
ATOM   2449  C  CE    . LYS B 1  83   ? -31.866 15.654  127.100 1.00   53.98  ? 83   LYS B CE    1 
ATOM   2450  N  NZ    . LYS B 1  83   ? -31.594 14.467  126.240 1.00   46.99  ? 83   LYS B NZ    1 
ATOM   2451  N  N     . GLU B 1  84   ? -31.542 22.543  125.750 1.00   55.84  ? 84   GLU B N     1 
ATOM   2452  C  CA    . GLU B 1  84   ? -30.961 23.623  124.960 1.00   59.10  ? 84   GLU B CA    1 
ATOM   2453  C  C     . GLU B 1  84   ? -30.951 24.951  125.714 1.00   57.19  ? 84   GLU B C     1 
ATOM   2454  O  O     . GLU B 1  84   ? -30.459 25.957  125.203 1.00   58.07  ? 84   GLU B O     1 
ATOM   2455  C  CB    . GLU B 1  84   ? -31.703 23.777  123.630 1.00   62.22  ? 84   GLU B CB    1 
ATOM   2456  C  CG    . GLU B 1  84   ? -31.685 22.531  122.755 1.00   61.25  ? 84   GLU B CG    1 
ATOM   2457  C  CD    . GLU B 1  84   ? -32.252 22.782  121.369 1.00   60.58  ? 84   GLU B CD    1 
ATOM   2458  O  OE1   . GLU B 1  84   ? -32.371 23.963  120.979 1.00   57.71  ? 84   GLU B OE1   1 
ATOM   2459  O  OE2   . GLU B 1  84   ? -32.580 21.799  120.670 1.00   53.42  ? 84   GLU B OE2   1 
ATOM   2460  N  N     . LEU B 1  85   ? -31.498 24.950  126.925 1.00   56.09  ? 85   LEU B N     1 
ATOM   2461  C  CA    . LEU B 1  85   ? -31.506 26.147  127.756 1.00   53.03  ? 85   LEU B CA    1 
ATOM   2462  C  C     . LEU B 1  85   ? -30.086 26.509  128.174 1.00   54.35  ? 85   LEU B C     1 
ATOM   2463  O  O     . LEU B 1  85   ? -29.367 25.684  128.739 1.00   56.75  ? 85   LEU B O     1 
ATOM   2464  C  CB    . LEU B 1  85   ? -32.378 25.933  128.995 1.00   56.32  ? 85   LEU B CB    1 
ATOM   2465  C  CG    . LEU B 1  85   ? -32.465 27.098  129.983 1.00   60.39  ? 85   LEU B CG    1 
ATOM   2466  C  CD1   . LEU B 1  85   ? -33.162 28.293  129.349 1.00   62.59  ? 85   LEU B CD1   1 
ATOM   2467  C  CD2   . LEU B 1  85   ? -33.173 26.673  131.261 1.00   59.82  ? 85   LEU B CD2   1 
ATOM   2468  N  N     . VAL B 1  86   ? -29.687 27.745  127.897 1.00   54.11  ? 86   VAL B N     1 
ATOM   2469  C  CA    . VAL B 1  86   ? -28.348 28.203  128.244 1.00   57.77  ? 86   VAL B CA    1 
ATOM   2470  C  C     . VAL B 1  86   ? -28.390 29.097  129.476 1.00   63.21  ? 86   VAL B C     1 
ATOM   2471  O  O     . VAL B 1  86   ? -28.866 30.230  129.417 1.00   72.35  ? 86   VAL B O     1 
ATOM   2472  C  CB    . VAL B 1  86   ? -27.695 28.971  127.082 1.00   53.99  ? 86   VAL B CB    1 
ATOM   2473  C  CG1   . VAL B 1  86   ? -26.278 29.378  127.447 1.00   59.29  ? 86   VAL B CG1   1 
ATOM   2474  C  CG2   . VAL B 1  86   ? -27.697 28.122  125.823 1.00   56.45  ? 86   VAL B CG2   1 
ATOM   2475  N  N     . VAL B 1  87   ? -27.878 28.581  130.588 1.00   61.65  ? 87   VAL B N     1 
ATOM   2476  C  CA    . VAL B 1  87   ? -27.880 29.311  131.849 1.00   62.86  ? 87   VAL B CA    1 
ATOM   2477  C  C     . VAL B 1  87   ? -26.454 29.672  132.248 1.00   62.97  ? 87   VAL B C     1 
ATOM   2478  O  O     . VAL B 1  87   ? -25.534 28.870  132.098 1.00   67.17  ? 87   VAL B O     1 
ATOM   2479  C  CB    . VAL B 1  87   ? -28.559 28.490  132.968 1.00   64.14  ? 87   VAL B CB    1 
ATOM   2480  C  CG1   . VAL B 1  87   ? -28.471 29.213  134.304 1.00   70.62  ? 87   VAL B CG1   1 
ATOM   2481  C  CG2   . VAL B 1  87   ? -30.011 28.208  132.608 1.00   57.52  ? 87   VAL B CG2   1 
ATOM   2482  N  N     . ARG B 1  88   ? -26.273 30.889  132.746 1.00   65.00  ? 88   ARG B N     1 
ATOM   2483  C  CA    . ARG B 1  88   ? -24.954 31.371  133.120 1.00   70.34  ? 88   ARG B CA    1 
ATOM   2484  C  C     . ARG B 1  88   ? -24.941 31.839  134.574 1.00   81.06  ? 88   ARG B C     1 
ATOM   2485  O  O     . ARG B 1  88   ? -25.785 32.636  134.986 1.00   81.55  ? 88   ARG B O     1 
ATOM   2486  C  CB    . ARG B 1  88   ? -24.542 32.507  132.185 1.00   68.65  ? 88   ARG B CB    1 
ATOM   2487  C  CG    . ARG B 1  88   ? -23.137 33.029  132.393 1.00   72.92  ? 88   ARG B CG    1 
ATOM   2488  C  CD    . ARG B 1  88   ? -22.845 34.140  131.403 1.00   64.87  ? 88   ARG B CD    1 
ATOM   2489  N  NE    . ARG B 1  88   ? -21.562 34.785  131.654 1.00   66.08  ? 88   ARG B NE    1 
ATOM   2490  C  CZ    . ARG B 1  88   ? -21.118 35.841  130.981 1.00   71.01  ? 88   ARG B CZ    1 
ATOM   2491  N  NH1   . ARG B 1  88   ? -21.858 36.369  130.015 1.00   67.39  ? 88   ARG B NH1   1 
ATOM   2492  N  NH2   . ARG B 1  88   ? -19.938 36.369  131.273 1.00   76.75  ? 88   ARG B NH2   1 
ATOM   2493  N  N     . PHE B 1  89   ? -23.983 31.337  135.350 1.00   80.19  ? 89   PHE B N     1 
ATOM   2494  C  CA    . PHE B 1  89   ? -23.869 31.712  136.755 1.00   77.60  ? 89   PHE B CA    1 
ATOM   2495  C  C     . PHE B 1  89   ? -22.921 32.895  136.908 1.00   81.19  ? 89   PHE B C     1 
ATOM   2496  O  O     . PHE B 1  89   ? -21.725 32.779  136.643 1.00   78.52  ? 89   PHE B O     1 
ATOM   2497  C  CB    . PHE B 1  89   ? -23.370 30.537  137.602 1.00   69.64  ? 89   PHE B CB    1 
ATOM   2498  C  CG    . PHE B 1  89   ? -24.335 29.384  137.683 1.00   72.03  ? 89   PHE B CG    1 
ATOM   2499  C  CD1   . PHE B 1  89   ? -25.647 29.520  137.257 1.00   73.12  ? 89   PHE B CD1   1 
ATOM   2500  C  CD2   . PHE B 1  89   ? -23.927 28.162  138.196 1.00   71.65  ? 89   PHE B CD2   1 
ATOM   2501  C  CE1   . PHE B 1  89   ? -26.531 28.456  137.332 1.00   68.49  ? 89   PHE B CE1   1 
ATOM   2502  C  CE2   . PHE B 1  89   ? -24.806 27.096  138.275 1.00   66.76  ? 89   PHE B CE2   1 
ATOM   2503  C  CZ    . PHE B 1  89   ? -26.110 27.244  137.844 1.00   62.48  ? 89   PHE B CZ    1 
ATOM   2504  N  N     . LEU B 1  90   ? -23.463 34.031  137.336 1.00   83.27  ? 90   LEU B N     1 
ATOM   2505  C  CA    . LEU B 1  90   ? -22.668 35.241  137.503 1.00   82.51  ? 90   LEU B CA    1 
ATOM   2506  C  C     . LEU B 1  90   ? -21.729 35.114  138.694 1.00   79.30  ? 90   LEU B C     1 
ATOM   2507  O  O     . LEU B 1  90   ? -20.631 35.667  138.694 1.00   79.64  ? 90   LEU B O     1 
ATOM   2508  C  CB    . LEU B 1  90   ? -23.566 36.471  137.672 1.00   85.40  ? 90   LEU B CB    1 
ATOM   2509  C  CG    . LEU B 1  90   ? -24.358 36.954  136.453 1.00   84.69  ? 90   LEU B CG    1 
ATOM   2510  C  CD1   . LEU B 1  90   ? -23.490 36.922  135.202 1.00   73.93  ? 90   LEU B CD1   1 
ATOM   2511  C  CD2   . LEU B 1  90   ? -25.619 36.132  136.249 1.00   80.01  ? 90   LEU B CD2   1 
ATOM   2512  N  N     . ASN B 1  91   ? -22.167 34.380  139.711 1.00   83.24  ? 91   ASN B N     1 
ATOM   2513  C  CA    . ASN B 1  91   ? -21.346 34.163  140.893 1.00   88.42  ? 91   ASN B CA    1 
ATOM   2514  C  C     . ASN B 1  91   ? -20.602 32.837  140.819 1.00   86.12  ? 91   ASN B C     1 
ATOM   2515  O  O     . ASN B 1  91   ? -21.218 31.779  140.706 1.00   85.70  ? 91   ASN B O     1 
ATOM   2516  C  CB    . ASN B 1  91   ? -22.193 34.224  142.167 1.00   92.18  ? 91   ASN B CB    1 
ATOM   2517  C  CG    . ASN B 1  91   ? -21.353 34.414  143.419 1.00   94.60  ? 91   ASN B CG    1 
ATOM   2518  O  OD1   . ASN B 1  91   ? -20.261 33.861  143.541 1.00   97.15  ? 91   ASN B OD1   1 
ATOM   2519  N  ND2   . ASN B 1  91   ? -21.857 35.210  144.353 1.00   97.64  ? 91   ASN B ND2   1 
ATOM   2520  N  N     . PRO B 1  92   ? -19.263 32.895  140.886 1.00   88.09  ? 92   PRO B N     1 
ATOM   2521  C  CA    . PRO B 1  92   ? -18.411 31.701  140.853 1.00   90.00  ? 92   PRO B CA    1 
ATOM   2522  C  C     . PRO B 1  92   ? -18.623 30.794  142.063 1.00   85.68  ? 92   PRO B C     1 
ATOM   2523  O  O     . PRO B 1  92   ? -18.211 29.636  142.033 1.00   87.05  ? 92   PRO B O     1 
ATOM   2524  C  CB    . PRO B 1  92   ? -16.991 32.283  140.867 1.00   94.70  ? 92   PRO B CB    1 
ATOM   2525  C  CG    . PRO B 1  92   ? -17.144 33.644  141.457 1.00   91.62  ? 92   PRO B CG    1 
ATOM   2526  C  CD    . PRO B 1  92   ? -18.471 34.132  140.974 1.00   88.93  ? 92   PRO B CD    1 
ATOM   2527  N  N     . SER B 1  93   ? -19.254 31.315  143.111 1.00   87.49  ? 93   SER B N     1 
ATOM   2528  C  CA    . SER B 1  93   ? -19.524 30.529  144.310 1.00   91.80  ? 93   SER B CA    1 
ATOM   2529  C  C     . SER B 1  93   ? -20.695 29.571  144.101 1.00   87.84  ? 93   SER B C     1 
ATOM   2530  O  O     . SER B 1  93   ? -20.723 28.475  144.666 1.00   77.40  ? 93   SER B O     1 
ATOM   2531  C  CB    . SER B 1  93   ? -19.820 31.448  145.498 1.00   91.29  ? 93   SER B CB    1 
ATOM   2532  O  OG    . SER B 1  93   ? -18.786 32.397  145.689 1.00   94.33  ? 93   SER B OG    1 
ATOM   2533  N  N     . LEU B 1  94   ? -21.654 29.987  143.279 1.00   84.57  ? 94   LEU B N     1 
ATOM   2534  C  CA    . LEU B 1  94   ? -22.905 29.253  143.127 1.00   78.26  ? 94   LEU B CA    1 
ATOM   2535  C  C     . LEU B 1  94   ? -22.723 27.927  142.393 1.00   68.70  ? 94   LEU B C     1 
ATOM   2536  O  O     . LEU B 1  94   ? -22.301 27.896  141.238 1.00   71.00  ? 94   LEU B O     1 
ATOM   2537  C  CB    . LEU B 1  94   ? -23.908 30.137  142.380 1.00   77.84  ? 94   LEU B CB    1 
ATOM   2538  C  CG    . LEU B 1  94   ? -25.123 29.510  141.698 1.00   75.02  ? 94   LEU B CG    1 
ATOM   2539  C  CD1   . LEU B 1  94   ? -26.003 28.790  142.702 1.00   76.29  ? 94   LEU B CD1   1 
ATOM   2540  C  CD2   . LEU B 1  94   ? -25.907 30.588  140.965 1.00   71.56  ? 94   LEU B CD2   1 
ATOM   2541  N  N     . GLN B 1  95   ? -23.048 26.833  143.078 1.00   65.98  ? 95   GLN B N     1 
ATOM   2542  C  CA    . GLN B 1  95   ? -23.009 25.498  142.484 1.00   69.29  ? 95   GLN B CA    1 
ATOM   2543  C  C     . GLN B 1  95   ? -24.274 25.092  141.724 1.00   66.17  ? 95   GLN B C     1 
ATOM   2544  O  O     . GLN B 1  95   ? -24.195 24.521  140.637 1.00   67.08  ? 95   GLN B O     1 
ATOM   2545  C  CB    . GLN B 1  95   ? -22.674 24.448  143.546 1.00   68.09  ? 95   GLN B CB    1 
ATOM   2546  C  CG    . GLN B 1  95   ? -21.245 24.513  144.060 1.00   65.79  ? 95   GLN B CG    1 
ATOM   2547  C  CD    . GLN B 1  95   ? -20.249 23.923  143.083 1.00   82.36  ? 95   GLN B CD    1 
ATOM   2548  O  OE1   . GLN B 1  95   ? -19.793 24.597  142.159 1.00   88.97  ? 95   GLN B OE1   1 
ATOM   2549  N  NE2   . GLN B 1  95   ? -19.908 22.655  143.282 1.00   88.76  ? 95   GLN B NE2   1 
ATOM   2550  N  N     . THR B 1  96   ? -25.438 25.377  142.303 1.00   65.55  ? 96   THR B N     1 
ATOM   2551  C  CA    . THR B 1  96   ? -26.698 24.878  141.752 1.00   63.51  ? 96   THR B CA    1 
ATOM   2552  C  C     . THR B 1  96   ? -27.909 25.762  142.049 1.00   60.99  ? 96   THR B C     1 
ATOM   2553  O  O     . THR B 1  96   ? -27.991 26.391  143.103 1.00   62.77  ? 96   THR B O     1 
ATOM   2554  C  CB    . THR B 1  96   ? -26.998 23.449  142.251 1.00   61.66  ? 96   THR B CB    1 
ATOM   2555  O  OG1   . THR B 1  96   ? -28.318 23.067  141.846 1.00   58.81  ? 96   THR B OG1   1 
ATOM   2556  C  CG2   . THR B 1  96   ? -26.901 23.380  143.767 1.00   64.89  ? 96   THR B CG2   1 
ATOM   2557  N  N     . VAL B 1  97   ? -28.853 25.789  141.110 1.00   62.49  ? 97   VAL B N     1 
ATOM   2558  C  CA    . VAL B 1  97   ? -30.078 26.573  141.251 1.00   61.13  ? 97   VAL B CA    1 
ATOM   2559  C  C     . VAL B 1  97   ? -31.302 25.730  140.900 1.00   64.16  ? 97   VAL B C     1 
ATOM   2560  O  O     . VAL B 1  97   ? -31.219 24.809  140.087 1.00   57.68  ? 97   VAL B O     1 
ATOM   2561  C  CB    . VAL B 1  97   ? -30.079 27.810  140.323 1.00   58.31  ? 97   VAL B CB    1 
ATOM   2562  C  CG1   . VAL B 1  97   ? -31.086 28.843  140.809 1.00   67.82  ? 97   VAL B CG1   1 
ATOM   2563  C  CG2   . VAL B 1  97   ? -28.698 28.427  140.241 1.00   60.15  ? 97   VAL B CG2   1 
ATOM   2564  N  N     . THR B 1  98   ? -32.434 26.048  141.521 1.00   76.71  ? 98   THR B N     1 
ATOM   2565  C  CA    . THR B 1  98   ? -33.711 25.447  141.155 1.00   75.97  ? 98   THR B CA    1 
ATOM   2566  C  C     . THR B 1  98   ? -34.631 26.519  140.578 1.00   74.49  ? 98   THR B C     1 
ATOM   2567  O  O     . THR B 1  98   ? -35.008 27.464  141.270 1.00   74.60  ? 98   THR B O     1 
ATOM   2568  C  CB    . THR B 1  98   ? -34.397 24.773  142.360 1.00   73.48  ? 98   THR B CB    1 
ATOM   2569  O  OG1   . THR B 1  98   ? -33.615 23.654  142.795 1.00   79.68  ? 98   THR B OG1   1 
ATOM   2570  C  CG2   . THR B 1  98   ? -35.788 24.289  141.980 1.00   71.05  ? 98   THR B CG2   1 
ATOM   2571  N  N     . LEU B 1  99   ? -34.981 26.371  139.304 1.00   78.64  ? 99   LEU B N     1 
ATOM   2572  C  CA    . LEU B 1  99   ? -35.802 27.359  138.612 1.00   72.17  ? 99   LEU B CA    1 
ATOM   2573  C  C     . LEU B 1  99   ? -37.257 26.914  138.530 1.00   73.50  ? 99   LEU B C     1 
ATOM   2574  O  O     . LEU B 1  99   ? -37.554 25.810  138.072 1.00   67.95  ? 99   LEU B O     1 
ATOM   2575  C  CB    . LEU B 1  99   ? -35.261 27.626  137.205 1.00   67.76  ? 99   LEU B CB    1 
ATOM   2576  C  CG    . LEU B 1  99   ? -34.072 28.575  137.029 1.00   69.38  ? 99   LEU B CG    1 
ATOM   2577  C  CD1   . LEU B 1  99   ? -32.809 28.040  137.691 1.00   65.43  ? 99   LEU B CD1   1 
ATOM   2578  C  CD2   . LEU B 1  99   ? -33.830 28.838  135.549 1.00   60.77  ? 99   LEU B CD2   1 
ATOM   2579  N  N     . LEU B 1  100  ? -38.162 27.781  138.971 1.00   81.73  ? 100  LEU B N     1 
ATOM   2580  C  CA    . LEU B 1  100  ? -39.585 27.468  138.959 1.00   86.12  ? 100  LEU B CA    1 
ATOM   2581  C  C     . LEU B 1  100  ? -40.292 28.163  137.800 1.00   76.66  ? 100  LEU B C     1 
ATOM   2582  O  O     . LEU B 1  100  ? -39.958 29.294  137.443 1.00   67.52  ? 100  LEU B O     1 
ATOM   2583  C  CB    . LEU B 1  100  ? -40.245 27.861  140.287 1.00   92.57  ? 100  LEU B CB    1 
ATOM   2584  C  CG    . LEU B 1  100  ? -39.753 27.195  141.578 1.00   90.17  ? 100  LEU B CG    1 
ATOM   2585  C  CD1   . LEU B 1  100  ? -38.606 27.980  142.206 1.00   83.88  ? 100  LEU B CD1   1 
ATOM   2586  C  CD2   . LEU B 1  100  ? -40.897 27.018  142.571 1.00   79.14  ? 100  LEU B CD2   1 
ATOM   2587  N  N     . LEU B 1  101  ? -41.259 27.471  137.206 1.00   78.03  ? 101  LEU B N     1 
ATOM   2588  C  CA    . LEU B 1  101  ? -42.086 28.062  136.161 1.00   82.50  ? 101  LEU B CA    1 
ATOM   2589  C  C     . LEU B 1  101  ? -43.555 27.674  136.314 1.00   86.91  ? 101  LEU B C     1 
ATOM   2590  O  O     . LEU B 1  101  ? -43.898 26.491  136.339 1.00   80.92  ? 101  LEU B O     1 
ATOM   2591  C  CB    . LEU B 1  101  ? -41.573 27.669  134.776 1.00   82.23  ? 101  LEU B CB    1 
ATOM   2592  C  CG    . LEU B 1  101  ? -42.264 28.350  133.594 1.00   84.58  ? 101  LEU B CG    1 
ATOM   2593  C  CD1   . LEU B 1  101  ? -41.229 28.899  132.628 1.00   79.36  ? 101  LEU B CD1   1 
ATOM   2594  C  CD2   . LEU B 1  101  ? -43.209 27.387  132.886 1.00   79.10  ? 101  LEU B CD2   1 
ATOM   2595  N  N     . LYS B 1  102  ? -44.418 28.682  136.409 1.00   87.46  ? 102  LYS B N     1 
ATOM   2596  C  CA    . LYS B 1  102  ? -45.855 28.462  136.521 1.00   83.11  ? 102  LYS B CA    1 
ATOM   2597  C  C     . LYS B 1  102  ? -46.589 29.325  135.503 1.00   75.46  ? 102  LYS B C     1 
ATOM   2598  O  O     . LYS B 1  102  ? -46.512 30.552  135.548 1.00   71.74  ? 102  LYS B O     1 
ATOM   2599  C  CB    . LYS B 1  102  ? -46.347 28.796  137.933 1.00   86.68  ? 102  LYS B CB    1 
ATOM   2600  C  CG    . LYS B 1  102  ? -45.685 27.991  139.043 1.00   94.07  ? 102  LYS B CG    1 
ATOM   2601  C  CD    . LYS B 1  102  ? -46.162 28.444  140.419 1.00   95.65  ? 102  LYS B CD    1 
ATOM   2602  C  CE    . LYS B 1  102  ? -45.448 27.691  141.534 1.00   83.27  ? 102  LYS B CE    1 
ATOM   2603  N  NZ    . LYS B 1  102  ? -45.881 28.146  142.886 1.00   55.80  ? 102  LYS B NZ    1 
ATOM   2604  N  N     . ALA B 1  103  ? -47.293 28.678  134.581 1.00   76.39  ? 103  ALA B N     1 
ATOM   2605  C  CA    . ALA B 1  103  ? -48.066 29.391  133.571 1.00   75.07  ? 103  ALA B CA    1 
ATOM   2606  C  C     . ALA B 1  103  ? -49.246 28.552  133.097 1.00   80.59  ? 103  ALA B C     1 
ATOM   2607  O  O     . ALA B 1  103  ? -49.217 27.323  133.172 1.00   82.02  ? 103  ALA B O     1 
ATOM   2608  C  CB    . ALA B 1  103  ? -47.180 29.777  132.398 1.00   75.22  ? 103  ALA B CB    1 
ATOM   2609  N  N     . GLU B 1  104  ? -50.284 29.221  132.608 1.00   85.31  ? 104  GLU B N     1 
ATOM   2610  C  CA    . GLU B 1  104  ? -51.474 28.531  132.126 1.00   97.39  ? 104  GLU B CA    1 
ATOM   2611  C  C     . GLU B 1  104  ? -52.153 29.302  130.998 1.00   101.39 ? 104  GLU B C     1 
ATOM   2612  O  O     . GLU B 1  104  ? -51.614 30.289  130.494 1.00   94.65  ? 104  GLU B O     1 
ATOM   2613  C  CB    . GLU B 1  104  ? -52.460 28.290  133.274 1.00   106.11 ? 104  GLU B CB    1 
ATOM   2614  C  CG    . GLU B 1  104  ? -52.954 29.558  133.955 1.00   106.58 ? 104  GLU B CG    1 
ATOM   2615  C  CD    . GLU B 1  104  ? -53.996 29.281  135.022 1.00   98.04  ? 104  GLU B CD    1 
ATOM   2616  O  OE1   . GLU B 1  104  ? -54.411 30.237  135.711 1.00   105.03 ? 104  GLU B OE1   1 
ATOM   2617  O  OE2   . GLU B 1  104  ? -54.402 28.109  135.172 1.00   90.38  ? 104  GLU B OE2   1 
ATOM   2618  N  N     . GLY B 1  105  ? -53.336 28.839  130.602 1.00   99.15  ? 105  GLY B N     1 
ATOM   2619  C  CA    . GLY B 1  105  ? -54.112 29.498  129.568 1.00   94.10  ? 105  GLY B CA    1 
ATOM   2620  C  C     . GLY B 1  105  ? -53.463 29.430  128.200 1.00   92.48  ? 105  GLY B C     1 
ATOM   2621  O  O     . GLY B 1  105  ? -52.464 28.737  128.018 1.00   96.69  ? 105  GLY B O     1 
ATOM   2622  N  N     . PRO B 1  106  ? -54.029 30.158  127.226 1.00   96.36  ? 106  PRO B N     1 
ATOM   2623  C  CA    . PRO B 1  106  ? -53.525 30.193  125.848 1.00   100.64 ? 106  PRO B CA    1 
ATOM   2624  C  C     . PRO B 1  106  ? -52.253 31.032  125.720 1.00   102.11 ? 106  PRO B C     1 
ATOM   2625  O  O     . PRO B 1  106  ? -52.310 32.193  125.312 1.00   96.73  ? 106  PRO B O     1 
ATOM   2626  C  CB    . PRO B 1  106  ? -54.674 30.845  125.077 1.00   100.66 ? 106  PRO B CB    1 
ATOM   2627  C  CG    . PRO B 1  106  ? -55.360 31.700  126.086 1.00   109.05 ? 106  PRO B CG    1 
ATOM   2628  C  CD    . PRO B 1  106  ? -55.253 30.964  127.391 1.00   98.46  ? 106  PRO B CD    1 
ATOM   2629  N  N     . LYS B 1  107  ? -51.115 30.437  126.063 1.00   97.98  ? 107  LYS B N     1 
ATOM   2630  C  CA    . LYS B 1  107  ? -49.844 31.152  126.067 1.00   92.68  ? 107  LYS B CA    1 
ATOM   2631  C  C     . LYS B 1  107  ? -48.704 30.242  125.611 1.00   89.15  ? 107  LYS B C     1 
ATOM   2632  O  O     . LYS B 1  107  ? -48.740 29.030  125.831 1.00   86.76  ? 107  LYS B O     1 
ATOM   2633  C  CB    . LYS B 1  107  ? -49.562 31.694  127.472 1.00   96.27  ? 107  LYS B CB    1 
ATOM   2634  C  CG    . LYS B 1  107  ? -48.337 32.586  127.585 1.00   86.94  ? 107  LYS B CG    1 
ATOM   2635  C  CD    . LYS B 1  107  ? -48.096 32.990  129.029 1.00   88.27  ? 107  LYS B CD    1 
ATOM   2636  C  CE    . LYS B 1  107  ? -46.867 33.870  129.163 1.00   89.92  ? 107  LYS B CE    1 
ATOM   2637  N  NZ    . LYS B 1  107  ? -46.623 34.257  130.580 1.00   97.70  ? 107  LYS B NZ    1 
ATOM   2638  N  N     . GLU B 1  108  ? -47.699 30.829  124.966 1.00   87.61  ? 108  GLU B N     1 
ATOM   2639  C  CA    . GLU B 1  108  ? -46.505 30.088  124.570 1.00   82.66  ? 108  GLU B CA    1 
ATOM   2640  C  C     . GLU B 1  108  ? -45.347 30.415  125.503 1.00   90.56  ? 108  GLU B C     1 
ATOM   2641  O  O     . GLU B 1  108  ? -44.815 31.526  125.483 1.00   90.51  ? 108  GLU B O     1 
ATOM   2642  C  CB    . GLU B 1  108  ? -46.119 30.414  123.128 1.00   75.13  ? 108  GLU B CB    1 
ATOM   2643  C  CG    . GLU B 1  108  ? -47.170 30.028  122.106 1.00   79.41  ? 108  GLU B CG    1 
ATOM   2644  C  CD    . GLU B 1  108  ? -46.693 30.221  120.681 1.00   75.58  ? 108  GLU B CD    1 
ATOM   2645  O  OE1   . GLU B 1  108  ? -45.521 30.611  120.492 1.00   73.70  ? 108  GLU B OE1   1 
ATOM   2646  O  OE2   . GLU B 1  108  ? -47.489 29.980  119.751 1.00   75.93  ? 108  GLU B OE2   1 
ATOM   2647  N  N     . VAL B 1  109  ? -44.953 29.436  126.311 1.00   87.21  ? 109  VAL B N     1 
ATOM   2648  C  CA    . VAL B 1  109  ? -43.935 29.647  127.333 1.00   80.89  ? 109  VAL B CA    1 
ATOM   2649  C  C     . VAL B 1  109  ? -42.530 29.771  126.745 1.00   70.28  ? 109  VAL B C     1 
ATOM   2650  O  O     . VAL B 1  109  ? -42.087 28.910  125.988 1.00   62.65  ? 109  VAL B O     1 
ATOM   2651  C  CB    . VAL B 1  109  ? -43.961 28.520  128.384 1.00   80.64  ? 109  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B 1  109  ? -42.868 28.734  129.413 1.00   76.44  ? 109  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B 1  109  ? -45.326 28.457  129.055 1.00   78.32  ? 109  VAL B CG2   1 
ATOM   2654  N  N     . LYS B 1  110  ? -41.840 30.853  127.095 1.00   76.81  ? 110  LYS B N     1 
ATOM   2655  C  CA    . LYS B 1  110  ? -40.460 31.058  126.667 1.00   77.62  ? 110  LYS B CA    1 
ATOM   2656  C  C     . LYS B 1  110  ? -39.545 30.984  127.883 1.00   77.01  ? 110  LYS B C     1 
ATOM   2657  O  O     . LYS B 1  110  ? -40.019 30.815  129.006 1.00   92.93  ? 110  LYS B O     1 
ATOM   2658  C  CB    . LYS B 1  110  ? -40.305 32.408  125.958 1.00   88.55  ? 110  LYS B CB    1 
ATOM   2659  C  CG    . LYS B 1  110  ? -41.038 32.501  124.622 1.00   91.76  ? 110  LYS B CG    1 
ATOM   2660  C  CD    . LYS B 1  110  ? -40.462 31.526  123.599 1.00   88.85  ? 110  LYS B CD    1 
ATOM   2661  C  CE    . LYS B 1  110  ? -41.181 31.620  122.258 1.00   85.10  ? 110  LYS B CE    1 
ATOM   2662  N  NZ    . LYS B 1  110  ? -42.640 31.335  122.375 1.00   89.21  ? 110  LYS B NZ    1 
ATOM   2663  N  N     . ALA B 1  111  ? -38.239 31.103  127.666 1.00   66.55  ? 111  ALA B N     1 
ATOM   2664  C  CA    . ALA B 1  111  ? -37.280 31.015  128.765 1.00   73.94  ? 111  ALA B CA    1 
ATOM   2665  C  C     . ALA B 1  111  ? -37.344 32.259  129.644 1.00   88.97  ? 111  ALA B C     1 
ATOM   2666  O  O     . ALA B 1  111  ? -36.854 32.267  130.774 1.00   92.78  ? 111  ALA B O     1 
ATOM   2667  C  CB    . ALA B 1  111  ? -35.876 30.808  128.233 1.00   71.21  ? 111  ALA B CB    1 
ATOM   2668  N  N     . ARG B 1  112  ? -37.955 33.307  129.105 1.00   87.82  ? 112  ARG B N     1 
ATOM   2669  C  CA    . ARG B 1  112  ? -38.167 34.551  129.826 1.00   91.19  ? 112  ARG B CA    1 
ATOM   2670  C  C     . ARG B 1  112  ? -39.087 34.316  131.019 1.00   87.73  ? 112  ARG B C     1 
ATOM   2671  O  O     . ARG B 1  112  ? -38.943 34.951  132.064 1.00   85.03  ? 112  ARG B O     1 
ATOM   2672  C  CB    . ARG B 1  112  ? -38.807 35.570  128.886 1.00   88.60  ? 112  ARG B CB    1 
ATOM   2673  C  CG    . ARG B 1  112  ? -38.436 37.012  129.157 1.00   89.52  ? 112  ARG B CG    1 
ATOM   2674  C  CD    . ARG B 1  112  ? -39.161 37.932  128.188 1.00   95.71  ? 112  ARG B CD    1 
ATOM   2675  N  NE    . ARG B 1  112  ? -39.479 37.256  126.931 1.00   97.46  ? 112  ARG B NE    1 
ATOM   2676  C  CZ    . ARG B 1  112  ? -38.683 37.230  125.867 1.00   95.55  ? 112  ARG B CZ    1 
ATOM   2677  N  NH1   . ARG B 1  112  ? -37.507 37.844  125.898 1.00   94.19  ? 112  ARG B NH1   1 
ATOM   2678  N  NH2   . ARG B 1  112  ? -39.063 36.588  124.770 1.00   81.88  ? 112  ARG B NH2   1 
ATOM   2679  N  N     . ASP B 1  113  ? -40.026 33.388  130.852 1.00   83.91  ? 113  ASP B N     1 
ATOM   2680  C  CA    . ASP B 1  113  ? -41.074 33.142  131.840 1.00   83.93  ? 113  ASP B CA    1 
ATOM   2681  C  C     . ASP B 1  113  ? -40.556 32.578  133.161 1.00   86.57  ? 113  ASP B C     1 
ATOM   2682  O  O     . ASP B 1  113  ? -41.267 32.591  134.166 1.00   93.65  ? 113  ASP B O     1 
ATOM   2683  C  CB    . ASP B 1  113  ? -42.143 32.215  131.257 1.00   85.27  ? 113  ASP B CB    1 
ATOM   2684  C  CG    . ASP B 1  113  ? -42.773 32.774  129.995 1.00   89.86  ? 113  ASP B CG    1 
ATOM   2685  O  OD1   . ASP B 1  113  ? -43.918 32.388  129.678 1.00   94.50  ? 113  ASP B OD1   1 
ATOM   2686  O  OD2   . ASP B 1  113  ? -42.124 33.602  129.321 1.00   82.31  ? 113  ASP B OD2   1 
ATOM   2687  N  N     . PHE B 1  114  ? -39.326 32.076  133.157 1.00   82.25  ? 114  PHE B N     1 
ATOM   2688  C  CA    . PHE B 1  114  ? -38.715 31.576  134.383 1.00   91.05  ? 114  PHE B CA    1 
ATOM   2689  C  C     . PHE B 1  114  ? -38.509 32.703  135.386 1.00   90.35  ? 114  PHE B C     1 
ATOM   2690  O  O     . PHE B 1  114  ? -37.975 33.759  135.044 1.00   92.42  ? 114  PHE B O     1 
ATOM   2691  C  CB    . PHE B 1  114  ? -37.381 30.887  134.088 1.00   86.16  ? 114  PHE B CB    1 
ATOM   2692  C  CG    . PHE B 1  114  ? -37.520 29.454  133.664 1.00   78.68  ? 114  PHE B CG    1 
ATOM   2693  C  CD1   . PHE B 1  114  ? -37.708 28.456  134.606 1.00   82.40  ? 114  PHE B CD1   1 
ATOM   2694  C  CD2   . PHE B 1  114  ? -37.461 29.104  132.328 1.00   70.68  ? 114  PHE B CD2   1 
ATOM   2695  C  CE1   . PHE B 1  114  ? -37.839 27.137  134.222 1.00   72.60  ? 114  PHE B CE1   1 
ATOM   2696  C  CE2   . PHE B 1  114  ? -37.590 27.785  131.938 1.00   68.72  ? 114  PHE B CE2   1 
ATOM   2697  C  CZ    . PHE B 1  114  ? -37.779 26.801  132.887 1.00   64.71  ? 114  PHE B CZ    1 
ATOM   2698  N  N     . LEU B 1  115  ? -38.942 32.478  136.623 1.00   79.31  ? 115  LEU B N     1 
ATOM   2699  C  CA    . LEU B 1  115  ? -38.757 33.460  137.682 1.00   82.52  ? 115  LEU B CA    1 
ATOM   2700  C  C     . LEU B 1  115  ? -37.270 33.676  137.944 1.00   89.17  ? 115  LEU B C     1 
ATOM   2701  O  O     . LEU B 1  115  ? -36.557 32.738  138.302 1.00   87.29  ? 115  LEU B O     1 
ATOM   2702  C  CB    . LEU B 1  115  ? -39.470 33.016  138.959 1.00   82.21  ? 115  LEU B CB    1 
ATOM   2703  C  CG    . LEU B 1  115  ? -40.996 32.968  138.874 1.00   79.86  ? 115  LEU B CG    1 
ATOM   2704  C  CD1   . LEU B 1  115  ? -41.592 32.442  140.171 1.00   90.84  ? 115  LEU B CD1   1 
ATOM   2705  C  CD2   . LEU B 1  115  ? -41.555 34.343  138.542 1.00   66.03  ? 115  LEU B CD2   1 
ATOM   2706  N  N     . PRO B 1  116  ? -36.801 34.920  137.754 1.00   86.56  ? 116  PRO B N     1 
ATOM   2707  C  CA    . PRO B 1  116  ? -35.388 35.300  137.868 1.00   81.64  ? 116  PRO B CA    1 
ATOM   2708  C  C     . PRO B 1  116  ? -34.787 34.955  139.227 1.00   83.15  ? 116  PRO B C     1 
ATOM   2709  O  O     . PRO B 1  116  ? -35.446 35.114  140.254 1.00   91.90  ? 116  PRO B O     1 
ATOM   2710  C  CB    . PRO B 1  116  ? -35.420 36.820  137.684 1.00   71.11  ? 116  PRO B CB    1 
ATOM   2711  C  CG    . PRO B 1  116  ? -36.653 37.076  136.895 1.00   72.78  ? 116  PRO B CG    1 
ATOM   2712  C  CD    . PRO B 1  116  ? -37.648 36.067  137.380 1.00   79.09  ? 116  PRO B CD    1 
ATOM   2713  N  N     . VAL B 1  117  ? -33.544 34.484  139.221 1.00   73.82  ? 117  VAL B N     1 
ATOM   2714  C  CA    . VAL B 1  117  ? -32.837 34.158  140.453 1.00   77.83  ? 117  VAL B CA    1 
ATOM   2715  C  C     . VAL B 1  117  ? -31.581 35.022  140.560 1.00   80.71  ? 117  VAL B C     1 
ATOM   2716  O  O     . VAL B 1  117  ? -31.021 35.440  139.546 1.00   68.49  ? 117  VAL B O     1 
ATOM   2717  C  CB    . VAL B 1  117  ? -32.463 32.659  140.509 1.00   72.66  ? 117  VAL B CB    1 
ATOM   2718  C  CG1   . VAL B 1  117  ? -32.017 32.265  141.911 1.00   71.57  ? 117  VAL B CG1   1 
ATOM   2719  C  CG2   . VAL B 1  117  ? -33.644 31.803  140.076 1.00   71.55  ? 117  VAL B CG2   1 
ATOM   2720  N  N     . ALA B 1  118  ? -31.157 35.301  141.790 1.00   92.96  ? 118  ALA B N     1 
ATOM   2721  C  CA    . ALA B 1  118  ? -29.975 36.121  142.036 1.00   93.66  ? 118  ALA B CA    1 
ATOM   2722  C  C     . ALA B 1  118  ? -28.720 35.492  141.439 1.00   87.84  ? 118  ALA B C     1 
ATOM   2723  O  O     . ALA B 1  118  ? -28.434 34.317  141.676 1.00   87.31  ? 118  ALA B O     1 
ATOM   2724  C  CB    . ALA B 1  118  ? -29.794 36.353  143.531 1.00   96.39  ? 118  ALA B CB    1 
ATOM   2725  N  N     . ASP B 1  119  ? -27.985 36.287  140.666 1.00   85.83  ? 119  ASP B N     1 
ATOM   2726  C  CA    . ASP B 1  119  ? -26.756 35.844  140.005 1.00   94.40  ? 119  ASP B CA    1 
ATOM   2727  C  C     . ASP B 1  119  ? -26.983 34.682  139.034 1.00   92.81  ? 119  ASP B C     1 
ATOM   2728  O  O     . ASP B 1  119  ? -26.145 33.787  138.915 1.00   88.57  ? 119  ASP B O     1 
ATOM   2729  C  CB    . ASP B 1  119  ? -25.669 35.492  141.031 1.00   100.88 ? 119  ASP B CB    1 
ATOM   2730  C  CG    . ASP B 1  119  ? -25.146 36.710  141.772 1.00   91.77  ? 119  ASP B CG    1 
ATOM   2731  O  OD1   . ASP B 1  119  ? -25.111 37.805  141.171 1.00   82.38  ? 119  ASP B OD1   1 
ATOM   2732  O  OD2   . ASP B 1  119  ? -24.766 36.570  142.955 1.00   81.71  ? 119  ASP B OD2   1 
ATOM   2733  N  N     . VAL B 1  120  ? -28.120 34.706  138.342 1.00   92.64  ? 120  VAL B N     1 
ATOM   2734  C  CA    . VAL B 1  120  ? -28.417 33.722  137.304 1.00   85.07  ? 120  VAL B CA    1 
ATOM   2735  C  C     . VAL B 1  120  ? -28.926 34.418  136.044 1.00   81.51  ? 120  VAL B C     1 
ATOM   2736  O  O     . VAL B 1  120  ? -29.969 35.072  136.065 1.00   83.20  ? 120  VAL B O     1 
ATOM   2737  C  CB    . VAL B 1  120  ? -29.469 32.691  137.771 1.00   79.79  ? 120  VAL B CB    1 
ATOM   2738  C  CG1   . VAL B 1  120  ? -29.915 31.819  136.606 1.00   62.16  ? 120  VAL B CG1   1 
ATOM   2739  C  CG2   . VAL B 1  120  ? -28.917 31.836  138.902 1.00   74.97  ? 120  VAL B CG2   1 
ATOM   2740  N  N     . GLU B 1  121  ? -28.187 34.276  134.948 1.00   82.36  ? 121  GLU B N     1 
ATOM   2741  C  CA    . GLU B 1  121  ? -28.563 34.911  133.688 1.00   81.82  ? 121  GLU B CA    1 
ATOM   2742  C  C     . GLU B 1  121  ? -28.932 33.895  132.615 1.00   75.82  ? 121  GLU B C     1 
ATOM   2743  O  O     . GLU B 1  121  ? -28.160 32.983  132.319 1.00   74.34  ? 121  GLU B O     1 
ATOM   2744  C  CB    . GLU B 1  121  ? -27.433 35.805  133.173 1.00   78.97  ? 121  GLU B CB    1 
ATOM   2745  C  CG    . GLU B 1  121  ? -27.679 36.370  131.782 1.00   74.31  ? 121  GLU B CG    1 
ATOM   2746  C  CD    . GLU B 1  121  ? -26.489 37.142  131.243 1.00   80.03  ? 121  GLU B CD    1 
ATOM   2747  O  OE1   . GLU B 1  121  ? -26.581 37.668  130.113 1.00   66.69  ? 121  GLU B OE1   1 
ATOM   2748  O  OE2   . GLU B 1  121  ? -25.460 37.220  131.948 1.00   83.85  ? 121  GLU B OE2   1 
ATOM   2749  N  N     . ILE B 1  122  ? -30.112 34.063  132.029 1.00   72.64  ? 122  ILE B N     1 
ATOM   2750  C  CA    . ILE B 1  122  ? -30.532 33.228  130.913 1.00   73.47  ? 122  ILE B CA    1 
ATOM   2751  C  C     . ILE B 1  122  ? -30.126 33.885  129.599 1.00   80.42  ? 122  ILE B C     1 
ATOM   2752  O  O     . ILE B 1  122  ? -30.616 34.960  129.252 1.00   80.89  ? 122  ILE B O     1 
ATOM   2753  C  CB    . ILE B 1  122  ? -32.049 32.977  130.929 1.00   62.29  ? 122  ILE B CB    1 
ATOM   2754  C  CG1   . ILE B 1  122  ? -32.429 32.139  132.151 1.00   64.96  ? 122  ILE B CG1   1 
ATOM   2755  C  CG2   . ILE B 1  122  ? -32.488 32.278  129.653 1.00   66.82  ? 122  ILE B CG2   1 
ATOM   2756  C  CD1   . ILE B 1  122  ? -33.902 31.808  132.232 1.00   87.04  ? 122  ILE B CD1   1 
ATOM   2757  N  N     . MET B 1  123  ? -29.223 33.230  128.876 1.00   81.47  ? 123  MET B N     1 
ATOM   2758  C  CA    . MET B 1  123  ? -28.654 33.790  127.655 1.00   77.40  ? 123  MET B CA    1 
ATOM   2759  C  C     . MET B 1  123  ? -29.673 33.846  126.521 1.00   81.27  ? 123  MET B C     1 
ATOM   2760  O  O     . MET B 1  123  ? -29.647 34.762  125.700 1.00   86.18  ? 123  MET B O     1 
ATOM   2761  C  CB    . MET B 1  123  ? -27.428 32.983  127.219 1.00   67.42  ? 123  MET B CB    1 
ATOM   2762  C  CG    . MET B 1  123  ? -26.320 32.913  128.263 1.00   75.33  ? 123  MET B CG    1 
ATOM   2763  S  SD    . MET B 1  123  ? -25.526 34.500  128.587 1.00   88.81  ? 123  MET B SD    1 
ATOM   2764  C  CE    . MET B 1  123  ? -24.839 34.873  126.975 1.00   78.19  ? 123  MET B CE    1 
ATOM   2765  N  N     . ASN B 1  124  ? -30.568 32.864  126.482 1.00   77.88  ? 124  ASN B N     1 
ATOM   2766  C  CA    . ASN B 1  124  ? -31.565 32.778  125.420 1.00   76.04  ? 124  ASN B CA    1 
ATOM   2767  C  C     . ASN B 1  124  ? -32.998 32.788  125.943 1.00   78.11  ? 124  ASN B C     1 
ATOM   2768  O  O     . ASN B 1  124  ? -33.642 31.743  126.018 1.00   82.72  ? 124  ASN B O     1 
ATOM   2769  C  CB    . ASN B 1  124  ? -31.326 31.527  124.571 1.00   74.01  ? 124  ASN B CB    1 
ATOM   2770  C  CG    . ASN B 1  124  ? -31.120 30.282  125.412 1.00   65.15  ? 124  ASN B CG    1 
ATOM   2771  O  OD1   . ASN B 1  124  ? -30.584 30.349  126.519 1.00   67.89  ? 124  ASN B OD1   1 
ATOM   2772  N  ND2   . ASN B 1  124  ? -31.547 29.137  124.892 1.00   55.51  ? 124  ASN B ND2   1 
ATOM   2773  N  N     . PRO B 1  125  ? -33.506 33.978  126.297 1.00   86.40  ? 125  PRO B N     1 
ATOM   2774  C  CA    . PRO B 1  125  ? -34.858 34.111  126.853 1.00   94.15  ? 125  PRO B CA    1 
ATOM   2775  C  C     . PRO B 1  125  ? -35.951 33.817  125.827 1.00   90.80  ? 125  PRO B C     1 
ATOM   2776  O  O     . PRO B 1  125  ? -37.091 33.550  126.211 1.00   87.46  ? 125  PRO B O     1 
ATOM   2777  C  CB    . PRO B 1  125  ? -34.913 35.580  127.282 1.00   94.62  ? 125  PRO B CB    1 
ATOM   2778  C  CG    . PRO B 1  125  ? -33.948 36.266  126.381 1.00   91.64  ? 125  PRO B CG    1 
ATOM   2779  C  CD    . PRO B 1  125  ? -32.835 35.282  126.158 1.00   83.95  ? 125  PRO B CD    1 
ATOM   2780  N  N     . ASP B 1  126  ? -35.605 33.862  124.543 1.00   83.63  ? 126  ASP B N     1 
ATOM   2781  C  CA    . ASP B 1  126  ? -36.581 33.649  123.479 1.00   87.44  ? 126  ASP B CA    1 
ATOM   2782  C  C     . ASP B 1  126  ? -36.697 32.180  123.077 1.00   84.66  ? 126  ASP B C     1 
ATOM   2783  O  O     . ASP B 1  126  ? -37.464 31.838  122.177 1.00   83.92  ? 126  ASP B O     1 
ATOM   2784  C  CB    . ASP B 1  126  ? -36.244 34.506  122.256 1.00   91.30  ? 126  ASP B CB    1 
ATOM   2785  C  CG    . ASP B 1  126  ? -36.482 35.986  122.495 1.00   99.85  ? 126  ASP B CG    1 
ATOM   2786  O  OD1   . ASP B 1  126  ? -36.792 36.704  121.520 1.00   94.00  ? 126  ASP B OD1   1 
ATOM   2787  O  OD2   . ASP B 1  126  ? -36.362 36.431  123.657 1.00   100.78 ? 126  ASP B OD2   1 
ATOM   2788  N  N     . LEU B 1  127  ? -35.932 31.319  123.743 1.00   83.85  ? 127  LEU B N     1 
ATOM   2789  C  CA    . LEU B 1  127  ? -36.015 29.881  123.508 1.00   75.29  ? 127  LEU B CA    1 
ATOM   2790  C  C     . LEU B 1  127  ? -37.401 29.353  123.863 1.00   70.80  ? 127  LEU B C     1 
ATOM   2791  O  O     . LEU B 1  127  ? -37.930 29.641  124.937 1.00   80.50  ? 127  LEU B O     1 
ATOM   2792  C  CB    . LEU B 1  127  ? -34.953 29.141  124.322 1.00   69.69  ? 127  LEU B CB    1 
ATOM   2793  C  CG    . LEU B 1  127  ? -35.105 27.619  124.365 1.00   61.17  ? 127  LEU B CG    1 
ATOM   2794  C  CD1   . LEU B 1  127  ? -34.960 27.026  122.973 1.00   73.17  ? 127  LEU B CD1   1 
ATOM   2795  C  CD2   . LEU B 1  127  ? -34.107 26.997  125.326 1.00   61.64  ? 127  LEU B CD2   1 
ATOM   2796  N  N     . HIS B 1  128  ? -37.987 28.579  122.959 1.00   55.77  ? 128  HIS B N     1 
ATOM   2797  C  CA    . HIS B 1  128  ? -39.328 28.056  123.176 1.00   65.42  ? 128  HIS B CA    1 
ATOM   2798  C  C     . HIS B 1  128  ? -39.328 26.749  123.978 1.00   69.92  ? 128  HIS B C     1 
ATOM   2799  O  O     . HIS B 1  128  ? -38.559 25.832  123.688 1.00   68.31  ? 128  HIS B O     1 
ATOM   2800  C  CB    . HIS B 1  128  ? -40.047 27.869  121.838 1.00   62.16  ? 128  HIS B CB    1 
ATOM   2801  C  CG    . HIS B 1  128  ? -41.463 27.418  121.981 1.00   63.77  ? 128  HIS B CG    1 
ATOM   2802  N  ND1   . HIS B 1  128  ? -42.428 28.183  122.597 1.00   85.98  ? 128  HIS B ND1   1 
ATOM   2803  C  CD2   . HIS B 1  128  ? -42.078 26.269  121.605 1.00   62.08  ? 128  HIS B CD2   1 
ATOM   2804  C  CE1   . HIS B 1  128  ? -43.577 27.530  122.592 1.00   86.26  ? 128  HIS B CE1   1 
ATOM   2805  N  NE2   . HIS B 1  128  ? -43.389 26.366  121.993 1.00   71.61  ? 128  HIS B NE2   1 
ATOM   2806  N  N     . ILE B 1  129  ? -40.189 26.681  124.993 1.00   72.21  ? 129  ILE B N     1 
ATOM   2807  C  CA    . ILE B 1  129  ? -40.356 25.469  125.800 1.00   61.86  ? 129  ILE B CA    1 
ATOM   2808  C  C     . ILE B 1  129  ? -41.621 24.690  125.422 1.00   63.32  ? 129  ILE B C     1 
ATOM   2809  O  O     . ILE B 1  129  ? -41.544 23.551  124.960 1.00   66.73  ? 129  ILE B O     1 
ATOM   2810  C  CB    . ILE B 1  129  ? -40.386 25.767  127.323 1.00   50.90  ? 129  ILE B CB    1 
ATOM   2811  C  CG1   . ILE B 1  129  ? -39.022 26.264  127.820 1.00   50.93  ? 129  ILE B CG1   1 
ATOM   2812  C  CG2   . ILE B 1  129  ? -40.784 24.519  128.100 1.00   55.75  ? 129  ILE B CG2   1 
ATOM   2813  C  CD1   . ILE B 1  129  ? -38.769 27.756  127.631 1.00   54.65  ? 129  ILE B CD1   1 
ATOM   2814  N  N     . ALA B 1  130  ? -42.783 25.300  125.637 1.00   65.64  ? 130  ALA B N     1 
ATOM   2815  C  CA    . ALA B 1  130  ? -44.050 24.645  125.326 1.00   72.53  ? 130  ALA B CA    1 
ATOM   2816  C  C     . ALA B 1  130  ? -45.169 25.638  125.020 1.00   77.73  ? 130  ALA B C     1 
ATOM   2817  O  O     . ALA B 1  130  ? -45.126 26.794  125.447 1.00   76.07  ? 130  ALA B O     1 
ATOM   2818  C  CB    . ALA B 1  130  ? -44.460 23.714  126.461 1.00   66.67  ? 130  ALA B CB    1 
ATOM   2819  N  N     . THR B 1  131  ? -46.163 25.176  124.266 1.00   78.51  ? 131  THR B N     1 
ATOM   2820  C  CA    . THR B 1  131  ? -47.369 25.954  124.015 1.00   78.79  ? 131  THR B CA    1 
ATOM   2821  C  C     . THR B 1  131  ? -48.529 25.375  124.813 1.00   83.79  ? 131  THR B C     1 
ATOM   2822  O  O     . THR B 1  131  ? -48.739 24.160  124.834 1.00   73.68  ? 131  THR B O     1 
ATOM   2823  C  CB    . THR B 1  131  ? -47.767 25.957  122.524 1.00   82.90  ? 131  THR B CB    1 
ATOM   2824  O  OG1   . THR B 1  131  ? -48.143 24.635  122.122 1.00   91.12  ? 131  THR B OG1   1 
ATOM   2825  C  CG2   . THR B 1  131  ? -46.626 26.445  121.654 1.00   73.72  ? 131  THR B CG2   1 
ATOM   2826  N  N     . LEU B 1  132  ? -49.284 26.251  125.467 1.00   85.72  ? 132  LEU B N     1 
ATOM   2827  C  CA    . LEU B 1  132  ? -50.440 25.823  126.240 1.00   78.83  ? 132  LEU B CA    1 
ATOM   2828  C  C     . LEU B 1  132  ? -51.738 26.294  125.593 1.00   77.60  ? 132  LEU B C     1 
ATOM   2829  O  O     . LEU B 1  132  ? -51.801 27.382  125.019 1.00   71.21  ? 132  LEU B O     1 
ATOM   2830  C  CB    . LEU B 1  132  ? -50.349 26.326  127.684 1.00   82.95  ? 132  LEU B CB    1 
ATOM   2831  C  CG    . LEU B 1  132  ? -49.394 25.607  128.644 1.00   81.95  ? 132  LEU B CG    1 
ATOM   2832  C  CD1   . LEU B 1  132  ? -47.943 25.982  128.377 1.00   67.94  ? 132  LEU B CD1   1 
ATOM   2833  C  CD2   . LEU B 1  132  ? -49.772 25.901  130.089 1.00   92.70  ? 132  LEU B CD2   1 
ATOM   2834  N  N     . GLU B 1  133  ? -52.770 25.463  125.688 1.00   83.36  ? 133  GLU B N     1 
ATOM   2835  C  CA    . GLU B 1  133  ? -54.080 25.793  125.141 1.00   87.37  ? 133  GLU B CA    1 
ATOM   2836  C  C     . GLU B 1  133  ? -55.020 26.250  126.252 1.00   91.93  ? 133  GLU B C     1 
ATOM   2837  O  O     . GLU B 1  133  ? -54.613 26.373  127.408 1.00   95.02  ? 133  GLU B O     1 
ATOM   2838  C  CB    . GLU B 1  133  ? -54.672 24.583  124.422 1.00   82.59  ? 133  GLU B CB    1 
ATOM   2839  C  CG    . GLU B 1  133  ? -53.737 23.952  123.407 1.00   78.72  ? 133  GLU B CG    1 
ATOM   2840  C  CD    . GLU B 1  133  ? -53.590 22.457  123.606 1.00   91.93  ? 133  GLU B CD    1 
ATOM   2841  O  OE1   . GLU B 1  133  ? -54.208 21.917  124.548 1.00   88.72  ? 133  GLU B OE1   1 
ATOM   2842  O  OE2   . GLU B 1  133  ? -52.855 21.821  122.821 1.00   98.63  ? 133  GLU B OE2   1 
ATOM   2843  N  N     . GLU B 1  134  ? -56.274 26.511  125.896 1.00   87.47  ? 134  GLU B N     1 
ATOM   2844  C  CA    . GLU B 1  134  ? -57.284 26.871  126.883 1.00   92.35  ? 134  GLU B CA    1 
ATOM   2845  C  C     . GLU B 1  134  ? -57.443 25.753  127.910 1.00   90.61  ? 134  GLU B C     1 
ATOM   2846  O  O     . GLU B 1  134  ? -57.683 24.600  127.553 1.00   87.25  ? 134  GLU B O     1 
ATOM   2847  C  CB    . GLU B 1  134  ? -58.627 27.148  126.203 1.00   95.18  ? 134  GLU B CB    1 
ATOM   2848  C  CG    . GLU B 1  134  ? -58.628 28.353  125.273 1.00   91.71  ? 134  GLU B CG    1 
ATOM   2849  C  CD    . GLU B 1  134  ? -58.739 29.671  126.016 1.00   96.75  ? 134  GLU B CD    1 
ATOM   2850  O  OE1   . GLU B 1  134  ? -58.689 30.731  125.356 1.00   94.57  ? 134  GLU B OE1   1 
ATOM   2851  O  OE2   . GLU B 1  134  ? -58.882 29.652  127.257 1.00   98.22  ? 134  GLU B OE2   1 
ATOM   2852  N  N     . GLY B 1  135  ? -57.305 26.102  129.185 1.00   96.09  ? 135  GLY B N     1 
ATOM   2853  C  CA    . GLY B 1  135  ? -57.417 25.132  130.258 1.00   98.01  ? 135  GLY B CA    1 
ATOM   2854  C  C     . GLY B 1  135  ? -56.108 24.427  130.562 1.00   102.97 ? 135  GLY B C     1 
ATOM   2855  O  O     . GLY B 1  135  ? -55.997 23.710  131.557 1.00   115.10 ? 135  GLY B O     1 
ATOM   2856  N  N     . GLY B 1  136  ? -55.115 24.629  129.701 1.00   93.07  ? 136  GLY B N     1 
ATOM   2857  C  CA    . GLY B 1  136  ? -53.809 24.022  129.888 1.00   90.88  ? 136  GLY B CA    1 
ATOM   2858  C  C     . GLY B 1  136  ? -53.042 24.659  131.030 1.00   100.26 ? 136  GLY B C     1 
ATOM   2859  O  O     . GLY B 1  136  ? -53.002 25.882  131.152 1.00   95.93  ? 136  GLY B O     1 
ATOM   2860  N  N     . ARG B 1  137  ? -52.429 23.826  131.866 1.00   105.32 ? 137  ARG B N     1 
ATOM   2861  C  CA    . ARG B 1  137  ? -51.684 24.309  133.025 1.00   102.84 ? 137  ARG B CA    1 
ATOM   2862  C  C     . ARG B 1  137  ? -50.295 23.679  133.093 1.00   92.97  ? 137  ARG B C     1 
ATOM   2863  O  O     . ARG B 1  137  ? -50.155 22.455  133.050 1.00   87.12  ? 137  ARG B O     1 
ATOM   2864  C  CB    . ARG B 1  137  ? -52.456 24.019  134.317 1.00   105.64 ? 137  ARG B CB    1 
ATOM   2865  C  CG    . ARG B 1  137  ? -53.802 24.724  134.415 1.00   107.24 ? 137  ARG B CG    1 
ATOM   2866  C  CD    . ARG B 1  137  ? -54.627 24.196  135.581 1.00   108.69 ? 137  ARG B CD    1 
ATOM   2867  N  NE    . ARG B 1  137  ? -54.005 24.471  136.873 1.00   115.16 ? 137  ARG B NE    1 
ATOM   2868  C  CZ    . ARG B 1  137  ? -54.292 25.525  137.631 1.00   116.71 ? 137  ARG B CZ    1 
ATOM   2869  N  NH1   . ARG B 1  137  ? -55.195 26.409  137.229 1.00   108.05 ? 137  ARG B NH1   1 
ATOM   2870  N  NH2   . ARG B 1  137  ? -53.677 25.695  138.794 1.00   117.59 ? 137  ARG B NH2   1 
ATOM   2871  N  N     . LEU B 1  138  ? -49.270 24.520  133.194 1.00   85.66  ? 138  LEU B N     1 
ATOM   2872  C  CA    . LEU B 1  138  ? -47.897 24.038  133.294 1.00   84.77  ? 138  LEU B CA    1 
ATOM   2873  C  C     . LEU B 1  138  ? -47.202 24.515  134.568 1.00   85.35  ? 138  LEU B C     1 
ATOM   2874  O  O     . LEU B 1  138  ? -46.929 25.705  134.733 1.00   81.38  ? 138  LEU B O     1 
ATOM   2875  C  CB    . LEU B 1  138  ? -47.089 24.471  132.069 1.00   84.07  ? 138  LEU B CB    1 
ATOM   2876  C  CG    . LEU B 1  138  ? -45.637 23.994  132.018 1.00   82.03  ? 138  LEU B CG    1 
ATOM   2877  C  CD1   . LEU B 1  138  ? -45.574 22.477  131.927 1.00   78.13  ? 138  LEU B CD1   1 
ATOM   2878  C  CD2   . LEU B 1  138  ? -44.904 24.639  130.853 1.00   68.62  ? 138  LEU B CD2   1 
ATOM   2879  N  N     . ASN B 1  139  ? -46.913 23.576  135.462 1.00   83.36  ? 139  ASN B N     1 
ATOM   2880  C  CA    . ASN B 1  139  ? -46.159 23.867  136.675 1.00   89.28  ? 139  ASN B CA    1 
ATOM   2881  C  C     . ASN B 1  139  ? -44.900 23.014  136.693 1.00   93.79  ? 139  ASN B C     1 
ATOM   2882  O  O     . ASN B 1  139  ? -44.982 21.791  136.797 1.00   89.38  ? 139  ASN B O     1 
ATOM   2883  C  CB    . ASN B 1  139  ? -47.014 23.578  137.913 1.00   91.67  ? 139  ASN B CB    1 
ATOM   2884  C  CG    . ASN B 1  139  ? -46.417 24.149  139.192 1.00   93.51  ? 139  ASN B CG    1 
ATOM   2885  O  OD1   . ASN B 1  139  ? -46.955 25.092  139.769 1.00   96.91  ? 139  ASN B OD1   1 
ATOM   2886  N  ND2   . ASN B 1  139  ? -45.312 23.567  139.648 1.00   87.68  ? 139  ASN B ND2   1 
ATOM   2887  N  N     . MET B 1  140  ? -43.736 23.651  136.591 1.00   91.96  ? 140  MET B N     1 
ATOM   2888  C  CA    . MET B 1  140  ? -42.483 22.899  136.560 1.00   83.80  ? 140  MET B CA    1 
ATOM   2889  C  C     . MET B 1  140  ? -41.323 23.532  137.332 1.00   78.06  ? 140  MET B C     1 
ATOM   2890  O  O     . MET B 1  140  ? -41.136 24.749  137.326 1.00   67.10  ? 140  MET B O     1 
ATOM   2891  C  CB    . MET B 1  140  ? -42.054 22.602  135.120 1.00   79.02  ? 140  MET B CB    1 
ATOM   2892  C  CG    . MET B 1  140  ? -41.707 23.830  134.296 1.00   90.04  ? 140  MET B CG    1 
ATOM   2893  S  SD    . MET B 1  140  ? -40.807 23.394  132.795 1.00   65.33  ? 140  MET B SD    1 
ATOM   2894  C  CE    . MET B 1  140  ? -41.866 22.105  132.151 1.00   68.10  ? 140  MET B CE    1 
ATOM   2895  N  N     . GLU B 1  141  ? -40.552 22.674  137.996 1.00   80.47  ? 141  GLU B N     1 
ATOM   2896  C  CA    . GLU B 1  141  ? -39.346 23.078  138.704 1.00   77.76  ? 141  GLU B CA    1 
ATOM   2897  C  C     . GLU B 1  141  ? -38.163 22.350  138.078 1.00   77.41  ? 141  GLU B C     1 
ATOM   2898  O  O     . GLU B 1  141  ? -38.153 21.121  138.013 1.00   75.10  ? 141  GLU B O     1 
ATOM   2899  C  CB    . GLU B 1  141  ? -39.452 22.715  140.188 1.00   80.51  ? 141  GLU B CB    1 
ATOM   2900  C  CG    . GLU B 1  141  ? -40.689 23.267  140.886 1.00   86.82  ? 141  GLU B CG    1 
ATOM   2901  C  CD    . GLU B 1  141  ? -40.906 22.660  142.261 1.00   87.18  ? 141  GLU B CD    1 
ATOM   2902  O  OE1   . GLU B 1  141  ? -40.064 21.845  142.695 1.00   87.10  ? 141  GLU B OE1   1 
ATOM   2903  O  OE2   . GLU B 1  141  ? -41.922 22.995  142.906 1.00   83.99  ? 141  GLU B OE2   1 
ATOM   2904  N  N     . VAL B 1  142  ? -37.173 23.104  137.610 1.00   79.60  ? 142  VAL B N     1 
ATOM   2905  C  CA    . VAL B 1  142  ? -36.020 22.506  136.939 1.00   70.66  ? 142  VAL B CA    1 
ATOM   2906  C  C     . VAL B 1  142  ? -34.707 22.715  137.698 1.00   67.19  ? 142  VAL B C     1 
ATOM   2907  O  O     . VAL B 1  142  ? -34.401 23.818  138.152 1.00   73.66  ? 142  VAL B O     1 
ATOM   2908  C  CB    . VAL B 1  142  ? -35.880 23.008  135.485 1.00   67.44  ? 142  VAL B CB    1 
ATOM   2909  C  CG1   . VAL B 1  142  ? -37.050 22.523  134.648 1.00   68.70  ? 142  VAL B CG1   1 
ATOM   2910  C  CG2   . VAL B 1  142  ? -35.790 24.524  135.444 1.00   65.95  ? 142  VAL B CG2   1 
ATOM   2911  N  N     . ARG B 1  143  ? -33.937 21.639  137.829 1.00   56.86  ? 143  ARG B N     1 
ATOM   2912  C  CA    . ARG B 1  143  ? -32.687 21.664  138.578 1.00   61.48  ? 143  ARG B CA    1 
ATOM   2913  C  C     . ARG B 1  143  ? -31.499 21.975  137.670 1.00   67.02  ? 143  ARG B C     1 
ATOM   2914  O  O     . ARG B 1  143  ? -31.214 21.232  136.732 1.00   67.51  ? 143  ARG B O     1 
ATOM   2915  C  CB    . ARG B 1  143  ? -32.477 20.321  139.281 1.00   66.47  ? 143  ARG B CB    1 
ATOM   2916  C  CG    . ARG B 1  143  ? -31.089 20.114  139.864 1.00   70.31  ? 143  ARG B CG    1 
ATOM   2917  C  CD    . ARG B 1  143  ? -30.967 20.647  141.281 1.00   77.76  ? 143  ARG B CD    1 
ATOM   2918  N  NE    . ARG B 1  143  ? -29.666 20.323  141.862 1.00   79.09  ? 143  ARG B NE    1 
ATOM   2919  C  CZ    . ARG B 1  143  ? -29.381 19.174  142.467 1.00   72.49  ? 143  ARG B CZ    1 
ATOM   2920  N  NH1   . ARG B 1  143  ? -30.308 18.231  142.575 1.00   72.48  ? 143  ARG B NH1   1 
ATOM   2921  N  NH2   . ARG B 1  143  ? -28.170 18.966  142.966 1.00   59.46  ? 143  ARG B NH2   1 
ATOM   2922  N  N     . VAL B 1  144  ? -30.810 23.075  137.956 1.00   69.16  ? 144  VAL B N     1 
ATOM   2923  C  CA    . VAL B 1  144  ? -29.661 23.493  137.157 1.00   61.68  ? 144  VAL B CA    1 
ATOM   2924  C  C     . VAL B 1  144  ? -28.360 23.393  137.950 1.00   60.15  ? 144  VAL B C     1 
ATOM   2925  O  O     . VAL B 1  144  ? -28.199 24.052  138.975 1.00   67.91  ? 144  VAL B O     1 
ATOM   2926  C  CB    . VAL B 1  144  ? -29.828 24.936  136.644 1.00   55.08  ? 144  VAL B CB    1 
ATOM   2927  C  CG1   . VAL B 1  144  ? -28.565 25.399  135.938 1.00   51.63  ? 144  VAL B CG1   1 
ATOM   2928  C  CG2   . VAL B 1  144  ? -31.031 25.033  135.720 1.00   55.00  ? 144  VAL B CG2   1 
ATOM   2929  N  N     . ASP B 1  145  ? -27.434 22.571  137.467 1.00   56.38  ? 145  ASP B N     1 
ATOM   2930  C  CA    . ASP B 1  145  ? -26.161 22.367  138.152 1.00   58.74  ? 145  ASP B CA    1 
ATOM   2931  C  C     . ASP B 1  145  ? -24.961 22.799  137.315 1.00   60.54  ? 145  ASP B C     1 
ATOM   2932  O  O     . ASP B 1  145  ? -25.033 22.865  136.088 1.00   56.52  ? 145  ASP B O     1 
ATOM   2933  C  CB    . ASP B 1  145  ? -25.997 20.900  138.557 1.00   56.82  ? 145  ASP B CB    1 
ATOM   2934  C  CG    . ASP B 1  145  ? -26.709 20.569  139.850 1.00   68.11  ? 145  ASP B CG    1 
ATOM   2935  O  OD1   . ASP B 1  145  ? -27.896 20.184  139.796 1.00   68.94  ? 145  ASP B OD1   1 
ATOM   2936  O  OD2   . ASP B 1  145  ? -26.078 20.689  140.922 1.00   72.62  ? 145  ASP B OD2   1 
ATOM   2937  N  N     . ARG B 1  146  ? -23.859 23.096  137.995 1.00   62.58  ? 146  ARG B N     1 
ATOM   2938  C  CA    . ARG B 1  146  ? -22.601 23.399  137.327 1.00   55.58  ? 146  ARG B CA    1 
ATOM   2939  C  C     . ARG B 1  146  ? -21.691 22.176  137.317 1.00   58.09  ? 146  ARG B C     1 
ATOM   2940  O  O     . ARG B 1  146  ? -21.536 21.494  138.331 1.00   59.76  ? 146  ARG B O     1 
ATOM   2941  C  CB    . ARG B 1  146  ? -21.899 24.581  138.000 1.00   59.34  ? 146  ARG B CB    1 
ATOM   2942  C  CG    . ARG B 1  146  ? -20.425 24.710  137.643 1.00   64.22  ? 146  ARG B CG    1 
ATOM   2943  C  CD    . ARG B 1  146  ? -19.974 26.159  137.644 1.00   75.13  ? 146  ARG B CD    1 
ATOM   2944  N  NE    . ARG B 1  146  ? -20.197 26.809  138.931 1.00   75.61  ? 146  ARG B NE    1 
ATOM   2945  C  CZ    . ARG B 1  146  ? -19.966 28.097  139.163 1.00   83.95  ? 146  ARG B CZ    1 
ATOM   2946  N  NH1   . ARG B 1  146  ? -19.505 28.876  138.193 1.00   80.04  ? 146  ARG B NH1   1 
ATOM   2947  N  NH2   . ARG B 1  146  ? -20.197 28.608  140.364 1.00   88.11  ? 146  ARG B NH2   1 
ATOM   2948  N  N     . GLY B 1  147  ? -21.092 21.903  136.165 1.00   58.04  ? 147  GLY B N     1 
ATOM   2949  C  CA    . GLY B 1  147  ? -20.207 20.765  136.018 1.00   59.15  ? 147  GLY B CA    1 
ATOM   2950  C  C     . GLY B 1  147  ? -19.520 20.775  134.668 1.00   59.79  ? 147  GLY B C     1 
ATOM   2951  O  O     . GLY B 1  147  ? -19.504 21.795  133.977 1.00   57.01  ? 147  GLY B O     1 
ATOM   2952  N  N     . VAL B 1  148  ? -18.949 19.637  134.292 1.00   58.72  ? 148  VAL B N     1 
ATOM   2953  C  CA    . VAL B 1  148  ? -18.224 19.528  133.032 1.00   61.83  ? 148  VAL B CA    1 
ATOM   2954  C  C     . VAL B 1  148  ? -18.631 18.282  132.251 1.00   57.74  ? 148  VAL B C     1 
ATOM   2955  O  O     . VAL B 1  148  ? -19.126 17.311  132.825 1.00   56.91  ? 148  VAL B O     1 
ATOM   2956  C  CB    . VAL B 1  148  ? -16.698 19.498  133.260 1.00   61.65  ? 148  VAL B CB    1 
ATOM   2957  C  CG1   . VAL B 1  148  ? -16.202 20.847  133.761 1.00   54.37  ? 148  VAL B CG1   1 
ATOM   2958  C  CG2   . VAL B 1  148  ? -16.327 18.387  134.235 1.00   56.91  ? 148  VAL B CG2   1 
ATOM   2959  N  N     . GLY B 1  149  ? -18.425 18.323  130.939 1.00   51.05  ? 149  GLY B N     1 
ATOM   2960  C  CA    . GLY B 1  149  ? -18.654 17.168  130.090 1.00   50.50  ? 149  GLY B CA    1 
ATOM   2961  C  C     . GLY B 1  149  ? -20.108 16.876  129.779 1.00   44.57  ? 149  GLY B C     1 
ATOM   2962  O  O     . GLY B 1  149  ? -20.945 17.779  129.737 1.00   42.37  ? 149  GLY B O     1 
ATOM   2963  N  N     . TYR B 1  150  ? -20.402 15.599  129.553 1.00   39.53  ? 150  TYR B N     1 
ATOM   2964  C  CA    . TYR B 1  150  ? -21.750 15.155  129.223 1.00   41.98  ? 150  TYR B CA    1 
ATOM   2965  C  C     . TYR B 1  150  ? -22.143 13.959  130.086 1.00   45.60  ? 150  TYR B C     1 
ATOM   2966  O  O     . TYR B 1  150  ? -21.519 12.899  130.015 1.00   44.66  ? 150  TYR B O     1 
ATOM   2967  C  CB    . TYR B 1  150  ? -21.835 14.790  127.740 1.00   43.23  ? 150  TYR B CB    1 
ATOM   2968  C  CG    . TYR B 1  150  ? -23.199 14.320  127.280 1.00   37.91  ? 150  TYR B CG    1 
ATOM   2969  C  CD1   . TYR B 1  150  ? -24.136 15.221  126.794 1.00   33.81  ? 150  TYR B CD1   1 
ATOM   2970  C  CD2   . TYR B 1  150  ? -23.542 12.973  127.316 1.00   36.66  ? 150  TYR B CD2   1 
ATOM   2971  C  CE1   . TYR B 1  150  ? -25.379 14.797  126.367 1.00   33.51  ? 150  TYR B CE1   1 
ATOM   2972  C  CE2   . TYR B 1  150  ? -24.784 12.540  126.892 1.00   36.40  ? 150  TYR B CE2   1 
ATOM   2973  C  CZ    . TYR B 1  150  ? -25.699 13.457  126.418 1.00   36.67  ? 150  TYR B CZ    1 
ATOM   2974  O  OH    . TYR B 1  150  ? -26.938 13.034  125.993 1.00   39.78  ? 150  TYR B OH    1 
ATOM   2975  N  N     . VAL B 1  151  ? -23.174 14.139  130.905 1.00   43.12  ? 151  VAL B N     1 
ATOM   2976  C  CA    . VAL B 1  151  ? -23.645 13.084  131.795 1.00   34.96  ? 151  VAL B CA    1 
ATOM   2977  C  C     . VAL B 1  151  ? -25.078 12.648  131.483 1.00   38.73  ? 151  VAL B C     1 
ATOM   2978  O  O     . VAL B 1  151  ? -26.009 13.448  131.590 1.00   40.10  ? 151  VAL B O     1 
ATOM   2979  C  CB    . VAL B 1  151  ? -23.551 13.516  133.264 1.00   34.04  ? 151  VAL B CB    1 
ATOM   2980  C  CG1   . VAL B 1  151  ? -23.963 12.373  134.178 1.00   50.36  ? 151  VAL B CG1   1 
ATOM   2981  C  CG2   . VAL B 1  151  ? -22.138 13.981  133.582 1.00   30.29  ? 151  VAL B CG2   1 
ATOM   2982  N  N     . PRO B 1  152  ? -25.258 11.376  131.092 1.00   42.33  ? 152  PRO B N     1 
ATOM   2983  C  CA    . PRO B 1  152  ? -26.586 10.810  130.826 1.00   43.69  ? 152  PRO B CA    1 
ATOM   2984  C  C     . PRO B 1  152  ? -27.499 10.882  132.047 1.00   53.27  ? 152  PRO B C     1 
ATOM   2985  O  O     . PRO B 1  152  ? -27.017 11.002  133.174 1.00   55.87  ? 152  PRO B O     1 
ATOM   2986  C  CB    . PRO B 1  152  ? -26.281 9.345   130.495 1.00   38.39  ? 152  PRO B CB    1 
ATOM   2987  C  CG    . PRO B 1  152  ? -24.889 9.353   129.999 1.00   36.16  ? 152  PRO B CG    1 
ATOM   2988  C  CD    . PRO B 1  152  ? -24.183 10.414  130.791 1.00   44.00  ? 152  PRO B CD    1 
ATOM   2989  N  N     . ALA B 1  153  ? -28.805 10.802  131.817 1.00   55.26  ? 153  ALA B N     1 
ATOM   2990  C  CA    . ALA B 1  153  ? -29.786 10.887  132.894 1.00   55.89  ? 153  ALA B CA    1 
ATOM   2991  C  C     . ALA B 1  153  ? -29.663 9.745   133.900 1.00   56.49  ? 153  ALA B C     1 
ATOM   2992  O  O     . ALA B 1  153  ? -30.089 9.871   135.047 1.00   67.48  ? 153  ALA B O     1 
ATOM   2993  C  CB    . ALA B 1  153  ? -31.194 10.929  132.322 1.00   59.56  ? 153  ALA B CB    1 
ATOM   2994  N  N     . GLU B 1  154  ? -29.088 8.631   133.465 1.00   53.62  ? 154  GLU B N     1 
ATOM   2995  C  CA    . GLU B 1  154  ? -28.987 7.447   134.308 1.00   56.86  ? 154  GLU B CA    1 
ATOM   2996  C  C     . GLU B 1  154  ? -27.840 7.563   135.306 1.00   62.14  ? 154  GLU B C     1 
ATOM   2997  O  O     . GLU B 1  154  ? -27.917 7.042   136.419 1.00   76.38  ? 154  GLU B O     1 
ATOM   2998  C  CB    . GLU B 1  154  ? -28.800 6.197   133.447 1.00   68.06  ? 154  GLU B CB    1 
ATOM   2999  C  CG    . GLU B 1  154  ? -29.072 6.409   131.962 1.00   73.33  ? 154  GLU B CG    1 
ATOM   3000  C  CD    . GLU B 1  154  ? -30.553 6.503   131.631 1.00   65.55  ? 154  GLU B CD    1 
ATOM   3001  O  OE1   . GLU B 1  154  ? -30.885 6.981   130.524 1.00   54.81  ? 154  GLU B OE1   1 
ATOM   3002  O  OE2   . GLU B 1  154  ? -31.383 6.094   132.471 1.00   61.78  ? 154  GLU B OE2   1 
ATOM   3003  N  N     . LYS B 1  155  ? -26.778 8.251   134.901 1.00   58.26  ? 155  LYS B N     1 
ATOM   3004  C  CA    . LYS B 1  155  ? -25.545 8.287   135.686 1.00   64.35  ? 155  LYS B CA    1 
ATOM   3005  C  C     . LYS B 1  155  ? -25.591 9.230   136.884 1.00   68.73  ? 155  LYS B C     1 
ATOM   3006  O  O     . LYS B 1  155  ? -25.064 8.902   137.949 1.00   77.38  ? 155  LYS B O     1 
ATOM   3007  C  CB    . LYS B 1  155  ? -24.339 8.613   134.800 1.00   58.86  ? 155  LYS B CB    1 
ATOM   3008  C  CG    . LYS B 1  155  ? -23.637 7.387   134.226 1.00   56.54  ? 155  LYS B CG    1 
ATOM   3009  C  CD    . LYS B 1  155  ? -24.613 6.464   133.505 1.00   59.37  ? 155  LYS B CD    1 
ATOM   3010  C  CE    . LYS B 1  155  ? -23.896 5.354   132.757 1.00   65.19  ? 155  LYS B CE    1 
ATOM   3011  N  NZ    . LYS B 1  155  ? -24.846 4.517   131.964 1.00   65.74  ? 155  LYS B NZ    1 
ATOM   3012  N  N     . HIS B 1  156  ? -26.203 10.399  136.723 1.00   62.48  ? 156  HIS B N     1 
ATOM   3013  C  CA    . HIS B 1  156  ? -26.335 11.297  137.867 1.00   73.60  ? 156  HIS B CA    1 
ATOM   3014  C  C     . HIS B 1  156  ? -27.440 10.838  138.826 1.00   79.70  ? 156  HIS B C     1 
ATOM   3015  O  O     . HIS B 1  156  ? -27.290 10.948  140.045 1.00   75.94  ? 156  HIS B O     1 
ATOM   3016  C  CB    . HIS B 1  156  ? -26.438 12.784  137.465 1.00   72.67  ? 156  HIS B CB    1 
ATOM   3017  C  CG    . HIS B 1  156  ? -27.672 13.151  136.699 1.00   69.17  ? 156  HIS B CG    1 
ATOM   3018  N  ND1   . HIS B 1  156  ? -28.603 12.226  136.267 1.00   72.33  ? 156  HIS B ND1   1 
ATOM   3019  C  CD2   . HIS B 1  156  ? -28.128 14.355  136.283 1.00   66.67  ? 156  HIS B CD2   1 
ATOM   3020  C  CE1   . HIS B 1  156  ? -29.573 12.846  135.626 1.00   72.50  ? 156  HIS B CE1   1 
ATOM   3021  N  NE2   . HIS B 1  156  ? -29.310 14.142  135.619 1.00   69.88  ? 156  HIS B NE2   1 
ATOM   3022  N  N     . GLY B 1  157  ? -28.525 10.303  138.267 1.00   77.87  ? 157  GLY B N     1 
ATOM   3023  C  CA    . GLY B 1  157  ? -29.599 9.700   139.038 1.00   80.29  ? 157  GLY B CA    1 
ATOM   3024  C  C     . GLY B 1  157  ? -30.162 10.550  140.161 1.00   87.39  ? 157  GLY B C     1 
ATOM   3025  O  O     . GLY B 1  157  ? -30.605 10.015  141.179 1.00   88.57  ? 157  GLY B O     1 
ATOM   3026  N  N     . ILE B 1  158  ? -30.151 11.868  139.988 1.00   77.12  ? 158  ILE B N     1 
ATOM   3027  C  CA    . ILE B 1  158  ? -30.589 12.758  141.058 1.00   81.60  ? 158  ILE B CA    1 
ATOM   3028  C  C     . ILE B 1  158  ? -32.092 13.030  141.041 1.00   80.23  ? 158  ILE B C     1 
ATOM   3029  O  O     . ILE B 1  158  ? -32.687 13.290  139.992 1.00   73.22  ? 158  ILE B O     1 
ATOM   3030  C  CB    . ILE B 1  158  ? -29.797 14.090  141.082 1.00   70.33  ? 158  ILE B CB    1 
ATOM   3031  C  CG1   . ILE B 1  158  ? -30.084 14.935  139.842 1.00   60.75  ? 158  ILE B CG1   1 
ATOM   3032  C  CG2   . ILE B 1  158  ? -28.303 13.823  141.221 1.00   72.66  ? 158  ILE B CG2   1 
ATOM   3033  C  CD1   . ILE B 1  158  ? -29.486 16.314  139.920 1.00   63.58  ? 158  ILE B CD1   1 
ATOM   3034  N  N     . LYS B 1  159  ? -32.700 12.941  142.219 1.00   70.98  ? 159  LYS B N     1 
ATOM   3035  C  CA    . LYS B 1  159  ? -34.107 13.269  142.386 1.00   64.84  ? 159  LYS B CA    1 
ATOM   3036  C  C     . LYS B 1  159  ? -34.326 14.079  143.656 1.00   76.47  ? 159  LYS B C     1 
ATOM   3037  O  O     . LYS B 1  159  ? -33.987 13.633  144.753 1.00   82.14  ? 159  LYS B O     1 
ATOM   3038  C  CB    . LYS B 1  159  ? -34.957 12.000  142.432 1.00   61.15  ? 159  LYS B CB    1 
ATOM   3039  C  CG    . LYS B 1  159  ? -35.107 11.293  141.100 1.00   55.61  ? 159  LYS B CG    1 
ATOM   3040  C  CD    . LYS B 1  159  ? -36.131 10.177  141.195 1.00   51.07  ? 159  LYS B CD    1 
ATOM   3041  C  CE    . LYS B 1  159  ? -36.280 9.449   139.874 1.00   51.44  ? 159  LYS B CE    1 
ATOM   3042  N  NZ    . LYS B 1  159  ? -35.000 8.813   139.457 1.00   57.32  ? 159  LYS B NZ    1 
ATOM   3043  N  N     . ASP B 1  160  ? -34.898 15.268  143.503 1.00   79.00  ? 160  ASP B N     1 
ATOM   3044  C  CA    . ASP B 1  160  ? -35.276 16.078  144.653 1.00   76.95  ? 160  ASP B CA    1 
ATOM   3045  C  C     . ASP B 1  160  ? -36.542 15.509  145.281 1.00   70.95  ? 160  ASP B C     1 
ATOM   3046  O  O     . ASP B 1  160  ? -36.646 15.399  146.503 1.00   75.03  ? 160  ASP B O     1 
ATOM   3047  C  CB    . ASP B 1  160  ? -35.479 17.538  144.243 1.00   81.75  ? 160  ASP B CB    1 
ATOM   3048  C  CG    . ASP B 1  160  ? -34.172 18.303  144.153 1.00   91.41  ? 160  ASP B CG    1 
ATOM   3049  O  OD1   . ASP B 1  160  ? -33.106 17.657  144.066 1.00   89.81  ? 160  ASP B OD1   1 
ATOM   3050  O  OD2   . ASP B 1  160  ? -34.210 19.551  144.170 1.00   99.29  ? 160  ASP B OD2   1 
ATOM   3051  N  N     . ARG B 1  161  ? -37.497 15.140  144.435 1.00   62.52  ? 161  ARG B N     1 
ATOM   3052  C  CA    . ARG B 1  161  ? -38.713 14.483  144.895 1.00   64.79  ? 161  ARG B CA    1 
ATOM   3053  C  C     . ARG B 1  161  ? -38.959 13.198  144.110 1.00   62.44  ? 161  ARG B C     1 
ATOM   3054  O  O     . ARG B 1  161  ? -38.165 12.830  143.247 1.00   70.11  ? 161  ARG B O     1 
ATOM   3055  C  CB    . ARG B 1  161  ? -39.910 15.424  144.786 1.00   64.54  ? 161  ARG B CB    1 
ATOM   3056  C  CG    . ARG B 1  161  ? -40.193 15.917  143.385 1.00   54.97  ? 161  ARG B CG    1 
ATOM   3057  C  CD    . ARG B 1  161  ? -41.268 16.985  143.413 1.00   63.45  ? 161  ARG B CD    1 
ATOM   3058  N  NE    . ARG B 1  161  ? -40.786 18.230  144.003 1.00   66.16  ? 161  ARG B NE    1 
ATOM   3059  C  CZ    . ARG B 1  161  ? -41.575 19.230  144.384 1.00   72.74  ? 161  ARG B CZ    1 
ATOM   3060  N  NH1   . ARG B 1  161  ? -42.889 19.126  144.248 1.00   75.73  ? 161  ARG B NH1   1 
ATOM   3061  N  NH2   . ARG B 1  161  ? -41.052 20.330  144.911 1.00   74.90  ? 161  ARG B NH2   1 
ATOM   3062  N  N     . ILE B 1  162  ? -40.059 12.517  144.412 1.00   62.27  ? 162  ILE B N     1 
ATOM   3063  C  CA    . ILE B 1  162  ? -40.338 11.217  143.808 1.00   59.34  ? 162  ILE B CA    1 
ATOM   3064  C  C     . ILE B 1  162  ? -40.680 11.319  142.320 1.00   63.96  ? 162  ILE B C     1 
ATOM   3065  O  O     . ILE B 1  162  ? -40.344 10.430  141.537 1.00   67.01  ? 162  ILE B O     1 
ATOM   3066  C  CB    . ILE B 1  162  ? -41.450 10.456  144.574 1.00   61.09  ? 162  ILE B CB    1 
ATOM   3067  C  CG1   . ILE B 1  162  ? -41.629 9.044   144.011 1.00   58.76  ? 162  ILE B CG1   1 
ATOM   3068  C  CG2   . ILE B 1  162  ? -42.759 11.234  144.551 1.00   66.31  ? 162  ILE B CG2   1 
ATOM   3069  C  CD1   . ILE B 1  162  ? -40.381 8.191   144.100 1.00   55.11  ? 162  ILE B CD1   1 
ATOM   3070  N  N     . ASN B 1  163  ? -41.333 12.409  141.929 1.00   68.13  ? 163  ASN B N     1 
ATOM   3071  C  CA    . ASN B 1  163  ? -41.729 12.600  140.536 1.00   76.29  ? 163  ASN B CA    1 
ATOM   3072  C  C     . ASN B 1  163  ? -40.739 13.414  139.705 1.00   77.59  ? 163  ASN B C     1 
ATOM   3073  O  O     . ASN B 1  163  ? -40.999 13.715  138.539 1.00   67.72  ? 163  ASN B O     1 
ATOM   3074  C  CB    . ASN B 1  163  ? -43.131 13.207  140.447 1.00   74.42  ? 163  ASN B CB    1 
ATOM   3075  C  CG    . ASN B 1  163  ? -44.217 12.201  140.764 1.00   80.72  ? 163  ASN B CG    1 
ATOM   3076  O  OD1   . ASN B 1  163  ? -44.040 10.997  140.569 1.00   71.59  ? 163  ASN B OD1   1 
ATOM   3077  N  ND2   . ASN B 1  163  ? -45.351 12.689  141.254 1.00   91.87  ? 163  ASN B ND2   1 
ATOM   3078  N  N     . ALA B 1  164  ? -39.612 13.777  140.310 1.00   81.12  ? 164  ALA B N     1 
ATOM   3079  C  CA    . ALA B 1  164  ? -38.562 14.495  139.596 1.00   70.53  ? 164  ALA B CA    1 
ATOM   3080  C  C     . ALA B 1  164  ? -37.939 13.602  138.528 1.00   74.28  ? 164  ALA B C     1 
ATOM   3081  O  O     . ALA B 1  164  ? -37.521 12.479  138.812 1.00   73.53  ? 164  ALA B O     1 
ATOM   3082  C  CB    . ALA B 1  164  ? -37.498 14.992  140.566 1.00   68.58  ? 164  ALA B CB    1 
ATOM   3083  N  N     . ILE B 1  165  ? -37.883 14.108  137.300 1.00   81.27  ? 165  ILE B N     1 
ATOM   3084  C  CA    . ILE B 1  165  ? -37.348 13.345  136.177 1.00   75.16  ? 165  ILE B CA    1 
ATOM   3085  C  C     . ILE B 1  165  ? -35.873 13.651  135.941 1.00   71.88  ? 165  ILE B C     1 
ATOM   3086  O  O     . ILE B 1  165  ? -35.506 14.803  135.702 1.00   62.97  ? 165  ILE B O     1 
ATOM   3087  C  CB    . ILE B 1  165  ? -38.115 13.642  134.873 1.00   65.94  ? 165  ILE B CB    1 
ATOM   3088  C  CG1   . ILE B 1  165  ? -39.619 13.452  135.076 1.00   69.45  ? 165  ILE B CG1   1 
ATOM   3089  C  CG2   . ILE B 1  165  ? -37.611 12.756  133.745 1.00   70.59  ? 165  ILE B CG2   1 
ATOM   3090  C  CD1   . ILE B 1  165  ? -40.435 13.711  133.830 1.00   58.32  ? 165  ILE B CD1   1 
ATOM   3091  N  N     . PRO B 1  166  ? -35.021 12.616  136.008 1.00   73.64  ? 166  PRO B N     1 
ATOM   3092  C  CA    . PRO B 1  166  ? -33.599 12.782  135.691 1.00   66.21  ? 166  PRO B CA    1 
ATOM   3093  C  C     . PRO B 1  166  ? -33.413 13.111  134.213 1.00   63.12  ? 166  PRO B C     1 
ATOM   3094  O  O     . PRO B 1  166  ? -34.002 12.453  133.355 1.00   61.79  ? 166  PRO B O     1 
ATOM   3095  C  CB    . PRO B 1  166  ? -33.004 11.409  136.016 1.00   63.50  ? 166  PRO B CB    1 
ATOM   3096  C  CG    . PRO B 1  166  ? -34.149 10.461  135.907 1.00   67.26  ? 166  PRO B CG    1 
ATOM   3097  C  CD    . PRO B 1  166  ? -35.350 11.228  136.373 1.00   71.51  ? 166  PRO B CD    1 
ATOM   3098  N  N     . VAL B 1  167  ? -32.602 14.123  133.927 1.00   60.72  ? 167  VAL B N     1 
ATOM   3099  C  CA    . VAL B 1  167  ? -32.408 14.592  132.561 1.00   60.55  ? 167  VAL B CA    1 
ATOM   3100  C  C     . VAL B 1  167  ? -30.956 14.411  132.138 1.00   59.24  ? 167  VAL B C     1 
ATOM   3101  O  O     . VAL B 1  167  ? -30.046 14.612  132.943 1.00   60.22  ? 167  VAL B O     1 
ATOM   3102  C  CB    . VAL B 1  167  ? -32.778 16.085  132.438 1.00   58.06  ? 167  VAL B CB    1 
ATOM   3103  C  CG1   . VAL B 1  167  ? -32.692 16.547  130.991 1.00   49.84  ? 167  VAL B CG1   1 
ATOM   3104  C  CG2   . VAL B 1  167  ? -34.167 16.332  132.999 1.00   64.49  ? 167  VAL B CG2   1 
ATOM   3105  N  N     . ASP B 1  168  ? -30.741 14.016  130.884 1.00   58.65  ? 168  ASP B N     1 
ATOM   3106  C  CA    . ASP B 1  168  ? -29.393 13.973  130.334 1.00   48.90  ? 168  ASP B CA    1 
ATOM   3107  C  C     . ASP B 1  168  ? -28.828 15.383  130.419 1.00   42.33  ? 168  ASP B C     1 
ATOM   3108  O  O     . ASP B 1  168  ? -29.410 16.327  129.889 1.00   46.45  ? 168  ASP B O     1 
ATOM   3109  C  CB    . ASP B 1  168  ? -29.418 13.499  128.879 1.00   43.87  ? 168  ASP B CB    1 
ATOM   3110  C  CG    . ASP B 1  168  ? -29.993 12.101  128.727 1.00   46.47  ? 168  ASP B CG    1 
ATOM   3111  O  OD1   . ASP B 1  168  ? -29.573 11.199  129.481 1.00   49.98  ? 168  ASP B OD1   1 
ATOM   3112  O  OD2   . ASP B 1  168  ? -30.869 11.904  127.858 1.00   40.35  ? 168  ASP B OD2   1 
ATOM   3113  N  N     . ALA B 1  169  ? -27.689 15.522  131.083 1.00   37.19  ? 169  ALA B N     1 
ATOM   3114  C  CA    . ALA B 1  169  ? -27.161 16.842  131.394 1.00   39.56  ? 169  ALA B CA    1 
ATOM   3115  C  C     . ALA B 1  169  ? -25.976 17.197  130.512 1.00   42.42  ? 169  ALA B C     1 
ATOM   3116  O  O     . ALA B 1  169  ? -24.940 16.536  130.561 1.00   44.92  ? 169  ALA B O     1 
ATOM   3117  C  CB    . ALA B 1  169  ? -26.769 16.917  132.858 1.00   43.87  ? 169  ALA B CB    1 
ATOM   3118  N  N     . VAL B 1  170  ? -26.124 18.247  129.712 1.00   41.79  ? 170  VAL B N     1 
ATOM   3119  C  CA    . VAL B 1  170  ? -25.018 18.696  128.887 1.00   39.97  ? 170  VAL B CA    1 
ATOM   3120  C  C     . VAL B 1  170  ? -24.392 19.915  129.537 1.00   43.26  ? 170  VAL B C     1 
ATOM   3121  O  O     . VAL B 1  170  ? -24.910 21.026  129.430 1.00   44.74  ? 170  VAL B O     1 
ATOM   3122  C  CB    . VAL B 1  170  ? -25.520 19.114  127.501 1.00   43.54  ? 170  VAL B CB    1 
ATOM   3123  C  CG1   . VAL B 1  170  ? -24.349 19.351  126.565 1.00   58.95  ? 170  VAL B CG1   1 
ATOM   3124  C  CG2   . VAL B 1  170  ? -26.467 18.063  126.940 1.00   40.98  ? 170  VAL B CG2   1 
ATOM   3125  N  N     . PHE B 1  171  ? -23.245 19.711  130.174 1.00   43.54  ? 171  PHE B N     1 
ATOM   3126  C  CA    . PHE B 1  171  ? -22.586 20.788  130.894 1.00   48.40  ? 171  PHE B CA    1 
ATOM   3127  C  C     . PHE B 1  171  ? -21.756 21.646  129.961 1.00   56.34  ? 171  PHE B C     1 
ATOM   3128  O  O     . PHE B 1  171  ? -21.779 22.874  130.047 1.00   56.86  ? 171  PHE B O     1 
ATOM   3129  C  CB    . PHE B 1  171  ? -21.716 20.232  132.022 1.00   51.62  ? 171  PHE B CB    1 
ATOM   3130  C  CG    . PHE B 1  171  ? -22.501 19.636  133.154 1.00   51.80  ? 171  PHE B CG    1 
ATOM   3131  C  CD1   . PHE B 1  171  ? -23.124 20.450  134.085 1.00   51.57  ? 171  PHE B CD1   1 
ATOM   3132  C  CD2   . PHE B 1  171  ? -22.614 18.262  133.289 1.00   52.05  ? 171  PHE B CD2   1 
ATOM   3133  C  CE1   . PHE B 1  171  ? -23.846 19.907  135.129 1.00   53.09  ? 171  PHE B CE1   1 
ATOM   3134  C  CE2   . PHE B 1  171  ? -23.337 17.712  134.332 1.00   50.55  ? 171  PHE B CE2   1 
ATOM   3135  C  CZ    . PHE B 1  171  ? -23.953 18.536  135.252 1.00   52.23  ? 171  PHE B CZ    1 
ATOM   3136  N  N     . SER B 1  172  ? -21.039 20.982  129.059 1.00   62.18  ? 172  SER B N     1 
ATOM   3137  C  CA    . SER B 1  172  ? -20.059 21.642  128.205 1.00   63.15  ? 172  SER B CA    1 
ATOM   3138  C  C     . SER B 1  172  ? -20.664 22.767  127.378 1.00   59.99  ? 172  SER B C     1 
ATOM   3139  O  O     . SER B 1  172  ? -21.562 22.538  126.567 1.00   52.75  ? 172  SER B O     1 
ATOM   3140  C  CB    . SER B 1  172  ? -19.379 20.628  127.284 1.00   54.06  ? 172  SER B CB    1 
ATOM   3141  O  OG    . SER B 1  172  ? -18.472 21.275  126.410 1.00   57.81  ? 172  SER B OG    1 
ATOM   3142  N  N     . PRO B 1  173  ? -20.164 23.993  127.587 1.00   60.08  ? 173  PRO B N     1 
ATOM   3143  C  CA    . PRO B 1  173  ? -20.604 25.164  126.827 1.00   62.19  ? 173  PRO B CA    1 
ATOM   3144  C  C     . PRO B 1  173  ? -20.148 25.057  125.380 1.00   62.37  ? 173  PRO B C     1 
ATOM   3145  O  O     . PRO B 1  173  ? -20.671 25.759  124.519 1.00   64.23  ? 173  PRO B O     1 
ATOM   3146  C  CB    . PRO B 1  173  ? -19.889 26.322  127.527 1.00   64.55  ? 173  PRO B CB    1 
ATOM   3147  C  CG    . PRO B 1  173  ? -18.682 25.705  128.124 1.00   57.99  ? 173  PRO B CG    1 
ATOM   3148  C  CD    . PRO B 1  173  ? -19.095 24.327  128.544 1.00   57.77  ? 173  PRO B CD    1 
ATOM   3149  N  N     . VAL B 1  174  ? -19.185 24.176  125.126 1.00   63.08  ? 174  VAL B N     1 
ATOM   3150  C  CA    . VAL B 1  174  ? -18.657 23.974  123.784 1.00   61.87  ? 174  VAL B CA    1 
ATOM   3151  C  C     . VAL B 1  174  ? -19.471 22.928  123.029 1.00   60.50  ? 174  VAL B C     1 
ATOM   3152  O  O     . VAL B 1  174  ? -19.522 21.763  123.425 1.00   62.07  ? 174  VAL B O     1 
ATOM   3153  C  CB    . VAL B 1  174  ? -17.190 23.518  123.823 1.00   54.61  ? 174  VAL B CB    1 
ATOM   3154  C  CG1   . VAL B 1  174  ? -16.708 23.186  122.427 1.00   55.46  ? 174  VAL B CG1   1 
ATOM   3155  C  CG2   . VAL B 1  174  ? -16.315 24.589  124.458 1.00   53.87  ? 174  VAL B CG2   1 
ATOM   3156  N  N     . ARG B 1  175  ? -20.102 23.350  121.938 1.00   55.76  ? 175  ARG B N     1 
ATOM   3157  C  CA    . ARG B 1  175  ? -20.946 22.460  121.147 1.00   55.28  ? 175  ARG B CA    1 
ATOM   3158  C  C     . ARG B 1  175  ? -20.129 21.530  120.250 1.00   60.44  ? 175  ARG B C     1 
ATOM   3159  O  O     . ARG B 1  175  ? -20.419 20.337  120.155 1.00   58.33  ? 175  ARG B O     1 
ATOM   3160  C  CB    . ARG B 1  175  ? -21.952 23.263  120.318 1.00   55.38  ? 175  ARG B CB    1 
ATOM   3161  C  CG    . ARG B 1  175  ? -22.795 24.220  121.145 1.00   58.51  ? 175  ARG B CG    1 
ATOM   3162  C  CD    . ARG B 1  175  ? -24.225 24.299  120.636 1.00   56.37  ? 175  ARG B CD    1 
ATOM   3163  N  NE    . ARG B 1  175  ? -25.089 25.013  121.572 1.00   70.82  ? 175  ARG B NE    1 
ATOM   3164  C  CZ    . ARG B 1  175  ? -25.637 24.464  122.653 1.00   72.34  ? 175  ARG B CZ    1 
ATOM   3165  N  NH1   . ARG B 1  175  ? -25.410 23.189  122.942 1.00   60.35  ? 175  ARG B NH1   1 
ATOM   3166  N  NH2   . ARG B 1  175  ? -26.410 25.191  123.450 1.00   64.60  ? 175  ARG B NH2   1 
ATOM   3167  N  N     . ARG B 1  176  ? -19.120 22.081  119.583 1.00   56.54  ? 176  ARG B N     1 
ATOM   3168  C  CA    . ARG B 1  176  ? -18.259 21.280  118.719 1.00   54.11  ? 176  ARG B CA    1 
ATOM   3169  C  C     . ARG B 1  176  ? -16.838 21.834  118.617 1.00   52.99  ? 176  ARG B C     1 
ATOM   3170  O  O     . ARG B 1  176  ? -16.629 23.048  118.614 1.00   50.32  ? 176  ARG B O     1 
ATOM   3171  C  CB    . ARG B 1  176  ? -18.882 21.142  117.324 1.00   57.57  ? 176  ARG B CB    1 
ATOM   3172  C  CG    . ARG B 1  176  ? -18.021 20.383  116.322 1.00   56.56  ? 176  ARG B CG    1 
ATOM   3173  C  CD    . ARG B 1  176  ? -18.833 19.895  115.137 1.00   60.53  ? 176  ARG B CD    1 
ATOM   3174  N  NE    . ARG B 1  176  ? -19.418 20.987  114.364 1.00   60.13  ? 176  ARG B NE    1 
ATOM   3175  C  CZ    . ARG B 1  176  ? -19.240 21.154  113.057 1.00   53.64  ? 176  ARG B CZ    1 
ATOM   3176  N  NH1   . ARG B 1  176  ? -18.495 20.299  112.370 1.00   43.63  ? 176  ARG B NH1   1 
ATOM   3177  N  NH2   . ARG B 1  176  ? -19.812 22.176  112.435 1.00   52.27  ? 176  ARG B NH2   1 
ATOM   3178  N  N     . VAL B 1  177  ? -15.865 20.931  118.541 1.00   51.84  ? 177  VAL B N     1 
ATOM   3179  C  CA    . VAL B 1  177  ? -14.486 21.301  118.253 1.00   47.94  ? 177  VAL B CA    1 
ATOM   3180  C  C     . VAL B 1  177  ? -13.990 20.523  117.044 1.00   52.87  ? 177  VAL B C     1 
ATOM   3181  O  O     . VAL B 1  177  ? -14.020 19.292  117.032 1.00   49.89  ? 177  VAL B O     1 
ATOM   3182  C  CB    . VAL B 1  177  ? -13.552 21.012  119.437 1.00   50.14  ? 177  VAL B CB    1 
ATOM   3183  C  CG1   . VAL B 1  177  ? -12.110 21.305  119.053 1.00   46.49  ? 177  VAL B CG1   1 
ATOM   3184  C  CG2   . VAL B 1  177  ? -13.956 21.833  120.642 1.00   54.03  ? 177  VAL B CG2   1 
ATOM   3185  N  N     . ALA B 1  178  ? -13.539 21.247  116.026 1.00   62.00  ? 178  ALA B N     1 
ATOM   3186  C  CA    . ALA B 1  178  ? -13.011 20.630  114.817 1.00   56.23  ? 178  ALA B CA    1 
ATOM   3187  C  C     . ALA B 1  178  ? -11.722 21.320  114.391 1.00   52.77  ? 178  ALA B C     1 
ATOM   3188  O  O     . ALA B 1  178  ? -11.680 22.542  114.248 1.00   52.59  ? 178  ALA B O     1 
ATOM   3189  C  CB    . ALA B 1  178  ? -14.042 20.685  113.700 1.00   56.31  ? 178  ALA B CB    1 
ATOM   3190  N  N     . PHE B 1  179  ? -10.668 20.536  114.196 1.00   52.71  ? 179  PHE B N     1 
ATOM   3191  C  CA    . PHE B 1  179  ? -9.386  21.092  113.784 1.00   57.86  ? 179  PHE B CA    1 
ATOM   3192  C  C     . PHE B 1  179  ? -8.832  20.377  112.559 1.00   64.91  ? 179  PHE B C     1 
ATOM   3193  O  O     . PHE B 1  179  ? -9.132  19.206  112.319 1.00   64.64  ? 179  PHE B O     1 
ATOM   3194  C  CB    . PHE B 1  179  ? -8.374  21.049  114.934 1.00   63.75  ? 179  PHE B CB    1 
ATOM   3195  C  CG    . PHE B 1  179  ? -7.738  19.702  115.142 1.00   60.25  ? 179  PHE B CG    1 
ATOM   3196  C  CD1   . PHE B 1  179  ? -6.427  19.476  114.756 1.00   52.11  ? 179  PHE B CD1   1 
ATOM   3197  C  CD2   . PHE B 1  179  ? -8.447  18.666  115.728 1.00   60.99  ? 179  PHE B CD2   1 
ATOM   3198  C  CE1   . PHE B 1  179  ? -5.836  18.243  114.947 1.00   51.84  ? 179  PHE B CE1   1 
ATOM   3199  C  CE2   . PHE B 1  179  ? -7.861  17.430  115.922 1.00   56.74  ? 179  PHE B CE2   1 
ATOM   3200  C  CZ    . PHE B 1  179  ? -6.554  17.219  115.531 1.00   60.09  ? 179  PHE B CZ    1 
ATOM   3201  N  N     . GLN B 1  180  ? -8.023  21.094  111.786 1.00   65.26  ? 180  GLN B N     1 
ATOM   3202  C  CA    . GLN B 1  180  ? -7.422  20.545  110.579 1.00   59.77  ? 180  GLN B CA    1 
ATOM   3203  C  C     . GLN B 1  180  ? -5.976  21.012  110.442 1.00   61.89  ? 180  GLN B C     1 
ATOM   3204  O  O     . GLN B 1  180  ? -5.675  22.194  110.617 1.00   56.88  ? 180  GLN B O     1 
ATOM   3205  C  CB    . GLN B 1  180  ? -8.229  20.960  109.349 1.00   58.98  ? 180  GLN B CB    1 
ATOM   3206  C  CG    . GLN B 1  180  ? -7.809  20.269  108.064 1.00   64.68  ? 180  GLN B CG    1 
ATOM   3207  C  CD    . GLN B 1  180  ? -8.551  20.803  106.854 1.00   73.84  ? 180  GLN B CD    1 
ATOM   3208  O  OE1   . GLN B 1  180  ? -9.018  21.942  106.852 1.00   86.09  ? 180  GLN B OE1   1 
ATOM   3209  N  NE2   . GLN B 1  180  ? -8.667  19.979  105.820 1.00   71.48  ? 180  GLN B NE2   1 
ATOM   3210  N  N     . VAL B 1  181  ? -5.084  20.077  110.134 1.00   65.54  ? 181  VAL B N     1 
ATOM   3211  C  CA    . VAL B 1  181  ? -3.668  20.392  109.989 1.00   63.76  ? 181  VAL B CA    1 
ATOM   3212  C  C     . VAL B 1  181  ? -3.237  20.372  108.527 1.00   60.19  ? 181  VAL B C     1 
ATOM   3213  O  O     . VAL B 1  181  ? -3.288  19.337  107.863 1.00   53.33  ? 181  VAL B O     1 
ATOM   3214  C  CB    . VAL B 1  181  ? -2.791  19.423  110.799 1.00   63.40  ? 181  VAL B CB    1 
ATOM   3215  C  CG1   . VAL B 1  181  ? -1.317  19.733  110.587 1.00   62.74  ? 181  VAL B CG1   1 
ATOM   3216  C  CG2   . VAL B 1  181  ? -3.151  19.506  112.271 1.00   65.60  ? 181  VAL B CG2   1 
ATOM   3217  N  N     . GLU B 1  182  ? -2.812  21.530  108.033 1.00   61.56  ? 182  GLU B N     1 
ATOM   3218  C  CA    . GLU B 1  182  ? -2.396  21.667  106.646 1.00   64.25  ? 182  GLU B CA    1 
ATOM   3219  C  C     . GLU B 1  182  ? -0.891  21.886  106.568 1.00   67.84  ? 182  GLU B C     1 
ATOM   3220  O  O     . GLU B 1  182  ? -0.303  22.522  107.444 1.00   64.77  ? 182  GLU B O     1 
ATOM   3221  C  CB    . GLU B 1  182  ? -3.124  22.844  105.994 1.00   67.41  ? 182  GLU B CB    1 
ATOM   3222  C  CG    . GLU B 1  182  ? -4.625  22.861  106.236 1.00   68.31  ? 182  GLU B CG    1 
ATOM   3223  C  CD    . GLU B 1  182  ? -5.280  24.137  105.741 1.00   72.55  ? 182  GLU B CD    1 
ATOM   3224  O  OE1   . GLU B 1  182  ? -6.456  24.378  106.086 1.00   68.90  ? 182  GLU B OE1   1 
ATOM   3225  O  OE2   . GLU B 1  182  ? -4.616  24.899  105.007 1.00   74.18  ? 182  GLU B OE2   1 
ATOM   3226  N  N     . ASP B 1  183  ? -0.268  21.352  105.522 1.00   66.25  ? 183  ASP B N     1 
ATOM   3227  C  CA    . ASP B 1  183  ? 1.157   21.564  105.298 1.00   66.73  ? 183  ASP B CA    1 
ATOM   3228  C  C     . ASP B 1  183  ? 1.420   22.983  104.808 1.00   64.64  ? 183  ASP B C     1 
ATOM   3229  O  O     . ASP B 1  183  ? 0.760   23.465  103.887 1.00   60.18  ? 183  ASP B O     1 
ATOM   3230  C  CB    . ASP B 1  183  ? 1.709   20.546  104.296 1.00   74.10  ? 183  ASP B CB    1 
ATOM   3231  C  CG    . ASP B 1  183  ? 2.067   19.220  104.944 1.00   84.95  ? 183  ASP B CG    1 
ATOM   3232  O  OD1   . ASP B 1  183  ? 2.629   19.231  106.061 1.00   90.86  ? 183  ASP B OD1   1 
ATOM   3233  O  OD2   . ASP B 1  183  ? 1.788   18.165  104.334 1.00   83.42  ? 183  ASP B OD2   1 
ATOM   3234  N  N     . THR B 1  184  ? 2.381   23.651  105.438 1.00   62.13  ? 184  THR B N     1 
ATOM   3235  C  CA    . THR B 1  184  ? 2.776   24.995  105.036 1.00   59.24  ? 184  THR B CA    1 
ATOM   3236  C  C     . THR B 1  184  ? 4.296   25.096  105.005 1.00   74.69  ? 184  THR B C     1 
ATOM   3237  O  O     . THR B 1  184  ? 4.991   24.224  105.525 1.00   81.84  ? 184  THR B O     1 
ATOM   3238  C  CB    . THR B 1  184  ? 2.216   26.062  105.991 1.00   58.43  ? 184  THR B CB    1 
ATOM   3239  O  OG1   . THR B 1  184  ? 2.502   27.366  105.471 1.00   67.98  ? 184  THR B OG1   1 
ATOM   3240  C  CG2   . THR B 1  184  ? 2.837   25.922  107.372 1.00   64.51  ? 184  THR B CG2   1 
ATOM   3241  N  N     . ARG B 1  185  ? 4.812   26.157  104.394 1.00   77.42  ? 185  ARG B N     1 
ATOM   3242  C  CA    . ARG B 1  185  ? 6.256   26.317  104.271 1.00   82.83  ? 185  ARG B CA    1 
ATOM   3243  C  C     . ARG B 1  185  ? 6.745   27.697  104.711 1.00   89.51  ? 185  ARG B C     1 
ATOM   3244  O  O     . ARG B 1  185  ? 6.145   28.720  104.380 1.00   95.97  ? 185  ARG B O     1 
ATOM   3245  C  CB    . ARG B 1  185  ? 6.712   26.023  102.837 1.00   86.95  ? 185  ARG B CB    1 
ATOM   3246  C  CG    . ARG B 1  185  ? 6.163   26.981  101.794 1.00   92.63  ? 185  ARG B CG    1 
ATOM   3247  C  CD    . ARG B 1  185  ? 6.773   26.725  100.427 1.00   90.20  ? 185  ARG B CD    1 
ATOM   3248  N  NE    . ARG B 1  185  ? 6.575   27.857  99.529  1.00   82.08  ? 185  ARG B NE    1 
ATOM   3249  C  CZ    . ARG B 1  185  ? 7.415   28.882  99.428  1.00   83.58  ? 185  ARG B CZ    1 
ATOM   3250  N  NH1   . ARG B 1  185  ? 8.514   28.915  100.171 1.00   81.72  ? 185  ARG B NH1   1 
ATOM   3251  N  NH2   . ARG B 1  185  ? 7.158   29.873  98.585  1.00   78.63  ? 185  ARG B NH2   1 
ATOM   3252  N  N     . LEU B 1  186  ? 7.834   27.710  105.473 1.00   88.24  ? 186  LEU B N     1 
ATOM   3253  C  CA    . LEU B 1  186  ? 8.504   28.952  105.831 1.00   93.05  ? 186  LEU B CA    1 
ATOM   3254  C  C     . LEU B 1  186  ? 9.863   28.971  105.150 1.00   98.87  ? 186  LEU B C     1 
ATOM   3255  O  O     . LEU B 1  186  ? 10.767  28.230  105.538 1.00   100.00 ? 186  LEU B O     1 
ATOM   3256  C  CB    . LEU B 1  186  ? 8.682   29.054  107.345 1.00   84.80  ? 186  LEU B CB    1 
ATOM   3257  C  CG    . LEU B 1  186  ? 9.488   30.254  107.851 1.00   89.60  ? 186  LEU B CG    1 
ATOM   3258  C  CD1   . LEU B 1  186  ? 8.718   31.551  107.644 1.00   86.88  ? 186  LEU B CD1   1 
ATOM   3259  C  CD2   . LEU B 1  186  ? 9.875   30.074  109.313 1.00   97.24  ? 186  LEU B CD2   1 
ATOM   3260  N  N     . GLY B 1  187  ? 10.011  29.827  104.145 1.00   95.99  ? 187  GLY B N     1 
ATOM   3261  C  CA    . GLY B 1  187  ? 11.217  29.828  103.342 1.00   93.77  ? 187  GLY B CA    1 
ATOM   3262  C  C     . GLY B 1  187  ? 11.369  28.491  102.645 1.00   96.32  ? 187  GLY B C     1 
ATOM   3263  O  O     . GLY B 1  187  ? 10.485  28.063  101.901 1.00   84.51  ? 187  GLY B O     1 
ATOM   3264  N  N     . GLN B 1  188  ? 12.498  27.832  102.883 1.00   101.87 ? 188  GLN B N     1 
ATOM   3265  C  CA    . GLN B 1  188  ? 12.747  26.517  102.305 1.00   100.67 ? 188  GLN B CA    1 
ATOM   3266  C  C     . GLN B 1  188  ? 12.379  25.362  103.241 1.00   105.68 ? 188  GLN B C     1 
ATOM   3267  O  O     . GLN B 1  188  ? 12.625  24.198  102.921 1.00   103.62 ? 188  GLN B O     1 
ATOM   3268  C  CB    . GLN B 1  188  ? 14.195  26.391  101.827 1.00   95.18  ? 188  GLN B CB    1 
ATOM   3269  C  CG    . GLN B 1  188  ? 14.359  25.460  100.635 1.00   95.49  ? 188  GLN B CG    1 
ATOM   3270  C  CD    . GLN B 1  188  ? 13.391  25.785  99.510  1.00   85.91  ? 188  GLN B CD    1 
ATOM   3271  O  OE1   . GLN B 1  188  ? 13.191  26.949  99.163  1.00   86.32  ? 188  GLN B OE1   1 
ATOM   3272  N  NE2   . GLN B 1  188  ? 12.778  24.753  98.943  1.00   77.33  ? 188  GLN B NE2   1 
ATOM   3273  N  N     . ARG B 1  189  ? 11.794  25.675  104.395 1.00   107.62 ? 189  ARG B N     1 
ATOM   3274  C  CA    . ARG B 1  189  ? 11.343  24.623  105.299 1.00   99.46  ? 189  ARG B CA    1 
ATOM   3275  C  C     . ARG B 1  189  ? 10.088  23.997  104.700 1.00   100.57 ? 189  ARG B C     1 
ATOM   3276  O  O     . ARG B 1  189  ? 9.073   24.667  104.512 1.00   93.05  ? 189  ARG B O     1 
ATOM   3277  C  CB    . ARG B 1  189  ? 11.032  25.198  106.681 1.00   100.62 ? 189  ARG B CB    1 
ATOM   3278  C  CG    . ARG B 1  189  ? 12.245  25.663  107.474 1.00   96.11  ? 189  ARG B CG    1 
ATOM   3279  C  CD    . ARG B 1  189  ? 13.074  24.487  107.966 1.00   102.11 ? 189  ARG B CD    1 
ATOM   3280  N  NE    . ARG B 1  189  ? 13.870  24.830  109.143 1.00   114.94 ? 189  ARG B NE    1 
ATOM   3281  C  CZ    . ARG B 1  189  ? 13.486  24.606  110.396 1.00   107.56 ? 189  ARG B CZ    1 
ATOM   3282  N  NH1   . ARG B 1  189  ? 14.273  24.951  111.407 1.00   104.41 ? 189  ARG B NH1   1 
ATOM   3283  N  NH2   . ARG B 1  189  ? 12.314  24.034  110.641 1.00   96.72  ? 189  ARG B NH2   1 
ATOM   3284  N  N     . THR B 1  190  ? 10.172  22.705  104.402 1.00   100.63 ? 190  THR B N     1 
ATOM   3285  C  CA    . THR B 1  190  ? 9.153   22.029  103.603 1.00   98.75  ? 190  THR B CA    1 
ATOM   3286  C  C     . THR B 1  190  ? 7.911   21.529  104.346 1.00   100.55 ? 190  THR B C     1 
ATOM   3287  O  O     . THR B 1  190  ? 6.784   21.730  103.892 1.00   96.92  ? 190  THR B O     1 
ATOM   3288  C  CB    . THR B 1  190  ? 9.775   20.835  102.858 1.00   98.68  ? 190  THR B CB    1 
ATOM   3289  O  OG1   . THR B 1  190  ? 9.815   19.694  103.725 1.00   110.23 ? 190  THR B OG1   1 
ATOM   3290  C  CG2   . THR B 1  190  ? 11.188  21.175  102.410 1.00   90.62  ? 190  THR B CG2   1 
ATOM   3291  N  N     . ASP B 1  191  ? 8.125   20.878  105.485 1.00   93.31  ? 191  ASP B N     1 
ATOM   3292  C  CA    . ASP B 1  191  ? 7.074   20.075  106.112 1.00   91.43  ? 191  ASP B CA    1 
ATOM   3293  C  C     . ASP B 1  191  ? 6.291   20.743  107.245 1.00   89.12  ? 191  ASP B C     1 
ATOM   3294  O  O     . ASP B 1  191  ? 5.453   20.097  107.876 1.00   88.11  ? 191  ASP B O     1 
ATOM   3295  C  CB    . ASP B 1  191  ? 7.639   18.732  106.583 1.00   93.32  ? 191  ASP B CB    1 
ATOM   3296  C  CG    . ASP B 1  191  ? 6.569   17.664  106.711 1.00   96.88  ? 191  ASP B CG    1 
ATOM   3297  O  OD1   . ASP B 1  191  ? 5.417   18.011  107.055 1.00   98.01  ? 191  ASP B OD1   1 
ATOM   3298  O  OD2   . ASP B 1  191  ? 6.878   16.480  106.459 1.00   93.11  ? 191  ASP B OD2   1 
ATOM   3299  N  N     . LEU B 1  192  ? 6.570   22.018  107.507 1.00   83.51  ? 192  LEU B N     1 
ATOM   3300  C  CA    . LEU B 1  192  ? 5.977   22.724  108.646 1.00   78.58  ? 192  LEU B CA    1 
ATOM   3301  C  C     . LEU B 1  192  ? 4.444   22.666  108.676 1.00   76.29  ? 192  LEU B C     1 
ATOM   3302  O  O     . LEU B 1  192  ? 3.789   22.730  107.635 1.00   75.26  ? 192  LEU B O     1 
ATOM   3303  C  CB    . LEU B 1  192  ? 6.460   24.177  108.688 1.00   72.73  ? 192  LEU B CB    1 
ATOM   3304  C  CG    . LEU B 1  192  ? 7.976   24.383  108.758 1.00   71.37  ? 192  LEU B CG    1 
ATOM   3305  C  CD1   . LEU B 1  192  ? 8.305   25.838  109.054 1.00   81.70  ? 192  LEU B CD1   1 
ATOM   3306  C  CD2   . LEU B 1  192  ? 8.611   23.463  109.792 1.00   66.79  ? 192  LEU B CD2   1 
ATOM   3307  N  N     . ASP B 1  193  ? 3.887   22.536  109.878 1.00   68.39  ? 193  ASP B N     1 
ATOM   3308  C  CA    . ASP B 1  193  ? 2.449   22.336  110.059 1.00   62.11  ? 193  ASP B CA    1 
ATOM   3309  C  C     . ASP B 1  193  ? 1.682   23.631  110.319 1.00   58.29  ? 193  ASP B C     1 
ATOM   3310  O  O     . ASP B 1  193  ? 2.185   24.542  110.977 1.00   59.59  ? 193  ASP B O     1 
ATOM   3311  C  CB    . ASP B 1  193  ? 2.187   21.348  111.202 1.00   59.81  ? 193  ASP B CB    1 
ATOM   3312  C  CG    . ASP B 1  193  ? 2.515   19.913  110.826 1.00   68.71  ? 193  ASP B CG    1 
ATOM   3313  O  OD1   . ASP B 1  193  ? 3.216   19.701  109.813 1.00   81.91  ? 193  ASP B OD1   1 
ATOM   3314  O  OD2   . ASP B 1  193  ? 2.072   18.995  111.549 1.00   56.89  ? 193  ASP B OD2   1 
ATOM   3315  N  N     . LYS B 1  194  ? 0.463   23.702  109.789 1.00   57.85  ? 194  LYS B N     1 
ATOM   3316  C  CA    . LYS B 1  194  ? -0.447  24.810  110.068 1.00   62.78  ? 194  LYS B CA    1 
ATOM   3317  C  C     . LYS B 1  194  ? -1.694  24.306  110.793 1.00   68.80  ? 194  LYS B C     1 
ATOM   3318  O  O     . LYS B 1  194  ? -2.452  23.501  110.252 1.00   70.86  ? 194  LYS B O     1 
ATOM   3319  C  CB    . LYS B 1  194  ? -0.858  25.518  108.776 1.00   55.61  ? 194  LYS B CB    1 
ATOM   3320  C  CG    . LYS B 1  194  ? -1.934  26.577  108.981 1.00   61.28  ? 194  LYS B CG    1 
ATOM   3321  C  CD    . LYS B 1  194  ? -2.573  27.007  107.668 1.00   61.76  ? 194  LYS B CD    1 
ATOM   3322  C  CE    . LYS B 1  194  ? -3.712  27.987  107.912 1.00   53.13  ? 194  LYS B CE    1 
ATOM   3323  N  NZ    . LYS B 1  194  ? -4.433  28.353  106.663 1.00   46.50  ? 194  LYS B NZ    1 
ATOM   3324  N  N     . LEU B 1  195  ? -1.906  24.784  112.015 1.00   62.25  ? 195  LEU B N     1 
ATOM   3325  C  CA    . LEU B 1  195  ? -3.049  24.347  112.812 1.00   64.41  ? 195  LEU B CA    1 
ATOM   3326  C  C     . LEU B 1  195  ? -4.212  25.334  112.752 1.00   64.84  ? 195  LEU B C     1 
ATOM   3327  O  O     . LEU B 1  195  ? -4.055  26.515  113.058 1.00   62.42  ? 195  LEU B O     1 
ATOM   3328  C  CB    . LEU B 1  195  ? -2.634  24.112  114.267 1.00   63.54  ? 195  LEU B CB    1 
ATOM   3329  C  CG    . LEU B 1  195  ? -3.745  23.678  115.226 1.00   50.69  ? 195  LEU B CG    1 
ATOM   3330  C  CD1   . LEU B 1  195  ? -4.397  22.390  114.748 1.00   45.67  ? 195  LEU B CD1   1 
ATOM   3331  C  CD2   . LEU B 1  195  ? -3.206  23.517  116.639 1.00   46.43  ? 195  LEU B CD2   1 
ATOM   3332  N  N     . THR B 1  196  ? -5.380  24.837  112.357 1.00   63.67  ? 196  THR B N     1 
ATOM   3333  C  CA    . THR B 1  196  ? -6.592  25.647  112.326 1.00   59.66  ? 196  THR B CA    1 
ATOM   3334  C  C     . THR B 1  196  ? -7.648  25.038  113.240 1.00   65.16  ? 196  THR B C     1 
ATOM   3335  O  O     . THR B 1  196  ? -8.058  23.895  113.049 1.00   62.34  ? 196  THR B O     1 
ATOM   3336  C  CB    . THR B 1  196  ? -7.164  25.760  110.903 1.00   56.63  ? 196  THR B CB    1 
ATOM   3337  O  OG1   . THR B 1  196  ? -6.202  26.392  110.049 1.00   65.86  ? 196  THR B OG1   1 
ATOM   3338  C  CG2   . THR B 1  196  ? -8.447  26.579  110.906 1.00   51.69  ? 196  THR B CG2   1 
ATOM   3339  N  N     . LEU B 1  197  ? -8.087  25.806  114.233 1.00   68.26  ? 197  LEU B N     1 
ATOM   3340  C  CA    . LEU B 1  197  ? -9.051  25.312  115.209 1.00   59.91  ? 197  LEU B CA    1 
ATOM   3341  C  C     . LEU B 1  197  ? -10.399 26.017  115.077 1.00   57.17  ? 197  LEU B C     1 
ATOM   3342  O  O     . LEU B 1  197  ? -10.461 27.220  114.823 1.00   57.71  ? 197  LEU B O     1 
ATOM   3343  C  CB    . LEU B 1  197  ? -8.502  25.474  116.628 1.00   58.73  ? 197  LEU B CB    1 
ATOM   3344  C  CG    . LEU B 1  197  ? -9.307  24.816  117.750 1.00   64.60  ? 197  LEU B CG    1 
ATOM   3345  C  CD1   . LEU B 1  197  ? -9.386  23.315  117.540 1.00   58.37  ? 197  LEU B CD1   1 
ATOM   3346  C  CD2   . LEU B 1  197  ? -8.704  25.138  119.107 1.00   69.54  ? 197  LEU B CD2   1 
ATOM   3347  N  N     . ARG B 1  198  ? -11.476 25.255  115.248 1.00   55.55  ? 198  ARG B N     1 
ATOM   3348  C  CA    . ARG B 1  198  ? -12.829 25.788  115.140 1.00   59.39  ? 198  ARG B CA    1 
ATOM   3349  C  C     . ARG B 1  198  ? -13.662 25.389  116.359 1.00   62.76  ? 198  ARG B C     1 
ATOM   3350  O  O     . ARG B 1  198  ? -13.810 24.204  116.657 1.00   62.99  ? 198  ARG B O     1 
ATOM   3351  C  CB    . ARG B 1  198  ? -13.492 25.280  113.859 1.00   62.00  ? 198  ARG B CB    1 
ATOM   3352  C  CG    . ARG B 1  198  ? -12.684 25.536  112.594 1.00   67.04  ? 198  ARG B CG    1 
ATOM   3353  C  CD    . ARG B 1  198  ? -13.155 24.654  111.448 1.00   63.66  ? 198  ARG B CD    1 
ATOM   3354  N  NE    . ARG B 1  198  ? -14.533 24.941  111.061 1.00   68.83  ? 198  ARG B NE    1 
ATOM   3355  C  CZ    . ARG B 1  198  ? -15.231 24.217  110.193 1.00   73.71  ? 198  ARG B CZ    1 
ATOM   3356  N  NH1   . ARG B 1  198  ? -16.480 24.553  109.899 1.00   66.20  ? 198  ARG B NH1   1 
ATOM   3357  N  NH2   . ARG B 1  198  ? -14.683 23.153  109.620 1.00   75.98  ? 198  ARG B NH2   1 
ATOM   3358  N  N     . ILE B 1  199  ? -14.205 26.380  117.060 1.00   60.89  ? 199  ILE B N     1 
ATOM   3359  C  CA    . ILE B 1  199  ? -14.943 26.125  118.294 1.00   54.14  ? 199  ILE B CA    1 
ATOM   3360  C  C     . ILE B 1  199  ? -16.373 26.664  118.254 1.00   59.29  ? 199  ILE B C     1 
ATOM   3361  O  O     . ILE B 1  199  ? -16.596 27.840  117.965 1.00   62.41  ? 199  ILE B O     1 
ATOM   3362  C  CB    . ILE B 1  199  ? -14.221 26.733  119.514 1.00   56.95  ? 199  ILE B CB    1 
ATOM   3363  C  CG1   . ILE B 1  199  ? -12.780 26.225  119.595 1.00   57.72  ? 199  ILE B CG1   1 
ATOM   3364  C  CG2   . ILE B 1  199  ? -14.972 26.412  120.797 1.00   61.85  ? 199  ILE B CG2   1 
ATOM   3365  C  CD1   . ILE B 1  199  ? -11.990 26.820  120.740 1.00   56.21  ? 199  ILE B CD1   1 
ATOM   3366  N  N     . TRP B 1  200  ? -17.335 25.794  118.549 1.00   60.90  ? 200  TRP B N     1 
ATOM   3367  C  CA    . TRP B 1  200  ? -18.736 26.189  118.660 1.00   62.87  ? 200  TRP B CA    1 
ATOM   3368  C  C     . TRP B 1  200  ? -19.160 26.208  120.124 1.00   67.53  ? 200  TRP B C     1 
ATOM   3369  O  O     . TRP B 1  200  ? -18.983 25.222  120.838 1.00   65.15  ? 200  TRP B O     1 
ATOM   3370  C  CB    . TRP B 1  200  ? -19.635 25.220  117.889 1.00   63.02  ? 200  TRP B CB    1 
ATOM   3371  C  CG    . TRP B 1  200  ? -19.573 25.368  116.401 1.00   63.83  ? 200  TRP B CG    1 
ATOM   3372  C  CD1   . TRP B 1  200  ? -20.485 25.991  115.602 1.00   61.13  ? 200  TRP B CD1   1 
ATOM   3373  C  CD2   . TRP B 1  200  ? -18.546 24.877  115.532 1.00   58.40  ? 200  TRP B CD2   1 
ATOM   3374  N  NE1   . TRP B 1  200  ? -20.090 25.921  114.288 1.00   59.89  ? 200  TRP B NE1   1 
ATOM   3375  C  CE2   . TRP B 1  200  ? -18.902 25.242  114.219 1.00   53.22  ? 200  TRP B CE2   1 
ATOM   3376  C  CE3   . TRP B 1  200  ? -17.360 24.166  115.736 1.00   55.53  ? 200  TRP B CE3   1 
ATOM   3377  C  CZ2   . TRP B 1  200  ? -18.116 24.920  113.117 1.00   56.86  ? 200  TRP B CZ2   1 
ATOM   3378  C  CZ3   . TRP B 1  200  ? -16.583 23.847  114.642 1.00   52.82  ? 200  TRP B CZ3   1 
ATOM   3379  C  CH2   . TRP B 1  200  ? -16.962 24.224  113.349 1.00   59.74  ? 200  TRP B CH2   1 
ATOM   3380  N  N     . THR B 1  201  ? -19.721 27.328  120.569 1.00   71.95  ? 201  THR B N     1 
ATOM   3381  C  CA    . THR B 1  201  ? -20.176 27.449  121.950 1.00   69.79  ? 201  THR B CA    1 
ATOM   3382  C  C     . THR B 1  201  ? -21.656 27.813  122.030 1.00   71.86  ? 201  THR B C     1 
ATOM   3383  O  O     . THR B 1  201  ? -22.313 27.990  121.005 1.00   76.85  ? 201  THR B O     1 
ATOM   3384  C  CB    . THR B 1  201  ? -19.356 28.494  122.727 1.00   70.54  ? 201  THR B CB    1 
ATOM   3385  O  OG1   . THR B 1  201  ? -19.528 29.784  122.127 1.00   79.22  ? 201  THR B OG1   1 
ATOM   3386  C  CG2   . THR B 1  201  ? -17.878 28.127  122.720 1.00   62.64  ? 201  THR B CG2   1 
ATOM   3387  N  N     . ASP B 1  202  ? -22.179 27.913  123.249 1.00   67.18  ? 202  ASP B N     1 
ATOM   3388  C  CA    . ASP B 1  202  ? -23.574 28.302  123.448 1.00   69.51  ? 202  ASP B CA    1 
ATOM   3389  C  C     . ASP B 1  202  ? -23.732 29.793  123.746 1.00   73.82  ? 202  ASP B C     1 
ATOM   3390  O  O     . ASP B 1  202  ? -24.850 30.293  123.876 1.00   68.30  ? 202  ASP B O     1 
ATOM   3391  C  CB    . ASP B 1  202  ? -24.230 27.463  124.552 1.00   66.09  ? 202  ASP B CB    1 
ATOM   3392  C  CG    . ASP B 1  202  ? -23.438 27.469  125.848 1.00   69.14  ? 202  ASP B CG    1 
ATOM   3393  O  OD1   . ASP B 1  202  ? -22.523 28.305  125.996 1.00   70.15  ? 202  ASP B OD1   1 
ATOM   3394  O  OD2   . ASP B 1  202  ? -23.739 26.634  126.728 1.00   72.94  ? 202  ASP B OD2   1 
ATOM   3395  N  N     . GLY B 1  203  ? -22.610 30.498  123.849 1.00   77.27  ? 203  GLY B N     1 
ATOM   3396  C  CA    . GLY B 1  203  ? -22.630 31.920  124.144 1.00   78.58  ? 203  GLY B CA    1 
ATOM   3397  C  C     . GLY B 1  203  ? -22.331 32.236  125.598 1.00   80.53  ? 203  GLY B C     1 
ATOM   3398  O  O     . GLY B 1  203  ? -21.955 33.363  125.928 1.00   71.44  ? 203  GLY B O     1 
ATOM   3399  N  N     . SER B 1  204  ? -22.504 31.244  126.469 1.00   82.91  ? 204  SER B N     1 
ATOM   3400  C  CA    . SER B 1  204  ? -22.215 31.405  127.892 1.00   71.52  ? 204  SER B CA    1 
ATOM   3401  C  C     . SER B 1  204  ? -20.723 31.632  128.106 1.00   68.72  ? 204  SER B C     1 
ATOM   3402  O  O     . SER B 1  204  ? -20.317 32.454  128.927 1.00   74.60  ? 204  SER B O     1 
ATOM   3403  C  CB    . SER B 1  204  ? -22.681 30.179  128.679 1.00   61.39  ? 204  SER B CB    1 
ATOM   3404  O  OG    . SER B 1  204  ? -22.007 29.010  128.248 1.00   51.59  ? 204  SER B OG    1 
ATOM   3405  N  N     . VAL B 1  205  ? -19.914 30.886  127.363 1.00   64.75  ? 205  VAL B N     1 
ATOM   3406  C  CA    . VAL B 1  205  ? -18.471 31.078  127.357 1.00   65.57  ? 205  VAL B CA    1 
ATOM   3407  C  C     . VAL B 1  205  ? -18.018 31.213  125.908 1.00   66.21  ? 205  VAL B C     1 
ATOM   3408  O  O     . VAL B 1  205  ? -18.283 30.334  125.091 1.00   62.82  ? 205  VAL B O     1 
ATOM   3409  C  CB    . VAL B 1  205  ? -17.735 29.892  128.013 1.00   58.43  ? 205  VAL B CB    1 
ATOM   3410  C  CG1   . VAL B 1  205  ? -16.243 30.172  128.091 1.00   57.34  ? 205  VAL B CG1   1 
ATOM   3411  C  CG2   . VAL B 1  205  ? -18.296 29.613  129.397 1.00   57.37  ? 205  VAL B CG2   1 
ATOM   3412  N  N     . THR B 1  206  ? -17.351 32.317  125.585 1.00   65.66  ? 206  THR B N     1 
ATOM   3413  C  CA    . THR B 1  206  ? -16.887 32.551  124.221 1.00   59.88  ? 206  THR B CA    1 
ATOM   3414  C  C     . THR B 1  206  ? -15.809 31.534  123.851 1.00   65.73  ? 206  THR B C     1 
ATOM   3415  O  O     . THR B 1  206  ? -15.097 31.041  124.726 1.00   64.00  ? 206  THR B O     1 
ATOM   3416  C  CB    . THR B 1  206  ? -16.330 33.980  124.042 1.00   55.26  ? 206  THR B CB    1 
ATOM   3417  O  OG1   . THR B 1  206  ? -14.963 34.024  124.468 1.00   58.15  ? 206  THR B OG1   1 
ATOM   3418  C  CG2   . THR B 1  206  ? -17.147 34.978  124.842 1.00   62.68  ? 206  THR B CG2   1 
ATOM   3419  N  N     . PRO B 1  207  ? -15.697 31.205  122.552 1.00   67.88  ? 207  PRO B N     1 
ATOM   3420  C  CA    . PRO B 1  207  ? -14.703 30.234  122.080 1.00   66.47  ? 207  PRO B CA    1 
ATOM   3421  C  C     . PRO B 1  207  ? -13.279 30.581  122.513 1.00   62.95  ? 207  PRO B C     1 
ATOM   3422  O  O     . PRO B 1  207  ? -12.548 29.694  122.956 1.00   58.77  ? 207  PRO B O     1 
ATOM   3423  C  CB    . PRO B 1  207  ? -14.832 30.326  120.559 1.00   68.00  ? 207  PRO B CB    1 
ATOM   3424  C  CG    . PRO B 1  207  ? -16.249 30.711  120.341 1.00   60.29  ? 207  PRO B CG    1 
ATOM   3425  C  CD    . PRO B 1  207  ? -16.585 31.649  121.461 1.00   63.72  ? 207  PRO B CD    1 
ATOM   3426  N  N     . LEU B 1  208  ? -12.898 31.850  122.390 1.00   62.44  ? 208  LEU B N     1 
ATOM   3427  C  CA    . LEU B 1  208  ? -11.571 32.290  122.806 1.00   62.31  ? 208  LEU B CA    1 
ATOM   3428  C  C     . LEU B 1  208  ? -11.363 32.037  124.296 1.00   63.13  ? 208  LEU B C     1 
ATOM   3429  O  O     . LEU B 1  208  ? -10.308 31.559  124.712 1.00   60.31  ? 208  LEU B O     1 
ATOM   3430  C  CB    . LEU B 1  208  ? -11.362 33.772  122.484 1.00   59.62  ? 208  LEU B CB    1 
ATOM   3431  C  CG    . LEU B 1  208  ? -10.075 34.406  123.020 1.00   61.13  ? 208  LEU B CG    1 
ATOM   3432  C  CD1   . LEU B 1  208  ? -8.846  33.670  122.511 1.00   53.99  ? 208  LEU B CD1   1 
ATOM   3433  C  CD2   . LEU B 1  208  ? -10.008 35.880  122.651 1.00   71.99  ? 208  LEU B CD2   1 
ATOM   3434  N  N     . GLU B 1  209  ? -12.380 32.358  125.091 1.00   64.67  ? 209  GLU B N     1 
ATOM   3435  C  CA    . GLU B 1  209  ? -12.353 32.078  126.519 1.00   61.57  ? 209  GLU B CA    1 
ATOM   3436  C  C     . GLU B 1  209  ? -12.243 30.577  126.741 1.00   64.40  ? 209  GLU B C     1 
ATOM   3437  O  O     . GLU B 1  209  ? -11.482 30.121  127.593 1.00   69.80  ? 209  GLU B O     1 
ATOM   3438  C  CB    . GLU B 1  209  ? -13.614 32.612  127.202 1.00   60.11  ? 209  GLU B CB    1 
ATOM   3439  C  CG    . GLU B 1  209  ? -13.683 34.126  127.313 1.00   60.19  ? 209  GLU B CG    1 
ATOM   3440  C  CD    . GLU B 1  209  ? -15.046 34.613  127.767 1.00   60.70  ? 209  GLU B CD    1 
ATOM   3441  O  OE1   . GLU B 1  209  ? -15.267 35.842  127.779 1.00   59.61  ? 209  GLU B OE1   1 
ATOM   3442  O  OE2   . GLU B 1  209  ? -15.898 33.765  128.111 1.00   58.29  ? 209  GLU B OE2   1 
ATOM   3443  N  N     . ALA B 1  210  ? -13.003 29.816  125.959 1.00   60.76  ? 210  ALA B N     1 
ATOM   3444  C  CA    . ALA B 1  210  ? -13.013 28.362  126.069 1.00   61.93  ? 210  ALA B CA    1 
ATOM   3445  C  C     . ALA B 1  210  ? -11.633 27.779  125.788 1.00   58.62  ? 210  ALA B C     1 
ATOM   3446  O  O     . ALA B 1  210  ? -11.155 26.908  126.516 1.00   52.97  ? 210  ALA B O     1 
ATOM   3447  C  CB    . ALA B 1  210  ? -14.047 27.766  125.126 1.00   56.69  ? 210  ALA B CB    1 
ATOM   3448  N  N     . LEU B 1  211  ? -10.995 28.270  124.731 1.00   59.35  ? 211  LEU B N     1 
ATOM   3449  C  CA    . LEU B 1  211  ? -9.673  27.791  124.349 1.00   61.08  ? 211  LEU B CA    1 
ATOM   3450  C  C     . LEU B 1  211  ? -8.631  28.136  125.407 1.00   60.55  ? 211  LEU B C     1 
ATOM   3451  O  O     . LEU B 1  211  ? -7.819  27.292  125.786 1.00   62.08  ? 211  LEU B O     1 
ATOM   3452  C  CB    . LEU B 1  211  ? -9.260  28.366  122.993 1.00   61.38  ? 211  LEU B CB    1 
ATOM   3453  C  CG    . LEU B 1  211  ? -7.879  27.946  122.485 1.00   58.71  ? 211  LEU B CG    1 
ATOM   3454  C  CD1   . LEU B 1  211  ? -7.770  26.431  122.415 1.00   51.03  ? 211  LEU B CD1   1 
ATOM   3455  C  CD2   . LEU B 1  211  ? -7.585  28.572  121.129 1.00   61.70  ? 211  LEU B CD2   1 
ATOM   3456  N  N     . ASN B 1  212  ? -8.660  29.377  125.883 1.00   59.68  ? 212  ASN B N     1 
ATOM   3457  C  CA    . ASN B 1  212  ? -7.716  29.825  126.900 1.00   57.45  ? 212  ASN B CA    1 
ATOM   3458  C  C     . ASN B 1  212  ? -7.845  29.027  128.191 1.00   54.53  ? 212  ASN B C     1 
ATOM   3459  O  O     . ASN B 1  212  ? -6.872  28.855  128.925 1.00   55.58  ? 212  ASN B O     1 
ATOM   3460  C  CB    . ASN B 1  212  ? -7.881  31.320  127.174 1.00   64.23  ? 212  ASN B CB    1 
ATOM   3461  C  CG    . ASN B 1  212  ? -7.405  32.179  126.019 1.00   73.61  ? 212  ASN B CG    1 
ATOM   3462  O  OD1   . ASN B 1  212  ? -6.443  31.835  125.331 1.00   67.20  ? 212  ASN B OD1   1 
ATOM   3463  N  ND2   . ASN B 1  212  ? -8.078  33.303  125.798 1.00   80.62  ? 212  ASN B ND2   1 
ATOM   3464  N  N     . GLN B 1  213  ? -9.051  28.538  128.461 1.00   51.53  ? 213  GLN B N     1 
ATOM   3465  C  CA    . GLN B 1  213  ? -9.275  27.673  129.609 1.00   56.29  ? 213  GLN B CA    1 
ATOM   3466  C  C     . GLN B 1  213  ? -8.722  26.285  129.318 1.00   52.04  ? 213  GLN B C     1 
ATOM   3467  O  O     . GLN B 1  213  ? -8.252  25.592  130.219 1.00   49.05  ? 213  GLN B O     1 
ATOM   3468  C  CB    . GLN B 1  213  ? -10.766 27.590  129.950 1.00   58.27  ? 213  GLN B CB    1 
ATOM   3469  C  CG    . GLN B 1  213  ? -11.358 28.881  130.497 1.00   52.71  ? 213  GLN B CG    1 
ATOM   3470  C  CD    . GLN B 1  213  ? -12.848 28.772  130.762 1.00   58.23  ? 213  GLN B CD    1 
ATOM   3471  O  OE1   . GLN B 1  213  ? -13.365 27.687  131.032 1.00   62.59  ? 213  GLN B OE1   1 
ATOM   3472  N  NE2   . GLN B 1  213  ? -13.548 29.898  130.680 1.00   56.89  ? 213  GLN B NE2   1 
ATOM   3473  N  N     . ALA B 1  214  ? -8.773  25.890  128.050 1.00   51.10  ? 214  ALA B N     1 
ATOM   3474  C  CA    . ALA B 1  214  ? -8.294  24.575  127.636 1.00   54.65  ? 214  ALA B CA    1 
ATOM   3475  C  C     . ALA B 1  214  ? -6.772  24.466  127.697 1.00   52.01  ? 214  ALA B C     1 
ATOM   3476  O  O     . ALA B 1  214  ? -6.233  23.418  128.052 1.00   48.26  ? 214  ALA B O     1 
ATOM   3477  C  CB    . ALA B 1  214  ? -8.796  24.241  126.240 1.00   52.41  ? 214  ALA B CB    1 
ATOM   3478  N  N     . VAL B 1  215  ? -6.081  25.548  127.349 1.00   50.12  ? 215  VAL B N     1 
ATOM   3479  C  CA    . VAL B 1  215  ? -4.622  25.556  127.393 1.00   47.23  ? 215  VAL B CA    1 
ATOM   3480  C  C     . VAL B 1  215  ? -4.111  25.718  128.823 1.00   52.91  ? 215  VAL B C     1 
ATOM   3481  O  O     . VAL B 1  215  ? -3.015  25.266  129.154 1.00   51.88  ? 215  VAL B O     1 
ATOM   3482  C  CB    . VAL B 1  215  ? -4.016  26.651  126.486 1.00   48.07  ? 215  VAL B CB    1 
ATOM   3483  C  CG1   . VAL B 1  215  ? -4.394  26.405  125.035 1.00   54.85  ? 215  VAL B CG1   1 
ATOM   3484  C  CG2   . VAL B 1  215  ? -4.464  28.034  126.930 1.00   54.93  ? 215  VAL B CG2   1 
ATOM   3485  N  N     . GLU B 1  216  ? -4.914  26.360  129.668 1.00   53.90  ? 216  GLU B N     1 
ATOM   3486  C  CA    . GLU B 1  216  ? -4.567  26.532  131.073 1.00   49.23  ? 216  GLU B CA    1 
ATOM   3487  C  C     . GLU B 1  216  ? -4.675  25.204  131.809 1.00   46.88  ? 216  GLU B C     1 
ATOM   3488  O  O     . GLU B 1  216  ? -3.825  24.871  132.635 1.00   49.20  ? 216  GLU B O     1 
ATOM   3489  C  CB    . GLU B 1  216  ? -5.466  27.585  131.728 1.00   51.67  ? 216  GLU B CB    1 
ATOM   3490  C  CG    . GLU B 1  216  ? -5.345  27.669  133.248 1.00   64.70  ? 216  GLU B CG    1 
ATOM   3491  C  CD    . GLU B 1  216  ? -3.983  28.158  133.718 1.00   68.34  ? 216  GLU B CD    1 
ATOM   3492  O  OE1   . GLU B 1  216  ? -3.667  27.970  134.912 1.00   66.70  ? 216  GLU B OE1   1 
ATOM   3493  O  OE2   . GLU B 1  216  ? -3.233  28.736  132.902 1.00   68.17  ? 216  GLU B OE2   1 
ATOM   3494  N  N     . ILE B 1  217  ? -5.726  24.449  131.499 1.00   41.48  ? 217  ILE B N     1 
ATOM   3495  C  CA    . ILE B 1  217  ? -5.916  23.122  132.073 1.00   44.90  ? 217  ILE B CA    1 
ATOM   3496  C  C     . ILE B 1  217  ? -4.751  22.212  131.702 1.00   50.76  ? 217  ILE B C     1 
ATOM   3497  O  O     . ILE B 1  217  ? -4.226  21.480  132.543 1.00   54.78  ? 217  ILE B O     1 
ATOM   3498  C  CB    . ILE B 1  217  ? -7.238  22.482  131.598 1.00   39.81  ? 217  ILE B CB    1 
ATOM   3499  C  CG1   . ILE B 1  217  ? -8.435  23.211  132.208 1.00   40.99  ? 217  ILE B CG1   1 
ATOM   3500  C  CG2   . ILE B 1  217  ? -7.292  21.009  131.972 1.00   37.49  ? 217  ILE B CG2   1 
ATOM   3501  C  CD1   . ILE B 1  217  ? -9.772  22.680  131.741 1.00   45.91  ? 217  ILE B CD1   1 
ATOM   3502  N  N     . LEU B 1  218  ? -4.339  22.276  130.440 1.00   49.79  ? 218  LEU B N     1 
ATOM   3503  C  CA    . LEU B 1  218  ? -3.249  21.443  129.952 1.00   49.48  ? 218  LEU B CA    1 
ATOM   3504  C  C     . LEU B 1  218  ? -1.926  21.817  130.613 1.00   49.55  ? 218  LEU B C     1 
ATOM   3505  O  O     . LEU B 1  218  ? -1.203  20.948  131.102 1.00   49.18  ? 218  LEU B O     1 
ATOM   3506  C  CB    . LEU B 1  218  ? -3.133  21.544  128.429 1.00   49.73  ? 218  LEU B CB    1 
ATOM   3507  C  CG    . LEU B 1  218  ? -2.137  20.592  127.763 1.00   48.47  ? 218  LEU B CG    1 
ATOM   3508  C  CD1   . LEU B 1  218  ? -2.398  19.154  128.187 1.00   44.03  ? 218  LEU B CD1   1 
ATOM   3509  C  CD2   . LEU B 1  218  ? -2.204  20.725  126.251 1.00   41.33  ? 218  LEU B CD2   1 
ATOM   3510  N  N     . ARG B 1  219  ? -1.620  23.112  130.627 1.00   47.05  ? 219  ARG B N     1 
ATOM   3511  C  CA    . ARG B 1  219  ? -0.392  23.606  131.238 1.00   48.29  ? 219  ARG B CA    1 
ATOM   3512  C  C     . ARG B 1  219  ? -0.309  23.198  132.704 1.00   53.73  ? 219  ARG B C     1 
ATOM   3513  O  O     . ARG B 1  219  ? 0.761   22.844  133.201 1.00   56.59  ? 219  ARG B O     1 
ATOM   3514  C  CB    . ARG B 1  219  ? -0.307  25.128  131.121 1.00   50.44  ? 219  ARG B CB    1 
ATOM   3515  C  CG    . ARG B 1  219  ? 0.962   25.722  131.711 1.00   56.65  ? 219  ARG B CG    1 
ATOM   3516  C  CD    . ARG B 1  219  ? 0.743   27.162  132.141 1.00   74.21  ? 219  ARG B CD    1 
ATOM   3517  N  NE    . ARG B 1  219  ? -0.326  27.274  133.132 1.00   72.83  ? 219  ARG B NE    1 
ATOM   3518  C  CZ    . ARG B 1  219  ? -0.145  27.156  134.444 1.00   68.95  ? 219  ARG B CZ    1 
ATOM   3519  N  NH1   . ARG B 1  219  ? 1.066   26.921  134.932 1.00   68.79  ? 219  ARG B NH1   1 
ATOM   3520  N  NH2   . ARG B 1  219  ? -1.177  27.271  135.270 1.00   68.25  ? 219  ARG B NH2   1 
ATOM   3521  N  N     . GLU B 1  220  ? -1.448  23.244  133.389 1.00   53.50  ? 220  GLU B N     1 
ATOM   3522  C  CA    . GLU B 1  220  ? -1.517  22.862  134.794 1.00   57.25  ? 220  GLU B CA    1 
ATOM   3523  C  C     . GLU B 1  220  ? -1.209  21.378  134.970 1.00   55.25  ? 220  GLU B C     1 
ATOM   3524  O  O     . GLU B 1  220  ? -0.620  20.970  135.972 1.00   54.71  ? 220  GLU B O     1 
ATOM   3525  C  CB    . GLU B 1  220  ? -2.895  23.195  135.375 1.00   57.71  ? 220  GLU B CB    1 
ATOM   3526  C  CG    . GLU B 1  220  ? -3.031  22.907  136.863 1.00   61.93  ? 220  GLU B CG    1 
ATOM   3527  C  CD    . GLU B 1  220  ? -4.378  23.324  137.421 1.00   67.59  ? 220  GLU B CD    1 
ATOM   3528  O  OE1   . GLU B 1  220  ? -5.185  23.907  136.664 1.00   54.38  ? 220  GLU B OE1   1 
ATOM   3529  O  OE2   . GLU B 1  220  ? -4.629  23.068  138.618 1.00   68.56  ? 220  GLU B OE2   1 
ATOM   3530  N  N     . HIS B 1  221  ? -1.605  20.574  133.988 1.00   54.99  ? 221  HIS B N     1 
ATOM   3531  C  CA    . HIS B 1  221  ? -1.344  19.139  134.026 1.00   57.69  ? 221  HIS B CA    1 
ATOM   3532  C  C     . HIS B 1  221  ? 0.131   18.821  133.796 1.00   59.22  ? 221  HIS B C     1 
ATOM   3533  O  O     . HIS B 1  221  ? 0.619   17.766  134.204 1.00   58.91  ? 221  HIS B O     1 
ATOM   3534  C  CB    . HIS B 1  221  ? -2.215  18.397  133.010 1.00   50.41  ? 221  HIS B CB    1 
ATOM   3535  C  CG    . HIS B 1  221  ? -3.577  18.049  133.523 1.00   48.83  ? 221  HIS B CG    1 
ATOM   3536  N  ND1   . HIS B 1  221  ? -4.590  18.977  133.636 1.00   56.47  ? 221  HIS B ND1   1 
ATOM   3537  C  CD2   . HIS B 1  221  ? -4.092  16.876  133.961 1.00   53.16  ? 221  HIS B CD2   1 
ATOM   3538  C  CE1   . HIS B 1  221  ? -5.670  18.391  134.119 1.00   59.77  ? 221  HIS B CE1   1 
ATOM   3539  N  NE2   . HIS B 1  221  ? -5.395  17.115  134.325 1.00   57.96  ? 221  HIS B NE2   1 
ATOM   3540  N  N     . LEU B 1  222  ? 0.837   19.739  133.144 1.00   53.54  ? 222  LEU B N     1 
ATOM   3541  C  CA    . LEU B 1  222  ? 2.259   19.559  132.879 1.00   52.30  ? 222  LEU B CA    1 
ATOM   3542  C  C     . LEU B 1  222  ? 3.087   19.756  134.145 1.00   56.32  ? 222  LEU B C     1 
ATOM   3543  O  O     . LEU B 1  222  ? 4.205   19.253  134.255 1.00   56.07  ? 222  LEU B O     1 
ATOM   3544  C  CB    . LEU B 1  222  ? 2.722   20.518  131.782 1.00   50.92  ? 222  LEU B CB    1 
ATOM   3545  C  CG    . LEU B 1  222  ? 2.115   20.270  130.401 1.00   48.45  ? 222  LEU B CG    1 
ATOM   3546  C  CD1   . LEU B 1  222  ? 2.648   21.266  129.388 1.00   47.61  ? 222  LEU B CD1   1 
ATOM   3547  C  CD2   . LEU B 1  222  ? 2.387   18.845  129.947 1.00   48.74  ? 222  LEU B CD2   1 
ATOM   3548  N  N     . THR B 1  223  ? 2.526   20.487  135.102 1.00   57.73  ? 223  THR B N     1 
ATOM   3549  C  CA    . THR B 1  223  ? 3.202   20.745  136.367 1.00   57.77  ? 223  THR B CA    1 
ATOM   3550  C  C     . THR B 1  223  ? 3.080   19.560  137.319 1.00   58.88  ? 223  THR B C     1 
ATOM   3551  O  O     . THR B 1  223  ? 3.693   19.545  138.385 1.00   64.04  ? 223  THR B O     1 
ATOM   3552  C  CB    . THR B 1  223  ? 2.637   21.998  137.057 1.00   54.02  ? 223  THR B CB    1 
ATOM   3553  O  OG1   . THR B 1  223  ? 1.245   21.805  137.331 1.00   59.43  ? 223  THR B OG1   1 
ATOM   3554  C  CG2   . THR B 1  223  ? 2.809   23.218  136.166 1.00   51.00  ? 223  THR B CG2   1 
ATOM   3555  N  N     . TYR B 1  224  ? 2.283   18.569  136.932 1.00   53.67  ? 224  TYR B N     1 
ATOM   3556  C  CA    . TYR B 1  224  ? 2.060   17.388  137.762 1.00   56.30  ? 224  TYR B CA    1 
ATOM   3557  C  C     . TYR B 1  224  ? 3.245   16.420  137.741 1.00   57.23  ? 224  TYR B C     1 
ATOM   3558  O  O     . TYR B 1  224  ? 3.263   15.427  138.467 1.00   59.30  ? 224  TYR B O     1 
ATOM   3559  C  CB    . TYR B 1  224  ? 0.768   16.678  137.350 1.00   57.03  ? 224  TYR B CB    1 
ATOM   3560  C  CG    . TYR B 1  224  ? -0.479  17.485  137.635 1.00   58.65  ? 224  TYR B CG    1 
ATOM   3561  C  CD1   . TYR B 1  224  ? -0.466  18.509  138.574 1.00   59.74  ? 224  TYR B CD1   1 
ATOM   3562  C  CD2   . TYR B 1  224  ? -1.668  17.226  136.966 1.00   60.10  ? 224  TYR B CD2   1 
ATOM   3563  C  CE1   . TYR B 1  224  ? -1.602  19.252  138.841 1.00   64.82  ? 224  TYR B CE1   1 
ATOM   3564  C  CE2   . TYR B 1  224  ? -2.812  17.964  137.226 1.00   65.03  ? 224  TYR B CE2   1 
ATOM   3565  C  CZ    . TYR B 1  224  ? -2.772  18.976  138.165 1.00   65.97  ? 224  TYR B CZ    1 
ATOM   3566  O  OH    . TYR B 1  224  ? -3.903  19.716  138.430 1.00   60.05  ? 224  TYR B OH    1 
ATOM   3567  N  N     . PHE B 1  225  ? 4.228   16.720  136.900 1.00   62.65  ? 225  PHE B N     1 
ATOM   3568  C  CA    . PHE B 1  225  ? 5.445   15.920  136.799 1.00   66.42  ? 225  PHE B CA    1 
ATOM   3569  C  C     . PHE B 1  225  ? 6.533   16.437  137.740 1.00   74.35  ? 225  PHE B C     1 
ATOM   3570  O  O     . PHE B 1  225  ? 7.677   15.983  137.693 1.00   70.80  ? 225  PHE B O     1 
ATOM   3571  C  CB    . PHE B 1  225  ? 5.949   15.890  135.354 1.00   62.73  ? 225  PHE B CB    1 
ATOM   3572  C  CG    . PHE B 1  225  ? 4.980   15.265  134.391 1.00   61.20  ? 225  PHE B CG    1 
ATOM   3573  C  CD1   . PHE B 1  225  ? 4.046   16.041  133.723 1.00   56.69  ? 225  PHE B CD1   1 
ATOM   3574  C  CD2   . PHE B 1  225  ? 4.996   13.899  134.161 1.00   53.11  ? 225  PHE B CD2   1 
ATOM   3575  C  CE1   . PHE B 1  225  ? 3.150   15.467  132.841 1.00   48.63  ? 225  PHE B CE1   1 
ATOM   3576  C  CE2   . PHE B 1  225  ? 4.103   13.321  133.280 1.00   49.69  ? 225  PHE B CE2   1 
ATOM   3577  C  CZ    . PHE B 1  225  ? 3.179   14.106  132.620 1.00   45.49  ? 225  PHE B CZ    1 
ATOM   3578  N  N     . SER B 1  226  ? 6.163   17.393  138.588 1.00   79.17  ? 226  SER B N     1 
ATOM   3579  C  CA    . SER B 1  226  ? 7.117   18.131  139.415 1.00   79.68  ? 226  SER B CA    1 
ATOM   3580  C  C     . SER B 1  226  ? 7.708   17.346  140.589 1.00   72.22  ? 226  SER B C     1 
ATOM   3581  O  O     . SER B 1  226  ? 8.916   17.118  140.639 1.00   72.90  ? 226  SER B O     1 
ATOM   3582  C  CB    . SER B 1  226  ? 6.479   19.424  139.936 1.00   74.84  ? 226  SER B CB    1 
ATOM   3583  O  OG    . SER B 1  226  ? 6.039   20.243  138.866 1.00   72.77  ? 226  SER B OG    1 
ATOM   3584  N  N     . ASN B 1  227  ? 6.863   16.937  141.529 1.00   64.26  ? 227  ASN B N     1 
ATOM   3585  C  CA    . ASN B 1  227  ? 7.349   16.438  142.815 1.00   74.15  ? 227  ASN B CA    1 
ATOM   3586  C  C     . ASN B 1  227  ? 6.936   15.002  143.138 1.00   79.81  ? 227  ASN B C     1 
ATOM   3587  O  O     . ASN B 1  227  ? 5.851   14.767  143.670 1.00   83.86  ? 227  ASN B O     1 
ATOM   3588  C  CB    . ASN B 1  227  ? 6.922   17.377  143.947 1.00   73.85  ? 227  ASN B CB    1 
ATOM   3589  C  CG    . ASN B 1  227  ? 7.470   16.952  145.297 1.00   79.41  ? 227  ASN B CG    1 
ATOM   3590  O  OD1   . ASN B 1  227  ? 6.775   16.315  146.090 1.00   81.79  ? 227  ASN B OD1   1 
ATOM   3591  N  ND2   . ASN B 1  227  ? 8.723   17.302  145.564 1.00   78.18  ? 227  ASN B ND2   1 
ATOM   3592  N  N     . PRO B 1  228  ? 7.808   14.036  142.800 1.00   73.27  ? 228  PRO B N     1 
ATOM   3593  C  CA    . PRO B 1  228  ? 7.599   12.604  143.053 1.00   65.91  ? 228  PRO B CA    1 
ATOM   3594  C  C     . PRO B 1  228  ? 7.307   12.303  144.519 1.00   52.52  ? 228  PRO B C     1 
ATOM   3595  O  O     . PRO B 1  228  ? 7.139   11.132  144.859 1.00   44.60  ? 228  PRO B O     1 
ATOM   3596  C  CB    . PRO B 1  228  ? 8.941   11.983  142.657 1.00   61.34  ? 228  PRO B CB    1 
ATOM   3597  C  CG    . PRO B 1  228  ? 9.523   12.938  141.678 1.00   64.00  ? 228  PRO B CG    1 
ATOM   3598  C  CD    . PRO B 1  228  ? 9.106   14.294  142.153 1.00   61.94  ? 228  PRO B CD    1 
ATOM   3599  N  N     . MET C 2  1    ? 19.138  -17.759 113.856 1.00   82.60  ? 1    MET C N     1 
ATOM   3600  C  CA    . MET C 2  1    ? 17.931  -18.114 114.593 1.00   79.76  ? 1    MET C CA    1 
ATOM   3601  C  C     . MET C 2  1    ? 17.396  -19.462 114.123 1.00   79.82  ? 1    MET C C     1 
ATOM   3602  O  O     . MET C 2  1    ? 17.834  -19.990 113.100 1.00   84.07  ? 1    MET C O     1 
ATOM   3603  C  CB    . MET C 2  1    ? 16.858  -17.038 114.417 1.00   78.28  ? 1    MET C CB    1 
ATOM   3604  C  CG    . MET C 2  1    ? 16.070  -17.153 113.118 1.00   72.51  ? 1    MET C CG    1 
ATOM   3605  S  SD    . MET C 2  1    ? 16.165  -15.678 112.084 1.00   79.90  ? 1    MET C SD    1 
ATOM   3606  C  CE    . MET C 2  1    ? 17.859  -15.765 111.510 1.00   73.72  ? 1    MET C CE    1 
ATOM   3607  N  N     . GLU C 2  2    ? 16.444  -20.012 114.871 1.00   77.30  ? 2    GLU C N     1 
ATOM   3608  C  CA    . GLU C 2  2    ? 15.853  -21.301 114.528 1.00   78.78  ? 2    GLU C CA    1 
ATOM   3609  C  C     . GLU C 2  2    ? 15.004  -21.220 113.262 1.00   60.43  ? 2    GLU C C     1 
ATOM   3610  O  O     . GLU C 2  2    ? 14.195  -20.307 113.100 1.00   51.63  ? 2    GLU C O     1 
ATOM   3611  C  CB    . GLU C 2  2    ? 15.014  -21.843 115.690 1.00   78.40  ? 2    GLU C CB    1 
ATOM   3612  C  CG    . GLU C 2  2    ? 14.218  -23.096 115.346 1.00   78.47  ? 2    GLU C CG    1 
ATOM   3613  C  CD    . GLU C 2  2    ? 13.515  -23.698 116.546 1.00   88.67  ? 2    GLU C CD    1 
ATOM   3614  O  OE1   . GLU C 2  2    ? 14.210  -24.230 117.438 1.00   101.74 ? 2    GLU C OE1   1 
ATOM   3615  O  OE2   . GLU C 2  2    ? 12.268  -23.641 116.599 1.00   88.71  ? 2    GLU C OE2   1 
ATOM   3616  N  N     . ILE C 2  3    ? 15.202  -22.179 112.366 1.00   59.38  ? 3    ILE C N     1 
ATOM   3617  C  CA    . ILE C 2  3    ? 14.403  -22.270 111.154 1.00   58.25  ? 3    ILE C CA    1 
ATOM   3618  C  C     . ILE C 2  3    ? 13.504  -23.496 111.230 1.00   56.42  ? 3    ILE C C     1 
ATOM   3619  O  O     . ILE C 2  3    ? 13.984  -24.628 111.172 1.00   64.76  ? 3    ILE C O     1 
ATOM   3620  C  CB    . ILE C 2  3    ? 15.293  -22.384 109.902 1.00   52.60  ? 3    ILE C CB    1 
ATOM   3621  C  CG1   . ILE C 2  3    ? 16.388  -21.313 109.918 1.00   54.44  ? 3    ILE C CG1   1 
ATOM   3622  C  CG2   . ILE C 2  3    ? 14.451  -22.294 108.638 1.00   44.14  ? 3    ILE C CG2   1 
ATOM   3623  C  CD1   . ILE C 2  3    ? 15.864  -19.896 109.926 1.00   53.24  ? 3    ILE C CD1   1 
ATOM   3624  N  N     . LYS C 2  4    ? 12.201  -23.278 111.362 1.00   50.12  ? 4    LYS C N     1 
ATOM   3625  C  CA    . LYS C 2  4    ? 11.271  -24.401 111.449 1.00   48.40  ? 4    LYS C CA    1 
ATOM   3626  C  C     . LYS C 2  4    ? 10.653  -24.714 110.089 1.00   52.07  ? 4    LYS C C     1 
ATOM   3627  O  O     . LYS C 2  4    ? 9.981   -23.870 109.492 1.00   54.02  ? 4    LYS C O     1 
ATOM   3628  C  CB    . LYS C 2  4    ? 10.178  -24.128 112.486 1.00   60.99  ? 4    LYS C CB    1 
ATOM   3629  C  CG    . LYS C 2  4    ? 9.308   -25.339 112.798 1.00   70.33  ? 4    LYS C CG    1 
ATOM   3630  C  CD    . LYS C 2  4    ? 8.266   -25.025 113.863 1.00   73.66  ? 4    LYS C CD    1 
ATOM   3631  C  CE    . LYS C 2  4    ? 7.496   -26.275 114.273 1.00   72.68  ? 4    LYS C CE    1 
ATOM   3632  N  NZ    . LYS C 2  4    ? 6.826   -26.935 113.116 1.00   63.88  ? 4    LYS C NZ    1 
ATOM   3633  N  N     . ARG C 2  5    ? 10.887  -25.927 109.598 1.00   50.13  ? 5    ARG C N     1 
ATOM   3634  C  CA    . ARG C 2  5    ? 10.358  -26.326 108.297 1.00   48.37  ? 5    ARG C CA    1 
ATOM   3635  C  C     . ARG C 2  5    ? 9.109   -27.189 108.434 1.00   47.99  ? 5    ARG C C     1 
ATOM   3636  O  O     . ARG C 2  5    ? 9.009   -28.022 109.336 1.00   56.19  ? 5    ARG C O     1 
ATOM   3637  C  CB    . ARG C 2  5    ? 11.421  -27.053 107.469 1.00   49.59  ? 5    ARG C CB    1 
ATOM   3638  C  CG    . ARG C 2  5    ? 11.798  -28.430 107.986 1.00   58.62  ? 5    ARG C CG    1 
ATOM   3639  C  CD    . ARG C 2  5    ? 12.687  -29.172 106.999 1.00   69.04  ? 5    ARG C CD    1 
ATOM   3640  N  NE    . ARG C 2  5    ? 12.088  -29.252 105.669 1.00   76.95  ? 5    ARG C NE    1 
ATOM   3641  C  CZ    . ARG C 2  5    ? 12.534  -28.589 104.606 1.00   76.99  ? 5    ARG C CZ    1 
ATOM   3642  N  NH1   . ARG C 2  5    ? 13.594  -27.797 104.710 1.00   66.37  ? 5    ARG C NH1   1 
ATOM   3643  N  NH2   . ARG C 2  5    ? 11.924  -28.723 103.435 1.00   79.55  ? 5    ARG C NH2   1 
ATOM   3644  N  N     . PHE C 2  6    ? 8.148   -26.968 107.544 1.00   43.24  ? 6    PHE C N     1 
ATOM   3645  C  CA    . PHE C 2  6    ? 6.914   -27.742 107.545 1.00   48.33  ? 6    PHE C CA    1 
ATOM   3646  C  C     . PHE C 2  6    ? 6.860   -28.732 106.386 1.00   60.52  ? 6    PHE C C     1 
ATOM   3647  O  O     . PHE C 2  6    ? 7.782   -28.817 105.573 1.00   62.48  ? 6    PHE C O     1 
ATOM   3648  C  CB    . PHE C 2  6    ? 5.697   -26.814 107.485 1.00   53.26  ? 6    PHE C CB    1 
ATOM   3649  C  CG    . PHE C 2  6    ? 5.639   -25.812 108.603 1.00   53.61  ? 6    PHE C CG    1 
ATOM   3650  C  CD1   . PHE C 2  6    ? 5.032   -26.130 109.806 1.00   56.16  ? 6    PHE C CD1   1 
ATOM   3651  C  CD2   . PHE C 2  6    ? 6.187   -24.549 108.449 1.00   51.25  ? 6    PHE C CD2   1 
ATOM   3652  C  CE1   . PHE C 2  6    ? 4.977   -25.208 110.834 1.00   57.51  ? 6    PHE C CE1   1 
ATOM   3653  C  CE2   . PHE C 2  6    ? 6.134   -23.624 109.473 1.00   45.82  ? 6    PHE C CE2   1 
ATOM   3654  C  CZ    . PHE C 2  6    ? 5.529   -23.954 110.666 1.00   49.15  ? 6    PHE C CZ    1 
ATOM   3655  N  N     . GLY C 2  7    ? 5.767   -29.483 106.331 1.00   71.43  ? 7    GLY C N     1 
ATOM   3656  C  CA    . GLY C 2  7    ? 5.467   -30.368 105.221 1.00   74.22  ? 7    GLY C CA    1 
ATOM   3657  C  C     . GLY C 2  7    ? 5.949   -31.790 105.424 1.00   76.21  ? 7    GLY C C     1 
ATOM   3658  O  O     . GLY C 2  7    ? 7.021   -32.024 105.983 1.00   71.59  ? 7    GLY C O     1 
ATOM   3659  N  N     . ARG C 2  8    ? 5.153   -32.742 104.948 1.00   79.41  ? 8    ARG C N     1 
ATOM   3660  C  CA    . ARG C 2  8    ? 5.488   -34.157 105.056 1.00   80.56  ? 8    ARG C CA    1 
ATOM   3661  C  C     . ARG C 2  8    ? 6.061   -34.749 103.769 1.00   72.48  ? 8    ARG C C     1 
ATOM   3662  O  O     . ARG C 2  8    ? 6.426   -35.923 103.732 1.00   75.57  ? 8    ARG C O     1 
ATOM   3663  C  CB    . ARG C 2  8    ? 4.274   -34.960 105.535 1.00   90.08  ? 8    ARG C CB    1 
ATOM   3664  C  CG    . ARG C 2  8    ? 3.780   -34.539 106.913 1.00   90.17  ? 8    ARG C CG    1 
ATOM   3665  C  CD    . ARG C 2  8    ? 2.577   -35.348 107.369 1.00   96.52  ? 8    ARG C CD    1 
ATOM   3666  N  NE    . ARG C 2  8    ? 2.110   -34.915 108.684 1.00   112.76 ? 8    ARG C NE    1 
ATOM   3667  C  CZ    . ARG C 2  8    ? 1.057   -35.426 109.313 1.00   113.94 ? 8    ARG C CZ    1 
ATOM   3668  N  NH1   . ARG C 2  8    ? 0.349   -36.396 108.749 1.00   116.59 ? 8    ARG C NH1   1 
ATOM   3669  N  NH2   . ARG C 2  8    ? 0.710   -34.967 110.508 1.00   106.02 ? 8    ARG C NH2   1 
ATOM   3670  N  N     . ILE C 2  9    ? 6.139   -33.939 102.718 1.00   74.18  ? 9    ILE C N     1 
ATOM   3671  C  CA    . ILE C 2  9    ? 6.622   -34.430 101.429 1.00   78.71  ? 9    ILE C CA    1 
ATOM   3672  C  C     . ILE C 2  9    ? 8.144   -34.523 101.391 1.00   76.49  ? 9    ILE C C     1 
ATOM   3673  O  O     . ILE C 2  9    ? 8.846   -33.536 101.612 1.00   81.99  ? 9    ILE C O     1 
ATOM   3674  C  CB    . ILE C 2  9    ? 6.122   -33.567 100.249 1.00   69.46  ? 9    ILE C CB    1 
ATOM   3675  C  CG1   . ILE C 2  9    ? 4.626   -33.792 100.022 1.00   71.00  ? 9    ILE C CG1   1 
ATOM   3676  C  CG2   . ILE C 2  9    ? 6.889   -33.902 98.981  1.00   67.35  ? 9    ILE C CG2   1 
ATOM   3677  C  CD1   . ILE C 2  9    ? 4.053   -33.000 98.866  1.00   58.19  ? 9    ILE C CD1   1 
ATOM   3678  N  N     . ARG C 2  10   ? 8.644   -35.722 101.110 1.00   66.13  ? 10   ARG C N     1 
ATOM   3679  C  CA    . ARG C 2  10   ? 10.078  -35.964 101.034 1.00   75.07  ? 10   ARG C CA    1 
ATOM   3680  C  C     . ARG C 2  10   ? 10.511  -36.105 99.577  1.00   77.21  ? 10   ARG C C     1 
ATOM   3681  O  O     . ARG C 2  10   ? 10.137  -37.062 98.899  1.00   81.46  ? 10   ARG C O     1 
ATOM   3682  C  CB    . ARG C 2  10   ? 10.438  -37.223 101.831 1.00   78.40  ? 10   ARG C CB    1 
ATOM   3683  C  CG    . ARG C 2  10   ? 11.930  -37.504 101.958 1.00   81.02  ? 10   ARG C CG    1 
ATOM   3684  C  CD    . ARG C 2  10   ? 12.383  -38.590 100.992 1.00   78.47  ? 10   ARG C CD    1 
ATOM   3685  N  NE    . ARG C 2  10   ? 11.582  -39.806 101.116 1.00   85.05  ? 10   ARG C NE    1 
ATOM   3686  C  CZ    . ARG C 2  10   ? 11.800  -40.920 100.423 1.00   85.35  ? 10   ARG C CZ    1 
ATOM   3687  N  NH1   . ARG C 2  10   ? 11.019  -41.977 100.599 1.00   77.27  ? 10   ARG C NH1   1 
ATOM   3688  N  NH2   . ARG C 2  10   ? 12.800  -40.978 99.555  1.00   81.49  ? 10   ARG C NH2   1 
ATOM   3689  N  N     . GLU C 2  11   ? 11.297  -35.145 99.096  1.00   73.82  ? 11   GLU C N     1 
ATOM   3690  C  CA    . GLU C 2  11   ? 11.774  -35.176 97.717  1.00   64.16  ? 11   GLU C CA    1 
ATOM   3691  C  C     . GLU C 2  11   ? 12.880  -36.207 97.542  1.00   58.82  ? 11   GLU C C     1 
ATOM   3692  O  O     . GLU C 2  11   ? 13.908  -36.152 98.217  1.00   63.67  ? 11   GLU C O     1 
ATOM   3693  C  CB    . GLU C 2  11   ? 12.278  -33.799 97.279  1.00   67.11  ? 11   GLU C CB    1 
ATOM   3694  C  CG    . GLU C 2  11   ? 11.204  -32.884 96.709  1.00   68.70  ? 11   GLU C CG    1 
ATOM   3695  C  CD    . GLU C 2  11   ? 10.505  -32.053 97.768  1.00   75.06  ? 11   GLU C CD    1 
ATOM   3696  O  OE1   . GLU C 2  11   ? 11.152  -31.706 98.780  1.00   82.08  ? 11   GLU C OE1   1 
ATOM   3697  O  OE2   . GLU C 2  11   ? 9.308   -31.743 97.586  1.00   67.23  ? 11   GLU C OE2   1 
ATOM   3698  N  N     . VAL C 2  12   ? 12.665  -37.143 96.625  1.00   52.25  ? 12   VAL C N     1 
ATOM   3699  C  CA    . VAL C 2  12   ? 13.632  -38.204 96.369  1.00   59.16  ? 12   VAL C CA    1 
ATOM   3700  C  C     . VAL C 2  12   ? 14.895  -37.660 95.710  1.00   58.51  ? 12   VAL C C     1 
ATOM   3701  O  O     . VAL C 2  12   ? 16.010  -37.993 96.113  1.00   62.42  ? 12   VAL C O     1 
ATOM   3702  C  CB    . VAL C 2  12   ? 13.020  -39.317 95.498  1.00   59.18  ? 12   VAL C CB    1 
ATOM   3703  C  CG1   . VAL C 2  12   ? 14.101  -40.255 94.982  1.00   60.79  ? 12   VAL C CG1   1 
ATOM   3704  C  CG2   . VAL C 2  12   ? 11.980  -40.083 96.293  1.00   69.33  ? 12   VAL C CG2   1 
ATOM   3705  N  N     . ILE C 2  13   ? 14.712  -36.812 94.705  1.00   61.49  ? 13   ILE C N     1 
ATOM   3706  C  CA    . ILE C 2  13   ? 15.835  -36.219 93.990  1.00   55.42  ? 13   ILE C CA    1 
ATOM   3707  C  C     . ILE C 2  13   ? 15.827  -34.701 94.129  1.00   55.01  ? 13   ILE C C     1 
ATOM   3708  O  O     . ILE C 2  13   ? 14.763  -34.084 94.190  1.00   57.69  ? 13   ILE C O     1 
ATOM   3709  C  CB    . ILE C 2  13   ? 15.803  -36.590 92.496  1.00   48.27  ? 13   ILE C CB    1 
ATOM   3710  C  CG1   . ILE C 2  13   ? 14.452  -36.217 91.884  1.00   48.36  ? 13   ILE C CG1   1 
ATOM   3711  C  CG2   . ILE C 2  13   ? 16.070  -38.073 92.311  1.00   53.04  ? 13   ILE C CG2   1 
ATOM   3712  C  CD1   . ILE C 2  13   ? 14.367  -36.467 90.399  1.00   55.87  ? 13   ILE C CD1   1 
ATOM   3713  N  N     . PRO C 2  14   ? 17.020  -34.089 94.191  1.00   51.20  ? 14   PRO C N     1 
ATOM   3714  C  CA    . PRO C 2  14   ? 17.094  -32.629 94.262  1.00   51.80  ? 14   PRO C CA    1 
ATOM   3715  C  C     . PRO C 2  14   ? 16.898  -32.021 92.883  1.00   51.27  ? 14   PRO C C     1 
ATOM   3716  O  O     . PRO C 2  14   ? 16.765  -32.753 91.902  1.00   51.50  ? 14   PRO C O     1 
ATOM   3717  C  CB    . PRO C 2  14   ? 18.527  -32.385 94.733  1.00   45.31  ? 14   PRO C CB    1 
ATOM   3718  C  CG    . PRO C 2  14   ? 19.289  -33.532 94.172  1.00   43.09  ? 14   PRO C CG    1 
ATOM   3719  C  CD    . PRO C 2  14   ? 18.354  -34.713 94.241  1.00   51.44  ? 14   PRO C CD    1 
ATOM   3720  N  N     . LEU C 2  15   ? 16.890  -30.695 92.808  1.00   50.05  ? 15   LEU C N     1 
ATOM   3721  C  CA    . LEU C 2  15   ? 16.793  -30.017 91.526  1.00   46.36  ? 15   LEU C CA    1 
ATOM   3722  C  C     . LEU C 2  15   ? 18.101  -30.163 90.768  1.00   45.36  ? 15   LEU C C     1 
ATOM   3723  O  O     . LEU C 2  15   ? 19.177  -30.069 91.360  1.00   45.65  ? 15   LEU C O     1 
ATOM   3724  C  CB    . LEU C 2  15   ? 16.466  -28.538 91.721  1.00   46.71  ? 15   LEU C CB    1 
ATOM   3725  C  CG    . LEU C 2  15   ? 15.031  -28.229 92.139  1.00   42.83  ? 15   LEU C CG    1 
ATOM   3726  C  CD1   . LEU C 2  15   ? 14.822  -26.733 92.249  1.00   38.46  ? 15   LEU C CD1   1 
ATOM   3727  C  CD2   . LEU C 2  15   ? 14.066  -28.833 91.139  1.00   48.03  ? 15   LEU C CD2   1 
ATOM   3728  N  N     . PRO C 2  16   ? 18.015  -30.392 89.450  1.00   46.83  ? 16   PRO C N     1 
ATOM   3729  C  CA    . PRO C 2  16   ? 19.220  -30.498 88.619  1.00   52.05  ? 16   PRO C CA    1 
ATOM   3730  C  C     . PRO C 2  16   ? 19.939  -29.150 88.554  1.00   45.52  ? 16   PRO C C     1 
ATOM   3731  O  O     . PRO C 2  16   ? 19.427  -28.175 89.106  1.00   40.68  ? 16   PRO C O     1 
ATOM   3732  C  CB    . PRO C 2  16   ? 18.655  -30.877 87.244  1.00   49.68  ? 16   PRO C CB    1 
ATOM   3733  C  CG    . PRO C 2  16   ? 17.249  -30.380 87.257  1.00   48.52  ? 16   PRO C CG    1 
ATOM   3734  C  CD    . PRO C 2  16   ? 16.779  -30.556 88.666  1.00   42.29  ? 16   PRO C CD    1 
ATOM   3735  N  N     . PRO C 2  17   ? 21.112  -29.089 87.902  1.00   43.81  ? 17   PRO C N     1 
ATOM   3736  C  CA    . PRO C 2  17   ? 21.713  -27.763 87.738  1.00   39.68  ? 17   PRO C CA    1 
ATOM   3737  C  C     . PRO C 2  17   ? 20.765  -26.889 86.932  1.00   45.64  ? 17   PRO C C     1 
ATOM   3738  O  O     . PRO C 2  17   ? 20.301  -27.303 85.873  1.00   51.77  ? 17   PRO C O     1 
ATOM   3739  C  CB    . PRO C 2  17   ? 22.983  -28.055 86.941  1.00   44.69  ? 17   PRO C CB    1 
ATOM   3740  C  CG    . PRO C 2  17   ? 23.326  -29.462 87.291  1.00   49.79  ? 17   PRO C CG    1 
ATOM   3741  C  CD    . PRO C 2  17   ? 22.013  -30.167 87.456  1.00   45.57  ? 17   PRO C CD    1 
ATOM   3742  N  N     . LEU C 2  18   ? 20.468  -25.698 87.438  1.00   45.77  ? 18   LEU C N     1 
ATOM   3743  C  CA    . LEU C 2  18   ? 19.421  -24.874 86.848  1.00   42.91  ? 18   LEU C CA    1 
ATOM   3744  C  C     . LEU C 2  18   ? 19.870  -24.218 85.547  1.00   39.48  ? 18   LEU C C     1 
ATOM   3745  O  O     . LEU C 2  18   ? 19.046  -23.871 84.701  1.00   42.40  ? 18   LEU C O     1 
ATOM   3746  C  CB    . LEU C 2  18   ? 18.929  -23.836 87.859  1.00   43.34  ? 18   LEU C CB    1 
ATOM   3747  C  CG    . LEU C 2  18   ? 18.304  -24.449 89.118  1.00   35.91  ? 18   LEU C CG    1 
ATOM   3748  C  CD1   . LEU C 2  18   ? 17.920  -23.381 90.129  1.00   25.93  ? 18   LEU C CD1   1 
ATOM   3749  C  CD2   . LEU C 2  18   ? 17.097  -25.306 88.758  1.00   38.81  ? 18   LEU C CD2   1 
ATOM   3750  N  N     . THR C 2  19   ? 21.180  -24.056 85.392  1.00   36.71  ? 19   THR C N     1 
ATOM   3751  C  CA    . THR C 2  19   ? 21.748  -23.521 84.160  1.00   35.43  ? 19   THR C CA    1 
ATOM   3752  C  C     . THR C 2  19   ? 22.183  -24.636 83.214  1.00   41.00  ? 19   THR C C     1 
ATOM   3753  O  O     . THR C 2  19   ? 22.764  -24.365 82.162  1.00   41.70  ? 19   THR C O     1 
ATOM   3754  C  CB    . THR C 2  19   ? 22.959  -22.607 84.438  1.00   30.67  ? 19   THR C CB    1 
ATOM   3755  O  OG1   . THR C 2  19   ? 23.939  -23.323 85.198  1.00   36.95  ? 19   THR C OG1   1 
ATOM   3756  C  CG2   . THR C 2  19   ? 22.532  -21.375 85.212  1.00   31.38  ? 19   THR C CG2   1 
ATOM   3757  N  N     . GLU C 2  20   ? 21.907  -25.884 83.592  1.00   42.51  ? 20   GLU C N     1 
ATOM   3758  C  CA    . GLU C 2  20   ? 22.439  -27.042 82.868  1.00   47.08  ? 20   GLU C CA    1 
ATOM   3759  C  C     . GLU C 2  20   ? 22.067  -27.081 81.389  1.00   45.91  ? 20   GLU C C     1 
ATOM   3760  O  O     . GLU C 2  20   ? 22.797  -27.668 80.590  1.00   49.50  ? 20   GLU C O     1 
ATOM   3761  C  CB    . GLU C 2  20   ? 22.033  -28.366 83.530  1.00   50.99  ? 20   GLU C CB    1 
ATOM   3762  C  CG    . GLU C 2  20   ? 20.813  -29.033 82.903  1.00   52.83  ? 20   GLU C CG    1 
ATOM   3763  C  CD    . GLU C 2  20   ? 20.541  -30.420 83.455  1.00   54.47  ? 20   GLU C CD    1 
ATOM   3764  O  OE1   . GLU C 2  20   ? 21.498  -31.094 83.891  1.00   53.45  ? 20   GLU C OE1   1 
ATOM   3765  O  OE2   . GLU C 2  20   ? 19.363  -30.837 83.452  1.00   57.60  ? 20   GLU C OE2   1 
ATOM   3766  N  N     . ILE C 2  21   ? 20.944  -26.472 81.016  1.00   43.64  ? 21   ILE C N     1 
ATOM   3767  C  CA    . ILE C 2  21   ? 20.549  -26.513 79.612  1.00   40.43  ? 21   ILE C CA    1 
ATOM   3768  C  C     . ILE C 2  21   ? 21.510  -25.678 78.771  1.00   39.55  ? 21   ILE C C     1 
ATOM   3769  O  O     . ILE C 2  21   ? 21.931  -26.110 77.703  1.00   47.02  ? 21   ILE C O     1 
ATOM   3770  C  CB    . ILE C 2  21   ? 19.044  -26.151 79.373  1.00   40.37  ? 21   ILE C CB    1 
ATOM   3771  C  CG1   . ILE C 2  21   ? 18.844  -24.666 79.061  1.00   31.60  ? 21   ILE C CG1   1 
ATOM   3772  C  CG2   . ILE C 2  21   ? 18.202  -26.588 80.555  1.00   46.79  ? 21   ILE C CG2   1 
ATOM   3773  C  CD1   . ILE C 2  21   ? 17.420  -24.303 78.738  1.00   27.70  ? 21   ILE C CD1   1 
ATOM   3774  N  N     . GLN C 2  22   ? 21.886  -24.508 79.279  1.00   39.78  ? 22   GLN C N     1 
ATOM   3775  C  CA    . GLN C 2  22   ? 22.800  -23.623 78.572  1.00   37.00  ? 22   GLN C CA    1 
ATOM   3776  C  C     . GLN C 2  22   ? 24.190  -24.236 78.480  1.00   37.22  ? 22   GLN C C     1 
ATOM   3777  O  O     . GLN C 2  22   ? 24.736  -24.436 77.384  1.00   41.73  ? 22   GLN C O     1 
ATOM   3778  C  CB    . GLN C 2  22   ? 22.875  -22.277 79.295  1.00   34.83  ? 22   GLN C CB    1 
ATOM   3779  C  CG    . GLN C 2  22   ? 21.568  -21.511 79.313  1.00   30.90  ? 22   GLN C CG    1 
ATOM   3780  C  CD    . GLN C 2  22   ? 21.368  -20.681 78.066  1.00   32.14  ? 22   GLN C CD    1 
ATOM   3781  O  OE1   . GLN C 2  22   ? 22.276  -19.975 77.619  1.00   32.40  ? 22   GLN C OE1   1 
ATOM   3782  N  NE2   . GLN C 2  22   ? 20.176  -20.762 77.491  1.00   32.56  ? 22   GLN C NE2   1 
ATOM   3783  N  N     . VAL C 2  23   ? 24.745  -24.544 79.646  1.00   29.83  ? 23   VAL C N     1 
ATOM   3784  C  CA    . VAL C 2  23   ? 26.078  -25.118 79.749  1.00   34.87  ? 23   VAL C CA    1 
ATOM   3785  C  C     . VAL C 2  23   ? 26.220  -26.406 78.937  1.00   37.45  ? 23   VAL C C     1 
ATOM   3786  O  O     . VAL C 2  23   ? 27.132  -26.528 78.118  1.00   38.79  ? 23   VAL C O     1 
ATOM   3787  C  CB    . VAL C 2  23   ? 26.464  -25.373 81.222  1.00   40.29  ? 23   VAL C CB    1 
ATOM   3788  C  CG1   . VAL C 2  23   ? 27.623  -26.359 81.318  1.00   48.59  ? 23   VAL C CG1   1 
ATOM   3789  C  CG2   . VAL C 2  23   ? 26.798  -24.057 81.927  1.00   44.04  ? 23   VAL C CG2   1 
ATOM   3790  N  N     . GLU C 2  24   ? 25.316  -27.358 79.150  1.00   36.49  ? 24   GLU C N     1 
ATOM   3791  C  CA    . GLU C 2  24   ? 25.410  -28.637 78.451  1.00   33.12  ? 24   GLU C CA    1 
ATOM   3792  C  C     . GLU C 2  24   ? 25.110  -28.540 76.962  1.00   41.36  ? 24   GLU C C     1 
ATOM   3793  O  O     . GLU C 2  24   ? 25.692  -29.281 76.174  1.00   55.58  ? 24   GLU C O     1 
ATOM   3794  C  CB    . GLU C 2  24   ? 24.534  -29.708 79.103  1.00   37.28  ? 24   GLU C CB    1 
ATOM   3795  C  CG    . GLU C 2  24   ? 25.077  -30.207 80.430  1.00   54.57  ? 24   GLU C CG    1 
ATOM   3796  C  CD    . GLU C 2  24   ? 26.432  -30.876 80.289  1.00   59.63  ? 24   GLU C CD    1 
ATOM   3797  O  OE1   . GLU C 2  24   ? 27.257  -30.753 81.219  1.00   56.28  ? 24   GLU C OE1   1 
ATOM   3798  O  OE2   . GLU C 2  24   ? 26.669  -31.529 79.249  1.00   59.92  ? 24   GLU C OE2   1 
ATOM   3799  N  N     . SER C 2  25   ? 24.213  -27.637 76.569  1.00   42.58  ? 25   SER C N     1 
ATOM   3800  C  CA    . SER C 2  25   ? 23.954  -27.439 75.145  1.00   38.45  ? 25   SER C CA    1 
ATOM   3801  C  C     . SER C 2  25   ? 25.194  -26.905 74.441  1.00   39.15  ? 25   SER C C     1 
ATOM   3802  O  O     . SER C 2  25   ? 25.660  -27.487 73.456  1.00   41.60  ? 25   SER C O     1 
ATOM   3803  C  CB    . SER C 2  25   ? 22.785  -26.483 74.920  1.00   34.81  ? 25   SER C CB    1 
ATOM   3804  O  OG    . SER C 2  25   ? 22.617  -26.189 73.547  1.00   35.70  ? 25   SER C OG    1 
ATOM   3805  N  N     . TYR C 2  26   ? 25.733  -25.801 74.954  1.00   38.69  ? 26   TYR C N     1 
ATOM   3806  C  CA    . TYR C 2  26   ? 26.885  -25.174 74.313  1.00   37.49  ? 26   TYR C CA    1 
ATOM   3807  C  C     . TYR C 2  26   ? 28.118  -26.081 74.350  1.00   46.18  ? 26   TYR C C     1 
ATOM   3808  O  O     . TYR C 2  26   ? 28.858  -26.176 73.367  1.00   54.57  ? 26   TYR C O     1 
ATOM   3809  C  CB    . TYR C 2  26   ? 27.185  -23.808 74.933  1.00   37.17  ? 26   TYR C CB    1 
ATOM   3810  C  CG    . TYR C 2  26   ? 27.922  -22.874 73.999  1.00   37.28  ? 26   TYR C CG    1 
ATOM   3811  C  CD1   . TYR C 2  26   ? 27.360  -22.489 72.788  1.00   34.88  ? 26   TYR C CD1   1 
ATOM   3812  C  CD2   . TYR C 2  26   ? 29.178  -22.376 74.325  1.00   36.00  ? 26   TYR C CD2   1 
ATOM   3813  C  CE1   . TYR C 2  26   ? 28.027  -21.638 71.928  1.00   32.17  ? 26   TYR C CE1   1 
ATOM   3814  C  CE2   . TYR C 2  26   ? 29.852  -21.522 73.472  1.00   32.38  ? 26   TYR C CE2   1 
ATOM   3815  C  CZ    . TYR C 2  26   ? 29.272  -21.158 72.276  1.00   31.75  ? 26   TYR C CZ    1 
ATOM   3816  O  OH    . TYR C 2  26   ? 29.941  -20.311 71.425  1.00   39.59  ? 26   TYR C OH    1 
ATOM   3817  N  N     . ARG C 2  27   ? 28.325  -26.756 75.479  1.00   43.90  ? 27   ARG C N     1 
ATOM   3818  C  CA    . ARG C 2  27   ? 29.418  -27.720 75.608  1.00   46.84  ? 27   ARG C CA    1 
ATOM   3819  C  C     . ARG C 2  27   ? 29.268  -28.856 74.601  1.00   43.67  ? 27   ARG C C     1 
ATOM   3820  O  O     . ARG C 2  27   ? 30.243  -29.272 73.974  1.00   44.40  ? 27   ARG C O     1 
ATOM   3821  C  CB    . ARG C 2  27   ? 29.475  -28.288 77.028  1.00   49.65  ? 27   ARG C CB    1 
ATOM   3822  C  CG    . ARG C 2  27   ? 30.492  -29.403 77.216  1.00   53.57  ? 27   ARG C CG    1 
ATOM   3823  C  CD    . ARG C 2  27   ? 30.301  -30.106 78.550  1.00   54.18  ? 27   ARG C CD    1 
ATOM   3824  N  NE    . ARG C 2  27   ? 30.473  -31.550 78.425  1.00   79.43  ? 27   ARG C NE    1 
ATOM   3825  C  CZ    . ARG C 2  27   ? 29.523  -32.379 78.001  1.00   81.82  ? 27   ARG C CZ    1 
ATOM   3826  N  NH1   . ARG C 2  27   ? 29.763  -33.681 77.916  1.00   83.39  ? 27   ARG C NH1   1 
ATOM   3827  N  NH2   . ARG C 2  27   ? 28.332  -31.905 77.659  1.00   65.63  ? 27   ARG C NH2   1 
ATOM   3828  N  N     . ARG C 2  28   ? 28.041  -29.349 74.455  1.00   41.52  ? 28   ARG C N     1 
ATOM   3829  C  CA    . ARG C 2  28   ? 27.734  -30.408 73.499  1.00   47.18  ? 28   ARG C CA    1 
ATOM   3830  C  C     . ARG C 2  28   ? 28.074  -29.958 72.085  1.00   43.46  ? 28   ARG C C     1 
ATOM   3831  O  O     . ARG C 2  28   ? 28.648  -30.715 71.301  1.00   42.64  ? 28   ARG C O     1 
ATOM   3832  C  CB    . ARG C 2  28   ? 26.250  -30.774 73.573  1.00   51.61  ? 28   ARG C CB    1 
ATOM   3833  C  CG    . ARG C 2  28   ? 25.868  -32.077 72.888  1.00   60.98  ? 28   ARG C CG    1 
ATOM   3834  C  CD    . ARG C 2  28   ? 26.216  -33.279 73.753  1.00   66.48  ? 28   ARG C CD    1 
ATOM   3835  N  NE    . ARG C 2  28   ? 25.669  -34.522 73.216  1.00   81.86  ? 28   ARG C NE    1 
ATOM   3836  C  CZ    . ARG C 2  28   ? 26.323  -35.334 72.391  1.00   89.02  ? 28   ARG C CZ    1 
ATOM   3837  N  NH1   . ARG C 2  28   ? 27.556  -35.036 72.003  1.00   80.80  ? 28   ARG C NH1   1 
ATOM   3838  N  NH2   . ARG C 2  28   ? 25.746  -36.446 71.954  1.00   85.03  ? 28   ARG C NH2   1 
ATOM   3839  N  N     . ALA C 2  29   ? 27.716  -28.718 71.767  1.00   44.09  ? 29   ALA C N     1 
ATOM   3840  C  CA    . ALA C 2  29   ? 27.957  -28.171 70.437  1.00   43.33  ? 29   ALA C CA    1 
ATOM   3841  C  C     . ALA C 2  29   ? 29.445  -27.992 70.147  1.00   42.25  ? 29   ALA C C     1 
ATOM   3842  O  O     . ALA C 2  29   ? 29.910  -28.305 69.049  1.00   42.84  ? 29   ALA C O     1 
ATOM   3843  C  CB    . ALA C 2  29   ? 27.217  -26.853 70.262  1.00   42.75  ? 29   ALA C CB    1 
ATOM   3844  N  N     . LEU C 2  30   ? 30.189  -27.491 71.129  1.00   39.60  ? 30   LEU C N     1 
ATOM   3845  C  CA    . LEU C 2  30   ? 31.612  -27.223 70.933  1.00   41.22  ? 30   LEU C CA    1 
ATOM   3846  C  C     . LEU C 2  30   ? 32.484  -28.477 70.953  1.00   43.88  ? 30   LEU C C     1 
ATOM   3847  O  O     . LEU C 2  30   ? 33.339  -28.651 70.083  1.00   42.79  ? 30   LEU C O     1 
ATOM   3848  C  CB    . LEU C 2  30   ? 32.129  -26.215 71.963  1.00   37.90  ? 30   LEU C CB    1 
ATOM   3849  C  CG    . LEU C 2  30   ? 31.697  -24.762 71.770  1.00   33.16  ? 30   LEU C CG    1 
ATOM   3850  C  CD1   . LEU C 2  30   ? 32.428  -23.859 72.752  1.00   36.56  ? 30   LEU C CD1   1 
ATOM   3851  C  CD2   . LEU C 2  30   ? 31.936  -24.313 70.338  1.00   30.11  ? 30   LEU C CD2   1 
ATOM   3852  N  N     . GLN C 2  31   ? 32.259  -29.341 71.942  1.00   43.12  ? 31   GLN C N     1 
ATOM   3853  C  CA    . GLN C 2  31   ? 33.102  -30.515 72.161  1.00   38.84  ? 31   GLN C CA    1 
ATOM   3854  C  C     . GLN C 2  31   ? 34.567  -30.107 72.274  1.00   37.23  ? 31   GLN C C     1 
ATOM   3855  O  O     . GLN C 2  31   ? 35.442  -30.723 71.669  1.00   40.24  ? 31   GLN C O     1 
ATOM   3856  C  CB    . GLN C 2  31   ? 32.927  -31.542 71.037  1.00   39.93  ? 31   GLN C CB    1 
ATOM   3857  C  CG    . GLN C 2  31   ? 31.572  -32.229 71.003  1.00   36.95  ? 31   GLN C CG    1 
ATOM   3858  C  CD    . GLN C 2  31   ? 31.416  -33.130 69.790  1.00   48.18  ? 31   GLN C CD    1 
ATOM   3859  O  OE1   . GLN C 2  31   ? 31.263  -34.346 69.918  1.00   45.93  ? 31   GLN C OE1   1 
ATOM   3860  N  NE2   . GLN C 2  31   ? 31.454  -32.534 68.603  1.00   49.82  ? 31   GLN C NE2   1 
ATOM   3861  N  N     . ALA C 2  32   ? 34.824  -29.059 73.049  1.00   36.35  ? 32   ALA C N     1 
ATOM   3862  C  CA    . ALA C 2  32   ? 36.171  -28.518 73.184  1.00   39.96  ? 32   ALA C CA    1 
ATOM   3863  C  C     . ALA C 2  32   ? 37.085  -29.426 74.003  1.00   49.40  ? 32   ALA C C     1 
ATOM   3864  O  O     . ALA C 2  32   ? 38.302  -29.415 73.821  1.00   49.39  ? 32   ALA C O     1 
ATOM   3865  C  CB    . ALA C 2  32   ? 36.122  -27.125 73.791  1.00   43.74  ? 32   ALA C CB    1 
ATOM   3866  N  N     . ASP C 2  33   ? 36.499  -30.201 74.911  1.00   50.28  ? 33   ASP C N     1 
ATOM   3867  C  CA    . ASP C 2  33   ? 37.276  -31.118 75.743  1.00   52.31  ? 33   ASP C CA    1 
ATOM   3868  C  C     . ASP C 2  33   ? 37.444  -32.499 75.112  1.00   50.97  ? 33   ASP C C     1 
ATOM   3869  O  O     . ASP C 2  33   ? 38.254  -33.305 75.569  1.00   53.25  ? 33   ASP C O     1 
ATOM   3870  C  CB    . ASP C 2  33   ? 36.652  -31.248 77.134  1.00   50.04  ? 33   ASP C CB    1 
ATOM   3871  C  CG    . ASP C 2  33   ? 37.041  -30.111 78.053  1.00   60.33  ? 33   ASP C CG    1 
ATOM   3872  O  OD1   . ASP C 2  33   ? 37.292  -28.997 77.547  1.00   59.96  ? 33   ASP C OD1   1 
ATOM   3873  O  OD2   . ASP C 2  33   ? 37.104  -30.333 79.280  1.00   76.97  ? 33   ASP C OD2   1 
ATOM   3874  N  N     . VAL C 2  34   ? 36.683  -32.766 74.058  1.00   41.31  ? 34   VAL C N     1 
ATOM   3875  C  CA    . VAL C 2  34   ? 36.771  -34.048 73.377  1.00   39.33  ? 34   VAL C CA    1 
ATOM   3876  C  C     . VAL C 2  34   ? 37.883  -34.020 72.337  1.00   48.60  ? 34   VAL C C     1 
ATOM   3877  O  O     . VAL C 2  34   ? 37.897  -33.150 71.464  1.00   51.57  ? 34   VAL C O     1 
ATOM   3878  C  CB    . VAL C 2  34   ? 35.444  -34.412 72.686  1.00   43.40  ? 34   VAL C CB    1 
ATOM   3879  C  CG1   . VAL C 2  34   ? 35.530  -35.802 72.070  1.00   43.64  ? 34   VAL C CG1   1 
ATOM   3880  C  CG2   . VAL C 2  34   ? 34.293  -34.334 73.675  1.00   44.87  ? 34   VAL C CG2   1 
ATOM   3881  N  N     . PRO C 2  35   ? 38.830  -34.967 72.438  1.00   45.70  ? 35   PRO C N     1 
ATOM   3882  C  CA    . PRO C 2  35   ? 39.893  -35.124 71.439  1.00   46.29  ? 35   PRO C CA    1 
ATOM   3883  C  C     . PRO C 2  35   ? 39.304  -35.298 70.043  1.00   45.85  ? 35   PRO C C     1 
ATOM   3884  O  O     . PRO C 2  35   ? 38.310  -36.007 69.894  1.00   52.21  ? 35   PRO C O     1 
ATOM   3885  C  CB    . PRO C 2  35   ? 40.617  -36.400 71.888  1.00   46.82  ? 35   PRO C CB    1 
ATOM   3886  C  CG    . PRO C 2  35   ? 39.701  -37.057 72.874  1.00   40.05  ? 35   PRO C CG    1 
ATOM   3887  C  CD    . PRO C 2  35   ? 38.952  -35.950 73.525  1.00   43.06  ? 35   PRO C CD    1 
ATOM   3888  N  N     . PRO C 2  36   ? 39.920  -34.663 69.034  1.00   43.87  ? 36   PRO C N     1 
ATOM   3889  C  CA    . PRO C 2  36   ? 39.383  -34.522 67.675  1.00   53.42  ? 36   PRO C CA    1 
ATOM   3890  C  C     . PRO C 2  36   ? 38.844  -35.814 67.063  1.00   61.18  ? 36   PRO C C     1 
ATOM   3891  O  O     . PRO C 2  36   ? 37.856  -35.768 66.329  1.00   69.60  ? 36   PRO C O     1 
ATOM   3892  C  CB    . PRO C 2  36   ? 40.594  -34.032 66.878  1.00   56.89  ? 36   PRO C CB    1 
ATOM   3893  C  CG    . PRO C 2  36   ? 41.403  -33.282 67.870  1.00   54.36  ? 36   PRO C CG    1 
ATOM   3894  C  CD    . PRO C 2  36   ? 41.240  -34.022 69.170  1.00   55.50  ? 36   PRO C CD    1 
ATOM   3895  N  N     . GLU C 2  37   ? 39.474  -36.945 67.361  1.00   60.81  ? 37   GLU C N     1 
ATOM   3896  C  CA    . GLU C 2  37   ? 39.062  -38.214 66.768  1.00   66.16  ? 37   GLU C CA    1 
ATOM   3897  C  C     . GLU C 2  37   ? 37.859  -38.844 67.473  1.00   62.22  ? 37   GLU C C     1 
ATOM   3898  O  O     . GLU C 2  37   ? 37.156  -39.670 66.892  1.00   64.20  ? 37   GLU C O     1 
ATOM   3899  C  CB    . GLU C 2  37   ? 40.233  -39.203 66.732  1.00   68.49  ? 37   GLU C CB    1 
ATOM   3900  C  CG    . GLU C 2  37   ? 40.671  -39.722 68.096  1.00   68.21  ? 37   GLU C CG    1 
ATOM   3901  C  CD    . GLU C 2  37   ? 41.562  -38.748 68.846  1.00   66.16  ? 37   GLU C CD    1 
ATOM   3902  O  OE1   . GLU C 2  37   ? 41.937  -37.708 68.262  1.00   62.28  ? 37   GLU C OE1   1 
ATOM   3903  O  OE2   . GLU C 2  37   ? 41.889  -39.027 70.020  1.00   59.87  ? 37   GLU C OE2   1 
ATOM   3904  N  N     . LYS C 2  38   ? 37.620  -38.447 68.720  1.00   56.48  ? 38   LYS C N     1 
ATOM   3905  C  CA    . LYS C 2  38   ? 36.541  -39.034 69.513  1.00   58.05  ? 38   LYS C CA    1 
ATOM   3906  C  C     . LYS C 2  38   ? 35.242  -38.238 69.431  1.00   60.46  ? 38   LYS C C     1 
ATOM   3907  O  O     . LYS C 2  38   ? 34.233  -38.620 70.025  1.00   58.86  ? 38   LYS C O     1 
ATOM   3908  C  CB    . LYS C 2  38   ? 36.962  -39.174 70.978  1.00   53.72  ? 38   LYS C CB    1 
ATOM   3909  C  CG    . LYS C 2  38   ? 38.091  -40.160 71.217  1.00   57.81  ? 38   LYS C CG    1 
ATOM   3910  C  CD    . LYS C 2  38   ? 38.347  -40.343 72.705  1.00   52.88  ? 38   LYS C CD    1 
ATOM   3911  C  CE    . LYS C 2  38   ? 39.565  -41.217 72.955  1.00   72.81  ? 38   LYS C CE    1 
ATOM   3912  N  NZ    . LYS C 2  38   ? 39.882  -41.329 74.406  1.00   62.00  ? 38   LYS C NZ    1 
ATOM   3913  N  N     . ARG C 2  39   ? 35.267  -37.132 68.697  1.00   61.04  ? 39   ARG C N     1 
ATOM   3914  C  CA    . ARG C 2  39   ? 34.095  -36.275 68.582  1.00   55.10  ? 39   ARG C CA    1 
ATOM   3915  C  C     . ARG C 2  39   ? 32.992  -36.937 67.764  1.00   60.37  ? 39   ARG C C     1 
ATOM   3916  O  O     . ARG C 2  39   ? 33.217  -37.373 66.635  1.00   64.08  ? 39   ARG C O     1 
ATOM   3917  C  CB    . ARG C 2  39   ? 34.472  -34.925 67.967  1.00   58.64  ? 39   ARG C CB    1 
ATOM   3918  C  CG    . ARG C 2  39   ? 35.271  -34.022 68.893  1.00   49.63  ? 39   ARG C CG    1 
ATOM   3919  C  CD    . ARG C 2  39   ? 35.787  -32.789 68.169  1.00   43.35  ? 39   ARG C CD    1 
ATOM   3920  N  NE    . ARG C 2  39   ? 36.513  -31.899 69.071  1.00   39.95  ? 39   ARG C NE    1 
ATOM   3921  C  CZ    . ARG C 2  39   ? 37.397  -30.991 68.673  1.00   43.85  ? 39   ARG C CZ    1 
ATOM   3922  N  NH1   . ARG C 2  39   ? 37.676  -30.854 67.385  1.00   44.52  ? 39   ARG C NH1   1 
ATOM   3923  N  NH2   . ARG C 2  39   ? 38.011  -30.224 69.564  1.00   45.57  ? 39   ARG C NH2   1 
ATOM   3924  N  N     . GLU C 2  40   ? 31.801  -37.014 68.349  1.00   58.59  ? 40   GLU C N     1 
ATOM   3925  C  CA    . GLU C 2  40   ? 30.617  -37.482 67.640  1.00   64.02  ? 40   GLU C CA    1 
ATOM   3926  C  C     . GLU C 2  40   ? 30.240  -36.459 66.586  1.00   57.91  ? 40   GLU C C     1 
ATOM   3927  O  O     . GLU C 2  40   ? 30.696  -35.317 66.639  1.00   56.25  ? 40   GLU C O     1 
ATOM   3928  C  CB    . GLU C 2  40   ? 29.446  -37.676 68.599  1.00   57.75  ? 40   GLU C CB    1 
ATOM   3929  C  CG    . GLU C 2  40   ? 29.673  -38.722 69.666  1.00   57.87  ? 40   GLU C CG    1 
ATOM   3930  C  CD    . GLU C 2  40   ? 28.404  -39.042 70.423  1.00   72.72  ? 40   GLU C CD    1 
ATOM   3931  O  OE1   . GLU C 2  40   ? 27.356  -39.232 69.769  1.00   81.47  ? 40   GLU C OE1   1 
ATOM   3932  O  OE2   . GLU C 2  40   ? 28.451  -39.092 71.669  1.00   78.38  ? 40   GLU C OE2   1 
ATOM   3933  N  N     . ASN C 2  41   ? 29.401  -36.848 65.632  1.00   59.51  ? 41   ASN C N     1 
ATOM   3934  C  CA    . ASN C 2  41   ? 29.031  -35.900 64.600  1.00   59.12  ? 41   ASN C CA    1 
ATOM   3935  C  C     . ASN C 2  41   ? 27.816  -35.141 65.105  1.00   56.74  ? 41   ASN C C     1 
ATOM   3936  O  O     . ASN C 2  41   ? 26.688  -35.629 65.056  1.00   57.10  ? 41   ASN C O     1 
ATOM   3937  C  CB    . ASN C 2  41   ? 28.677  -36.659 63.320  1.00   65.41  ? 41   ASN C CB    1 
ATOM   3938  C  CG    . ASN C 2  41   ? 28.445  -35.742 62.139  1.00   68.47  ? 41   ASN C CG    1 
ATOM   3939  O  OD1   . ASN C 2  41   ? 29.083  -34.700 62.018  1.00   69.45  ? 41   ASN C OD1   1 
ATOM   3940  N  ND2   . ASN C 2  41   ? 27.530  -36.129 61.257  1.00   65.42  ? 41   ASN C ND2   1 
ATOM   3941  N  N     . VAL C 2  42   ? 28.079  -33.918 65.558  1.00   57.85  ? 42   VAL C N     1 
ATOM   3942  C  CA    . VAL C 2  42   ? 27.088  -33.028 66.151  1.00   50.17  ? 42   VAL C CA    1 
ATOM   3943  C  C     . VAL C 2  42   ? 27.656  -31.614 66.137  1.00   50.21  ? 42   VAL C C     1 
ATOM   3944  O  O     . VAL C 2  42   ? 28.871  -31.434 66.053  1.00   55.00  ? 42   VAL C O     1 
ATOM   3945  C  CB    . VAL C 2  42   ? 26.771  -33.405 67.617  1.00   40.92  ? 42   VAL C CB    1 
ATOM   3946  C  CG1   . VAL C 2  42   ? 25.656  -34.443 67.697  1.00   40.30  ? 42   VAL C CG1   1 
ATOM   3947  C  CG2   . VAL C 2  42   ? 28.026  -33.886 68.330  1.00   47.46  ? 42   VAL C CG2   1 
ATOM   3948  N  N     . GLY C 2  43   ? 26.786  -30.616 66.248  1.00   49.57  ? 43   GLY C N     1 
ATOM   3949  C  CA    . GLY C 2  43   ? 27.217  -29.232 66.353  1.00   51.05  ? 43   GLY C CA    1 
ATOM   3950  C  C     . GLY C 2  43   ? 28.130  -28.753 65.239  1.00   51.20  ? 43   GLY C C     1 
ATOM   3951  O  O     . GLY C 2  43   ? 27.882  -29.008 64.056  1.00   54.08  ? 43   GLY C O     1 
ATOM   3952  N  N     . ILE C 2  44   ? 29.198  -28.055 65.619  1.00   46.19  ? 44   ILE C N     1 
ATOM   3953  C  CA    . ILE C 2  44   ? 30.130  -27.504 64.642  1.00   43.42  ? 44   ILE C CA    1 
ATOM   3954  C  C     . ILE C 2  44   ? 30.865  -28.608 63.889  1.00   48.66  ? 44   ILE C C     1 
ATOM   3955  O  O     . ILE C 2  44   ? 31.245  -28.431 62.731  1.00   58.48  ? 44   ILE C O     1 
ATOM   3956  C  CB    . ILE C 2  44   ? 31.136  -26.521 65.281  1.00   37.56  ? 44   ILE C CB    1 
ATOM   3957  C  CG1   . ILE C 2  44   ? 31.937  -27.203 66.389  1.00   42.30  ? 44   ILE C CG1   1 
ATOM   3958  C  CG2   . ILE C 2  44   ? 30.413  -25.305 65.832  1.00   41.59  ? 44   ILE C CG2   1 
ATOM   3959  C  CD1   . ILE C 2  44   ? 32.924  -26.279 67.068  1.00   42.00  ? 44   ILE C CD1   1 
ATOM   3960  N  N     . GLN C 2  45   ? 31.052  -29.749 64.547  1.00   48.58  ? 45   GLN C N     1 
ATOM   3961  C  CA    . GLN C 2  45   ? 31.613  -30.920 63.889  1.00   46.86  ? 45   GLN C CA    1 
ATOM   3962  C  C     . GLN C 2  45   ? 30.701  -31.317 62.735  1.00   49.96  ? 45   GLN C C     1 
ATOM   3963  O  O     . GLN C 2  45   ? 31.163  -31.549 61.616  1.00   60.37  ? 45   GLN C O     1 
ATOM   3964  C  CB    . GLN C 2  45   ? 31.757  -32.077 64.881  1.00   44.06  ? 45   GLN C CB    1 
ATOM   3965  C  CG    . GLN C 2  45   ? 32.237  -33.385 64.266  1.00   48.47  ? 45   GLN C CG    1 
ATOM   3966  C  CD    . GLN C 2  45   ? 33.730  -33.401 63.986  1.00   53.41  ? 45   GLN C CD    1 
ATOM   3967  O  OE1   . GLN C 2  45   ? 34.441  -32.442 64.282  1.00   50.87  ? 45   GLN C OE1   1 
ATOM   3968  N  NE2   . GLN C 2  45   ? 34.212  -34.499 63.417  1.00   61.29  ? 45   GLN C NE2   1 
ATOM   3969  N  N     . ALA C 2  46   ? 29.401  -31.366 63.011  1.00   46.85  ? 46   ALA C N     1 
ATOM   3970  C  CA    . ALA C 2  46   ? 28.409  -31.684 61.990  1.00   52.70  ? 46   ALA C CA    1 
ATOM   3971  C  C     . ALA C 2  46   ? 28.401  -30.651 60.867  1.00   60.96  ? 46   ALA C C     1 
ATOM   3972  O  O     . ALA C 2  46   ? 28.250  -31.000 59.695  1.00   67.92  ? 46   ALA C O     1 
ATOM   3973  C  CB    . ALA C 2  46   ? 27.025  -31.813 62.609  1.00   49.83  ? 46   ALA C CB    1 
ATOM   3974  N  N     . ALA C 2  47   ? 28.567  -29.381 61.230  1.00   57.28  ? 47   ALA C N     1 
ATOM   3975  C  CA    . ALA C 2  47   ? 28.624  -28.311 60.238  1.00   53.88  ? 47   ALA C CA    1 
ATOM   3976  C  C     . ALA C 2  47   ? 29.807  -28.505 59.294  1.00   56.19  ? 47   ALA C C     1 
ATOM   3977  O  O     . ALA C 2  47   ? 29.678  -28.341 58.076  1.00   63.05  ? 47   ALA C O     1 
ATOM   3978  C  CB    . ALA C 2  47   ? 28.701  -26.956 60.919  1.00   57.23  ? 47   ALA C CB    1 
ATOM   3979  N  N     . PHE C 2  48   ? 30.956  -28.861 59.864  1.00   55.22  ? 48   PHE C N     1 
ATOM   3980  C  CA    . PHE C 2  48   ? 32.145  -29.165 59.072  1.00   55.12  ? 48   PHE C CA    1 
ATOM   3981  C  C     . PHE C 2  48   ? 31.905  -30.368 58.165  1.00   53.28  ? 48   PHE C C     1 
ATOM   3982  O  O     . PHE C 2  48   ? 32.316  -30.371 57.004  1.00   53.66  ? 48   PHE C O     1 
ATOM   3983  C  CB    . PHE C 2  48   ? 33.356  -29.429 59.974  1.00   47.76  ? 48   PHE C CB    1 
ATOM   3984  C  CG    . PHE C 2  48   ? 34.082  -28.183 60.402  1.00   44.21  ? 48   PHE C CG    1 
ATOM   3985  C  CD1   . PHE C 2  48   ? 34.064  -27.772 61.725  1.00   44.46  ? 48   PHE C CD1   1 
ATOM   3986  C  CD2   . PHE C 2  48   ? 34.788  -27.427 59.482  1.00   40.60  ? 48   PHE C CD2   1 
ATOM   3987  C  CE1   . PHE C 2  48   ? 34.732  -26.630 62.122  1.00   41.96  ? 48   PHE C CE1   1 
ATOM   3988  C  CE2   . PHE C 2  48   ? 35.459  -26.283 59.872  1.00   41.34  ? 48   PHE C CE2   1 
ATOM   3989  C  CZ    . PHE C 2  48   ? 35.430  -25.885 61.194  1.00   43.87  ? 48   PHE C CZ    1 
ATOM   3990  N  N     . ARG C 2  49   ? 31.235  -31.386 58.698  1.00   47.00  ? 49   ARG C N     1 
ATOM   3991  C  CA    . ARG C 2  49   ? 30.962  -32.599 57.934  1.00   51.40  ? 49   ARG C CA    1 
ATOM   3992  C  C     . ARG C 2  49   ? 30.001  -32.356 56.773  1.00   58.22  ? 49   ARG C C     1 
ATOM   3993  O  O     . ARG C 2  49   ? 30.080  -33.027 55.745  1.00   71.37  ? 49   ARG C O     1 
ATOM   3994  C  CB    . ARG C 2  49   ? 30.427  -33.705 58.844  1.00   50.12  ? 49   ARG C CB    1 
ATOM   3995  C  CG    . ARG C 2  49   ? 31.428  -34.176 59.887  1.00   61.64  ? 49   ARG C CG    1 
ATOM   3996  C  CD    . ARG C 2  49   ? 32.637  -34.850 59.254  1.00   66.33  ? 49   ARG C CD    1 
ATOM   3997  N  NE    . ARG C 2  49   ? 32.430  -36.283 59.069  1.00   80.48  ? 49   ARG C NE    1 
ATOM   3998  C  CZ    . ARG C 2  49   ? 31.976  -36.837 57.949  1.00   87.22  ? 49   ARG C CZ    1 
ATOM   3999  N  NH1   . ARG C 2  49   ? 31.680  -36.080 56.901  1.00   78.12  ? 49   ARG C NH1   1 
ATOM   4000  N  NH2   . ARG C 2  49   ? 31.820  -38.152 57.877  1.00   96.09  ? 49   ARG C NH2   1 
ATOM   4001  N  N     . GLU C 2  50   ? 29.092  -31.401 56.941  1.00   58.16  ? 50   GLU C N     1 
ATOM   4002  C  CA    . GLU C 2  50   ? 28.157  -31.055 55.874  1.00   66.58  ? 50   GLU C CA    1 
ATOM   4003  C  C     . GLU C 2  50   ? 28.794  -30.152 54.820  1.00   69.70  ? 50   GLU C C     1 
ATOM   4004  O  O     . GLU C 2  50   ? 28.592  -30.348 53.621  1.00   70.66  ? 50   GLU C O     1 
ATOM   4005  C  CB    . GLU C 2  50   ? 26.899  -30.395 56.443  1.00   68.27  ? 50   GLU C CB    1 
ATOM   4006  C  CG    . GLU C 2  50   ? 26.073  -31.305 57.334  1.00   76.61  ? 50   GLU C CG    1 
ATOM   4007  C  CD    . GLU C 2  50   ? 24.770  -30.665 57.769  1.00   83.99  ? 50   GLU C CD    1 
ATOM   4008  O  OE1   . GLU C 2  50   ? 24.210  -31.094 58.801  1.00   83.13  ? 50   GLU C OE1   1 
ATOM   4009  O  OE2   . GLU C 2  50   ? 24.303  -29.737 57.075  1.00   90.52  ? 50   GLU C OE2   1 
ATOM   4010  N  N     . THR C 2  51   ? 29.564  -29.165 55.269  1.00   66.22  ? 51   THR C N     1 
ATOM   4011  C  CA    . THR C 2  51   ? 30.174  -28.202 54.355  1.00   59.49  ? 51   THR C CA    1 
ATOM   4012  C  C     . THR C 2  51   ? 31.252  -28.856 53.487  1.00   62.65  ? 51   THR C C     1 
ATOM   4013  O  O     . THR C 2  51   ? 31.487  -28.437 52.352  1.00   68.22  ? 51   THR C O     1 
ATOM   4014  C  CB    . THR C 2  51   ? 30.760  -26.990 55.118  1.00   59.16  ? 51   THR C CB    1 
ATOM   4015  O  OG1   . THR C 2  51   ? 29.762  -26.443 55.989  1.00   56.58  ? 51   THR C OG1   1 
ATOM   4016  C  CG2   . THR C 2  51   ? 31.219  -25.906 54.153  1.00   59.82  ? 51   THR C CG2   1 
ATOM   4017  N  N     . PHE C 2  52   ? 31.880  -29.904 54.012  1.00   63.86  ? 52   PHE C N     1 
ATOM   4018  C  CA    . PHE C 2  52   ? 32.984  -30.567 53.319  1.00   69.39  ? 52   PHE C CA    1 
ATOM   4019  C  C     . PHE C 2  52   ? 32.600  -31.982 52.883  1.00   70.16  ? 52   PHE C C     1 
ATOM   4020  O  O     . PHE C 2  52   ? 31.758  -32.618 53.517  1.00   65.71  ? 52   PHE C O     1 
ATOM   4021  C  CB    . PHE C 2  52   ? 34.225  -30.604 54.219  1.00   51.34  ? 52   PHE C CB    1 
ATOM   4022  C  CG    . PHE C 2  52   ? 34.872  -29.262 54.413  1.00   48.72  ? 52   PHE C CG    1 
ATOM   4023  C  CD1   . PHE C 2  52   ? 35.755  -28.762 53.471  1.00   49.06  ? 52   PHE C CD1   1 
ATOM   4024  C  CD2   . PHE C 2  52   ? 34.596  -28.499 55.534  1.00   50.52  ? 52   PHE C CD2   1 
ATOM   4025  C  CE1   . PHE C 2  52   ? 36.352  -27.528 53.643  1.00   43.22  ? 52   PHE C CE1   1 
ATOM   4026  C  CE2   . PHE C 2  52   ? 35.191  -27.263 55.712  1.00   52.18  ? 52   PHE C CE2   1 
ATOM   4027  C  CZ    . PHE C 2  52   ? 36.070  -26.778 54.764  1.00   41.37  ? 52   PHE C CZ    1 
ATOM   4028  N  N     . PRO C 2  53   ? 33.218  -32.488 51.798  1.00   68.23  ? 53   PRO C N     1 
ATOM   4029  C  CA    . PRO C 2  53   ? 34.257  -31.873 50.960  1.00   65.51  ? 53   PRO C CA    1 
ATOM   4030  C  C     . PRO C 2  53   ? 33.731  -30.841 49.963  1.00   65.68  ? 53   PRO C C     1 
ATOM   4031  O  O     . PRO C 2  53   ? 32.556  -30.865 49.597  1.00   68.58  ? 53   PRO C O     1 
ATOM   4032  C  CB    . PRO C 2  53   ? 34.829  -33.069 50.200  1.00   61.74  ? 53   PRO C CB    1 
ATOM   4033  C  CG    . PRO C 2  53   ? 33.669  -33.981 50.055  1.00   60.76  ? 53   PRO C CG    1 
ATOM   4034  C  CD    . PRO C 2  53   ? 32.883  -33.846 51.332  1.00   59.19  ? 53   PRO C CD    1 
ATOM   4035  N  N     . ILE C 2  54   ? 34.615  -29.947 49.529  1.00   63.84  ? 54   ILE C N     1 
ATOM   4036  C  CA    . ILE C 2  54   ? 34.288  -28.948 48.518  1.00   74.64  ? 54   ILE C CA    1 
ATOM   4037  C  C     . ILE C 2  54   ? 35.005  -29.284 47.212  1.00   88.07  ? 54   ILE C C     1 
ATOM   4038  O  O     . ILE C 2  54   ? 36.235  -29.309 47.162  1.00   87.96  ? 54   ILE C O     1 
ATOM   4039  C  CB    . ILE C 2  54   ? 34.702  -27.538 48.975  1.00   72.87  ? 54   ILE C CB    1 
ATOM   4040  C  CG1   . ILE C 2  54   ? 34.092  -27.218 50.341  1.00   62.70  ? 54   ILE C CG1   1 
ATOM   4041  C  CG2   . ILE C 2  54   ? 34.294  -26.498 47.942  1.00   80.33  ? 54   ILE C CG2   1 
ATOM   4042  C  CD1   . ILE C 2  54   ? 34.521  -25.880 50.901  1.00   64.15  ? 54   ILE C CD1   1 
ATOM   4043  N  N     . GLU C 2  55   ? 34.238  -29.536 46.155  1.00   89.14  ? 55   GLU C N     1 
ATOM   4044  C  CA    . GLU C 2  55   ? 34.816  -29.997 44.895  1.00   85.56  ? 55   GLU C CA    1 
ATOM   4045  C  C     . GLU C 2  55   ? 34.648  -28.994 43.758  1.00   86.86  ? 55   GLU C C     1 
ATOM   4046  O  O     . GLU C 2  55   ? 34.058  -27.929 43.940  1.00   100.27 ? 55   GLU C O     1 
ATOM   4047  C  CB    . GLU C 2  55   ? 34.204  -31.341 44.501  1.00   85.33  ? 55   GLU C CB    1 
ATOM   4048  C  CG    . GLU C 2  55   ? 34.194  -32.354 45.631  1.00   84.98  ? 55   GLU C CG    1 
ATOM   4049  C  CD    . GLU C 2  55   ? 33.628  -33.691 45.208  1.00   93.25  ? 55   GLU C CD    1 
ATOM   4050  O  OE1   . GLU C 2  55   ? 33.317  -34.512 46.097  1.00   87.30  ? 55   GLU C OE1   1 
ATOM   4051  O  OE2   . GLU C 2  55   ? 33.497  -33.923 43.988  1.00   101.67 ? 55   GLU C OE2   1 
ATOM   4052  N  N     . GLU C 2  56   ? 35.172  -29.353 42.588  1.00   83.07  ? 56   GLU C N     1 
ATOM   4053  C  CA    . GLU C 2  56   ? 35.128  -28.500 41.401  1.00   96.70  ? 56   GLU C CA    1 
ATOM   4054  C  C     . GLU C 2  56   ? 35.782  -27.140 41.636  1.00   97.02  ? 56   GLU C C     1 
ATOM   4055  O  O     . GLU C 2  56   ? 35.900  -26.328 40.717  1.00   96.78  ? 56   GLU C O     1 
ATOM   4056  C  CB    . GLU C 2  56   ? 33.689  -28.321 40.907  1.00   97.56  ? 56   GLU C CB    1 
ATOM   4057  C  CG    . GLU C 2  56   ? 33.031  -29.604 40.437  1.00   101.12 ? 56   GLU C CG    1 
ATOM   4058  C  CD    . GLU C 2  56   ? 31.598  -29.390 39.995  1.00   111.59 ? 56   GLU C CD    1 
ATOM   4059  O  OE1   . GLU C 2  56   ? 31.254  -29.806 38.869  1.00   114.44 ? 56   GLU C OE1   1 
ATOM   4060  O  OE2   . GLU C 2  56   ? 30.815  -28.808 40.776  1.00   110.13 ? 56   GLU C OE2   1 
ATOM   4061  N  N     . GLY C 2  63   ? 39.046  -31.956 39.023  1.00   119.48 ? 63   GLY C N     1 
ATOM   4062  C  CA    . GLY C 2  63   ? 39.459  -30.647 39.495  1.00   115.00 ? 63   GLY C CA    1 
ATOM   4063  C  C     . GLY C 2  63   ? 40.037  -30.691 40.896  1.00   101.33 ? 63   GLY C C     1 
ATOM   4064  O  O     . GLY C 2  63   ? 40.410  -31.754 41.391  1.00   100.72 ? 63   GLY C O     1 
ATOM   4065  N  N     . LEU C 2  64   ? 40.113  -29.528 41.535  1.00   86.20  ? 64   LEU C N     1 
ATOM   4066  C  CA    . LEU C 2  64   ? 40.650  -29.429 42.887  1.00   83.75  ? 64   LEU C CA    1 
ATOM   4067  C  C     . LEU C 2  64   ? 39.623  -29.878 43.923  1.00   98.92  ? 64   LEU C C     1 
ATOM   4068  O  O     . LEU C 2  64   ? 38.418  -29.720 43.723  1.00   106.24 ? 64   LEU C O     1 
ATOM   4069  C  CB    . LEU C 2  64   ? 41.091  -27.993 43.180  1.00   94.97  ? 64   LEU C CB    1 
ATOM   4070  C  CG    . LEU C 2  64   ? 42.166  -27.389 42.273  1.00   103.45 ? 64   LEU C CG    1 
ATOM   4071  C  CD1   . LEU C 2  64   ? 42.267  -25.884 42.478  1.00   94.71  ? 64   LEU C CD1   1 
ATOM   4072  C  CD2   . LEU C 2  64   ? 43.509  -28.057 42.513  1.00   109.61 ? 64   LEU C CD2   1 
ATOM   4073  N  N     . VAL C 2  65   ? 40.107  -30.439 45.027  1.00   96.54  ? 65   VAL C N     1 
ATOM   4074  C  CA    . VAL C 2  65   ? 39.241  -30.865 46.124  1.00   88.49  ? 65   VAL C CA    1 
ATOM   4075  C  C     . VAL C 2  65   ? 39.814  -30.450 47.478  1.00   83.99  ? 65   VAL C C     1 
ATOM   4076  O  O     . VAL C 2  65   ? 40.948  -30.796 47.813  1.00   80.41  ? 65   VAL C O     1 
ATOM   4077  C  CB    . VAL C 2  65   ? 39.014  -32.394 46.116  1.00   73.21  ? 65   VAL C CB    1 
ATOM   4078  C  CG1   . VAL C 2  65   ? 38.417  -32.855 47.436  1.00   51.60  ? 65   VAL C CG1   1 
ATOM   4079  C  CG2   . VAL C 2  65   ? 38.119  -32.796 44.956  1.00   77.95  ? 65   VAL C CG2   1 
ATOM   4080  N  N     . LEU C 2  66   ? 39.025  -29.705 48.248  1.00   87.03  ? 66   LEU C N     1 
ATOM   4081  C  CA    . LEU C 2  66   ? 39.426  -29.282 49.587  1.00   78.56  ? 66   LEU C CA    1 
ATOM   4082  C  C     . LEU C 2  66   ? 38.617  -30.034 50.637  1.00   62.32  ? 66   LEU C C     1 
ATOM   4083  O  O     . LEU C 2  66   ? 37.412  -29.823 50.775  1.00   58.46  ? 66   LEU C O     1 
ATOM   4084  C  CB    . LEU C 2  66   ? 39.232  -27.773 49.756  1.00   71.17  ? 66   LEU C CB    1 
ATOM   4085  C  CG    . LEU C 2  66   ? 39.664  -27.153 51.088  1.00   55.01  ? 66   LEU C CG    1 
ATOM   4086  C  CD1   . LEU C 2  66   ? 41.175  -27.229 51.261  1.00   58.33  ? 66   LEU C CD1   1 
ATOM   4087  C  CD2   . LEU C 2  66   ? 39.180  -25.713 51.192  1.00   59.65  ? 66   LEU C CD2   1 
ATOM   4088  N  N     . ASP C 2  67   ? 39.284  -30.917 51.373  1.00   60.29  ? 67   ASP C N     1 
ATOM   4089  C  CA    . ASP C 2  67   ? 38.601  -31.736 52.364  1.00   58.89  ? 67   ASP C CA    1 
ATOM   4090  C  C     . ASP C 2  67   ? 38.887  -31.276 53.791  1.00   62.77  ? 67   ASP C C     1 
ATOM   4091  O  O     . ASP C 2  67   ? 39.662  -30.346 54.015  1.00   65.21  ? 67   ASP C O     1 
ATOM   4092  C  CB    . ASP C 2  67   ? 38.980  -33.209 52.194  1.00   59.79  ? 67   ASP C CB    1 
ATOM   4093  C  CG    . ASP C 2  67   ? 37.916  -34.151 52.726  1.00   64.45  ? 67   ASP C CG    1 
ATOM   4094  O  OD1   . ASP C 2  67   ? 36.727  -33.765 52.737  1.00   59.84  ? 67   ASP C OD1   1 
ATOM   4095  O  OD2   . ASP C 2  67   ? 38.265  -35.278 53.135  1.00   75.88  ? 67   ASP C OD2   1 
ATOM   4096  N  N     . PHE C 2  68   ? 38.267  -31.952 54.752  1.00   57.27  ? 68   PHE C N     1 
ATOM   4097  C  CA    . PHE C 2  68   ? 38.370  -31.575 56.157  1.00   49.77  ? 68   PHE C CA    1 
ATOM   4098  C  C     . PHE C 2  68   ? 38.785  -32.758 57.018  1.00   46.82  ? 68   PHE C C     1 
ATOM   4099  O  O     . PHE C 2  68   ? 38.267  -33.866 56.864  1.00   47.36  ? 68   PHE C O     1 
ATOM   4100  C  CB    . PHE C 2  68   ? 37.035  -31.000 56.640  1.00   55.19  ? 68   PHE C CB    1 
ATOM   4101  C  CG    . PHE C 2  68   ? 36.825  -31.088 58.128  1.00   51.91  ? 68   PHE C CG    1 
ATOM   4102  C  CD1   . PHE C 2  68   ? 37.410  -30.172 58.981  1.00   49.13  ? 68   PHE C CD1   1 
ATOM   4103  C  CD2   . PHE C 2  68   ? 36.016  -32.073 58.670  1.00   52.57  ? 68   PHE C CD2   1 
ATOM   4104  C  CE1   . PHE C 2  68   ? 37.210  -30.245 60.336  1.00   41.91  ? 68   PHE C CE1   1 
ATOM   4105  C  CE2   . PHE C 2  68   ? 35.812  -32.146 60.031  1.00   51.00  ? 68   PHE C CE2   1 
ATOM   4106  C  CZ    . PHE C 2  68   ? 36.411  -31.230 60.863  1.00   47.24  ? 68   PHE C CZ    1 
ATOM   4107  N  N     . LEU C 2  69   ? 39.728  -32.514 57.921  1.00   46.58  ? 69   LEU C N     1 
ATOM   4108  C  CA    . LEU C 2  69   ? 40.221  -33.554 58.818  1.00   46.51  ? 69   LEU C CA    1 
ATOM   4109  C  C     . LEU C 2  69   ? 39.647  -33.397 60.225  1.00   48.59  ? 69   LEU C C     1 
ATOM   4110  O  O     . LEU C 2  69   ? 38.847  -34.220 60.671  1.00   57.45  ? 69   LEU C O     1 
ATOM   4111  C  CB    . LEU C 2  69   ? 41.755  -33.545 58.867  1.00   46.74  ? 69   LEU C CB    1 
ATOM   4112  C  CG    . LEU C 2  69   ? 42.526  -33.913 57.591  1.00   43.04  ? 69   LEU C CG    1 
ATOM   4113  C  CD1   . LEU C 2  69   ? 44.026  -33.722 57.791  1.00   42.21  ? 69   LEU C CD1   1 
ATOM   4114  C  CD2   . LEU C 2  69   ? 42.219  -35.339 57.166  1.00   38.91  ? 69   LEU C CD2   1 
ATOM   4115  N  N     . GLU C 2  70   ? 40.058  -32.338 60.917  1.00   48.85  ? 70   GLU C N     1 
ATOM   4116  C  CA    . GLU C 2  70   ? 39.579  -32.067 62.268  1.00   49.55  ? 70   GLU C CA    1 
ATOM   4117  C  C     . GLU C 2  70   ? 39.641  -30.575 62.572  1.00   47.36  ? 70   GLU C C     1 
ATOM   4118  O  O     . GLU C 2  70   ? 40.113  -29.787 61.752  1.00   51.46  ? 70   GLU C O     1 
ATOM   4119  C  CB    . GLU C 2  70   ? 40.428  -32.830 63.282  1.00   53.73  ? 70   GLU C CB    1 
ATOM   4120  C  CG    . GLU C 2  70   ? 41.915  -32.506 63.187  1.00   53.43  ? 70   GLU C CG    1 
ATOM   4121  C  CD    . GLU C 2  70   ? 42.777  -33.412 64.049  1.00   56.48  ? 70   GLU C CD    1 
ATOM   4122  O  OE1   . GLU C 2  70   ? 43.675  -32.896 64.746  1.00   58.57  ? 70   GLU C OE1   1 
ATOM   4123  O  OE2   . GLU C 2  70   ? 42.563  -34.642 64.023  1.00   58.18  ? 70   GLU C OE2   1 
ATOM   4124  N  N     . TYR C 2  71   ? 39.177  -30.197 63.760  1.00   45.16  ? 71   TYR C N     1 
ATOM   4125  C  CA    . TYR C 2  71   ? 39.247  -28.808 64.208  1.00   44.04  ? 71   TYR C CA    1 
ATOM   4126  C  C     . TYR C 2  71   ? 39.765  -28.710 65.643  1.00   40.24  ? 71   TYR C C     1 
ATOM   4127  O  O     . TYR C 2  71   ? 39.824  -29.707 66.362  1.00   44.03  ? 71   TYR C O     1 
ATOM   4128  C  CB    . TYR C 2  71   ? 37.881  -28.119 64.083  1.00   41.46  ? 71   TYR C CB    1 
ATOM   4129  C  CG    . TYR C 2  71   ? 36.864  -28.525 65.134  1.00   43.80  ? 71   TYR C CG    1 
ATOM   4130  C  CD1   . TYR C 2  71   ? 36.789  -27.859 66.353  1.00   43.29  ? 71   TYR C CD1   1 
ATOM   4131  C  CD2   . TYR C 2  71   ? 35.971  -29.562 64.902  1.00   44.35  ? 71   TYR C CD2   1 
ATOM   4132  C  CE1   . TYR C 2  71   ? 35.864  -28.224 67.312  1.00   37.14  ? 71   TYR C CE1   1 
ATOM   4133  C  CE2   . TYR C 2  71   ? 35.041  -29.930 65.856  1.00   40.83  ? 71   TYR C CE2   1 
ATOM   4134  C  CZ    . TYR C 2  71   ? 34.992  -29.260 67.057  1.00   36.62  ? 71   TYR C CZ    1 
ATOM   4135  O  OH    . TYR C 2  71   ? 34.064  -29.635 68.001  1.00   38.92  ? 71   TYR C OH    1 
ATOM   4136  N  N     . ARG C 2  72   ? 40.136  -27.505 66.058  1.00   37.50  ? 72   ARG C N     1 
ATOM   4137  C  CA    . ARG C 2  72   ? 40.573  -27.286 67.429  1.00   41.03  ? 72   ARG C CA    1 
ATOM   4138  C  C     . ARG C 2  72   ? 40.253  -25.871 67.898  1.00   43.58  ? 72   ARG C C     1 
ATOM   4139  O  O     . ARG C 2  72   ? 40.240  -24.926 67.105  1.00   44.54  ? 72   ARG C O     1 
ATOM   4140  C  CB    . ARG C 2  72   ? 42.070  -27.570 67.575  1.00   39.89  ? 72   ARG C CB    1 
ATOM   4141  C  CG    . ARG C 2  72   ? 42.975  -26.550 66.905  1.00   39.48  ? 72   ARG C CG    1 
ATOM   4142  C  CD    . ARG C 2  72   ? 44.437  -26.824 67.220  1.00   40.53  ? 72   ARG C CD    1 
ATOM   4143  N  NE    . ARG C 2  72   ? 45.324  -25.823 66.633  1.00   48.69  ? 72   ARG C NE    1 
ATOM   4144  C  CZ    . ARG C 2  72   ? 45.793  -24.765 67.285  1.00   53.25  ? 72   ARG C CZ    1 
ATOM   4145  N  NH1   . ARG C 2  72   ? 45.462  -24.564 68.554  1.00   46.55  ? 72   ARG C NH1   1 
ATOM   4146  N  NH2   . ARG C 2  72   ? 46.594  -23.906 66.668  1.00   54.68  ? 72   ARG C NH2   1 
ATOM   4147  N  N     . LEU C 2  73   ? 39.988  -25.736 69.193  1.00   40.57  ? 73   LEU C N     1 
ATOM   4148  C  CA    . LEU C 2  73   ? 39.728  -24.435 69.792  1.00   42.43  ? 73   LEU C CA    1 
ATOM   4149  C  C     . LEU C 2  73   ? 40.860  -24.050 70.736  1.00   44.12  ? 73   LEU C C     1 
ATOM   4150  O  O     . LEU C 2  73   ? 41.118  -24.741 71.723  1.00   48.50  ? 73   LEU C O     1 
ATOM   4151  C  CB    . LEU C 2  73   ? 38.391  -24.445 70.537  1.00   46.20  ? 73   LEU C CB    1 
ATOM   4152  C  CG    . LEU C 2  73   ? 37.137  -24.599 69.673  1.00   41.81  ? 73   LEU C CG    1 
ATOM   4153  C  CD1   . LEU C 2  73   ? 35.897  -24.758 70.540  1.00   40.26  ? 73   LEU C CD1   1 
ATOM   4154  C  CD2   . LEU C 2  73   ? 36.985  -23.412 68.739  1.00   36.05  ? 73   LEU C CD2   1 
ATOM   4155  N  N     . GLY C 2  74   ? 41.536  -22.948 70.426  1.00   40.84  ? 74   GLY C N     1 
ATOM   4156  C  CA    . GLY C 2  74   ? 42.645  -22.482 71.236  1.00   44.94  ? 74   GLY C CA    1 
ATOM   4157  C  C     . GLY C 2  74   ? 42.181  -21.816 72.516  1.00   50.82  ? 74   GLY C C     1 
ATOM   4158  O  O     . GLY C 2  74   ? 40.988  -21.790 72.813  1.00   52.85  ? 74   GLY C O     1 
ATOM   4159  N  N     . GLU C 2  75   ? 43.128  -21.278 73.277  1.00   54.96  ? 75   GLU C N     1 
ATOM   4160  C  CA    . GLU C 2  75   ? 42.811  -20.599 74.529  1.00   56.19  ? 75   GLU C CA    1 
ATOM   4161  C  C     . GLU C 2  75   ? 42.389  -19.156 74.274  1.00   55.61  ? 75   GLU C C     1 
ATOM   4162  O  O     . GLU C 2  75   ? 42.872  -18.523 73.334  1.00   55.28  ? 75   GLU C O     1 
ATOM   4163  C  CB    . GLU C 2  75   ? 44.010  -20.644 75.479  1.00   55.91  ? 75   GLU C CB    1 
ATOM   4164  C  CG    . GLU C 2  75   ? 44.375  -22.044 75.931  1.00   57.68  ? 75   GLU C CG    1 
ATOM   4165  C  CD    . GLU C 2  75   ? 43.238  -22.726 76.666  1.00   70.23  ? 75   GLU C CD    1 
ATOM   4166  O  OE1   . GLU C 2  75   ? 42.907  -23.878 76.312  1.00   68.41  ? 75   GLU C OE1   1 
ATOM   4167  O  OE2   . GLU C 2  75   ? 42.677  -22.111 77.598  1.00   78.14  ? 75   GLU C OE2   1 
ATOM   4168  N  N     . PRO C 2  76   ? 41.475  -18.634 75.109  1.00   49.76  ? 76   PRO C N     1 
ATOM   4169  C  CA    . PRO C 2  76   ? 41.000  -17.254 74.968  1.00   52.08  ? 76   PRO C CA    1 
ATOM   4170  C  C     . PRO C 2  76   ? 42.136  -16.250 75.120  1.00   59.83  ? 76   PRO C C     1 
ATOM   4171  O  O     . PRO C 2  76   ? 42.901  -16.340 76.081  1.00   57.69  ? 76   PRO C O     1 
ATOM   4172  C  CB    . PRO C 2  76   ? 40.015  -17.103 76.132  1.00   55.57  ? 76   PRO C CB    1 
ATOM   4173  C  CG    . PRO C 2  76   ? 39.589  -18.489 76.456  1.00   52.96  ? 76   PRO C CG    1 
ATOM   4174  C  CD    . PRO C 2  76   ? 40.790  -19.344 76.201  1.00   52.11  ? 76   PRO C CD    1 
ATOM   4175  N  N     . PRO C 2  77   ? 42.245  -15.300 74.178  1.00   62.86  ? 77   PRO C N     1 
ATOM   4176  C  CA    . PRO C 2  77   ? 43.290  -14.272 74.225  1.00   66.25  ? 77   PRO C CA    1 
ATOM   4177  C  C     . PRO C 2  77   ? 43.156  -13.362 75.445  1.00   64.10  ? 77   PRO C C     1 
ATOM   4178  O  O     . PRO C 2  77   ? 44.155  -12.810 75.907  1.00   64.74  ? 77   PRO C O     1 
ATOM   4179  C  CB    . PRO C 2  77   ? 43.058  -13.476 72.934  1.00   63.25  ? 77   PRO C CB    1 
ATOM   4180  C  CG    . PRO C 2  77   ? 41.639  -13.751 72.560  1.00   60.83  ? 77   PRO C CG    1 
ATOM   4181  C  CD    . PRO C 2  77   ? 41.384  -15.159 72.992  1.00   56.56  ? 77   PRO C CD    1 
ATOM   4182  N  N     . PHE C 2  78   ? 41.938  -13.210 75.956  1.00   59.75  ? 78   PHE C N     1 
ATOM   4183  C  CA    . PHE C 2  78   ? 41.706  -12.370 77.126  1.00   62.17  ? 78   PHE C CA    1 
ATOM   4184  C  C     . PHE C 2  78   ? 40.716  -13.011 78.097  1.00   60.85  ? 78   PHE C C     1 
ATOM   4185  O  O     . PHE C 2  78   ? 39.750  -13.646 77.673  1.00   59.73  ? 78   PHE C O     1 
ATOM   4186  C  CB    . PHE C 2  78   ? 41.203  -10.991 76.696  1.00   66.11  ? 78   PHE C CB    1 
ATOM   4187  C  CG    . PHE C 2  78   ? 42.104  -10.295 75.715  1.00   60.56  ? 78   PHE C CG    1 
ATOM   4188  C  CD1   . PHE C 2  78   ? 41.854  -10.367 74.354  1.00   52.66  ? 78   PHE C CD1   1 
ATOM   4189  C  CD2   . PHE C 2  78   ? 43.201  -9.574  76.153  1.00   55.60  ? 78   PHE C CD2   1 
ATOM   4190  C  CE1   . PHE C 2  78   ? 42.681  -9.730  73.450  1.00   52.40  ? 78   PHE C CE1   1 
ATOM   4191  C  CE2   . PHE C 2  78   ? 44.031  -8.935  75.254  1.00   53.90  ? 78   PHE C CE2   1 
ATOM   4192  C  CZ    . PHE C 2  78   ? 43.771  -9.013  73.901  1.00   54.70  ? 78   PHE C CZ    1 
ATOM   4193  N  N     . PRO C 2  79   ? 40.953  -12.841 79.408  1.00   61.34  ? 79   PRO C N     1 
ATOM   4194  C  CA    . PRO C 2  79   ? 40.044  -13.361 80.435  1.00   62.34  ? 79   PRO C CA    1 
ATOM   4195  C  C     . PRO C 2  79   ? 38.718  -12.610 80.427  1.00   66.70  ? 79   PRO C C     1 
ATOM   4196  O  O     . PRO C 2  79   ? 38.635  -11.527 79.848  1.00   67.72  ? 79   PRO C O     1 
ATOM   4197  C  CB    . PRO C 2  79   ? 40.801  -13.096 81.739  1.00   66.56  ? 79   PRO C CB    1 
ATOM   4198  C  CG    . PRO C 2  79   ? 41.701  -11.958 81.427  1.00   72.40  ? 79   PRO C CG    1 
ATOM   4199  C  CD    . PRO C 2  79   ? 42.112  -12.149 79.998  1.00   66.86  ? 79   PRO C CD    1 
ATOM   4200  N  N     . GLN C 2  80   ? 37.700  -13.187 81.060  1.00   67.51  ? 80   GLN C N     1 
ATOM   4201  C  CA    . GLN C 2  80   ? 36.348  -12.634 81.037  1.00   64.87  ? 80   GLN C CA    1 
ATOM   4202  C  C     . GLN C 2  80   ? 36.277  -11.185 81.517  1.00   72.43  ? 80   GLN C C     1 
ATOM   4203  O  O     . GLN C 2  80   ? 35.740  -10.320 80.823  1.00   67.84  ? 80   GLN C O     1 
ATOM   4204  C  CB    . GLN C 2  80   ? 35.404  -13.507 81.866  1.00   57.67  ? 80   GLN C CB    1 
ATOM   4205  C  CG    . GLN C 2  80   ? 35.304  -14.943 81.382  1.00   49.20  ? 80   GLN C CG    1 
ATOM   4206  C  CD    . GLN C 2  80   ? 34.295  -15.754 82.171  1.00   61.45  ? 80   GLN C CD    1 
ATOM   4207  O  OE1   . GLN C 2  80   ? 33.587  -15.224 83.029  1.00   61.84  ? 80   GLN C OE1   1 
ATOM   4208  N  NE2   . GLN C 2  80   ? 34.222  -17.047 81.882  1.00   68.99  ? 80   GLN C NE2   1 
ATOM   4209  N  N     . ASP C 2  81   ? 36.820  -10.934 82.705  1.00   83.63  ? 81   ASP C N     1 
ATOM   4210  C  CA    . ASP C 2  81   ? 36.821  -9.601  83.307  1.00   82.12  ? 81   ASP C CA    1 
ATOM   4211  C  C     . ASP C 2  81   ? 37.456  -8.550  82.398  1.00   75.42  ? 81   ASP C C     1 
ATOM   4212  O  O     . ASP C 2  81   ? 36.881  -7.481  82.161  1.00   73.69  ? 81   ASP C O     1 
ATOM   4213  C  CB    . ASP C 2  81   ? 37.553  -9.642  84.650  1.00   89.03  ? 81   ASP C CB    1 
ATOM   4214  C  CG    . ASP C 2  81   ? 38.790  -10.523 84.610  1.00   98.62  ? 81   ASP C CG    1 
ATOM   4215  O  OD1   . ASP C 2  81   ? 39.881  -10.041 84.981  1.00   103.18 ? 81   ASP C OD1   1 
ATOM   4216  O  OD2   . ASP C 2  81   ? 38.669  -11.702 84.210  1.00   95.92  ? 81   ASP C OD2   1 
ATOM   4217  N  N     . GLU C 2  82   ? 38.642  -8.865  81.890  1.00   70.82  ? 82   GLU C N     1 
ATOM   4218  C  CA    . GLU C 2  82   ? 39.367  -7.966  81.002  1.00   73.27  ? 82   GLU C CA    1 
ATOM   4219  C  C     . GLU C 2  82   ? 38.576  -7.703  79.724  1.00   67.50  ? 82   GLU C C     1 
ATOM   4220  O  O     . GLU C 2  82   ? 38.625  -6.605  79.168  1.00   66.11  ? 82   GLU C O     1 
ATOM   4221  C  CB    . GLU C 2  82   ? 40.742  -8.548  80.674  1.00   69.45  ? 82   GLU C CB    1 
ATOM   4222  C  CG    . GLU C 2  82   ? 41.621  -7.649  79.830  1.00   66.62  ? 82   GLU C CG    1 
ATOM   4223  C  CD    . GLU C 2  82   ? 43.018  -8.210  79.659  1.00   75.16  ? 82   GLU C CD    1 
ATOM   4224  O  OE1   . GLU C 2  82   ? 43.395  -9.109  80.441  1.00   65.84  ? 82   GLU C OE1   1 
ATOM   4225  O  OE2   . GLU C 2  82   ? 43.736  -7.755  78.744  1.00   83.93  ? 82   GLU C OE2   1 
ATOM   4226  N  N     . CYS C 2  83   ? 37.845  -8.714  79.264  1.00   62.66  ? 83   CYS C N     1 
ATOM   4227  C  CA    . CYS C 2  83   ? 36.974  -8.559  78.105  1.00   58.46  ? 83   CYS C CA    1 
ATOM   4228  C  C     . CYS C 2  83   ? 35.816  -7.622  78.422  1.00   60.06  ? 83   CYS C C     1 
ATOM   4229  O  O     . CYS C 2  83   ? 35.384  -6.847  77.571  1.00   62.86  ? 83   CYS C O     1 
ATOM   4230  C  CB    . CYS C 2  83   ? 36.440  -9.914  77.638  1.00   58.14  ? 83   CYS C CB    1 
ATOM   4231  S  SG    . CYS C 2  83   ? 37.597  -10.878 76.638  1.00   58.71  ? 83   CYS C SG    1 
ATOM   4232  N  N     . ARG C 2  84   ? 35.315  -7.698  79.651  1.00   61.65  ? 84   ARG C N     1 
ATOM   4233  C  CA    . ARG C 2  84   ? 34.236  -6.817  80.084  1.00   66.48  ? 84   ARG C CA    1 
ATOM   4234  C  C     . ARG C 2  84   ? 34.707  -5.368  80.138  1.00   66.78  ? 84   ARG C C     1 
ATOM   4235  O  O     . ARG C 2  84   ? 33.985  -4.455  79.732  1.00   62.55  ? 84   ARG C O     1 
ATOM   4236  C  CB    . ARG C 2  84   ? 33.693  -7.246  81.451  1.00   64.65  ? 84   ARG C CB    1 
ATOM   4237  C  CG    . ARG C 2  84   ? 32.943  -8.569  81.441  1.00   57.97  ? 84   ARG C CG    1 
ATOM   4238  C  CD    . ARG C 2  84   ? 32.266  -8.837  82.778  1.00   45.38  ? 84   ARG C CD    1 
ATOM   4239  N  NE    . ARG C 2  84   ? 31.418  -10.026 82.732  1.00   42.25  ? 84   ARG C NE    1 
ATOM   4240  C  CZ    . ARG C 2  84   ? 31.788  -11.227 83.164  1.00   47.47  ? 84   ARG C CZ    1 
ATOM   4241  N  NH1   . ARG C 2  84   ? 32.994  -11.404 83.685  1.00   57.96  ? 84   ARG C NH1   1 
ATOM   4242  N  NH2   . ARG C 2  84   ? 30.949  -12.252 83.080  1.00   41.20  ? 84   ARG C NH2   1 
ATOM   4243  N  N     . GLU C 2  85   ? 35.925  -5.163  80.632  1.00   65.04  ? 85   GLU C N     1 
ATOM   4244  C  CA    . GLU C 2  85   ? 36.461  -3.814  80.791  1.00   65.79  ? 85   GLU C CA    1 
ATOM   4245  C  C     . GLU C 2  85   ? 36.807  -3.147  79.459  1.00   61.10  ? 85   GLU C C     1 
ATOM   4246  O  O     . GLU C 2  85   ? 36.508  -1.971  79.249  1.00   63.07  ? 85   GLU C O     1 
ATOM   4247  C  CB    . GLU C 2  85   ? 37.689  -3.824  81.704  1.00   65.96  ? 85   GLU C CB    1 
ATOM   4248  C  CG    . GLU C 2  85   ? 38.313  -2.451  81.906  1.00   74.60  ? 85   GLU C CG    1 
ATOM   4249  C  CD    . GLU C 2  85   ? 39.510  -2.483  82.834  1.00   88.08  ? 85   GLU C CD    1 
ATOM   4250  O  OE1   . GLU C 2  85   ? 39.672  -3.485  83.562  1.00   94.89  ? 85   GLU C OE1   1 
ATOM   4251  O  OE2   . GLU C 2  85   ? 40.290  -1.507  82.832  1.00   90.82  ? 85   GLU C OE2   1 
ATOM   4252  N  N     . LYS C 2  86   ? 37.426  -3.905  78.562  1.00   61.48  ? 86   LYS C N     1 
ATOM   4253  C  CA    . LYS C 2  86   ? 37.926  -3.355  77.304  1.00   56.80  ? 86   LYS C CA    1 
ATOM   4254  C  C     . LYS C 2  86   ? 36.891  -3.398  76.184  1.00   54.67  ? 86   LYS C C     1 
ATOM   4255  O  O     . LYS C 2  86   ? 37.205  -3.090  75.033  1.00   51.92  ? 86   LYS C O     1 
ATOM   4256  C  CB    . LYS C 2  86   ? 39.205  -4.075  76.870  1.00   51.85  ? 86   LYS C CB    1 
ATOM   4257  C  CG    . LYS C 2  86   ? 40.384  -3.861  77.804  1.00   56.44  ? 86   LYS C CG    1 
ATOM   4258  C  CD    . LYS C 2  86   ? 41.633  -4.556  77.284  1.00   56.16  ? 86   LYS C CD    1 
ATOM   4259  C  CE    . LYS C 2  86   ? 42.828  -4.290  78.185  1.00   53.46  ? 86   LYS C CE    1 
ATOM   4260  N  NZ    . LYS C 2  86   ? 44.064  -4.947  77.676  1.00   58.74  ? 86   LYS C NZ    1 
ATOM   4261  N  N     . ASP C 2  87   ? 35.670  -3.800  76.527  1.00   59.94  ? 87   ASP C N     1 
ATOM   4262  C  CA    . ASP C 2  87   ? 34.577  -3.926  75.561  1.00   60.80  ? 87   ASP C CA    1 
ATOM   4263  C  C     . ASP C 2  87   ? 34.916  -4.932  74.461  1.00   55.98  ? 87   ASP C C     1 
ATOM   4264  O  O     . ASP C 2  87   ? 34.660  -4.693  73.280  1.00   52.83  ? 87   ASP C O     1 
ATOM   4265  C  CB    . ASP C 2  87   ? 34.183  -2.564  74.971  1.00   59.90  ? 87   ASP C CB    1 
ATOM   4266  C  CG    . ASP C 2  87   ? 33.443  -1.685  75.971  1.00   68.77  ? 87   ASP C CG    1 
ATOM   4267  O  OD1   . ASP C 2  87   ? 33.571  -1.924  77.192  1.00   67.16  ? 87   ASP C OD1   1 
ATOM   4268  O  OD2   . ASP C 2  87   ? 32.735  -0.752  75.534  1.00   61.12  ? 87   ASP C OD2   1 
ATOM   4269  N  N     . LEU C 2  88   ? 35.489  -6.060  74.872  1.00   59.81  ? 88   LEU C N     1 
ATOM   4270  C  CA    . LEU C 2  88   ? 35.890  -7.120  73.955  1.00   51.84  ? 88   LEU C CA    1 
ATOM   4271  C  C     . LEU C 2  88   ? 35.038  -8.366  74.161  1.00   52.17  ? 88   LEU C C     1 
ATOM   4272  O  O     . LEU C 2  88   ? 34.532  -8.611  75.255  1.00   58.57  ? 88   LEU C O     1 
ATOM   4273  C  CB    . LEU C 2  88   ? 37.360  -7.479  74.166  1.00   44.11  ? 88   LEU C CB    1 
ATOM   4274  C  CG    . LEU C 2  88   ? 38.357  -6.323  74.167  1.00   47.06  ? 88   LEU C CG    1 
ATOM   4275  C  CD1   . LEU C 2  88   ? 39.772  -6.845  74.361  1.00   45.65  ? 88   LEU C CD1   1 
ATOM   4276  C  CD2   . LEU C 2  88   ? 38.244  -5.513  72.886  1.00   54.78  ? 88   LEU C CD2   1 
ATOM   4277  N  N     . THR C 2  89   ? 34.883  -9.150  73.100  1.00   49.08  ? 89   THR C N     1 
ATOM   4278  C  CA    . THR C 2  89   ? 34.148  -10.406 73.170  1.00   46.78  ? 89   THR C CA    1 
ATOM   4279  C  C     . THR C 2  89   ? 35.011  -11.519 73.764  1.00   52.85  ? 89   THR C C     1 
ATOM   4280  O  O     . THR C 2  89   ? 36.175  -11.676 73.390  1.00   52.79  ? 89   THR C O     1 
ATOM   4281  C  CB    . THR C 2  89   ? 33.654  -10.826 71.773  1.00   41.66  ? 89   THR C CB    1 
ATOM   4282  O  OG1   . THR C 2  89   ? 32.631  -9.922  71.339  1.00   50.99  ? 89   THR C OG1   1 
ATOM   4283  C  CG2   . THR C 2  89   ? 33.096  -12.238 71.793  1.00   41.25  ? 89   THR C CG2   1 
ATOM   4284  N  N     . TYR C 2  90   ? 34.441  -12.294 74.685  1.00   56.30  ? 90   TYR C N     1 
ATOM   4285  C  CA    . TYR C 2  90   ? 35.156  -13.423 75.268  1.00   54.08  ? 90   TYR C CA    1 
ATOM   4286  C  C     . TYR C 2  90   ? 35.010  -14.617 74.337  1.00   52.94  ? 90   TYR C C     1 
ATOM   4287  O  O     . TYR C 2  90   ? 33.907  -15.129 74.134  1.00   45.18  ? 90   TYR C O     1 
ATOM   4288  C  CB    . TYR C 2  90   ? 34.597  -13.757 76.652  1.00   46.73  ? 90   TYR C CB    1 
ATOM   4289  C  CG    . TYR C 2  90   ? 35.294  -14.910 77.342  1.00   48.63  ? 90   TYR C CG    1 
ATOM   4290  C  CD1   . TYR C 2  90   ? 36.578  -14.768 77.850  1.00   52.33  ? 90   TYR C CD1   1 
ATOM   4291  C  CD2   . TYR C 2  90   ? 34.662  -16.136 77.495  1.00   47.21  ? 90   TYR C CD2   1 
ATOM   4292  C  CE1   . TYR C 2  90   ? 37.217  -15.817 78.483  1.00   51.74  ? 90   TYR C CE1   1 
ATOM   4293  C  CE2   . TYR C 2  90   ? 35.292  -17.191 78.129  1.00   46.17  ? 90   TYR C CE2   1 
ATOM   4294  C  CZ    . TYR C 2  90   ? 36.569  -17.025 78.621  1.00   48.93  ? 90   TYR C CZ    1 
ATOM   4295  O  OH    . TYR C 2  90   ? 37.200  -18.073 79.251  1.00   55.42  ? 90   TYR C OH    1 
ATOM   4296  N  N     . GLN C 2  91   ? 36.136  -15.066 73.791  1.00   50.97  ? 91   GLN C N     1 
ATOM   4297  C  CA    . GLN C 2  91   ? 36.125  -16.007 72.680  1.00   42.42  ? 91   GLN C CA    1 
ATOM   4298  C  C     . GLN C 2  91   ? 37.424  -16.797 72.571  1.00   44.12  ? 91   GLN C C     1 
ATOM   4299  O  O     . GLN C 2  91   ? 38.441  -16.429 73.157  1.00   44.52  ? 91   GLN C O     1 
ATOM   4300  C  CB    . GLN C 2  91   ? 35.878  -15.248 71.377  1.00   38.51  ? 91   GLN C CB    1 
ATOM   4301  C  CG    . GLN C 2  91   ? 36.860  -14.112 71.153  1.00   44.07  ? 91   GLN C CG    1 
ATOM   4302  C  CD    . GLN C 2  91   ? 36.476  -13.229 69.986  1.00   49.74  ? 91   GLN C CD    1 
ATOM   4303  O  OE1   . GLN C 2  91   ? 35.449  -13.442 69.341  1.00   46.41  ? 91   GLN C OE1   1 
ATOM   4304  N  NE2   . GLN C 2  91   ? 37.304  -12.228 69.706  1.00   49.94  ? 91   GLN C NE2   1 
ATOM   4305  N  N     . ALA C 2  92   ? 37.375  -17.888 71.812  1.00   47.13  ? 92   ALA C N     1 
ATOM   4306  C  CA    . ALA C 2  92   ? 38.545  -18.718 71.557  1.00   44.82  ? 92   ALA C CA    1 
ATOM   4307  C  C     . ALA C 2  92   ? 38.768  -18.863 70.054  1.00   43.26  ? 92   ALA C C     1 
ATOM   4308  O  O     . ALA C 2  92   ? 37.810  -18.968 69.289  1.00   40.04  ? 92   ALA C O     1 
ATOM   4309  C  CB    . ALA C 2  92   ? 38.367  -20.083 72.194  1.00   46.87  ? 92   ALA C CB    1 
ATOM   4310  N  N     . PRO C 2  93   ? 40.039  -18.872 69.626  1.00   46.21  ? 93   PRO C N     1 
ATOM   4311  C  CA    . PRO C 2  93   ? 40.361  -19.003 68.202  1.00   43.80  ? 93   PRO C CA    1 
ATOM   4312  C  C     . PRO C 2  93   ? 40.012  -20.389 67.671  1.00   40.92  ? 93   PRO C C     1 
ATOM   4313  O  O     . PRO C 2  93   ? 40.300  -21.388 68.328  1.00   45.40  ? 93   PRO C O     1 
ATOM   4314  C  CB    . PRO C 2  93   ? 41.877  -18.788 68.169  1.00   42.90  ? 93   PRO C CB    1 
ATOM   4315  C  CG    . PRO C 2  93   ? 42.343  -19.179 69.526  1.00   44.51  ? 93   PRO C CG    1 
ATOM   4316  C  CD    . PRO C 2  93   ? 41.249  -18.763 70.460  1.00   50.50  ? 93   PRO C CD    1 
ATOM   4317  N  N     . LEU C 2  94   ? 39.393  -20.443 66.496  1.00   38.07  ? 94   LEU C N     1 
ATOM   4318  C  CA    . LEU C 2  94   ? 39.043  -21.716 65.877  1.00   40.95  ? 94   LEU C CA    1 
ATOM   4319  C  C     . LEU C 2  94   ? 39.969  -22.046 64.712  1.00   49.89  ? 94   LEU C C     1 
ATOM   4320  O  O     . LEU C 2  94   ? 39.993  -21.339 63.703  1.00   50.95  ? 94   LEU C O     1 
ATOM   4321  C  CB    . LEU C 2  94   ? 37.588  -21.713 65.402  1.00   39.33  ? 94   LEU C CB    1 
ATOM   4322  C  CG    . LEU C 2  94   ? 37.151  -22.890 64.523  1.00   32.47  ? 94   LEU C CG    1 
ATOM   4323  C  CD1   . LEU C 2  94   ? 37.336  -24.217 65.238  1.00   34.48  ? 94   LEU C CD1   1 
ATOM   4324  C  CD2   . LEU C 2  94   ? 35.709  -22.725 64.074  1.00   29.35  ? 94   LEU C CD2   1 
ATOM   4325  N  N     . TYR C 2  95   ? 40.728  -23.127 64.858  1.00   47.98  ? 95   TYR C N     1 
ATOM   4326  C  CA    . TYR C 2  95   ? 41.592  -23.599 63.784  1.00   42.07  ? 95   TYR C CA    1 
ATOM   4327  C  C     . TYR C 2  95   ? 40.989  -24.848 63.157  1.00   38.97  ? 95   TYR C C     1 
ATOM   4328  O  O     . TYR C 2  95   ? 40.376  -25.660 63.844  1.00   43.62  ? 95   TYR C O     1 
ATOM   4329  C  CB    . TYR C 2  95   ? 42.991  -23.909 64.314  1.00   44.17  ? 95   TYR C CB    1 
ATOM   4330  C  CG    . TYR C 2  95   ? 43.697  -22.723 64.931  1.00   48.90  ? 95   TYR C CG    1 
ATOM   4331  C  CD1   . TYR C 2  95   ? 43.585  -22.452 66.288  1.00   48.27  ? 95   TYR C CD1   1 
ATOM   4332  C  CD2   . TYR C 2  95   ? 44.481  -21.878 64.156  1.00   57.05  ? 95   TYR C CD2   1 
ATOM   4333  C  CE1   . TYR C 2  95   ? 44.233  -21.371 66.857  1.00   51.75  ? 95   TYR C CE1   1 
ATOM   4334  C  CE2   . TYR C 2  95   ? 45.132  -20.794 64.716  1.00   58.83  ? 95   TYR C CE2   1 
ATOM   4335  C  CZ    . TYR C 2  95   ? 45.005  -20.546 66.066  1.00   56.58  ? 95   TYR C CZ    1 
ATOM   4336  O  OH    . TYR C 2  95   ? 45.652  -19.468 66.626  1.00   64.00  ? 95   TYR C OH    1 
ATOM   4337  N  N     . ALA C 2  96   ? 41.156  -24.998 61.849  1.00   40.68  ? 96   ALA C N     1 
ATOM   4338  C  CA    . ALA C 2  96   ? 40.647  -26.177 61.161  1.00   38.49  ? 96   ALA C CA    1 
ATOM   4339  C  C     . ALA C 2  96   ? 41.702  -26.748 60.222  1.00   54.66  ? 96   ALA C C     1 
ATOM   4340  O  O     . ALA C 2  96   ? 42.282  -26.024 59.410  1.00   62.76  ? 96   ALA C O     1 
ATOM   4341  C  CB    . ALA C 2  96   ? 39.374  -25.845 60.400  1.00   37.75  ? 96   ALA C CB    1 
ATOM   4342  N  N     . ARG C 2  97   ? 41.957  -28.046 60.339  1.00   47.45  ? 97   ARG C N     1 
ATOM   4343  C  CA    . ARG C 2  97   ? 42.961  -28.686 59.501  1.00   42.72  ? 97   ARG C CA    1 
ATOM   4344  C  C     . ARG C 2  97   ? 42.365  -29.141 58.178  1.00   44.05  ? 97   ARG C C     1 
ATOM   4345  O  O     . ARG C 2  97   ? 41.456  -29.968 58.141  1.00   42.77  ? 97   ARG C O     1 
ATOM   4346  C  CB    . ARG C 2  97   ? 43.612  -29.856 60.235  1.00   43.96  ? 97   ARG C CB    1 
ATOM   4347  C  CG    . ARG C 2  97   ? 44.467  -29.428 61.414  1.00   54.15  ? 97   ARG C CG    1 
ATOM   4348  C  CD    . ARG C 2  97   ? 45.225  -30.604 61.995  1.00   60.16  ? 97   ARG C CD    1 
ATOM   4349  N  NE    . ARG C 2  97   ? 45.910  -31.368 60.957  1.00   58.30  ? 97   ARG C NE    1 
ATOM   4350  C  CZ    . ARG C 2  97   ? 46.674  -32.428 61.196  1.00   60.53  ? 97   ARG C CZ    1 
ATOM   4351  N  NH1   . ARG C 2  97   ? 47.257  -33.068 60.193  1.00   61.04  ? 97   ARG C NH1   1 
ATOM   4352  N  NH2   . ARG C 2  97   ? 46.855  -32.848 62.440  1.00   62.99  ? 97   ARG C NH2   1 
ATOM   4353  N  N     . LEU C 2  98   ? 42.889  -28.589 57.091  1.00   50.34  ? 98   LEU C N     1 
ATOM   4354  C  CA    . LEU C 2  98   ? 42.364  -28.873 55.766  1.00   58.52  ? 98   LEU C CA    1 
ATOM   4355  C  C     . LEU C 2  98   ? 43.451  -29.429 54.857  1.00   71.16  ? 98   LEU C C     1 
ATOM   4356  O  O     . LEU C 2  98   ? 44.643  -29.256 55.119  1.00   74.83  ? 98   LEU C O     1 
ATOM   4357  C  CB    . LEU C 2  98   ? 41.782  -27.601 55.147  1.00   64.51  ? 98   LEU C CB    1 
ATOM   4358  C  CG    . LEU C 2  98   ? 40.739  -26.831 55.957  1.00   52.08  ? 98   LEU C CG    1 
ATOM   4359  C  CD1   . LEU C 2  98   ? 40.242  -25.629 55.170  1.00   50.02  ? 98   LEU C CD1   1 
ATOM   4360  C  CD2   . LEU C 2  98   ? 39.584  -27.740 56.342  1.00   46.52  ? 98   LEU C CD2   1 
ATOM   4361  N  N     . GLN C 2  99   ? 43.033  -30.098 53.789  1.00   72.41  ? 99   GLN C N     1 
ATOM   4362  C  CA    . GLN C 2  99   ? 43.964  -30.569 52.772  1.00   74.91  ? 99   GLN C CA    1 
ATOM   4363  C  C     . GLN C 2  99   ? 43.383  -30.397 51.369  1.00   78.77  ? 99   GLN C C     1 
ATOM   4364  O  O     . GLN C 2  99   ? 42.226  -30.735 51.116  1.00   76.05  ? 99   GLN C O     1 
ATOM   4365  C  CB    . GLN C 2  99   ? 44.359  -32.027 53.023  1.00   68.10  ? 99   GLN C CB    1 
ATOM   4366  C  CG    . GLN C 2  99   ? 43.205  -33.011 52.979  1.00   62.27  ? 99   GLN C CG    1 
ATOM   4367  C  CD    . GLN C 2  99   ? 43.673  -34.450 53.031  1.00   67.49  ? 99   GLN C CD    1 
ATOM   4368  O  OE1   . GLN C 2  99   ? 43.020  -35.347 52.496  1.00   71.02  ? 99   GLN C OE1   1 
ATOM   4369  N  NE2   . GLN C 2  99   ? 44.811  -34.679 53.678  1.00   56.41  ? 99   GLN C NE2   1 
ATOM   4370  N  N     . LEU C 2  100  ? 44.191  -29.852 50.467  1.00   82.96  ? 100  LEU C N     1 
ATOM   4371  C  CA    . LEU C 2  100  ? 43.783  -29.653 49.083  1.00   79.78  ? 100  LEU C CA    1 
ATOM   4372  C  C     . LEU C 2  100  ? 44.317  -30.803 48.240  1.00   75.43  ? 100  LEU C C     1 
ATOM   4373  O  O     . LEU C 2  100  ? 45.478  -31.192 48.375  1.00   80.51  ? 100  LEU C O     1 
ATOM   4374  C  CB    . LEU C 2  100  ? 44.315  -28.316 48.561  1.00   80.50  ? 100  LEU C CB    1 
ATOM   4375  C  CG    . LEU C 2  100  ? 43.513  -27.560 47.497  1.00   79.62  ? 100  LEU C CG    1 
ATOM   4376  C  CD1   . LEU C 2  100  ? 44.083  -26.166 47.321  1.00   86.73  ? 100  LEU C CD1   1 
ATOM   4377  C  CD2   . LEU C 2  100  ? 43.495  -28.292 46.165  1.00   79.66  ? 100  LEU C CD2   1 
ATOM   4378  N  N     . ILE C 2  101  ? 43.465  -31.347 47.377  1.00   77.75  ? 101  ILE C N     1 
ATOM   4379  C  CA    . ILE C 2  101  ? 43.847  -32.465 46.523  1.00   85.88  ? 101  ILE C CA    1 
ATOM   4380  C  C     . ILE C 2  101  ? 43.465  -32.233 45.062  1.00   102.55 ? 101  ILE C C     1 
ATOM   4381  O  O     . ILE C 2  101  ? 42.290  -32.053 44.742  1.00   106.36 ? 101  ILE C O     1 
ATOM   4382  C  CB    . ILE C 2  101  ? 43.187  -33.777 46.987  1.00   68.38  ? 101  ILE C CB    1 
ATOM   4383  C  CG1   . ILE C 2  101  ? 43.577  -34.098 48.430  1.00   65.48  ? 101  ILE C CG1   1 
ATOM   4384  C  CG2   . ILE C 2  101  ? 43.571  -34.921 46.063  1.00   77.63  ? 101  ILE C CG2   1 
ATOM   4385  C  CD1   . ILE C 2  101  ? 42.926  -35.349 48.970  1.00   64.90  ? 101  ILE C CD1   1 
ATOM   4386  N  N     . HIS C 2  102  ? 44.460  -32.237 44.180  1.00   98.73  ? 102  HIS C N     1 
ATOM   4387  C  CA    . HIS C 2  102  ? 44.197  -32.225 42.747  1.00   101.26 ? 102  HIS C CA    1 
ATOM   4388  C  C     . HIS C 2  102  ? 44.063  -33.674 42.293  1.00   107.08 ? 102  HIS C C     1 
ATOM   4389  O  O     . HIS C 2  102  ? 44.970  -34.478 42.500  1.00   108.92 ? 102  HIS C O     1 
ATOM   4390  C  CB    . HIS C 2  102  ? 45.326  -31.523 41.986  1.00   100.59 ? 102  HIS C CB    1 
ATOM   4391  C  CG    . HIS C 2  102  ? 44.975  -31.168 40.572  1.00   109.85 ? 102  HIS C CG    1 
ATOM   4392  N  ND1   . HIS C 2  102  ? 44.809  -32.115 39.585  1.00   111.77 ? 102  HIS C ND1   1 
ATOM   4393  C  CD2   . HIS C 2  102  ? 44.767  -29.967 39.980  1.00   106.01 ? 102  HIS C CD2   1 
ATOM   4394  C  CE1   . HIS C 2  102  ? 44.508  -31.514 38.447  1.00   107.22 ? 102  HIS C CE1   1 
ATOM   4395  N  NE2   . HIS C 2  102  ? 44.476  -30.211 38.659  1.00   104.14 ? 102  HIS C NE2   1 
ATOM   4396  N  N     . LYS C 2  103  ? 42.924  -34.005 41.692  1.00   110.12 ? 103  LYS C N     1 
ATOM   4397  C  CA    . LYS C 2  103  ? 42.621  -35.383 41.310  1.00   108.58 ? 103  LYS C CA    1 
ATOM   4398  C  C     . LYS C 2  103  ? 43.640  -35.972 40.336  1.00   117.00 ? 103  LYS C C     1 
ATOM   4399  O  O     . LYS C 2  103  ? 44.176  -37.057 40.567  1.00   111.10 ? 103  LYS C O     1 
ATOM   4400  C  CB    . LYS C 2  103  ? 41.214  -35.477 40.714  1.00   109.63 ? 103  LYS C CB    1 
ATOM   4401  C  CG    . LYS C 2  103  ? 40.102  -35.145 41.694  1.00   105.42 ? 103  LYS C CG    1 
ATOM   4402  C  CD    . LYS C 2  103  ? 38.748  -35.119 41.003  1.00   107.23 ? 103  LYS C CD    1 
ATOM   4403  C  CE    . LYS C 2  103  ? 37.638  -34.778 41.984  1.00   108.12 ? 103  LYS C CE    1 
ATOM   4404  N  NZ    . LYS C 2  103  ? 36.323  -34.608 41.307  1.00   114.58 ? 103  LYS C NZ    1 
ATOM   4405  N  N     . ASP C 2  104  ? 43.906  -35.251 39.252  1.00   119.14 ? 104  ASP C N     1 
ATOM   4406  C  CA    . ASP C 2  104  ? 44.828  -35.724 38.226  1.00   112.03 ? 104  ASP C CA    1 
ATOM   4407  C  C     . ASP C 2  104  ? 46.271  -35.763 38.722  1.00   108.81 ? 104  ASP C C     1 
ATOM   4408  O  O     . ASP C 2  104  ? 46.939  -36.791 38.625  1.00   116.80 ? 104  ASP C O     1 
ATOM   4409  C  CB    . ASP C 2  104  ? 44.729  -34.853 36.971  1.00   116.77 ? 104  ASP C CB    1 
ATOM   4410  C  CG    . ASP C 2  104  ? 43.381  -34.967 36.288  1.00   120.60 ? 104  ASP C CG    1 
ATOM   4411  O  OD1   . ASP C 2  104  ? 42.757  -36.046 36.378  1.00   107.97 ? 104  ASP C OD1   1 
ATOM   4412  O  OD2   . ASP C 2  104  ? 42.945  -33.978 35.661  1.00   132.73 ? 104  ASP C OD2   1 
ATOM   4413  N  N     . THR C 2  105  ? 46.742  -34.641 39.257  1.00   107.50 ? 105  THR C N     1 
ATOM   4414  C  CA    . THR C 2  105  ? 48.122  -34.530 39.717  1.00   105.66 ? 105  THR C CA    1 
ATOM   4415  C  C     . THR C 2  105  ? 48.386  -35.429 40.925  1.00   101.58 ? 105  THR C C     1 
ATOM   4416  O  O     . THR C 2  105  ? 49.468  -36.000 41.062  1.00   97.72  ? 105  THR C O     1 
ATOM   4417  C  CB    . THR C 2  105  ? 48.481  -33.072 40.070  1.00   102.98 ? 105  THR C CB    1 
ATOM   4418  O  OG1   . THR C 2  105  ? 48.123  -32.212 38.981  1.00   101.64 ? 105  THR C OG1   1 
ATOM   4419  C  CG2   . THR C 2  105  ? 49.970  -32.936 40.344  1.00   95.47  ? 105  THR C CG2   1 
ATOM   4420  N  N     . GLY C 2  106  ? 47.388  -35.556 41.793  1.00   105.15 ? 106  GLY C N     1 
ATOM   4421  C  CA    . GLY C 2  106  ? 47.519  -36.369 42.989  1.00   106.88 ? 106  GLY C CA    1 
ATOM   4422  C  C     . GLY C 2  106  ? 48.188  -35.620 44.125  1.00   110.79 ? 106  GLY C C     1 
ATOM   4423  O  O     . GLY C 2  106  ? 48.347  -36.153 45.224  1.00   103.61 ? 106  GLY C O     1 
ATOM   4424  N  N     . LEU C 2  107  ? 48.578  -34.377 43.857  1.00   112.07 ? 107  LEU C N     1 
ATOM   4425  C  CA    . LEU C 2  107  ? 49.248  -33.543 44.850  1.00   102.42 ? 107  LEU C CA    1 
ATOM   4426  C  C     . LEU C 2  107  ? 48.326  -33.237 46.024  1.00   94.71  ? 107  LEU C C     1 
ATOM   4427  O  O     . LEU C 2  107  ? 47.156  -32.905 45.836  1.00   93.38  ? 107  LEU C O     1 
ATOM   4428  C  CB    . LEU C 2  107  ? 49.733  -32.239 44.211  1.00   106.48 ? 107  LEU C CB    1 
ATOM   4429  C  CG    . LEU C 2  107  ? 50.464  -31.250 45.124  1.00   104.53 ? 107  LEU C CG    1 
ATOM   4430  C  CD1   . LEU C 2  107  ? 51.740  -31.869 45.675  1.00   95.58  ? 107  LEU C CD1   1 
ATOM   4431  C  CD2   . LEU C 2  107  ? 50.764  -29.950 44.388  1.00   99.42  ? 107  LEU C CD2   1 
ATOM   4432  N  N     . ILE C 2  108  ? 48.860  -33.358 47.236  1.00   90.63  ? 108  ILE C N     1 
ATOM   4433  C  CA    . ILE C 2  108  ? 48.092  -33.078 48.444  1.00   86.38  ? 108  ILE C CA    1 
ATOM   4434  C  C     . ILE C 2  108  ? 48.792  -32.038 49.314  1.00   86.91  ? 108  ILE C C     1 
ATOM   4435  O  O     . ILE C 2  108  ? 49.872  -32.290 49.848  1.00   92.39  ? 108  ILE C O     1 
ATOM   4436  C  CB    . ILE C 2  108  ? 47.868  -34.353 49.277  1.00   70.08  ? 108  ILE C CB    1 
ATOM   4437  C  CG1   . ILE C 2  108  ? 47.216  -35.443 48.426  1.00   67.43  ? 108  ILE C CG1   1 
ATOM   4438  C  CG2   . ILE C 2  108  ? 47.019  -34.045 50.500  1.00   70.55  ? 108  ILE C CG2   1 
ATOM   4439  C  CD1   . ILE C 2  108  ? 46.983  -36.738 49.169  1.00   52.17  ? 108  ILE C CD1   1 
ATOM   4440  N  N     . LYS C 2  109  ? 48.170  -30.872 49.461  1.00   79.50  ? 109  LYS C N     1 
ATOM   4441  C  CA    . LYS C 2  109  ? 48.738  -29.812 50.289  1.00   78.11  ? 109  LYS C CA    1 
ATOM   4442  C  C     . LYS C 2  109  ? 47.906  -29.606 51.552  1.00   83.29  ? 109  LYS C C     1 
ATOM   4443  O  O     . LYS C 2  109  ? 46.783  -29.108 51.496  1.00   86.26  ? 109  LYS C O     1 
ATOM   4444  C  CB    . LYS C 2  109  ? 48.848  -28.506 49.495  1.00   78.89  ? 109  LYS C CB    1 
ATOM   4445  C  CG    . LYS C 2  109  ? 49.269  -27.299 50.324  1.00   84.19  ? 109  LYS C CG    1 
ATOM   4446  C  CD    . LYS C 2  109  ? 50.615  -27.519 50.997  1.00   81.36  ? 109  LYS C CD    1 
ATOM   4447  C  CE    . LYS C 2  109  ? 50.974  -26.352 51.903  1.00   76.15  ? 109  LYS C CE    1 
ATOM   4448  N  NZ    . LYS C 2  109  ? 52.239  -26.594 52.648  1.00   64.64  ? 109  LYS C NZ    1 
ATOM   4449  N  N     . GLU C 2  110  ? 48.474  -29.984 52.692  1.00   79.68  ? 110  GLU C N     1 
ATOM   4450  C  CA    . GLU C 2  110  ? 47.759  -29.931 53.961  1.00   70.56  ? 110  GLU C CA    1 
ATOM   4451  C  C     . GLU C 2  110  ? 48.225  -28.771 54.835  1.00   71.93  ? 110  GLU C C     1 
ATOM   4452  O  O     . GLU C 2  110  ? 49.424  -28.541 54.992  1.00   76.50  ? 110  GLU C O     1 
ATOM   4453  C  CB    . GLU C 2  110  ? 47.926  -31.252 54.709  1.00   59.49  ? 110  GLU C CB    1 
ATOM   4454  C  CG    . GLU C 2  110  ? 47.424  -31.226 56.133  1.00   62.30  ? 110  GLU C CG    1 
ATOM   4455  C  CD    . GLU C 2  110  ? 47.617  -32.551 56.830  1.00   69.61  ? 110  GLU C CD    1 
ATOM   4456  O  OE1   . GLU C 2  110  ? 47.736  -32.555 58.072  1.00   74.69  ? 110  GLU C OE1   1 
ATOM   4457  O  OE2   . GLU C 2  110  ? 47.650  -33.589 56.135  1.00   60.43  ? 110  GLU C OE2   1 
ATOM   4458  N  N     . ASP C 2  111  ? 47.268  -28.045 55.405  1.00   65.82  ? 111  ASP C N     1 
ATOM   4459  C  CA    . ASP C 2  111  ? 47.582  -26.888 56.232  1.00   67.33  ? 111  ASP C CA    1 
ATOM   4460  C  C     . ASP C 2  111  ? 46.482  -26.637 57.264  1.00   65.28  ? 111  ASP C C     1 
ATOM   4461  O  O     . ASP C 2  111  ? 45.325  -27.008 57.056  1.00   61.33  ? 111  ASP C O     1 
ATOM   4462  C  CB    . ASP C 2  111  ? 47.781  -25.655 55.343  1.00   66.60  ? 111  ASP C CB    1 
ATOM   4463  C  CG    . ASP C 2  111  ? 48.381  -24.481 56.092  1.00   68.90  ? 111  ASP C CG    1 
ATOM   4464  O  OD1   . ASP C 2  111  ? 48.204  -23.333 55.631  1.00   70.28  ? 111  ASP C OD1   1 
ATOM   4465  O  OD2   . ASP C 2  111  ? 49.029  -24.703 57.138  1.00   60.61  ? 111  ASP C OD2   1 
ATOM   4466  N  N     . GLU C 2  112  ? 46.850  -26.017 58.381  1.00   55.41  ? 112  GLU C N     1 
ATOM   4467  C  CA    . GLU C 2  112  ? 45.881  -25.637 59.401  1.00   41.08  ? 112  GLU C CA    1 
ATOM   4468  C  C     . GLU C 2  112  ? 45.501  -24.174 59.226  1.00   51.85  ? 112  GLU C C     1 
ATOM   4469  O  O     . GLU C 2  112  ? 46.348  -23.289 59.345  1.00   62.31  ? 112  GLU C O     1 
ATOM   4470  C  CB    . GLU C 2  112  ? 46.454  -25.860 60.800  1.00   36.59  ? 112  GLU C CB    1 
ATOM   4471  C  CG    . GLU C 2  112  ? 45.490  -25.497 61.918  1.00   50.38  ? 112  GLU C CG    1 
ATOM   4472  C  CD    . GLU C 2  112  ? 46.096  -25.663 63.299  1.00   50.31  ? 112  GLU C CD    1 
ATOM   4473  O  OE1   . GLU C 2  112  ? 47.147  -25.044 63.567  1.00   52.99  ? 112  GLU C OE1   1 
ATOM   4474  O  OE2   . GLU C 2  112  ? 45.522  -26.414 64.115  1.00   43.32  ? 112  GLU C OE2   1 
ATOM   4475  N  N     . VAL C 2  113  ? 44.227  -23.919 58.946  1.00   46.86  ? 113  VAL C N     1 
ATOM   4476  C  CA    . VAL C 2  113  ? 43.767  -22.559 58.687  1.00   48.33  ? 113  VAL C CA    1 
ATOM   4477  C  C     . VAL C 2  113  ? 43.047  -21.939 59.882  1.00   54.24  ? 113  VAL C C     1 
ATOM   4478  O  O     . VAL C 2  113  ? 42.369  -22.629 60.648  1.00   53.98  ? 113  VAL C O     1 
ATOM   4479  C  CB    . VAL C 2  113  ? 42.858  -22.490 57.446  1.00   45.59  ? 113  VAL C CB    1 
ATOM   4480  C  CG1   . VAL C 2  113  ? 43.632  -22.893 56.204  1.00   53.98  ? 113  VAL C CG1   1 
ATOM   4481  C  CG2   . VAL C 2  113  ? 41.643  -23.376 57.630  1.00   45.57  ? 113  VAL C CG2   1 
ATOM   4482  N  N     . PHE C 2  114  ? 43.215  -20.629 60.035  1.00   62.02  ? 114  PHE C N     1 
ATOM   4483  C  CA    . PHE C 2  114  ? 42.585  -19.882 61.116  1.00   59.57  ? 114  PHE C CA    1 
ATOM   4484  C  C     . PHE C 2  114  ? 41.235  -19.333 60.662  1.00   56.86  ? 114  PHE C C     1 
ATOM   4485  O  O     . PHE C 2  114  ? 41.164  -18.484 59.773  1.00   60.10  ? 114  PHE C O     1 
ATOM   4486  C  CB    . PHE C 2  114  ? 43.505  -18.745 61.569  1.00   58.96  ? 114  PHE C CB    1 
ATOM   4487  C  CG    . PHE C 2  114  ? 42.898  -17.842 62.601  1.00   57.42  ? 114  PHE C CG    1 
ATOM   4488  C  CD1   . PHE C 2  114  ? 42.818  -18.236 63.925  1.00   55.21  ? 114  PHE C CD1   1 
ATOM   4489  C  CD2   . PHE C 2  114  ? 42.422  -16.590 62.249  1.00   61.41  ? 114  PHE C CD2   1 
ATOM   4490  C  CE1   . PHE C 2  114  ? 42.264  -17.404 64.877  1.00   53.70  ? 114  PHE C CE1   1 
ATOM   4491  C  CE2   . PHE C 2  114  ? 41.869  -15.753 63.197  1.00   63.44  ? 114  PHE C CE2   1 
ATOM   4492  C  CZ    . PHE C 2  114  ? 41.790  -16.161 64.513  1.00   54.18  ? 114  PHE C CZ    1 
ATOM   4493  N  N     . LEU C 2  115  ? 40.167  -19.824 61.281  1.00   51.49  ? 115  LEU C N     1 
ATOM   4494  C  CA    . LEU C 2  115  ? 38.811  -19.479 60.868  1.00   50.91  ? 115  LEU C CA    1 
ATOM   4495  C  C     . LEU C 2  115  ? 38.227  -18.305 61.645  1.00   55.54  ? 115  LEU C C     1 
ATOM   4496  O  O     . LEU C 2  115  ? 37.058  -17.961 61.473  1.00   59.14  ? 115  LEU C O     1 
ATOM   4497  C  CB    . LEU C 2  115  ? 37.889  -20.692 60.993  1.00   42.03  ? 115  LEU C CB    1 
ATOM   4498  C  CG    . LEU C 2  115  ? 38.280  -21.909 60.158  1.00   36.55  ? 115  LEU C CG    1 
ATOM   4499  C  CD1   . LEU C 2  115  ? 37.150  -22.924 60.133  1.00   27.37  ? 115  LEU C CD1   1 
ATOM   4500  C  CD2   . LEU C 2  115  ? 38.663  -21.487 58.750  1.00   43.07  ? 115  LEU C CD2   1 
ATOM   4501  N  N     . GLY C 2  116  ? 39.038  -17.694 62.500  1.00   54.51  ? 116  GLY C N     1 
ATOM   4502  C  CA    . GLY C 2  116  ? 38.545  -16.645 63.371  1.00   60.10  ? 116  GLY C CA    1 
ATOM   4503  C  C     . GLY C 2  116  ? 38.237  -17.181 64.754  1.00   59.03  ? 116  GLY C C     1 
ATOM   4504  O  O     . GLY C 2  116  ? 38.732  -18.238 65.146  1.00   57.66  ? 116  GLY C O     1 
ATOM   4505  N  N     . HIS C 2  117  ? 37.413  -16.452 65.498  1.00   47.99  ? 117  HIS C N     1 
ATOM   4506  C  CA    . HIS C 2  117  ? 37.103  -16.826 66.870  1.00   41.81  ? 117  HIS C CA    1 
ATOM   4507  C  C     . HIS C 2  117  ? 35.641  -17.224 67.033  1.00   41.54  ? 117  HIS C C     1 
ATOM   4508  O  O     . HIS C 2  117  ? 34.786  -16.827 66.242  1.00   42.64  ? 117  HIS C O     1 
ATOM   4509  C  CB    . HIS C 2  117  ? 37.420  -15.670 67.820  1.00   45.88  ? 117  HIS C CB    1 
ATOM   4510  C  CG    . HIS C 2  117  ? 38.877  -15.340 67.912  1.00   45.48  ? 117  HIS C CG    1 
ATOM   4511  N  ND1   . HIS C 2  117  ? 39.631  -15.610 69.034  1.00   47.15  ? 117  HIS C ND1   1 
ATOM   4512  C  CD2   . HIS C 2  117  ? 39.718  -14.758 67.025  1.00   48.37  ? 117  HIS C CD2   1 
ATOM   4513  C  CE1   . HIS C 2  117  ? 40.873  -15.211 68.834  1.00   50.40  ? 117  HIS C CE1   1 
ATOM   4514  N  NE2   . HIS C 2  117  ? 40.954  -14.690 67.622  1.00   61.01  ? 117  HIS C NE2   1 
ATOM   4515  N  N     . ILE C 2  118  ? 35.364  -18.024 68.056  1.00   40.50  ? 118  ILE C N     1 
ATOM   4516  C  CA    . ILE C 2  118  ? 33.993  -18.302 68.454  1.00   42.98  ? 118  ILE C CA    1 
ATOM   4517  C  C     . ILE C 2  118  ? 33.841  -17.927 69.922  1.00   39.98  ? 118  ILE C C     1 
ATOM   4518  O  O     . ILE C 2  118  ? 34.716  -18.224 70.730  1.00   40.46  ? 118  ILE C O     1 
ATOM   4519  C  CB    . ILE C 2  118  ? 33.661  -19.794 68.264  1.00   37.45  ? 118  ILE C CB    1 
ATOM   4520  C  CG1   . ILE C 2  118  ? 33.658  -20.144 66.778  1.00   40.38  ? 118  ILE C CG1   1 
ATOM   4521  C  CG2   . ILE C 2  118  ? 32.318  -20.149 68.881  1.00   34.72  ? 118  ILE C CG2   1 
ATOM   4522  C  CD1   . ILE C 2  118  ? 33.186  -21.543 66.493  1.00   48.61  ? 118  ILE C CD1   1 
ATOM   4523  N  N     . PRO C 2  119  ? 32.721  -17.284 70.279  1.00   37.34  ? 119  PRO C N     1 
ATOM   4524  C  CA    . PRO C 2  119  ? 32.530  -16.888 71.677  1.00   40.57  ? 119  PRO C CA    1 
ATOM   4525  C  C     . PRO C 2  119  ? 32.369  -18.099 72.591  1.00   38.01  ? 119  PRO C C     1 
ATOM   4526  O  O     . PRO C 2  119  ? 31.742  -19.088 72.208  1.00   35.84  ? 119  PRO C O     1 
ATOM   4527  C  CB    . PRO C 2  119  ? 31.239  -16.064 71.632  1.00   40.52  ? 119  PRO C CB    1 
ATOM   4528  C  CG    . PRO C 2  119  ? 31.141  -15.590 70.215  1.00   34.68  ? 119  PRO C CG    1 
ATOM   4529  C  CD    . PRO C 2  119  ? 31.687  -16.714 69.399  1.00   35.63  ? 119  PRO C CD    1 
ATOM   4530  N  N     . LEU C 2  120  ? 32.952  -18.019 73.783  1.00   40.01  ? 120  LEU C N     1 
ATOM   4531  C  CA    . LEU C 2  120  ? 32.853  -19.092 74.764  1.00   38.26  ? 120  LEU C CA    1 
ATOM   4532  C  C     . LEU C 2  120  ? 31.834  -18.738 75.834  1.00   35.18  ? 120  LEU C C     1 
ATOM   4533  O  O     . LEU C 2  120  ? 31.721  -17.579 76.234  1.00   42.20  ? 120  LEU C O     1 
ATOM   4534  C  CB    . LEU C 2  120  ? 34.211  -19.354 75.416  1.00   38.65  ? 120  LEU C CB    1 
ATOM   4535  C  CG    . LEU C 2  120  ? 35.317  -19.938 74.539  1.00   36.11  ? 120  LEU C CG    1 
ATOM   4536  C  CD1   . LEU C 2  120  ? 36.564  -20.176 75.368  1.00   37.63  ? 120  LEU C CD1   1 
ATOM   4537  C  CD2   . LEU C 2  120  ? 34.855  -21.228 73.884  1.00   34.28  ? 120  LEU C CD2   1 
ATOM   4538  N  N     . MET C 2  121  ? 31.091  -19.737 76.295  1.00   29.20  ? 121  MET C N     1 
ATOM   4539  C  CA    . MET C 2  121  ? 30.117  -19.533 77.358  1.00   28.84  ? 121  MET C CA    1 
ATOM   4540  C  C     . MET C 2  121  ? 30.812  -19.509 78.713  1.00   30.21  ? 121  MET C C     1 
ATOM   4541  O  O     . MET C 2  121  ? 31.720  -20.300 78.964  1.00   31.92  ? 121  MET C O     1 
ATOM   4542  C  CB    . MET C 2  121  ? 29.056  -20.633 77.325  1.00   26.52  ? 121  MET C CB    1 
ATOM   4543  C  CG    . MET C 2  121  ? 28.089  -20.604 78.492  1.00   29.17  ? 121  MET C CG    1 
ATOM   4544  S  SD    . MET C 2  121  ? 26.807  -21.862 78.360  1.00   29.53  ? 121  MET C SD    1 
ATOM   4545  C  CE    . MET C 2  121  ? 25.807  -21.194 77.033  1.00   32.16  ? 121  MET C CE    1 
ATOM   4546  N  N     . THR C 2  122  ? 30.391  -18.596 79.581  1.00   32.24  ? 122  THR C N     1 
ATOM   4547  C  CA    . THR C 2  122  ? 30.973  -18.497 80.913  1.00   37.68  ? 122  THR C CA    1 
ATOM   4548  C  C     . THR C 2  122  ? 30.474  -19.628 81.802  1.00   39.74  ? 122  THR C C     1 
ATOM   4549  O  O     . THR C 2  122  ? 29.654  -20.446 81.383  1.00   38.15  ? 122  THR C O     1 
ATOM   4550  C  CB    . THR C 2  122  ? 30.646  -17.151 81.577  1.00   41.00  ? 122  THR C CB    1 
ATOM   4551  O  OG1   . THR C 2  122  ? 29.232  -17.046 81.781  1.00   39.59  ? 122  THR C OG1   1 
ATOM   4552  C  CG2   . THR C 2  122  ? 31.119  -15.999 80.703  1.00   41.53  ? 122  THR C CG2   1 
ATOM   4553  N  N     . GLU C 2  123  ? 30.965  -19.663 83.035  1.00   40.97  ? 123  GLU C N     1 
ATOM   4554  C  CA    . GLU C 2  123  ? 30.625  -20.739 83.954  1.00   44.09  ? 123  GLU C CA    1 
ATOM   4555  C  C     . GLU C 2  123  ? 29.147  -20.712 84.331  1.00   40.45  ? 123  GLU C C     1 
ATOM   4556  O  O     . GLU C 2  123  ? 28.538  -21.759 84.549  1.00   42.71  ? 123  GLU C O     1 
ATOM   4557  C  CB    . GLU C 2  123  ? 31.499  -20.671 85.208  1.00   52.02  ? 123  GLU C CB    1 
ATOM   4558  C  CG    . GLU C 2  123  ? 31.411  -21.907 86.090  1.00   61.42  ? 123  GLU C CG    1 
ATOM   4559  C  CD    . GLU C 2  123  ? 32.372  -21.860 87.263  1.00   73.49  ? 123  GLU C CD    1 
ATOM   4560  O  OE1   . GLU C 2  123  ? 32.477  -22.873 87.987  1.00   73.91  ? 123  GLU C OE1   1 
ATOM   4561  O  OE2   . GLU C 2  123  ? 33.022  -20.811 87.461  1.00   77.74  ? 123  GLU C OE2   1 
ATOM   4562  N  N     . ASP C 2  124  ? 28.570  -19.516 84.392  1.00   37.85  ? 124  ASP C N     1 
ATOM   4563  C  CA    . ASP C 2  124  ? 27.175  -19.363 84.797  1.00   40.54  ? 124  ASP C CA    1 
ATOM   4564  C  C     . ASP C 2  124  ? 26.194  -19.563 83.642  1.00   36.04  ? 124  ASP C C     1 
ATOM   4565  O  O     . ASP C 2  124  ? 24.980  -19.569 83.844  1.00   34.57  ? 124  ASP C O     1 
ATOM   4566  C  CB    . ASP C 2  124  ? 26.948  -18.005 85.471  1.00   41.52  ? 124  ASP C CB    1 
ATOM   4567  C  CG    . ASP C 2  124  ? 27.291  -16.839 84.567  1.00   42.89  ? 124  ASP C CG    1 
ATOM   4568  O  OD1   . ASP C 2  124  ? 28.497  -16.596 84.341  1.00   44.42  ? 124  ASP C OD1   1 
ATOM   4569  O  OD2   . ASP C 2  124  ? 26.356  -16.159 84.091  1.00   38.74  ? 124  ASP C OD2   1 
ATOM   4570  N  N     . GLY C 2  125  ? 26.723  -19.733 82.435  1.00   34.16  ? 125  GLY C N     1 
ATOM   4571  C  CA    . GLY C 2  125  ? 25.890  -20.027 81.284  1.00   35.11  ? 125  GLY C CA    1 
ATOM   4572  C  C     . GLY C 2  125  ? 25.597  -18.849 80.373  1.00   37.59  ? 125  GLY C C     1 
ATOM   4573  O  O     . GLY C 2  125  ? 24.734  -18.933 79.498  1.00   38.55  ? 125  GLY C O     1 
ATOM   4574  N  N     . SER C 2  126  ? 26.320  -17.751 80.561  1.00   38.86  ? 126  SER C N     1 
ATOM   4575  C  CA    . SER C 2  126  ? 26.100  -16.562 79.745  1.00   36.21  ? 126  SER C CA    1 
ATOM   4576  C  C     . SER C 2  126  ? 27.285  -16.291 78.825  1.00   36.40  ? 126  SER C C     1 
ATOM   4577  O  O     . SER C 2  126  ? 28.275  -17.022 78.838  1.00   40.07  ? 126  SER C O     1 
ATOM   4578  C  CB    . SER C 2  126  ? 25.823  -15.343 80.629  1.00   37.52  ? 126  SER C CB    1 
ATOM   4579  O  OG    . SER C 2  126  ? 26.916  -15.071 81.490  1.00   37.37  ? 126  SER C OG    1 
ATOM   4580  N  N     . PHE C 2  127  ? 27.176  -15.234 78.027  1.00   31.48  ? 127  PHE C N     1 
ATOM   4581  C  CA    . PHE C 2  127  ? 28.226  -14.862 77.090  1.00   31.07  ? 127  PHE C CA    1 
ATOM   4582  C  C     . PHE C 2  127  ? 28.678  -13.429 77.330  1.00   42.01  ? 127  PHE C C     1 
ATOM   4583  O  O     . PHE C 2  127  ? 27.986  -12.653 77.989  1.00   41.31  ? 127  PHE C O     1 
ATOM   4584  C  CB    . PHE C 2  127  ? 27.729  -14.988 75.650  1.00   33.67  ? 127  PHE C CB    1 
ATOM   4585  C  CG    . PHE C 2  127  ? 27.500  -16.401 75.200  1.00   34.89  ? 127  PHE C CG    1 
ATOM   4586  C  CD1   . PHE C 2  127  ? 26.274  -17.015 75.396  1.00   38.72  ? 127  PHE C CD1   1 
ATOM   4587  C  CD2   . PHE C 2  127  ? 28.504  -17.109 74.562  1.00   37.37  ? 127  PHE C CD2   1 
ATOM   4588  C  CE1   . PHE C 2  127  ? 26.058  -18.313 74.972  1.00   37.44  ? 127  PHE C CE1   1 
ATOM   4589  C  CE2   . PHE C 2  127  ? 28.295  -18.408 74.138  1.00   33.67  ? 127  PHE C CE2   1 
ATOM   4590  C  CZ    . PHE C 2  127  ? 27.071  -19.011 74.343  1.00   32.25  ? 127  PHE C CZ    1 
ATOM   4591  N  N     . ILE C 2  128  ? 29.848  -13.089 76.798  1.00   47.77  ? 128  ILE C N     1 
ATOM   4592  C  CA    . ILE C 2  128  ? 30.326  -11.713 76.806  1.00   42.05  ? 128  ILE C CA    1 
ATOM   4593  C  C     . ILE C 2  128  ? 30.576  -11.250 75.375  1.00   45.38  ? 128  ILE C C     1 
ATOM   4594  O  O     . ILE C 2  128  ? 31.479  -11.750 74.705  1.00   50.50  ? 128  ILE C O     1 
ATOM   4595  C  CB    . ILE C 2  128  ? 31.625  -11.566 77.617  1.00   37.83  ? 128  ILE C CB    1 
ATOM   4596  C  CG1   . ILE C 2  128  ? 31.419  -12.065 79.049  1.00   37.32  ? 128  ILE C CG1   1 
ATOM   4597  C  CG2   . ILE C 2  128  ? 32.095  -10.119 77.614  1.00   38.01  ? 128  ILE C CG2   1 
ATOM   4598  C  CD1   . ILE C 2  128  ? 32.678  -12.052 79.883  1.00   42.04  ? 128  ILE C CD1   1 
ATOM   4599  N  N     . ILE C 2  129  ? 29.772  -10.298 74.910  1.00   49.70  ? 129  ILE C N     1 
ATOM   4600  C  CA    . ILE C 2  129  ? 29.910  -9.770  73.555  1.00   51.75  ? 129  ILE C CA    1 
ATOM   4601  C  C     . ILE C 2  129  ? 30.164  -8.268  73.572  1.00   53.30  ? 129  ILE C C     1 
ATOM   4602  O  O     . ILE C 2  129  ? 29.309  -7.492  74.004  1.00   58.11  ? 129  ILE C O     1 
ATOM   4603  C  CB    . ILE C 2  129  ? 28.657  -10.049 72.705  1.00   47.03  ? 129  ILE C CB    1 
ATOM   4604  C  CG1   . ILE C 2  129  ? 28.360  -11.548 72.669  1.00   43.18  ? 129  ILE C CG1   1 
ATOM   4605  C  CG2   . ILE C 2  129  ? 28.834  -9.500  71.299  1.00   43.06  ? 129  ILE C CG2   1 
ATOM   4606  C  CD1   . ILE C 2  129  ? 29.509  -12.376 72.156  1.00   39.62  ? 129  ILE C CD1   1 
ATOM   4607  N  N     . ASN C 2  130  ? 31.343  -7.871  73.096  1.00   45.69  ? 130  ASN C N     1 
ATOM   4608  C  CA    . ASN C 2  130  ? 31.756  -6.469  73.086  1.00   48.96  ? 130  ASN C CA    1 
ATOM   4609  C  C     . ASN C 2  130  ? 31.725  -5.835  74.476  1.00   53.57  ? 130  ASN C C     1 
ATOM   4610  O  O     . ASN C 2  130  ? 31.425  -4.650  74.620  1.00   56.70  ? 130  ASN C O     1 
ATOM   4611  C  CB    . ASN C 2  130  ? 30.906  -5.654  72.104  1.00   54.38  ? 130  ASN C CB    1 
ATOM   4612  C  CG    . ASN C 2  130  ? 31.057  -6.126  70.670  1.00   59.06  ? 130  ASN C CG    1 
ATOM   4613  O  OD1   . ASN C 2  130  ? 32.166  -6.391  70.203  1.00   57.17  ? 130  ASN C OD1   1 
ATOM   4614  N  ND2   . ASN C 2  130  ? 29.938  -6.238  69.962  1.00   55.80  ? 130  ASN C ND2   1 
ATOM   4615  N  N     . GLY C 2  131  ? 32.032  -6.636  75.493  1.00   52.90  ? 131  GLY C N     1 
ATOM   4616  C  CA    . GLY C 2  131  ? 32.087  -6.156  76.862  1.00   51.40  ? 131  GLY C CA    1 
ATOM   4617  C  C     . GLY C 2  131  ? 30.750  -6.190  77.574  1.00   48.42  ? 131  GLY C C     1 
ATOM   4618  O  O     . GLY C 2  131  ? 30.653  -5.828  78.748  1.00   51.14  ? 131  GLY C O     1 
ATOM   4619  N  N     . ALA C 2  132  ? 29.716  -6.625  76.863  1.00   43.06  ? 132  ALA C N     1 
ATOM   4620  C  CA    . ALA C 2  132  ? 28.373  -6.680  77.424  1.00   46.66  ? 132  ALA C CA    1 
ATOM   4621  C  C     . ALA C 2  132  ? 27.905  -8.119  77.605  1.00   41.76  ? 132  ALA C C     1 
ATOM   4622  O  O     . ALA C 2  132  ? 27.934  -8.911  76.662  1.00   41.88  ? 132  ALA C O     1 
ATOM   4623  C  CB    . ALA C 2  132  ? 27.402  -5.915  76.539  1.00   53.06  ? 132  ALA C CB    1 
ATOM   4624  N  N     . ASP C 2  133  ? 27.476  -8.452  78.818  1.00   35.87  ? 133  ASP C N     1 
ATOM   4625  C  CA    . ASP C 2  133  ? 26.945  -9.781  79.101  1.00   35.25  ? 133  ASP C CA    1 
ATOM   4626  C  C     . ASP C 2  133  ? 25.632  -10.008 78.361  1.00   37.27  ? 133  ASP C C     1 
ATOM   4627  O  O     . ASP C 2  133  ? 24.722  -9.182  78.426  1.00   39.60  ? 133  ASP C O     1 
ATOM   4628  C  CB    . ASP C 2  133  ? 26.739  -9.976  80.603  1.00   38.91  ? 133  ASP C CB    1 
ATOM   4629  C  CG    . ASP C 2  133  ? 28.043  -10.128 81.354  1.00   42.29  ? 133  ASP C CG    1 
ATOM   4630  O  OD1   . ASP C 2  133  ? 29.061  -9.570  80.895  1.00   44.71  ? 133  ASP C OD1   1 
ATOM   4631  O  OD2   . ASP C 2  133  ? 28.051  -10.808 82.402  1.00   47.13  ? 133  ASP C OD2   1 
ATOM   4632  N  N     . ARG C 2  134  ? 25.545  -11.126 77.648  1.00   35.07  ? 134  ARG C N     1 
ATOM   4633  C  CA    . ARG C 2  134  ? 24.348  -11.455 76.885  1.00   32.24  ? 134  ARG C CA    1 
ATOM   4634  C  C     . ARG C 2  134  ? 23.939  -12.905 77.126  1.00   28.91  ? 134  ARG C C     1 
ATOM   4635  O  O     . ARG C 2  134  ? 24.758  -13.731 77.518  1.00   35.72  ? 134  ARG C O     1 
ATOM   4636  C  CB    . ARG C 2  134  ? 24.575  -11.205 75.390  1.00   36.66  ? 134  ARG C CB    1 
ATOM   4637  C  CG    . ARG C 2  134  ? 25.157  -9.833  75.065  1.00   39.93  ? 134  ARG C CG    1 
ATOM   4638  C  CD    . ARG C 2  134  ? 25.191  -9.565  73.569  1.00   41.28  ? 134  ARG C CD    1 
ATOM   4639  N  NE    . ARG C 2  134  ? 24.182  -8.591  73.161  1.00   45.35  ? 134  ARG C NE    1 
ATOM   4640  C  CZ    . ARG C 2  134  ? 22.956  -8.909  72.757  1.00   41.23  ? 134  ARG C CZ    1 
ATOM   4641  N  NH1   . ARG C 2  134  ? 22.585  -10.180 72.705  1.00   36.30  ? 134  ARG C NH1   1 
ATOM   4642  N  NH2   . ARG C 2  134  ? 22.102  -7.958  72.404  1.00   41.42  ? 134  ARG C NH2   1 
ATOM   4643  N  N     . VAL C 2  135  ? 22.666  -13.203 76.894  1.00   26.92  ? 135  VAL C N     1 
ATOM   4644  C  CA    . VAL C 2  135  ? 22.128  -14.541 77.111  1.00   29.86  ? 135  VAL C CA    1 
ATOM   4645  C  C     . VAL C 2  135  ? 21.366  -15.008 75.876  1.00   28.73  ? 135  VAL C C     1 
ATOM   4646  O  O     . VAL C 2  135  ? 20.576  -14.255 75.305  1.00   35.59  ? 135  VAL C O     1 
ATOM   4647  C  CB    . VAL C 2  135  ? 21.190  -14.574 78.345  1.00   28.76  ? 135  VAL C CB    1 
ATOM   4648  C  CG1   . VAL C 2  135  ? 20.407  -15.878 78.404  1.00   25.76  ? 135  VAL C CG1   1 
ATOM   4649  C  CG2   . VAL C 2  135  ? 21.984  -14.364 79.626  1.00   24.15  ? 135  VAL C CG2   1 
ATOM   4650  N  N     . ILE C 2  136  ? 21.608  -16.249 75.462  1.00   27.26  ? 136  ILE C N     1 
ATOM   4651  C  CA    . ILE C 2  136  ? 20.899  -16.820 74.323  1.00   30.60  ? 136  ILE C CA    1 
ATOM   4652  C  C     . ILE C 2  136  ? 19.658  -17.568 74.796  1.00   25.96  ? 136  ILE C C     1 
ATOM   4653  O  O     . ILE C 2  136  ? 19.755  -18.589 75.475  1.00   27.04  ? 136  ILE C O     1 
ATOM   4654  C  CB    . ILE C 2  136  ? 21.793  -17.784 73.516  1.00   31.90  ? 136  ILE C CB    1 
ATOM   4655  C  CG1   . ILE C 2  136  ? 23.093  -17.091 73.101  1.00   31.09  ? 136  ILE C CG1   1 
ATOM   4656  C  CG2   . ILE C 2  136  ? 21.050  -18.308 72.293  1.00   24.11  ? 136  ILE C CG2   1 
ATOM   4657  C  CD1   . ILE C 2  136  ? 22.891  -15.923 72.165  1.00   29.38  ? 136  ILE C CD1   1 
ATOM   4658  N  N     . VAL C 2  137  ? 18.492  -17.052 74.429  1.00   25.22  ? 137  VAL C N     1 
ATOM   4659  C  CA    . VAL C 2  137  ? 17.228  -17.637 74.852  1.00   25.45  ? 137  VAL C CA    1 
ATOM   4660  C  C     . VAL C 2  137  ? 16.818  -18.801 73.956  1.00   25.86  ? 137  VAL C C     1 
ATOM   4661  O  O     . VAL C 2  137  ? 16.801  -18.679 72.731  1.00   28.02  ? 137  VAL C O     1 
ATOM   4662  C  CB    . VAL C 2  137  ? 16.106  -16.578 74.877  1.00   28.55  ? 137  VAL C CB    1 
ATOM   4663  C  CG1   . VAL C 2  137  ? 14.747  -17.233 75.074  1.00   28.78  ? 137  VAL C CG1   1 
ATOM   4664  C  CG2   . VAL C 2  137  ? 16.376  -15.554 75.968  1.00   30.16  ? 137  VAL C CG2   1 
ATOM   4665  N  N     . SER C 2  138  ? 16.496  -19.929 74.580  1.00   29.16  ? 138  SER C N     1 
ATOM   4666  C  CA    . SER C 2  138  ? 16.044  -21.117 73.864  1.00   29.73  ? 138  SER C CA    1 
ATOM   4667  C  C     . SER C 2  138  ? 14.766  -20.833 73.078  1.00   24.51  ? 138  SER C C     1 
ATOM   4668  O  O     . SER C 2  138  ? 13.934  -20.029 73.495  1.00   28.20  ? 138  SER C O     1 
ATOM   4669  C  CB    . SER C 2  138  ? 15.811  -22.267 74.846  1.00   32.53  ? 138  SER C CB    1 
ATOM   4670  O  OG    . SER C 2  138  ? 16.951  -22.483 75.659  1.00   34.20  ? 138  SER C OG    1 
ATOM   4671  N  N     . GLN C 2  139  ? 14.614  -21.500 71.940  1.00   22.15  ? 139  GLN C N     1 
ATOM   4672  C  CA    . GLN C 2  139  ? 13.470  -21.261 71.071  1.00   26.21  ? 139  GLN C CA    1 
ATOM   4673  C  C     . GLN C 2  139  ? 12.603  -22.501 70.910  1.00   29.75  ? 139  GLN C C     1 
ATOM   4674  O  O     . GLN C 2  139  ? 13.040  -23.500 70.347  1.00   36.09  ? 139  GLN C O     1 
ATOM   4675  C  CB    . GLN C 2  139  ? 13.938  -20.784 69.694  1.00   33.79  ? 139  GLN C CB    1 
ATOM   4676  C  CG    . GLN C 2  139  ? 12.811  -20.554 68.696  1.00   32.58  ? 139  GLN C CG    1 
ATOM   4677  C  CD    . GLN C 2  139  ? 13.315  -20.103 67.337  1.00   40.64  ? 139  GLN C CD    1 
ATOM   4678  O  OE1   . GLN C 2  139  ? 14.210  -20.719 66.756  1.00   44.42  ? 139  GLN C OE1   1 
ATOM   4679  N  NE2   . GLN C 2  139  ? 12.744  -19.018 66.825  1.00   44.71  ? 139  GLN C NE2   1 
ATOM   4680  N  N     . ILE C 2  140  ? 11.369  -22.433 71.397  1.00   31.29  ? 140  ILE C N     1 
ATOM   4681  C  CA    . ILE C 2  140  ? 10.424  -23.526 71.202  1.00   34.30  ? 140  ILE C CA    1 
ATOM   4682  C  C     . ILE C 2  140  ? 9.789   -23.440 69.813  1.00   36.01  ? 140  ILE C C     1 
ATOM   4683  O  O     . ILE C 2  140  ? 9.380   -22.365 69.370  1.00   35.73  ? 140  ILE C O     1 
ATOM   4684  C  CB    . ILE C 2  140  ? 9.334   -23.556 72.307  1.00   32.66  ? 140  ILE C CB    1 
ATOM   4685  C  CG1   . ILE C 2  140  ? 8.398   -24.752 72.117  1.00   38.01  ? 140  ILE C CG1   1 
ATOM   4686  C  CG2   . ILE C 2  140  ? 8.552   -22.252 72.348  1.00   34.96  ? 140  ILE C CG2   1 
ATOM   4687  C  CD1   . ILE C 2  140  ? 7.384   -24.915 73.231  1.00   32.08  ? 140  ILE C CD1   1 
ATOM   4688  N  N     . HIS C 2  141  ? 9.732   -24.569 69.114  1.00   35.31  ? 141  HIS C N     1 
ATOM   4689  C  CA    . HIS C 2  141  ? 9.099   -24.597 67.800  1.00   36.51  ? 141  HIS C CA    1 
ATOM   4690  C  C     . HIS C 2  141  ? 8.433   -25.937 67.519  1.00   39.18  ? 141  HIS C C     1 
ATOM   4691  O  O     . HIS C 2  141  ? 8.483   -26.852 68.343  1.00   35.06  ? 141  HIS C O     1 
ATOM   4692  C  CB    . HIS C 2  141  ? 10.111  -24.273 66.698  1.00   32.57  ? 141  HIS C CB    1 
ATOM   4693  C  CG    . HIS C 2  141  ? 11.107  -25.363 66.447  1.00   39.45  ? 141  HIS C CG    1 
ATOM   4694  N  ND1   . HIS C 2  141  ? 11.500  -25.733 65.179  1.00   43.24  ? 141  HIS C ND1   1 
ATOM   4695  C  CD2   . HIS C 2  141  ? 11.796  -26.157 67.301  1.00   39.12  ? 141  HIS C CD2   1 
ATOM   4696  C  CE1   . HIS C 2  141  ? 12.385  -26.711 65.262  1.00   39.89  ? 141  HIS C CE1   1 
ATOM   4697  N  NE2   . HIS C 2  141  ? 12.583  -26.985 66.538  1.00   36.36  ? 141  HIS C NE2   1 
ATOM   4698  N  N     . ARG C 2  142  ? 7.808   -26.042 66.350  1.00   40.95  ? 142  ARG C N     1 
ATOM   4699  C  CA    . ARG C 2  142  ? 7.189   -27.291 65.932  1.00   45.55  ? 142  ARG C CA    1 
ATOM   4700  C  C     . ARG C 2  142  ? 8.265   -28.296 65.555  1.00   47.00  ? 142  ARG C C     1 
ATOM   4701  O  O     . ARG C 2  142  ? 9.099   -28.031 64.689  1.00   48.74  ? 142  ARG C O     1 
ATOM   4702  C  CB    . ARG C 2  142  ? 6.255   -27.065 64.743  1.00   52.56  ? 142  ARG C CB    1 
ATOM   4703  C  CG    . ARG C 2  142  ? 5.000   -26.278 65.069  1.00   60.51  ? 142  ARG C CG    1 
ATOM   4704  C  CD    . ARG C 2  142  ? 4.015   -26.338 63.912  1.00   67.10  ? 142  ARG C CD    1 
ATOM   4705  N  NE    . ARG C 2  142  ? 3.618   -27.711 63.609  1.00   62.94  ? 142  ARG C NE    1 
ATOM   4706  C  CZ    . ARG C 2  142  ? 2.857   -28.060 62.577  1.00   60.92  ? 142  ARG C CZ    1 
ATOM   4707  N  NH1   . ARG C 2  142  ? 2.409   -27.136 61.738  1.00   62.73  ? 142  ARG C NH1   1 
ATOM   4708  N  NH2   . ARG C 2  142  ? 2.548   -29.335 62.380  1.00   56.02  ? 142  ARG C NH2   1 
ATOM   4709  N  N     . SER C 2  143  ? 8.237   -29.453 66.207  1.00   48.67  ? 143  SER C N     1 
ATOM   4710  C  CA    . SER C 2  143  ? 9.217   -30.498 65.951  1.00   49.29  ? 143  SER C CA    1 
ATOM   4711  C  C     . SER C 2  143  ? 9.031   -31.080 64.559  1.00   53.07  ? 143  SER C C     1 
ATOM   4712  O  O     . SER C 2  143  ? 7.904   -31.331 64.137  1.00   59.73  ? 143  SER C O     1 
ATOM   4713  C  CB    . SER C 2  143  ? 9.103   -31.607 66.998  1.00   47.94  ? 143  SER C CB    1 
ATOM   4714  O  OG    . SER C 2  143  ? 9.948   -32.698 66.678  1.00   50.21  ? 143  SER C OG    1 
ATOM   4715  N  N     . PRO C 2  144  ? 10.140  -31.286 63.836  1.00   53.45  ? 144  PRO C N     1 
ATOM   4716  C  CA    . PRO C 2  144  ? 10.093  -31.934 62.524  1.00   54.15  ? 144  PRO C CA    1 
ATOM   4717  C  C     . PRO C 2  144  ? 9.497   -33.334 62.615  1.00   60.63  ? 144  PRO C C     1 
ATOM   4718  O  O     . PRO C 2  144  ? 9.488   -33.934 63.690  1.00   62.68  ? 144  PRO C O     1 
ATOM   4719  C  CB    . PRO C 2  144  ? 11.567  -32.013 62.125  1.00   51.92  ? 144  PRO C CB    1 
ATOM   4720  C  CG    . PRO C 2  144  ? 12.199  -30.879 62.834  1.00   50.60  ? 144  PRO C CG    1 
ATOM   4721  C  CD    . PRO C 2  144  ? 11.489  -30.790 64.154  1.00   53.63  ? 144  PRO C CD    1 
ATOM   4722  N  N     . GLY C 2  145  ? 8.988   -33.838 61.498  1.00   56.45  ? 145  GLY C N     1 
ATOM   4723  C  CA    . GLY C 2  145  ? 8.374   -35.150 61.468  1.00   60.28  ? 145  GLY C CA    1 
ATOM   4724  C  C     . GLY C 2  145  ? 7.253   -35.201 60.452  1.00   63.91  ? 145  GLY C C     1 
ATOM   4725  O  O     . GLY C 2  145  ? 7.170   -34.354 59.562  1.00   65.10  ? 145  GLY C O     1 
ATOM   4726  N  N     . VAL C 2  146  ? 6.393   -36.205 60.581  1.00   62.42  ? 146  VAL C N     1 
ATOM   4727  C  CA    . VAL C 2  146  ? 5.211   -36.303 59.738  1.00   62.17  ? 146  VAL C CA    1 
ATOM   4728  C  C     . VAL C 2  146  ? 3.956   -36.150 60.588  1.00   67.26  ? 146  VAL C C     1 
ATOM   4729  O  O     . VAL C 2  146  ? 3.764   -36.871 61.567  1.00   67.68  ? 146  VAL C O     1 
ATOM   4730  C  CB    . VAL C 2  146  ? 5.162   -37.639 58.981  1.00   68.55  ? 146  VAL C CB    1 
ATOM   4731  C  CG1   . VAL C 2  146  ? 3.920   -37.704 58.108  1.00   74.36  ? 146  VAL C CG1   1 
ATOM   4732  C  CG2   . VAL C 2  146  ? 6.416   -37.813 58.140  1.00   75.07  ? 146  VAL C CG2   1 
ATOM   4733  N  N     . TYR C 2  147  ? 3.108   -35.200 60.210  1.00   67.76  ? 147  TYR C N     1 
ATOM   4734  C  CA    . TYR C 2  147  ? 1.887   -34.918 60.953  1.00   67.12  ? 147  TYR C CA    1 
ATOM   4735  C  C     . TYR C 2  147  ? 0.650   -35.120 60.090  1.00   73.94  ? 147  TYR C C     1 
ATOM   4736  O  O     . TYR C 2  147  ? 0.719   -35.067 58.862  1.00   77.40  ? 147  TYR C O     1 
ATOM   4737  C  CB    . TYR C 2  147  ? 1.901   -33.485 61.482  1.00   64.48  ? 147  TYR C CB    1 
ATOM   4738  C  CG    . TYR C 2  147  ? 3.004   -33.199 62.471  1.00   58.96  ? 147  TYR C CG    1 
ATOM   4739  C  CD1   . TYR C 2  147  ? 4.203   -32.637 62.058  1.00   60.50  ? 147  TYR C CD1   1 
ATOM   4740  C  CD2   . TYR C 2  147  ? 2.844   -33.486 63.818  1.00   61.32  ? 147  TYR C CD2   1 
ATOM   4741  C  CE1   . TYR C 2  147  ? 5.213   -32.372 62.959  1.00   62.33  ? 147  TYR C CE1   1 
ATOM   4742  C  CE2   . TYR C 2  147  ? 3.848   -33.225 64.726  1.00   57.04  ? 147  TYR C CE2   1 
ATOM   4743  C  CZ    . TYR C 2  147  ? 5.030   -32.668 64.293  1.00   58.60  ? 147  TYR C CZ    1 
ATOM   4744  O  OH    . TYR C 2  147  ? 6.031   -32.407 65.200  1.00   62.23  ? 147  TYR C OH    1 
ATOM   4745  N  N     . PHE C 2  148  ? -0.481  -35.351 60.746  1.00   68.49  ? 148  PHE C N     1 
ATOM   4746  C  CA    . PHE C 2  148  ? -1.757  -35.470 60.056  1.00   70.28  ? 148  PHE C CA    1 
ATOM   4747  C  C     . PHE C 2  148  ? -2.815  -34.654 60.789  1.00   73.15  ? 148  PHE C C     1 
ATOM   4748  O  O     . PHE C 2  148  ? -3.114  -34.911 61.955  1.00   68.61  ? 148  PHE C O     1 
ATOM   4749  C  CB    . PHE C 2  148  ? -2.171  -36.937 59.952  1.00   66.19  ? 148  PHE C CB    1 
ATOM   4750  C  CG    . PHE C 2  148  ? -1.192  -37.784 59.194  1.00   67.91  ? 148  PHE C CG    1 
ATOM   4751  C  CD1   . PHE C 2  148  ? -0.129  -38.390 59.844  1.00   70.38  ? 148  PHE C CD1   1 
ATOM   4752  C  CD2   . PHE C 2  148  ? -1.327  -37.967 57.828  1.00   74.13  ? 148  PHE C CD2   1 
ATOM   4753  C  CE1   . PHE C 2  148  ? 0.778   -39.164 59.148  1.00   76.76  ? 148  PHE C CE1   1 
ATOM   4754  C  CE2   . PHE C 2  148  ? -0.424  -38.743 57.126  1.00   80.37  ? 148  PHE C CE2   1 
ATOM   4755  C  CZ    . PHE C 2  148  ? 0.629   -39.343 57.787  1.00   79.86  ? 148  PHE C CZ    1 
ATOM   4756  N  N     . THR C 2  149  ? -3.375  -33.666 60.101  1.00   76.81  ? 149  THR C N     1 
ATOM   4757  C  CA    . THR C 2  149  ? -4.301  -32.734 60.735  1.00   73.50  ? 149  THR C CA    1 
ATOM   4758  C  C     . THR C 2  149  ? -5.631  -32.671 59.989  1.00   78.51  ? 149  THR C C     1 
ATOM   4759  O  O     . THR C 2  149  ? -5.661  -32.772 58.769  1.00   83.58  ? 149  THR C O     1 
ATOM   4760  C  CB    . THR C 2  149  ? -3.685  -31.320 60.830  1.00   77.06  ? 149  THR C CB    1 
ATOM   4761  O  OG1   . THR C 2  149  ? -4.675  -30.390 61.282  1.00   86.39  ? 149  THR C OG1   1 
ATOM   4762  C  CG2   . THR C 2  149  ? -3.155  -30.872 59.474  1.00   74.48  ? 149  THR C CG2   1 
ATOM   4763  N  N     . PRO C 2  150  ? -6.740  -32.517 60.727  1.00   84.53  ? 150  PRO C N     1 
ATOM   4764  C  CA    . PRO C 2  150  ? -8.063  -32.420 60.098  1.00   90.04  ? 150  PRO C CA    1 
ATOM   4765  C  C     . PRO C 2  150  ? -8.180  -31.224 59.153  1.00   95.28  ? 150  PRO C C     1 
ATOM   4766  O  O     . PRO C 2  150  ? -7.816  -30.107 59.523  1.00   93.53  ? 150  PRO C O     1 
ATOM   4767  C  CB    . PRO C 2  150  ? -9.002  -32.235 61.293  1.00   91.22  ? 150  PRO C CB    1 
ATOM   4768  C  CG    . PRO C 2  150  ? -8.279  -32.850 62.440  1.00   87.00  ? 150  PRO C CG    1 
ATOM   4769  C  CD    . PRO C 2  150  ? -6.829  -32.560 62.197  1.00   86.25  ? 150  PRO C CD    1 
ATOM   4770  N  N     . ASP C 2  151  ? -8.682  -31.465 57.945  1.00   101.75 ? 151  ASP C N     1 
ATOM   4771  C  CA    . ASP C 2  151  ? -8.905  -30.401 56.973  1.00   100.80 ? 151  ASP C CA    1 
ATOM   4772  C  C     . ASP C 2  151  ? -10.076 -29.542 57.440  1.00   102.47 ? 151  ASP C C     1 
ATOM   4773  O  O     . ASP C 2  151  ? -11.184 -30.045 57.622  1.00   103.44 ? 151  ASP C O     1 
ATOM   4774  C  CB    . ASP C 2  151  ? -9.197  -30.999 55.592  1.00   103.26 ? 151  ASP C CB    1 
ATOM   4775  C  CG    . ASP C 2  151  ? -9.069  -29.984 54.464  1.00   103.61 ? 151  ASP C CG    1 
ATOM   4776  O  OD1   . ASP C 2  151  ? -9.347  -28.787 54.685  1.00   100.28 ? 151  ASP C OD1   1 
ATOM   4777  O  OD2   . ASP C 2  151  ? -8.693  -30.390 53.343  1.00   108.37 ? 151  ASP C OD2   1 
ATOM   4778  N  N     . PRO C 2  152  ? -9.829  -28.239 57.645  1.00   103.96 ? 152  PRO C N     1 
ATOM   4779  C  CA    . PRO C 2  152  ? -10.871 -27.311 58.101  1.00   104.51 ? 152  PRO C CA    1 
ATOM   4780  C  C     . PRO C 2  152  ? -12.020 -27.182 57.103  1.00   104.58 ? 152  PRO C C     1 
ATOM   4781  O  O     . PRO C 2  152  ? -13.176 -27.070 57.510  1.00   97.55  ? 152  PRO C O     1 
ATOM   4782  C  CB    . PRO C 2  152  ? -10.122 -25.978 58.229  1.00   108.00 ? 152  PRO C CB    1 
ATOM   4783  C  CG    . PRO C 2  152  ? -8.905  -26.130 57.373  1.00   107.87 ? 152  PRO C CG    1 
ATOM   4784  C  CD    . PRO C 2  152  ? -8.526  -27.571 57.485  1.00   105.13 ? 152  PRO C CD    1 
ATOM   4785  N  N     . ALA C 2  153  ? -11.701 -27.202 55.813  1.00   110.57 ? 153  ALA C N     1 
ATOM   4786  C  CA    . ALA C 2  153  ? -12.714 -27.071 54.770  1.00   110.58 ? 153  ALA C CA    1 
ATOM   4787  C  C     . ALA C 2  153  ? -13.507 -28.362 54.583  1.00   112.31 ? 153  ALA C C     1 
ATOM   4788  O  O     . ALA C 2  153  ? -14.733 -28.337 54.467  1.00   107.53 ? 153  ALA C O     1 
ATOM   4789  C  CB    . ALA C 2  153  ? -12.070 -26.646 53.458  1.00   103.41 ? 153  ALA C CB    1 
ATOM   4790  N  N     . ARG C 2  154  ? -12.800 -29.488 54.556  1.00   114.65 ? 154  ARG C N     1 
ATOM   4791  C  CA    . ARG C 2  154  ? -13.419 -30.789 54.322  1.00   108.59 ? 154  ARG C CA    1 
ATOM   4792  C  C     . ARG C 2  154  ? -13.373 -31.662 55.576  1.00   105.57 ? 154  ARG C C     1 
ATOM   4793  O  O     . ARG C 2  154  ? -12.299 -32.084 56.003  1.00   109.33 ? 154  ARG C O     1 
ATOM   4794  C  CB    . ARG C 2  154  ? -12.731 -31.488 53.147  1.00   112.37 ? 154  ARG C CB    1 
ATOM   4795  C  CG    . ARG C 2  154  ? -12.797 -30.691 51.851  1.00   113.41 ? 154  ARG C CG    1 
ATOM   4796  C  CD    . ARG C 2  154  ? -11.695 -31.080 50.877  1.00   111.01 ? 154  ARG C CD    1 
ATOM   4797  N  NE    . ARG C 2  154  ? -11.762 -32.484 50.486  1.00   116.15 ? 154  ARG C NE    1 
ATOM   4798  C  CZ    . ARG C 2  154  ? -12.595 -32.966 49.569  1.00   122.46 ? 154  ARG C CZ    1 
ATOM   4799  N  NH1   . ARG C 2  154  ? -13.447 -32.159 48.952  1.00   122.86 ? 154  ARG C NH1   1 
ATOM   4800  N  NH2   . ARG C 2  154  ? -12.584 -34.259 49.275  1.00   126.51 ? 154  ARG C NH2   1 
ATOM   4801  N  N     . PRO C 2  155  ? -14.548 -31.937 56.165  1.00   99.66  ? 155  PRO C N     1 
ATOM   4802  C  CA    . PRO C 2  155  ? -14.684 -32.646 57.445  1.00   101.01 ? 155  PRO C CA    1 
ATOM   4803  C  C     . PRO C 2  155  ? -14.092 -34.055 57.443  1.00   108.51 ? 155  PRO C C     1 
ATOM   4804  O  O     . PRO C 2  155  ? -13.395 -34.423 58.388  1.00   113.26 ? 155  PRO C O     1 
ATOM   4805  C  CB    . PRO C 2  155  ? -16.202 -32.725 57.641  1.00   91.99  ? 155  PRO C CB    1 
ATOM   4806  C  CG    . PRO C 2  155  ? -16.752 -31.615 56.817  1.00   93.52  ? 155  PRO C CG    1 
ATOM   4807  C  CD    . PRO C 2  155  ? -15.857 -31.535 55.622  1.00   96.94  ? 155  PRO C CD    1 
ATOM   4808  N  N     . GLY C 2  156  ? -14.366 -34.828 56.397  1.00   103.01 ? 156  GLY C N     1 
ATOM   4809  C  CA    . GLY C 2  156  ? -13.931 -36.212 56.344  1.00   97.86  ? 156  GLY C CA    1 
ATOM   4810  C  C     . GLY C 2  156  ? -12.580 -36.417 55.687  1.00   102.21 ? 156  GLY C C     1 
ATOM   4811  O  O     . GLY C 2  156  ? -12.170 -37.552 55.439  1.00   102.35 ? 156  GLY C O     1 
ATOM   4812  N  N     . ARG C 2  157  ? -11.882 -35.321 55.407  1.00   105.79 ? 157  ARG C N     1 
ATOM   4813  C  CA    . ARG C 2  157  ? -10.579 -35.393 54.754  1.00   106.46 ? 157  ARG C CA    1 
ATOM   4814  C  C     . ARG C 2  157  ? -9.482  -34.835 55.653  1.00   104.08 ? 157  ARG C C     1 
ATOM   4815  O  O     . ARG C 2  157  ? -9.753  -34.052 56.564  1.00   105.63 ? 157  ARG C O     1 
ATOM   4816  C  CB    . ARG C 2  157  ? -10.604 -34.652 53.415  1.00   106.72 ? 157  ARG C CB    1 
ATOM   4817  C  CG    . ARG C 2  157  ? -11.685 -35.145 52.468  1.00   110.54 ? 157  ARG C CG    1 
ATOM   4818  C  CD    . ARG C 2  157  ? -11.613 -36.654 52.293  1.00   112.97 ? 157  ARG C CD    1 
ATOM   4819  N  NE    . ARG C 2  157  ? -12.784 -37.181 51.599  1.00   114.71 ? 157  ARG C NE    1 
ATOM   4820  C  CZ    . ARG C 2  157  ? -12.844 -37.393 50.288  1.00   129.74 ? 157  ARG C CZ    1 
ATOM   4821  N  NH1   . ARG C 2  157  ? -11.795 -37.126 49.521  1.00   129.80 ? 157  ARG C NH1   1 
ATOM   4822  N  NH2   . ARG C 2  157  ? -13.953 -37.875 49.744  1.00   130.47 ? 157  ARG C NH2   1 
ATOM   4823  N  N     . TYR C 2  158  ? -8.244  -35.250 55.401  1.00   98.97  ? 158  TYR C N     1 
ATOM   4824  C  CA    . TYR C 2  158  ? -7.125  -34.850 56.245  1.00   95.46  ? 158  TYR C CA    1 
ATOM   4825  C  C     . TYR C 2  158  ? -5.922  -34.366 55.437  1.00   98.25  ? 158  TYR C C     1 
ATOM   4826  O  O     . TYR C 2  158  ? -5.719  -34.774 54.293  1.00   104.68 ? 158  TYR C O     1 
ATOM   4827  C  CB    . TYR C 2  158  ? -6.712  -36.004 57.163  1.00   96.36  ? 158  TYR C CB    1 
ATOM   4828  C  CG    . TYR C 2  158  ? -7.843  -36.560 58.001  1.00   93.33  ? 158  TYR C CG    1 
ATOM   4829  C  CD1   . TYR C 2  158  ? -8.150  -36.014 59.241  1.00   87.74  ? 158  TYR C CD1   1 
ATOM   4830  C  CD2   . TYR C 2  158  ? -8.604  -37.631 57.552  1.00   96.78  ? 158  TYR C CD2   1 
ATOM   4831  C  CE1   . TYR C 2  158  ? -9.184  -36.519 60.007  1.00   87.89  ? 158  TYR C CE1   1 
ATOM   4832  C  CE2   . TYR C 2  158  ? -9.639  -38.142 58.312  1.00   93.55  ? 158  TYR C CE2   1 
ATOM   4833  C  CZ    . TYR C 2  158  ? -9.924  -37.583 59.538  1.00   87.85  ? 158  TYR C CZ    1 
ATOM   4834  O  OH    . TYR C 2  158  ? -10.954 -38.091 60.296  1.00   86.19  ? 158  TYR C OH    1 
ATOM   4835  N  N     . ILE C 2  159  ? -5.131  -33.491 56.050  1.00   98.00  ? 159  ILE C N     1 
ATOM   4836  C  CA    . ILE C 2  159  ? -3.915  -32.966 55.444  1.00   90.64  ? 159  ILE C CA    1 
ATOM   4837  C  C     . ILE C 2  159  ? -2.681  -33.597 56.080  1.00   84.76  ? 159  ILE C C     1 
ATOM   4838  O  O     . ILE C 2  159  ? -2.507  -33.556 57.302  1.00   84.62  ? 159  ILE C O     1 
ATOM   4839  C  CB    . ILE C 2  159  ? -3.813  -31.439 55.621  1.00   87.21  ? 159  ILE C CB    1 
ATOM   4840  C  CG1   . ILE C 2  159  ? -5.115  -30.758 55.197  1.00   94.91  ? 159  ILE C CG1   1 
ATOM   4841  C  CG2   . ILE C 2  159  ? -2.629  -30.888 54.838  1.00   86.74  ? 159  ILE C CG2   1 
ATOM   4842  C  CD1   . ILE C 2  159  ? -5.422  -30.898 53.728  1.00   102.84 ? 159  ILE C CD1   1 
ATOM   4843  N  N     . ALA C 2  160  ? -1.832  -34.184 55.243  1.00   76.84  ? 160  ALA C N     1 
ATOM   4844  C  CA    . ALA C 2  160  ? -0.555  -34.716 55.693  1.00   76.23  ? 160  ALA C CA    1 
ATOM   4845  C  C     . ALA C 2  160  ? 0.518   -33.652 55.512  1.00   82.61  ? 160  ALA C C     1 
ATOM   4846  O  O     . ALA C 2  160  ? 0.560   -32.974 54.486  1.00   85.14  ? 160  ALA C O     1 
ATOM   4847  C  CB    . ALA C 2  160  ? -0.198  -35.969 54.915  1.00   71.33  ? 160  ALA C CB    1 
ATOM   4848  N  N     . SER C 2  161  ? 1.380   -33.498 56.510  1.00   81.06  ? 161  SER C N     1 
ATOM   4849  C  CA    . SER C 2  161  ? 2.427   -32.487 56.450  1.00   72.86  ? 161  SER C CA    1 
ATOM   4850  C  C     . SER C 2  161  ? 3.777   -33.053 56.873  1.00   71.62  ? 161  SER C C     1 
ATOM   4851  O  O     . SER C 2  161  ? 3.934   -33.541 57.990  1.00   70.55  ? 161  SER C O     1 
ATOM   4852  C  CB    . SER C 2  161  ? 2.062   -31.285 57.323  1.00   77.98  ? 161  SER C CB    1 
ATOM   4853  O  OG    . SER C 2  161  ? 0.845   -30.695 56.899  1.00   80.29  ? 161  SER C OG    1 
ATOM   4854  N  N     . ILE C 2  162  ? 4.749   -32.986 55.970  1.00   75.18  ? 162  ILE C N     1 
ATOM   4855  C  CA    . ILE C 2  162  ? 6.102   -33.431 56.274  1.00   73.55  ? 162  ILE C CA    1 
ATOM   4856  C  C     . ILE C 2  162  ? 6.983   -32.219 56.544  1.00   78.89  ? 162  ILE C C     1 
ATOM   4857  O  O     . ILE C 2  162  ? 7.290   -31.447 55.635  1.00   92.33  ? 162  ILE C O     1 
ATOM   4858  C  CB    . ILE C 2  162  ? 6.702   -34.238 55.112  1.00   74.62  ? 162  ILE C CB    1 
ATOM   4859  C  CG1   . ILE C 2  162  ? 5.747   -35.354 54.686  1.00   64.25  ? 162  ILE C CG1   1 
ATOM   4860  C  CG2   . ILE C 2  162  ? 8.054   -34.808 55.507  1.00   81.84  ? 162  ILE C CG2   1 
ATOM   4861  C  CD1   . ILE C 2  162  ? 6.213   -36.119 53.469  1.00   69.08  ? 162  ILE C CD1   1 
ATOM   4862  N  N     . ILE C 2  163  ? 7.388   -32.055 57.799  1.00   67.82  ? 163  ILE C N     1 
ATOM   4863  C  CA    . ILE C 2  163  ? 8.139   -30.875 58.207  1.00   73.52  ? 163  ILE C CA    1 
ATOM   4864  C  C     . ILE C 2  163  ? 9.588   -31.203 58.552  1.00   71.23  ? 163  ILE C C     1 
ATOM   4865  O  O     . ILE C 2  163  ? 9.845   -32.030 59.419  1.00   68.52  ? 163  ILE C O     1 
ATOM   4866  C  CB    . ILE C 2  163  ? 7.480   -30.191 59.421  1.00   72.53  ? 163  ILE C CB    1 
ATOM   4867  C  CG1   . ILE C 2  163  ? 6.036   -29.806 59.098  1.00   72.21  ? 163  ILE C CG1   1 
ATOM   4868  C  CG2   . ILE C 2  163  ? 8.278   -28.970 59.846  1.00   82.44  ? 163  ILE C CG2   1 
ATOM   4869  C  CD1   . ILE C 2  163  ? 5.321   -29.115 60.237  1.00   73.28  ? 163  ILE C CD1   1 
ATOM   4870  N  N     . PRO C 2  164  ? 10.541  -30.575 57.847  1.00   68.92  ? 164  PRO C N     1 
ATOM   4871  C  CA    . PRO C 2  164  ? 11.953  -30.659 58.229  1.00   65.65  ? 164  PRO C CA    1 
ATOM   4872  C  C     . PRO C 2  164  ? 12.340  -29.513 59.161  1.00   70.52  ? 164  PRO C C     1 
ATOM   4873  O  O     . PRO C 2  164  ? 11.500  -28.666 59.461  1.00   78.42  ? 164  PRO C O     1 
ATOM   4874  C  CB    . PRO C 2  164  ? 12.673  -30.515 56.892  1.00   73.33  ? 164  PRO C CB    1 
ATOM   4875  C  CG    . PRO C 2  164  ? 11.779  -29.624 56.104  1.00   83.57  ? 164  PRO C CG    1 
ATOM   4876  C  CD    . PRO C 2  164  ? 10.365  -29.926 56.536  1.00   76.27  ? 164  PRO C CD    1 
ATOM   4877  N  N     . LEU C 2  165  ? 13.595  -29.487 59.601  1.00   65.95  ? 165  LEU C N     1 
ATOM   4878  C  CA    . LEU C 2  165  ? 14.091  -28.421 60.469  1.00   66.45  ? 165  LEU C CA    1 
ATOM   4879  C  C     . LEU C 2  165  ? 14.028  -27.062 59.765  1.00   75.41  ? 165  LEU C C     1 
ATOM   4880  O  O     . LEU C 2  165  ? 13.948  -27.004 58.538  1.00   82.23  ? 165  LEU C O     1 
ATOM   4881  C  CB    . LEU C 2  165  ? 15.526  -28.727 60.913  1.00   63.65  ? 165  LEU C CB    1 
ATOM   4882  C  CG    . LEU C 2  165  ? 15.771  -29.801 61.972  1.00   64.88  ? 165  LEU C CG    1 
ATOM   4883  C  CD1   . LEU C 2  165  ? 17.239  -30.194 61.981  1.00   69.65  ? 165  LEU C CD1   1 
ATOM   4884  C  CD2   . LEU C 2  165  ? 15.354  -29.296 63.341  1.00   65.77  ? 165  LEU C CD2   1 
ATOM   4885  N  N     . PRO C 2  166  ? 14.035  -25.963 60.542  1.00   71.97  ? 166  PRO C N     1 
ATOM   4886  C  CA    . PRO C 2  166  ? 14.034  -24.610 59.970  1.00   76.15  ? 166  PRO C CA    1 
ATOM   4887  C  C     . PRO C 2  166  ? 15.177  -24.363 58.982  1.00   85.24  ? 166  PRO C C     1 
ATOM   4888  O  O     . PRO C 2  166  ? 16.322  -24.722 59.262  1.00   84.85  ? 166  PRO C O     1 
ATOM   4889  C  CB    . PRO C 2  166  ? 14.200  -23.718 61.201  1.00   67.97  ? 166  PRO C CB    1 
ATOM   4890  C  CG    . PRO C 2  166  ? 13.557  -24.491 62.293  1.00   61.59  ? 166  PRO C CG    1 
ATOM   4891  C  CD    . PRO C 2  166  ? 13.870  -25.934 62.007  1.00   60.60  ? 166  PRO C CD    1 
ATOM   4892  N  N     . LYS C 2  167  ? 14.844  -23.768 57.837  1.00   87.43  ? 167  LYS C N     1 
ATOM   4893  C  CA    . LYS C 2  167  ? 15.798  -23.459 56.769  1.00   87.66  ? 167  LYS C CA    1 
ATOM   4894  C  C     . LYS C 2  167  ? 16.494  -24.708 56.228  1.00   88.18  ? 167  LYS C C     1 
ATOM   4895  O  O     . LYS C 2  167  ? 17.557  -24.624 55.613  1.00   86.97  ? 167  LYS C O     1 
ATOM   4896  C  CB    . LYS C 2  167  ? 16.843  -22.446 57.251  1.00   82.28  ? 167  LYS C CB    1 
ATOM   4897  C  CG    . LYS C 2  167  ? 16.286  -21.081 57.632  1.00   83.76  ? 167  LYS C CG    1 
ATOM   4898  C  CD    . LYS C 2  167  ? 16.063  -20.207 56.408  1.00   100.88 ? 167  LYS C CD    1 
ATOM   4899  C  CE    . LYS C 2  167  ? 15.729  -18.776 56.801  1.00   92.76  ? 167  LYS C CE    1 
ATOM   4900  N  NZ    . LYS C 2  167  ? 15.603  -17.890 55.610  1.00   97.33  ? 167  LYS C NZ    1 
ATOM   4901  N  N     . ARG C 2  168  ? 15.881  -25.863 56.463  1.00   86.86  ? 168  ARG C N     1 
ATOM   4902  C  CA    . ARG C 2  168  ? 16.371  -27.140 55.948  1.00   89.19  ? 168  ARG C CA    1 
ATOM   4903  C  C     . ARG C 2  168  ? 15.656  -27.600 54.679  1.00   93.24  ? 168  ARG C C     1 
ATOM   4904  O  O     . ARG C 2  168  ? 15.821  -28.736 54.241  1.00   86.34  ? 168  ARG C O     1 
ATOM   4905  C  CB    . ARG C 2  168  ? 16.393  -28.217 57.033  1.00   83.53  ? 168  ARG C CB    1 
ATOM   4906  C  CG    . ARG C 2  168  ? 17.372  -27.910 58.165  1.00   84.68  ? 168  ARG C CG    1 
ATOM   4907  C  CD    . ARG C 2  168  ? 18.813  -28.279 57.829  1.00   85.53  ? 168  ARG C CD    1 
ATOM   4908  N  NE    . ARG C 2  168  ? 19.420  -27.385 56.847  1.00   93.65  ? 168  ARG C NE    1 
ATOM   4909  C  CZ    . ARG C 2  168  ? 20.630  -27.561 56.329  1.00   93.10  ? 168  ARG C CZ    1 
ATOM   4910  N  NH1   . ARG C 2  168  ? 21.367  -28.600 56.699  1.00   90.47  ? 168  ARG C NH1   1 
ATOM   4911  N  NH2   . ARG C 2  168  ? 21.105  -26.700 55.440  1.00   96.26  ? 168  ARG C NH2   1 
ATOM   4912  N  N     . GLY C 2  169  ? 14.840  -26.718 54.111  1.00   103.53 ? 169  GLY C N     1 
ATOM   4913  C  CA    . GLY C 2  169  ? 14.036  -27.050 52.950  1.00   103.99 ? 169  GLY C CA    1 
ATOM   4914  C  C     . GLY C 2  169  ? 12.545  -27.067 53.226  1.00   107.17 ? 169  GLY C C     1 
ATOM   4915  O  O     . GLY C 2  169  ? 12.121  -27.036 54.380  1.00   106.15 ? 169  GLY C O     1 
ATOM   4916  N  N     . PRO C 2  170  ? 11.741  -27.115 52.152  1.00   105.97 ? 170  PRO C N     1 
ATOM   4917  C  CA    . PRO C 2  170  ? 10.306  -26.802 52.139  1.00   101.52 ? 170  PRO C CA    1 
ATOM   4918  C  C     . PRO C 2  170  ? 9.416   -27.787 52.890  1.00   97.53  ? 170  PRO C C     1 
ATOM   4919  O  O     . PRO C 2  170  ? 9.748   -28.965 53.021  1.00   94.66  ? 170  PRO C O     1 
ATOM   4920  C  CB    . PRO C 2  170  ? 9.964   -26.844 50.649  1.00   101.74 ? 170  PRO C CB    1 
ATOM   4921  C  CG    . PRO C 2  170  ? 10.927  -27.825 50.085  1.00   103.02 ? 170  PRO C CG    1 
ATOM   4922  C  CD    . PRO C 2  170  ? 12.206  -27.599 50.840  1.00   102.53 ? 170  PRO C CD    1 
ATOM   4923  N  N     . TRP C 2  171  ? 8.284   -27.284 53.373  1.00   97.17  ? 171  TRP C N     1 
ATOM   4924  C  CA    . TRP C 2  171  ? 7.241   -28.127 53.941  1.00   94.29  ? 171  TRP C CA    1 
ATOM   4925  C  C     . TRP C 2  171  ? 6.435   -28.726 52.797  1.00   98.43  ? 171  TRP C C     1 
ATOM   4926  O  O     . TRP C 2  171  ? 6.144   -28.044 51.815  1.00   108.88 ? 171  TRP C O     1 
ATOM   4927  C  CB    . TRP C 2  171  ? 6.316   -27.316 54.852  1.00   90.10  ? 171  TRP C CB    1 
ATOM   4928  C  CG    . TRP C 2  171  ? 6.953   -26.833 56.122  1.00   96.73  ? 171  TRP C CG    1 
ATOM   4929  C  CD1   . TRP C 2  171  ? 8.287   -26.781 56.408  1.00   101.63 ? 171  TRP C CD1   1 
ATOM   4930  C  CD2   . TRP C 2  171  ? 6.276   -26.341 57.285  1.00   98.89  ? 171  TRP C CD2   1 
ATOM   4931  N  NE1   . TRP C 2  171  ? 8.482   -26.283 57.674  1.00   97.79  ? 171  TRP C NE1   1 
ATOM   4932  C  CE2   . TRP C 2  171  ? 7.262   -26.005 58.234  1.00   105.08 ? 171  TRP C CE2   1 
ATOM   4933  C  CE3   . TRP C 2  171  ? 4.930   -26.151 57.616  1.00   96.23  ? 171  TRP C CE3   1 
ATOM   4934  C  CZ2   . TRP C 2  171  ? 6.947   -25.491 59.491  1.00   108.83 ? 171  TRP C CZ2   1 
ATOM   4935  C  CZ3   . TRP C 2  171  ? 4.619   -25.639 58.864  1.00   101.94 ? 171  TRP C CZ3   1 
ATOM   4936  C  CH2   . TRP C 2  171  ? 5.623   -25.316 59.786  1.00   97.35  ? 171  TRP C CH2   1 
ATOM   4937  N  N     . ILE C 2  172  ? 6.075   -29.998 52.924  1.00   88.19  ? 172  ILE C N     1 
ATOM   4938  C  CA    . ILE C 2  172  ? 5.339   -30.688 51.870  1.00   82.57  ? 172  ILE C CA    1 
ATOM   4939  C  C     . ILE C 2  172  ? 3.940   -31.076 52.334  1.00   80.55  ? 172  ILE C C     1 
ATOM   4940  O  O     . ILE C 2  172  ? 3.779   -31.677 53.395  1.00   83.12  ? 172  ILE C O     1 
ATOM   4941  C  CB    . ILE C 2  172  ? 6.088   -31.947 51.404  1.00   83.95  ? 172  ILE C CB    1 
ATOM   4942  C  CG1   . ILE C 2  172  ? 7.451   -31.564 50.825  1.00   94.86  ? 172  ILE C CG1   1 
ATOM   4943  C  CG2   . ILE C 2  172  ? 5.262   -32.710 50.385  1.00   87.03  ? 172  ILE C CG2   1 
ATOM   4944  C  CD1   . ILE C 2  172  ? 8.231   -32.732 50.268  1.00   96.00  ? 172  ILE C CD1   1 
ATOM   4945  N  N     . ASP C 2  173  ? 2.929   -30.733 51.540  1.00   85.98  ? 173  ASP C N     1 
ATOM   4946  C  CA    . ASP C 2  173  ? 1.549   -31.039 51.921  1.00   86.39  ? 173  ASP C CA    1 
ATOM   4947  C  C     . ASP C 2  173  ? 0.861   -32.059 51.015  1.00   92.08  ? 173  ASP C C     1 
ATOM   4948  O  O     . ASP C 2  173  ? 0.710   -31.839 49.818  1.00   98.09  ? 173  ASP C O     1 
ATOM   4949  C  CB    . ASP C 2  173  ? 0.712   -29.759 52.000  1.00   88.75  ? 173  ASP C CB    1 
ATOM   4950  C  CG    . ASP C 2  173  ? 0.825   -29.073 53.345  1.00   87.28  ? 173  ASP C CG    1 
ATOM   4951  O  OD1   . ASP C 2  173  ? 1.879   -29.217 54.000  1.00   89.72  ? 173  ASP C OD1   1 
ATOM   4952  O  OD2   . ASP C 2  173  ? -0.142  -28.394 53.749  1.00   89.56  ? 173  ASP C OD2   1 
ATOM   4953  N  N     . LEU C 2  174  ? 0.432   -33.172 51.602  1.00   87.58  ? 174  LEU C N     1 
ATOM   4954  C  CA    . LEU C 2  174  ? -0.317  -34.187 50.869  1.00   81.05  ? 174  LEU C CA    1 
ATOM   4955  C  C     . LEU C 2  174  ? -1.802  -34.078 51.201  1.00   87.56  ? 174  LEU C C     1 
ATOM   4956  O  O     . LEU C 2  174  ? -2.186  -34.092 52.370  1.00   87.76  ? 174  LEU C O     1 
ATOM   4957  C  CB    . LEU C 2  174  ? 0.202   -35.589 51.199  1.00   65.23  ? 174  LEU C CB    1 
ATOM   4958  C  CG    . LEU C 2  174  ? 1.328   -36.159 50.330  1.00   58.78  ? 174  LEU C CG    1 
ATOM   4959  C  CD1   . LEU C 2  174  ? 2.466   -35.167 50.141  1.00   63.41  ? 174  LEU C CD1   1 
ATOM   4960  C  CD2   . LEU C 2  174  ? 1.843   -37.461 50.924  1.00   67.01  ? 174  LEU C CD2   1 
ATOM   4961  N  N     . GLU C 2  175  ? -2.634  -33.965 50.171  1.00   92.44  ? 175  GLU C N     1 
ATOM   4962  C  CA    . GLU C 2  175  ? -4.064  -33.753 50.373  1.00   92.78  ? 175  GLU C CA    1 
ATOM   4963  C  C     . GLU C 2  175  ? -4.884  -34.557 49.369  1.00   101.56 ? 175  GLU C C     1 
ATOM   4964  O  O     . GLU C 2  175  ? -4.451  -34.765 48.243  1.00   109.00 ? 175  GLU C O     1 
ATOM   4965  C  CB    . GLU C 2  175  ? -4.389  -32.261 50.245  1.00   94.16  ? 175  GLU C CB    1 
ATOM   4966  C  CG    . GLU C 2  175  ? -5.868  -31.913 50.324  1.00   94.24  ? 175  GLU C CG    1 
ATOM   4967  C  CD    . GLU C 2  175  ? -6.135  -30.440 50.081  1.00   96.58  ? 175  GLU C CD    1 
ATOM   4968  O  OE1   . GLU C 2  175  ? -5.169  -29.696 49.808  1.00   90.34  ? 175  GLU C OE1   1 
ATOM   4969  O  OE2   . GLU C 2  175  ? -7.311  -30.027 50.162  1.00   96.47  ? 175  GLU C OE2   1 
ATOM   4970  N  N     . VAL C 2  176  ? -6.063  -35.016 49.774  1.00   105.11 ? 176  VAL C N     1 
ATOM   4971  C  CA    . VAL C 2  176  ? -6.961  -35.682 48.838  1.00   111.12 ? 176  VAL C CA    1 
ATOM   4972  C  C     . VAL C 2  176  ? -7.938  -34.667 48.248  1.00   114.19 ? 176  VAL C C     1 
ATOM   4973  O  O     . VAL C 2  176  ? -8.804  -34.141 48.947  1.00   116.82 ? 176  VAL C O     1 
ATOM   4974  C  CB    . VAL C 2  176  ? -7.741  -36.830 49.505  1.00   109.62 ? 176  VAL C CB    1 
ATOM   4975  C  CG1   . VAL C 2  176  ? -8.653  -37.504 48.492  1.00   110.24 ? 176  VAL C CG1   1 
ATOM   4976  C  CG2   . VAL C 2  176  ? -6.778  -37.838 50.112  1.00   101.58 ? 176  VAL C CG2   1 
ATOM   4977  N  N     . GLU C 2  177  ? -7.788  -34.402 46.954  1.00   114.81 ? 177  GLU C N     1 
ATOM   4978  C  CA    . GLU C 2  177  ? -8.576  -33.382 46.271  1.00   118.67 ? 177  GLU C CA    1 
ATOM   4979  C  C     . GLU C 2  177  ? -10.029 -33.825 46.095  1.00   119.28 ? 177  GLU C C     1 
ATOM   4980  O  O     . GLU C 2  177  ? -10.312 -35.023 46.070  1.00   120.22 ? 177  GLU C O     1 
ATOM   4981  C  CB    . GLU C 2  177  ? -7.944  -33.059 44.911  1.00   115.87 ? 177  GLU C CB    1 
ATOM   4982  C  CG    . GLU C 2  177  ? -7.654  -31.581 44.687  1.00   114.78 ? 177  GLU C CG    1 
ATOM   4983  C  CD    . GLU C 2  177  ? -6.879  -30.959 45.832  1.00   110.57 ? 177  GLU C CD    1 
ATOM   4984  O  OE1   . GLU C 2  177  ? -7.316  -29.908 46.348  1.00   102.74 ? 177  GLU C OE1   1 
ATOM   4985  O  OE2   . GLU C 2  177  ? -5.831  -31.518 46.216  1.00   107.93 ? 177  GLU C OE2   1 
ATOM   4986  N  N     . PRO C 2  178  ? -10.956 -32.855 45.991  1.00   116.71 ? 178  PRO C N     1 
ATOM   4987  C  CA    . PRO C 2  178  ? -12.372 -33.139 45.731  1.00   114.39 ? 178  PRO C CA    1 
ATOM   4988  C  C     . PRO C 2  178  ? -12.596 -33.996 44.486  1.00   118.42 ? 178  PRO C C     1 
ATOM   4989  O  O     . PRO C 2  178  ? -13.591 -34.718 44.420  1.00   121.27 ? 178  PRO C O     1 
ATOM   4990  C  CB    . PRO C 2  178  ? -12.966 -31.748 45.513  1.00   113.32 ? 178  PRO C CB    1 
ATOM   4991  C  CG    . PRO C 2  178  ? -12.120 -30.856 46.336  1.00   116.61 ? 178  PRO C CG    1 
ATOM   4992  C  CD    . PRO C 2  178  ? -10.732 -31.429 46.290  1.00   115.63 ? 178  PRO C CD    1 
ATOM   4993  N  N     . ASN C 2  179  ? -11.689 -33.920 43.516  1.00   116.22 ? 179  ASN C N     1 
ATOM   4994  C  CA    . ASN C 2  179  ? -11.824 -34.704 42.292  1.00   118.44 ? 179  ASN C CA    1 
ATOM   4995  C  C     . ASN C 2  179  ? -11.247 -36.112 42.434  1.00   125.38 ? 179  ASN C C     1 
ATOM   4996  O  O     . ASN C 2  179  ? -11.279 -36.904 41.491  1.00   127.76 ? 179  ASN C O     1 
ATOM   4997  C  CB    . ASN C 2  179  ? -11.194 -33.978 41.099  1.00   112.40 ? 179  ASN C CB    1 
ATOM   4998  C  CG    . ASN C 2  179  ? -9.683  -34.084 41.082  1.00   112.73 ? 179  ASN C CG    1 
ATOM   4999  O  OD1   . ASN C 2  179  ? -9.121  -34.992 40.470  1.00   108.92 ? 179  ASN C OD1   1 
ATOM   5000  N  ND2   . ASN C 2  179  ? -9.015  -33.151 41.751  1.00   115.34 ? 179  ASN C ND2   1 
ATOM   5001  N  N     . GLY C 2  180  ? -10.718 -36.415 43.616  1.00   124.31 ? 180  GLY C N     1 
ATOM   5002  C  CA    . GLY C 2  180  ? -10.264 -37.758 43.932  1.00   119.73 ? 180  GLY C CA    1 
ATOM   5003  C  C     . GLY C 2  180  ? -8.764  -37.981 43.862  1.00   118.39 ? 180  GLY C C     1 
ATOM   5004  O  O     . GLY C 2  180  ? -8.248  -38.916 44.473  1.00   116.11 ? 180  GLY C O     1 
ATOM   5005  N  N     . VAL C 2  181  ? -8.061  -37.125 43.126  1.00   120.93 ? 181  VAL C N     1 
ATOM   5006  C  CA    . VAL C 2  181  ? -6.617  -37.276 42.961  1.00   117.51 ? 181  VAL C CA    1 
ATOM   5007  C  C     . VAL C 2  181  ? -5.863  -36.760 44.190  1.00   112.69 ? 181  VAL C C     1 
ATOM   5008  O  O     . VAL C 2  181  ? -6.272  -35.783 44.818  1.00   104.94 ? 181  VAL C O     1 
ATOM   5009  C  CB    . VAL C 2  181  ? -6.111  -36.577 41.669  1.00   107.96 ? 181  VAL C CB    1 
ATOM   5010  C  CG1   . VAL C 2  181  ? -6.223  -35.064 41.789  1.00   104.11 ? 181  VAL C CG1   1 
ATOM   5011  C  CG2   . VAL C 2  181  ? -4.679  -36.989 41.353  1.00   99.19  ? 181  VAL C CG2   1 
ATOM   5012  N  N     . VAL C 2  182  ? -4.774  -37.437 44.545  1.00   114.25 ? 182  VAL C N     1 
ATOM   5013  C  CA    . VAL C 2  182  ? -3.947  -37.011 45.669  1.00   109.67 ? 182  VAL C CA    1 
ATOM   5014  C  C     . VAL C 2  182  ? -2.893  -35.997 45.225  1.00   111.21 ? 182  VAL C C     1 
ATOM   5015  O  O     . VAL C 2  182  ? -2.046  -36.286 44.378  1.00   114.04 ? 182  VAL C O     1 
ATOM   5016  C  CB    . VAL C 2  182  ? -3.281  -38.210 46.382  1.00   104.61 ? 182  VAL C CB    1 
ATOM   5017  C  CG1   . VAL C 2  182  ? -2.786  -39.228 45.371  1.00   113.36 ? 182  VAL C CG1   1 
ATOM   5018  C  CG2   . VAL C 2  182  ? -2.151  -37.737 47.287  1.00   100.49 ? 182  VAL C CG2   1 
ATOM   5019  N  N     . SER C 2  183  ? -2.961  -34.805 45.807  1.00   108.62 ? 183  SER C N     1 
ATOM   5020  C  CA    . SER C 2  183  ? -2.101  -33.697 45.420  1.00   107.59 ? 183  SER C CA    1 
ATOM   5021  C  C     . SER C 2  183  ? -1.004  -33.417 46.440  1.00   101.52 ? 183  SER C C     1 
ATOM   5022  O  O     . SER C 2  183  ? -1.183  -33.602 47.649  1.00   96.13  ? 183  SER C O     1 
ATOM   5023  C  CB    . SER C 2  183  ? -2.928  -32.431 45.192  1.00   106.47 ? 183  SER C CB    1 
ATOM   5024  O  OG    . SER C 2  183  ? -3.588  -32.034 46.381  1.00   93.27  ? 183  SER C OG    1 
ATOM   5025  N  N     . MET C 2  184  ? 0.131   -32.964 45.921  1.00   105.59 ? 184  MET C N     1 
ATOM   5026  C  CA    . MET C 2  184  ? 1.301   -32.627 46.711  1.00   100.54 ? 184  MET C CA    1 
ATOM   5027  C  C     . MET C 2  184  ? 1.629   -31.150 46.521  1.00   105.11 ? 184  MET C C     1 
ATOM   5028  O  O     . MET C 2  184  ? 1.565   -30.624 45.403  1.00   109.67 ? 184  MET C O     1 
ATOM   5029  C  CB    . MET C 2  184  ? 2.481   -33.498 46.279  1.00   95.52  ? 184  MET C CB    1 
ATOM   5030  C  CG    . MET C 2  184  ? 3.802   -33.193 46.959  1.00   88.59  ? 184  MET C CG    1 
ATOM   5031  S  SD    . MET C 2  184  ? 5.033   -34.413 46.466  1.00   87.08  ? 184  MET C SD    1 
ATOM   5032  C  CE    . MET C 2  184  ? 6.527   -33.747 47.186  1.00   88.13  ? 184  MET C CE    1 
ATOM   5033  N  N     . LYS C 2  185  ? 1.970   -30.490 47.624  1.00   98.97  ? 185  LYS C N     1 
ATOM   5034  C  CA    . LYS C 2  185  ? 2.252   -29.062 47.637  1.00   101.69 ? 185  LYS C CA    1 
ATOM   5035  C  C     . LYS C 2  185  ? 3.663   -28.797 48.151  1.00   104.17 ? 185  LYS C C     1 
ATOM   5036  O  O     . LYS C 2  185  ? 3.982   -29.108 49.305  1.00   110.67 ? 185  LYS C O     1 
ATOM   5037  C  CB    . LYS C 2  185  ? 1.233   -28.326 48.511  1.00   92.76  ? 185  LYS C CB    1 
ATOM   5038  C  CG    . LYS C 2  185  ? 1.487   -26.832 48.646  1.00   93.65  ? 185  LYS C CG    1 
ATOM   5039  C  CD    . LYS C 2  185  ? 0.650   -26.226 49.763  1.00   92.83  ? 185  LYS C CD    1 
ATOM   5040  C  CE    . LYS C 2  185  ? -0.839  -26.385 49.499  1.00   91.79  ? 185  LYS C CE    1 
ATOM   5041  N  NZ    . LYS C 2  185  ? -1.274  -25.628 48.294  1.00   98.58  ? 185  LYS C NZ    1 
ATOM   5042  N  N     . VAL C 2  186  ? 4.499   -28.239 47.277  1.00   99.20  ? 186  VAL C N     1 
ATOM   5043  C  CA    . VAL C 2  186  ? 5.867   -27.851 47.610  1.00   98.02  ? 186  VAL C CA    1 
ATOM   5044  C  C     . VAL C 2  186  ? 6.154   -26.472 47.030  1.00   107.75 ? 186  VAL C C     1 
ATOM   5045  O  O     . VAL C 2  186  ? 5.947   -26.248 45.836  1.00   112.13 ? 186  VAL C O     1 
ATOM   5046  C  CB    . VAL C 2  186  ? 6.899   -28.834 47.025  1.00   94.02  ? 186  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C 2  186  ? 8.313   -28.391 47.371  1.00   91.23  ? 186  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C 2  186  ? 6.646   -30.237 47.529  1.00   100.12 ? 186  VAL C CG2   1 
ATOM   5049  N  N     . ASN C 2  187  ? 6.635   -25.560 47.872  1.00   109.01 ? 187  ASN C N     1 
ATOM   5050  C  CA    . ASN C 2  187  ? 6.910   -24.182 47.464  1.00   104.78 ? 187  ASN C CA    1 
ATOM   5051  C  C     . ASN C 2  187  ? 5.698   -23.529 46.804  1.00   99.05  ? 187  ASN C C     1 
ATOM   5052  O  O     . ASN C 2  187  ? 5.833   -22.811 45.813  1.00   98.39  ? 187  ASN C O     1 
ATOM   5053  C  CB    . ASN C 2  187  ? 8.123   -24.117 46.527  1.00   107.05 ? 187  ASN C CB    1 
ATOM   5054  C  CG    . ASN C 2  187  ? 9.395   -24.630 47.177  1.00   105.98 ? 187  ASN C CG    1 
ATOM   5055  O  OD1   . ASN C 2  187  ? 10.002  -25.591 46.704  1.00   98.96  ? 187  ASN C OD1   1 
ATOM   5056  N  ND2   . ASN C 2  187  ? 9.807   -23.987 48.263  1.00   105.58 ? 187  ASN C ND2   1 
ATOM   5057  N  N     . LYS C 2  188  ? 4.521   -23.797 47.364  1.00   101.51 ? 188  LYS C N     1 
ATOM   5058  C  CA    . LYS C 2  188  ? 3.251   -23.313 46.823  1.00   109.63 ? 188  LYS C CA    1 
ATOM   5059  C  C     . LYS C 2  188  ? 2.982   -23.794 45.395  1.00   118.52 ? 188  LYS C C     1 
ATOM   5060  O  O     . LYS C 2  188  ? 2.610   -23.006 44.525  1.00   127.64 ? 188  LYS C O     1 
ATOM   5061  C  CB    . LYS C 2  188  ? 3.156   -21.785 46.912  1.00   103.36 ? 188  LYS C CB    1 
ATOM   5062  C  CG    . LYS C 2  188  ? 2.966   -21.257 48.325  1.00   99.92  ? 188  LYS C CG    1 
ATOM   5063  C  CD    . LYS C 2  188  ? 2.963   -19.737 48.354  1.00   100.62 ? 188  LYS C CD    1 
ATOM   5064  C  CE    . LYS C 2  188  ? 4.349   -19.174 48.081  1.00   98.28  ? 188  LYS C CE    1 
ATOM   5065  N  NZ    . LYS C 2  188  ? 5.321   -19.558 49.142  1.00   101.11 ? 188  LYS C NZ    1 
ATOM   5066  N  N     . ARG C 2  189  ? 3.173   -25.090 45.162  1.00   111.53 ? 189  ARG C N     1 
ATOM   5067  C  CA    . ARG C 2  189  ? 2.859   -25.697 43.871  1.00   107.17 ? 189  ARG C CA    1 
ATOM   5068  C  C     . ARG C 2  189  ? 2.085   -27.002 44.048  1.00   107.36 ? 189  ARG C C     1 
ATOM   5069  O  O     . ARG C 2  189  ? 2.586   -27.953 44.644  1.00   107.53 ? 189  ARG C O     1 
ATOM   5070  C  CB    . ARG C 2  189  ? 4.134   -25.955 43.061  1.00   109.69 ? 189  ARG C CB    1 
ATOM   5071  C  CG    . ARG C 2  189  ? 4.815   -24.701 42.534  1.00   114.43 ? 189  ARG C CG    1 
ATOM   5072  C  CD    . ARG C 2  189  ? 6.004   -25.051 41.651  1.00   116.43 ? 189  ARG C CD    1 
ATOM   5073  N  NE    . ARG C 2  189  ? 6.711   -23.863 41.180  1.00   126.21 ? 189  ARG C NE    1 
ATOM   5074  C  CZ    . ARG C 2  189  ? 6.481   -23.267 40.014  1.00   130.11 ? 189  ARG C CZ    1 
ATOM   5075  N  NH1   . ARG C 2  189  ? 5.560   -23.748 39.190  1.00   128.60 ? 189  ARG C NH1   1 
ATOM   5076  N  NH2   . ARG C 2  189  ? 7.174   -22.190 39.671  1.00   127.05 ? 189  ARG C NH2   1 
ATOM   5077  N  N     . LYS C 2  190  ? 0.866   -27.040 43.517  1.00   108.15 ? 190  LYS C N     1 
ATOM   5078  C  CA    . LYS C 2  190  ? 0.014   -28.224 43.605  1.00   104.98 ? 190  LYS C CA    1 
ATOM   5079  C  C     . LYS C 2  190  ? 0.189   -29.131 42.391  1.00   99.90  ? 190  LYS C C     1 
ATOM   5080  O  O     . LYS C 2  190  ? -0.108  -28.731 41.266  1.00   96.00  ? 190  LYS C O     1 
ATOM   5081  C  CB    . LYS C 2  190  ? -1.454  -27.808 43.706  1.00   101.80 ? 190  LYS C CB    1 
ATOM   5082  C  CG    . LYS C 2  190  ? -1.900  -27.334 45.079  1.00   102.11 ? 190  LYS C CG    1 
ATOM   5083  C  CD    . LYS C 2  190  ? -2.400  -28.494 45.924  1.00   104.08 ? 190  LYS C CD    1 
ATOM   5084  C  CE    . LYS C 2  190  ? -3.431  -28.028 46.943  1.00   102.39 ? 190  LYS C CE    1 
ATOM   5085  N  NZ    . LYS C 2  190  ? -4.630  -27.435 46.285  1.00   81.28  ? 190  LYS C NZ    1 
ATOM   5086  N  N     . PHE C 2  191  ? 0.664   -30.354 42.615  1.00   98.27  ? 191  PHE C N     1 
ATOM   5087  C  CA    . PHE C 2  191  ? 0.787   -31.314 41.519  1.00   101.23 ? 191  PHE C CA    1 
ATOM   5088  C  C     . PHE C 2  191  ? 0.471   -32.732 41.992  1.00   110.77 ? 191  PHE C C     1 
ATOM   5089  O  O     . PHE C 2  191  ? 0.761   -33.079 43.131  1.00   115.08 ? 191  PHE C O     1 
ATOM   5090  C  CB    . PHE C 2  191  ? 2.187   -31.251 40.900  1.00   99.37  ? 191  PHE C CB    1 
ATOM   5091  C  CG    . PHE C 2  191  ? 3.232   -32.000 41.677  1.00   107.46 ? 191  PHE C CG    1 
ATOM   5092  C  CD1   . PHE C 2  191  ? 3.633   -33.267 41.282  1.00   110.20 ? 191  PHE C CD1   1 
ATOM   5093  C  CD2   . PHE C 2  191  ? 3.816   -31.438 42.801  1.00   108.65 ? 191  PHE C CD2   1 
ATOM   5094  C  CE1   . PHE C 2  191  ? 4.592   -33.961 41.994  1.00   108.03 ? 191  PHE C CE1   1 
ATOM   5095  C  CE2   . PHE C 2  191  ? 4.778   -32.127 43.516  1.00   112.35 ? 191  PHE C CE2   1 
ATOM   5096  C  CZ    . PHE C 2  191  ? 5.167   -33.390 43.111  1.00   109.05 ? 191  PHE C CZ    1 
ATOM   5097  N  N     . PRO C 2  192  ? -0.117  -33.560 41.111  1.00   109.73 ? 192  PRO C N     1 
ATOM   5098  C  CA    . PRO C 2  192  ? -0.484  -34.934 41.481  1.00   105.63 ? 192  PRO C CA    1 
ATOM   5099  C  C     . PRO C 2  192  ? 0.711   -35.765 41.950  1.00   110.16 ? 192  PRO C C     1 
ATOM   5100  O  O     . PRO C 2  192  ? 1.751   -35.794 41.290  1.00   105.32 ? 192  PRO C O     1 
ATOM   5101  C  CB    . PRO C 2  192  ? -1.061  -35.508 40.181  1.00   104.60 ? 192  PRO C CB    1 
ATOM   5102  C  CG    . PRO C 2  192  ? -0.541  -34.622 39.097  1.00   111.81 ? 192  PRO C CG    1 
ATOM   5103  C  CD    . PRO C 2  192  ? -0.458  -33.262 39.711  1.00   114.60 ? 192  PRO C CD    1 
ATOM   5104  N  N     . LEU C 2  193  ? 0.542   -36.438 43.085  1.00   110.42 ? 193  LEU C N     1 
ATOM   5105  C  CA    . LEU C 2  193  ? 1.606   -37.220 43.711  1.00   111.63 ? 193  LEU C CA    1 
ATOM   5106  C  C     . LEU C 2  193  ? 2.034   -38.403 42.844  1.00   109.91 ? 193  LEU C C     1 
ATOM   5107  O  O     . LEU C 2  193  ? 3.149   -38.916 42.978  1.00   106.11 ? 193  LEU C O     1 
ATOM   5108  C  CB    . LEU C 2  193  ? 1.146   -37.710 45.088  1.00   104.26 ? 193  LEU C CB    1 
ATOM   5109  C  CG    . LEU C 2  193  ? 2.136   -38.473 45.970  1.00   96.31  ? 193  LEU C CG    1 
ATOM   5110  C  CD1   . LEU C 2  193  ? 3.336   -37.607 46.317  1.00   91.02  ? 193  LEU C CD1   1 
ATOM   5111  C  CD2   . LEU C 2  193  ? 1.450   -38.968 47.232  1.00   87.18  ? 193  LEU C CD2   1 
ATOM   5112  N  N     . VAL C 2  194  ? 1.136   -38.823 41.956  1.00   110.74 ? 194  VAL C N     1 
ATOM   5113  C  CA    . VAL C 2  194  ? 1.378   -39.943 41.053  1.00   112.40 ? 194  VAL C CA    1 
ATOM   5114  C  C     . VAL C 2  194  ? 2.690   -39.781 40.293  1.00   112.40 ? 194  VAL C C     1 
ATOM   5115  O  O     . VAL C 2  194  ? 3.476   -40.724 40.178  1.00   113.12 ? 194  VAL C O     1 
ATOM   5116  C  CB    . VAL C 2  194  ? 0.243   -40.073 40.023  1.00   113.01 ? 194  VAL C CB    1 
ATOM   5117  C  CG1   . VAL C 2  194  ? 0.318   -41.419 39.319  1.00   117.27 ? 194  VAL C CG1   1 
ATOM   5118  C  CG2   . VAL C 2  194  ? -1.110  -39.888 40.695  1.00   108.62 ? 194  VAL C CG2   1 
ATOM   5119  N  N     . LEU C 2  195  ? 2.916   -38.574 39.784  1.00   112.26 ? 195  LEU C N     1 
ATOM   5120  C  CA    . LEU C 2  195  ? 4.112   -38.262 39.011  1.00   115.09 ? 195  LEU C CA    1 
ATOM   5121  C  C     . LEU C 2  195  ? 5.378   -38.518 39.820  1.00   114.74 ? 195  LEU C C     1 
ATOM   5122  O  O     . LEU C 2  195  ? 6.291   -39.214 39.364  1.00   115.64 ? 195  LEU C O     1 
ATOM   5123  C  CB    . LEU C 2  195  ? 4.070   -36.805 38.549  1.00   111.46 ? 195  LEU C CB    1 
ATOM   5124  C  CG    . LEU C 2  195  ? 5.211   -36.327 37.652  1.00   120.74 ? 195  LEU C CG    1 
ATOM   5125  C  CD1   . LEU C 2  195  ? 5.261   -37.138 36.368  1.00   122.49 ? 195  LEU C CD1   1 
ATOM   5126  C  CD2   . LEU C 2  195  ? 5.050   -34.850 37.346  1.00   122.50 ? 195  LEU C CD2   1 
ATOM   5127  N  N     . LEU C 2  196  ? 5.421   -37.959 41.026  1.00   112.33 ? 196  LEU C N     1 
ATOM   5128  C  CA    . LEU C 2  196  ? 6.568   -38.137 41.905  1.00   113.47 ? 196  LEU C CA    1 
ATOM   5129  C  C     . LEU C 2  196  ? 6.767   -39.606 42.247  1.00   111.59 ? 196  LEU C C     1 
ATOM   5130  O  O     . LEU C 2  196  ? 7.895   -40.097 42.272  1.00   113.32 ? 196  LEU C O     1 
ATOM   5131  C  CB    . LEU C 2  196  ? 6.409   -37.325 43.190  1.00   105.88 ? 196  LEU C CB    1 
ATOM   5132  C  CG    . LEU C 2  196  ? 7.603   -37.471 44.136  1.00   101.35 ? 196  LEU C CG    1 
ATOM   5133  C  CD1   . LEU C 2  196  ? 8.836   -36.800 43.546  1.00   109.65 ? 196  LEU C CD1   1 
ATOM   5134  C  CD2   . LEU C 2  196  ? 7.297   -36.931 45.520  1.00   98.25  ? 196  LEU C CD2   1 
ATOM   5135  N  N     . LEU C 2  197  ? 5.667   -40.307 42.507  1.00   108.93 ? 197  LEU C N     1 
ATOM   5136  C  CA    . LEU C 2  197  ? 5.739   -41.731 42.809  1.00   112.02 ? 197  LEU C CA    1 
ATOM   5137  C  C     . LEU C 2  197  ? 6.326   -42.516 41.640  1.00   113.32 ? 197  LEU C C     1 
ATOM   5138  O  O     . LEU C 2  197  ? 7.023   -43.509 41.839  1.00   113.85 ? 197  LEU C O     1 
ATOM   5139  C  CB    . LEU C 2  197  ? 4.366   -42.283 43.197  1.00   109.43 ? 197  LEU C CB    1 
ATOM   5140  C  CG    . LEU C 2  197  ? 3.862   -41.866 44.580  1.00   105.43 ? 197  LEU C CG    1 
ATOM   5141  C  CD1   . LEU C 2  197  ? 2.606   -42.633 44.947  1.00   106.40 ? 197  LEU C CD1   1 
ATOM   5142  C  CD2   . LEU C 2  197  ? 4.943   -42.072 45.631  1.00   103.16 ? 197  LEU C CD2   1 
ATOM   5143  N  N     . ARG C 2  198  ? 6.052   -42.060 40.421  1.00   114.19 ? 198  ARG C N     1 
ATOM   5144  C  CA    . ARG C 2  198  ? 6.639   -42.681 39.241  1.00   117.38 ? 198  ARG C CA    1 
ATOM   5145  C  C     . ARG C 2  198  ? 8.130   -42.367 39.166  1.00   118.46 ? 198  ARG C C     1 
ATOM   5146  O  O     . ARG C 2  198  ? 8.931   -43.218 38.780  1.00   124.54 ? 198  ARG C O     1 
ATOM   5147  C  CB    . ARG C 2  198  ? 5.935   -42.213 37.966  1.00   120.03 ? 198  ARG C CB    1 
ATOM   5148  C  CG    . ARG C 2  198  ? 6.275   -43.036 36.729  1.00   130.27 ? 198  ARG C CG    1 
ATOM   5149  C  CD    . ARG C 2  198  ? 5.737   -44.458 36.842  1.00   130.88 ? 198  ARG C CD    1 
ATOM   5150  N  NE    . ARG C 2  198  ? 6.007   -45.256 35.647  1.00   130.67 ? 198  ARG C NE    1 
ATOM   5151  C  CZ    . ARG C 2  198  ? 6.982   -46.154 35.548  1.00   123.07 ? 198  ARG C CZ    1 
ATOM   5152  N  NH1   . ARG C 2  198  ? 7.150   -46.832 34.421  1.00   109.73 ? 198  ARG C NH1   1 
ATOM   5153  N  NH2   . ARG C 2  198  ? 7.788   -46.378 36.577  1.00   126.53 ? 198  ARG C NH2   1 
ATOM   5154  N  N     . VAL C 2  199  ? 8.497   -41.143 39.538  1.00   114.94 ? 199  VAL C N     1 
ATOM   5155  C  CA    . VAL C 2  199  ? 9.902   -40.742 39.558  1.00   111.90 ? 199  VAL C CA    1 
ATOM   5156  C  C     . VAL C 2  199  ? 10.696  -41.566 40.576  1.00   109.29 ? 199  VAL C C     1 
ATOM   5157  O  O     . VAL C 2  199  ? 11.854  -41.918 40.341  1.00   103.09 ? 199  VAL C O     1 
ATOM   5158  C  CB    . VAL C 2  199  ? 10.060  -39.235 39.861  1.00   111.20 ? 199  VAL C CB    1 
ATOM   5159  C  CG1   . VAL C 2  199  ? 11.531  -38.850 39.931  1.00   107.36 ? 199  VAL C CG1   1 
ATOM   5160  C  CG2   . VAL C 2  199  ? 9.344   -38.407 38.808  1.00   114.71 ? 199  VAL C CG2   1 
ATOM   5161  N  N     . LEU C 2  200  ? 10.059  -41.887 41.698  1.00   115.25 ? 200  LEU C N     1 
ATOM   5162  C  CA    . LEU C 2  200  ? 10.692  -42.696 42.736  1.00   116.78 ? 200  LEU C CA    1 
ATOM   5163  C  C     . LEU C 2  200  ? 10.911  -44.141 42.294  1.00   114.77 ? 200  LEU C C     1 
ATOM   5164  O  O     . LEU C 2  200  ? 11.613  -44.900 42.962  1.00   116.52 ? 200  LEU C O     1 
ATOM   5165  C  CB    . LEU C 2  200  ? 9.873   -42.663 44.030  1.00   117.48 ? 200  LEU C CB    1 
ATOM   5166  C  CG    . LEU C 2  200  ? 10.308  -41.648 45.091  1.00   110.92 ? 200  LEU C CG    1 
ATOM   5167  C  CD1   . LEU C 2  200  ? 11.809  -41.740 45.331  1.00   117.74 ? 200  LEU C CD1   1 
ATOM   5168  C  CD2   . LEU C 2  200  ? 9.908   -40.233 44.711  1.00   100.60 ? 200  LEU C CD2   1 
ATOM   5169  N  N     . GLY C 2  201  ? 10.303  -44.519 41.174  1.00   113.18 ? 201  GLY C N     1 
ATOM   5170  C  CA    . GLY C 2  201  ? 10.500  -45.843 40.615  1.00   115.85 ? 201  GLY C CA    1 
ATOM   5171  C  C     . GLY C 2  201  ? 9.359   -46.808 40.876  1.00   111.19 ? 201  GLY C C     1 
ATOM   5172  O  O     . GLY C 2  201  ? 9.470   -47.999 40.584  1.00   104.69 ? 201  GLY C O     1 
ATOM   5173  N  N     . TYR C 2  202  ? 8.262   -46.299 41.427  1.00   117.50 ? 202  TYR C N     1 
ATOM   5174  C  CA    . TYR C 2  202  ? 7.088   -47.128 41.680  1.00   119.98 ? 202  TYR C CA    1 
ATOM   5175  C  C     . TYR C 2  202  ? 6.336   -47.440 40.396  1.00   116.86 ? 202  TYR C C     1 
ATOM   5176  O  O     . TYR C 2  202  ? 6.292   -46.627 39.472  1.00   112.72 ? 202  TYR C O     1 
ATOM   5177  C  CB    . TYR C 2  202  ? 6.139   -46.457 42.675  1.00   121.28 ? 202  TYR C CB    1 
ATOM   5178  C  CG    . TYR C 2  202  ? 6.619   -46.497 44.104  1.00   112.16 ? 202  TYR C CG    1 
ATOM   5179  C  CD1   . TYR C 2  202  ? 6.722   -47.702 44.785  1.00   115.41 ? 202  TYR C CD1   1 
ATOM   5180  C  CD2   . TYR C 2  202  ? 6.960   -45.332 44.775  1.00   103.16 ? 202  TYR C CD2   1 
ATOM   5181  C  CE1   . TYR C 2  202  ? 7.159   -47.747 46.092  1.00   110.08 ? 202  TYR C CE1   1 
ATOM   5182  C  CE2   . TYR C 2  202  ? 7.397   -45.366 46.082  1.00   101.97 ? 202  TYR C CE2   1 
ATOM   5183  C  CZ    . TYR C 2  202  ? 7.494   -46.576 46.735  1.00   106.23 ? 202  TYR C CZ    1 
ATOM   5184  O  OH    . TYR C 2  202  ? 7.930   -46.617 48.039  1.00   109.23 ? 202  TYR C OH    1 
ATOM   5185  N  N     . ASP C 2  203  ? 5.736   -48.623 40.353  1.00   116.07 ? 203  ASP C N     1 
ATOM   5186  C  CA    . ASP C 2  203  ? 4.933   -49.035 39.213  1.00   121.63 ? 203  ASP C CA    1 
ATOM   5187  C  C     . ASP C 2  203  ? 3.508   -49.286 39.687  1.00   121.63 ? 203  ASP C C     1 
ATOM   5188  O  O     . ASP C 2  203  ? 3.276   -49.493 40.879  1.00   120.49 ? 203  ASP C O     1 
ATOM   5189  C  CB    . ASP C 2  203  ? 5.522   -50.293 38.573  1.00   123.93 ? 203  ASP C CB    1 
ATOM   5190  C  CG    . ASP C 2  203  ? 5.056   -50.493 37.144  1.00   123.96 ? 203  ASP C CG    1 
ATOM   5191  O  OD1   . ASP C 2  203  ? 5.916   -50.713 36.265  1.00   110.86 ? 203  ASP C OD1   1 
ATOM   5192  O  OD2   . ASP C 2  203  ? 3.832   -50.432 36.900  1.00   130.74 ? 203  ASP C OD2   1 
ATOM   5193  N  N     . GLN C 2  204  ? 2.560   -49.257 38.754  1.00   118.61 ? 204  GLN C N     1 
ATOM   5194  C  CA    . GLN C 2  204  ? 1.141   -49.403 39.073  1.00   115.74 ? 204  GLN C CA    1 
ATOM   5195  C  C     . GLN C 2  204  ? 0.851   -50.666 39.883  1.00   119.64 ? 204  GLN C C     1 
ATOM   5196  O  O     . GLN C 2  204  ? -0.024  -50.670 40.751  1.00   117.90 ? 204  GLN C O     1 
ATOM   5197  C  CB    . GLN C 2  204  ? 0.303   -49.386 37.791  1.00   114.73 ? 204  GLN C CB    1 
ATOM   5198  C  CG    . GLN C 2  204  ? -1.198  -49.419 38.028  1.00   115.13 ? 204  GLN C CG    1 
ATOM   5199  C  CD    . GLN C 2  204  ? -1.996  -49.239 36.751  1.00   124.76 ? 204  GLN C CD    1 
ATOM   5200  O  OE1   . GLN C 2  204  ? -1.432  -49.122 35.663  1.00   129.43 ? 204  GLN C OE1   1 
ATOM   5201  N  NE2   . GLN C 2  204  ? -3.318  -49.214 36.879  1.00   116.13 ? 204  GLN C NE2   1 
ATOM   5202  N  N     . GLU C 2  205  ? 1.603   -51.725 39.601  1.00   121.20 ? 205  GLU C N     1 
ATOM   5203  C  CA    . GLU C 2  205  ? 1.455   -52.998 40.297  1.00   122.83 ? 205  GLU C CA    1 
ATOM   5204  C  C     . GLU C 2  205  ? 1.710   -52.842 41.794  1.00   114.21 ? 205  GLU C C     1 
ATOM   5205  O  O     . GLU C 2  205  ? 0.876   -53.220 42.622  1.00   113.39 ? 205  GLU C O     1 
ATOM   5206  C  CB    . GLU C 2  205  ? 2.430   -54.025 39.716  1.00   127.92 ? 205  GLU C CB    1 
ATOM   5207  C  CG    . GLU C 2  205  ? 2.074   -55.473 40.010  1.00   138.21 ? 205  GLU C CG    1 
ATOM   5208  C  CD    . GLU C 2  205  ? 1.156   -56.071 38.960  1.00   139.89 ? 205  GLU C CD    1 
ATOM   5209  O  OE1   . GLU C 2  205  ? 0.852   -55.375 37.968  1.00   132.55 ? 205  GLU C OE1   1 
ATOM   5210  O  OE2   . GLU C 2  205  ? 0.743   -57.239 39.124  1.00   141.99 ? 205  GLU C OE2   1 
ATOM   5211  N  N     . THR C 2  206  ? 2.867   -52.276 42.127  1.00   111.77 ? 206  THR C N     1 
ATOM   5212  C  CA    . THR C 2  206  ? 3.292   -52.125 43.516  1.00   116.36 ? 206  THR C CA    1 
ATOM   5213  C  C     . THR C 2  206  ? 2.346   -51.233 44.318  1.00   115.14 ? 206  THR C C     1 
ATOM   5214  O  O     . THR C 2  206  ? 2.002   -51.549 45.457  1.00   113.10 ? 206  THR C O     1 
ATOM   5215  C  CB    . THR C 2  206  ? 4.729   -51.569 43.608  1.00   114.42 ? 206  THR C CB    1 
ATOM   5216  O  OG1   . THR C 2  206  ? 5.601   -52.353 42.786  1.00   106.71 ? 206  THR C OG1   1 
ATOM   5217  C  CG2   . THR C 2  206  ? 5.228   -51.605 45.047  1.00   103.88 ? 206  THR C CG2   1 
ATOM   5218  N  N     . LEU C 2  207  ? 1.925   -50.122 43.720  1.00   115.64 ? 207  LEU C N     1 
ATOM   5219  C  CA    . LEU C 2  207  ? 0.990   -49.213 44.374  1.00   115.90 ? 207  LEU C CA    1 
ATOM   5220  C  C     . LEU C 2  207  ? -0.376  -49.873 44.554  1.00   114.22 ? 207  LEU C C     1 
ATOM   5221  O  O     . LEU C 2  207  ? -1.057  -49.654 45.562  1.00   109.84 ? 207  LEU C O     1 
ATOM   5222  C  CB    . LEU C 2  207  ? 0.854   -47.909 43.581  1.00   114.55 ? 207  LEU C CB    1 
ATOM   5223  C  CG    . LEU C 2  207  ? 2.119   -47.059 43.427  1.00   110.90 ? 207  LEU C CG    1 
ATOM   5224  C  CD1   . LEU C 2  207  ? 1.819   -45.782 42.656  1.00   104.24 ? 207  LEU C CD1   1 
ATOM   5225  C  CD2   . LEU C 2  207  ? 2.732   -46.737 44.782  1.00   104.70 ? 207  LEU C CD2   1 
ATOM   5226  N  N     . ALA C 2  208  ? -0.764  -50.686 43.575  1.00   118.79 ? 208  ALA C N     1 
ATOM   5227  C  CA    . ALA C 2  208  ? -2.029  -51.411 43.638  1.00   117.06 ? 208  ALA C CA    1 
ATOM   5228  C  C     . ALA C 2  208  ? -2.043  -52.426 44.776  1.00   108.81 ? 208  ALA C C     1 
ATOM   5229  O  O     . ALA C 2  208  ? -3.000  -52.487 45.543  1.00   97.61  ? 208  ALA C O     1 
ATOM   5230  C  CB    . ALA C 2  208  ? -2.325  -52.095 42.311  1.00   113.78 ? 208  ALA C CB    1 
ATOM   5231  N  N     . ARG C 2  209  ? -0.983  -53.222 44.888  1.00   109.78 ? 209  ARG C N     1 
ATOM   5232  C  CA    . ARG C 2  209  ? -0.915  -54.225 45.949  1.00   102.36 ? 209  ARG C CA    1 
ATOM   5233  C  C     . ARG C 2  209  ? -0.698  -53.599 47.326  1.00   107.09 ? 209  ARG C C     1 
ATOM   5234  O  O     . ARG C 2  209  ? -1.172  -54.125 48.335  1.00   111.05 ? 209  ARG C O     1 
ATOM   5235  C  CB    . ARG C 2  209  ? 0.172   -55.267 45.662  1.00   98.33  ? 209  ARG C CB    1 
ATOM   5236  C  CG    . ARG C 2  209  ? 1.547   -54.685 45.399  1.00   105.20 ? 209  ARG C CG    1 
ATOM   5237  C  CD    . ARG C 2  209  ? 2.621   -55.759 45.404  1.00   106.09 ? 209  ARG C CD    1 
ATOM   5238  N  NE    . ARG C 2  209  ? 2.938   -56.203 46.758  1.00   109.98 ? 209  ARG C NE    1 
ATOM   5239  C  CZ    . ARG C 2  209  ? 3.864   -55.641 47.528  1.00   115.73 ? 209  ARG C CZ    1 
ATOM   5240  N  NH1   . ARG C 2  209  ? 4.567   -54.609 47.079  1.00   110.99 ? 209  ARG C NH1   1 
ATOM   5241  N  NH2   . ARG C 2  209  ? 4.088   -56.109 48.749  1.00   125.24 ? 209  ARG C NH2   1 
ATOM   5242  N  N     . GLU C 2  210  ? 0.016   -52.478 47.366  1.00   107.42 ? 210  GLU C N     1 
ATOM   5243  C  CA    . GLU C 2  210  ? 0.310   -51.815 48.632  1.00   105.94 ? 210  GLU C CA    1 
ATOM   5244  C  C     . GLU C 2  210  ? -0.899  -51.091 49.209  1.00   108.83 ? 210  GLU C C     1 
ATOM   5245  O  O     . GLU C 2  210  ? -1.222  -51.246 50.390  1.00   104.86 ? 210  GLU C O     1 
ATOM   5246  C  CB    . GLU C 2  210  ? 1.461   -50.819 48.471  1.00   99.45  ? 210  GLU C CB    1 
ATOM   5247  C  CG    . GLU C 2  210  ? 2.467   -50.871 49.604  1.00   99.96  ? 210  GLU C CG    1 
ATOM   5248  C  CD    . GLU C 2  210  ? 3.254   -52.164 49.604  1.00   101.73 ? 210  GLU C CD    1 
ATOM   5249  O  OE1   . GLU C 2  210  ? 3.749   -52.552 48.525  1.00   102.26 ? 210  GLU C OE1   1 
ATOM   5250  O  OE2   . GLU C 2  210  ? 3.370   -52.798 50.674  1.00   96.77  ? 210  GLU C OE2   1 
ATOM   5251  N  N     . LEU C 2  211  ? -1.559  -50.290 48.380  1.00   112.34 ? 211  LEU C N     1 
ATOM   5252  C  CA    . LEU C 2  211  ? -2.668  -49.463 48.852  1.00   108.60 ? 211  LEU C CA    1 
ATOM   5253  C  C     . LEU C 2  211  ? -4.050  -50.084 48.612  1.00   110.48 ? 211  LEU C C     1 
ATOM   5254  O  O     . LEU C 2  211  ? -5.061  -49.533 49.040  1.00   110.39 ? 211  LEU C O     1 
ATOM   5255  C  CB    . LEU C 2  211  ? -2.600  -48.076 48.194  1.00   103.02 ? 211  LEU C CB    1 
ATOM   5256  C  CG    . LEU C 2  211  ? -1.783  -46.954 48.858  1.00   100.88 ? 211  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C 2  211  ? -0.409  -47.421 49.317  1.00   100.60 ? 211  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C 2  211  ? -1.648  -45.785 47.893  1.00   96.15  ? 211  LEU C CD2   1 
ATOM   5259  N  N     . GLY C 2  212  ? -4.080  -51.243 47.959  1.00   117.03 ? 212  GLY C N     1 
ATOM   5260  C  CA    . GLY C 2  212  ? -5.316  -51.853 47.491  1.00   118.08 ? 212  GLY C CA    1 
ATOM   5261  C  C     . GLY C 2  212  ? -6.473  -52.013 48.463  1.00   115.99 ? 212  GLY C C     1 
ATOM   5262  O  O     . GLY C 2  212  ? -7.629  -51.819 48.083  1.00   113.23 ? 212  GLY C O     1 
ATOM   5263  N  N     . ALA C 2  213  ? -6.174  -52.365 49.711  1.00   114.15 ? 213  ALA C N     1 
ATOM   5264  C  CA    . ALA C 2  213  ? -7.207  -52.618 50.718  1.00   119.47 ? 213  ALA C CA    1 
ATOM   5265  C  C     . ALA C 2  213  ? -8.052  -51.382 51.026  1.00   122.13 ? 213  ALA C C     1 
ATOM   5266  O  O     . ALA C 2  213  ? -9.137  -51.481 51.603  1.00   120.54 ? 213  ALA C O     1 
ATOM   5267  C  CB    . ALA C 2  213  ? -6.576  -53.157 51.994  1.00   118.83 ? 213  ALA C CB    1 
ATOM   5268  N  N     . TYR C 2  214  ? -7.543  -50.221 50.636  1.00   122.41 ? 214  TYR C N     1 
ATOM   5269  C  CA    . TYR C 2  214  ? -8.215  -48.948 50.876  1.00   114.78 ? 214  TYR C CA    1 
ATOM   5270  C  C     . TYR C 2  214  ? -9.445  -48.699 50.001  1.00   115.13 ? 214  TYR C C     1 
ATOM   5271  O  O     . TYR C 2  214  ? -9.669  -49.389 49.005  1.00   112.94 ? 214  TYR C O     1 
ATOM   5272  C  CB    . TYR C 2  214  ? -7.220  -47.785 50.878  1.00   107.58 ? 214  TYR C CB    1 
ATOM   5273  C  CG    . TYR C 2  214  ? -6.206  -47.949 51.986  1.00   105.04 ? 214  TYR C CG    1 
ATOM   5274  C  CD1   . TYR C 2  214  ? -6.611  -47.991 53.313  1.00   96.64  ? 214  TYR C CD1   1 
ATOM   5275  C  CD2   . TYR C 2  214  ? -4.853  -48.098 51.708  1.00   107.84 ? 214  TYR C CD2   1 
ATOM   5276  C  CE1   . TYR C 2  214  ? -5.699  -48.161 54.334  1.00   97.81  ? 214  TYR C CE1   1 
ATOM   5277  C  CE2   . TYR C 2  214  ? -3.930  -48.267 52.725  1.00   103.64 ? 214  TYR C CE2   1 
ATOM   5278  C  CZ    . TYR C 2  214  ? -4.360  -48.297 54.037  1.00   100.58 ? 214  TYR C CZ    1 
ATOM   5279  O  OH    . TYR C 2  214  ? -3.453  -48.464 55.058  1.00   92.39  ? 214  TYR C OH    1 
ATOM   5280  N  N     . GLY C 2  215  ? -10.216 -47.691 50.386  1.00   115.79 ? 215  GLY C N     1 
ATOM   5281  C  CA    . GLY C 2  215  ? -11.611 -47.530 50.020  1.00   121.17 ? 215  GLY C CA    1 
ATOM   5282  C  C     . GLY C 2  215  ? -11.888 -46.930 48.655  1.00   124.39 ? 215  GLY C C     1 
ATOM   5283  O  O     . GLY C 2  215  ? -12.841 -46.161 48.518  1.00   119.98 ? 215  GLY C O     1 
ATOM   5284  N  N     . GLU C 2  216  ? -11.025 -47.247 47.684  1.00   121.59 ? 216  GLU C N     1 
ATOM   5285  C  CA    . GLU C 2  216  ? -11.003 -46.680 46.323  1.00   128.51 ? 216  GLU C CA    1 
ATOM   5286  C  C     . GLU C 2  216  ? -10.091 -45.452 46.254  1.00   136.61 ? 216  GLU C C     1 
ATOM   5287  O  O     . GLU C 2  216  ? -9.790  -44.934 45.175  1.00   136.94 ? 216  GLU C O     1 
ATOM   5288  C  CB    . GLU C 2  216  ? -12.426 -46.453 45.749  1.00   133.88 ? 216  GLU C CB    1 
ATOM   5289  C  CG    . GLU C 2  216  ? -12.663 -45.220 44.870  1.00   143.03 ? 216  GLU C CG    1 
ATOM   5290  C  CD    . GLU C 2  216  ? -13.038 -43.978 45.666  1.00   142.03 ? 216  GLU C CD    1 
ATOM   5291  O  OE1   . GLU C 2  216  ? -12.334 -43.645 46.643  1.00   138.54 ? 216  GLU C OE1   1 
ATOM   5292  O  OE2   . GLU C 2  216  ? -14.048 -43.331 45.315  1.00   137.15 ? 216  GLU C OE2   1 
ATOM   5293  N  N     . LEU C 2  217  ? -9.586  -45.050 47.417  1.00   133.62 ? 217  LEU C N     1 
ATOM   5294  C  CA    . LEU C 2  217  ? -8.599  -43.977 47.520  1.00   124.49 ? 217  LEU C CA    1 
ATOM   5295  C  C     . LEU C 2  217  ? -7.406  -44.218 46.588  1.00   122.23 ? 217  LEU C C     1 
ATOM   5296  O  O     . LEU C 2  217  ? -6.732  -43.278 46.170  1.00   125.64 ? 217  LEU C O     1 
ATOM   5297  C  CB    . LEU C 2  217  ? -8.103  -43.850 48.967  1.00   120.22 ? 217  LEU C CB    1 
ATOM   5298  C  CG    . LEU C 2  217  ? -8.994  -43.204 50.035  1.00   112.63 ? 217  LEU C CG    1 
ATOM   5299  C  CD1   . LEU C 2  217  ? -9.428  -41.809 49.603  1.00   114.34 ? 217  LEU C CD1   1 
ATOM   5300  C  CD2   . LEU C 2  217  ? -10.206 -44.066 50.388  1.00   111.96 ? 217  LEU C CD2   1 
ATOM   5301  N  N     . VAL C 2  218  ? -7.152  -45.486 46.282  1.00   123.57 ? 218  VAL C N     1 
ATOM   5302  C  CA    . VAL C 2  218  ? -6.095  -45.885 45.364  1.00   121.27 ? 218  VAL C CA    1 
ATOM   5303  C  C     . VAL C 2  218  ? -6.297  -45.314 43.968  1.00   120.85 ? 218  VAL C C     1 
ATOM   5304  O  O     . VAL C 2  218  ? -5.360  -44.810 43.352  1.00   122.81 ? 218  VAL C O     1 
ATOM   5305  C  CB    . VAL C 2  218  ? -6.079  -47.418 45.207  1.00   116.74 ? 218  VAL C CB    1 
ATOM   5306  C  CG1   . VAL C 2  218  ? -4.870  -47.870 44.392  1.00   111.73 ? 218  VAL C CG1   1 
ATOM   5307  C  CG2   . VAL C 2  218  ? -6.112  -48.092 46.567  1.00   112.79 ? 218  VAL C CG2   1 
ATOM   5308  N  N     . GLN C 2  219  ? -7.524  -45.417 43.467  1.00   124.30 ? 219  GLN C N     1 
ATOM   5309  C  CA    . GLN C 2  219  ? -7.839  -45.036 42.090  1.00   134.56 ? 219  GLN C CA    1 
ATOM   5310  C  C     . GLN C 2  219  ? -7.555  -43.565 41.776  1.00   135.83 ? 219  GLN C C     1 
ATOM   5311  O  O     . GLN C 2  219  ? -7.315  -43.201 40.623  1.00   136.51 ? 219  GLN C O     1 
ATOM   5312  C  CB    . GLN C 2  219  ? -9.289  -45.388 41.756  1.00   137.16 ? 219  GLN C CB    1 
ATOM   5313  C  CG    . GLN C 2  219  ? -9.550  -46.883 41.709  1.00   141.56 ? 219  GLN C CG    1 
ATOM   5314  C  CD    . GLN C 2  219  ? -10.979 -47.215 41.345  1.00   142.96 ? 219  GLN C CD    1 
ATOM   5315  O  OE1   . GLN C 2  219  ? -11.879 -46.393 41.510  1.00   137.49 ? 219  GLN C OE1   1 
ATOM   5316  N  NE2   . GLN C 2  219  ? -11.195 -48.425 40.840  1.00   144.99 ? 219  GLN C NE2   1 
ATOM   5317  N  N     . GLY C 2  220  ? -7.577  -42.728 42.808  1.00   129.71 ? 220  GLY C N     1 
ATOM   5318  C  CA    . GLY C 2  220  ? -7.228  -41.326 42.659  1.00   117.26 ? 220  GLY C CA    1 
ATOM   5319  C  C     . GLY C 2  220  ? -5.751  -41.162 42.356  1.00   119.95 ? 220  GLY C C     1 
ATOM   5320  O  O     . GLY C 2  220  ? -5.320  -40.149 41.804  1.00   115.46 ? 220  GLY C O     1 
ATOM   5321  N  N     . LEU C 2  221  ? -4.976  -42.177 42.725  1.00   123.03 ? 221  LEU C N     1 
ATOM   5322  C  CA    . LEU C 2  221  ? -3.543  -42.206 42.474  1.00   118.50 ? 221  LEU C CA    1 
ATOM   5323  C  C     . LEU C 2  221  ? -3.264  -42.921 41.151  1.00   121.57 ? 221  LEU C C     1 
ATOM   5324  O  O     . LEU C 2  221  ? -2.120  -43.010 40.707  1.00   121.73 ? 221  LEU C O     1 
ATOM   5325  C  CB    . LEU C 2  221  ? -2.835  -42.914 43.635  1.00   112.08 ? 221  LEU C CB    1 
ATOM   5326  C  CG    . LEU C 2  221  ? -1.309  -43.021 43.664  1.00   120.73 ? 221  LEU C CG    1 
ATOM   5327  C  CD1   . LEU C 2  221  ? -0.667  -41.654 43.818  1.00   116.04 ? 221  LEU C CD1   1 
ATOM   5328  C  CD2   . LEU C 2  221  ? -0.861  -43.961 44.771  1.00   116.01 ? 221  LEU C CD2   1 
ATOM   5329  N  N     . MET C 2  222  ? -4.320  -43.417 40.512  1.00   120.56 ? 222  MET C N     1 
ATOM   5330  C  CA    . MET C 2  222  ? -4.170  -44.161 39.265  1.00   120.65 ? 222  MET C CA    1 
ATOM   5331  C  C     . MET C 2  222  ? -4.304  -43.269 38.035  1.00   120.41 ? 222  MET C C     1 
ATOM   5332  O  O     . MET C 2  222  ? -5.383  -42.752 37.740  1.00   112.05 ? 222  MET C O     1 
ATOM   5333  C  CB    . MET C 2  222  ? -5.185  -45.306 39.194  1.00   116.60 ? 222  MET C CB    1 
ATOM   5334  C  CG    . MET C 2  222  ? -4.908  -46.444 40.163  1.00   119.53 ? 222  MET C CG    1 
ATOM   5335  S  SD    . MET C 2  222  ? -3.303  -47.214 39.879  1.00   136.17 ? 222  MET C SD    1 
ATOM   5336  C  CE    . MET C 2  222  ? -3.315  -48.512 41.113  1.00   110.64 ? 222  MET C CE    1 
ATOM   5337  N  N     . ASP C 2  223  ? -3.197  -43.098 37.319  1.00   122.88 ? 223  ASP C N     1 
ATOM   5338  C  CA    . ASP C 2  223  ? -3.188  -42.330 36.080  1.00   123.43 ? 223  ASP C CA    1 
ATOM   5339  C  C     . ASP C 2  223  ? -2.384  -43.068 35.011  1.00   123.78 ? 223  ASP C C     1 
ATOM   5340  O  O     . ASP C 2  223  ? -1.205  -43.364 35.203  1.00   117.79 ? 223  ASP C O     1 
ATOM   5341  C  CB    . ASP C 2  223  ? -2.613  -40.933 36.317  1.00   120.73 ? 223  ASP C CB    1 
ATOM   5342  C  CG    . ASP C 2  223  ? -2.936  -39.972 35.190  1.00   119.61 ? 223  ASP C CG    1 
ATOM   5343  O  OD1   . ASP C 2  223  ? -2.147  -39.896 34.225  1.00   121.10 ? 223  ASP C OD1   1 
ATOM   5344  O  OD2   . ASP C 2  223  ? -3.981  -39.291 35.270  1.00   112.38 ? 223  ASP C OD2   1 
ATOM   5345  N  N     . GLU C 2  224  ? -3.031  -43.361 33.888  1.00   127.25 ? 224  GLU C N     1 
ATOM   5346  C  CA    . GLU C 2  224  ? -2.421  -44.159 32.827  1.00   131.95 ? 224  GLU C CA    1 
ATOM   5347  C  C     . GLU C 2  224  ? -1.271  -43.449 32.111  1.00   128.81 ? 224  GLU C C     1 
ATOM   5348  O  O     . GLU C 2  224  ? -0.285  -44.082 31.732  1.00   126.67 ? 224  GLU C O     1 
ATOM   5349  C  CB    . GLU C 2  224  ? -3.479  -44.613 31.811  1.00   133.65 ? 224  GLU C CB    1 
ATOM   5350  C  CG    . GLU C 2  224  ? -4.278  -43.485 31.167  1.00   133.90 ? 224  GLU C CG    1 
ATOM   5351  C  CD    . GLU C 2  224  ? -5.371  -42.944 32.071  1.00   136.13 ? 224  GLU C CD    1 
ATOM   5352  O  OE1   . GLU C 2  224  ? -6.406  -43.625 32.229  1.00   141.77 ? 224  GLU C OE1   1 
ATOM   5353  O  OE2   . GLU C 2  224  ? -5.191  -41.841 32.629  1.00   129.82 ? 224  GLU C OE2   1 
ATOM   5354  N  N     . SER C 2  225  ? -1.398  -42.138 31.928  1.00   126.48 ? 225  SER C N     1 
ATOM   5355  C  CA    . SER C 2  225  ? -0.380  -41.362 31.226  1.00   125.47 ? 225  SER C CA    1 
ATOM   5356  C  C     . SER C 2  225  ? 0.927   -41.290 32.014  1.00   127.95 ? 225  SER C C     1 
ATOM   5357  O  O     . SER C 2  225  ? 1.999   -41.091 31.441  1.00   125.78 ? 225  SER C O     1 
ATOM   5358  C  CB    . SER C 2  225  ? -0.895  -39.954 30.916  1.00   121.32 ? 225  SER C CB    1 
ATOM   5359  O  OG    . SER C 2  225  ? -1.346  -39.299 32.089  1.00   110.56 ? 225  SER C OG    1 
ATOM   5360  N  N     . VAL C 2  226  ? 0.829   -41.454 33.330  1.00   129.91 ? 226  VAL C N     1 
ATOM   5361  C  CA    . VAL C 2  226  ? 1.999   -41.405 34.199  1.00   127.36 ? 226  VAL C CA    1 
ATOM   5362  C  C     . VAL C 2  226  ? 2.787   -42.714 34.164  1.00   128.92 ? 226  VAL C C     1 
ATOM   5363  O  O     . VAL C 2  226  ? 4.017   -42.706 34.097  1.00   128.59 ? 226  VAL C O     1 
ATOM   5364  C  CB    . VAL C 2  226  ? 1.601   -41.079 35.654  1.00   123.75 ? 226  VAL C CB    1 
ATOM   5365  C  CG1   . VAL C 2  226  ? 2.828   -41.046 36.549  1.00   121.36 ? 226  VAL C CG1   1 
ATOM   5366  C  CG2   . VAL C 2  226  ? 0.858   -39.753 35.714  1.00   111.59 ? 226  VAL C CG2   1 
ATOM   5367  N  N     . PHE C 2  227  ? 2.076   -43.837 34.201  1.00   131.83 ? 227  PHE C N     1 
ATOM   5368  C  CA    . PHE C 2  227  ? 2.720   -45.148 34.183  1.00   134.43 ? 227  PHE C CA    1 
ATOM   5369  C  C     . PHE C 2  227  ? 3.185   -45.534 32.783  1.00   130.72 ? 227  PHE C C     1 
ATOM   5370  O  O     . PHE C 2  227  ? 3.948   -46.485 32.612  1.00   124.08 ? 227  PHE C O     1 
ATOM   5371  C  CB    . PHE C 2  227  ? 1.786   -46.224 34.745  1.00   133.63 ? 227  PHE C CB    1 
ATOM   5372  C  CG    . PHE C 2  227  ? 1.485   -46.063 36.207  1.00   133.56 ? 227  PHE C CG    1 
ATOM   5373  C  CD1   . PHE C 2  227  ? 2.481   -46.233 37.155  1.00   129.13 ? 227  PHE C CD1   1 
ATOM   5374  C  CD2   . PHE C 2  227  ? 0.206   -45.752 36.636  1.00   127.68 ? 227  PHE C CD2   1 
ATOM   5375  C  CE1   . PHE C 2  227  ? 2.210   -46.086 38.501  1.00   123.27 ? 227  PHE C CE1   1 
ATOM   5376  C  CE2   . PHE C 2  227  ? -0.073  -45.605 37.982  1.00   124.58 ? 227  PHE C CE2   1 
ATOM   5377  C  CZ    . PHE C 2  227  ? 0.930   -45.774 38.915  1.00   126.83 ? 227  PHE C CZ    1 
ATOM   5378  N  N     . ALA C 2  228  ? 2.723   -44.787 31.784  1.00   132.03 ? 228  ALA C N     1 
ATOM   5379  C  CA    . ALA C 2  228  ? 3.090   -45.049 30.398  1.00   131.49 ? 228  ALA C CA    1 
ATOM   5380  C  C     . ALA C 2  228  ? 4.518   -44.598 30.105  1.00   130.81 ? 228  ALA C C     1 
ATOM   5381  O  O     . ALA C 2  228  ? 5.084   -44.939 29.067  1.00   128.33 ? 228  ALA C O     1 
ATOM   5382  C  CB    . ALA C 2  228  ? 2.113   -44.365 29.452  1.00   123.99 ? 228  ALA C CB    1 
ATOM   5383  N  N     . MET C 2  229  ? 5.095   -43.833 31.027  1.00   134.25 ? 229  MET C N     1 
ATOM   5384  C  CA    . MET C 2  229  ? 6.442   -43.303 30.844  1.00   137.53 ? 229  MET C CA    1 
ATOM   5385  C  C     . MET C 2  229  ? 7.405   -43.743 31.946  1.00   134.54 ? 229  MET C C     1 
ATOM   5386  O  O     . MET C 2  229  ? 7.019   -43.891 33.106  1.00   131.83 ? 229  MET C O     1 
ATOM   5387  C  CB    . MET C 2  229  ? 6.407   -41.775 30.744  1.00   133.62 ? 229  MET C CB    1 
ATOM   5388  C  CG    . MET C 2  229  ? 5.686   -41.086 31.891  1.00   125.31 ? 229  MET C CG    1 
ATOM   5389  S  SD    . MET C 2  229  ? 5.551   -39.305 31.649  1.00   131.78 ? 229  MET C SD    1 
ATOM   5390  C  CE    . MET C 2  229  ? 4.615   -38.831 33.100  1.00   121.10 ? 229  MET C CE    1 
ATOM   5391  N  N     . ARG C 2  230  ? 8.662   -43.950 31.565  1.00   131.73 ? 230  ARG C N     1 
ATOM   5392  C  CA    . ARG C 2  230  ? 9.714   -44.343 32.497  1.00   128.01 ? 230  ARG C CA    1 
ATOM   5393  C  C     . ARG C 2  230  ? 10.014  -43.213 33.486  1.00   129.54 ? 230  ARG C C     1 
ATOM   5394  O  O     . ARG C 2  230  ? 9.645   -42.064 33.239  1.00   127.55 ? 230  ARG C O     1 
ATOM   5395  C  CB    . ARG C 2  230  ? 10.978  -44.735 31.723  1.00   127.45 ? 230  ARG C CB    1 
ATOM   5396  C  CG    . ARG C 2  230  ? 10.900  -44.491 30.227  1.00   124.08 ? 230  ARG C CG    1 
ATOM   5397  C  CD    . ARG C 2  230  ? 12.183  -44.920 29.537  1.00   113.58 ? 230  ARG C CD    1 
ATOM   5398  N  NE    . ARG C 2  230  ? 12.112  -44.741 28.091  1.00   118.38 ? 230  ARG C NE    1 
ATOM   5399  C  CZ    . ARG C 2  230  ? 12.403  -43.605 27.465  1.00   127.85 ? 230  ARG C CZ    1 
ATOM   5400  N  NH1   . ARG C 2  230  ? 12.311  -43.531 26.144  1.00   124.59 ? 230  ARG C NH1   1 
ATOM   5401  N  NH2   . ARG C 2  230  ? 12.784  -42.542 28.160  1.00   128.13 ? 230  ARG C NH2   1 
ATOM   5402  N  N     . PRO C 2  231  ? 10.671  -43.540 34.617  1.00   129.12 ? 231  PRO C N     1 
ATOM   5403  C  CA    . PRO C 2  231  ? 11.045  -42.545 35.631  1.00   127.01 ? 231  PRO C CA    1 
ATOM   5404  C  C     . PRO C 2  231  ? 11.748  -41.300 35.082  1.00   125.12 ? 231  PRO C C     1 
ATOM   5405  O  O     . PRO C 2  231  ? 11.592  -40.227 35.659  1.00   120.57 ? 231  PRO C O     1 
ATOM   5406  C  CB    . PRO C 2  231  ? 11.996  -43.328 36.536  1.00   123.53 ? 231  PRO C CB    1 
ATOM   5407  C  CG    . PRO C 2  231  ? 11.472  -44.713 36.485  1.00   116.84 ? 231  PRO C CG    1 
ATOM   5408  C  CD    . PRO C 2  231  ? 10.946  -44.913 35.084  1.00   119.66 ? 231  PRO C CD    1 
ATOM   5409  N  N     . GLU C 2  232  ? 12.507  -41.441 33.999  1.00   130.37 ? 232  GLU C N     1 
ATOM   5410  C  CA    . GLU C 2  232  ? 13.209  -40.304 33.405  1.00   132.30 ? 232  GLU C CA    1 
ATOM   5411  C  C     . GLU C 2  232  ? 12.245  -39.270 32.820  1.00   131.89 ? 232  GLU C C     1 
ATOM   5412  O  O     . GLU C 2  232  ? 12.347  -38.074 33.113  1.00   137.15 ? 232  GLU C O     1 
ATOM   5413  C  CB    . GLU C 2  232  ? 14.198  -40.772 32.330  1.00   136.30 ? 232  GLU C CB    1 
ATOM   5414  C  CG    . GLU C 2  232  ? 15.508  -41.334 32.873  1.00   136.42 ? 232  GLU C CG    1 
ATOM   5415  C  CD    . GLU C 2  232  ? 15.346  -42.691 33.532  1.00   139.89 ? 232  GLU C CD    1 
ATOM   5416  O  OE1   . GLU C 2  232  ? 14.359  -43.392 33.224  1.00   140.50 ? 232  GLU C OE1   1 
ATOM   5417  O  OE2   . GLU C 2  232  ? 16.208  -43.058 34.359  1.00   131.36 ? 232  GLU C OE2   1 
ATOM   5418  N  N     . GLU C 2  233  ? 11.315  -39.738 31.993  1.00   131.49 ? 233  GLU C N     1 
ATOM   5419  C  CA    . GLU C 2  233  ? 10.324  -38.863 31.372  1.00   131.96 ? 233  GLU C CA    1 
ATOM   5420  C  C     . GLU C 2  233  ? 9.447   -38.190 32.426  1.00   130.81 ? 233  GLU C C     1 
ATOM   5421  O  O     . GLU C 2  233  ? 9.119   -37.007 32.314  1.00   129.14 ? 233  GLU C O     1 
ATOM   5422  C  CB    . GLU C 2  233  ? 9.456   -39.648 30.383  1.00   135.48 ? 233  GLU C CB    1 
ATOM   5423  C  CG    . GLU C 2  233  ? 10.240  -40.347 29.280  1.00   135.22 ? 233  GLU C CG    1 
ATOM   5424  C  CD    . GLU C 2  233  ? 9.342   -41.017 28.255  1.00   125.74 ? 233  GLU C CD    1 
ATOM   5425  O  OE1   . GLU C 2  233  ? 8.138   -40.689 28.210  1.00   124.52 ? 233  GLU C OE1   1 
ATOM   5426  O  OE2   . GLU C 2  233  ? 9.839   -41.873 27.494  1.00   116.06 ? 233  GLU C OE2   1 
ATOM   5427  N  N     . ALA C 2  234  ? 9.076   -38.952 33.450  1.00   128.00 ? 234  ALA C N     1 
ATOM   5428  C  CA    . ALA C 2  234  ? 8.287   -38.426 34.557  1.00   121.69 ? 234  ALA C CA    1 
ATOM   5429  C  C     . ALA C 2  234  ? 9.081   -37.375 35.324  1.00   120.49 ? 234  ALA C C     1 
ATOM   5430  O  O     . ALA C 2  234  ? 8.527   -36.381 35.795  1.00   114.52 ? 234  ALA C O     1 
ATOM   5431  C  CB    . ALA C 2  234  ? 7.864   -39.554 35.484  1.00   114.32 ? 234  ALA C CB    1 
ATOM   5432  N  N     . LEU C 2  235  ? 10.385  -37.606 35.441  1.00   122.85 ? 235  LEU C N     1 
ATOM   5433  C  CA    . LEU C 2  235  ? 11.286  -36.686 36.124  1.00   118.39 ? 235  LEU C CA    1 
ATOM   5434  C  C     . LEU C 2  235  ? 11.357  -35.351 35.393  1.00   119.96 ? 235  LEU C C     1 
ATOM   5435  O  O     . LEU C 2  235  ? 11.211  -34.288 36.005  1.00   116.17 ? 235  LEU C O     1 
ATOM   5436  C  CB    . LEU C 2  235  ? 12.682  -37.303 36.232  1.00   120.22 ? 235  LEU C CB    1 
ATOM   5437  C  CG    . LEU C 2  235  ? 13.788  -36.479 36.890  1.00   120.35 ? 235  LEU C CG    1 
ATOM   5438  C  CD1   . LEU C 2  235  ? 13.397  -36.108 38.305  1.00   125.00 ? 235  LEU C CD1   1 
ATOM   5439  C  CD2   . LEU C 2  235  ? 15.094  -37.254 36.881  1.00   110.21 ? 235  LEU C CD2   1 
ATOM   5440  N  N     . ILE C 2  236  ? 11.579  -35.412 34.083  1.00   131.38 ? 236  ILE C N     1 
ATOM   5441  C  CA    . ILE C 2  236  ? 11.623  -34.206 33.259  1.00   132.62 ? 236  ILE C CA    1 
ATOM   5442  C  C     . ILE C 2  236  ? 10.272  -33.486 33.284  1.00   123.53 ? 236  ILE C C     1 
ATOM   5443  O  O     . ILE C 2  236  ? 10.214  -32.254 33.312  1.00   113.74 ? 236  ILE C O     1 
ATOM   5444  C  CB    . ILE C 2  236  ? 12.051  -34.521 31.804  1.00   128.13 ? 236  ILE C CB    1 
ATOM   5445  C  CG1   . ILE C 2  236  ? 13.469  -35.100 31.782  1.00   110.94 ? 236  ILE C CG1   1 
ATOM   5446  C  CG2   . ILE C 2  236  ? 11.982  -33.275 30.935  1.00   120.47 ? 236  ILE C CG2   1 
ATOM   5447  C  CD1   . ILE C 2  236  ? 14.015  -35.341 30.391  1.00   100.02 ? 236  ILE C CD1   1 
ATOM   5448  N  N     . ARG C 2  237  ? 9.193   -34.264 33.294  1.00   121.39 ? 237  ARG C N     1 
ATOM   5449  C  CA    . ARG C 2  237  ? 7.844   -33.718 33.415  1.00   118.95 ? 237  ARG C CA    1 
ATOM   5450  C  C     . ARG C 2  237  ? 7.689   -32.921 34.708  1.00   123.44 ? 237  ARG C C     1 
ATOM   5451  O  O     . ARG C 2  237  ? 7.167   -31.799 34.708  1.00   128.62 ? 237  ARG C O     1 
ATOM   5452  C  CB    . ARG C 2  237  ? 6.813   -34.847 33.371  1.00   117.09 ? 237  ARG C CB    1 
ATOM   5453  C  CG    . ARG C 2  237  ? 5.390   -34.408 33.677  1.00   122.98 ? 237  ARG C CG    1 
ATOM   5454  C  CD    . ARG C 2  237  ? 4.896   -33.377 32.677  1.00   125.35 ? 237  ARG C CD    1 
ATOM   5455  N  NE    . ARG C 2  237  ? 3.518   -32.978 32.944  1.00   120.43 ? 237  ARG C NE    1 
ATOM   5456  C  CZ    . ARG C 2  237  ? 2.844   -32.088 32.223  1.00   118.44 ? 237  ARG C CZ    1 
ATOM   5457  N  NH1   . ARG C 2  237  ? 1.592   -31.787 32.540  1.00   125.42 ? 237  ARG C NH1   1 
ATOM   5458  N  NH2   . ARG C 2  237  ? 3.421   -31.499 31.185  1.00   106.19 ? 237  ARG C NH2   1 
ATOM   5459  N  N     . LEU C 2  238  ? 8.153   -33.507 35.806  1.00   121.78 ? 238  LEU C N     1 
ATOM   5460  C  CA    . LEU C 2  238  ? 8.085   -32.861 37.111  1.00   125.60 ? 238  LEU C CA    1 
ATOM   5461  C  C     . LEU C 2  238  ? 8.933   -31.594 37.153  1.00   129.99 ? 238  LEU C C     1 
ATOM   5462  O  O     . LEU C 2  238  ? 8.536   -30.596 37.757  1.00   122.17 ? 238  LEU C O     1 
ATOM   5463  C  CB    . LEU C 2  238  ? 8.518   -33.829 38.214  1.00   128.01 ? 238  LEU C CB    1 
ATOM   5464  C  CG    . LEU C 2  238  ? 8.471   -33.285 39.643  1.00   126.71 ? 238  LEU C CG    1 
ATOM   5465  C  CD1   . LEU C 2  238  ? 7.108   -32.678 39.939  1.00   113.01 ? 238  LEU C CD1   1 
ATOM   5466  C  CD2   . LEU C 2  238  ? 8.803   -34.379 40.646  1.00   115.42 ? 238  LEU C CD2   1 
ATOM   5467  N  N     . PHE C 2  239  ? 10.099  -31.634 36.513  1.00   133.21 ? 239  PHE C N     1 
ATOM   5468  C  CA    . PHE C 2  239  ? 10.959  -30.456 36.449  1.00   119.60 ? 239  PHE C CA    1 
ATOM   5469  C  C     . PHE C 2  239  ? 10.300  -29.341 35.643  1.00   122.56 ? 239  PHE C C     1 
ATOM   5470  O  O     . PHE C 2  239  ? 10.439  -28.164 35.973  1.00   120.90 ? 239  PHE C O     1 
ATOM   5471  C  CB    . PHE C 2  239  ? 12.329  -30.800 35.861  1.00   108.13 ? 239  PHE C CB    1 
ATOM   5472  C  CG    . PHE C 2  239  ? 13.292  -29.643 35.855  1.00   111.79 ? 239  PHE C CG    1 
ATOM   5473  C  CD1   . PHE C 2  239  ? 13.482  -28.886 34.711  1.00   121.46 ? 239  PHE C CD1   1 
ATOM   5474  C  CD2   . PHE C 2  239  ? 14.000  -29.309 36.997  1.00   111.22 ? 239  PHE C CD2   1 
ATOM   5475  C  CE1   . PHE C 2  239  ? 14.365  -27.821 34.705  1.00   121.78 ? 239  PHE C CE1   1 
ATOM   5476  C  CE2   . PHE C 2  239  ? 14.884  -28.246 36.997  1.00   111.90 ? 239  PHE C CE2   1 
ATOM   5477  C  CZ    . PHE C 2  239  ? 15.066  -27.501 35.850  1.00   112.87 ? 239  PHE C CZ    1 
ATOM   5478  N  N     . THR C 2  240  ? 9.581   -29.713 34.587  1.00   129.46 ? 240  THR C N     1 
ATOM   5479  C  CA    . THR C 2  240  ? 8.843   -28.736 33.792  1.00   130.02 ? 240  THR C CA    1 
ATOM   5480  C  C     . THR C 2  240  ? 7.677   -28.157 34.587  1.00   126.45 ? 240  THR C C     1 
ATOM   5481  O  O     . THR C 2  240  ? 7.292   -27.004 34.389  1.00   117.15 ? 240  THR C O     1 
ATOM   5482  C  CB    . THR C 2  240  ? 8.308   -29.338 32.476  1.00   129.69 ? 240  THR C CB    1 
ATOM   5483  O  OG1   . THR C 2  240  ? 7.521   -30.501 32.760  1.00   129.57 ? 240  THR C OG1   1 
ATOM   5484  C  CG2   . THR C 2  240  ? 9.455   -29.716 31.553  1.00   120.26 ? 240  THR C CG2   1 
ATOM   5485  N  N     . LEU C 2  241  ? 7.116   -28.962 35.485  1.00   129.04 ? 241  LEU C N     1 
ATOM   5486  C  CA    . LEU C 2  241  ? 6.024   -28.497 36.337  1.00   124.48 ? 241  LEU C CA    1 
ATOM   5487  C  C     . LEU C 2  241  ? 6.499   -27.548 37.437  1.00   125.07 ? 241  LEU C C     1 
ATOM   5488  O  O     . LEU C 2  241  ? 5.822   -26.569 37.756  1.00   116.54 ? 241  LEU C O     1 
ATOM   5489  C  CB    . LEU C 2  241  ? 5.273   -29.680 36.953  1.00   116.14 ? 241  LEU C CB    1 
ATOM   5490  C  CG    . LEU C 2  241  ? 4.362   -30.463 36.007  1.00   117.90 ? 241  LEU C CG    1 
ATOM   5491  C  CD1   . LEU C 2  241  ? 3.624   -31.554 36.762  1.00   122.06 ? 241  LEU C CD1   1 
ATOM   5492  C  CD2   . LEU C 2  241  ? 3.381   -29.528 35.318  1.00   118.02 ? 241  LEU C CD2   1 
ATOM   5493  N  N     . LEU C 2  242  ? 7.657   -27.846 38.020  1.00   130.21 ? 242  LEU C N     1 
ATOM   5494  C  CA    . LEU C 2  242  ? 8.184   -27.050 39.126  1.00   132.72 ? 242  LEU C CA    1 
ATOM   5495  C  C     . LEU C 2  242  ? 9.086   -25.896 38.683  1.00   129.17 ? 242  LEU C C     1 
ATOM   5496  O  O     . LEU C 2  242  ? 9.415   -25.019 39.484  1.00   125.08 ? 242  LEU C O     1 
ATOM   5497  C  CB    . LEU C 2  242  ? 8.940   -27.945 40.112  1.00   126.78 ? 242  LEU C CB    1 
ATOM   5498  C  CG    . LEU C 2  242  ? 8.163   -29.111 40.726  1.00   118.05 ? 242  LEU C CG    1 
ATOM   5499  C  CD1   . LEU C 2  242  ? 9.074   -29.944 41.614  1.00   111.14 ? 242  LEU C CD1   1 
ATOM   5500  C  CD2   . LEU C 2  242  ? 6.957   -28.610 41.507  1.00   107.13 ? 242  LEU C CD2   1 
ATOM   5501  N  N     . ARG C 2  243  ? 9.485   -25.893 37.414  1.00   128.95 ? 243  ARG C N     1 
ATOM   5502  C  CA    . ARG C 2  243  ? 10.403  -24.871 36.911  1.00   125.49 ? 243  ARG C CA    1 
ATOM   5503  C  C     . ARG C 2  243  ? 9.993   -24.335 35.540  1.00   126.72 ? 243  ARG C C     1 
ATOM   5504  O  O     . ARG C 2  243  ? 10.617  -24.669 34.532  1.00   124.24 ? 243  ARG C O     1 
ATOM   5505  C  CB    . ARG C 2  243  ? 11.830  -25.428 36.834  1.00   119.07 ? 243  ARG C CB    1 
ATOM   5506  C  CG    . ARG C 2  243  ? 12.397  -25.916 38.160  1.00   115.21 ? 243  ARG C CG    1 
ATOM   5507  C  CD    . ARG C 2  243  ? 12.868  -24.762 39.025  1.00   114.14 ? 243  ARG C CD    1 
ATOM   5508  N  NE    . ARG C 2  243  ? 13.982  -24.049 38.408  1.00   115.75 ? 243  ARG C NE    1 
ATOM   5509  C  CZ    . ARG C 2  243  ? 14.676  -23.086 39.003  1.00   111.36 ? 243  ARG C CZ    1 
ATOM   5510  N  NH1   . ARG C 2  243  ? 15.674  -22.495 38.362  1.00   110.44 ? 243  ARG C NH1   1 
ATOM   5511  N  NH2   . ARG C 2  243  ? 14.375  -22.714 40.240  1.00   112.75 ? 243  ARG C NH2   1 
ATOM   5512  N  N     . PRO C 2  244  ? 8.940   -23.500 35.497  1.00   125.27 ? 244  PRO C N     1 
ATOM   5513  C  CA    . PRO C 2  244  ? 8.498   -22.891 34.237  1.00   118.36 ? 244  PRO C CA    1 
ATOM   5514  C  C     . PRO C 2  244  ? 9.561   -21.968 33.646  1.00   113.49 ? 244  PRO C C     1 
ATOM   5515  O  O     . PRO C 2  244  ? 10.103  -21.121 34.356  1.00   107.80 ? 244  PRO C O     1 
ATOM   5516  C  CB    . PRO C 2  244  ? 7.270   -22.072 34.656  1.00   109.16 ? 244  PRO C CB    1 
ATOM   5517  C  CG    . PRO C 2  244  ? 6.819   -22.679 35.942  1.00   107.69 ? 244  PRO C CG    1 
ATOM   5518  C  CD    . PRO C 2  244  ? 8.074   -23.117 36.624  1.00   116.22 ? 244  PRO C CD    1 
ATOM   5519  N  N     . GLY C 2  245  ? 9.851   -22.136 32.360  1.00   115.79 ? 245  GLY C N     1 
ATOM   5520  C  CA    . GLY C 2  245  ? 10.813  -21.291 31.676  1.00   121.18 ? 245  GLY C CA    1 
ATOM   5521  C  C     . GLY C 2  245  ? 12.235  -21.814 31.737  1.00   120.66 ? 245  GLY C C     1 
ATOM   5522  O  O     . GLY C 2  245  ? 13.072  -21.457 30.909  1.00   119.16 ? 245  GLY C O     1 
ATOM   5523  N  N     . ASP C 2  246  ? 12.510  -22.664 32.721  1.00   117.60 ? 246  ASP C N     1 
ATOM   5524  C  CA    . ASP C 2  246  ? 13.834  -23.254 32.880  1.00   117.33 ? 246  ASP C CA    1 
ATOM   5525  C  C     . ASP C 2  246  ? 13.952  -24.475 31.972  1.00   119.50 ? 246  ASP C C     1 
ATOM   5526  O  O     . ASP C 2  246  ? 13.097  -25.361 32.014  1.00   111.99 ? 246  ASP C O     1 
ATOM   5527  C  CB    . ASP C 2  246  ? 14.061  -23.647 34.344  1.00   121.46 ? 246  ASP C CB    1 
ATOM   5528  C  CG    . ASP C 2  246  ? 15.529  -23.861 34.678  1.00   124.94 ? 246  ASP C CG    1 
ATOM   5529  O  OD1   . ASP C 2  246  ? 16.213  -24.615 33.955  1.00   128.65 ? 246  ASP C OD1   1 
ATOM   5530  O  OD2   . ASP C 2  246  ? 16.001  -23.271 35.673  1.00   118.41 ? 246  ASP C OD2   1 
ATOM   5531  N  N     . PRO C 2  247  ? 15.006  -24.516 31.137  1.00   124.29 ? 247  PRO C N     1 
ATOM   5532  C  CA    . PRO C 2  247  ? 15.217  -25.632 30.206  1.00   127.02 ? 247  PRO C CA    1 
ATOM   5533  C  C     . PRO C 2  247  ? 15.261  -26.985 30.915  1.00   121.12 ? 247  PRO C C     1 
ATOM   5534  O  O     . PRO C 2  247  ? 16.015  -27.152 31.875  1.00   113.49 ? 247  PRO C O     1 
ATOM   5535  C  CB    . PRO C 2  247  ? 16.578  -25.310 29.568  1.00   118.54 ? 247  PRO C CB    1 
ATOM   5536  C  CG    . PRO C 2  247  ? 17.200  -24.269 30.451  1.00   107.95 ? 247  PRO C CG    1 
ATOM   5537  C  CD    . PRO C 2  247  ? 16.055  -23.492 31.010  1.00   114.08 ? 247  PRO C CD    1 
ATOM   5538  N  N     . PRO C 2  248  ? 14.459  -27.946 30.433  1.00   119.20 ? 248  PRO C N     1 
ATOM   5539  C  CA    . PRO C 2  248  ? 14.290  -29.266 31.048  1.00   112.57 ? 248  PRO C CA    1 
ATOM   5540  C  C     . PRO C 2  248  ? 15.428  -30.227 30.724  1.00   113.76 ? 248  PRO C C     1 
ATOM   5541  O  O     . PRO C 2  248  ? 15.171  -31.322 30.222  1.00   109.84 ? 248  PRO C O     1 
ATOM   5542  C  CB    . PRO C 2  248  ? 12.988  -29.784 30.419  1.00   114.84 ? 248  PRO C CB    1 
ATOM   5543  C  CG    . PRO C 2  248  ? 12.373  -28.601 29.714  1.00   111.29 ? 248  PRO C CG    1 
ATOM   5544  C  CD    . PRO C 2  248  ? 13.522  -27.747 29.317  1.00   117.70 ? 248  PRO C CD    1 
ATOM   5545  N  N     . LYS C 2  249  ? 16.664  -29.828 31.006  1.00   117.76 ? 249  LYS C N     1 
ATOM   5546  C  CA    . LYS C 2  249  ? 17.807  -30.706 30.787  1.00   119.32 ? 249  LYS C CA    1 
ATOM   5547  C  C     . LYS C 2  249  ? 17.767  -31.846 31.799  1.00   118.58 ? 249  LYS C C     1 
ATOM   5548  O  O     . LYS C 2  249  ? 17.268  -31.677 32.911  1.00   121.02 ? 249  LYS C O     1 
ATOM   5549  C  CB    . LYS C 2  249  ? 19.120  -29.927 30.898  1.00   116.94 ? 249  LYS C CB    1 
ATOM   5550  C  CG    . LYS C 2  249  ? 20.322  -30.648 30.301  1.00   112.36 ? 249  LYS C CG    1 
ATOM   5551  C  CD    . LYS C 2  249  ? 21.548  -29.749 30.270  1.00   112.70 ? 249  LYS C CD    1 
ATOM   5552  C  CE    . LYS C 2  249  ? 22.718  -30.432 29.579  1.00   93.60  ? 249  LYS C CE    1 
ATOM   5553  N  NZ    . LYS C 2  249  ? 22.397  -30.802 28.173  1.00   82.81  ? 249  LYS C NZ    1 
ATOM   5554  N  N     . ARG C 2  250  ? 18.285  -33.006 31.405  1.00   114.41 ? 250  ARG C N     1 
ATOM   5555  C  CA    . ARG C 2  250  ? 18.229  -34.201 32.243  1.00   112.48 ? 250  ARG C CA    1 
ATOM   5556  C  C     . ARG C 2  250  ? 18.984  -34.020 33.560  1.00   114.42 ? 250  ARG C C     1 
ATOM   5557  O  O     . ARG C 2  250  ? 18.409  -34.179 34.640  1.00   118.51 ? 250  ARG C O     1 
ATOM   5558  C  CB    . ARG C 2  250  ? 18.768  -35.414 31.474  1.00   106.10 ? 250  ARG C CB    1 
ATOM   5559  C  CG    . ARG C 2  250  ? 18.446  -36.766 32.102  1.00   99.66  ? 250  ARG C CG    1 
ATOM   5560  C  CD    . ARG C 2  250  ? 19.555  -37.242 33.030  1.00   100.86 ? 250  ARG C CD    1 
ATOM   5561  N  NE    . ARG C 2  250  ? 19.246  -38.532 33.639  1.00   102.72 ? 250  ARG C NE    1 
ATOM   5562  C  CZ    . ARG C 2  250  ? 20.022  -39.143 34.528  1.00   100.50 ? 250  ARG C CZ    1 
ATOM   5563  N  NH1   . ARG C 2  250  ? 21.158  -38.581 34.917  1.00   89.30  ? 250  ARG C NH1   1 
ATOM   5564  N  NH2   . ARG C 2  250  ? 19.662  -40.317 35.030  1.00   105.67 ? 250  ARG C NH2   1 
ATOM   5565  N  N     . ASP C 2  251  ? 20.267  -33.682 33.467  1.00   111.80 ? 251  ASP C N     1 
ATOM   5566  C  CA    . ASP C 2  251  ? 21.115  -33.549 34.649  1.00   113.89 ? 251  ASP C CA    1 
ATOM   5567  C  C     . ASP C 2  251  ? 20.691  -32.398 35.562  1.00   118.19 ? 251  ASP C C     1 
ATOM   5568  O  O     . ASP C 2  251  ? 20.907  -32.450 36.774  1.00   114.42 ? 251  ASP C O     1 
ATOM   5569  C  CB    . ASP C 2  251  ? 22.586  -33.401 34.248  1.00   104.82 ? 251  ASP C CB    1 
ATOM   5570  C  CG    . ASP C 2  251  ? 22.803  -32.312 33.218  1.00   111.57 ? 251  ASP C CG    1 
ATOM   5571  O  OD1   . ASP C 2  251  ? 22.685  -32.606 32.011  1.00   114.09 ? 251  ASP C OD1   1 
ATOM   5572  O  OD2   . ASP C 2  251  ? 23.093  -31.164 33.615  1.00   117.80 ? 251  ASP C OD2   1 
ATOM   5573  N  N     . LYS C 2  252  ? 20.087  -31.366 34.981  1.00   117.78 ? 252  LYS C N     1 
ATOM   5574  C  CA    . LYS C 2  252  ? 19.604  -30.234 35.764  1.00   115.14 ? 252  LYS C CA    1 
ATOM   5575  C  C     . LYS C 2  252  ? 18.336  -30.613 36.523  1.00   113.37 ? 252  LYS C C     1 
ATOM   5576  O  O     . LYS C 2  252  ? 18.096  -30.132 37.632  1.00   108.21 ? 252  LYS C O     1 
ATOM   5577  C  CB    . LYS C 2  252  ? 19.350  -29.019 34.867  1.00   112.70 ? 252  LYS C CB    1 
ATOM   5578  C  CG    . LYS C 2  252  ? 19.274  -27.703 35.626  1.00   117.91 ? 252  LYS C CG    1 
ATOM   5579  C  CD    . LYS C 2  252  ? 19.073  -26.522 34.690  1.00   112.95 ? 252  LYS C CD    1 
ATOM   5580  C  CE    . LYS C 2  252  ? 19.128  -25.207 35.454  1.00   104.11 ? 252  LYS C CE    1 
ATOM   5581  N  NZ    . LYS C 2  252  ? 18.859  -24.035 34.576  1.00   105.60 ? 252  LYS C NZ    1 
ATOM   5582  N  N     . ALA C 2  253  ? 17.529  -31.480 35.919  1.00   115.65 ? 253  ALA C N     1 
ATOM   5583  C  CA    . ALA C 2  253  ? 16.322  -31.990 36.561  1.00   110.69 ? 253  ALA C CA    1 
ATOM   5584  C  C     . ALA C 2  253  ? 16.689  -32.932 37.700  1.00   113.19 ? 253  ALA C C     1 
ATOM   5585  O  O     . ALA C 2  253  ? 16.121  -32.855 38.794  1.00   115.05 ? 253  ALA C O     1 
ATOM   5586  C  CB    . ALA C 2  253  ? 15.443  -32.701 35.548  1.00   109.37 ? 253  ALA C CB    1 
ATOM   5587  N  N     . VAL C 2  254  ? 17.642  -33.822 37.433  1.00   114.83 ? 254  VAL C N     1 
ATOM   5588  C  CA    . VAL C 2  254  ? 18.157  -34.724 38.457  1.00   114.49 ? 254  VAL C CA    1 
ATOM   5589  C  C     . VAL C 2  254  ? 18.744  -33.926 39.615  1.00   114.71 ? 254  VAL C C     1 
ATOM   5590  O  O     . VAL C 2  254  ? 18.488  -34.230 40.777  1.00   110.91 ? 254  VAL C O     1 
ATOM   5591  C  CB    . VAL C 2  254  ? 19.237  -35.674 37.896  1.00   114.95 ? 254  VAL C CB    1 
ATOM   5592  C  CG1   . VAL C 2  254  ? 19.839  -36.518 39.012  1.00   110.95 ? 254  VAL C CG1   1 
ATOM   5593  C  CG2   . VAL C 2  254  ? 18.655  -36.564 36.813  1.00   110.57 ? 254  VAL C CG2   1 
ATOM   5594  N  N     . ALA C 2  255  ? 19.520  -32.896 39.289  1.00   112.60 ? 255  ALA C N     1 
ATOM   5595  C  CA    . ALA C 2  255  ? 20.134  -32.045 40.305  1.00   108.64 ? 255  ALA C CA    1 
ATOM   5596  C  C     . ALA C 2  255  ? 19.095  -31.297 41.141  1.00   113.29 ? 255  ALA C C     1 
ATOM   5597  O  O     . ALA C 2  255  ? 19.201  -31.249 42.366  1.00   109.94 ? 255  ALA C O     1 
ATOM   5598  C  CB    . ALA C 2  255  ? 21.106  -31.065 39.664  1.00   107.01 ? 255  ALA C CB    1 
ATOM   5599  N  N     . TYR C 2  256  ? 18.096  -30.717 40.480  1.00   114.79 ? 256  TYR C N     1 
ATOM   5600  C  CA    . TYR C 2  256  ? 17.057  -29.966 41.182  1.00   104.46 ? 256  TYR C CA    1 
ATOM   5601  C  C     . TYR C 2  256  ? 16.216  -30.857 42.091  1.00   100.47 ? 256  TYR C C     1 
ATOM   5602  O  O     . TYR C 2  256  ? 15.937  -30.498 43.234  1.00   100.91 ? 256  TYR C O     1 
ATOM   5603  C  CB    . TYR C 2  256  ? 16.149  -29.215 40.201  1.00   103.75 ? 256  TYR C CB    1 
ATOM   5604  C  CG    . TYR C 2  256  ? 15.031  -28.445 40.878  1.00   103.71 ? 256  TYR C CG    1 
ATOM   5605  C  CD1   . TYR C 2  256  ? 15.249  -27.174 41.393  1.00   103.99 ? 256  TYR C CD1   1 
ATOM   5606  C  CD2   . TYR C 2  256  ? 13.758  -28.991 41.004  1.00   103.23 ? 256  TYR C CD2   1 
ATOM   5607  C  CE1   . TYR C 2  256  ? 14.233  -26.467 42.016  1.00   108.42 ? 256  TYR C CE1   1 
ATOM   5608  C  CE2   . TYR C 2  256  ? 12.736  -28.293 41.625  1.00   104.15 ? 256  TYR C CE2   1 
ATOM   5609  C  CZ    . TYR C 2  256  ? 12.979  -27.032 42.128  1.00   107.88 ? 256  TYR C CZ    1 
ATOM   5610  O  OH    . TYR C 2  256  ? 11.965  -26.334 42.745  1.00   100.32 ? 256  TYR C OH    1 
ATOM   5611  N  N     . VAL C 2  257  ? 15.808  -32.015 41.581  1.00   102.11 ? 257  VAL C N     1 
ATOM   5612  C  CA    . VAL C 2  257  ? 14.988  -32.935 42.366  1.00   106.64 ? 257  VAL C CA    1 
ATOM   5613  C  C     . VAL C 2  257  ? 15.779  -33.544 43.521  1.00   105.37 ? 257  VAL C C     1 
ATOM   5614  O  O     . VAL C 2  257  ? 15.269  -33.669 44.635  1.00   103.46 ? 257  VAL C O     1 
ATOM   5615  C  CB    . VAL C 2  257  ? 14.358  -34.036 41.483  1.00   110.63 ? 257  VAL C CB    1 
ATOM   5616  C  CG1   . VAL C 2  257  ? 13.923  -35.231 42.321  1.00   95.30  ? 257  VAL C CG1   1 
ATOM   5617  C  CG2   . VAL C 2  257  ? 13.181  -33.466 40.708  1.00   118.44 ? 257  VAL C CG2   1 
ATOM   5618  N  N     . TYR C 2  258  ? 17.029  -33.909 43.255  1.00   105.43 ? 258  TYR C N     1 
ATOM   5619  C  CA    . TYR C 2  258  ? 17.903  -34.440 44.293  1.00   98.91  ? 258  TYR C CA    1 
ATOM   5620  C  C     . TYR C 2  258  ? 18.110  -33.406 45.393  1.00   99.50  ? 258  TYR C C     1 
ATOM   5621  O  O     . TYR C 2  258  ? 18.003  -33.721 46.576  1.00   99.29  ? 258  TYR C O     1 
ATOM   5622  C  CB    . TYR C 2  258  ? 19.244  -34.865 43.699  1.00   99.81  ? 258  TYR C CB    1 
ATOM   5623  C  CG    . TYR C 2  258  ? 20.276  -35.275 44.722  1.00   92.75  ? 258  TYR C CG    1 
ATOM   5624  C  CD1   . TYR C 2  258  ? 21.253  -34.384 45.143  1.00   93.41  ? 258  TYR C CD1   1 
ATOM   5625  C  CD2   . TYR C 2  258  ? 20.277  -36.553 45.263  1.00   87.15  ? 258  TYR C CD2   1 
ATOM   5626  C  CE1   . TYR C 2  258  ? 22.201  -34.752 46.075  1.00   87.45  ? 258  TYR C CE1   1 
ATOM   5627  C  CE2   . TYR C 2  258  ? 21.223  -36.932 46.196  1.00   84.32  ? 258  TYR C CE2   1 
ATOM   5628  C  CZ    . TYR C 2  258  ? 22.183  -36.028 46.597  1.00   85.62  ? 258  TYR C CZ    1 
ATOM   5629  O  OH    . TYR C 2  258  ? 23.125  -36.400 47.528  1.00   86.52  ? 258  TYR C OH    1 
ATOM   5630  N  N     . GLY C 2  259  ? 18.400  -32.171 44.991  1.00   101.66 ? 259  GLY C N     1 
ATOM   5631  C  CA    . GLY C 2  259  ? 18.556  -31.071 45.926  1.00   107.65 ? 259  GLY C CA    1 
ATOM   5632  C  C     . GLY C 2  259  ? 17.289  -30.739 46.698  1.00   108.32 ? 259  GLY C C     1 
ATOM   5633  O  O     . GLY C 2  259  ? 17.354  -30.265 47.832  1.00   107.84 ? 259  GLY C O     1 
ATOM   5634  N  N     . LEU C 2  260  ? 16.135  -30.994 46.084  1.00   103.26 ? 260  LEU C N     1 
ATOM   5635  C  CA    . LEU C 2  260  ? 14.843  -30.703 46.706  1.00   101.38 ? 260  LEU C CA    1 
ATOM   5636  C  C     . LEU C 2  260  ? 14.500  -31.722 47.793  1.00   103.25 ? 260  LEU C C     1 
ATOM   5637  O  O     . LEU C 2  260  ? 14.075  -31.362 48.895  1.00   100.78 ? 260  LEU C O     1 
ATOM   5638  C  CB    . LEU C 2  260  ? 13.732  -30.679 45.651  1.00   99.93  ? 260  LEU C CB    1 
ATOM   5639  C  CG    . LEU C 2  260  ? 12.401  -30.044 46.072  1.00   98.39  ? 260  LEU C CG    1 
ATOM   5640  C  CD1   . LEU C 2  260  ? 12.470  -28.513 46.046  1.00   106.96 ? 260  LEU C CD1   1 
ATOM   5641  C  CD2   . LEU C 2  260  ? 11.252  -30.554 45.215  1.00   95.91  ? 260  LEU C CD2   1 
ATOM   5642  N  N     . ILE C 2  261  ? 14.703  -32.997 47.474  1.00   103.04 ? 261  ILE C N     1 
ATOM   5643  C  CA    . ILE C 2  261  ? 14.340  -34.093 48.369  1.00   95.10  ? 261  ILE C CA    1 
ATOM   5644  C  C     . ILE C 2  261  ? 15.498  -34.863 48.980  1.00   94.97  ? 261  ILE C C     1 
ATOM   5645  O  O     . ILE C 2  261  ? 15.646  -34.881 50.195  1.00   102.53 ? 261  ILE C O     1 
ATOM   5646  C  CB    . ILE C 2  261  ? 13.440  -35.105 47.656  1.00   84.23  ? 261  ILE C CB    1 
ATOM   5647  C  CG1   . ILE C 2  261  ? 12.226  -34.381 47.082  1.00   78.45  ? 261  ILE C CG1   1 
ATOM   5648  C  CG2   . ILE C 2  261  ? 13.060  -36.266 48.580  1.00   86.34  ? 261  ILE C CG2   1 
ATOM   5649  C  CD1   . ILE C 2  261  ? 11.441  -33.606 48.105  1.00   90.18  ? 261  ILE C CD1   1 
ATOM   5650  N  N     . ALA C 2  262  ? 16.286  -35.529 48.141  1.00   88.77  ? 262  ALA C N     1 
ATOM   5651  C  CA    . ALA C 2  262  ? 17.276  -36.496 48.613  1.00   91.26  ? 262  ALA C CA    1 
ATOM   5652  C  C     . ALA C 2  262  ? 18.567  -35.897 49.185  1.00   92.44  ? 262  ALA C C     1 
ATOM   5653  O  O     . ALA C 2  262  ? 19.230  -36.533 50.003  1.00   85.27  ? 262  ALA C O     1 
ATOM   5654  C  CB    . ALA C 2  262  ? 17.593  -37.508 47.509  1.00   102.60 ? 262  ALA C CB    1 
ATOM   5655  N  N     . ASP C 2  263  ? 18.920  -34.681 48.774  1.00   96.79  ? 263  ASP C N     1 
ATOM   5656  C  CA    . ASP C 2  263  ? 20.183  -34.076 49.204  1.00   94.90  ? 263  ASP C CA    1 
ATOM   5657  C  C     . ASP C 2  263  ? 20.196  -33.781 50.704  1.00   94.27  ? 263  ASP C C     1 
ATOM   5658  O  O     . ASP C 2  263  ? 19.437  -32.938 51.181  1.00   94.30  ? 263  ASP C O     1 
ATOM   5659  C  CB    . ASP C 2  263  ? 20.458  -32.790 48.418  1.00   98.19  ? 263  ASP C CB    1 
ATOM   5660  C  CG    . ASP C 2  263  ? 21.903  -32.331 48.527  1.00   100.67 ? 263  ASP C CG    1 
ATOM   5661  O  OD1   . ASP C 2  263  ? 22.788  -33.179 48.766  1.00   100.85 ? 263  ASP C OD1   1 
ATOM   5662  O  OD2   . ASP C 2  263  ? 22.156  -31.118 48.365  1.00   101.92 ? 263  ASP C OD2   1 
ATOM   5663  N  N     . PRO C 2  264  ? 21.077  -34.468 51.451  1.00   93.69  ? 264  PRO C N     1 
ATOM   5664  C  CA    . PRO C 2  264  ? 21.169  -34.283 52.903  1.00   90.64  ? 264  PRO C CA    1 
ATOM   5665  C  C     . PRO C 2  264  ? 21.729  -32.913 53.255  1.00   92.72  ? 264  PRO C C     1 
ATOM   5666  O  O     . PRO C 2  264  ? 21.444  -32.379 54.327  1.00   91.73  ? 264  PRO C O     1 
ATOM   5667  C  CB    . PRO C 2  264  ? 22.136  -35.387 53.335  1.00   82.24  ? 264  PRO C CB    1 
ATOM   5668  C  CG    . PRO C 2  264  ? 22.971  -35.643 52.133  1.00   81.06  ? 264  PRO C CG    1 
ATOM   5669  C  CD    . PRO C 2  264  ? 22.064  -35.442 50.954  1.00   89.96  ? 264  PRO C CD    1 
ATOM   5670  N  N     . ARG C 2  265  ? 22.519  -32.356 52.344  1.00   96.11  ? 265  ARG C N     1 
ATOM   5671  C  CA    . ARG C 2  265  ? 23.104  -31.036 52.528  1.00   98.35  ? 265  ARG C CA    1 
ATOM   5672  C  C     . ARG C 2  265  ? 22.028  -29.952 52.464  1.00   95.94  ? 265  ARG C C     1 
ATOM   5673  O  O     . ARG C 2  265  ? 22.002  -29.044 53.296  1.00   90.39  ? 265  ARG C O     1 
ATOM   5674  C  CB    . ARG C 2  265  ? 24.188  -30.792 51.472  1.00   95.72  ? 265  ARG C CB    1 
ATOM   5675  C  CG    . ARG C 2  265  ? 25.222  -31.914 51.393  1.00   92.25  ? 265  ARG C CG    1 
ATOM   5676  C  CD    . ARG C 2  265  ? 26.097  -31.810 50.148  1.00   91.94  ? 265  ARG C CD    1 
ATOM   5677  N  NE    . ARG C 2  265  ? 27.164  -30.822 50.289  1.00   101.20 ? 265  ARG C NE    1 
ATOM   5678  C  CZ    . ARG C 2  265  ? 28.413  -31.113 50.641  1.00   85.07  ? 265  ARG C CZ    1 
ATOM   5679  N  NH1   . ARG C 2  265  ? 28.760  -32.368 50.891  1.00   77.60  ? 265  ARG C NH1   1 
ATOM   5680  N  NH2   . ARG C 2  265  ? 29.318  -30.148 50.744  1.00   72.73  ? 265  ARG C NH2   1 
ATOM   5681  N  N     . ARG C 2  266  ? 21.143  -30.046 51.475  1.00   98.03  ? 266  ARG C N     1 
ATOM   5682  C  CA    . ARG C 2  266  ? 20.062  -29.074 51.334  1.00   100.96 ? 266  ARG C CA    1 
ATOM   5683  C  C     . ARG C 2  266  ? 18.754  -29.479 52.023  1.00   101.28 ? 266  ARG C C     1 
ATOM   5684  O  O     . ARG C 2  266  ? 17.847  -28.657 52.160  1.00   102.72 ? 266  ARG C O     1 
ATOM   5685  C  CB    . ARG C 2  266  ? 19.798  -28.768 49.855  1.00   106.98 ? 266  ARG C CB    1 
ATOM   5686  C  CG    . ARG C 2  266  ? 20.982  -28.156 49.122  1.00   108.31 ? 266  ARG C CG    1 
ATOM   5687  C  CD    . ARG C 2  266  ? 20.539  -27.417 47.867  1.00   112.17 ? 266  ARG C CD    1 
ATOM   5688  N  NE    . ARG C 2  266  ? 19.602  -26.340 48.179  1.00   120.89 ? 266  ARG C NE    1 
ATOM   5689  C  CZ    . ARG C 2  266  ? 18.321  -26.335 47.826  1.00   116.96 ? 266  ARG C CZ    1 
ATOM   5690  N  NH1   . ARG C 2  266  ? 17.545  -25.313 48.160  1.00   116.68 ? 266  ARG C NH1   1 
ATOM   5691  N  NH2   . ARG C 2  266  ? 17.815  -27.347 47.134  1.00   110.51 ? 266  ARG C NH2   1 
ATOM   5692  N  N     . TYR C 2  267  ? 18.651  -30.733 52.456  1.00   99.59  ? 267  TYR C N     1 
ATOM   5693  C  CA    . TYR C 2  267  ? 17.447  -31.192 53.152  1.00   97.50  ? 267  TYR C CA    1 
ATOM   5694  C  C     . TYR C 2  267  ? 17.764  -32.056 54.369  1.00   92.98  ? 267  TYR C C     1 
ATOM   5695  O  O     . TYR C 2  267  ? 18.371  -33.119 54.245  1.00   94.04  ? 267  TYR C O     1 
ATOM   5696  C  CB    . TYR C 2  267  ? 16.517  -31.949 52.200  1.00   97.95  ? 267  TYR C CB    1 
ATOM   5697  C  CG    . TYR C 2  267  ? 15.139  -32.208 52.773  1.00   93.87  ? 267  TYR C CG    1 
ATOM   5698  C  CD1   . TYR C 2  267  ? 14.106  -31.299 52.580  1.00   93.24  ? 267  TYR C CD1   1 
ATOM   5699  C  CD2   . TYR C 2  267  ? 14.871  -33.358 53.506  1.00   84.65  ? 267  TYR C CD2   1 
ATOM   5700  C  CE1   . TYR C 2  267  ? 12.846  -31.528 53.100  1.00   93.05  ? 267  TYR C CE1   1 
ATOM   5701  C  CE2   . TYR C 2  267  ? 13.614  -33.594 54.031  1.00   83.68  ? 267  TYR C CE2   1 
ATOM   5702  C  CZ    . TYR C 2  267  ? 12.605  -32.676 53.824  1.00   86.05  ? 267  TYR C CZ    1 
ATOM   5703  O  OH    . TYR C 2  267  ? 11.350  -32.904 54.342  1.00   79.46  ? 267  TYR C OH    1 
ATOM   5704  N  N     . ASP C 2  268  ? 17.344  -31.600 55.543  1.00   82.76  ? 268  ASP C N     1 
ATOM   5705  C  CA    . ASP C 2  268  ? 17.591  -32.350 56.766  1.00   77.83  ? 268  ASP C CA    1 
ATOM   5706  C  C     . ASP C 2  268  ? 16.389  -32.370 57.709  1.00   78.53  ? 268  ASP C C     1 
ATOM   5707  O  O     . ASP C 2  268  ? 15.927  -31.321 58.157  1.00   80.58  ? 268  ASP C O     1 
ATOM   5708  C  CB    . ASP C 2  268  ? 18.814  -31.780 57.487  1.00   80.58  ? 268  ASP C CB    1 
ATOM   5709  C  CG    . ASP C 2  268  ? 19.277  -32.655 58.631  1.00   82.81  ? 268  ASP C CG    1 
ATOM   5710  O  OD1   . ASP C 2  268  ? 19.305  -33.890 58.458  1.00   85.04  ? 268  ASP C OD1   1 
ATOM   5711  O  OD2   . ASP C 2  268  ? 19.614  -32.107 59.702  1.00   77.91  ? 268  ASP C OD2   1 
ATOM   5712  N  N     . LEU C 2  269  ? 15.883  -33.564 58.004  1.00   78.90  ? 269  LEU C N     1 
ATOM   5713  C  CA    . LEU C 2  269  ? 14.958  -33.733 59.116  1.00   67.17  ? 269  LEU C CA    1 
ATOM   5714  C  C     . LEU C 2  269  ? 15.804  -33.732 60.376  1.00   67.40  ? 269  LEU C C     1 
ATOM   5715  O  O     . LEU C 2  269  ? 16.991  -34.045 60.325  1.00   73.86  ? 269  LEU C O     1 
ATOM   5716  C  CB    . LEU C 2  269  ? 14.201  -35.061 59.021  1.00   61.23  ? 269  LEU C CB    1 
ATOM   5717  C  CG    . LEU C 2  269  ? 13.160  -35.279 57.921  1.00   60.58  ? 269  LEU C CG    1 
ATOM   5718  C  CD1   . LEU C 2  269  ? 12.582  -36.681 58.023  1.00   48.39  ? 269  LEU C CD1   1 
ATOM   5719  C  CD2   . LEU C 2  269  ? 12.056  -34.246 57.999  1.00   66.57  ? 269  LEU C CD2   1 
ATOM   5720  N  N     . GLY C 2  270  ? 15.207  -33.374 61.505  1.00   72.89  ? 270  GLY C N     1 
ATOM   5721  C  CA    . GLY C 2  270  ? 15.915  -33.463 62.767  1.00   81.52  ? 270  GLY C CA    1 
ATOM   5722  C  C     . GLY C 2  270  ? 16.127  -34.918 63.132  1.00   78.52  ? 270  GLY C C     1 
ATOM   5723  O  O     . GLY C 2  270  ? 15.495  -35.802 62.552  1.00   79.33  ? 270  GLY C O     1 
ATOM   5724  N  N     . GLU C 2  271  ? 17.022  -35.176 64.080  1.00   71.47  ? 271  GLU C N     1 
ATOM   5725  C  CA    . GLU C 2  271  ? 17.174  -36.524 64.609  1.00   74.56  ? 271  GLU C CA    1 
ATOM   5726  C  C     . GLU C 2  271  ? 15.876  -36.865 65.325  1.00   80.25  ? 271  GLU C C     1 
ATOM   5727  O  O     . GLU C 2  271  ? 15.435  -38.018 65.344  1.00   74.64  ? 271  GLU C O     1 
ATOM   5728  C  CB    . GLU C 2  271  ? 18.357  -36.601 65.574  1.00   70.76  ? 271  GLU C CB    1 
ATOM   5729  C  CG    . GLU C 2  271  ? 18.938  -37.998 65.728  1.00   68.75  ? 271  GLU C CG    1 
ATOM   5730  C  CD    . GLU C 2  271  ? 19.600  -38.497 64.455  1.00   94.71  ? 271  GLU C CD    1 
ATOM   5731  O  OE1   . GLU C 2  271  ? 20.009  -37.659 63.622  1.00   88.97  ? 271  GLU C OE1   1 
ATOM   5732  O  OE2   . GLU C 2  271  ? 19.710  -39.729 64.285  1.00   101.84 ? 271  GLU C OE2   1 
ATOM   5733  N  N     . ALA C 2  272  ? 15.266  -35.833 65.902  1.00   80.67  ? 272  ALA C N     1 
ATOM   5734  C  CA    . ALA C 2  272  ? 13.948  -35.939 66.509  1.00   74.19  ? 272  ALA C CA    1 
ATOM   5735  C  C     . ALA C 2  272  ? 12.888  -36.112 65.429  1.00   67.80  ? 272  ALA C C     1 
ATOM   5736  O  O     . ALA C 2  272  ? 11.934  -36.864 65.602  1.00   71.74  ? 272  ALA C O     1 
ATOM   5737  C  CB    . ALA C 2  272  ? 13.654  -34.705 67.344  1.00   68.10  ? 272  ALA C CB    1 
ATOM   5738  N  N     . GLY C 2  273  ? 13.058  -35.403 64.317  1.00   62.29  ? 273  GLY C N     1 
ATOM   5739  C  CA    . GLY C 2  273  ? 12.159  -35.541 63.186  1.00   68.79  ? 273  GLY C CA    1 
ATOM   5740  C  C     . GLY C 2  273  ? 12.255  -36.932 62.595  1.00   72.41  ? 273  GLY C C     1 
ATOM   5741  O  O     . GLY C 2  273  ? 11.248  -37.547 62.245  1.00   72.01  ? 273  GLY C O     1 
ATOM   5742  N  N     . ARG C 2  274  ? 13.486  -37.421 62.495  1.00   74.34  ? 274  ARG C N     1 
ATOM   5743  C  CA    . ARG C 2  274  ? 13.766  -38.773 62.035  1.00   72.47  ? 274  ARG C CA    1 
ATOM   5744  C  C     . ARG C 2  274  ? 13.064  -39.793 62.926  1.00   77.11  ? 274  ARG C C     1 
ATOM   5745  O  O     . ARG C 2  274  ? 12.266  -40.609 62.450  1.00   81.11  ? 274  ARG C O     1 
ATOM   5746  C  CB    . ARG C 2  274  ? 15.277  -39.007 62.065  1.00   82.28  ? 274  ARG C CB    1 
ATOM   5747  C  CG    . ARG C 2  274  ? 15.749  -40.319 61.471  1.00   89.42  ? 274  ARG C CG    1 
ATOM   5748  C  CD    . ARG C 2  274  ? 17.261  -40.422 61.588  1.00   85.12  ? 274  ARG C CD    1 
ATOM   5749  N  NE    . ARG C 2  274  ? 17.806  -41.554 60.847  1.00   90.97  ? 274  ARG C NE    1 
ATOM   5750  C  CZ    . ARG C 2  274  ? 17.985  -42.766 61.359  1.00   95.33  ? 274  ARG C CZ    1 
ATOM   5751  N  NH1   . ARG C 2  274  ? 17.658  -43.011 62.621  1.00   84.00  ? 274  ARG C NH1   1 
ATOM   5752  N  NH2   . ARG C 2  274  ? 18.491  -43.734 60.607  1.00   101.07 ? 274  ARG C NH2   1 
ATOM   5753  N  N     . TYR C 2  275  ? 13.357  -39.727 64.222  1.00   74.31  ? 275  TYR C N     1 
ATOM   5754  C  CA    . TYR C 2  275  ? 12.777  -40.640 65.203  1.00   76.39  ? 275  TYR C CA    1 
ATOM   5755  C  C     . TYR C 2  275  ? 11.249  -40.623 65.196  1.00   80.33  ? 275  TYR C C     1 
ATOM   5756  O  O     . TYR C 2  275  ? 10.613  -41.675 65.148  1.00   81.93  ? 275  TYR C O     1 
ATOM   5757  C  CB    . TYR C 2  275  ? 13.303  -40.317 66.606  1.00   77.40  ? 275  TYR C CB    1 
ATOM   5758  C  CG    . TYR C 2  275  ? 12.390  -40.765 67.729  1.00   91.47  ? 275  TYR C CG    1 
ATOM   5759  C  CD1   . TYR C 2  275  ? 12.354  -42.093 68.137  1.00   95.37  ? 275  TYR C CD1   1 
ATOM   5760  C  CD2   . TYR C 2  275  ? 11.569  -39.855 68.387  1.00   95.30  ? 275  TYR C CD2   1 
ATOM   5761  C  CE1   . TYR C 2  275  ? 11.520  -42.503 69.165  1.00   97.25  ? 275  TYR C CE1   1 
ATOM   5762  C  CE2   . TYR C 2  275  ? 10.733  -40.255 69.415  1.00   96.56  ? 275  TYR C CE2   1 
ATOM   5763  C  CZ    . TYR C 2  275  ? 10.712  -41.579 69.800  1.00   97.56  ? 275  TYR C CZ    1 
ATOM   5764  O  OH    . TYR C 2  275  ? 9.881   -41.978 70.823  1.00   81.44  ? 275  TYR C OH    1 
ATOM   5765  N  N     . LYS C 2  276  ? 10.669  -39.428 65.243  1.00   76.66  ? 276  LYS C N     1 
ATOM   5766  C  CA    . LYS C 2  276  ? 9.218   -39.279 65.274  1.00   71.31  ? 276  LYS C CA    1 
ATOM   5767  C  C     . LYS C 2  276  ? 8.558   -39.757 63.988  1.00   74.82  ? 276  LYS C C     1 
ATOM   5768  O  O     . LYS C 2  276  ? 7.456   -40.299 64.019  1.00   76.97  ? 276  LYS C O     1 
ATOM   5769  C  CB    . LYS C 2  276  ? 8.820   -37.830 65.557  1.00   67.59  ? 276  LYS C CB    1 
ATOM   5770  C  CG    . LYS C 2  276  ? 8.861   -37.450 67.026  1.00   65.52  ? 276  LYS C CG    1 
ATOM   5771  C  CD    . LYS C 2  276  ? 8.139   -36.134 67.287  1.00   64.50  ? 276  LYS C CD    1 
ATOM   5772  C  CE    . LYS C 2  276  ? 6.641   -36.243 67.015  1.00   59.35  ? 276  LYS C CE    1 
ATOM   5773  N  NZ    . LYS C 2  276  ? 6.269   -35.939 65.602  1.00   56.89  ? 276  LYS C NZ    1 
ATOM   5774  N  N     . ALA C 2  277  ? 9.225   -39.547 62.858  1.00   75.34  ? 277  ALA C N     1 
ATOM   5775  C  CA    . ALA C 2  277  ? 8.719   -40.049 61.588  1.00   72.31  ? 277  ALA C CA    1 
ATOM   5776  C  C     . ALA C 2  277  ? 8.725   -41.572 61.604  1.00   79.18  ? 277  ALA C C     1 
ATOM   5777  O  O     . ALA C 2  277  ? 7.792   -42.210 61.116  1.00   76.27  ? 277  ALA C O     1 
ATOM   5778  C  CB    . ALA C 2  277  ? 9.549   -39.524 60.431  1.00   65.45  ? 277  ALA C CB    1 
ATOM   5779  N  N     . GLU C 2  278  ? 9.780   -42.146 62.178  1.00   84.45  ? 278  GLU C N     1 
ATOM   5780  C  CA    . GLU C 2  278  ? 9.893   -43.599 62.287  1.00   87.08  ? 278  GLU C CA    1 
ATOM   5781  C  C     . GLU C 2  278  ? 8.842   -44.180 63.228  1.00   85.06  ? 278  GLU C C     1 
ATOM   5782  O  O     . GLU C 2  278  ? 8.370   -45.300 63.032  1.00   86.04  ? 278  GLU C O     1 
ATOM   5783  C  CB    . GLU C 2  278  ? 11.294  -43.996 62.764  1.00   84.45  ? 278  GLU C CB    1 
ATOM   5784  C  CG    . GLU C 2  278  ? 12.398  -43.724 61.755  1.00   91.29  ? 278  GLU C CG    1 
ATOM   5785  C  CD    . GLU C 2  278  ? 13.771  -44.099 62.279  1.00   92.47  ? 278  GLU C CD    1 
ATOM   5786  O  OE1   . GLU C 2  278  ? 13.848  -44.695 63.375  1.00   89.68  ? 278  GLU C OE1   1 
ATOM   5787  O  OE2   . GLU C 2  278  ? 14.773  -43.795 61.598  1.00   88.18  ? 278  GLU C OE2   1 
ATOM   5788  N  N     . GLU C 2  279  ? 8.482   -43.412 64.251  1.00   80.05  ? 279  GLU C N     1 
ATOM   5789  C  CA    . GLU C 2  279  ? 7.528   -43.865 65.255  1.00   81.36  ? 279  GLU C CA    1 
ATOM   5790  C  C     . GLU C 2  279  ? 6.091   -43.747 64.751  1.00   80.98  ? 279  GLU C C     1 
ATOM   5791  O  O     . GLU C 2  279  ? 5.257   -44.614 65.011  1.00   81.59  ? 279  GLU C O     1 
ATOM   5792  C  CB    . GLU C 2  279  ? 7.702   -43.063 66.548  1.00   85.54  ? 279  GLU C CB    1 
ATOM   5793  C  CG    . GLU C 2  279  ? 7.188   -43.763 67.797  1.00   99.03  ? 279  GLU C CG    1 
ATOM   5794  C  CD    . GLU C 2  279  ? 8.089   -44.900 68.244  1.00   99.52  ? 279  GLU C CD    1 
ATOM   5795  O  OE1   . GLU C 2  279  ? 7.635   -45.739 69.051  1.00   98.32  ? 279  GLU C OE1   1 
ATOM   5796  O  OE2   . GLU C 2  279  ? 9.254   -44.953 67.794  1.00   88.02  ? 279  GLU C OE2   1 
ATOM   5797  N  N     . LYS C 2  280  ? 5.813   -42.668 64.027  1.00   77.17  ? 280  LYS C N     1 
ATOM   5798  C  CA    . LYS C 2  280  ? 4.467   -42.382 63.542  1.00   76.27  ? 280  LYS C CA    1 
ATOM   5799  C  C     . LYS C 2  280  ? 4.069   -43.303 62.393  1.00   84.52  ? 280  LYS C C     1 
ATOM   5800  O  O     . LYS C 2  280  ? 2.991   -43.897 62.408  1.00   80.82  ? 280  LYS C O     1 
ATOM   5801  C  CB    . LYS C 2  280  ? 4.369   -40.921 63.095  1.00   75.17  ? 280  LYS C CB    1 
ATOM   5802  C  CG    . LYS C 2  280  ? 2.980   -40.486 62.656  1.00   70.92  ? 280  LYS C CG    1 
ATOM   5803  C  CD    . LYS C 2  280  ? 1.997   -40.529 63.814  1.00   74.48  ? 280  LYS C CD    1 
ATOM   5804  C  CE    . LYS C 2  280  ? 0.636   -39.987 63.405  1.00   77.92  ? 280  LYS C CE    1 
ATOM   5805  N  NZ    . LYS C 2  280  ? -0.353  -40.054 64.519  1.00   75.31  ? 280  LYS C NZ    1 
ATOM   5806  N  N     . LEU C 2  281  ? 4.947   -43.418 61.402  1.00   89.74  ? 281  LEU C N     1 
ATOM   5807  C  CA    . LEU C 2  281  ? 4.669   -44.227 60.220  1.00   87.18  ? 281  LEU C CA    1 
ATOM   5808  C  C     . LEU C 2  281  ? 4.978   -45.703 60.449  1.00   94.64  ? 281  LEU C C     1 
ATOM   5809  O  O     . LEU C 2  281  ? 4.617   -46.553 59.634  1.00   99.92  ? 281  LEU C O     1 
ATOM   5810  C  CB    . LEU C 2  281  ? 5.462   -43.710 59.019  1.00   85.86  ? 281  LEU C CB    1 
ATOM   5811  C  CG    . LEU C 2  281  ? 5.129   -42.295 58.545  1.00   89.58  ? 281  LEU C CG    1 
ATOM   5812  C  CD1   . LEU C 2  281  ? 6.003   -41.907 57.364  1.00   86.16  ? 281  LEU C CD1   1 
ATOM   5813  C  CD2   . LEU C 2  281  ? 3.655   -42.186 58.185  1.00   88.41  ? 281  LEU C CD2   1 
ATOM   5814  N  N     . GLY C 2  282  ? 5.648   -46.001 61.558  1.00   92.96  ? 282  GLY C N     1 
ATOM   5815  C  CA    . GLY C 2  282  ? 6.018   -47.367 61.886  1.00   88.03  ? 282  GLY C CA    1 
ATOM   5816  C  C     . GLY C 2  282  ? 7.011   -47.946 60.896  1.00   96.94  ? 282  GLY C C     1 
ATOM   5817  O  O     . GLY C 2  282  ? 6.909   -49.109 60.504  1.00   97.58  ? 282  GLY C O     1 
ATOM   5818  N  N     . ILE C 2  283  ? 7.973   -47.125 60.488  1.00   94.43  ? 283  ILE C N     1 
ATOM   5819  C  CA    . ILE C 2  283  ? 8.985   -47.540 59.524  1.00   88.25  ? 283  ILE C CA    1 
ATOM   5820  C  C     . ILE C 2  283  ? 10.385  -47.241 60.051  1.00   93.23  ? 283  ILE C C     1 
ATOM   5821  O  O     . ILE C 2  283  ? 10.546  -46.814 61.195  1.00   93.24  ? 283  ILE C O     1 
ATOM   5822  C  CB    . ILE C 2  283  ? 8.792   -46.838 58.167  1.00   82.62  ? 283  ILE C CB    1 
ATOM   5823  C  CG1   . ILE C 2  283  ? 8.955   -45.324 58.322  1.00   83.49  ? 283  ILE C CG1   1 
ATOM   5824  C  CG2   . ILE C 2  283  ? 7.428   -47.175 57.579  1.00   74.10  ? 283  ILE C CG2   1 
ATOM   5825  C  CD1   . ILE C 2  283  ? 8.827   -44.559 57.023  1.00   86.05  ? 283  ILE C CD1   1 
ATOM   5826  N  N     . ARG C 2  284  ? 11.394  -47.471 59.217  1.00   88.31  ? 284  ARG C N     1 
ATOM   5827  C  CA    . ARG C 2  284  ? 12.778  -47.218 59.604  1.00   96.32  ? 284  ARG C CA    1 
ATOM   5828  C  C     . ARG C 2  284  ? 13.515  -46.428 58.525  1.00   100.23 ? 284  ARG C C     1 
ATOM   5829  O  O     . ARG C 2  284  ? 13.494  -46.792 57.348  1.00   100.15 ? 284  ARG C O     1 
ATOM   5830  C  CB    . ARG C 2  284  ? 13.502  -48.535 59.895  1.00   98.65  ? 284  ARG C CB    1 
ATOM   5831  C  CG    . ARG C 2  284  ? 14.831  -48.377 60.619  1.00   98.59  ? 284  ARG C CG    1 
ATOM   5832  C  CD    . ARG C 2  284  ? 14.650  -47.674 61.955  1.00   96.24  ? 284  ARG C CD    1 
ATOM   5833  N  NE    . ARG C 2  284  ? 15.865  -47.705 62.766  1.00   100.71 ? 284  ARG C NE    1 
ATOM   5834  C  CZ    . ARG C 2  284  ? 16.857  -46.828 62.661  1.00   96.54  ? 284  ARG C CZ    1 
ATOM   5835  N  NH1   . ARG C 2  284  ? 17.924  -46.931 63.443  1.00   87.29  ? 284  ARG C NH1   1 
ATOM   5836  N  NH2   . ARG C 2  284  ? 16.785  -45.847 61.772  1.00   99.58  ? 284  ARG C NH2   1 
ATOM   5837  N  N     . LEU C 2  285  ? 14.166  -45.344 58.935  1.00   98.82  ? 285  LEU C N     1 
ATOM   5838  C  CA    . LEU C 2  285  ? 14.868  -44.467 58.006  1.00   99.20  ? 285  LEU C CA    1 
ATOM   5839  C  C     . LEU C 2  285  ? 16.365  -44.758 57.969  1.00   99.07  ? 285  LEU C C     1 
ATOM   5840  O  O     . LEU C 2  285  ? 17.003  -44.894 59.013  1.00   95.66  ? 285  LEU C O     1 
ATOM   5841  C  CB    . LEU C 2  285  ? 14.639  -43.002 58.388  1.00   99.18  ? 285  LEU C CB    1 
ATOM   5842  C  CG    . LEU C 2  285  ? 13.494  -42.258 57.699  1.00   99.84  ? 285  LEU C CG    1 
ATOM   5843  C  CD1   . LEU C 2  285  ? 13.796  -42.109 56.221  1.00   93.08  ? 285  LEU C CD1   1 
ATOM   5844  C  CD2   . LEU C 2  285  ? 12.162  -42.964 57.911  1.00   91.59  ? 285  LEU C CD2   1 
ATOM   5845  N  N     . SER C 2  286  ? 16.921  -44.854 56.765  1.00   104.33 ? 286  SER C N     1 
ATOM   5846  C  CA    . SER C 2  286  ? 18.362  -45.012 56.605  1.00   105.64 ? 286  SER C CA    1 
ATOM   5847  C  C     . SER C 2  286  ? 19.032  -43.646 56.657  1.00   102.57 ? 286  SER C C     1 
ATOM   5848  O  O     . SER C 2  286  ? 20.250  -43.542 56.804  1.00   108.40 ? 286  SER C O     1 
ATOM   5849  C  CB    . SER C 2  286  ? 18.690  -45.702 55.280  1.00   108.90 ? 286  SER C CB    1 
ATOM   5850  O  OG    . SER C 2  286  ? 17.942  -46.895 55.130  1.00   127.95 ? 286  SER C OG    1 
ATOM   5851  N  N     . GLY C 2  287  ? 18.223  -42.600 56.536  1.00   98.43  ? 287  GLY C N     1 
ATOM   5852  C  CA    . GLY C 2  287  ? 18.730  -41.242 56.546  1.00   93.27  ? 287  GLY C CA    1 
ATOM   5853  C  C     . GLY C 2  287  ? 17.703  -40.230 57.011  1.00   87.07  ? 287  GLY C C     1 
ATOM   5854  O  O     . GLY C 2  287  ? 16.560  -40.570 57.314  1.00   85.72  ? 287  GLY C O     1 
ATOM   5855  N  N     . ARG C 2  288  ? 18.122  -38.972 57.060  1.00   81.35  ? 288  ARG C N     1 
ATOM   5856  C  CA    . ARG C 2  288  ? 17.268  -37.883 57.509  1.00   73.63  ? 288  ARG C CA    1 
ATOM   5857  C  C     . ARG C 2  288  ? 16.537  -37.225 56.340  1.00   80.63  ? 288  ARG C C     1 
ATOM   5858  O  O     . ARG C 2  288  ? 15.897  -36.188 56.497  1.00   81.77  ? 288  ARG C O     1 
ATOM   5859  C  CB    . ARG C 2  288  ? 18.075  -36.864 58.313  1.00   69.83  ? 288  ARG C CB    1 
ATOM   5860  C  CG    . ARG C 2  288  ? 18.609  -37.427 59.623  1.00   75.58  ? 288  ARG C CG    1 
ATOM   5861  C  CD    . ARG C 2  288  ? 19.215  -36.346 60.498  1.00   83.10  ? 288  ARG C CD    1 
ATOM   5862  N  NE    . ARG C 2  288  ? 20.487  -35.860 59.973  1.00   84.51  ? 288  ARG C NE    1 
ATOM   5863  C  CZ    . ARG C 2  288  ? 21.664  -36.080 60.549  1.00   97.43  ? 288  ARG C CZ    1 
ATOM   5864  N  NH1   . ARG C 2  288  ? 21.731  -36.774 61.678  1.00   85.13  ? 288  ARG C NH1   1 
ATOM   5865  N  NH2   . ARG C 2  288  ? 22.772  -35.600 60.002  1.00   109.54 ? 288  ARG C NH2   1 
ATOM   5866  N  N     . THR C 2  289  ? 16.655  -37.831 55.163  1.00   89.72  ? 289  THR C N     1 
ATOM   5867  C  CA    . THR C 2  289  ? 16.030  -37.300 53.956  1.00   92.61  ? 289  THR C CA    1 
ATOM   5868  C  C     . THR C 2  289  ? 14.856  -38.167 53.508  1.00   88.57  ? 289  THR C C     1 
ATOM   5869  O  O     . THR C 2  289  ? 14.813  -39.366 53.786  1.00   83.85  ? 289  THR C O     1 
ATOM   5870  C  CB    . THR C 2  289  ? 17.043  -37.186 52.804  1.00   96.98  ? 289  THR C CB    1 
ATOM   5871  O  OG1   . THR C 2  289  ? 17.577  -38.481 52.502  1.00   100.81 ? 289  THR C OG1   1 
ATOM   5872  C  CG2   . THR C 2  289  ? 18.178  -36.257 53.191  1.00   92.41  ? 289  THR C CG2   1 
ATOM   5873  N  N     . LEU C 2  290  ? 13.899  -37.542 52.827  1.00   88.32  ? 290  LEU C N     1 
ATOM   5874  C  CA    . LEU C 2  290  ? 12.683  -38.222 52.385  1.00   89.50  ? 290  LEU C CA    1 
ATOM   5875  C  C     . LEU C 2  290  ? 12.953  -39.310 51.347  1.00   99.03  ? 290  LEU C C     1 
ATOM   5876  O  O     . LEU C 2  290  ? 12.158  -40.237 51.189  1.00   98.04  ? 290  LEU C O     1 
ATOM   5877  C  CB    . LEU C 2  290  ? 11.682  -37.210 51.823  1.00   80.76  ? 290  LEU C CB    1 
ATOM   5878  C  CG    . LEU C 2  290  ? 11.374  -35.998 52.703  1.00   82.30  ? 290  LEU C CG    1 
ATOM   5879  C  CD1   . LEU C 2  290  ? 10.253  -35.168 52.098  1.00   78.27  ? 290  LEU C CD1   1 
ATOM   5880  C  CD2   . LEU C 2  290  ? 11.027  -36.428 54.120  1.00   81.56  ? 290  LEU C CD2   1 
ATOM   5881  N  N     . ALA C 2  291  ? 14.070  -39.189 50.636  1.00   105.28 ? 291  ALA C N     1 
ATOM   5882  C  CA    . ALA C 2  291  ? 14.449  -40.175 49.631  1.00   101.01 ? 291  ALA C CA    1 
ATOM   5883  C  C     . ALA C 2  291  ? 15.961  -40.188 49.425  1.00   103.78 ? 291  ALA C C     1 
ATOM   5884  O  O     . ALA C 2  291  ? 16.685  -39.409 50.044  1.00   103.25 ? 291  ALA C O     1 
ATOM   5885  C  CB    . ALA C 2  291  ? 13.733  -39.898 48.318  1.00   94.94  ? 291  ALA C CB    1 
ATOM   5886  N  N     . ARG C 2  292  ? 16.432  -41.075 48.554  1.00   112.09 ? 292  ARG C N     1 
ATOM   5887  C  CA    . ARG C 2  292  ? 17.863  -41.203 48.291  1.00   112.11 ? 292  ARG C CA    1 
ATOM   5888  C  C     . ARG C 2  292  ? 18.160  -41.278 46.798  1.00   111.38 ? 292  ARG C C     1 
ATOM   5889  O  O     . ARG C 2  292  ? 17.281  -41.581 45.991  1.00   107.61 ? 292  ARG C O     1 
ATOM   5890  C  CB    . ARG C 2  292  ? 18.423  -42.459 48.963  1.00   104.71 ? 292  ARG C CB    1 
ATOM   5891  C  CG    . ARG C 2  292  ? 18.173  -42.563 50.456  1.00   100.00 ? 292  ARG C CG    1 
ATOM   5892  C  CD    . ARG C 2  292  ? 18.441  -43.980 50.925  1.00   100.64 ? 292  ARG C CD    1 
ATOM   5893  N  NE    . ARG C 2  292  ? 17.670  -44.944 50.145  1.00   98.09  ? 292  ARG C NE    1 
ATOM   5894  C  CZ    . ARG C 2  292  ? 17.836  -46.261 50.205  1.00   102.45 ? 292  ARG C CZ    1 
ATOM   5895  N  NH1   . ARG C 2  292  ? 18.752  -46.781 51.010  1.00   108.60 ? 292  ARG C NH1   1 
ATOM   5896  N  NH2   . ARG C 2  292  ? 17.086  -47.058 49.457  1.00   103.15 ? 292  ARG C NH2   1 
ATOM   5897  N  N     . PHE C 2  293  ? 19.411  -41.004 46.442  1.00   115.11 ? 293  PHE C N     1 
ATOM   5898  C  CA    . PHE C 2  293  ? 19.900  -41.256 45.094  1.00   118.39 ? 293  PHE C CA    1 
ATOM   5899  C  C     . PHE C 2  293  ? 20.851  -42.443 45.175  1.00   118.34 ? 293  PHE C C     1 
ATOM   5900  O  O     . PHE C 2  293  ? 21.952  -42.333 45.715  1.00   111.54 ? 293  PHE C O     1 
ATOM   5901  C  CB    . PHE C 2  293  ? 20.626  -40.026 44.544  1.00   113.48 ? 293  PHE C CB    1 
ATOM   5902  C  CG    . PHE C 2  293  ? 20.995  -40.132 43.087  1.00   113.34 ? 293  PHE C CG    1 
ATOM   5903  C  CD1   . PHE C 2  293  ? 20.121  -39.697 42.104  1.00   110.79 ? 293  PHE C CD1   1 
ATOM   5904  C  CD2   . PHE C 2  293  ? 22.219  -40.657 42.702  1.00   112.65 ? 293  PHE C CD2   1 
ATOM   5905  C  CE1   . PHE C 2  293  ? 20.457  -39.789 40.765  1.00   109.34 ? 293  PHE C CE1   1 
ATOM   5906  C  CE2   . PHE C 2  293  ? 22.561  -40.753 41.364  1.00   108.20 ? 293  PHE C CE2   1 
ATOM   5907  C  CZ    . PHE C 2  293  ? 21.679  -40.318 40.395  1.00   112.29 ? 293  PHE C CZ    1 
ATOM   5908  N  N     . GLU C 2  294  ? 20.419  -43.579 44.641  1.00   115.64 ? 294  GLU C N     1 
ATOM   5909  C  CA    . GLU C 2  294  ? 21.194  -44.808 44.746  1.00   112.25 ? 294  GLU C CA    1 
ATOM   5910  C  C     . GLU C 2  294  ? 21.224  -45.565 43.422  1.00   120.90 ? 294  GLU C C     1 
ATOM   5911  O  O     . GLU C 2  294  ? 20.178  -45.864 42.843  1.00   118.99 ? 294  GLU C O     1 
ATOM   5912  C  CB    . GLU C 2  294  ? 20.634  -45.694 45.861  1.00   105.94 ? 294  GLU C CB    1 
ATOM   5913  C  CG    . GLU C 2  294  ? 21.402  -46.986 46.087  1.00   108.85 ? 294  GLU C CG    1 
ATOM   5914  C  CD    . GLU C 2  294  ? 20.881  -47.772 47.276  1.00   102.25 ? 294  GLU C CD    1 
ATOM   5915  O  OE1   . GLU C 2  294  ? 20.619  -48.983 47.122  1.00   97.06  ? 294  GLU C OE1   1 
ATOM   5916  O  OE2   . GLU C 2  294  ? 20.736  -47.179 48.366  1.00   96.19  ? 294  GLU C OE2   1 
ATOM   5917  N  N     . ASP C 2  295  ? 22.434  -45.862 42.953  1.00   123.35 ? 295  ASP C N     1 
ATOM   5918  C  CA    . ASP C 2  295  ? 22.649  -46.586 41.701  1.00   118.25 ? 295  ASP C CA    1 
ATOM   5919  C  C     . ASP C 2  295  ? 22.041  -45.877 40.490  1.00   120.45 ? 295  ASP C C     1 
ATOM   5920  O  O     . ASP C 2  295  ? 21.494  -46.518 39.592  1.00   122.83 ? 295  ASP C O     1 
ATOM   5921  C  CB    . ASP C 2  295  ? 22.138  -48.028 41.805  1.00   110.67 ? 295  ASP C CB    1 
ATOM   5922  C  CG    . ASP C 2  295  ? 22.857  -48.823 42.880  1.00   103.25 ? 295  ASP C CG    1 
ATOM   5923  O  OD1   . ASP C 2  295  ? 22.184  -49.573 43.619  1.00   98.22  ? 295  ASP C OD1   1 
ATOM   5924  O  OD2   . ASP C 2  295  ? 24.095  -48.698 42.987  1.00   98.55  ? 295  ASP C OD2   1 
ATOM   5925  N  N     . GLY C 2  296  ? 22.141  -44.551 40.476  1.00   116.45 ? 296  GLY C N     1 
ATOM   5926  C  CA    . GLY C 2  296  ? 21.710  -43.760 39.338  1.00   118.95 ? 296  GLY C CA    1 
ATOM   5927  C  C     . GLY C 2  296  ? 20.249  -43.351 39.352  1.00   116.58 ? 296  GLY C C     1 
ATOM   5928  O  O     . GLY C 2  296  ? 19.832  -42.504 38.562  1.00   119.60 ? 296  GLY C O     1 
ATOM   5929  N  N     . GLU C 2  297  ? 19.468  -43.947 40.247  1.00   111.27 ? 297  GLU C N     1 
ATOM   5930  C  CA    . GLU C 2  297  ? 18.042  -43.648 40.329  1.00   115.62 ? 297  GLU C CA    1 
ATOM   5931  C  C     . GLU C 2  297  ? 17.640  -43.163 41.721  1.00   120.41 ? 297  GLU C C     1 
ATOM   5932  O  O     . GLU C 2  297  ? 18.472  -43.081 42.624  1.00   118.93 ? 297  GLU C O     1 
ATOM   5933  C  CB    . GLU C 2  297  ? 17.216  -44.877 39.938  1.00   120.52 ? 297  GLU C CB    1 
ATOM   5934  C  CG    . GLU C 2  297  ? 17.473  -46.099 40.808  1.00   122.33 ? 297  GLU C CG    1 
ATOM   5935  C  CD    . GLU C 2  297  ? 16.632  -47.295 40.402  1.00   116.16 ? 297  GLU C CD    1 
ATOM   5936  O  OE1   . GLU C 2  297  ? 16.667  -48.317 41.119  1.00   114.91 ? 297  GLU C OE1   1 
ATOM   5937  O  OE2   . GLU C 2  297  ? 15.938  -47.213 39.366  1.00   104.08 ? 297  GLU C OE2   1 
ATOM   5938  N  N     . PHE C 2  298  ? 16.359  -42.844 41.886  1.00   120.59 ? 298  PHE C N     1 
ATOM   5939  C  CA    . PHE C 2  298  ? 15.840  -42.380 43.169  1.00   116.37 ? 298  PHE C CA    1 
ATOM   5940  C  C     . PHE C 2  298  ? 15.104  -43.498 43.907  1.00   117.33 ? 298  PHE C C     1 
ATOM   5941  O  O     . PHE C 2  298  ? 14.278  -44.197 43.322  1.00   113.06 ? 298  PHE C O     1 
ATOM   5942  C  CB    . PHE C 2  298  ? 14.908  -41.179 42.973  1.00   108.97 ? 298  PHE C CB    1 
ATOM   5943  C  CG    . PHE C 2  298  ? 15.614  -39.921 42.546  1.00   103.22 ? 298  PHE C CG    1 
ATOM   5944  C  CD1   . PHE C 2  298  ? 15.544  -39.480 41.235  1.00   107.68 ? 298  PHE C CD1   1 
ATOM   5945  C  CD2   . PHE C 2  298  ? 16.344  -39.177 43.459  1.00   101.66 ? 298  PHE C CD2   1 
ATOM   5946  C  CE1   . PHE C 2  298  ? 16.190  -38.321 40.842  1.00   111.22 ? 298  PHE C CE1   1 
ATOM   5947  C  CE2   . PHE C 2  298  ? 16.992  -38.018 43.073  1.00   97.95  ? 298  PHE C CE2   1 
ATOM   5948  C  CZ    . PHE C 2  298  ? 16.915  -37.590 41.763  1.00   104.12 ? 298  PHE C CZ    1 
ATOM   5949  N  N     . LYS C 2  299  ? 15.408  -43.661 45.193  1.00   117.33 ? 299  LYS C N     1 
ATOM   5950  C  CA    . LYS C 2  299  ? 14.747  -44.669 46.021  1.00   112.34 ? 299  LYS C CA    1 
ATOM   5951  C  C     . LYS C 2  299  ? 13.976  -44.017 47.173  1.00   111.25 ? 299  LYS C C     1 
ATOM   5952  O  O     . LYS C 2  299  ? 14.484  -43.115 47.839  1.00   110.81 ? 299  LYS C O     1 
ATOM   5953  C  CB    . LYS C 2  299  ? 15.766  -45.684 46.549  1.00   107.36 ? 299  LYS C CB    1 
ATOM   5954  C  CG    . LYS C 2  299  ? 16.508  -46.444 45.454  1.00   106.12 ? 299  LYS C CG    1 
ATOM   5955  C  CD    . LYS C 2  299  ? 17.418  -47.516 46.034  1.00   99.04  ? 299  LYS C CD    1 
ATOM   5956  C  CE    . LYS C 2  299  ? 18.146  -48.281 44.938  1.00   100.99 ? 299  LYS C CE    1 
ATOM   5957  N  NZ    . LYS C 2  299  ? 17.207  -48.923 43.976  1.00   98.92  ? 299  LYS C NZ    1 
ATOM   5958  N  N     . ASP C 2  300  ? 12.750  -44.485 47.401  1.00   114.38 ? 300  ASP C N     1 
ATOM   5959  C  CA    . ASP C 2  300  ? 11.830  -43.851 48.346  1.00   113.30 ? 300  ASP C CA    1 
ATOM   5960  C  C     . ASP C 2  300  ? 11.976  -44.350 49.783  1.00   111.59 ? 300  ASP C C     1 
ATOM   5961  O  O     . ASP C 2  300  ? 11.792  -45.533 50.073  1.00   113.59 ? 300  ASP C O     1 
ATOM   5962  C  CB    . ASP C 2  300  ? 10.385  -44.033 47.874  1.00   108.57 ? 300  ASP C CB    1 
ATOM   5963  C  CG    . ASP C 2  300  ? 9.370   -43.699 48.951  1.00   107.96 ? 300  ASP C CG    1 
ATOM   5964  O  OD1   . ASP C 2  300  ? 9.483   -42.621 49.574  1.00   102.56 ? 300  ASP C OD1   1 
ATOM   5965  O  OD2   . ASP C 2  300  ? 8.460   -44.522 49.187  1.00   110.78 ? 300  ASP C OD2   1 
ATOM   5966  N  N     . GLU C 2  301  ? 12.347  -43.432 50.667  1.00   105.04 ? 301  GLU C N     1 
ATOM   5967  C  CA    . GLU C 2  301  ? 12.429  -43.689 52.099  1.00   103.77 ? 301  GLU C CA    1 
ATOM   5968  C  C     . GLU C 2  301  ? 11.094  -43.520 52.828  1.00   106.95 ? 301  GLU C C     1 
ATOM   5969  O  O     . GLU C 2  301  ? 10.747  -44.299 53.718  1.00   109.22 ? 301  GLU C O     1 
ATOM   5970  C  CB    . GLU C 2  301  ? 13.471  -42.755 52.721  1.00   103.41 ? 301  GLU C CB    1 
ATOM   5971  C  CG    . GLU C 2  301  ? 14.914  -43.111 52.423  1.00   101.86 ? 301  GLU C CG    1 
ATOM   5972  C  CD    . GLU C 2  301  ? 15.498  -44.045 53.459  1.00   102.51 ? 301  GLU C CD    1 
ATOM   5973  O  OE1   . GLU C 2  301  ? 14.860  -45.076 53.765  1.00   101.72 ? 301  GLU C OE1   1 
ATOM   5974  O  OE2   . GLU C 2  301  ? 16.593  -43.736 53.974  1.00   98.11  ? 301  GLU C OE2   1 
ATOM   5975  N  N     . VAL C 2  302  ? 10.351  -42.493 52.431  1.00   107.37 ? 302  VAL C N     1 
ATOM   5976  C  CA    . VAL C 2  302  ? 9.257   -41.954 53.239  1.00   94.72  ? 302  VAL C CA    1 
ATOM   5977  C  C     . VAL C 2  302  ? 7.870   -41.937 52.583  1.00   85.95  ? 302  VAL C C     1 
ATOM   5978  O  O     . VAL C 2  302  ? 6.918   -42.456 53.153  1.00   81.22  ? 302  VAL C O     1 
ATOM   5979  C  CB    . VAL C 2  302  ? 9.610   -40.571 53.829  1.00   81.41  ? 302  VAL C CB    1 
ATOM   5980  C  CG1   . VAL C 2  302  ? 8.380   -39.933 54.446  1.00   60.20  ? 302  VAL C CG1   1 
ATOM   5981  C  CG2   . VAL C 2  302  ? 10.716  -40.706 54.868  1.00   78.57  ? 302  VAL C CG2   1 
ATOM   5982  N  N     . PHE C 2  303  ? 7.765   -41.293 51.420  1.00   89.27  ? 303  PHE C N     1 
ATOM   5983  C  CA    . PHE C 2  303  ? 6.484   -40.922 50.804  1.00   84.87  ? 303  PHE C CA    1 
ATOM   5984  C  C     . PHE C 2  303  ? 5.396   -41.995 50.803  1.00   88.81  ? 303  PHE C C     1 
ATOM   5985  O  O     . PHE C 2  303  ? 4.233   -41.705 51.094  1.00   89.12  ? 303  PHE C O     1 
ATOM   5986  C  CB    . PHE C 2  303  ? 6.702   -40.431 49.364  1.00   79.70  ? 303  PHE C CB    1 
ATOM   5987  C  CG    . PHE C 2  303  ? 7.324   -39.072 49.277  1.00   84.37  ? 303  PHE C CG    1 
ATOM   5988  C  CD1   . PHE C 2  303  ? 8.699   -38.926 49.322  1.00   84.13  ? 303  PHE C CD1   1 
ATOM   5989  C  CD2   . PHE C 2  303  ? 6.536   -37.938 49.169  1.00   83.69  ? 303  PHE C CD2   1 
ATOM   5990  C  CE1   . PHE C 2  303  ? 9.280   -37.675 49.253  1.00   82.60  ? 303  PHE C CE1   1 
ATOM   5991  C  CE2   . PHE C 2  303  ? 7.113   -36.680 49.100  1.00   84.52  ? 303  PHE C CE2   1 
ATOM   5992  C  CZ    . PHE C 2  303  ? 8.487   -36.551 49.142  1.00   83.66  ? 303  PHE C CZ    1 
ATOM   5993  N  N     . LEU C 2  304  ? 5.769   -43.233 50.496  1.00   94.95  ? 304  LEU C N     1 
ATOM   5994  C  CA    . LEU C 2  304  ? 4.778   -44.309 50.420  1.00   95.75  ? 304  LEU C CA    1 
ATOM   5995  C  C     . LEU C 2  304  ? 4.117   -44.670 51.762  1.00   88.64  ? 304  LEU C C     1 
ATOM   5996  O  O     . LEU C 2  304  ? 2.895   -44.755 51.824  1.00   83.60  ? 304  LEU C O     1 
ATOM   5997  C  CB    . LEU C 2  304  ? 5.319   -45.549 49.693  1.00   96.12  ? 304  LEU C CB    1 
ATOM   5998  C  CG    . LEU C 2  304  ? 4.361   -46.739 49.630  1.00   86.82  ? 304  LEU C CG    1 
ATOM   5999  C  CD1   . LEU C 2  304  ? 3.113   -46.384 48.835  1.00   81.23  ? 304  LEU C CD1   1 
ATOM   6000  C  CD2   . LEU C 2  304  ? 5.052   -47.954 49.035  1.00   89.61  ? 304  LEU C CD2   1 
ATOM   6001  N  N     . PRO C 2  305  ? 4.911   -44.900 52.830  1.00   86.87  ? 305  PRO C N     1 
ATOM   6002  C  CA    . PRO C 2  305  ? 4.296   -45.015 54.159  1.00   86.46  ? 305  PRO C CA    1 
ATOM   6003  C  C     . PRO C 2  305  ? 3.450   -43.805 54.567  1.00   84.11  ? 305  PRO C C     1 
ATOM   6004  O  O     . PRO C 2  305  ? 2.465   -43.978 55.282  1.00   86.05  ? 305  PRO C O     1 
ATOM   6005  C  CB    . PRO C 2  305  ? 5.507   -45.136 55.078  1.00   86.40  ? 305  PRO C CB    1 
ATOM   6006  C  CG    . PRO C 2  305  ? 6.499   -45.859 54.257  1.00   83.10  ? 305  PRO C CG    1 
ATOM   6007  C  CD    . PRO C 2  305  ? 6.308   -45.378 52.846  1.00   83.72  ? 305  PRO C CD    1 
ATOM   6008  N  N     . THR C 2  306  ? 3.826   -42.607 54.127  1.00   87.76  ? 306  THR C N     1 
ATOM   6009  C  CA    . THR C 2  306  ? 3.076   -41.401 54.477  1.00   86.74  ? 306  THR C CA    1 
ATOM   6010  C  C     . THR C 2  306  ? 1.708   -41.390 53.804  1.00   90.94  ? 306  THR C C     1 
ATOM   6011  O  O     . THR C 2  306  ? 0.689   -41.142 54.451  1.00   92.22  ? 306  THR C O     1 
ATOM   6012  C  CB    . THR C 2  306  ? 3.837   -40.115 54.099  1.00   80.56  ? 306  THR C CB    1 
ATOM   6013  O  OG1   . THR C 2  306  ? 5.013   -40.000 54.907  1.00   86.55  ? 306  THR C OG1   1 
ATOM   6014  C  CG2   . THR C 2  306  ? 2.961   -38.891 54.322  1.00   65.06  ? 306  THR C CG2   1 
ATOM   6015  N  N     . LEU C 2  307  ? 1.694   -41.661 52.502  1.00   89.59  ? 307  LEU C N     1 
ATOM   6016  C  CA    . LEU C 2  307  ? 0.451   -41.745 51.743  1.00   83.92  ? 307  LEU C CA    1 
ATOM   6017  C  C     . LEU C 2  307  ? -0.417  -42.876 52.282  1.00   89.94  ? 307  LEU C C     1 
ATOM   6018  O  O     . LEU C 2  307  ? -1.644  -42.759 52.359  1.00   94.00  ? 307  LEU C O     1 
ATOM   6019  C  CB    . LEU C 2  307  ? 0.755   -41.977 50.264  1.00   80.99  ? 307  LEU C CB    1 
ATOM   6020  C  CG    . LEU C 2  307  ? -0.443  -42.018 49.319  1.00   90.60  ? 307  LEU C CG    1 
ATOM   6021  C  CD1   . LEU C 2  307  ? -1.196  -40.700 49.365  1.00   87.06  ? 307  LEU C CD1   1 
ATOM   6022  C  CD2   . LEU C 2  307  ? 0.012   -42.333 47.904  1.00   97.24  ? 307  LEU C CD2   1 
ATOM   6023  N  N     . ARG C 2  308  ? 0.243   -43.969 52.654  1.00   91.65  ? 308  ARG C N     1 
ATOM   6024  C  CA    . ARG C 2  308  ? -0.412  -45.131 53.238  1.00   92.78  ? 308  ARG C CA    1 
ATOM   6025  C  C     . ARG C 2  308  ? -1.138  -44.729 54.520  1.00   94.82  ? 308  ARG C C     1 
ATOM   6026  O  O     . ARG C 2  308  ? -2.315  -45.046 54.704  1.00   93.83  ? 308  ARG C O     1 
ATOM   6027  C  CB    . ARG C 2  308  ? 0.630   -46.221 53.520  1.00   88.53  ? 308  ARG C CB    1 
ATOM   6028  C  CG    . ARG C 2  308  ? 0.082   -47.630 53.709  1.00   88.62  ? 308  ARG C CG    1 
ATOM   6029  C  CD    . ARG C 2  308  ? -0.345  -47.877 55.146  1.00   96.98  ? 308  ARG C CD    1 
ATOM   6030  N  NE    . ARG C 2  308  ? 0.660   -47.414 56.098  1.00   95.66  ? 308  ARG C NE    1 
ATOM   6031  C  CZ    . ARG C 2  308  ? 0.459   -47.316 57.408  1.00   99.63  ? 308  ARG C CZ    1 
ATOM   6032  N  NH1   . ARG C 2  308  ? -0.715  -47.649 57.928  1.00   102.93 ? 308  ARG C NH1   1 
ATOM   6033  N  NH2   . ARG C 2  308  ? 1.431   -46.882 58.199  1.00   93.40  ? 308  ARG C NH2   1 
ATOM   6034  N  N     . TYR C 2  309  ? -0.432  -44.018 55.397  1.00   96.10  ? 309  TYR C N     1 
ATOM   6035  C  CA    . TYR C 2  309  ? -1.006  -43.562 56.658  1.00   89.80  ? 309  TYR C CA    1 
ATOM   6036  C  C     . TYR C 2  309  ? -2.144  -42.575 56.414  1.00   90.10  ? 309  TYR C C     1 
ATOM   6037  O  O     . TYR C 2  309  ? -3.136  -42.574 57.140  1.00   93.55  ? 309  TYR C O     1 
ATOM   6038  C  CB    . TYR C 2  309  ? 0.067   -42.920 57.545  1.00   87.90  ? 309  TYR C CB    1 
ATOM   6039  C  CG    . TYR C 2  309  ? -0.319  -42.811 59.007  1.00   84.06  ? 309  TYR C CG    1 
ATOM   6040  C  CD1   . TYR C 2  309  ? 0.202   -43.688 59.949  1.00   88.36  ? 309  TYR C CD1   1 
ATOM   6041  C  CD2   . TYR C 2  309  ? -1.207  -41.835 59.445  1.00   79.71  ? 309  TYR C CD2   1 
ATOM   6042  C  CE1   . TYR C 2  309  ? -0.147  -43.594 61.286  1.00   85.51  ? 309  TYR C CE1   1 
ATOM   6043  C  CE2   . TYR C 2  309  ? -1.562  -41.734 60.777  1.00   82.06  ? 309  TYR C CE2   1 
ATOM   6044  C  CZ    . TYR C 2  309  ? -1.030  -42.616 61.693  1.00   77.62  ? 309  TYR C CZ    1 
ATOM   6045  O  OH    . TYR C 2  309  ? -1.381  -42.519 63.021  1.00   71.50  ? 309  TYR C OH    1 
ATOM   6046  N  N     . LEU C 2  310  ? -1.994  -41.736 55.392  1.00   88.71  ? 310  LEU C N     1 
ATOM   6047  C  CA    . LEU C 2  310  ? -3.024  -40.760 55.050  1.00   89.53  ? 310  LEU C CA    1 
ATOM   6048  C  C     . LEU C 2  310  ? -4.323  -41.448 54.641  1.00   92.53  ? 310  LEU C C     1 
ATOM   6049  O  O     . LEU C 2  310  ? -5.393  -41.143 55.174  1.00   88.49  ? 310  LEU C O     1 
ATOM   6050  C  CB    . LEU C 2  310  ? -2.546  -39.832 53.931  1.00   86.62  ? 310  LEU C CB    1 
ATOM   6051  C  CG    . LEU C 2  310  ? -3.579  -38.832 53.403  1.00   81.40  ? 310  LEU C CG    1 
ATOM   6052  C  CD1   . LEU C 2  310  ? -4.058  -37.908 54.515  1.00   75.13  ? 310  LEU C CD1   1 
ATOM   6053  C  CD2   . LEU C 2  310  ? -3.012  -38.032 52.238  1.00   84.33  ? 310  LEU C CD2   1 
ATOM   6054  N  N     . PHE C 2  311  ? -4.221  -42.377 53.694  1.00   99.20  ? 311  PHE C N     1 
ATOM   6055  C  CA    . PHE C 2  311  ? -5.389  -43.124 53.240  1.00   99.86  ? 311  PHE C CA    1 
ATOM   6056  C  C     . PHE C 2  311  ? -5.988  -43.944 54.381  1.00   97.75  ? 311  PHE C C     1 
ATOM   6057  O  O     . PHE C 2  311  ? -7.208  -44.090 54.478  1.00   97.42  ? 311  PHE C O     1 
ATOM   6058  C  CB    . PHE C 2  311  ? -5.032  -44.030 52.056  1.00   103.35 ? 311  PHE C CB    1 
ATOM   6059  C  CG    . PHE C 2  311  ? -4.796  -43.287 50.767  1.00   103.12 ? 311  PHE C CG    1 
ATOM   6060  C  CD1   . PHE C 2  311  ? -5.202  -41.969 50.625  1.00   104.54 ? 311  PHE C CD1   1 
ATOM   6061  C  CD2   . PHE C 2  311  ? -4.174  -43.908 49.696  1.00   104.15 ? 311  PHE C CD2   1 
ATOM   6062  C  CE1   . PHE C 2  311  ? -4.987  -41.284 49.441  1.00   99.58  ? 311  PHE C CE1   1 
ATOM   6063  C  CE2   . PHE C 2  311  ? -3.958  -43.228 48.510  1.00   107.67 ? 311  PHE C CE2   1 
ATOM   6064  C  CZ    . PHE C 2  311  ? -4.365  -41.915 48.383  1.00   101.90 ? 311  PHE C CZ    1 
ATOM   6065  N  N     . ALA C 2  312  ? -5.122  -44.466 55.247  1.00   100.63 ? 312  ALA C N     1 
ATOM   6066  C  CA    . ALA C 2  312  ? -5.562  -45.259 56.391  1.00   98.35  ? 312  ALA C CA    1 
ATOM   6067  C  C     . ALA C 2  312  ? -6.357  -44.424 57.393  1.00   93.25  ? 312  ALA C C     1 
ATOM   6068  O  O     . ALA C 2  312  ? -7.337  -44.895 57.969  1.00   90.20  ? 312  ALA C O     1 
ATOM   6069  C  CB    . ALA C 2  312  ? -4.371  -45.915 57.071  1.00   92.03  ? 312  ALA C CB    1 
ATOM   6070  N  N     . LEU C 2  313  ? -5.926  -43.184 57.598  1.00   94.37  ? 313  LEU C N     1 
ATOM   6071  C  CA    . LEU C 2  313  ? -6.618  -42.276 58.503  1.00   93.24  ? 313  LEU C CA    1 
ATOM   6072  C  C     . LEU C 2  313  ? -7.932  -41.814 57.887  1.00   93.44  ? 313  LEU C C     1 
ATOM   6073  O  O     . LEU C 2  313  ? -8.941  -41.681 58.581  1.00   94.39  ? 313  LEU C O     1 
ATOM   6074  C  CB    . LEU C 2  313  ? -5.735  -41.070 58.834  1.00   95.43  ? 313  LEU C CB    1 
ATOM   6075  C  CG    . LEU C 2  313  ? -6.344  -39.987 59.729  1.00   90.59  ? 313  LEU C CG    1 
ATOM   6076  C  CD1   . LEU C 2  313  ? -6.706  -40.549 61.096  1.00   85.15  ? 313  LEU C CD1   1 
ATOM   6077  C  CD2   . LEU C 2  313  ? -5.396  -38.807 59.866  1.00   78.73  ? 313  LEU C CD2   1 
ATOM   6078  N  N     . THR C 2  314  ? -7.914  -41.573 56.579  1.00   95.29  ? 314  THR C N     1 
ATOM   6079  C  CA    . THR C 2  314  ? -9.105  -41.117 55.871  1.00   97.42  ? 314  THR C CA    1 
ATOM   6080  C  C     . THR C 2  314  ? -10.196 -42.186 55.870  1.00   100.23 ? 314  THR C C     1 
ATOM   6081  O  O     . THR C 2  314  ? -11.372 -41.886 56.083  1.00   92.71  ? 314  THR C O     1 
ATOM   6082  C  CB    . THR C 2  314  ? -8.781  -40.716 54.417  1.00   90.61  ? 314  THR C CB    1 
ATOM   6083  O  OG1   . THR C 2  314  ? -7.707  -39.768 54.409  1.00   91.25  ? 314  THR C OG1   1 
ATOM   6084  C  CG2   . THR C 2  314  ? -9.999  -40.099 53.746  1.00   87.77  ? 314  THR C CG2   1 
ATOM   6085  N  N     . ALA C 2  315  ? -9.798  -43.434 55.640  1.00   102.70 ? 315  ALA C N     1 
ATOM   6086  C  CA    . ALA C 2  315  ? -10.747 -44.542 55.562  1.00   96.98  ? 315  ALA C CA    1 
ATOM   6087  C  C     . ALA C 2  315  ? -11.393 -44.858 56.910  1.00   91.84  ? 315  ALA C C     1 
ATOM   6088  O  O     . ALA C 2  315  ? -12.513 -45.366 56.964  1.00   92.39  ? 315  ALA C O     1 
ATOM   6089  C  CB    . ALA C 2  315  ? -10.070 -45.783 54.992  1.00   92.09  ? 315  ALA C CB    1 
ATOM   6090  N  N     . GLY C 2  316  ? -10.687 -44.553 57.994  1.00   87.11  ? 316  GLY C N     1 
ATOM   6091  C  CA    . GLY C 2  316  ? -11.192 -44.826 59.326  1.00   81.31  ? 316  GLY C CA    1 
ATOM   6092  C  C     . GLY C 2  316  ? -10.563 -46.056 59.949  1.00   85.36  ? 316  GLY C C     1 
ATOM   6093  O  O     . GLY C 2  316  ? -11.009 -46.528 60.995  1.00   94.06  ? 316  GLY C O     1 
ATOM   6094  N  N     . VAL C 2  317  ? -9.528  -46.579 59.295  1.00   86.65  ? 317  VAL C N     1 
ATOM   6095  C  CA    . VAL C 2  317  ? -8.804  -47.752 59.779  1.00   84.85  ? 317  VAL C CA    1 
ATOM   6096  C  C     . VAL C 2  317  ? -8.242  -47.524 61.183  1.00   86.97  ? 317  VAL C C     1 
ATOM   6097  O  O     . VAL C 2  317  ? -7.541  -46.540 61.420  1.00   89.66  ? 317  VAL C O     1 
ATOM   6098  C  CB    . VAL C 2  317  ? -7.656  -48.132 58.819  1.00   82.15  ? 317  VAL C CB    1 
ATOM   6099  C  CG1   . VAL C 2  317  ? -6.878  -49.324 59.353  1.00   86.02  ? 317  VAL C CG1   1 
ATOM   6100  C  CG2   . VAL C 2  317  ? -8.203  -48.425 57.429  1.00   78.43  ? 317  VAL C CG2   1 
ATOM   6101  N  N     . PRO C 2  318  ? -8.560  -48.435 62.119  1.00   91.12  ? 318  PRO C N     1 
ATOM   6102  C  CA    . PRO C 2  318  ? -8.158  -48.344 63.529  1.00   89.97  ? 318  PRO C CA    1 
ATOM   6103  C  C     . PRO C 2  318  ? -6.646  -48.243 63.714  1.00   92.12  ? 318  PRO C C     1 
ATOM   6104  O  O     . PRO C 2  318  ? -5.892  -48.906 63.003  1.00   95.08  ? 318  PRO C O     1 
ATOM   6105  C  CB    . PRO C 2  318  ? -8.665  -49.663 64.120  1.00   87.93  ? 318  PRO C CB    1 
ATOM   6106  C  CG    . PRO C 2  318  ? -9.788  -50.064 63.236  1.00   96.11  ? 318  PRO C CG    1 
ATOM   6107  C  CD    . PRO C 2  318  ? -9.399  -49.619 61.862  1.00   94.43  ? 318  PRO C CD    1 
ATOM   6108  N  N     . GLY C 2  319  ? -6.218  -47.426 64.672  1.00   96.74  ? 319  GLY C N     1 
ATOM   6109  C  CA    . GLY C 2  319  ? -4.805  -47.248 64.954  1.00   95.43  ? 319  GLY C CA    1 
ATOM   6110  C  C     . GLY C 2  319  ? -4.177  -46.070 64.233  1.00   92.30  ? 319  GLY C C     1 
ATOM   6111  O  O     . GLY C 2  319  ? -2.957  -46.010 64.075  1.00   86.50  ? 319  GLY C O     1 
ATOM   6112  N  N     . HIS C 2  320  ? -5.010  -45.131 63.793  1.00   95.59  ? 320  HIS C N     1 
ATOM   6113  C  CA    . HIS C 2  320  ? -4.528  -43.933 63.112  1.00   88.04  ? 320  HIS C CA    1 
ATOM   6114  C  C     . HIS C 2  320  ? -5.166  -42.676 63.695  1.00   85.36  ? 320  HIS C C     1 
ATOM   6115  O  O     . HIS C 2  320  ? -6.390  -42.545 63.731  1.00   81.88  ? 320  HIS C O     1 
ATOM   6116  C  CB    . HIS C 2  320  ? -4.794  -44.026 61.608  1.00   83.40  ? 320  HIS C CB    1 
ATOM   6117  C  CG    . HIS C 2  320  ? -4.160  -45.217 60.960  1.00   82.66  ? 320  HIS C CG    1 
ATOM   6118  N  ND1   . HIS C 2  320  ? -4.757  -46.459 60.939  1.00   83.19  ? 320  HIS C ND1   1 
ATOM   6119  C  CD2   . HIS C 2  320  ? -2.975  -45.359 60.320  1.00   87.45  ? 320  HIS C CD2   1 
ATOM   6120  C  CE1   . HIS C 2  320  ? -3.971  -47.313 60.308  1.00   83.62  ? 320  HIS C CE1   1 
ATOM   6121  N  NE2   . HIS C 2  320  ? -2.883  -46.671 59.924  1.00   84.65  ? 320  HIS C NE2   1 
ATOM   6122  N  N     . GLU C 2  321  ? -4.326  -41.752 64.150  1.00   83.74  ? 321  GLU C N     1 
ATOM   6123  C  CA    . GLU C 2  321  ? -4.800  -40.567 64.855  1.00   79.90  ? 321  GLU C CA    1 
ATOM   6124  C  C     . GLU C 2  321  ? -4.350  -39.276 64.187  1.00   75.38  ? 321  GLU C C     1 
ATOM   6125  O  O     . GLU C 2  321  ? -3.299  -39.228 63.550  1.00   69.11  ? 321  GLU C O     1 
ATOM   6126  C  CB    . GLU C 2  321  ? -4.283  -40.576 66.293  1.00   76.44  ? 321  GLU C CB    1 
ATOM   6127  C  CG    . GLU C 2  321  ? -4.610  -41.832 67.074  1.00   84.93  ? 321  GLU C CG    1 
ATOM   6128  C  CD    . GLU C 2  321  ? -3.805  -41.933 68.353  1.00   86.56  ? 321  GLU C CD    1 
ATOM   6129  O  OE1   . GLU C 2  321  ? -2.632  -41.502 68.348  1.00   81.30  ? 321  GLU C OE1   1 
ATOM   6130  O  OE2   . GLU C 2  321  ? -4.344  -42.434 69.362  1.00   80.49  ? 321  GLU C OE2   1 
ATOM   6131  N  N     . VAL C 2  322  ? -5.155  -38.230 64.343  1.00   74.11  ? 322  VAL C N     1 
ATOM   6132  C  CA    . VAL C 2  322  ? -4.732  -36.887 63.981  1.00   67.25  ? 322  VAL C CA    1 
ATOM   6133  C  C     . VAL C 2  322  ? -3.817  -36.374 65.085  1.00   68.50  ? 322  VAL C C     1 
ATOM   6134  O  O     . VAL C 2  322  ? -3.909  -36.821 66.229  1.00   74.58  ? 322  VAL C O     1 
ATOM   6135  C  CB    . VAL C 2  322  ? -5.927  -35.936 63.803  1.00   64.77  ? 322  VAL C CB    1 
ATOM   6136  C  CG1   . VAL C 2  322  ? -6.760  -36.357 62.604  1.00   71.46  ? 322  VAL C CG1   1 
ATOM   6137  C  CG2   . VAL C 2  322  ? -6.779  -35.910 65.062  1.00   72.82  ? 322  VAL C CG2   1 
ATOM   6138  N  N     . ASP C 2  323  ? -2.929  -35.446 64.749  1.00   65.54  ? 323  ASP C N     1 
ATOM   6139  C  CA    . ASP C 2  323  ? -1.920  -35.003 65.703  1.00   62.23  ? 323  ASP C CA    1 
ATOM   6140  C  C     . ASP C 2  323  ? -2.216  -33.642 66.324  1.00   55.88  ? 323  ASP C C     1 
ATOM   6141  O  O     . ASP C 2  323  ? -2.752  -32.747 65.670  1.00   53.93  ? 323  ASP C O     1 
ATOM   6142  C  CB    . ASP C 2  323  ? -0.534  -34.997 65.056  1.00   64.41  ? 323  ASP C CB    1 
ATOM   6143  C  CG    . ASP C 2  323  ? -0.094  -36.377 64.614  1.00   72.64  ? 323  ASP C CG    1 
ATOM   6144  O  OD1   . ASP C 2  323  ? 0.382   -37.152 65.472  1.00   74.03  ? 323  ASP C OD1   1 
ATOM   6145  O  OD2   . ASP C 2  323  ? -0.224  -36.685 63.410  1.00   71.95  ? 323  ASP C OD2   1 
ATOM   6146  N  N     . ASP C 2  324  ? -1.858  -33.506 67.597  1.00   54.65  ? 324  ASP C N     1 
ATOM   6147  C  CA    . ASP C 2  324  ? -1.970  -32.242 68.308  1.00   52.64  ? 324  ASP C CA    1 
ATOM   6148  C  C     . ASP C 2  324  ? -0.630  -31.528 68.190  1.00   50.68  ? 324  ASP C C     1 
ATOM   6149  O  O     . ASP C 2  324  ? 0.366   -31.971 68.758  1.00   51.40  ? 324  ASP C O     1 
ATOM   6150  C  CB    . ASP C 2  324  ? -2.299  -32.502 69.780  1.00   43.40  ? 324  ASP C CB    1 
ATOM   6151  C  CG    . ASP C 2  324  ? -2.748  -31.253 70.515  1.00   43.62  ? 324  ASP C CG    1 
ATOM   6152  O  OD1   . ASP C 2  324  ? -2.549  -30.138 69.990  1.00   50.27  ? 324  ASP C OD1   1 
ATOM   6153  O  OD2   . ASP C 2  324  ? -3.299  -31.388 71.628  1.00   39.53  ? 324  ASP C OD2   1 
ATOM   6154  N  N     . ILE C 2  325  ? -0.603  -30.421 67.454  1.00   47.18  ? 325  ILE C N     1 
ATOM   6155  C  CA    . ILE C 2  325  ? 0.651   -29.721 67.195  1.00   48.13  ? 325  ILE C CA    1 
ATOM   6156  C  C     . ILE C 2  325  ? 1.098   -28.870 68.380  1.00   46.35  ? 325  ILE C C     1 
ATOM   6157  O  O     . ILE C 2  325  ? 2.229   -28.387 68.414  1.00   44.87  ? 325  ILE C O     1 
ATOM   6158  C  CB    . ILE C 2  325  ? 0.566   -28.843 65.933  1.00   49.02  ? 325  ILE C CB    1 
ATOM   6159  C  CG1   . ILE C 2  325  ? -0.459  -27.724 66.126  1.00   58.17  ? 325  ILE C CG1   1 
ATOM   6160  C  CG2   . ILE C 2  325  ? 0.214   -29.692 64.723  1.00   52.46  ? 325  ILE C CG2   1 
ATOM   6161  C  CD1   . ILE C 2  325  ? -0.573  -26.790 64.938  1.00   59.91  ? 325  ILE C CD1   1 
ATOM   6162  N  N     . ASP C 2  326  ? 0.205   -28.685 69.347  1.00   44.33  ? 326  ASP C N     1 
ATOM   6163  C  CA    . ASP C 2  326  ? 0.534   -27.934 70.551  1.00   44.00  ? 326  ASP C CA    1 
ATOM   6164  C  C     . ASP C 2  326  ? 0.980   -28.870 71.669  1.00   42.61  ? 326  ASP C C     1 
ATOM   6165  O  O     . ASP C 2  326  ? 1.377   -28.424 72.747  1.00   42.64  ? 326  ASP C O     1 
ATOM   6166  C  CB    . ASP C 2  326  ? -0.662  -27.093 71.000  1.00   52.15  ? 326  ASP C CB    1 
ATOM   6167  C  CG    . ASP C 2  326  ? -1.004  -25.993 70.012  1.00   53.18  ? 326  ASP C CG    1 
ATOM   6168  O  OD1   . ASP C 2  326  ? -0.074  -25.299 69.547  1.00   52.36  ? 326  ASP C OD1   1 
ATOM   6169  O  OD2   . ASP C 2  326  ? -2.202  -25.825 69.697  1.00   50.96  ? 326  ASP C OD2   1 
ATOM   6170  N  N     . HIS C 2  327  ? 0.912   -30.170 71.398  1.00   40.31  ? 327  HIS C N     1 
ATOM   6171  C  CA    . HIS C 2  327  ? 1.393   -31.188 72.322  1.00   39.18  ? 327  HIS C CA    1 
ATOM   6172  C  C     . HIS C 2  327  ? 2.894   -30.992 72.473  1.00   37.21  ? 327  HIS C C     1 
ATOM   6173  O  O     . HIS C 2  327  ? 3.568   -30.612 71.517  1.00   39.46  ? 327  HIS C O     1 
ATOM   6174  C  CB    . HIS C 2  327  ? 1.097   -32.577 71.752  1.00   41.72  ? 327  HIS C CB    1 
ATOM   6175  C  CG    . HIS C 2  327  ? 1.101   -33.677 72.769  1.00   39.36  ? 327  HIS C CG    1 
ATOM   6176  N  ND1   . HIS C 2  327  ? 2.257   -34.299 73.192  1.00   38.90  ? 327  HIS C ND1   1 
ATOM   6177  C  CD2   . HIS C 2  327  ? 0.086   -34.289 73.424  1.00   40.31  ? 327  HIS C CD2   1 
ATOM   6178  C  CE1   . HIS C 2  327  ? 1.954   -35.235 74.073  1.00   38.32  ? 327  HIS C CE1   1 
ATOM   6179  N  NE2   . HIS C 2  327  ? 0.643   -35.250 74.231  1.00   35.06  ? 327  HIS C NE2   1 
ATOM   6180  N  N     . LEU C 2  328  ? 3.423   -31.246 73.665  1.00   35.69  ? 328  LEU C N     1 
ATOM   6181  C  CA    . LEU C 2  328  ? 4.849   -31.039 73.907  1.00   37.18  ? 328  LEU C CA    1 
ATOM   6182  C  C     . LEU C 2  328  ? 5.688   -32.213 73.410  1.00   33.30  ? 328  LEU C C     1 
ATOM   6183  O  O     . LEU C 2  328  ? 6.912   -32.216 73.540  1.00   28.02  ? 328  LEU C O     1 
ATOM   6184  C  CB    . LEU C 2  328  ? 5.130   -30.748 75.384  1.00   34.97  ? 328  LEU C CB    1 
ATOM   6185  C  CG    . LEU C 2  328  ? 4.883   -29.304 75.826  1.00   29.08  ? 328  LEU C CG    1 
ATOM   6186  C  CD1   . LEU C 2  328  ? 5.406   -29.074 77.233  1.00   33.40  ? 328  LEU C CD1   1 
ATOM   6187  C  CD2   . LEU C 2  328  ? 5.521   -28.327 74.850  1.00   26.22  ? 328  LEU C CD2   1 
ATOM   6188  N  N     . GLY C 2  329  ? 5.014   -33.214 72.853  1.00   34.97  ? 329  GLY C N     1 
ATOM   6189  C  CA    . GLY C 2  329  ? 5.686   -34.290 72.153  1.00   38.98  ? 329  GLY C CA    1 
ATOM   6190  C  C     . GLY C 2  329  ? 5.908   -33.901 70.703  1.00   41.10  ? 329  GLY C C     1 
ATOM   6191  O  O     . GLY C 2  329  ? 6.818   -34.404 70.045  1.00   43.84  ? 329  GLY C O     1 
ATOM   6192  N  N     . ASN C 2  330  ? 5.057   -33.008 70.204  1.00   38.94  ? 330  ASN C N     1 
ATOM   6193  C  CA    . ASN C 2  330  ? 5.187   -32.488 68.846  1.00   40.18  ? 330  ASN C CA    1 
ATOM   6194  C  C     . ASN C 2  330  ? 5.889   -31.129 68.759  1.00   41.01  ? 330  ASN C C     1 
ATOM   6195  O  O     . ASN C 2  330  ? 6.073   -30.590 67.668  1.00   42.04  ? 330  ASN C O     1 
ATOM   6196  C  CB    . ASN C 2  330  ? 3.820   -32.433 68.159  1.00   43.64  ? 330  ASN C CB    1 
ATOM   6197  C  CG    . ASN C 2  330  ? 3.221   -33.811 67.944  1.00   44.43  ? 330  ASN C CG    1 
ATOM   6198  O  OD1   . ASN C 2  330  ? 3.933   -34.814 67.929  1.00   42.11  ? 330  ASN C OD1   1 
ATOM   6199  N  ND2   . ASN C 2  330  ? 1.906   -33.865 67.768  1.00   54.76  ? 330  ASN C ND2   1 
ATOM   6200  N  N     . ARG C 2  331  ? 6.265   -30.575 69.910  1.00   39.26  ? 331  ARG C N     1 
ATOM   6201  C  CA    . ARG C 2  331  ? 7.037   -29.334 69.955  1.00   37.69  ? 331  ARG C CA    1 
ATOM   6202  C  C     . ARG C 2  331  ? 8.367   -29.569 70.656  1.00   34.79  ? 331  ARG C C     1 
ATOM   6203  O  O     . ARG C 2  331  ? 8.440   -30.325 71.623  1.00   34.08  ? 331  ARG C O     1 
ATOM   6204  C  CB    . ARG C 2  331  ? 6.264   -28.222 70.669  1.00   36.23  ? 331  ARG C CB    1 
ATOM   6205  C  CG    . ARG C 2  331  ? 5.065   -27.699 69.899  1.00   43.54  ? 331  ARG C CG    1 
ATOM   6206  C  CD    . ARG C 2  331  ? 4.303   -26.647 70.694  1.00   47.94  ? 331  ARG C CD    1 
ATOM   6207  N  NE    . ARG C 2  331  ? 5.007   -25.369 70.754  1.00   42.08  ? 331  ARG C NE    1 
ATOM   6208  C  CZ    . ARG C 2  331  ? 4.512   -24.271 71.318  1.00   47.90  ? 331  ARG C CZ    1 
ATOM   6209  N  NH1   . ARG C 2  331  ? 3.309   -24.293 71.876  1.00   53.04  ? 331  ARG C NH1   1 
ATOM   6210  N  NH2   . ARG C 2  331  ? 5.219   -23.150 71.326  1.00   49.39  ? 331  ARG C NH2   1 
ATOM   6211  N  N     . ARG C 2  332  ? 9.418   -28.917 70.172  1.00   36.35  ? 332  ARG C N     1 
ATOM   6212  C  CA    . ARG C 2  332  ? 10.748  -29.124 70.733  1.00   34.92  ? 332  ARG C CA    1 
ATOM   6213  C  C     . ARG C 2  332  ? 11.473  -27.814 71.012  1.00   33.79  ? 332  ARG C C     1 
ATOM   6214  O  O     . ARG C 2  332  ? 11.057  -26.746 70.554  1.00   37.62  ? 332  ARG C O     1 
ATOM   6215  C  CB    . ARG C 2  332  ? 11.593  -30.009 69.813  1.00   40.59  ? 332  ARG C CB    1 
ATOM   6216  C  CG    . ARG C 2  332  ? 11.798  -29.440 68.422  1.00   39.13  ? 332  ARG C CG    1 
ATOM   6217  C  CD    . ARG C 2  332  ? 12.726  -30.316 67.597  1.00   39.91  ? 332  ARG C CD    1 
ATOM   6218  N  NE    . ARG C 2  332  ? 14.030  -30.475 68.234  1.00   44.73  ? 332  ARG C NE    1 
ATOM   6219  C  CZ    . ARG C 2  332  ? 15.081  -29.700 67.990  1.00   41.24  ? 332  ARG C CZ    1 
ATOM   6220  N  NH1   . ARG C 2  332  ? 14.986  -28.707 67.116  1.00   40.67  ? 332  ARG C NH1   1 
ATOM   6221  N  NH2   . ARG C 2  332  ? 16.229  -29.918 68.618  1.00   35.21  ? 332  ARG C NH2   1 
ATOM   6222  N  N     . ILE C 2  333  ? 12.563  -27.914 71.765  1.00   30.79  ? 333  ILE C N     1 
ATOM   6223  C  CA    . ILE C 2  333  ? 13.335  -26.749 72.174  1.00   32.68  ? 333  ILE C CA    1 
ATOM   6224  C  C     . ILE C 2  333  ? 14.689  -26.701 71.483  1.00   35.87  ? 333  ILE C C     1 
ATOM   6225  O  O     . ILE C 2  333  ? 15.470  -27.648 71.562  1.00   45.03  ? 333  ILE C O     1 
ATOM   6226  C  CB    . ILE C 2  333  ? 13.587  -26.756 73.691  1.00   32.99  ? 333  ILE C CB    1 
ATOM   6227  C  CG1   . ILE C 2  333  ? 12.270  -26.902 74.451  1.00   33.68  ? 333  ILE C CG1   1 
ATOM   6228  C  CG2   . ILE C 2  333  ? 14.321  -25.495 74.115  1.00   31.01  ? 333  ILE C CG2   1 
ATOM   6229  C  CD1   . ILE C 2  333  ? 11.344  -25.728 74.292  1.00   33.21  ? 333  ILE C CD1   1 
ATOM   6230  N  N     . ARG C 2  334  ? 14.965  -25.592 70.809  1.00   31.00  ? 334  ARG C N     1 
ATOM   6231  C  CA    . ARG C 2  334  ? 16.280  -25.359 70.239  1.00   30.94  ? 334  ARG C CA    1 
ATOM   6232  C  C     . ARG C 2  334  ? 17.083  -24.528 71.226  1.00   29.68  ? 334  ARG C C     1 
ATOM   6233  O  O     . ARG C 2  334  ? 16.782  -23.356 71.447  1.00   34.22  ? 334  ARG C O     1 
ATOM   6234  C  CB    . ARG C 2  334  ? 16.165  -24.609 68.913  1.00   34.17  ? 334  ARG C CB    1 
ATOM   6235  C  CG    . ARG C 2  334  ? 15.025  -25.074 68.027  1.00   39.06  ? 334  ARG C CG    1 
ATOM   6236  C  CD    . ARG C 2  334  ? 15.095  -24.409 66.664  1.00   39.03  ? 334  ARG C CD    1 
ATOM   6237  N  NE    . ARG C 2  334  ? 16.224  -24.905 65.884  1.00   46.98  ? 334  ARG C NE    1 
ATOM   6238  C  CZ    . ARG C 2  334  ? 16.659  -24.348 64.760  1.00   56.85  ? 334  ARG C CZ    1 
ATOM   6239  N  NH1   . ARG C 2  334  ? 16.062  -23.263 64.282  1.00   64.41  ? 334  ARG C NH1   1 
ATOM   6240  N  NH2   . ARG C 2  334  ? 17.694  -24.872 64.117  1.00   51.75  ? 334  ARG C NH2   1 
ATOM   6241  N  N     . THR C 2  335  ? 18.106  -25.131 71.818  1.00   25.86  ? 335  THR C N     1 
ATOM   6242  C  CA    . THR C 2  335  ? 18.938  -24.423 72.781  1.00   29.01  ? 335  THR C CA    1 
ATOM   6243  C  C     . THR C 2  335  ? 20.079  -23.678 72.090  1.00   30.06  ? 335  THR C C     1 
ATOM   6244  O  O     . THR C 2  335  ? 20.144  -23.637 70.862  1.00   33.58  ? 335  THR C O     1 
ATOM   6245  C  CB    . THR C 2  335  ? 19.493  -25.374 73.853  1.00   32.19  ? 335  THR C CB    1 
ATOM   6246  O  OG1   . THR C 2  335  ? 20.017  -26.549 73.223  1.00   37.59  ? 335  THR C OG1   1 
ATOM   6247  C  CG2   . THR C 2  335  ? 18.393  -25.781 74.816  1.00   39.13  ? 335  THR C CG2   1 
ATOM   6248  N  N     . VAL C 2  336  ? 20.965  -23.091 72.890  1.00   26.75  ? 336  VAL C N     1 
ATOM   6249  C  CA    . VAL C 2  336  ? 22.052  -22.254 72.388  1.00   23.21  ? 336  VAL C CA    1 
ATOM   6250  C  C     . VAL C 2  336  ? 22.887  -22.956 71.327  1.00   31.51  ? 336  VAL C C     1 
ATOM   6251  O  O     . VAL C 2  336  ? 23.164  -22.399 70.258  1.00   34.61  ? 336  VAL C O     1 
ATOM   6252  C  CB    . VAL C 2  336  ? 22.994  -21.841 73.530  1.00   24.10  ? 336  VAL C CB    1 
ATOM   6253  C  CG1   . VAL C 2  336  ? 23.999  -20.813 73.041  1.00   24.45  ? 336  VAL C CG1   1 
ATOM   6254  C  CG2   . VAL C 2  336  ? 22.199  -21.303 74.705  1.00   31.81  ? 336  VAL C CG2   1 
ATOM   6255  N  N     . GLY C 2  337  ? 23.281  -24.187 71.635  1.00   38.82  ? 337  GLY C N     1 
ATOM   6256  C  CA    . GLY C 2  337  ? 24.133  -24.970 70.763  1.00   38.25  ? 337  GLY C CA    1 
ATOM   6257  C  C     . GLY C 2  337  ? 23.559  -25.183 69.379  1.00   34.37  ? 337  GLY C C     1 
ATOM   6258  O  O     . GLY C 2  337  ? 24.284  -25.114 68.390  1.00   43.00  ? 337  GLY C O     1 
ATOM   6259  N  N     . GLU C 2  338  ? 22.256  -25.434 69.304  1.00   29.04  ? 338  GLU C N     1 
ATOM   6260  C  CA    . GLU C 2  338  ? 21.614  -25.722 68.026  1.00   36.19  ? 338  GLU C CA    1 
ATOM   6261  C  C     . GLU C 2  338  ? 21.520  -24.485 67.133  1.00   41.31  ? 338  GLU C C     1 
ATOM   6262  O  O     . GLU C 2  338  ? 21.784  -24.555 65.930  1.00   50.24  ? 338  GLU C O     1 
ATOM   6263  C  CB    . GLU C 2  338  ? 20.231  -26.339 68.239  1.00   31.74  ? 338  GLU C CB    1 
ATOM   6264  C  CG    . GLU C 2  338  ? 19.549  -26.770 66.952  1.00   37.14  ? 338  GLU C CG    1 
ATOM   6265  C  CD    . GLU C 2  338  ? 18.303  -27.594 67.200  1.00   41.47  ? 338  GLU C CD    1 
ATOM   6266  O  OE1   . GLU C 2  338  ? 18.099  -28.034 68.351  1.00   34.65  ? 338  GLU C OE1   1 
ATOM   6267  O  OE2   . GLU C 2  338  ? 17.527  -27.800 66.242  1.00   47.69  ? 338  GLU C OE2   1 
ATOM   6268  N  N     . LEU C 2  339  ? 21.146  -23.356 67.726  1.00   32.55  ? 339  LEU C N     1 
ATOM   6269  C  CA    . LEU C 2  339  ? 21.042  -22.102 66.989  1.00   36.13  ? 339  LEU C CA    1 
ATOM   6270  C  C     . LEU C 2  339  ? 22.422  -21.668 66.500  1.00   41.69  ? 339  LEU C C     1 
ATOM   6271  O  O     . LEU C 2  339  ? 22.608  -21.332 65.315  1.00   51.71  ? 339  LEU C O     1 
ATOM   6272  C  CB    . LEU C 2  339  ? 20.434  -21.019 67.881  1.00   37.47  ? 339  LEU C CB    1 
ATOM   6273  C  CG    . LEU C 2  339  ? 19.171  -21.392 68.664  1.00   33.66  ? 339  LEU C CG    1 
ATOM   6274  C  CD1   . LEU C 2  339  ? 18.824  -20.309 69.674  1.00   22.44  ? 339  LEU C CD1   1 
ATOM   6275  C  CD2   . LEU C 2  339  ? 18.002  -21.648 67.725  1.00   36.47  ? 339  LEU C CD2   1 
ATOM   6276  N  N     . MET C 2  340  ? 23.385  -21.690 67.420  1.00   37.18  ? 340  MET C N     1 
ATOM   6277  C  CA    . MET C 2  340  ? 24.767  -21.348 67.098  1.00   40.30  ? 340  MET C CA    1 
ATOM   6278  C  C     . MET C 2  340  ? 25.279  -22.238 65.972  1.00   40.12  ? 340  MET C C     1 
ATOM   6279  O  O     . MET C 2  340  ? 25.924  -21.760 65.040  1.00   41.33  ? 340  MET C O     1 
ATOM   6280  C  CB    . MET C 2  340  ? 25.659  -21.486 68.336  1.00   36.43  ? 340  MET C CB    1 
ATOM   6281  C  CG    . MET C 2  340  ? 27.051  -20.873 68.195  1.00   36.06  ? 340  MET C CG    1 
ATOM   6282  S  SD    . MET C 2  340  ? 28.212  -21.840 67.201  1.00   30.18  ? 340  MET C SD    1 
ATOM   6283  C  CE    . MET C 2  340  ? 28.281  -23.362 68.143  1.00   43.76  ? 340  MET C CE    1 
ATOM   6284  N  N     . THR C 2  341  ? 24.983  -23.530 66.063  1.00   37.48  ? 341  THR C N     1 
ATOM   6285  C  CA    . THR C 2  341  ? 25.375  -24.481 65.030  1.00   37.35  ? 341  THR C CA    1 
ATOM   6286  C  C     . THR C 2  341  ? 24.732  -24.137 63.691  1.00   46.98  ? 341  THR C C     1 
ATOM   6287  O  O     . THR C 2  341  ? 25.368  -24.260 62.645  1.00   55.34  ? 341  THR C O     1 
ATOM   6288  C  CB    . THR C 2  341  ? 25.014  -25.925 65.425  1.00   37.47  ? 341  THR C CB    1 
ATOM   6289  O  OG1   . THR C 2  341  ? 25.776  -26.307 66.576  1.00   39.69  ? 341  THR C OG1   1 
ATOM   6290  C  CG2   . THR C 2  341  ? 25.312  -26.889 64.287  1.00   41.47  ? 341  THR C CG2   1 
ATOM   6291  N  N     . ASP C 2  342  ? 23.477  -23.697 63.724  1.00   38.68  ? 342  ASP C N     1 
ATOM   6292  C  CA    . ASP C 2  342  ? 22.788  -23.297 62.500  1.00   39.75  ? 342  ASP C CA    1 
ATOM   6293  C  C     . ASP C 2  342  ? 23.481  -22.127 61.808  1.00   45.46  ? 342  ASP C C     1 
ATOM   6294  O  O     . ASP C 2  342  ? 23.852  -22.221 60.630  1.00   52.25  ? 342  ASP C O     1 
ATOM   6295  C  CB    . ASP C 2  342  ? 21.326  -22.954 62.780  1.00   42.91  ? 342  ASP C CB    1 
ATOM   6296  C  CG    . ASP C 2  342  ? 20.396  -24.118 62.510  1.00   57.80  ? 342  ASP C CG    1 
ATOM   6297  O  OD1   . ASP C 2  342  ? 20.830  -25.277 62.684  1.00   60.97  ? 342  ASP C OD1   1 
ATOM   6298  O  OD2   . ASP C 2  342  ? 19.234  -23.875 62.119  1.00   59.05  ? 342  ASP C OD2   1 
ATOM   6299  N  N     . GLN C 2  343  ? 23.664  -21.030 62.537  1.00   41.46  ? 343  GLN C N     1 
ATOM   6300  C  CA    . GLN C 2  343  ? 24.309  -19.858 61.943  1.00   45.84  ? 343  GLN C CA    1 
ATOM   6301  C  C     . GLN C 2  343  ? 25.742  -20.165 61.503  1.00   48.34  ? 343  GLN C C     1 
ATOM   6302  O  O     . GLN C 2  343  ? 26.216  -19.663 60.475  1.00   57.45  ? 343  GLN C O     1 
ATOM   6303  C  CB    . GLN C 2  343  ? 24.266  -18.665 62.898  1.00   44.79  ? 343  GLN C CB    1 
ATOM   6304  C  CG    . GLN C 2  343  ? 22.859  -18.147 63.145  1.00   53.83  ? 343  GLN C CG    1 
ATOM   6305  C  CD    . GLN C 2  343  ? 22.140  -17.784 61.859  1.00   55.04  ? 343  GLN C CD    1 
ATOM   6306  O  OE1   . GLN C 2  343  ? 21.037  -18.265 61.592  1.00   53.42  ? 343  GLN C OE1   1 
ATOM   6307  N  NE2   . GLN C 2  343  ? 22.761  -16.929 61.055  1.00   48.62  ? 343  GLN C NE2   1 
ATOM   6308  N  N     . PHE C 2  344  ? 26.415  -21.009 62.280  1.00   42.26  ? 344  PHE C N     1 
ATOM   6309  C  CA    . PHE C 2  344  ? 27.760  -21.470 61.955  1.00   45.26  ? 344  PHE C CA    1 
ATOM   6310  C  C     . PHE C 2  344  ? 27.756  -22.222 60.627  1.00   48.18  ? 344  PHE C C     1 
ATOM   6311  O  O     . PHE C 2  344  ? 28.661  -22.065 59.805  1.00   47.86  ? 344  PHE C O     1 
ATOM   6312  C  CB    . PHE C 2  344  ? 28.280  -22.377 63.071  1.00   40.99  ? 344  PHE C CB    1 
ATOM   6313  C  CG    . PHE C 2  344  ? 29.715  -22.784 62.911  1.00   35.88  ? 344  PHE C CG    1 
ATOM   6314  C  CD1   . PHE C 2  344  ? 30.042  -24.030 62.408  1.00   33.10  ? 344  PHE C CD1   1 
ATOM   6315  C  CD2   . PHE C 2  344  ? 30.736  -21.923 63.276  1.00   41.86  ? 344  PHE C CD2   1 
ATOM   6316  C  CE1   . PHE C 2  344  ? 31.362  -24.410 62.265  1.00   37.26  ? 344  PHE C CE1   1 
ATOM   6317  C  CE2   . PHE C 2  344  ? 32.058  -22.297 63.135  1.00   44.92  ? 344  PHE C CE2   1 
ATOM   6318  C  CZ    . PHE C 2  344  ? 32.371  -23.543 62.629  1.00   41.27  ? 344  PHE C CZ    1 
ATOM   6319  N  N     . ARG C 2  345  ? 26.722  -23.032 60.425  1.00   45.55  ? 345  ARG C N     1 
ATOM   6320  C  CA    . ARG C 2  345  ? 26.575  -23.815 59.207  1.00   45.40  ? 345  ARG C CA    1 
ATOM   6321  C  C     . ARG C 2  345  ? 26.318  -22.913 58.004  1.00   48.71  ? 345  ARG C C     1 
ATOM   6322  O  O     . ARG C 2  345  ? 26.853  -23.145 56.918  1.00   48.86  ? 345  ARG C O     1 
ATOM   6323  C  CB    . ARG C 2  345  ? 25.446  -24.834 59.359  1.00   38.63  ? 345  ARG C CB    1 
ATOM   6324  C  CG    . ARG C 2  345  ? 25.249  -25.721 58.146  1.00   50.72  ? 345  ARG C CG    1 
ATOM   6325  C  CD    . ARG C 2  345  ? 24.165  -26.759 58.384  1.00   70.51  ? 345  ARG C CD    1 
ATOM   6326  N  NE    . ARG C 2  345  ? 24.487  -27.652 59.494  1.00   77.80  ? 345  ARG C NE    1 
ATOM   6327  C  CZ    . ARG C 2  345  ? 23.804  -27.710 60.634  1.00   77.21  ? 345  ARG C CZ    1 
ATOM   6328  N  NH1   . ARG C 2  345  ? 22.748  -26.929 60.819  1.00   79.44  ? 345  ARG C NH1   1 
ATOM   6329  N  NH2   . ARG C 2  345  ? 24.171  -28.556 61.588  1.00   61.41  ? 345  ARG C NH2   1 
ATOM   6330  N  N     . VAL C 2  346  ? 25.499  -21.884 58.202  1.00   48.44  ? 346  VAL C N     1 
ATOM   6331  C  CA    . VAL C 2  346  ? 25.246  -20.914 57.139  1.00   51.23  ? 346  VAL C CA    1 
ATOM   6332  C  C     . VAL C 2  346  ? 26.537  -20.204 56.723  1.00   57.56  ? 346  VAL C C     1 
ATOM   6333  O  O     . VAL C 2  346  ? 26.895  -20.178 55.535  1.00   61.00  ? 346  VAL C O     1 
ATOM   6334  C  CB    . VAL C 2  346  ? 24.199  -19.869 57.561  1.00   48.22  ? 346  VAL C CB    1 
ATOM   6335  C  CG1   . VAL C 2  346  ? 23.994  -18.847 56.453  1.00   54.89  ? 346  VAL C CG1   1 
ATOM   6336  C  CG2   . VAL C 2  346  ? 22.887  -20.552 57.913  1.00   50.49  ? 346  VAL C CG2   1 
ATOM   6337  N  N     . GLY C 2  347  ? 27.234  -19.639 57.708  1.00   53.57  ? 347  GLY C N     1 
ATOM   6338  C  CA    . GLY C 2  347  ? 28.497  -18.964 57.459  1.00   53.36  ? 347  GLY C CA    1 
ATOM   6339  C  C     . GLY C 2  347  ? 29.510  -19.868 56.780  1.00   55.92  ? 347  GLY C C     1 
ATOM   6340  O  O     . GLY C 2  347  ? 30.271  -19.433 55.909  1.00   62.80  ? 347  GLY C O     1 
ATOM   6341  N  N     . LEU C 2  348  ? 29.505  -21.138 57.174  1.00   52.83  ? 348  LEU C N     1 
ATOM   6342  C  CA    . LEU C 2  348  ? 30.399  -22.129 56.588  1.00   54.90  ? 348  LEU C CA    1 
ATOM   6343  C  C     . LEU C 2  348  ? 30.036  -22.400 55.130  1.00   56.65  ? 348  LEU C C     1 
ATOM   6344  O  O     . LEU C 2  348  ? 30.913  -22.618 54.293  1.00   59.16  ? 348  LEU C O     1 
ATOM   6345  C  CB    . LEU C 2  348  ? 30.357  -23.426 57.397  1.00   52.21  ? 348  LEU C CB    1 
ATOM   6346  C  CG    . LEU C 2  348  ? 31.697  -24.132 57.602  1.00   47.37  ? 348  LEU C CG    1 
ATOM   6347  C  CD1   . LEU C 2  348  ? 32.708  -23.169 58.203  1.00   49.52  ? 348  LEU C CD1   1 
ATOM   6348  C  CD2   . LEU C 2  348  ? 31.529  -25.354 58.490  1.00   40.38  ? 348  LEU C CD2   1 
ATOM   6349  N  N     . ALA C 2  349  ? 28.739  -22.385 54.831  1.00   54.60  ? 349  ALA C N     1 
ATOM   6350  C  CA    . ALA C 2  349  ? 28.271  -22.565 53.461  1.00   54.40  ? 349  ALA C CA    1 
ATOM   6351  C  C     . ALA C 2  349  ? 28.725  -21.406 52.579  1.00   54.86  ? 349  ALA C C     1 
ATOM   6352  O  O     . ALA C 2  349  ? 29.188  -21.612 51.450  1.00   54.61  ? 349  ALA C O     1 
ATOM   6353  C  CB    . ALA C 2  349  ? 26.758  -22.699 53.430  1.00   58.88  ? 349  ALA C CB    1 
ATOM   6354  N  N     . ARG C 2  350  ? 28.590  -20.187 53.099  1.00   55.69  ? 350  ARG C N     1 
ATOM   6355  C  CA    . ARG C 2  350  ? 29.081  -19.006 52.390  1.00   57.91  ? 350  ARG C CA    1 
ATOM   6356  C  C     . ARG C 2  350  ? 30.583  -19.126 52.138  1.00   64.15  ? 350  ARG C C     1 
ATOM   6357  O  O     . ARG C 2  350  ? 31.075  -18.831 51.037  1.00   76.41  ? 350  ARG C O     1 
ATOM   6358  C  CB    . ARG C 2  350  ? 28.767  -17.734 53.179  1.00   53.64  ? 350  ARG C CB    1 
ATOM   6359  C  CG    . ARG C 2  350  ? 27.279  -17.450 53.311  1.00   59.37  ? 350  ARG C CG    1 
ATOM   6360  C  CD    . ARG C 2  350  ? 27.009  -16.327 54.296  1.00   63.13  ? 350  ARG C CD    1 
ATOM   6361  N  NE    . ARG C 2  350  ? 25.579  -16.105 54.485  1.00   63.69  ? 350  ARG C NE    1 
ATOM   6362  C  CZ    . ARG C 2  350  ? 25.065  -15.291 55.401  1.00   74.51  ? 350  ARG C CZ    1 
ATOM   6363  N  NH1   . ARG C 2  350  ? 25.866  -14.622 56.220  1.00   72.81  ? 350  ARG C NH1   1 
ATOM   6364  N  NH2   . ARG C 2  350  ? 23.749  -15.149 55.502  1.00   75.14  ? 350  ARG C NH2   1 
ATOM   6365  N  N     . LEU C 2  351  ? 31.302  -19.578 53.163  1.00   57.18  ? 351  LEU C N     1 
ATOM   6366  C  CA    . LEU C 2  351  ? 32.732  -19.844 53.040  1.00   58.83  ? 351  LEU C CA    1 
ATOM   6367  C  C     . LEU C 2  351  ? 33.018  -20.842 51.918  1.00   61.72  ? 351  LEU C C     1 
ATOM   6368  O  O     . LEU C 2  351  ? 34.002  -20.703 51.192  1.00   62.52  ? 351  LEU C O     1 
ATOM   6369  C  CB    . LEU C 2  351  ? 33.298  -20.355 54.368  1.00   56.89  ? 351  LEU C CB    1 
ATOM   6370  C  CG    . LEU C 2  351  ? 34.779  -20.739 54.402  1.00   51.01  ? 351  LEU C CG    1 
ATOM   6371  C  CD1   . LEU C 2  351  ? 35.457  -20.136 55.621  1.00   52.93  ? 351  LEU C CD1   1 
ATOM   6372  C  CD2   . LEU C 2  351  ? 34.939  -22.250 54.399  1.00   44.42  ? 351  LEU C CD2   1 
ATOM   6373  N  N     . ALA C 2  352  ? 32.149  -21.841 51.776  1.00   62.16  ? 352  ALA C N     1 
ATOM   6374  C  CA    . ALA C 2  352  ? 32.291  -22.844 50.722  1.00   63.79  ? 352  ALA C CA    1 
ATOM   6375  C  C     . ALA C 2  352  ? 32.091  -22.242 49.332  1.00   71.76  ? 352  ALA C C     1 
ATOM   6376  O  O     . ALA C 2  352  ? 32.831  -22.563 48.394  1.00   73.15  ? 352  ALA C O     1 
ATOM   6377  C  CB    . ALA C 2  352  ? 31.324  -23.996 50.947  1.00   58.77  ? 352  ALA C CB    1 
ATOM   6378  N  N     . ARG C 2  353  ? 31.085  -21.379 49.203  1.00   75.93  ? 353  ARG C N     1 
ATOM   6379  C  CA    . ARG C 2  353  ? 30.856  -20.658 47.952  1.00   75.59  ? 353  ARG C CA    1 
ATOM   6380  C  C     . ARG C 2  353  ? 32.122  -19.888 47.583  1.00   80.78  ? 353  ARG C C     1 
ATOM   6381  O  O     . ARG C 2  353  ? 32.589  -19.939 46.436  1.00   81.28  ? 353  ARG C O     1 
ATOM   6382  C  CB    . ARG C 2  353  ? 29.666  -19.703 48.088  1.00   81.06  ? 353  ARG C CB    1 
ATOM   6383  C  CG    . ARG C 2  353  ? 28.925  -19.410 46.783  1.00   90.95  ? 353  ARG C CG    1 
ATOM   6384  C  CD    . ARG C 2  353  ? 29.592  -18.314 45.953  1.00   106.66 ? 353  ARG C CD    1 
ATOM   6385  N  NE    . ARG C 2  353  ? 29.396  -16.981 46.520  1.00   106.19 ? 353  ARG C NE    1 
ATOM   6386  C  CZ    . ARG C 2  353  ? 29.713  -15.849 45.898  1.00   97.10  ? 353  ARG C CZ    1 
ATOM   6387  N  NH1   . ARG C 2  353  ? 30.240  -15.883 44.681  1.00   92.74  ? 353  ARG C NH1   1 
ATOM   6388  N  NH2   . ARG C 2  353  ? 29.501  -14.681 46.489  1.00   92.24  ? 353  ARG C NH2   1 
ATOM   6389  N  N     . GLY C 2  354  ? 32.684  -19.192 48.570  1.00   80.51  ? 354  GLY C N     1 
ATOM   6390  C  CA    . GLY C 2  354  ? 33.940  -18.488 48.378  1.00   83.87  ? 354  GLY C CA    1 
ATOM   6391  C  C     . GLY C 2  354  ? 35.072  -19.408 47.950  1.00   83.49  ? 354  GLY C C     1 
ATOM   6392  O  O     . GLY C 2  354  ? 35.917  -19.033 47.131  1.00   81.75  ? 354  GLY C O     1 
ATOM   6393  N  N     . VAL C 2  355  ? 35.082  -20.621 48.499  1.00   83.11  ? 355  VAL C N     1 
ATOM   6394  C  CA    . VAL C 2  355  ? 36.121  -21.602 48.186  1.00   78.79  ? 355  VAL C CA    1 
ATOM   6395  C  C     . VAL C 2  355  ? 36.052  -22.084 46.738  1.00   78.71  ? 355  VAL C C     1 
ATOM   6396  O  O     . VAL C 2  355  ? 37.069  -22.110 46.047  1.00   85.96  ? 355  VAL C O     1 
ATOM   6397  C  CB    . VAL C 2  355  ? 36.086  -22.812 49.149  1.00   70.03  ? 355  VAL C CB    1 
ATOM   6398  C  CG1   . VAL C 2  355  ? 36.878  -23.978 48.579  1.00   60.13  ? 355  VAL C CG1   1 
ATOM   6399  C  CG2   . VAL C 2  355  ? 36.629  -22.419 50.513  1.00   68.43  ? 355  VAL C CG2   1 
ATOM   6400  N  N     . ARG C 2  356  ? 34.862  -22.463 46.279  1.00   74.33  ? 356  ARG C N     1 
ATOM   6401  C  CA    . ARG C 2  356  ? 34.691  -22.871 44.883  1.00   74.68  ? 356  ARG C CA    1 
ATOM   6402  C  C     . ARG C 2  356  ? 35.003  -21.722 43.924  1.00   77.68  ? 356  ARG C C     1 
ATOM   6403  O  O     . ARG C 2  356  ? 35.673  -21.911 42.894  1.00   73.12  ? 356  ARG C O     1 
ATOM   6404  C  CB    . ARG C 2  356  ? 33.278  -23.402 44.641  1.00   74.96  ? 356  ARG C CB    1 
ATOM   6405  C  CG    . ARG C 2  356  ? 33.138  -24.899 44.850  1.00   67.09  ? 356  ARG C CG    1 
ATOM   6406  C  CD    . ARG C 2  356  ? 31.692  -25.340 44.745  1.00   73.72  ? 356  ARG C CD    1 
ATOM   6407  N  NE    . ARG C 2  356  ? 30.922  -24.955 45.925  1.00   95.05  ? 356  ARG C NE    1 
ATOM   6408  C  CZ    . ARG C 2  356  ? 30.658  -25.769 46.942  1.00   93.39  ? 356  ARG C CZ    1 
ATOM   6409  N  NH1   . ARG C 2  356  ? 29.951  -25.335 47.977  1.00   73.76  ? 356  ARG C NH1   1 
ATOM   6410  N  NH2   . ARG C 2  356  ? 31.097  -27.021 46.923  1.00   95.42  ? 356  ARG C NH2   1 
ATOM   6411  N  N     . GLU C 2  357  ? 34.509  -20.535 44.272  1.00   83.54  ? 357  GLU C N     1 
ATOM   6412  C  CA    . GLU C 2  357  ? 34.836  -19.313 43.543  1.00   85.83  ? 357  GLU C CA    1 
ATOM   6413  C  C     . GLU C 2  357  ? 36.347  -19.194 43.344  1.00   88.94  ? 357  GLU C C     1 
ATOM   6414  O  O     . GLU C 2  357  ? 36.830  -19.151 42.213  1.00   90.63  ? 357  GLU C O     1 
ATOM   6415  C  CB    . GLU C 2  357  ? 34.279  -18.082 44.261  1.00   95.03  ? 357  GLU C CB    1 
ATOM   6416  C  CG    . GLU C 2  357  ? 34.397  -16.792 43.464  1.00   96.50  ? 357  GLU C CG    1 
ATOM   6417  C  CD    . GLU C 2  357  ? 33.241  -15.845 43.720  1.00   99.30  ? 357  GLU C CD    1 
ATOM   6418  O  OE1   . GLU C 2  357  ? 33.335  -15.022 44.656  1.00   98.28  ? 357  GLU C OE1   1 
ATOM   6419  O  OE2   . GLU C 2  357  ? 32.234  -15.928 42.985  1.00   92.46  ? 357  GLU C OE2   1 
ATOM   6420  N  N     . ARG C 2  358  ? 37.085  -19.136 44.449  1.00   93.15  ? 358  ARG C N     1 
ATOM   6421  C  CA    . ARG C 2  358  ? 38.545  -19.067 44.399  1.00   87.08  ? 358  ARG C CA    1 
ATOM   6422  C  C     . ARG C 2  358  ? 39.211  -20.305 43.787  1.00   83.39  ? 358  ARG C C     1 
ATOM   6423  O  O     . ARG C 2  358  ? 40.403  -20.282 43.483  1.00   81.76  ? 358  ARG C O     1 
ATOM   6424  C  CB    . ARG C 2  358  ? 39.116  -18.793 45.792  1.00   80.10  ? 358  ARG C CB    1 
ATOM   6425  C  CG    . ARG C 2  358  ? 38.812  -17.401 46.309  1.00   75.55  ? 358  ARG C CG    1 
ATOM   6426  C  CD    . ARG C 2  358  ? 39.260  -17.226 47.746  1.00   69.24  ? 358  ARG C CD    1 
ATOM   6427  N  NE    . ARG C 2  358  ? 38.986  -15.876 48.227  1.00   79.69  ? 358  ARG C NE    1 
ATOM   6428  C  CZ    . ARG C 2  358  ? 37.799  -15.468 48.664  1.00   93.55  ? 358  ARG C CZ    1 
ATOM   6429  N  NH1   . ARG C 2  358  ? 37.639  -14.220 49.083  1.00   103.37 ? 358  ARG C NH1   1 
ATOM   6430  N  NH2   . ARG C 2  358  ? 36.771  -16.307 48.681  1.00   92.05  ? 358  ARG C NH2   1 
ATOM   6431  N  N     . MET C 2  359  ? 38.452  -21.386 43.625  1.00   82.96  ? 359  MET C N     1 
ATOM   6432  C  CA    . MET C 2  359  ? 38.963  -22.577 42.951  1.00   80.75  ? 359  MET C CA    1 
ATOM   6433  C  C     . MET C 2  359  ? 38.914  -22.427 41.436  1.00   90.10  ? 359  MET C C     1 
ATOM   6434  O  O     . MET C 2  359  ? 39.770  -22.955 40.726  1.00   88.48  ? 359  MET C O     1 
ATOM   6435  C  CB    . MET C 2  359  ? 38.213  -23.839 43.384  1.00   75.77  ? 359  MET C CB    1 
ATOM   6436  C  CG    . MET C 2  359  ? 38.807  -24.515 44.609  1.00   78.87  ? 359  MET C CG    1 
ATOM   6437  S  SD    . MET C 2  359  ? 38.323  -26.245 44.776  1.00   69.71  ? 359  MET C SD    1 
ATOM   6438  C  CE    . MET C 2  359  ? 36.551  -26.092 44.958  1.00   86.11  ? 359  MET C CE    1 
ATOM   6439  N  N     . LEU C 2  360  ? 37.907  -21.714 40.941  1.00   95.60  ? 360  LEU C N     1 
ATOM   6440  C  CA    . LEU C 2  360  ? 37.836  -21.429 39.509  1.00   92.81  ? 360  LEU C CA    1 
ATOM   6441  C  C     . LEU C 2  360  ? 38.964  -20.501 39.048  1.00   93.03  ? 360  LEU C C     1 
ATOM   6442  O  O     . LEU C 2  360  ? 39.675  -20.804 38.089  1.00   80.41  ? 360  LEU C O     1 
ATOM   6443  C  CB    . LEU C 2  360  ? 36.476  -20.837 39.135  1.00   96.64  ? 360  LEU C CB    1 
ATOM   6444  C  CG    . LEU C 2  360  ? 35.491  -21.793 38.456  1.00   94.06  ? 360  LEU C CG    1 
ATOM   6445  C  CD1   . LEU C 2  360  ? 35.315  -23.071 39.266  1.00   75.01  ? 360  LEU C CD1   1 
ATOM   6446  C  CD2   . LEU C 2  360  ? 34.152  -21.108 38.223  1.00   104.77 ? 360  LEU C CD2   1 
ATOM   6447  N  N     . MET C 2  361  ? 39.125  -19.377 39.741  1.00   104.77 ? 361  MET C N     1 
ATOM   6448  C  CA    . MET C 2  361  ? 40.131  -18.380 39.383  1.00   110.30 ? 361  MET C CA    1 
ATOM   6449  C  C     . MET C 2  361  ? 41.411  -18.555 40.196  1.00   115.58 ? 361  MET C C     1 
ATOM   6450  O  O     . MET C 2  361  ? 41.362  -18.710 41.416  1.00   114.06 ? 361  MET C O     1 
ATOM   6451  C  CB    . MET C 2  361  ? 39.583  -16.969 39.617  1.00   108.07 ? 361  MET C CB    1 
ATOM   6452  C  CG    . MET C 2  361  ? 38.098  -16.792 39.315  1.00   103.03 ? 361  MET C CG    1 
ATOM   6453  S  SD    . MET C 2  361  ? 37.729  -16.383 37.596  1.00   132.93 ? 361  MET C SD    1 
ATOM   6454  C  CE    . MET C 2  361  ? 37.654  -18.009 36.847  1.00   109.96 ? 361  MET C CE    1 
ATOM   6455  N  N     . GLY C 2  362  ? 42.557  -18.533 39.522  1.00   109.90 ? 362  GLY C N     1 
ATOM   6456  C  CA    . GLY C 2  362  ? 43.832  -18.555 40.215  1.00   106.67 ? 362  GLY C CA    1 
ATOM   6457  C  C     . GLY C 2  362  ? 44.915  -19.290 39.455  1.00   113.75 ? 362  GLY C C     1 
ATOM   6458  O  O     . GLY C 2  362  ? 44.768  -19.581 38.268  1.00   121.76 ? 362  GLY C O     1 
ATOM   6459  N  N     . SER C 2  363  ? 46.010  -19.591 40.145  1.00   117.84 ? 363  SER C N     1 
ATOM   6460  C  CA    . SER C 2  363  ? 47.055  -20.431 39.580  1.00   121.02 ? 363  SER C CA    1 
ATOM   6461  C  C     . SER C 2  363  ? 46.751  -21.867 39.979  1.00   113.21 ? 363  SER C C     1 
ATOM   6462  O  O     . SER C 2  363  ? 46.829  -22.223 41.154  1.00   106.34 ? 363  SER C O     1 
ATOM   6463  C  CB    . SER C 2  363  ? 48.431  -20.013 40.101  1.00   109.11 ? 363  SER C CB    1 
ATOM   6464  O  OG    . SER C 2  363  ? 48.738  -18.679 39.730  1.00   106.35 ? 363  SER C OG    1 
ATOM   6465  N  N     . GLU C 2  364  ? 46.404  -22.686 38.993  1.00   119.61 ? 364  GLU C N     1 
ATOM   6466  C  CA    . GLU C 2  364  ? 45.929  -24.042 39.247  1.00   124.60 ? 364  GLU C CA    1 
ATOM   6467  C  C     . GLU C 2  364  ? 46.997  -24.955 39.845  1.00   129.59 ? 364  GLU C C     1 
ATOM   6468  O  O     . GLU C 2  364  ? 46.675  -25.943 40.507  1.00   124.85 ? 364  GLU C O     1 
ATOM   6469  C  CB    . GLU C 2  364  ? 45.364  -24.659 37.964  1.00   119.44 ? 364  GLU C CB    1 
ATOM   6470  C  CG    . GLU C 2  364  ? 44.055  -24.036 37.499  1.00   118.90 ? 364  GLU C CG    1 
ATOM   6471  C  CD    . GLU C 2  364  ? 42.894  -24.365 38.418  1.00   116.03 ? 364  GLU C CD    1 
ATOM   6472  O  OE1   . GLU C 2  364  ? 41.956  -23.545 38.512  1.00   107.98 ? 364  GLU C OE1   1 
ATOM   6473  O  OE2   . GLU C 2  364  ? 42.918  -25.447 39.042  1.00   107.63 ? 364  GLU C OE2   1 
ATOM   6474  N  N     . ASP C 2  365  ? 48.264  -24.626 39.612  1.00   129.32 ? 365  ASP C N     1 
ATOM   6475  C  CA    . ASP C 2  365  ? 49.362  -25.445 40.116  1.00   122.84 ? 365  ASP C CA    1 
ATOM   6476  C  C     . ASP C 2  365  ? 49.613  -25.238 41.606  1.00   113.77 ? 365  ASP C C     1 
ATOM   6477  O  O     . ASP C 2  365  ? 49.744  -26.205 42.358  1.00   102.98 ? 365  ASP C O     1 
ATOM   6478  C  CB    . ASP C 2  365  ? 50.648  -25.174 39.335  1.00   122.23 ? 365  ASP C CB    1 
ATOM   6479  C  CG    . ASP C 2  365  ? 51.833  -25.944 39.885  1.00   123.50 ? 365  ASP C CG    1 
ATOM   6480  O  OD1   . ASP C 2  365  ? 51.646  -27.106 40.306  1.00   121.47 ? 365  ASP C OD1   1 
ATOM   6481  O  OD2   . ASP C 2  365  ? 52.948  -25.383 39.905  1.00   126.90 ? 365  ASP C OD2   1 
ATOM   6482  N  N     . SER C 2  366  ? 49.684  -23.981 42.031  1.00   112.41 ? 366  SER C N     1 
ATOM   6483  C  CA    . SER C 2  366  ? 49.960  -23.689 43.432  1.00   111.42 ? 366  SER C CA    1 
ATOM   6484  C  C     . SER C 2  366  ? 48.776  -23.033 44.133  1.00   104.03 ? 366  SER C C     1 
ATOM   6485  O  O     . SER C 2  366  ? 48.489  -21.853 43.927  1.00   100.18 ? 366  SER C O     1 
ATOM   6486  C  CB    . SER C 2  366  ? 51.189  -22.786 43.552  1.00   107.03 ? 366  SER C CB    1 
ATOM   6487  O  OG    . SER C 2  366  ? 50.983  -21.553 42.883  1.00   104.24 ? 366  SER C OG    1 
ATOM   6488  N  N     . LEU C 2  367  ? 48.101  -23.811 44.972  1.00   95.77  ? 367  LEU C N     1 
ATOM   6489  C  CA    . LEU C 2  367  ? 47.069  -23.286 45.855  1.00   85.65  ? 367  LEU C CA    1 
ATOM   6490  C  C     . LEU C 2  367  ? 47.156  -23.951 47.223  1.00   85.36  ? 367  LEU C C     1 
ATOM   6491  O  O     . LEU C 2  367  ? 47.065  -25.172 47.335  1.00   77.27  ? 367  LEU C O     1 
ATOM   6492  C  CB    . LEU C 2  367  ? 45.677  -23.489 45.252  1.00   78.58  ? 367  LEU C CB    1 
ATOM   6493  C  CG    . LEU C 2  367  ? 45.272  -22.530 44.130  1.00   89.26  ? 367  LEU C CG    1 
ATOM   6494  C  CD1   . LEU C 2  367  ? 43.857  -22.825 43.659  1.00   88.64  ? 367  LEU C CD1   1 
ATOM   6495  C  CD2   . LEU C 2  367  ? 45.396  -21.083 44.586  1.00   85.74  ? 367  LEU C CD2   1 
ATOM   6496  N  N     . THR C 2  368  ? 47.343  -23.143 48.259  1.00   82.37  ? 368  THR C N     1 
ATOM   6497  C  CA    . THR C 2  368  ? 47.290  -23.631 49.628  1.00   70.44  ? 368  THR C CA    1 
ATOM   6498  C  C     . THR C 2  368  ? 45.858  -23.498 50.129  1.00   85.38  ? 368  THR C C     1 
ATOM   6499  O  O     . THR C 2  368  ? 45.077  -22.730 49.563  1.00   85.39  ? 368  THR C O     1 
ATOM   6500  C  CB    . THR C 2  368  ? 48.251  -22.847 50.546  1.00   75.27  ? 368  THR C CB    1 
ATOM   6501  O  OG1   . THR C 2  368  ? 48.000  -21.442 50.422  1.00   74.42  ? 368  THR C OG1   1 
ATOM   6502  C  CG2   . THR C 2  368  ? 49.696  -23.131 50.170  1.00   75.72  ? 368  THR C CG2   1 
ATOM   6503  N  N     . PRO C 2  369  ? 45.494  -24.263 51.172  1.00   92.20  ? 369  PRO C N     1 
ATOM   6504  C  CA    . PRO C 2  369  ? 44.185  -24.067 51.803  1.00   82.28  ? 369  PRO C CA    1 
ATOM   6505  C  C     . PRO C 2  369  ? 43.994  -22.623 52.265  1.00   74.03  ? 369  PRO C C     1 
ATOM   6506  O  O     . PRO C 2  369  ? 42.873  -22.115 52.243  1.00   74.01  ? 369  PRO C O     1 
ATOM   6507  C  CB    . PRO C 2  369  ? 44.243  -25.006 53.009  1.00   70.76  ? 369  PRO C CB    1 
ATOM   6508  C  CG    . PRO C 2  369  ? 45.156  -26.097 52.575  1.00   71.18  ? 369  PRO C CG    1 
ATOM   6509  C  CD    . PRO C 2  369  ? 46.202  -25.433 51.723  1.00   80.92  ? 369  PRO C CD    1 
ATOM   6510  N  N     . ALA C 2  370  ? 45.084  -21.974 52.663  1.00   71.32  ? 370  ALA C N     1 
ATOM   6511  C  CA    . ALA C 2  370  ? 45.040  -20.585 53.111  1.00   74.04  ? 370  ALA C CA    1 
ATOM   6512  C  C     . ALA C 2  370  ? 44.622  -19.629 51.994  1.00   77.32  ? 370  ALA C C     1 
ATOM   6513  O  O     . ALA C 2  370  ? 43.935  -18.637 52.243  1.00   78.25  ? 370  ALA C O     1 
ATOM   6514  C  CB    . ALA C 2  370  ? 46.388  -20.173 53.688  1.00   71.97  ? 370  ALA C CB    1 
ATOM   6515  N  N     . LYS C 2  371  ? 45.041  -19.928 50.767  1.00   79.68  ? 371  LYS C N     1 
ATOM   6516  C  CA    . LYS C 2  371  ? 44.698  -19.097 49.615  1.00   79.31  ? 371  LYS C CA    1 
ATOM   6517  C  C     . LYS C 2  371  ? 43.231  -19.247 49.230  1.00   79.53  ? 371  LYS C C     1 
ATOM   6518  O  O     . LYS C 2  371  ? 42.607  -18.298 48.754  1.00   87.41  ? 371  LYS C O     1 
ATOM   6519  C  CB    . LYS C 2  371  ? 45.583  -19.436 48.411  1.00   81.96  ? 371  LYS C CB    1 
ATOM   6520  C  CG    . LYS C 2  371  ? 47.025  -18.968 48.528  1.00   88.50  ? 371  LYS C CG    1 
ATOM   6521  C  CD    . LYS C 2  371  ? 47.812  -19.321 47.273  1.00   84.96  ? 371  LYS C CD    1 
ATOM   6522  C  CE    . LYS C 2  371  ? 49.268  -18.901 47.388  1.00   73.34  ? 371  LYS C CE    1 
ATOM   6523  N  NZ    . LYS C 2  371  ? 50.048  -19.298 46.184  1.00   67.90  ? 371  LYS C NZ    1 
ATOM   6524  N  N     . LEU C 2  372  ? 42.688  -20.443 49.430  1.00   73.25  ? 372  LEU C N     1 
ATOM   6525  C  CA    . LEU C 2  372  ? 41.292  -20.718 49.099  1.00   79.20  ? 372  LEU C CA    1 
ATOM   6526  C  C     . LEU C 2  372  ? 40.312  -20.208 50.154  1.00   83.63  ? 372  LEU C C     1 
ATOM   6527  O  O     . LEU C 2  372  ? 39.206  -19.774 49.828  1.00   83.31  ? 372  LEU C O     1 
ATOM   6528  C  CB    . LEU C 2  372  ? 41.073  -22.217 48.887  1.00   67.35  ? 372  LEU C CB    1 
ATOM   6529  C  CG    . LEU C 2  372  ? 41.625  -22.835 47.606  1.00   66.40  ? 372  LEU C CG    1 
ATOM   6530  C  CD1   . LEU C 2  372  ? 41.089  -24.245 47.455  1.00   58.17  ? 372  LEU C CD1   1 
ATOM   6531  C  CD2   . LEU C 2  372  ? 41.243  -21.991 46.403  1.00   83.39  ? 372  LEU C CD2   1 
ATOM   6532  N  N     . VAL C 2  373  ? 40.721  -20.265 51.417  1.00   75.38  ? 373  VAL C N     1 
ATOM   6533  C  CA    . VAL C 2  373  ? 39.819  -19.968 52.523  1.00   64.11  ? 373  VAL C CA    1 
ATOM   6534  C  C     . VAL C 2  373  ? 39.798  -18.496 52.929  1.00   69.44  ? 373  VAL C C     1 
ATOM   6535  O  O     . VAL C 2  373  ? 40.813  -17.937 53.349  1.00   67.52  ? 373  VAL C O     1 
ATOM   6536  C  CB    . VAL C 2  373  ? 40.149  -20.829 53.763  1.00   59.63  ? 373  VAL C CB    1 
ATOM   6537  C  CG1   . VAL C 2  373  ? 39.387  -20.331 54.983  1.00   56.12  ? 373  VAL C CG1   1 
ATOM   6538  C  CG2   . VAL C 2  373  ? 39.835  -22.290 53.489  1.00   56.05  ? 373  VAL C CG2   1 
ATOM   6539  N  N     . ASN C 2  374  ? 38.629  -17.878 52.790  1.00   69.04  ? 374  ASN C N     1 
ATOM   6540  C  CA    . ASN C 2  374  ? 38.373  -16.569 53.373  1.00   65.67  ? 374  ASN C CA    1 
ATOM   6541  C  C     . ASN C 2  374  ? 37.414  -16.753 54.540  1.00   65.90  ? 374  ASN C C     1 
ATOM   6542  O  O     . ASN C 2  374  ? 36.241  -17.070 54.345  1.00   68.02  ? 374  ASN C O     1 
ATOM   6543  C  CB    . ASN C 2  374  ? 37.780  -15.614 52.335  1.00   66.15  ? 374  ASN C CB    1 
ATOM   6544  C  CG    . ASN C 2  374  ? 37.554  -14.218 52.888  1.00   70.95  ? 374  ASN C CG    1 
ATOM   6545  O  OD1   . ASN C 2  374  ? 38.055  -13.872 53.957  1.00   71.46  ? 374  ASN C OD1   1 
ATOM   6546  N  ND2   . ASN C 2  374  ? 36.798  -13.406 52.157  1.00   76.58  ? 374  ASN C ND2   1 
ATOM   6547  N  N     . SER C 2  375  ? 37.917  -16.561 55.754  1.00   61.74  ? 375  SER C N     1 
ATOM   6548  C  CA    . SER C 2  375  ? 37.147  -16.867 56.953  1.00   52.12  ? 375  SER C CA    1 
ATOM   6549  C  C     . SER C 2  375  ? 36.061  -15.834 57.229  1.00   59.37  ? 375  SER C C     1 
ATOM   6550  O  O     . SER C 2  375  ? 35.088  -16.127 57.929  1.00   63.15  ? 375  SER C O     1 
ATOM   6551  C  CB    . SER C 2  375  ? 38.073  -16.993 58.165  1.00   53.90  ? 375  SER C CB    1 
ATOM   6552  O  OG    . SER C 2  375  ? 38.813  -15.802 58.367  1.00   58.83  ? 375  SER C OG    1 
ATOM   6553  N  N     . ARG C 2  376  ? 36.223  -14.643 56.654  1.00   61.93  ? 376  ARG C N     1 
ATOM   6554  C  CA    . ARG C 2  376  ? 35.362  -13.496 56.959  1.00   64.37  ? 376  ARG C CA    1 
ATOM   6555  C  C     . ARG C 2  376  ? 33.857  -13.798 57.036  1.00   59.92  ? 376  ARG C C     1 
ATOM   6556  O  O     . ARG C 2  376  ? 33.247  -13.537 58.082  1.00   62.18  ? 376  ARG C O     1 
ATOM   6557  C  CB    . ARG C 2  376  ? 35.643  -12.323 56.007  1.00   65.31  ? 376  ARG C CB    1 
ATOM   6558  C  CG    . ARG C 2  376  ? 36.583  -11.264 56.573  1.00   72.61  ? 376  ARG C CG    1 
ATOM   6559  C  CD    . ARG C 2  376  ? 37.920  -11.860 56.982  1.00   75.26  ? 376  ARG C CD    1 
ATOM   6560  N  NE    . ARG C 2  376  ? 38.900  -10.829 57.315  1.00   88.80  ? 376  ARG C NE    1 
ATOM   6561  C  CZ    . ARG C 2  376  ? 39.177  -10.429 58.552  1.00   92.08  ? 376  ARG C CZ    1 
ATOM   6562  N  NH1   . ARG C 2  376  ? 38.551  -10.974 59.586  1.00   83.60  ? 376  ARG C NH1   1 
ATOM   6563  N  NH2   . ARG C 2  376  ? 40.086  -9.483  58.756  1.00   91.47  ? 376  ARG C NH2   1 
ATOM   6564  N  N     . PRO C 2  377  ? 33.265  -14.384 55.968  1.00   50.97  ? 377  PRO C N     1 
ATOM   6565  C  CA    . PRO C 2  377  ? 31.821  -14.642 56.036  1.00   56.28  ? 377  PRO C CA    1 
ATOM   6566  C  C     . PRO C 2  377  ? 31.442  -15.430 57.283  1.00   55.02  ? 377  PRO C C     1 
ATOM   6567  O  O     . PRO C 2  377  ? 30.507  -15.032 57.984  1.00   63.61  ? 377  PRO C O     1 
ATOM   6568  C  CB    . PRO C 2  377  ? 31.548  -15.478 54.777  1.00   46.49  ? 377  PRO C CB    1 
ATOM   6569  C  CG    . PRO C 2  377  ? 32.875  -15.998 54.354  1.00   47.44  ? 377  PRO C CG    1 
ATOM   6570  C  CD    . PRO C 2  377  ? 33.837  -14.914 54.718  1.00   48.16  ? 377  PRO C CD    1 
ATOM   6571  N  N     . LEU C 2  378  ? 32.195  -16.490 57.574  1.00   46.94  ? 378  LEU C N     1 
ATOM   6572  C  CA    . LEU C 2  378  ? 31.963  -17.294 58.768  1.00   45.84  ? 378  LEU C CA    1 
ATOM   6573  C  C     . LEU C 2  378  ? 31.908  -16.402 60.000  1.00   46.24  ? 378  LEU C C     1 
ATOM   6574  O  O     . LEU C 2  378  ? 30.916  -16.417 60.732  1.00   45.90  ? 378  LEU C O     1 
ATOM   6575  C  CB    . LEU C 2  378  ? 33.054  -18.353 58.933  1.00   49.19  ? 378  LEU C CB    1 
ATOM   6576  C  CG    . LEU C 2  378  ? 32.958  -19.228 60.185  1.00   42.39  ? 378  LEU C CG    1 
ATOM   6577  C  CD1   . LEU C 2  378  ? 31.641  -19.986 60.218  1.00   44.99  ? 378  LEU C CD1   1 
ATOM   6578  C  CD2   . LEU C 2  378  ? 34.131  -20.189 60.248  1.00   37.92  ? 378  LEU C CD2   1 
ATOM   6579  N  N     . GLU C 2  379  ? 32.952  -15.599 60.201  1.00   49.13  ? 379  GLU C N     1 
ATOM   6580  C  CA    . GLU C 2  379  ? 32.986  -14.657 61.316  1.00   51.29  ? 379  GLU C CA    1 
ATOM   6581  C  C     . GLU C 2  379  ? 31.735  -13.794 61.274  1.00   52.78  ? 379  GLU C C     1 
ATOM   6582  O  O     . GLU C 2  379  ? 31.001  -13.690 62.265  1.00   52.83  ? 379  GLU C O     1 
ATOM   6583  C  CB    . GLU C 2  379  ? 34.223  -13.761 61.226  1.00   61.14  ? 379  GLU C CB    1 
ATOM   6584  C  CG    . GLU C 2  379  ? 35.532  -14.510 61.060  1.00   63.57  ? 379  GLU C CG    1 
ATOM   6585  C  CD    . GLU C 2  379  ? 36.724  -13.580 60.932  1.00   72.54  ? 379  GLU C CD    1 
ATOM   6586  O  OE1   . GLU C 2  379  ? 37.296  -13.498 59.826  1.00   67.47  ? 379  GLU C OE1   1 
ATOM   6587  O  OE2   . GLU C 2  379  ? 37.092  -12.937 61.938  1.00   93.23  ? 379  GLU C OE2   1 
ATOM   6588  N  N     . ALA C 2  380  ? 31.480  -13.217 60.100  1.00   54.74  ? 380  ALA C N     1 
ATOM   6589  C  CA    . ALA C 2  380  ? 30.352  -12.317 59.899  1.00   52.58  ? 380  ALA C CA    1 
ATOM   6590  C  C     . ALA C 2  380  ? 29.037  -12.977 60.283  1.00   55.00  ? 380  ALA C C     1 
ATOM   6591  O  O     . ALA C 2  380  ? 28.111  -12.302 60.724  1.00   64.18  ? 380  ALA C O     1 
ATOM   6592  C  CB    . ALA C 2  380  ? 30.304  -11.829 58.457  1.00   48.71  ? 380  ALA C CB    1 
ATOM   6593  N  N     . ALA C 2  381  ? 28.956  -14.294 60.119  1.00   51.09  ? 381  ALA C N     1 
ATOM   6594  C  CA    . ALA C 2  381  ? 27.753  -15.006 60.517  1.00   50.47  ? 381  ALA C CA    1 
ATOM   6595  C  C     . ALA C 2  381  ? 27.666  -15.058 62.034  1.00   51.43  ? 381  ALA C C     1 
ATOM   6596  O  O     . ALA C 2  381  ? 26.671  -14.624 62.621  1.00   56.25  ? 381  ALA C O     1 
ATOM   6597  C  CB    . ALA C 2  381  ? 27.740  -16.403 59.933  1.00   53.78  ? 381  ALA C CB    1 
ATOM   6598  N  N     . ILE C 2  382  ? 28.732  -15.553 62.662  1.00   51.39  ? 382  ILE C N     1 
ATOM   6599  C  CA    . ILE C 2  382  ? 28.729  -15.790 64.101  1.00   42.74  ? 382  ILE C CA    1 
ATOM   6600  C  C     . ILE C 2  382  ? 28.438  -14.500 64.848  1.00   48.14  ? 382  ILE C C     1 
ATOM   6601  O  O     . ILE C 2  382  ? 27.503  -14.437 65.650  1.00   49.38  ? 382  ILE C O     1 
ATOM   6602  C  CB    . ILE C 2  382  ? 30.061  -16.382 64.586  1.00   40.04  ? 382  ILE C CB    1 
ATOM   6603  C  CG1   . ILE C 2  382  ? 30.300  -17.747 63.938  1.00   42.73  ? 382  ILE C CG1   1 
ATOM   6604  C  CG2   . ILE C 2  382  ? 30.063  -16.501 66.097  1.00   43.73  ? 382  ILE C CG2   1 
ATOM   6605  C  CD1   . ILE C 2  382  ? 31.586  -18.407 64.370  1.00   38.91  ? 382  ILE C CD1   1 
ATOM   6606  N  N     . ARG C 2  383  ? 29.222  -13.468 64.547  1.00   50.45  ? 383  ARG C N     1 
ATOM   6607  C  CA    . ARG C 2  383  ? 29.002  -12.138 65.099  1.00   56.10  ? 383  ARG C CA    1 
ATOM   6608  C  C     . ARG C 2  383  ? 27.544  -11.726 64.925  1.00   58.72  ? 383  ARG C C     1 
ATOM   6609  O  O     . ARG C 2  383  ? 26.896  -11.297 65.884  1.00   57.22  ? 383  ARG C O     1 
ATOM   6610  C  CB    . ARG C 2  383  ? 29.927  -11.124 64.422  1.00   61.28  ? 383  ARG C CB    1 
ATOM   6611  C  CG    . ARG C 2  383  ? 29.834  -9.713  64.979  1.00   70.62  ? 383  ARG C CG    1 
ATOM   6612  C  CD    . ARG C 2  383  ? 31.031  -8.867  64.558  1.00   66.11  ? 383  ARG C CD    1 
ATOM   6613  N  NE    . ARG C 2  383  ? 31.180  -8.785  63.106  1.00   74.46  ? 383  ARG C NE    1 
ATOM   6614  C  CZ    . ARG C 2  383  ? 32.088  -9.456  62.402  1.00   69.12  ? 383  ARG C CZ    1 
ATOM   6615  N  NH1   . ARG C 2  383  ? 32.941  -10.269 63.013  1.00   58.08  ? 383  ARG C NH1   1 
ATOM   6616  N  NH2   . ARG C 2  383  ? 32.144  -9.312  61.084  1.00   59.22  ? 383  ARG C NH2   1 
ATOM   6617  N  N     . GLU C 2  384  ? 27.025  -11.899 63.710  1.00   54.33  ? 384  GLU C N     1 
ATOM   6618  C  CA    . GLU C 2  384  ? 25.650  -11.513 63.405  1.00   55.18  ? 384  GLU C CA    1 
ATOM   6619  C  C     . GLU C 2  384  ? 24.645  -12.233 64.299  1.00   57.43  ? 384  GLU C C     1 
ATOM   6620  O  O     . GLU C 2  384  ? 23.639  -11.651 64.706  1.00   63.10  ? 384  GLU C O     1 
ATOM   6621  C  CB    . GLU C 2  384  ? 25.333  -11.766 61.930  1.00   60.30  ? 384  GLU C CB    1 
ATOM   6622  C  CG    . GLU C 2  384  ? 23.970  -12.382 61.679  1.00   77.87  ? 384  GLU C CG    1 
ATOM   6623  C  CD    . GLU C 2  384  ? 24.000  -13.408 60.566  1.00   87.89  ? 384  GLU C CD    1 
ATOM   6624  O  OE1   . GLU C 2  384  ? 24.350  -13.033 59.427  1.00   79.42  ? 384  GLU C OE1   1 
ATOM   6625  O  OE2   . GLU C 2  384  ? 23.687  -14.589 60.834  1.00   83.31  ? 384  GLU C OE2   1 
ATOM   6626  N  N     . PHE C 2  385  ? 24.924  -13.493 64.619  1.00   51.40  ? 385  PHE C N     1 
ATOM   6627  C  CA    . PHE C 2  385  ? 24.033  -14.244 65.490  1.00   46.68  ? 385  PHE C CA    1 
ATOM   6628  C  C     . PHE C 2  385  ? 24.153  -13.753 66.924  1.00   46.42  ? 385  PHE C C     1 
ATOM   6629  O  O     . PHE C 2  385  ? 23.186  -13.779 67.677  1.00   48.92  ? 385  PHE C O     1 
ATOM   6630  C  CB    . PHE C 2  385  ? 24.323  -15.744 65.420  1.00   48.35  ? 385  PHE C CB    1 
ATOM   6631  C  CG    . PHE C 2  385  ? 23.550  -16.557 66.424  1.00   46.81  ? 385  PHE C CG    1 
ATOM   6632  C  CD1   . PHE C 2  385  ? 22.166  -16.504 66.460  1.00   50.33  ? 385  PHE C CD1   1 
ATOM   6633  C  CD2   . PHE C 2  385  ? 24.207  -17.377 67.326  1.00   40.25  ? 385  PHE C CD2   1 
ATOM   6634  C  CE1   . PHE C 2  385  ? 21.453  -17.247 67.379  1.00   42.29  ? 385  PHE C CE1   1 
ATOM   6635  C  CE2   . PHE C 2  385  ? 23.500  -18.125 68.245  1.00   39.75  ? 385  PHE C CE2   1 
ATOM   6636  C  CZ    . PHE C 2  385  ? 22.121  -18.058 68.273  1.00   39.22  ? 385  PHE C CZ    1 
ATOM   6637  N  N     . PHE C 2  386  ? 25.347  -13.328 67.318  1.00   47.32  ? 386  PHE C N     1 
ATOM   6638  C  CA    . PHE C 2  386  ? 25.533  -12.846 68.684  1.00   49.53  ? 386  PHE C CA    1 
ATOM   6639  C  C     . PHE C 2  386  ? 25.132  -11.384 68.888  1.00   51.97  ? 386  PHE C C     1 
ATOM   6640  O  O     . PHE C 2  386  ? 24.496  -11.047 69.887  1.00   48.69  ? 386  PHE C O     1 
ATOM   6641  C  CB    . PHE C 2  386  ? 26.952  -13.133 69.189  1.00   48.96  ? 386  PHE C CB    1 
ATOM   6642  C  CG    . PHE C 2  386  ? 27.165  -14.569 69.596  1.00   48.25  ? 386  PHE C CG    1 
ATOM   6643  C  CD1   . PHE C 2  386  ? 26.964  -15.592 68.686  1.00   47.14  ? 386  PHE C CD1   1 
ATOM   6644  C  CD2   . PHE C 2  386  ? 27.555  -14.897 70.882  1.00   49.44  ? 386  PHE C CD2   1 
ATOM   6645  C  CE1   . PHE C 2  386  ? 27.147  -16.911 69.046  1.00   43.98  ? 386  PHE C CE1   1 
ATOM   6646  C  CE2   . PHE C 2  386  ? 27.746  -16.219 71.244  1.00   50.51  ? 386  PHE C CE2   1 
ATOM   6647  C  CZ    . PHE C 2  386  ? 27.539  -17.225 70.321  1.00   48.37  ? 386  PHE C CZ    1 
ATOM   6648  N  N     . SER C 2  387  ? 25.509  -10.521 67.948  1.00   54.73  ? 387  SER C N     1 
ATOM   6649  C  CA    . SER C 2  387  ? 25.193  -9.098  68.056  1.00   60.11  ? 387  SER C CA    1 
ATOM   6650  C  C     . SER C 2  387  ? 23.727  -8.746  67.784  1.00   56.96  ? 387  SER C C     1 
ATOM   6651  O  O     . SER C 2  387  ? 23.048  -8.175  68.637  1.00   60.98  ? 387  SER C O     1 
ATOM   6652  C  CB    . SER C 2  387  ? 26.104  -8.282  67.131  1.00   65.50  ? 387  SER C CB    1 
ATOM   6653  O  OG    . SER C 2  387  ? 27.473  -8.571  67.368  1.00   57.15  ? 387  SER C OG    1 
ATOM   6654  N  N     . ARG C 2  388  ? 23.241  -9.103  66.600  1.00   52.79  ? 388  ARG C N     1 
ATOM   6655  C  CA    . ARG C 2  388  ? 21.937  -8.624  66.144  1.00   59.80  ? 388  ARG C CA    1 
ATOM   6656  C  C     . ARG C 2  388  ? 20.735  -9.570  66.265  1.00   54.05  ? 388  ARG C C     1 
ATOM   6657  O  O     . ARG C 2  388  ? 19.617  -9.177  65.935  1.00   64.79  ? 388  ARG C O     1 
ATOM   6658  C  CB    . ARG C 2  388  ? 22.044  -8.071  64.719  1.00   66.52  ? 388  ARG C CB    1 
ATOM   6659  C  CG    . ARG C 2  388  ? 22.275  -6.567  64.673  1.00   73.28  ? 388  ARG C CG    1 
ATOM   6660  C  CD    . ARG C 2  388  ? 23.465  -6.187  63.805  1.00   81.34  ? 388  ARG C CD    1 
ATOM   6661  N  NE    . ARG C 2  388  ? 24.696  -6.042  64.584  1.00   91.96  ? 388  ARG C NE    1 
ATOM   6662  C  CZ    . ARG C 2  388  ? 24.960  -5.013  65.386  1.00   93.60  ? 388  ARG C CZ    1 
ATOM   6663  N  NH1   . ARG C 2  388  ? 24.074  -4.033  65.522  1.00   99.62  ? 388  ARG C NH1   1 
ATOM   6664  N  NH2   . ARG C 2  388  ? 26.106  -4.965  66.059  1.00   93.91  ? 388  ARG C NH2   1 
ATOM   6665  N  N     . SER C 2  389  ? 20.935  -10.795 66.736  1.00   47.81  ? 389  SER C N     1 
ATOM   6666  C  CA    . SER C 2  389  ? 19.832  -11.758 66.716  1.00   58.51  ? 389  SER C CA    1 
ATOM   6667  C  C     . SER C 2  389  ? 18.714  -11.485 67.725  1.00   55.26  ? 389  SER C C     1 
ATOM   6668  O  O     . SER C 2  389  ? 18.935  -10.912 68.794  1.00   44.74  ? 389  SER C O     1 
ATOM   6669  C  CB    . SER C 2  389  ? 20.333  -13.193 66.870  1.00   57.38  ? 389  SER C CB    1 
ATOM   6670  O  OG    . SER C 2  389  ? 19.240  -14.097 66.987  1.00   44.46  ? 389  SER C OG    1 
ATOM   6671  N  N     . GLN C 2  390  ? 17.511  -11.917 67.361  1.00   56.66  ? 390  GLN C N     1 
ATOM   6672  C  CA    . GLN C 2  390  ? 16.337  -11.780 68.210  1.00   54.85  ? 390  GLN C CA    1 
ATOM   6673  C  C     . GLN C 2  390  ? 16.497  -12.590 69.490  1.00   50.33  ? 390  GLN C C     1 
ATOM   6674  O  O     . GLN C 2  390  ? 16.098  -12.149 70.569  1.00   42.74  ? 390  GLN C O     1 
ATOM   6675  C  CB    . GLN C 2  390  ? 15.087  -12.240 67.451  1.00   60.36  ? 390  GLN C CB    1 
ATOM   6676  C  CG    . GLN C 2  390  ? 13.853  -12.463 68.319  1.00   63.75  ? 390  GLN C CG    1 
ATOM   6677  C  CD    . GLN C 2  390  ? 13.018  -11.210 68.505  1.00   76.98  ? 390  GLN C CD    1 
ATOM   6678  O  OE1   . GLN C 2  390  ? 11.828  -11.190 68.183  1.00   70.94  ? 390  GLN C OE1   1 
ATOM   6679  N  NE2   . GLN C 2  390  ? 13.632  -10.160 69.037  1.00   83.63  ? 390  GLN C NE2   1 
ATOM   6680  N  N     . LEU C 2  391  ? 17.093  -13.771 69.360  1.00   48.69  ? 391  LEU C N     1 
ATOM   6681  C  CA    . LEU C 2  391  ? 17.229  -14.695 70.481  1.00   40.27  ? 391  LEU C CA    1 
ATOM   6682  C  C     . LEU C 2  391  ? 18.458  -14.405 71.335  1.00   34.94  ? 391  LEU C C     1 
ATOM   6683  O  O     . LEU C 2  391  ? 18.621  -14.974 72.413  1.00   28.15  ? 391  LEU C O     1 
ATOM   6684  C  CB    . LEU C 2  391  ? 17.255  -16.139 69.981  1.00   32.02  ? 391  LEU C CB    1 
ATOM   6685  C  CG    . LEU C 2  391  ? 15.960  -16.600 69.316  1.00   31.04  ? 391  LEU C CG    1 
ATOM   6686  C  CD1   . LEU C 2  391  ? 16.095  -18.018 68.801  1.00   37.69  ? 391  LEU C CD1   1 
ATOM   6687  C  CD2   . LEU C 2  391  ? 14.803  -16.492 70.290  1.00   30.74  ? 391  LEU C CD2   1 
ATOM   6688  N  N     . SER C 2  392  ? 19.321  -13.518 70.854  1.00   35.21  ? 392  SER C N     1 
ATOM   6689  C  CA    . SER C 2  392  ? 20.443  -13.067 71.660  1.00   31.94  ? 392  SER C CA    1 
ATOM   6690  C  C     . SER C 2  392  ? 20.011  -11.811 72.394  1.00   38.70  ? 392  SER C C     1 
ATOM   6691  O  O     . SER C 2  392  ? 19.830  -10.757 71.784  1.00   44.36  ? 392  SER C O     1 
ATOM   6692  C  CB    . SER C 2  392  ? 21.654  -12.768 70.781  1.00   37.34  ? 392  SER C CB    1 
ATOM   6693  O  OG    . SER C 2  392  ? 22.724  -12.258 71.556  1.00   36.23  ? 392  SER C OG    1 
ATOM   6694  N  N     . GLN C 2  393  ? 19.860  -11.923 73.709  1.00   37.28  ? 393  GLN C N     1 
ATOM   6695  C  CA    . GLN C 2  393  ? 19.303  -10.834 74.502  1.00   35.51  ? 393  GLN C CA    1 
ATOM   6696  C  C     . GLN C 2  393  ? 20.329  -10.227 75.448  1.00   37.46  ? 393  GLN C C     1 
ATOM   6697  O  O     . GLN C 2  393  ? 21.252  -10.903 75.894  1.00   37.38  ? 393  GLN C O     1 
ATOM   6698  C  CB    . GLN C 2  393  ? 18.087  -11.321 75.293  1.00   29.12  ? 393  GLN C CB    1 
ATOM   6699  C  CG    . GLN C 2  393  ? 16.959  -11.856 74.423  1.00   34.32  ? 393  GLN C CG    1 
ATOM   6700  C  CD    . GLN C 2  393  ? 15.732  -12.246 75.228  1.00   39.91  ? 393  GLN C CD    1 
ATOM   6701  O  OE1   . GLN C 2  393  ? 15.754  -12.237 76.459  1.00   40.04  ? 393  GLN C OE1   1 
ATOM   6702  N  NE2   . GLN C 2  393  ? 14.653  -12.590 74.533  1.00   36.82  ? 393  GLN C NE2   1 
ATOM   6703  N  N     . PHE C 2  394  ? 20.169  -8.942  75.741  1.00   39.74  ? 394  PHE C N     1 
ATOM   6704  C  CA    . PHE C 2  394  ? 21.009  -8.279  76.725  1.00   39.27  ? 394  PHE C CA    1 
ATOM   6705  C  C     . PHE C 2  394  ? 20.686  -8.878  78.093  1.00   40.94  ? 394  PHE C C     1 
ATOM   6706  O  O     . PHE C 2  394  ? 19.525  -8.915  78.502  1.00   41.78  ? 394  PHE C O     1 
ATOM   6707  C  CB    . PHE C 2  394  ? 20.743  -6.772  76.705  1.00   42.24  ? 394  PHE C CB    1 
ATOM   6708  C  CG    . PHE C 2  394  ? 21.787  -5.956  77.415  1.00   50.31  ? 394  PHE C CG    1 
ATOM   6709  C  CD1   . PHE C 2  394  ? 23.052  -5.800  76.872  1.00   43.62  ? 394  PHE C CD1   1 
ATOM   6710  C  CD2   . PHE C 2  394  ? 21.495  -5.326  78.614  1.00   56.18  ? 394  PHE C CD2   1 
ATOM   6711  C  CE1   . PHE C 2  394  ? 24.012  -5.043  77.522  1.00   49.41  ? 394  PHE C CE1   1 
ATOM   6712  C  CE2   . PHE C 2  394  ? 22.449  -4.566  79.266  1.00   50.54  ? 394  PHE C CE2   1 
ATOM   6713  C  CZ    . PHE C 2  394  ? 23.709  -4.425  78.720  1.00   50.34  ? 394  PHE C CZ    1 
ATOM   6714  N  N     . LYS C 2  395  ? 21.713  -9.356  78.790  1.00   37.29  ? 395  LYS C N     1 
ATOM   6715  C  CA    . LYS C 2  395  ? 21.524  -10.098 80.036  1.00   34.01  ? 395  LYS C CA    1 
ATOM   6716  C  C     . LYS C 2  395  ? 20.899  -9.249  81.134  1.00   34.24  ? 395  LYS C C     1 
ATOM   6717  O  O     . LYS C 2  395  ? 21.250  -8.082  81.302  1.00   35.46  ? 395  LYS C O     1 
ATOM   6718  C  CB    . LYS C 2  395  ? 22.860  -10.669 80.521  1.00   34.65  ? 395  LYS C CB    1 
ATOM   6719  C  CG    . LYS C 2  395  ? 22.779  -11.474 81.809  1.00   29.84  ? 395  LYS C CG    1 
ATOM   6720  C  CD    . LYS C 2  395  ? 24.138  -12.048 82.175  1.00   31.32  ? 395  LYS C CD    1 
ATOM   6721  C  CE    . LYS C 2  395  ? 24.054  -12.945 83.395  1.00   33.57  ? 395  LYS C CE    1 
ATOM   6722  N  NZ    . LYS C 2  395  ? 25.375  -13.545 83.731  1.00   35.77  ? 395  LYS C NZ    1 
ATOM   6723  N  N     . ASP C 2  396  ? 19.975  -9.841  81.886  1.00   36.52  ? 396  ASP C N     1 
ATOM   6724  C  CA    . ASP C 2  396  ? 19.398  -9.150  83.028  1.00   37.10  ? 396  ASP C CA    1 
ATOM   6725  C  C     . ASP C 2  396  ? 20.195  -9.524  84.270  1.00   37.18  ? 396  ASP C C     1 
ATOM   6726  O  O     . ASP C 2  396  ? 20.102  -10.643 84.778  1.00   34.15  ? 396  ASP C O     1 
ATOM   6727  C  CB    . ASP C 2  396  ? 17.928  -9.538  83.195  1.00   32.55  ? 396  ASP C CB    1 
ATOM   6728  C  CG    . ASP C 2  396  ? 17.246  -8.779  84.319  1.00   37.00  ? 396  ASP C CG    1 
ATOM   6729  O  OD1   . ASP C 2  396  ? 17.778  -7.735  84.751  1.00   36.47  ? 396  ASP C OD1   1 
ATOM   6730  O  OD2   . ASP C 2  396  ? 16.168  -9.224  84.766  1.00   36.37  ? 396  ASP C OD2   1 
ATOM   6731  N  N     . GLU C 2  397  ? 20.980  -8.565  84.748  1.00   38.22  ? 397  GLU C N     1 
ATOM   6732  C  CA    . GLU C 2  397  ? 21.856  -8.757  85.898  1.00   37.62  ? 397  GLU C CA    1 
ATOM   6733  C  C     . GLU C 2  397  ? 21.276  -8.216  87.202  1.00   41.35  ? 397  GLU C C     1 
ATOM   6734  O  O     . GLU C 2  397  ? 21.966  -8.202  88.224  1.00   43.26  ? 397  GLU C O     1 
ATOM   6735  C  CB    . GLU C 2  397  ? 23.239  -8.158  85.631  1.00   36.04  ? 397  GLU C CB    1 
ATOM   6736  C  CG    . GLU C 2  397  ? 24.027  -8.894  84.560  1.00   42.58  ? 397  GLU C CG    1 
ATOM   6737  C  CD    . GLU C 2  397  ? 25.497  -8.519  84.549  1.00   52.51  ? 397  GLU C CD    1 
ATOM   6738  O  OE1   . GLU C 2  397  ? 26.337  -9.395  84.852  1.00   52.85  ? 397  GLU C OE1   1 
ATOM   6739  O  OE2   . GLU C 2  397  ? 25.814  -7.352  84.232  1.00   52.14  ? 397  GLU C OE2   1 
ATOM   6740  N  N     . THR C 2  398  ? 20.025  -7.759  87.151  1.00   37.84  ? 398  THR C N     1 
ATOM   6741  C  CA    . THR C 2  398  ? 19.403  -7.022  88.251  1.00   31.62  ? 398  THR C CA    1 
ATOM   6742  C  C     . THR C 2  398  ? 19.641  -7.690  89.600  1.00   33.14  ? 398  THR C C     1 
ATOM   6743  O  O     . THR C 2  398  ? 20.112  -7.051  90.536  1.00   35.59  ? 398  THR C O     1 
ATOM   6744  C  CB    . THR C 2  398  ? 17.887  -6.869  88.032  1.00   31.42  ? 398  THR C CB    1 
ATOM   6745  O  OG1   . THR C 2  398  ? 17.645  -6.246  86.765  1.00   29.02  ? 398  THR C OG1   1 
ATOM   6746  C  CG2   . THR C 2  398  ? 17.273  -6.022  89.134  1.00   35.68  ? 398  THR C CG2   1 
ATOM   6747  N  N     . ASN C 2  399  ? 19.339  -8.981  89.682  1.00   34.85  ? 399  ASN C N     1 
ATOM   6748  C  CA    . ASN C 2  399  ? 19.767  -9.801  90.811  1.00   35.36  ? 399  ASN C CA    1 
ATOM   6749  C  C     . ASN C 2  399  ? 20.153  -11.187 90.284  1.00   33.24  ? 399  ASN C C     1 
ATOM   6750  O  O     . ASN C 2  399  ? 19.998  -11.446 89.091  1.00   34.94  ? 399  ASN C O     1 
ATOM   6751  C  CB    . ASN C 2  399  ? 18.667  -9.867  91.881  1.00   27.42  ? 399  ASN C CB    1 
ATOM   6752  C  CG    . ASN C 2  399  ? 17.329  -10.282 91.320  1.00   32.03  ? 399  ASN C CG    1 
ATOM   6753  O  OD1   . ASN C 2  399  ? 17.133  -11.437 90.943  1.00   35.84  ? 399  ASN C OD1   1 
ATOM   6754  N  ND2   . ASN C 2  399  ? 16.390  -9.344  91.273  1.00   32.50  ? 399  ASN C ND2   1 
ATOM   6755  N  N     . PRO C 2  400  ? 20.675  -12.075 91.150  1.00   26.03  ? 400  PRO C N     1 
ATOM   6756  C  CA    . PRO C 2  400  ? 21.021  -13.413 90.650  1.00   32.01  ? 400  PRO C CA    1 
ATOM   6757  C  C     . PRO C 2  400  ? 19.844  -14.171 90.031  1.00   32.63  ? 400  PRO C C     1 
ATOM   6758  O  O     . PRO C 2  400  ? 20.007  -14.845 89.003  1.00   37.02  ? 400  PRO C O     1 
ATOM   6759  C  CB    . PRO C 2  400  ? 21.512  -14.125 91.908  1.00   33.02  ? 400  PRO C CB    1 
ATOM   6760  C  CG    . PRO C 2  400  ? 22.139  -13.036 92.702  1.00   30.54  ? 400  PRO C CG    1 
ATOM   6761  C  CD    . PRO C 2  400  ? 21.294  -11.815 92.464  1.00   27.30  ? 400  PRO C CD    1 
ATOM   6762  N  N     . LEU C 2  401  ? 18.671  -14.049 90.644  1.00   28.85  ? 401  LEU C N     1 
ATOM   6763  C  CA    . LEU C 2  401  ? 17.472  -14.700 90.132  1.00   31.82  ? 401  LEU C CA    1 
ATOM   6764  C  C     . LEU C 2  401  ? 17.113  -14.172 88.745  1.00   36.26  ? 401  LEU C C     1 
ATOM   6765  O  O     . LEU C 2  401  ? 16.516  -14.883 87.937  1.00   40.48  ? 401  LEU C O     1 
ATOM   6766  C  CB    . LEU C 2  401  ? 16.300  -14.507 91.094  1.00   28.63  ? 401  LEU C CB    1 
ATOM   6767  C  CG    . LEU C 2  401  ? 14.966  -15.120 90.668  1.00   26.58  ? 401  LEU C CG    1 
ATOM   6768  C  CD1   . LEU C 2  401  ? 15.070  -16.636 90.583  1.00   25.34  ? 401  LEU C CD1   1 
ATOM   6769  C  CD2   . LEU C 2  401  ? 13.867  -14.701 91.624  1.00   36.73  ? 401  LEU C CD2   1 
ATOM   6770  N  N     . SER C 2  402  ? 17.483  -12.925 88.473  1.00   32.64  ? 402  SER C N     1 
ATOM   6771  C  CA    . SER C 2  402  ? 17.245  -12.331 87.163  1.00   36.22  ? 402  SER C CA    1 
ATOM   6772  C  C     . SER C 2  402  ? 18.029  -13.071 86.082  1.00   36.62  ? 402  SER C C     1 
ATOM   6773  O  O     . SER C 2  402  ? 17.473  -13.460 85.055  1.00   36.39  ? 402  SER C O     1 
ATOM   6774  C  CB    . SER C 2  402  ? 17.625  -10.849 87.166  1.00   39.42  ? 402  SER C CB    1 
ATOM   6775  O  OG    . SER C 2  402  ? 16.923  -10.141 88.173  1.00   37.74  ? 402  SER C OG    1 
ATOM   6776  N  N     . SER C 2  403  ? 19.322  -13.262 86.327  1.00   33.10  ? 403  SER C N     1 
ATOM   6777  C  CA    . SER C 2  403  ? 20.188  -13.978 85.398  1.00   31.40  ? 403  SER C CA    1 
ATOM   6778  C  C     . SER C 2  403  ? 19.725  -15.421 85.238  1.00   33.10  ? 403  SER C C     1 
ATOM   6779  O  O     . SER C 2  403  ? 19.584  -15.922 84.115  1.00   35.04  ? 403  SER C O     1 
ATOM   6780  C  CB    . SER C 2  403  ? 21.635  -13.951 85.893  1.00   31.12  ? 403  SER C CB    1 
ATOM   6781  O  OG    . SER C 2  403  ? 22.080  -12.621 86.096  1.00   30.54  ? 403  SER C OG    1 
ATOM   6782  N  N     . LEU C 2  404  ? 19.482  -16.080 86.368  1.00   35.86  ? 404  LEU C N     1 
ATOM   6783  C  CA    . LEU C 2  404  ? 19.058  -17.479 86.359  1.00   36.50  ? 404  LEU C CA    1 
ATOM   6784  C  C     . LEU C 2  404  ? 17.762  -17.685 85.574  1.00   33.51  ? 404  LEU C C     1 
ATOM   6785  O  O     . LEU C 2  404  ? 17.647  -18.629 84.792  1.00   31.47  ? 404  LEU C O     1 
ATOM   6786  C  CB    . LEU C 2  404  ? 18.896  -18.000 87.787  1.00   31.85  ? 404  LEU C CB    1 
ATOM   6787  C  CG    . LEU C 2  404  ? 18.642  -19.500 87.933  1.00   25.44  ? 404  LEU C CG    1 
ATOM   6788  C  CD1   . LEU C 2  404  ? 19.837  -20.295 87.438  1.00   26.74  ? 404  LEU C CD1   1 
ATOM   6789  C  CD2   . LEU C 2  404  ? 18.333  -19.842 89.378  1.00   35.85  ? 404  LEU C CD2   1 
ATOM   6790  N  N     . ARG C 2  405  ? 16.797  -16.794 85.781  1.00   33.30  ? 405  ARG C N     1 
ATOM   6791  C  CA    . ARG C 2  405  ? 15.519  -16.868 85.080  1.00   33.31  ? 405  ARG C CA    1 
ATOM   6792  C  C     . ARG C 2  405  ? 15.690  -16.553 83.603  1.00   35.29  ? 405  ARG C C     1 
ATOM   6793  O  O     . ARG C 2  405  ? 15.037  -17.157 82.749  1.00   37.98  ? 405  ARG C O     1 
ATOM   6794  C  CB    . ARG C 2  405  ? 14.513  -15.891 85.683  1.00   35.21  ? 405  ARG C CB    1 
ATOM   6795  C  CG    . ARG C 2  405  ? 13.117  -16.028 85.105  1.00   45.99  ? 405  ARG C CG    1 
ATOM   6796  C  CD    . ARG C 2  405  ? 12.302  -14.768 85.316  1.00   42.21  ? 405  ARG C CD    1 
ATOM   6797  N  NE    . ARG C 2  405  ? 12.584  -13.767 84.294  1.00   46.52  ? 405  ARG C NE    1 
ATOM   6798  C  CZ    . ARG C 2  405  ? 11.652  -13.033 83.696  1.00   52.84  ? 405  ARG C CZ    1 
ATOM   6799  N  NH1   . ARG C 2  405  ? 10.375  -13.187 84.023  1.00   37.32  ? 405  ARG C NH1   1 
ATOM   6800  N  NH2   . ARG C 2  405  ? 11.998  -12.145 82.773  1.00   65.72  ? 405  ARG C NH2   1 
ATOM   6801  N  N     . HIS C 2  406  ? 16.562  -15.593 83.312  1.00   32.17  ? 406  HIS C N     1 
ATOM   6802  C  CA    . HIS C 2  406  ? 16.833  -15.187 81.941  1.00   29.17  ? 406  HIS C CA    1 
ATOM   6803  C  C     . HIS C 2  406  ? 17.395  -16.360 81.151  1.00   26.03  ? 406  HIS C C     1 
ATOM   6804  O  O     . HIS C 2  406  ? 17.065  -16.545 79.981  1.00   24.58  ? 406  HIS C O     1 
ATOM   6805  C  CB    . HIS C 2  406  ? 17.815  -14.014 81.913  1.00   31.02  ? 406  HIS C CB    1 
ATOM   6806  C  CG    . HIS C 2  406  ? 17.838  -13.272 80.613  1.00   30.23  ? 406  HIS C CG    1 
ATOM   6807  N  ND1   . HIS C 2  406  ? 18.615  -12.152 80.409  1.00   29.97  ? 406  HIS C ND1   1 
ATOM   6808  C  CD2   . HIS C 2  406  ? 17.175  -13.485 79.451  1.00   30.89  ? 406  HIS C CD2   1 
ATOM   6809  C  CE1   . HIS C 2  406  ? 18.433  -11.709 79.178  1.00   30.25  ? 406  HIS C CE1   1 
ATOM   6810  N  NE2   . HIS C 2  406  ? 17.563  -12.500 78.576  1.00   31.26  ? 406  HIS C NE2   1 
ATOM   6811  N  N     . LYS C 2  407  ? 18.237  -17.156 81.802  1.00   29.94  ? 407  LYS C N     1 
ATOM   6812  C  CA    . LYS C 2  407  ? 18.841  -18.313 81.148  1.00   30.78  ? 407  LYS C CA    1 
ATOM   6813  C  C     . LYS C 2  407  ? 17.853  -19.469 80.980  1.00   31.26  ? 407  LYS C C     1 
ATOM   6814  O  O     . LYS C 2  407  ? 18.073  -20.375 80.174  1.00   31.99  ? 407  LYS C O     1 
ATOM   6815  C  CB    . LYS C 2  407  ? 20.090  -18.764 81.909  1.00   26.09  ? 407  LYS C CB    1 
ATOM   6816  C  CG    . LYS C 2  407  ? 21.221  -17.752 81.842  1.00   28.46  ? 407  LYS C CG    1 
ATOM   6817  C  CD    . LYS C 2  407  ? 22.207  -17.915 82.985  1.00   32.32  ? 407  LYS C CD    1 
ATOM   6818  C  CE    . LYS C 2  407  ? 23.221  -16.779 82.988  1.00   32.27  ? 407  LYS C CE    1 
ATOM   6819  N  NZ    . LYS C 2  407  ? 24.103  -16.807 84.185  1.00   34.59  ? 407  LYS C NZ    1 
ATOM   6820  N  N     . ARG C 2  408  ? 16.766  -19.433 81.745  1.00   27.44  ? 408  ARG C N     1 
ATOM   6821  C  CA    . ARG C 2  408  ? 15.735  -20.465 81.669  1.00   27.60  ? 408  ARG C CA    1 
ATOM   6822  C  C     . ARG C 2  408  ? 14.554  -20.091 80.769  1.00   30.75  ? 408  ARG C C     1 
ATOM   6823  O  O     . ARG C 2  408  ? 13.563  -20.819 80.707  1.00   30.49  ? 408  ARG C O     1 
ATOM   6824  C  CB    . ARG C 2  408  ? 15.247  -20.844 83.068  1.00   31.57  ? 408  ARG C CB    1 
ATOM   6825  C  CG    . ARG C 2  408  ? 16.329  -21.445 83.948  1.00   29.59  ? 408  ARG C CG    1 
ATOM   6826  C  CD    . ARG C 2  408  ? 15.799  -21.763 85.335  1.00   34.87  ? 408  ARG C CD    1 
ATOM   6827  N  NE    . ARG C 2  408  ? 14.755  -22.781 85.294  1.00   35.25  ? 408  ARG C NE    1 
ATOM   6828  C  CZ    . ARG C 2  408  ? 14.987  -24.087 85.364  1.00   42.37  ? 408  ARG C CZ    1 
ATOM   6829  N  NH1   . ARG C 2  408  ? 13.979  -24.946 85.318  1.00   45.30  ? 408  ARG C NH1   1 
ATOM   6830  N  NH2   . ARG C 2  408  ? 16.230  -24.536 85.477  1.00   42.41  ? 408  ARG C NH2   1 
ATOM   6831  N  N     . ARG C 2  409  ? 14.654  -18.948 80.093  1.00   33.44  ? 409  ARG C N     1 
ATOM   6832  C  CA    . ARG C 2  409  ? 13.593  -18.476 79.200  1.00   34.49  ? 409  ARG C CA    1 
ATOM   6833  C  C     . ARG C 2  409  ? 13.364  -19.400 78.003  1.00   29.50  ? 409  ARG C C     1 
ATOM   6834  O  O     . ARG C 2  409  ? 14.288  -20.054 77.520  1.00   24.89  ? 409  ARG C O     1 
ATOM   6835  C  CB    . ARG C 2  409  ? 13.903  -17.065 78.690  1.00   31.35  ? 409  ARG C CB    1 
ATOM   6836  C  CG    . ARG C 2  409  ? 13.887  -15.977 79.751  1.00   43.54  ? 409  ARG C CG    1 
ATOM   6837  C  CD    . ARG C 2  409  ? 12.541  -15.267 79.824  1.00   48.03  ? 409  ARG C CD    1 
ATOM   6838  N  NE    . ARG C 2  409  ? 11.537  -16.038 80.552  1.00   58.22  ? 409  ARG C NE    1 
ATOM   6839  C  CZ    . ARG C 2  409  ? 10.361  -15.552 80.936  1.00   58.77  ? 409  ARG C CZ    1 
ATOM   6840  N  NH1   . ARG C 2  409  ? 10.042  -14.293 80.661  1.00   56.63  ? 409  ARG C NH1   1 
ATOM   6841  N  NH2   . ARG C 2  409  ? 9.504   -16.320 81.596  1.00   54.91  ? 409  ARG C NH2   1 
ATOM   6842  N  N     . ILE C 2  410  ? 12.119  -19.443 77.535  1.00   27.94  ? 410  ILE C N     1 
ATOM   6843  C  CA    . ILE C 2  410  ? 11.758  -20.197 76.340  1.00   22.15  ? 410  ILE C CA    1 
ATOM   6844  C  C     . ILE C 2  410  ? 10.902  -19.323 75.432  1.00   24.89  ? 410  ILE C C     1 
ATOM   6845  O  O     . ILE C 2  410  ? 9.785   -18.956 75.793  1.00   31.64  ? 410  ILE C O     1 
ATOM   6846  C  CB    . ILE C 2  410  ? 10.950  -21.456 76.696  1.00   23.11  ? 410  ILE C CB    1 
ATOM   6847  C  CG1   . ILE C 2  410  ? 11.790  -22.421 77.532  1.00   25.12  ? 410  ILE C CG1   1 
ATOM   6848  C  CG2   . ILE C 2  410  ? 10.457  -22.144 75.440  1.00   21.43  ? 410  ILE C CG2   1 
ATOM   6849  C  CD1   . ILE C 2  410  ? 11.034  -23.657 77.970  1.00   27.21  ? 410  ILE C CD1   1 
ATOM   6850  N  N     . SER C 2  411  ? 11.415  -19.004 74.249  1.00   22.90  ? 411  SER C N     1 
ATOM   6851  C  CA    . SER C 2  411  ? 10.712  -18.101 73.342  1.00   27.09  ? 411  SER C CA    1 
ATOM   6852  C  C     . SER C 2  411  ? 10.145  -18.819 72.124  1.00   31.20  ? 411  SER C C     1 
ATOM   6853  O  O     . SER C 2  411  ? 10.847  -19.574 71.458  1.00   33.92  ? 411  SER C O     1 
ATOM   6854  C  CB    . SER C 2  411  ? 11.635  -16.967 72.889  1.00   24.04  ? 411  SER C CB    1 
ATOM   6855  O  OG    . SER C 2  411  ? 10.991  -16.134 71.940  1.00   21.33  ? 411  SER C OG    1 
ATOM   6856  N  N     . ALA C 2  412  ? 8.871   -18.576 71.834  1.00   34.60  ? 412  ALA C N     1 
ATOM   6857  C  CA    . ALA C 2  412  ? 8.249   -19.115 70.632  1.00   35.82  ? 412  ALA C CA    1 
ATOM   6858  C  C     . ALA C 2  412  ? 8.493   -18.170 69.462  1.00   42.15  ? 412  ALA C C     1 
ATOM   6859  O  O     . ALA C 2  412  ? 8.228   -18.506 68.308  1.00   45.52  ? 412  ALA C O     1 
ATOM   6860  C  CB    . ALA C 2  412  ? 6.761   -19.325 70.849  1.00   38.91  ? 412  ALA C CB    1 
ATOM   6861  N  N     . LEU C 2  413  ? 9.006   -16.985 69.777  1.00   39.52  ? 413  LEU C N     1 
ATOM   6862  C  CA    . LEU C 2  413  ? 9.317   -15.979 68.772  1.00   43.75  ? 413  LEU C CA    1 
ATOM   6863  C  C     . LEU C 2  413  ? 10.705  -16.233 68.199  1.00   45.06  ? 413  LEU C C     1 
ATOM   6864  O  O     . LEU C 2  413  ? 11.318  -17.262 68.480  1.00   46.23  ? 413  LEU C O     1 
ATOM   6865  C  CB    . LEU C 2  413  ? 9.254   -14.583 69.393  1.00   43.32  ? 413  LEU C CB    1 
ATOM   6866  C  CG    . LEU C 2  413  ? 7.941   -14.206 70.087  1.00   41.44  ? 413  LEU C CG    1 
ATOM   6867  C  CD1   . LEU C 2  413  ? 8.131   -12.986 70.972  1.00   44.59  ? 413  LEU C CD1   1 
ATOM   6868  C  CD2   . LEU C 2  413  ? 6.845   -13.954 69.064  1.00   50.94  ? 413  LEU C CD2   1 
ATOM   6869  N  N     . GLY C 2  414  ? 11.199  -15.297 67.395  1.00   51.98  ? 414  GLY C N     1 
ATOM   6870  C  CA    . GLY C 2  414  ? 12.538  -15.401 66.843  1.00   50.85  ? 414  GLY C CA    1 
ATOM   6871  C  C     . GLY C 2  414  ? 12.568  -15.880 65.405  1.00   62.71  ? 414  GLY C C     1 
ATOM   6872  O  O     . GLY C 2  414  ? 11.523  -16.191 64.830  1.00   60.73  ? 414  GLY C O     1 
ATOM   6873  N  N     . PRO C 2  415  ? 13.774  -15.939 64.812  1.00   68.26  ? 415  PRO C N     1 
ATOM   6874  C  CA    . PRO C 2  415  ? 13.956  -16.398 63.430  1.00   60.35  ? 415  PRO C CA    1 
ATOM   6875  C  C     . PRO C 2  415  ? 13.476  -17.834 63.257  1.00   61.30  ? 415  PRO C C     1 
ATOM   6876  O  O     . PRO C 2  415  ? 13.870  -18.713 64.024  1.00   62.66  ? 415  PRO C O     1 
ATOM   6877  C  CB    . PRO C 2  415  ? 15.475  -16.326 63.236  1.00   52.59  ? 415  PRO C CB    1 
ATOM   6878  C  CG    . PRO C 2  415  ? 15.940  -15.322 64.234  1.00   53.34  ? 415  PRO C CG    1 
ATOM   6879  C  CD    . PRO C 2  415  ? 15.042  -15.497 65.419  1.00   60.46  ? 415  PRO C CD    1 
ATOM   6880  N  N     . GLY C 2  416  ? 12.636  -18.065 62.252  1.00   63.65  ? 416  GLY C N     1 
ATOM   6881  C  CA    . GLY C 2  416  ? 12.044  -19.373 62.034  1.00   66.29  ? 416  GLY C CA    1 
ATOM   6882  C  C     . GLY C 2  416  ? 10.909  -19.662 63.001  1.00   63.43  ? 416  GLY C C     1 
ATOM   6883  O  O     . GLY C 2  416  ? 10.299  -20.731 62.957  1.00   53.53  ? 416  GLY C O     1 
ATOM   6884  N  N     . GLY C 2  417  ? 10.626  -18.703 63.877  1.00   55.80  ? 417  GLY C N     1 
ATOM   6885  C  CA    . GLY C 2  417  ? 9.582   -18.859 64.871  1.00   54.56  ? 417  GLY C CA    1 
ATOM   6886  C  C     . GLY C 2  417  ? 8.348   -18.041 64.551  1.00   63.02  ? 417  GLY C C     1 
ATOM   6887  O  O     . GLY C 2  417  ? 8.167   -17.586 63.421  1.00   69.21  ? 417  GLY C O     1 
ATOM   6888  N  N     . LEU C 2  418  ? 7.498   -17.849 65.555  1.00   65.74  ? 418  LEU C N     1 
ATOM   6889  C  CA    . LEU C 2  418  ? 6.251   -17.115 65.379  1.00   72.36  ? 418  LEU C CA    1 
ATOM   6890  C  C     . LEU C 2  418  ? 6.477   -15.613 65.240  1.00   76.00  ? 418  LEU C C     1 
ATOM   6891  O  O     . LEU C 2  418  ? 7.191   -15.005 66.038  1.00   65.87  ? 418  LEU C O     1 
ATOM   6892  C  CB    . LEU C 2  418  ? 5.293   -17.375 66.550  1.00   68.26  ? 418  LEU C CB    1 
ATOM   6893  C  CG    . LEU C 2  418  ? 4.461   -18.661 66.599  1.00   63.92  ? 418  LEU C CG    1 
ATOM   6894  C  CD1   . LEU C 2  418  ? 3.670   -18.840 65.310  1.00   72.40  ? 418  LEU C CD1   1 
ATOM   6895  C  CD2   . LEU C 2  418  ? 5.326   -19.883 66.879  1.00   68.59  ? 418  LEU C CD2   1 
ATOM   6896  N  N     . THR C 2  419  ? 5.875   -15.024 64.213  1.00   85.68  ? 419  THR C N     1 
ATOM   6897  C  CA    . THR C 2  419  ? 5.751   -13.578 64.134  1.00   84.64  ? 419  THR C CA    1 
ATOM   6898  C  C     . THR C 2  419  ? 4.593   -13.223 65.052  1.00   79.50  ? 419  THR C C     1 
ATOM   6899  O  O     . THR C 2  419  ? 3.694   -14.038 65.250  1.00   79.97  ? 419  THR C O     1 
ATOM   6900  C  CB    . THR C 2  419  ? 5.424   -13.116 62.700  1.00   88.85  ? 419  THR C CB    1 
ATOM   6901  O  OG1   . THR C 2  419  ? 6.357   -13.698 61.781  1.00   102.89 ? 419  THR C OG1   1 
ATOM   6902  C  CG2   . THR C 2  419  ? 5.486   -11.597 62.586  1.00   75.37  ? 419  THR C CG2   1 
ATOM   6903  N  N     . ARG C 2  420  ? 4.605   -12.031 65.634  1.00   78.88  ? 420  ARG C N     1 
ATOM   6904  C  CA    . ARG C 2  420  ? 3.475   -11.632 66.457  1.00   75.79  ? 420  ARG C CA    1 
ATOM   6905  C  C     . ARG C 2  420  ? 2.265   -11.352 65.567  1.00   89.52  ? 420  ARG C C     1 
ATOM   6906  O  O     . ARG C 2  420  ? 2.410   -10.959 64.409  1.00   97.32  ? 420  ARG C O     1 
ATOM   6907  C  CB    . ARG C 2  420  ? 3.817   -10.442 67.351  1.00   70.94  ? 420  ARG C CB    1 
ATOM   6908  C  CG    . ARG C 2  420  ? 3.114   -10.495 68.697  1.00   57.44  ? 420  ARG C CG    1 
ATOM   6909  C  CD    . ARG C 2  420  ? 3.619   -9.425  69.650  1.00   63.42  ? 420  ARG C CD    1 
ATOM   6910  N  NE    . ARG C 2  420  ? 4.973   -9.693  70.126  1.00   50.72  ? 420  ARG C NE    1 
ATOM   6911  C  CZ    . ARG C 2  420  ? 6.063   -9.088  69.665  1.00   55.20  ? 420  ARG C CZ    1 
ATOM   6912  N  NH1   . ARG C 2  420  ? 5.965   -8.173  68.709  1.00   52.52  ? 420  ARG C NH1   1 
ATOM   6913  N  NH2   . ARG C 2  420  ? 7.253   -9.396  70.162  1.00   51.93  ? 420  ARG C NH2   1 
ATOM   6914  N  N     . GLU C 2  421  ? 1.081   -11.575 66.129  1.00   86.74  ? 421  GLU C N     1 
ATOM   6915  C  CA    . GLU C 2  421  ? -0.181  -11.659 65.388  1.00   90.34  ? 421  GLU C CA    1 
ATOM   6916  C  C     . GLU C 2  421  ? -0.183  -12.782 64.352  1.00   95.57  ? 421  GLU C C     1 
ATOM   6917  O  O     . GLU C 2  421  ? -0.998  -12.778 63.431  1.00   105.58 ? 421  GLU C O     1 
ATOM   6918  C  CB    . GLU C 2  421  ? -0.544  -10.331 64.709  1.00   92.52  ? 421  GLU C CB    1 
ATOM   6919  C  CG    . GLU C 2  421  ? -0.885  -9.196  65.657  1.00   105.08 ? 421  GLU C CG    1 
ATOM   6920  C  CD    . GLU C 2  421  ? 0.332   -8.388  66.054  1.00   104.78 ? 421  GLU C CD    1 
ATOM   6921  O  OE1   . GLU C 2  421  ? 1.029   -8.793  67.006  1.00   109.35 ? 421  GLU C OE1   1 
ATOM   6922  O  OE2   . GLU C 2  421  ? 0.592   -7.348  65.412  1.00   98.62  ? 421  GLU C OE2   1 
ATOM   6923  N  N     . ARG C 2  422  ? 0.731   -13.737 64.498  1.00   97.08  ? 422  ARG C N     1 
ATOM   6924  C  CA    . ARG C 2  422  ? 0.560   -15.055 63.900  1.00   98.25  ? 422  ARG C CA    1 
ATOM   6925  C  C     . ARG C 2  422  ? 0.090   -16.003 64.993  1.00   94.48  ? 422  ARG C C     1 
ATOM   6926  O  O     . ARG C 2  422  ? -0.184  -17.178 64.747  1.00   93.68  ? 422  ARG C O     1 
ATOM   6927  C  CB    . ARG C 2  422  ? 1.853   -15.571 63.263  1.00   90.72  ? 422  ARG C CB    1 
ATOM   6928  C  CG    . ARG C 2  422  ? 2.241   -14.881 61.966  1.00   97.97  ? 422  ARG C CG    1 
ATOM   6929  C  CD    . ARG C 2  422  ? 2.884   -15.864 60.994  1.00   104.45 ? 422  ARG C CD    1 
ATOM   6930  N  NE    . ARG C 2  422  ? 3.942   -16.652 61.621  1.00   107.24 ? 422  ARG C NE    1 
ATOM   6931  C  CZ    . ARG C 2  422  ? 4.626   -17.613 61.005  1.00   110.71 ? 422  ARG C CZ    1 
ATOM   6932  N  NH1   . ARG C 2  422  ? 5.572   -18.278 61.654  1.00   100.25 ? 422  ARG C NH1   1 
ATOM   6933  N  NH2   . ARG C 2  422  ? 4.365   -17.909 59.739  1.00   117.31 ? 422  ARG C NH2   1 
ATOM   6934  N  N     . ALA C 2  423  ? 0.002   -15.469 66.207  1.00   80.70  ? 423  ALA C N     1 
ATOM   6935  C  CA    . ALA C 2  423  ? -0.273  -16.275 67.386  1.00   70.46  ? 423  ALA C CA    1 
ATOM   6936  C  C     . ALA C 2  423  ? -1.686  -16.054 67.902  1.00   71.07  ? 423  ALA C C     1 
ATOM   6937  O  O     . ALA C 2  423  ? -2.017  -14.975 68.396  1.00   63.93  ? 423  ALA C O     1 
ATOM   6938  C  CB    . ALA C 2  423  ? 0.742   -15.972 68.476  1.00   64.13  ? 423  ALA C CB    1 
ATOM   6939  N  N     . GLY C 2  424  ? -2.514  -17.086 67.786  1.00   74.99  ? 424  GLY C N     1 
ATOM   6940  C  CA    . GLY C 2  424  ? -3.868  -17.039 68.301  1.00   72.57  ? 424  GLY C CA    1 
ATOM   6941  C  C     . GLY C 2  424  ? -3.886  -17.426 69.764  1.00   67.07  ? 424  GLY C C     1 
ATOM   6942  O  O     . GLY C 2  424  ? -2.897  -17.246 70.470  1.00   67.07  ? 424  GLY C O     1 
ATOM   6943  N  N     . PHE C 2  425  ? -5.013  -17.956 70.224  1.00   66.68  ? 425  PHE C N     1 
ATOM   6944  C  CA    . PHE C 2  425  ? -5.127  -18.404 71.606  1.00   62.94  ? 425  PHE C CA    1 
ATOM   6945  C  C     . PHE C 2  425  ? -4.438  -19.751 71.803  1.00   62.61  ? 425  PHE C C     1 
ATOM   6946  O  O     . PHE C 2  425  ? -3.926  -20.042 72.884  1.00   60.33  ? 425  PHE C O     1 
ATOM   6947  C  CB    . PHE C 2  425  ? -6.597  -18.497 72.019  1.00   66.58  ? 425  PHE C CB    1 
ATOM   6948  C  CG    . PHE C 2  425  ? -7.299  -17.169 72.069  1.00   76.75  ? 425  PHE C CG    1 
ATOM   6949  C  CD1   . PHE C 2  425  ? -7.473  -16.508 73.275  1.00   74.20  ? 425  PHE C CD1   1 
ATOM   6950  C  CD2   . PHE C 2  425  ? -7.785  -16.581 70.912  1.00   72.20  ? 425  PHE C CD2   1 
ATOM   6951  C  CE1   . PHE C 2  425  ? -8.120  -15.286 73.326  1.00   61.60  ? 425  PHE C CE1   1 
ATOM   6952  C  CE2   . PHE C 2  425  ? -8.432  -15.360 70.956  1.00   73.38  ? 425  PHE C CE2   1 
ATOM   6953  C  CZ    . PHE C 2  425  ? -8.600  -14.712 72.165  1.00   69.51  ? 425  PHE C CZ    1 
ATOM   6954  N  N     . ASP C 2  426  ? -4.424  -20.563 70.749  1.00   58.55  ? 426  ASP C N     1 
ATOM   6955  C  CA    . ASP C 2  426  ? -3.879  -21.916 70.814  1.00   54.22  ? 426  ASP C CA    1 
ATOM   6956  C  C     . ASP C 2  426  ? -2.393  -21.939 71.158  1.00   52.18  ? 426  ASP C C     1 
ATOM   6957  O  O     . ASP C 2  426  ? -1.957  -22.712 72.012  1.00   57.95  ? 426  ASP C O     1 
ATOM   6958  C  CB    . ASP C 2  426  ? -4.115  -22.650 69.494  1.00   59.62  ? 426  ASP C CB    1 
ATOM   6959  C  CG    . ASP C 2  426  ? -5.580  -22.711 69.116  1.00   66.20  ? 426  ASP C CG    1 
ATOM   6960  O  OD1   . ASP C 2  426  ? -6.434  -22.591 70.020  1.00   63.84  ? 426  ASP C OD1   1 
ATOM   6961  O  OD2   . ASP C 2  426  ? -5.879  -22.883 67.916  1.00   80.78  ? 426  ASP C OD2   1 
ATOM   6962  N  N     . VAL C 2  427  ? -1.621  -21.093 70.487  1.00   49.22  ? 427  VAL C N     1 
ATOM   6963  C  CA    . VAL C 2  427  ? -0.180  -21.043 70.694  1.00   49.14  ? 427  VAL C CA    1 
ATOM   6964  C  C     . VAL C 2  427  ? 0.158   -20.582 72.109  1.00   49.61  ? 427  VAL C C     1 
ATOM   6965  O  O     . VAL C 2  427  ? 1.098   -21.079 72.730  1.00   49.65  ? 427  VAL C O     1 
ATOM   6966  C  CB    . VAL C 2  427  ? 0.491   -20.091 69.687  1.00   51.72  ? 427  VAL C CB    1 
ATOM   6967  C  CG1   . VAL C 2  427  ? 1.999   -20.281 69.700  1.00   56.44  ? 427  VAL C CG1   1 
ATOM   6968  C  CG2   . VAL C 2  427  ? -0.064  -20.321 68.290  1.00   58.02  ? 427  VAL C CG2   1 
ATOM   6969  N  N     . ARG C 2  428  ? -0.627  -19.636 72.616  1.00   47.32  ? 428  ARG C N     1 
ATOM   6970  C  CA    . ARG C 2  428  ? -0.364  -19.028 73.914  1.00   38.72  ? 428  ARG C CA    1 
ATOM   6971  C  C     . ARG C 2  428  ? -0.992  -19.821 75.055  1.00   44.01  ? 428  ARG C C     1 
ATOM   6972  O  O     . ARG C 2  428  ? -0.720  -19.555 76.224  1.00   44.53  ? 428  ARG C O     1 
ATOM   6973  C  CB    . ARG C 2  428  ? -0.893  -17.594 73.937  1.00   35.10  ? 428  ARG C CB    1 
ATOM   6974  C  CG    . ARG C 2  428  ? -0.620  -16.813 72.664  1.00   42.31  ? 428  ARG C CG    1 
ATOM   6975  C  CD    . ARG C 2  428  ? -1.334  -15.470 72.679  1.00   37.55  ? 428  ARG C CD    1 
ATOM   6976  N  NE    . ARG C 2  428  ? -0.433  -14.372 73.009  1.00   31.68  ? 428  ARG C NE    1 
ATOM   6977  C  CZ    . ARG C 2  428  ? 0.075   -13.532 72.115  1.00   29.72  ? 428  ARG C CZ    1 
ATOM   6978  N  NH1   . ARG C 2  428  ? -0.237  -13.658 70.832  1.00   34.76  ? 428  ARG C NH1   1 
ATOM   6979  N  NH2   . ARG C 2  428  ? 0.889   -12.561 72.503  1.00   29.55  ? 428  ARG C NH2   1 
ATOM   6980  N  N     . ASP C 2  429  ? -1.824  -20.798 74.711  1.00   47.62  ? 429  ASP C N     1 
ATOM   6981  C  CA    . ASP C 2  429  ? -2.545  -21.583 75.711  1.00   45.46  ? 429  ASP C CA    1 
ATOM   6982  C  C     . ASP C 2  429  ? -1.607  -22.426 76.565  1.00   40.24  ? 429  ASP C C     1 
ATOM   6983  O  O     . ASP C 2  429  ? -0.469  -22.691 76.182  1.00   47.18  ? 429  ASP C O     1 
ATOM   6984  C  CB    . ASP C 2  429  ? -3.576  -22.496 75.041  1.00   48.66  ? 429  ASP C CB    1 
ATOM   6985  C  CG    . ASP C 2  429  ? -4.983  -21.932 75.098  1.00   61.02  ? 429  ASP C CG    1 
ATOM   6986  O  OD1   . ASP C 2  429  ? -5.286  -21.177 76.047  1.00   61.42  ? 429  ASP C OD1   1 
ATOM   6987  O  OD2   . ASP C 2  429  ? -5.788  -22.249 74.197  1.00   65.06  ? 429  ASP C OD2   1 
ATOM   6988  N  N     . VAL C 2  430  ? -2.092  -22.835 77.732  1.00   32.10  ? 430  VAL C N     1 
ATOM   6989  C  CA    . VAL C 2  430  ? -1.368  -23.787 78.556  1.00   32.98  ? 430  VAL C CA    1 
ATOM   6990  C  C     . VAL C 2  430  ? -1.851  -25.173 78.174  1.00   36.83  ? 430  VAL C C     1 
ATOM   6991  O  O     . VAL C 2  430  ? -3.006  -25.521 78.409  1.00   44.67  ? 430  VAL C O     1 
ATOM   6992  C  CB    . VAL C 2  430  ? -1.636  -23.561 80.055  1.00   35.48  ? 430  VAL C CB    1 
ATOM   6993  C  CG1   . VAL C 2  430  ? -1.009  -24.672 80.885  1.00   32.61  ? 430  VAL C CG1   1 
ATOM   6994  C  CG2   . VAL C 2  430  ? -1.101  -22.210 80.488  1.00   40.91  ? 430  VAL C CG2   1 
ATOM   6995  N  N     . HIS C 2  431  ? -0.968  -25.958 77.567  1.00   35.13  ? 431  HIS C N     1 
ATOM   6996  C  CA    . HIS C 2  431  ? -1.327  -27.293 77.109  1.00   38.72  ? 431  HIS C CA    1 
ATOM   6997  C  C     . HIS C 2  431  ? -1.328  -28.273 78.274  1.00   41.30  ? 431  HIS C C     1 
ATOM   6998  O  O     . HIS C 2  431  ? -0.650  -28.055 79.277  1.00   44.99  ? 431  HIS C O     1 
ATOM   6999  C  CB    . HIS C 2  431  ? -0.363  -27.764 76.021  1.00   39.78  ? 431  HIS C CB    1 
ATOM   7000  C  CG    . HIS C 2  431  ? -0.909  -28.865 75.168  1.00   40.35  ? 431  HIS C CG    1 
ATOM   7001  N  ND1   . HIS C 2  431  ? -0.783  -30.197 75.499  1.00   39.98  ? 431  HIS C ND1   1 
ATOM   7002  C  CD2   . HIS C 2  431  ? -1.585  -28.832 73.995  1.00   42.39  ? 431  HIS C CD2   1 
ATOM   7003  C  CE1   . HIS C 2  431  ? -1.356  -30.936 74.567  1.00   42.76  ? 431  HIS C CE1   1 
ATOM   7004  N  NE2   . HIS C 2  431  ? -1.851  -30.132 73.643  1.00   41.01  ? 431  HIS C NE2   1 
ATOM   7005  N  N     . ARG C 2  432  ? -2.092  -29.352 78.142  1.00   38.34  ? 432  ARG C N     1 
ATOM   7006  C  CA    . ARG C 2  432  ? -2.166  -30.358 79.196  1.00   45.43  ? 432  ARG C CA    1 
ATOM   7007  C  C     . ARG C 2  432  ? -0.815  -31.035 79.425  1.00   46.58  ? 432  ARG C C     1 
ATOM   7008  O  O     . ARG C 2  432  ? -0.579  -31.631 80.477  1.00   48.40  ? 432  ARG C O     1 
ATOM   7009  C  CB    . ARG C 2  432  ? -3.230  -31.405 78.866  1.00   41.71  ? 432  ARG C CB    1 
ATOM   7010  C  CG    . ARG C 2  432  ? -2.956  -32.176 77.591  1.00   40.34  ? 432  ARG C CG    1 
ATOM   7011  C  CD    . ARG C 2  432  ? -3.974  -33.280 77.385  1.00   42.65  ? 432  ARG C CD    1 
ATOM   7012  N  NE    . ARG C 2  432  ? -3.658  -34.095 76.217  1.00   36.68  ? 432  ARG C NE    1 
ATOM   7013  C  CZ    . ARG C 2  432  ? -2.807  -35.116 76.231  1.00   37.01  ? 432  ARG C CZ    1 
ATOM   7014  N  NH1   . ARG C 2  432  ? -2.184  -35.446 77.354  1.00   36.14  ? 432  ARG C NH1   1 
ATOM   7015  N  NH2   . ARG C 2  432  ? -2.578  -35.804 75.121  1.00   41.47  ? 432  ARG C NH2   1 
ATOM   7016  N  N     . THR C 2  433  ? 0.067   -30.935 78.436  1.00   39.10  ? 433  THR C N     1 
ATOM   7017  C  CA    . THR C 2  433  ? 1.392   -31.533 78.530  1.00   38.93  ? 433  THR C CA    1 
ATOM   7018  C  C     . THR C 2  433  ? 2.414   -30.563 79.109  1.00   45.54  ? 433  THR C C     1 
ATOM   7019  O  O     . THR C 2  433  ? 3.580   -30.916 79.285  1.00   49.37  ? 433  THR C O     1 
ATOM   7020  C  CB    . THR C 2  433  ? 1.887   -32.023 77.163  1.00   37.71  ? 433  THR C CB    1 
ATOM   7021  O  OG1   . THR C 2  433  ? 1.952   -30.920 76.252  1.00   38.69  ? 433  THR C OG1   1 
ATOM   7022  C  CG2   . THR C 2  433  ? 0.945   -33.071 76.612  1.00   43.08  ? 433  THR C CG2   1 
ATOM   7023  N  N     . HIS C 2  434  ? 1.977   -29.342 79.406  1.00   42.04  ? 434  HIS C N     1 
ATOM   7024  C  CA    . HIS C 2  434  ? 2.854   -28.354 80.027  1.00   37.86  ? 434  HIS C CA    1 
ATOM   7025  C  C     . HIS C 2  434  ? 3.150   -28.730 81.472  1.00   40.24  ? 434  HIS C C     1 
ATOM   7026  O  O     . HIS C 2  434  ? 3.998   -28.118 82.120  1.00   47.37  ? 434  HIS C O     1 
ATOM   7027  C  CB    . HIS C 2  434  ? 2.241   -26.954 79.969  1.00   36.41  ? 434  HIS C CB    1 
ATOM   7028  C  CG    . HIS C 2  434  ? 2.371   -26.289 78.635  1.00   37.54  ? 434  HIS C CG    1 
ATOM   7029  N  ND1   . HIS C 2  434  ? 2.717   -26.976 77.491  1.00   39.29  ? 434  HIS C ND1   1 
ATOM   7030  C  CD2   . HIS C 2  434  ? 2.208   -24.998 78.263  1.00   38.70  ? 434  HIS C CD2   1 
ATOM   7031  C  CE1   . HIS C 2  434  ? 2.757   -26.137 76.471  1.00   40.23  ? 434  HIS C CE1   1 
ATOM   7032  N  NE2   . HIS C 2  434  ? 2.452   -24.929 76.913  1.00   45.07  ? 434  HIS C NE2   1 
ATOM   7033  N  N     . TYR C 2  435  ? 2.439   -29.738 81.969  1.00   39.79  ? 435  TYR C N     1 
ATOM   7034  C  CA    . TYR C 2  435  ? 2.628   -30.224 83.328  1.00   40.74  ? 435  TYR C CA    1 
ATOM   7035  C  C     . TYR C 2  435  ? 4.065   -30.688 83.546  1.00   37.59  ? 435  TYR C C     1 
ATOM   7036  O  O     . TYR C 2  435  ? 4.580   -31.521 82.800  1.00   35.25  ? 435  TYR C O     1 
ATOM   7037  C  CB    . TYR C 2  435  ? 1.658   -31.375 83.608  1.00   38.65  ? 435  TYR C CB    1 
ATOM   7038  C  CG    . TYR C 2  435  ? 1.580   -31.776 85.062  1.00   37.95  ? 435  TYR C CG    1 
ATOM   7039  C  CD1   . TYR C 2  435  ? 0.689   -31.153 85.924  1.00   40.80  ? 435  TYR C CD1   1 
ATOM   7040  C  CD2   . TYR C 2  435  ? 2.393   -32.778 85.572  1.00   40.05  ? 435  TYR C CD2   1 
ATOM   7041  C  CE1   . TYR C 2  435  ? 0.610   -31.515 87.254  1.00   41.84  ? 435  TYR C CE1   1 
ATOM   7042  C  CE2   . TYR C 2  435  ? 2.322   -33.147 86.902  1.00   43.72  ? 435  TYR C CE2   1 
ATOM   7043  C  CZ    . TYR C 2  435  ? 1.428   -32.512 87.738  1.00   46.80  ? 435  TYR C CZ    1 
ATOM   7044  O  OH    . TYR C 2  435  ? 1.351   -32.873 89.064  1.00   53.57  ? 435  TYR C OH    1 
ATOM   7045  N  N     . GLY C 2  436  ? 4.709   -30.136 84.568  1.00   35.57  ? 436  GLY C N     1 
ATOM   7046  C  CA    . GLY C 2  436  ? 6.057   -30.535 84.933  1.00   41.85  ? 436  GLY C CA    1 
ATOM   7047  C  C     . GLY C 2  436  ? 7.146   -30.131 83.955  1.00   42.65  ? 436  GLY C C     1 
ATOM   7048  O  O     . GLY C 2  436  ? 8.320   -30.434 84.170  1.00   44.73  ? 436  GLY C O     1 
ATOM   7049  N  N     . ARG C 2  437  ? 6.766   -29.436 82.888  1.00   39.80  ? 437  ARG C N     1 
ATOM   7050  C  CA    . ARG C 2  437  ? 7.708   -29.073 81.833  1.00   38.58  ? 437  ARG C CA    1 
ATOM   7051  C  C     . ARG C 2  437  ? 7.837   -27.562 81.660  1.00   37.54  ? 437  ARG C C     1 
ATOM   7052  O  O     . ARG C 2  437  ? 8.913   -26.994 81.847  1.00   32.20  ? 437  ARG C O     1 
ATOM   7053  C  CB    . ARG C 2  437  ? 7.303   -29.734 80.515  1.00   39.99  ? 437  ARG C CB    1 
ATOM   7054  C  CG    . ARG C 2  437  ? 7.349   -31.249 80.573  1.00   40.20  ? 437  ARG C CG    1 
ATOM   7055  C  CD    . ARG C 2  437  ? 6.854   -31.891 79.293  1.00   37.32  ? 437  ARG C CD    1 
ATOM   7056  N  NE    . ARG C 2  437  ? 6.889   -33.347 79.393  1.00   44.17  ? 437  ARG C NE    1 
ATOM   7057  C  CZ    . ARG C 2  437  ? 5.910   -34.082 79.910  1.00   45.88  ? 437  ARG C CZ    1 
ATOM   7058  N  NH1   . ARG C 2  437  ? 4.813   -33.498 80.372  1.00   47.85  ? 437  ARG C NH1   1 
ATOM   7059  N  NH2   . ARG C 2  437  ? 6.027   -35.402 79.968  1.00   45.11  ? 437  ARG C NH2   1 
ATOM   7060  N  N     . ILE C 2  438  ? 6.738   -26.923 81.279  1.00   42.69  ? 438  ILE C N     1 
ATOM   7061  C  CA    . ILE C 2  438  ? 6.705   -25.478 81.105  1.00   39.68  ? 438  ILE C CA    1 
ATOM   7062  C  C     . ILE C 2  438  ? 5.785   -24.845 82.141  1.00   37.46  ? 438  ILE C C     1 
ATOM   7063  O  O     . ILE C 2  438  ? 4.638   -25.261 82.296  1.00   40.73  ? 438  ILE C O     1 
ATOM   7064  C  CB    . ILE C 2  438  ? 6.234   -25.099 79.689  1.00   38.41  ? 438  ILE C CB    1 
ATOM   7065  C  CG1   . ILE C 2  438  ? 7.283   -25.517 78.657  1.00   34.77  ? 438  ILE C CG1   1 
ATOM   7066  C  CG2   . ILE C 2  438  ? 5.956   -23.610 79.598  1.00   35.17  ? 438  ILE C CG2   1 
ATOM   7067  C  CD1   . ILE C 2  438  ? 6.868   -25.273 77.226  1.00   36.99  ? 438  ILE C CD1   1 
ATOM   7068  N  N     . CYS C 2  439  ? 6.294   -23.842 82.849  1.00   39.44  ? 439  CYS C N     1 
ATOM   7069  C  CA    . CYS C 2  439  ? 5.539   -23.191 83.914  1.00   36.80  ? 439  CYS C CA    1 
ATOM   7070  C  C     . CYS C 2  439  ? 4.276   -22.501 83.408  1.00   36.10  ? 439  CYS C C     1 
ATOM   7071  O  O     . CYS C 2  439  ? 4.341   -21.640 82.530  1.00   40.35  ? 439  CYS C O     1 
ATOM   7072  C  CB    . CYS C 2  439  ? 6.415   -22.178 84.648  1.00   37.51  ? 439  CYS C CB    1 
ATOM   7073  S  SG    . CYS C 2  439  ? 5.590   -21.359 86.028  1.00   31.56  ? 439  CYS C SG    1 
ATOM   7074  N  N     . PRO C 2  440  ? 3.117   -22.892 83.958  1.00   36.52  ? 440  PRO C N     1 
ATOM   7075  C  CA    . PRO C 2  440  ? 1.821   -22.283 83.639  1.00   38.46  ? 440  PRO C CA    1 
ATOM   7076  C  C     . PRO C 2  440  ? 1.686   -20.879 84.223  1.00   33.25  ? 440  PRO C C     1 
ATOM   7077  O  O     . PRO C 2  440  ? 0.936   -20.056 83.696  1.00   30.50  ? 440  PRO C O     1 
ATOM   7078  C  CB    . PRO C 2  440  ? 0.821   -23.231 84.305  1.00   34.85  ? 440  PRO C CB    1 
ATOM   7079  C  CG    . PRO C 2  440  ? 1.574   -23.826 85.441  1.00   34.75  ? 440  PRO C CG    1 
ATOM   7080  C  CD    . PRO C 2  440  ? 2.990   -23.967 84.959  1.00   36.90  ? 440  PRO C CD    1 
ATOM   7081  N  N     . VAL C 2  441  ? 2.397   -20.623 85.316  1.00   31.98  ? 441  VAL C N     1 
ATOM   7082  C  CA    . VAL C 2  441  ? 2.305   -19.344 86.014  1.00   32.65  ? 441  VAL C CA    1 
ATOM   7083  C  C     . VAL C 2  441  ? 3.103   -18.212 85.369  1.00   32.12  ? 441  VAL C C     1 
ATOM   7084  O  O     . VAL C 2  441  ? 2.582   -17.113 85.179  1.00   34.83  ? 441  VAL C O     1 
ATOM   7085  C  CB    . VAL C 2  441  ? 2.723   -19.478 87.492  1.00   33.24  ? 441  VAL C CB    1 
ATOM   7086  C  CG1   . VAL C 2  441  ? 2.762   -18.112 88.164  1.00   32.58  ? 441  VAL C CG1   1 
ATOM   7087  C  CG2   . VAL C 2  441  ? 1.769   -20.402 88.225  1.00   34.87  ? 441  VAL C CG2   1 
ATOM   7088  N  N     . GLU C 2  442  ? 4.358   -18.475 85.015  1.00   32.37  ? 442  GLU C N     1 
ATOM   7089  C  CA    . GLU C 2  442  ? 5.236   -17.381 84.615  1.00   33.65  ? 442  GLU C CA    1 
ATOM   7090  C  C     . GLU C 2  442  ? 5.260   -17.128 83.110  1.00   42.14  ? 442  GLU C C     1 
ATOM   7091  O  O     . GLU C 2  442  ? 5.834   -17.895 82.334  1.00   40.34  ? 442  GLU C O     1 
ATOM   7092  C  CB    . GLU C 2  442  ? 6.658   -17.630 85.117  1.00   30.37  ? 442  GLU C CB    1 
ATOM   7093  C  CG    . GLU C 2  442  ? 7.630   -16.526 84.757  1.00   32.11  ? 442  GLU C CG    1 
ATOM   7094  C  CD    . GLU C 2  442  ? 9.056   -16.869 85.120  1.00   39.96  ? 442  GLU C CD    1 
ATOM   7095  O  OE1   . GLU C 2  442  ? 9.278   -17.439 86.210  1.00   33.44  ? 442  GLU C OE1   1 
ATOM   7096  O  OE2   . GLU C 2  442  ? 9.956   -16.576 84.308  1.00   50.27  ? 442  GLU C OE2   1 
ATOM   7097  N  N     . THR C 2  443  ? 4.628   -16.025 82.724  1.00   37.20  ? 443  THR C N     1 
ATOM   7098  C  CA    . THR C 2  443  ? 4.677   -15.498 81.369  1.00   34.33  ? 443  THR C CA    1 
ATOM   7099  C  C     . THR C 2  443  ? 4.519   -13.984 81.482  1.00   32.38  ? 443  THR C C     1 
ATOM   7100  O  O     . THR C 2  443  ? 3.941   -13.499 82.452  1.00   35.15  ? 443  THR C O     1 
ATOM   7101  C  CB    . THR C 2  443  ? 3.574   -16.115 80.478  1.00   35.09  ? 443  THR C CB    1 
ATOM   7102  O  OG1   . THR C 2  443  ? 3.658   -15.581 79.150  1.00   40.02  ? 443  THR C OG1   1 
ATOM   7103  C  CG2   . THR C 2  443  ? 2.198   -15.831 81.048  1.00   31.79  ? 443  THR C CG2   1 
ATOM   7104  N  N     . PRO C 2  444  ? 5.059   -13.226 80.518  1.00   33.71  ? 444  PRO C N     1 
ATOM   7105  C  CA    . PRO C 2  444  ? 4.847   -11.774 80.537  1.00   32.68  ? 444  PRO C CA    1 
ATOM   7106  C  C     . PRO C 2  444  ? 3.381   -11.385 80.339  1.00   30.25  ? 444  PRO C C     1 
ATOM   7107  O  O     . PRO C 2  444  ? 2.642   -12.097 79.661  1.00   31.23  ? 444  PRO C O     1 
ATOM   7108  C  CB    . PRO C 2  444  ? 5.667   -11.289 79.338  1.00   33.40  ? 444  PRO C CB    1 
ATOM   7109  C  CG    . PRO C 2  444  ? 6.702   -12.331 79.139  1.00   39.17  ? 444  PRO C CG    1 
ATOM   7110  C  CD    . PRO C 2  444  ? 6.044   -13.626 79.499  1.00   39.49  ? 444  PRO C CD    1 
ATOM   7111  N  N     . GLU C 2  445  ? 2.966   -10.274 80.941  1.00   27.09  ? 445  GLU C N     1 
ATOM   7112  C  CA    . GLU C 2  445  ? 1.676   -9.675  80.628  1.00   28.45  ? 445  GLU C CA    1 
ATOM   7113  C  C     . GLU C 2  445  ? 1.777   -8.970  79.283  1.00   39.14  ? 445  GLU C C     1 
ATOM   7114  O  O     . GLU C 2  445  ? 2.872   -8.631  78.834  1.00   42.26  ? 445  GLU C O     1 
ATOM   7115  C  CB    . GLU C 2  445  ? 1.274   -8.649  81.685  1.00   29.78  ? 445  GLU C CB    1 
ATOM   7116  C  CG    . GLU C 2  445  ? 1.275   -9.152  83.107  1.00   30.30  ? 445  GLU C CG    1 
ATOM   7117  C  CD    . GLU C 2  445  ? 0.792   -8.096  84.080  1.00   31.07  ? 445  GLU C CD    1 
ATOM   7118  O  OE1   . GLU C 2  445  ? 0.067   -7.177  83.644  1.00   31.81  ? 445  GLU C OE1   1 
ATOM   7119  O  OE2   . GLU C 2  445  ? 1.138   -8.180  85.275  1.00   32.55  ? 445  GLU C OE2   1 
ATOM   7120  N  N     . GLY C 2  446  ? 0.638   -8.736  78.644  1.00   42.34  ? 446  GLY C N     1 
ATOM   7121  C  CA    . GLY C 2  446  ? 0.624   -7.975  77.409  1.00   45.09  ? 446  GLY C CA    1 
ATOM   7122  C  C     . GLY C 2  446  ? 0.932   -8.784  76.164  1.00   41.17  ? 446  GLY C C     1 
ATOM   7123  O  O     . GLY C 2  446  ? 0.573   -9.955  76.069  1.00   43.66  ? 446  GLY C O     1 
ATOM   7124  N  N     . ALA C 2  447  ? 1.610   -8.152  75.211  1.00   33.54  ? 447  ALA C N     1 
ATOM   7125  C  CA    . ALA C 2  447  ? 1.767   -8.708  73.868  1.00   36.50  ? 447  ALA C CA    1 
ATOM   7126  C  C     . ALA C 2  447  ? 2.527   -10.032 73.797  1.00   33.72  ? 447  ALA C C     1 
ATOM   7127  O  O     . ALA C 2  447  ? 2.355   -10.798 72.850  1.00   32.91  ? 447  ALA C O     1 
ATOM   7128  C  CB    . ALA C 2  447  ? 2.409   -7.678  72.946  1.00   45.64  ? 447  ALA C CB    1 
ATOM   7129  N  N     . ASN C 2  448  ? 3.365   -10.301 74.792  1.00   34.96  ? 448  ASN C N     1 
ATOM   7130  C  CA    . ASN C 2  448  ? 4.206   -11.496 74.767  1.00   36.85  ? 448  ASN C CA    1 
ATOM   7131  C  C     . ASN C 2  448  ? 3.638   -12.711 75.499  1.00   42.15  ? 448  ASN C C     1 
ATOM   7132  O  O     . ASN C 2  448  ? 4.300   -13.747 75.584  1.00   40.36  ? 448  ASN C O     1 
ATOM   7133  C  CB    . ASN C 2  448  ? 5.604   -11.179 75.301  1.00   33.66  ? 448  ASN C CB    1 
ATOM   7134  C  CG    . ASN C 2  448  ? 6.536   -10.673 74.222  1.00   38.41  ? 448  ASN C CG    1 
ATOM   7135  O  OD1   . ASN C 2  448  ? 6.451   -11.092 73.067  1.00   34.00  ? 448  ASN C OD1   1 
ATOM   7136  N  ND2   . ASN C 2  448  ? 7.433   -9.766  74.592  1.00   48.13  ? 448  ASN C ND2   1 
ATOM   7137  N  N     . ILE C 2  449  ? 2.422   -12.587 76.024  1.00   45.26  ? 449  ILE C N     1 
ATOM   7138  C  CA    . ILE C 2  449  ? 1.853   -13.641 76.861  1.00   38.24  ? 449  ILE C CA    1 
ATOM   7139  C  C     . ILE C 2  449  ? 1.741   -14.983 76.136  1.00   35.91  ? 449  ILE C C     1 
ATOM   7140  O  O     . ILE C 2  449  ? 1.172   -15.078 75.047  1.00   36.13  ? 449  ILE C O     1 
ATOM   7141  C  CB    . ILE C 2  449  ? 0.488   -13.231 77.471  1.00   31.87  ? 449  ILE C CB    1 
ATOM   7142  C  CG1   . ILE C 2  449  ? -0.045  -14.340 78.379  1.00   33.53  ? 449  ILE C CG1   1 
ATOM   7143  C  CG2   . ILE C 2  449  ? -0.521  -12.886 76.386  1.00   35.30  ? 449  ILE C CG2   1 
ATOM   7144  C  CD1   . ILE C 2  449  ? -1.398  -14.033 78.982  1.00   42.65  ? 449  ILE C CD1   1 
ATOM   7145  N  N     . GLY C 2  450  ? 2.330   -16.010 76.738  1.00   35.10  ? 450  GLY C N     1 
ATOM   7146  C  CA    . GLY C 2  450  ? 2.233   -17.365 76.231  1.00   39.10  ? 450  GLY C CA    1 
ATOM   7147  C  C     . GLY C 2  450  ? 3.297   -17.697 75.204  1.00   35.44  ? 450  GLY C C     1 
ATOM   7148  O  O     . GLY C 2  450  ? 3.634   -18.864 75.007  1.00   40.40  ? 450  GLY C O     1 
ATOM   7149  N  N     . LEU C 2  451  ? 3.823   -16.672 74.543  1.00   31.64  ? 451  LEU C N     1 
ATOM   7150  C  CA    . LEU C 2  451  ? 4.904   -16.864 73.585  1.00   31.05  ? 451  LEU C CA    1 
ATOM   7151  C  C     . LEU C 2  451  ? 6.256   -16.901 74.289  1.00   35.13  ? 451  LEU C C     1 
ATOM   7152  O  O     . LEU C 2  451  ? 7.221   -17.466 73.776  1.00   32.09  ? 451  LEU C O     1 
ATOM   7153  C  CB    . LEU C 2  451  ? 4.879   -15.764 72.527  1.00   28.90  ? 451  LEU C CB    1 
ATOM   7154  C  CG    . LEU C 2  451  ? 3.561   -15.669 71.761  1.00   29.29  ? 451  LEU C CG    1 
ATOM   7155  C  CD1   . LEU C 2  451  ? 3.625   -14.576 70.710  1.00   42.32  ? 451  LEU C CD1   1 
ATOM   7156  C  CD2   . LEU C 2  451  ? 3.221   -17.007 71.130  1.00   33.67  ? 451  LEU C CD2   1 
ATOM   7157  N  N     . ILE C 2  452  ? 6.309   -16.306 75.476  1.00   35.89  ? 452  ILE C N     1 
ATOM   7158  C  CA    . ILE C 2  452  ? 7.514   -16.319 76.293  1.00   30.20  ? 452  ILE C CA    1 
ATOM   7159  C  C     . ILE C 2  452  ? 7.205   -17.036 77.596  1.00   36.07  ? 452  ILE C C     1 
ATOM   7160  O  O     . ILE C 2  452  ? 6.342   -16.608 78.361  1.00   36.59  ? 452  ILE C O     1 
ATOM   7161  C  CB    . ILE C 2  452  ? 8.014   -14.898 76.611  1.00   25.50  ? 452  ILE C CB    1 
ATOM   7162  C  CG1   . ILE C 2  452  ? 8.202   -14.090 75.326  1.00   23.31  ? 452  ILE C CG1   1 
ATOM   7163  C  CG2   . ILE C 2  452  ? 9.311   -14.957 77.403  1.00   24.75  ? 452  ILE C CG2   1 
ATOM   7164  C  CD1   . ILE C 2  452  ? 9.276   -14.626 74.420  1.00   20.66  ? 452  ILE C CD1   1 
ATOM   7165  N  N     . THR C 2  453  ? 7.906   -18.137 77.839  1.00   38.84  ? 453  THR C N     1 
ATOM   7166  C  CA    . THR C 2  453  ? 7.643   -18.961 79.009  1.00   37.73  ? 453  THR C CA    1 
ATOM   7167  C  C     . THR C 2  453  ? 8.921   -19.245 79.786  1.00   33.82  ? 453  THR C C     1 
ATOM   7168  O  O     . THR C 2  453  ? 10.004  -18.797 79.407  1.00   28.55  ? 453  THR C O     1 
ATOM   7169  C  CB    . THR C 2  453  ? 6.988   -20.295 78.609  1.00   38.84  ? 453  THR C CB    1 
ATOM   7170  O  OG1   . THR C 2  453  ? 7.758   -20.913 77.571  1.00   32.40  ? 453  THR C OG1   1 
ATOM   7171  C  CG2   . THR C 2  453  ? 5.573   -20.063 78.102  1.00   42.56  ? 453  THR C CG2   1 
ATOM   7172  N  N     . SER C 2  454  ? 8.787   -19.988 80.878  1.00   37.26  ? 454  SER C N     1 
ATOM   7173  C  CA    . SER C 2  454  ? 9.939   -20.355 81.688  1.00   40.29  ? 454  SER C CA    1 
ATOM   7174  C  C     . SER C 2  454  ? 9.958   -21.858 81.931  1.00   37.79  ? 454  SER C C     1 
ATOM   7175  O  O     . SER C 2  454  ? 8.909   -22.483 82.090  1.00   35.37  ? 454  SER C O     1 
ATOM   7176  C  CB    . SER C 2  454  ? 9.929   -19.600 83.018  1.00   41.14  ? 454  SER C CB    1 
ATOM   7177  O  OG    . SER C 2  454  ? 11.164  -19.747 83.698  1.00   38.79  ? 454  SER C OG    1 
ATOM   7178  N  N     . LEU C 2  455  ? 11.158  -22.428 81.951  1.00   36.49  ? 455  LEU C N     1 
ATOM   7179  C  CA    . LEU C 2  455  ? 11.328  -23.861 82.150  1.00   35.18  ? 455  LEU C CA    1 
ATOM   7180  C  C     . LEU C 2  455  ? 10.996  -24.260 83.584  1.00   37.31  ? 455  LEU C C     1 
ATOM   7181  O  O     . LEU C 2  455  ? 11.388  -23.576 84.530  1.00   33.61  ? 455  LEU C O     1 
ATOM   7182  C  CB    . LEU C 2  455  ? 12.762  -24.271 81.814  1.00   27.35  ? 455  LEU C CB    1 
ATOM   7183  C  CG    . LEU C 2  455  ? 13.042  -25.774 81.779  1.00   33.19  ? 455  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C 2  455  ? 12.227  -26.442 80.682  1.00   35.40  ? 455  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C 2  455  ? 14.524  -26.037 81.581  1.00   37.92  ? 455  LEU C CD2   1 
ATOM   7186  N  N     . ALA C 2  456  ? 10.269  -25.365 83.739  1.00   37.53  ? 456  ALA C N     1 
ATOM   7187  C  CA    . ALA C 2  456  ? 9.941   -25.890 85.062  1.00   32.41  ? 456  ALA C CA    1 
ATOM   7188  C  C     . ALA C 2  456  ? 11.204  -26.337 85.788  1.00   40.16  ? 456  ALA C C     1 
ATOM   7189  O  O     . ALA C 2  456  ? 12.195  -26.703 85.155  1.00   46.91  ? 456  ALA C O     1 
ATOM   7190  C  CB    . ALA C 2  456  ? 8.954   -27.036 84.956  1.00   31.53  ? 456  ALA C CB    1 
ATOM   7191  N  N     . ALA C 2  457  ? 11.160  -26.303 87.116  1.00   38.51  ? 457  ALA C N     1 
ATOM   7192  C  CA    . ALA C 2  457  ? 12.335  -26.568 87.941  1.00   37.59  ? 457  ALA C CA    1 
ATOM   7193  C  C     . ALA C 2  457  ? 12.944  -27.948 87.702  1.00   42.26  ? 457  ALA C C     1 
ATOM   7194  O  O     . ALA C 2  457  ? 14.153  -28.072 87.502  1.00   43.98  ? 457  ALA C O     1 
ATOM   7195  C  CB    . ALA C 2  457  ? 11.997  -26.381 89.413  1.00   35.12  ? 457  ALA C CB    1 
ATOM   7196  N  N     . TYR C 2  458  ? 12.105  -28.980 87.720  1.00   41.96  ? 458  TYR C N     1 
ATOM   7197  C  CA    . TYR C 2  458  ? 12.575  -30.349 87.528  1.00   46.20  ? 458  TYR C CA    1 
ATOM   7198  C  C     . TYR C 2  458  ? 12.646  -30.743 86.057  1.00   50.17  ? 458  TYR C C     1 
ATOM   7199  O  O     . TYR C 2  458  ? 13.142  -31.819 85.718  1.00   46.25  ? 458  TYR C O     1 
ATOM   7200  C  CB    . TYR C 2  458  ? 11.682  -31.338 88.278  1.00   45.29  ? 458  TYR C CB    1 
ATOM   7201  C  CG    . TYR C 2  458  ? 12.072  -31.559 89.720  1.00   44.83  ? 458  TYR C CG    1 
ATOM   7202  C  CD1   . TYR C 2  458  ? 11.305  -31.042 90.756  1.00   43.35  ? 458  TYR C CD1   1 
ATOM   7203  C  CD2   . TYR C 2  458  ? 13.208  -32.287 90.046  1.00   46.84  ? 458  TYR C CD2   1 
ATOM   7204  C  CE1   . TYR C 2  458  ? 11.658  -31.246 92.077  1.00   47.36  ? 458  TYR C CE1   1 
ATOM   7205  C  CE2   . TYR C 2  458  ? 13.569  -32.495 91.364  1.00   52.32  ? 458  TYR C CE2   1 
ATOM   7206  C  CZ    . TYR C 2  458  ? 12.792  -31.972 92.375  1.00   49.42  ? 458  TYR C CZ    1 
ATOM   7207  O  OH    . TYR C 2  458  ? 13.150  -32.177 93.687  1.00   51.35  ? 458  TYR C OH    1 
ATOM   7208  N  N     . ALA C 2  459  ? 12.147  -29.871 85.187  1.00   54.05  ? 459  ALA C N     1 
ATOM   7209  C  CA    . ALA C 2  459  ? 12.117  -30.151 83.756  1.00   43.96  ? 459  ALA C CA    1 
ATOM   7210  C  C     . ALA C 2  459  ? 13.519  -30.266 83.166  1.00   40.61  ? 459  ALA C C     1 
ATOM   7211  O  O     . ALA C 2  459  ? 14.453  -29.596 83.610  1.00   42.36  ? 459  ALA C O     1 
ATOM   7212  C  CB    . ALA C 2  459  ? 11.314  -29.087 83.021  1.00   41.03  ? 459  ALA C CB    1 
ATOM   7213  N  N     . ARG C 2  460  ? 13.654  -31.125 82.163  1.00   38.24  ? 460  ARG C N     1 
ATOM   7214  C  CA    . ARG C 2  460  ? 14.921  -31.318 81.476  1.00   32.96  ? 460  ARG C CA    1 
ATOM   7215  C  C     . ARG C 2  460  ? 14.710  -31.447 79.974  1.00   34.04  ? 460  ARG C C     1 
ATOM   7216  O  O     . ARG C 2  460  ? 13.787  -32.125 79.526  1.00   34.55  ? 460  ARG C O     1 
ATOM   7217  C  CB    . ARG C 2  460  ? 15.628  -32.568 81.996  1.00   36.35  ? 460  ARG C CB    1 
ATOM   7218  C  CG    . ARG C 2  460  ? 16.444  -32.360 83.255  1.00   44.45  ? 460  ARG C CG    1 
ATOM   7219  C  CD    . ARG C 2  460  ? 17.311  -33.578 83.527  1.00   51.69  ? 460  ARG C CD    1 
ATOM   7220  N  NE    . ARG C 2  460  ? 18.330  -33.319 84.539  1.00   67.14  ? 460  ARG C NE    1 
ATOM   7221  C  CZ    . ARG C 2  460  ? 19.288  -34.180 84.867  1.00   72.20  ? 460  ARG C CZ    1 
ATOM   7222  N  NH1   . ARG C 2  460  ? 19.359  -35.357 84.259  1.00   65.16  ? 460  ARG C NH1   1 
ATOM   7223  N  NH2   . ARG C 2  460  ? 20.176  -33.864 85.800  1.00   77.66  ? 460  ARG C NH2   1 
ATOM   7224  N  N     . VAL C 2  461  ? 15.570  -30.794 79.200  1.00   29.76  ? 461  VAL C N     1 
ATOM   7225  C  CA    . VAL C 2  461  ? 15.551  -30.944 77.753  1.00   28.86  ? 461  VAL C CA    1 
ATOM   7226  C  C     . VAL C 2  461  ? 16.482  -32.084 77.357  1.00   34.33  ? 461  VAL C C     1 
ATOM   7227  O  O     . VAL C 2  461  ? 17.662  -32.075 77.704  1.00   34.72  ? 461  VAL C O     1 
ATOM   7228  C  CB    . VAL C 2  461  ? 16.008  -29.659 77.048  1.00   29.21  ? 461  VAL C CB    1 
ATOM   7229  C  CG1   . VAL C 2  461  ? 15.796  -29.776 75.546  1.00   32.38  ? 461  VAL C CG1   1 
ATOM   7230  C  CG2   . VAL C 2  461  ? 15.260  -28.460 77.601  1.00   38.15  ? 461  VAL C CG2   1 
ATOM   7231  N  N     . ASP C 2  462  ? 15.951  -33.070 76.640  1.00   38.33  ? 462  ASP C N     1 
ATOM   7232  C  CA    . ASP C 2  462  ? 16.759  -34.210 76.215  1.00   41.83  ? 462  ASP C CA    1 
ATOM   7233  C  C     . ASP C 2  462  ? 17.632  -33.891 75.002  1.00   46.82  ? 462  ASP C C     1 
ATOM   7234  O  O     . ASP C 2  462  ? 17.704  -32.746 74.556  1.00   46.33  ? 462  ASP C O     1 
ATOM   7235  C  CB    . ASP C 2  462  ? 15.892  -35.448 75.951  1.00   43.19  ? 462  ASP C CB    1 
ATOM   7236  C  CG    . ASP C 2  462  ? 14.771  -35.191 74.954  1.00   48.00  ? 462  ASP C CG    1 
ATOM   7237  O  OD1   . ASP C 2  462  ? 14.896  -34.272 74.116  1.00   50.39  ? 462  ASP C OD1   1 
ATOM   7238  O  OD2   . ASP C 2  462  ? 13.759  -35.922 75.005  1.00   46.40  ? 462  ASP C OD2   1 
ATOM   7239  N  N     . GLU C 2  463  ? 18.288  -34.917 74.472  1.00   46.81  ? 463  GLU C N     1 
ATOM   7240  C  CA    . GLU C 2  463  ? 19.194  -34.749 73.344  1.00   46.75  ? 463  GLU C CA    1 
ATOM   7241  C  C     . GLU C 2  463  ? 18.437  -34.424 72.061  1.00   41.40  ? 463  GLU C C     1 
ATOM   7242  O  O     . GLU C 2  463  ? 18.979  -33.798 71.150  1.00   40.89  ? 463  GLU C O     1 
ATOM   7243  C  CB    . GLU C 2  463  ? 20.041  -36.008 73.159  1.00   54.84  ? 463  GLU C CB    1 
ATOM   7244  C  CG    . GLU C 2  463  ? 20.763  -36.446 74.425  1.00   57.42  ? 463  GLU C CG    1 
ATOM   7245  C  CD    . GLU C 2  463  ? 21.629  -37.671 74.212  1.00   57.73  ? 463  GLU C CD    1 
ATOM   7246  O  OE1   . GLU C 2  463  ? 22.214  -38.164 75.199  1.00   56.44  ? 463  GLU C OE1   1 
ATOM   7247  O  OE2   . GLU C 2  463  ? 21.725  -38.140 73.058  1.00   58.17  ? 463  GLU C OE2   1 
ATOM   7248  N  N     . LEU C 2  464  ? 17.181  -34.850 71.995  1.00   43.84  ? 464  LEU C N     1 
ATOM   7249  C  CA    . LEU C 2  464  ? 16.354  -34.598 70.819  1.00   53.50  ? 464  LEU C CA    1 
ATOM   7250  C  C     . LEU C 2  464  ? 15.718  -33.208 70.850  1.00   48.43  ? 464  LEU C C     1 
ATOM   7251  O  O     . LEU C 2  464  ? 15.245  -32.710 69.829  1.00   45.50  ? 464  LEU C O     1 
ATOM   7252  C  CB    . LEU C 2  464  ? 15.284  -35.684 70.668  1.00   56.35  ? 464  LEU C CB    1 
ATOM   7253  C  CG    . LEU C 2  464  ? 15.626  -36.868 69.755  1.00   49.34  ? 464  LEU C CG    1 
ATOM   7254  C  CD1   . LEU C 2  464  ? 16.972  -37.484 70.107  1.00   45.84  ? 464  LEU C CD1   1 
ATOM   7255  C  CD2   . LEU C 2  464  ? 14.525  -37.917 69.802  1.00   58.81  ? 464  LEU C CD2   1 
ATOM   7256  N  N     . GLY C 2  465  ? 15.714  -32.585 72.024  1.00   45.15  ? 465  GLY C N     1 
ATOM   7257  C  CA    . GLY C 2  465  ? 15.195  -31.236 72.163  1.00   40.57  ? 465  GLY C CA    1 
ATOM   7258  C  C     . GLY C 2  465  ? 13.836  -31.153 72.829  1.00   34.67  ? 465  GLY C C     1 
ATOM   7259  O  O     . GLY C 2  465  ? 13.279  -30.065 72.969  1.00   32.98  ? 465  GLY C O     1 
ATOM   7260  N  N     . PHE C 2  466  ? 13.301  -32.300 73.237  1.00   39.16  ? 466  PHE C N     1 
ATOM   7261  C  CA    . PHE C 2  466  ? 12.015  -32.351 73.928  1.00   38.36  ? 466  PHE C CA    1 
ATOM   7262  C  C     . PHE C 2  466  ? 12.192  -32.164 75.432  1.00   40.25  ? 466  PHE C C     1 
ATOM   7263  O  O     . PHE C 2  466  ? 13.186  -32.608 76.004  1.00   45.12  ? 466  PHE C O     1 
ATOM   7264  C  CB    . PHE C 2  466  ? 11.302  -33.676 73.652  1.00   33.93  ? 466  PHE C CB    1 
ATOM   7265  C  CG    . PHE C 2  466  ? 11.042  -33.931 72.198  1.00   39.28  ? 466  PHE C CG    1 
ATOM   7266  C  CD1   . PHE C 2  466  ? 11.784  -34.871 71.503  1.00   53.56  ? 466  PHE C CD1   1 
ATOM   7267  C  CD2   . PHE C 2  466  ? 10.059  -33.226 71.522  1.00   41.17  ? 466  PHE C CD2   1 
ATOM   7268  C  CE1   . PHE C 2  466  ? 11.547  -35.107 70.161  1.00   60.01  ? 466  PHE C CE1   1 
ATOM   7269  C  CE2   . PHE C 2  466  ? 9.818   -33.456 70.180  1.00   45.71  ? 466  PHE C CE2   1 
ATOM   7270  C  CZ    . PHE C 2  466  ? 10.563  -34.399 69.499  1.00   55.67  ? 466  PHE C CZ    1 
ATOM   7271  N  N     . ILE C 2  467  ? 11.233  -31.496 76.067  1.00   36.73  ? 467  ILE C N     1 
ATOM   7272  C  CA    . ILE C 2  467  ? 11.281  -31.292 77.512  1.00   41.30  ? 467  ILE C CA    1 
ATOM   7273  C  C     . ILE C 2  467  ? 10.746  -32.509 78.267  1.00   41.12  ? 467  ILE C C     1 
ATOM   7274  O  O     . ILE C 2  467  ? 9.635   -32.975 78.007  1.00   38.21  ? 467  ILE C O     1 
ATOM   7275  C  CB    . ILE C 2  467  ? 10.480  -30.049 77.937  1.00   38.76  ? 467  ILE C CB    1 
ATOM   7276  C  CG1   . ILE C 2  467  ? 10.822  -28.862 77.040  1.00   34.98  ? 467  ILE C CG1   1 
ATOM   7277  C  CG2   . ILE C 2  467  ? 10.754  -29.713 79.394  1.00   36.40  ? 467  ILE C CG2   1 
ATOM   7278  C  CD1   . ILE C 2  467  ? 10.039  -27.610 77.368  1.00   44.16  ? 467  ILE C CD1   1 
ATOM   7279  N  N     . ARG C 2  468  ? 11.543  -33.019 79.201  1.00   36.88  ? 468  ARG C N     1 
ATOM   7280  C  CA    . ARG C 2  468  ? 11.156  -34.188 79.982  1.00   37.83  ? 468  ARG C CA    1 
ATOM   7281  C  C     . ARG C 2  468  ? 11.022  -33.850 81.463  1.00   42.18  ? 468  ARG C C     1 
ATOM   7282  O  O     . ARG C 2  468  ? 11.789  -33.050 81.999  1.00   43.65  ? 468  ARG C O     1 
ATOM   7283  C  CB    . ARG C 2  468  ? 12.169  -35.319 79.797  1.00   39.21  ? 468  ARG C CB    1 
ATOM   7284  C  CG    . ARG C 2  468  ? 12.391  -35.726 78.349  1.00   45.85  ? 468  ARG C CG    1 
ATOM   7285  C  CD    . ARG C 2  468  ? 13.524  -36.735 78.223  1.00   50.76  ? 468  ARG C CD    1 
ATOM   7286  N  NE    . ARG C 2  468  ? 13.104  -38.098 78.534  1.00   57.74  ? 468  ARG C NE    1 
ATOM   7287  C  CZ    . ARG C 2  468  ? 13.285  -39.137 77.724  1.00   52.69  ? 468  ARG C CZ    1 
ATOM   7288  N  NH1   . ARG C 2  468  ? 13.883  -38.970 76.553  1.00   41.91  ? 468  ARG C NH1   1 
ATOM   7289  N  NH2   . ARG C 2  468  ? 12.871  -40.344 78.086  1.00   57.22  ? 468  ARG C NH2   1 
ATOM   7290  N  N     . THR C 2  469  ? 10.044  -34.469 82.118  1.00   42.91  ? 469  THR C N     1 
ATOM   7291  C  CA    . THR C 2  469  ? 9.824   -34.266 83.546  1.00   42.41  ? 469  THR C CA    1 
ATOM   7292  C  C     . THR C 2  469  ? 9.948   -35.596 84.290  1.00   46.02  ? 469  THR C C     1 
ATOM   7293  O  O     . THR C 2  469  ? 9.551   -36.641 83.771  1.00   47.87  ? 469  THR C O     1 
ATOM   7294  C  CB    . THR C 2  469  ? 8.442   -33.620 83.812  1.00   43.50  ? 469  THR C CB    1 
ATOM   7295  O  OG1   . THR C 2  469  ? 8.207   -33.529 85.222  1.00   41.70  ? 469  THR C OG1   1 
ATOM   7296  C  CG2   . THR C 2  469  ? 7.330   -34.430 83.162  1.00   44.72  ? 469  THR C CG2   1 
ATOM   7297  N  N     . PRO C 2  470  ? 10.516  -35.565 85.507  1.00   47.11  ? 470  PRO C N     1 
ATOM   7298  C  CA    . PRO C 2  470  ? 10.753  -36.793 86.274  1.00   47.17  ? 470  PRO C CA    1 
ATOM   7299  C  C     . PRO C 2  470  ? 9.497   -37.363 86.930  1.00   43.31  ? 470  PRO C C     1 
ATOM   7300  O  O     . PRO C 2  470  ? 8.606   -36.611 87.325  1.00   43.54  ? 470  PRO C O     1 
ATOM   7301  C  CB    . PRO C 2  470  ? 11.745  -36.339 87.348  1.00   45.40  ? 470  PRO C CB    1 
ATOM   7302  C  CG    . PRO C 2  470  ? 11.425  -34.909 87.558  1.00   45.07  ? 470  PRO C CG    1 
ATOM   7303  C  CD    . PRO C 2  470  ? 11.038  -34.375 86.204  1.00   50.48  ? 470  PRO C CD    1 
ATOM   7304  N  N     . TYR C 2  471  ? 9.439   -38.687 87.037  1.00   43.19  ? 471  TYR C N     1 
ATOM   7305  C  CA    . TYR C 2  471  ? 8.382   -39.363 87.782  1.00   43.94  ? 471  TYR C CA    1 
ATOM   7306  C  C     . TYR C 2  471  ? 8.961   -40.548 88.550  1.00   50.64  ? 471  TYR C C     1 
ATOM   7307  O  O     . TYR C 2  471  ? 10.033  -41.044 88.218  1.00   54.64  ? 471  TYR C O     1 
ATOM   7308  C  CB    . TYR C 2  471  ? 7.265   -39.836 86.849  1.00   45.30  ? 471  TYR C CB    1 
ATOM   7309  C  CG    . TYR C 2  471  ? 6.444   -38.720 86.240  1.00   49.79  ? 471  TYR C CG    1 
ATOM   7310  C  CD1   . TYR C 2  471  ? 6.521   -38.436 84.882  1.00   50.14  ? 471  TYR C CD1   1 
ATOM   7311  C  CD2   . TYR C 2  471  ? 5.591   -37.951 87.022  1.00   53.91  ? 471  TYR C CD2   1 
ATOM   7312  C  CE1   . TYR C 2  471  ? 5.770   -37.418 84.320  1.00   46.94  ? 471  TYR C CE1   1 
ATOM   7313  C  CE2   . TYR C 2  471  ? 4.837   -36.929 86.468  1.00   51.57  ? 471  TYR C CE2   1 
ATOM   7314  C  CZ    . TYR C 2  471  ? 4.932   -36.668 85.116  1.00   45.68  ? 471  TYR C CZ    1 
ATOM   7315  O  OH    . TYR C 2  471  ? 4.186   -35.655 84.558  1.00   41.35  ? 471  TYR C OH    1 
ATOM   7316  N  N     . ARG C 2  472  ? 8.250   -40.994 89.579  1.00   53.53  ? 472  ARG C N     1 
ATOM   7317  C  CA    . ARG C 2  472  ? 8.681   -42.134 90.381  1.00   54.84  ? 472  ARG C CA    1 
ATOM   7318  C  C     . ARG C 2  472  ? 7.955   -43.406 89.970  1.00   56.28  ? 472  ARG C C     1 
ATOM   7319  O  O     . ARG C 2  472  ? 6.744   -43.396 89.756  1.00   52.42  ? 472  ARG C O     1 
ATOM   7320  C  CB    . ARG C 2  472  ? 8.452   -41.869 91.870  1.00   50.82  ? 472  ARG C CB    1 
ATOM   7321  C  CG    . ARG C 2  472  ? 9.530   -41.029 92.525  1.00   54.37  ? 472  ARG C CG    1 
ATOM   7322  C  CD    . ARG C 2  472  ? 9.513   -41.203 94.032  1.00   56.60  ? 472  ARG C CD    1 
ATOM   7323  N  NE    . ARG C 2  472  ? 8.455   -40.432 94.674  1.00   63.28  ? 472  ARG C NE    1 
ATOM   7324  C  CZ    . ARG C 2  472  ? 8.203   -40.455 95.980  1.00   79.42  ? 472  ARG C CZ    1 
ATOM   7325  N  NH1   . ARG C 2  472  ? 8.930   -41.219 96.784  1.00   76.19  ? 472  ARG C NH1   1 
ATOM   7326  N  NH2   . ARG C 2  472  ? 7.221   -39.717 96.482  1.00   78.79  ? 472  ARG C NH2   1 
ATOM   7327  N  N     . ARG C 2  473  ? 8.703   -44.500 89.867  1.00   58.76  ? 473  ARG C N     1 
ATOM   7328  C  CA    . ARG C 2  473  ? 8.134   -45.791 89.500  1.00   61.87  ? 473  ARG C CA    1 
ATOM   7329  C  C     . ARG C 2  473  ? 7.331   -46.386 90.651  1.00   69.56  ? 473  ARG C C     1 
ATOM   7330  O  O     . ARG C 2  473  ? 7.816   -46.471 91.781  1.00   70.80  ? 473  ARG C O     1 
ATOM   7331  C  CB    . ARG C 2  473  ? 9.241   -46.763 89.090  1.00   66.94  ? 473  ARG C CB    1 
ATOM   7332  C  CG    . ARG C 2  473  ? 8.741   -48.149 88.712  1.00   74.45  ? 473  ARG C CG    1 
ATOM   7333  C  CD    . ARG C 2  473  ? 8.452   -48.248 87.224  1.00   71.25  ? 473  ARG C CD    1 
ATOM   7334  N  NE    . ARG C 2  473  ? 9.667   -48.086 86.431  1.00   64.40  ? 473  ARG C NE    1 
ATOM   7335  C  CZ    . ARG C 2  473  ? 9.709   -48.147 85.105  1.00   66.03  ? 473  ARG C CZ    1 
ATOM   7336  N  NH1   . ARG C 2  473  ? 8.599   -48.368 84.413  1.00   68.47  ? 473  ARG C NH1   1 
ATOM   7337  N  NH2   . ARG C 2  473  ? 10.862  -47.986 84.469  1.00   72.48  ? 473  ARG C NH2   1 
ATOM   7338  N  N     . VAL C 2  474  ? 6.101   -46.796 90.359  1.00   72.33  ? 474  VAL C N     1 
ATOM   7339  C  CA    . VAL C 2  474  ? 5.248   -47.430 91.358  1.00   73.81  ? 474  VAL C CA    1 
ATOM   7340  C  C     . VAL C 2  474  ? 4.886   -48.849 90.931  1.00   78.39  ? 474  VAL C C     1 
ATOM   7341  O  O     . VAL C 2  474  ? 4.297   -49.057 89.870  1.00   75.04  ? 474  VAL C O     1 
ATOM   7342  C  CB    . VAL C 2  474  ? 3.956   -46.625 91.598  1.00   62.33  ? 474  VAL C CB    1 
ATOM   7343  C  CG1   . VAL C 2  474  ? 3.082   -47.321 92.629  1.00   61.59  ? 474  VAL C CG1   1 
ATOM   7344  C  CG2   . VAL C 2  474  ? 4.288   -45.212 92.043  1.00   64.66  ? 474  VAL C CG2   1 
ATOM   7345  N  N     . VAL C 2  475  ? 5.249   -49.823 91.761  1.00   78.30  ? 475  VAL C N     1 
ATOM   7346  C  CA    . VAL C 2  475  ? 4.963   -51.223 91.469  1.00   73.80  ? 475  VAL C CA    1 
ATOM   7347  C  C     . VAL C 2  475  ? 4.163   -51.871 92.595  1.00   71.81  ? 475  VAL C C     1 
ATOM   7348  O  O     . VAL C 2  475  ? 4.652   -52.005 93.717  1.00   70.42  ? 475  VAL C O     1 
ATOM   7349  C  CB    . VAL C 2  475  ? 6.257   -52.031 91.238  1.00   69.05  ? 475  VAL C CB    1 
ATOM   7350  C  CG1   . VAL C 2  475  ? 5.937   -53.504 91.040  1.00   69.90  ? 475  VAL C CG1   1 
ATOM   7351  C  CG2   . VAL C 2  475  ? 7.023   -51.481 90.043  1.00   63.94  ? 475  VAL C CG2   1 
ATOM   7352  N  N     . GLY C 2  476  ? 2.932   -52.269 92.285  1.00   65.89  ? 476  GLY C N     1 
ATOM   7353  C  CA    . GLY C 2  476  ? 2.073   -52.941 93.244  1.00   62.57  ? 476  GLY C CA    1 
ATOM   7354  C  C     . GLY C 2  476  ? 1.787   -52.124 94.489  1.00   66.23  ? 476  GLY C C     1 
ATOM   7355  O  O     . GLY C 2  476  ? 1.698   -52.667 95.590  1.00   68.38  ? 476  GLY C O     1 
ATOM   7356  N  N     . GLY C 2  477  ? 1.649   -50.815 94.316  1.00   64.68  ? 477  GLY C N     1 
ATOM   7357  C  CA    . GLY C 2  477  ? 1.338   -49.933 95.426  1.00   66.11  ? 477  GLY C CA    1 
ATOM   7358  C  C     . GLY C 2  477  ? 2.553   -49.538 96.243  1.00   69.87  ? 477  GLY C C     1 
ATOM   7359  O  O     . GLY C 2  477  ? 2.422   -48.963 97.323  1.00   75.33  ? 477  GLY C O     1 
ATOM   7360  N  N     . VAL C 2  478  ? 3.738   -49.852 95.732  1.00   63.37  ? 478  VAL C N     1 
ATOM   7361  C  CA    . VAL C 2  478  ? 4.976   -49.481 96.405  1.00   69.28  ? 478  VAL C CA    1 
ATOM   7362  C  C     . VAL C 2  478  ? 5.730   -48.444 95.581  1.00   79.46  ? 478  VAL C C     1 
ATOM   7363  O  O     . VAL C 2  478  ? 5.944   -48.629 94.382  1.00   73.46  ? 478  VAL C O     1 
ATOM   7364  C  CB    . VAL C 2  478  ? 5.883   -50.704 96.639  1.00   72.17  ? 478  VAL C CB    1 
ATOM   7365  C  CG1   . VAL C 2  478  ? 7.094   -50.314 97.473  1.00   72.62  ? 478  VAL C CG1   1 
ATOM   7366  C  CG2   . VAL C 2  478  ? 5.104   -51.818 97.318  1.00   79.89  ? 478  VAL C CG2   1 
ATOM   7367  N  N     . VAL C 2  479  ? 6.133   -47.352 96.224  1.00   83.85  ? 479  VAL C N     1 
ATOM   7368  C  CA    . VAL C 2  479  ? 6.827   -46.279 95.523  1.00   78.21  ? 479  VAL C CA    1 
ATOM   7369  C  C     . VAL C 2  479  ? 8.338   -46.455 95.613  1.00   72.29  ? 479  VAL C C     1 
ATOM   7370  O  O     . VAL C 2  479  ? 8.932   -46.302 96.680  1.00   72.73  ? 479  VAL C O     1 
ATOM   7371  C  CB    . VAL C 2  479  ? 6.454   -44.895 96.090  1.00   72.20  ? 479  VAL C CB    1 
ATOM   7372  C  CG1   . VAL C 2  479  ? 7.170   -43.797 95.321  1.00   66.85  ? 479  VAL C CG1   1 
ATOM   7373  C  CG2   . VAL C 2  479  ? 4.948   -44.688 96.043  1.00   70.83  ? 479  VAL C CG2   1 
ATOM   7374  N  N     . THR C 2  480  ? 8.951   -46.779 94.480  1.00   62.36  ? 480  THR C N     1 
ATOM   7375  C  CA    . THR C 2  480  ? 10.398  -46.916 94.402  1.00   71.31  ? 480  THR C CA    1 
ATOM   7376  C  C     . THR C 2  480  ? 11.062  -45.546 94.373  1.00   70.76  ? 480  THR C C     1 
ATOM   7377  O  O     . THR C 2  480  ? 10.422  -44.545 94.052  1.00   75.32  ? 480  THR C O     1 
ATOM   7378  C  CB    . THR C 2  480  ? 10.825  -47.703 93.149  1.00   72.26  ? 480  THR C CB    1 
ATOM   7379  O  OG1   . THR C 2  480  ? 10.577  -46.916 91.978  1.00   71.85  ? 480  THR C OG1   1 
ATOM   7380  C  CG2   . THR C 2  480  ? 10.055  -49.012 93.051  1.00   72.85  ? 480  THR C CG2   1 
ATOM   7381  N  N     . ASP C 2  481  ? 12.345  -45.501 94.715  1.00   64.41  ? 481  ASP C N     1 
ATOM   7382  C  CA    . ASP C 2  481  ? 13.118  -44.273 94.582  1.00   64.33  ? 481  ASP C CA    1 
ATOM   7383  C  C     . ASP C 2  481  ? 13.679  -44.151 93.168  1.00   65.90  ? 481  ASP C C     1 
ATOM   7384  O  O     . ASP C 2  481  ? 14.388  -43.197 92.849  1.00   65.59  ? 481  ASP C O     1 
ATOM   7385  C  CB    . ASP C 2  481  ? 14.240  -44.216 95.618  1.00   72.44  ? 481  ASP C CB    1 
ATOM   7386  C  CG    . ASP C 2  481  ? 13.725  -43.934 97.016  1.00   83.75  ? 481  ASP C CG    1 
ATOM   7387  O  OD1   . ASP C 2  481  ? 12.631  -43.342 97.137  1.00   76.12  ? 481  ASP C OD1   1 
ATOM   7388  O  OD2   . ASP C 2  481  ? 14.415  -44.300 97.991  1.00   101.07 ? 481  ASP C OD2   1 
ATOM   7389  N  N     . GLU C 2  482  ? 13.362  -45.133 92.330  1.00   62.85  ? 482  GLU C N     1 
ATOM   7390  C  CA    . GLU C 2  482  ? 13.719  -45.091 90.919  1.00   62.90  ? 482  GLU C CA    1 
ATOM   7391  C  C     . GLU C 2  482  ? 13.014  -43.921 90.246  1.00   67.83  ? 482  GLU C C     1 
ATOM   7392  O  O     . GLU C 2  482  ? 11.805  -43.744 90.404  1.00   64.39  ? 482  GLU C O     1 
ATOM   7393  C  CB    . GLU C 2  482  ? 13.324  -46.399 90.231  1.00   70.31  ? 482  GLU C CB    1 
ATOM   7394  C  CG    . GLU C 2  482  ? 13.464  -46.374 88.715  1.00   76.42  ? 482  GLU C CG    1 
ATOM   7395  C  CD    . GLU C 2  482  ? 12.877  -47.606 88.051  1.00   76.81  ? 482  GLU C CD    1 
ATOM   7396  O  OE1   . GLU C 2  482  ? 12.883  -47.669 86.803  1.00   78.15  ? 482  GLU C OE1   1 
ATOM   7397  O  OE2   . GLU C 2  482  ? 12.407  -48.510 88.775  1.00   71.03  ? 482  GLU C OE2   1 
ATOM   7398  N  N     . VAL C 2  483  ? 13.771  -43.123 89.498  1.00   67.81  ? 483  VAL C N     1 
ATOM   7399  C  CA    . VAL C 2  483  ? 13.214  -41.957 88.819  1.00   54.53  ? 483  VAL C CA    1 
ATOM   7400  C  C     . VAL C 2  483  ? 13.369  -42.059 87.304  1.00   49.88  ? 483  VAL C C     1 
ATOM   7401  O  O     . VAL C 2  483  ? 14.440  -42.395 86.800  1.00   59.06  ? 483  VAL C O     1 
ATOM   7402  C  CB    . VAL C 2  483  ? 13.868  -40.653 89.312  1.00   45.65  ? 483  VAL C CB    1 
ATOM   7403  C  CG1   . VAL C 2  483  ? 13.251  -39.455 88.614  1.00   45.66  ? 483  VAL C CG1   1 
ATOM   7404  C  CG2   . VAL C 2  483  ? 13.722  -40.525 90.818  1.00   56.68  ? 483  VAL C CG2   1 
ATOM   7405  N  N     . VAL C 2  484  ? 12.288  -41.768 86.587  1.00   47.35  ? 484  VAL C N     1 
ATOM   7406  C  CA    . VAL C 2  484  ? 12.276  -41.823 85.130  1.00   50.77  ? 484  VAL C CA    1 
ATOM   7407  C  C     . VAL C 2  484  ? 11.798  -40.504 84.524  1.00   51.94  ? 484  VAL C C     1 
ATOM   7408  O  O     . VAL C 2  484  ? 10.680  -40.059 84.790  1.00   54.54  ? 484  VAL C O     1 
ATOM   7409  C  CB    . VAL C 2  484  ? 11.364  -42.959 84.625  1.00   44.88  ? 484  VAL C CB    1 
ATOM   7410  C  CG1   . VAL C 2  484  ? 11.249  -42.918 83.109  1.00   42.23  ? 484  VAL C CG1   1 
ATOM   7411  C  CG2   . VAL C 2  484  ? 11.886  -44.310 85.095  1.00   54.71  ? 484  VAL C CG2   1 
ATOM   7412  N  N     . TYR C 2  485  ? 12.651  -39.883 83.714  1.00   47.48  ? 485  TYR C N     1 
ATOM   7413  C  CA    . TYR C 2  485  ? 12.278  -38.678 82.979  1.00   44.49  ? 485  TYR C CA    1 
ATOM   7414  C  C     . TYR C 2  485  ? 11.518  -39.054 81.712  1.00   46.05  ? 485  TYR C C     1 
ATOM   7415  O  O     . TYR C 2  485  ? 11.973  -39.896 80.937  1.00   48.56  ? 485  TYR C O     1 
ATOM   7416  C  CB    . TYR C 2  485  ? 13.521  -37.865 82.617  1.00   43.70  ? 485  TYR C CB    1 
ATOM   7417  C  CG    . TYR C 2  485  ? 14.036  -36.976 83.726  1.00   41.46  ? 485  TYR C CG    1 
ATOM   7418  C  CD1   . TYR C 2  485  ? 14.896  -37.467 84.699  1.00   41.22  ? 485  TYR C CD1   1 
ATOM   7419  C  CD2   . TYR C 2  485  ? 13.670  -35.639 83.791  1.00   46.34  ? 485  TYR C CD2   1 
ATOM   7420  C  CE1   . TYR C 2  485  ? 15.371  -36.649 85.710  1.00   48.93  ? 485  TYR C CE1   1 
ATOM   7421  C  CE2   . TYR C 2  485  ? 14.140  -34.815 84.795  1.00   45.52  ? 485  TYR C CE2   1 
ATOM   7422  C  CZ    . TYR C 2  485  ? 14.987  -35.324 85.752  1.00   46.38  ? 485  TYR C CZ    1 
ATOM   7423  O  OH    . TYR C 2  485  ? 15.452  -34.499 86.752  1.00   45.05  ? 485  TYR C OH    1 
ATOM   7424  N  N     . MET C 2  486  ? 10.363  -38.431 81.497  1.00   43.71  ? 486  MET C N     1 
ATOM   7425  C  CA    . MET C 2  486  ? 9.512   -38.799 80.369  1.00   50.47  ? 486  MET C CA    1 
ATOM   7426  C  C     . MET C 2  486  ? 9.199   -37.643 79.429  1.00   46.29  ? 486  MET C C     1 
ATOM   7427  O  O     . MET C 2  486  ? 9.007   -36.508 79.861  1.00   45.70  ? 486  MET C O     1 
ATOM   7428  C  CB    . MET C 2  486  ? 8.190   -39.390 80.862  1.00   50.02  ? 486  MET C CB    1 
ATOM   7429  C  CG    . MET C 2  486  ? 8.321   -40.611 81.744  1.00   49.51  ? 486  MET C CG    1 
ATOM   7430  S  SD    . MET C 2  486  ? 6.703   -41.305 82.122  1.00   48.94  ? 486  MET C SD    1 
ATOM   7431  C  CE    . MET C 2  486  ? 7.135   -42.450 83.424  1.00   54.52  ? 486  MET C CE    1 
ATOM   7432  N  N     . THR C 2  487  ? 9.140   -37.951 78.138  1.00   44.45  ? 487  THR C N     1 
ATOM   7433  C  CA    . THR C 2  487  ? 8.573   -37.042 77.157  1.00   41.30  ? 487  THR C CA    1 
ATOM   7434  C  C     . THR C 2  487  ? 7.065   -37.061 77.356  1.00   44.39  ? 487  THR C C     1 
ATOM   7435  O  O     . THR C 2  487  ? 6.535   -37.988 77.967  1.00   51.31  ? 487  THR C O     1 
ATOM   7436  C  CB    . THR C 2  487  ? 8.887   -37.496 75.726  1.00   45.05  ? 487  THR C CB    1 
ATOM   7437  O  OG1   . THR C 2  487  ? 8.264   -38.763 75.478  1.00   40.08  ? 487  THR C OG1   1 
ATOM   7438  C  CG2   . THR C 2  487  ? 10.390  -37.625 75.524  1.00   44.36  ? 487  THR C CG2   1 
ATOM   7439  N  N     . ALA C 2  488  ? 6.375   -36.039 76.860  1.00   41.01  ? 488  ALA C N     1 
ATOM   7440  C  CA    . ALA C 2  488  ? 4.920   -35.976 76.983  1.00   44.50  ? 488  ALA C CA    1 
ATOM   7441  C  C     . ALA C 2  488  ? 4.252   -37.186 76.329  1.00   48.37  ? 488  ALA C C     1 
ATOM   7442  O  O     . ALA C 2  488  ? 3.271   -37.730 76.850  1.00   47.84  ? 488  ALA C O     1 
ATOM   7443  C  CB    . ALA C 2  488  ? 4.393   -34.685 76.386  1.00   45.54  ? 488  ALA C CB    1 
ATOM   7444  N  N     . THR C 2  489  ? 4.805   -37.605 75.193  1.00   42.76  ? 489  THR C N     1 
ATOM   7445  C  CA    . THR C 2  489  ? 4.318   -38.777 74.476  1.00   42.31  ? 489  THR C CA    1 
ATOM   7446  C  C     . THR C 2  489  ? 4.444   -40.030 75.339  1.00   47.42  ? 489  THR C C     1 
ATOM   7447  O  O     . THR C 2  489  ? 3.567   -40.895 75.329  1.00   47.27  ? 489  THR C O     1 
ATOM   7448  C  CB    . THR C 2  489  ? 5.089   -38.986 73.160  1.00   40.76  ? 489  THR C CB    1 
ATOM   7449  O  OG1   . THR C 2  489  ? 5.104   -37.764 72.413  1.00   42.06  ? 489  THR C OG1   1 
ATOM   7450  C  CG2   . THR C 2  489  ? 4.437   -40.077 72.326  1.00   45.55  ? 489  THR C CG2   1 
ATOM   7451  N  N     . GLU C 2  490  ? 5.538   -40.119 76.089  1.00   48.43  ? 490  GLU C N     1 
ATOM   7452  C  CA    . GLU C 2  490  ? 5.749   -41.235 77.004  1.00   51.68  ? 490  GLU C CA    1 
ATOM   7453  C  C     . GLU C 2  490  ? 4.879   -41.117 78.253  1.00   51.03  ? 490  GLU C C     1 
ATOM   7454  O  O     . GLU C 2  490  ? 4.417   -42.122 78.793  1.00   54.37  ? 490  GLU C O     1 
ATOM   7455  C  CB    . GLU C 2  490  ? 7.226   -41.347 77.393  1.00   49.75  ? 490  GLU C CB    1 
ATOM   7456  C  CG    . GLU C 2  490  ? 7.971   -42.459 76.671  1.00   53.50  ? 490  GLU C CG    1 
ATOM   7457  C  CD    . GLU C 2  490  ? 7.480   -43.842 77.067  1.00   58.37  ? 490  GLU C CD    1 
ATOM   7458  O  OE1   . GLU C 2  490  ? 7.151   -44.641 76.164  1.00   53.44  ? 490  GLU C OE1   1 
ATOM   7459  O  OE2   . GLU C 2  490  ? 7.428   -44.131 78.281  1.00   57.19  ? 490  GLU C OE2   1 
ATOM   7460  N  N     . GLU C 2  491  ? 4.658   -39.887 78.708  1.00   47.94  ? 491  GLU C N     1 
ATOM   7461  C  CA    . GLU C 2  491  ? 3.824   -39.645 79.881  1.00   48.14  ? 491  GLU C CA    1 
ATOM   7462  C  C     . GLU C 2  491  ? 2.378   -40.053 79.628  1.00   51.79  ? 491  GLU C C     1 
ATOM   7463  O  O     . GLU C 2  491  ? 1.709   -40.581 80.519  1.00   52.72  ? 491  GLU C O     1 
ATOM   7464  C  CB    . GLU C 2  491  ? 3.880   -38.172 80.293  1.00   53.85  ? 491  GLU C CB    1 
ATOM   7465  C  CG    . GLU C 2  491  ? 2.920   -37.813 81.421  1.00   52.23  ? 491  GLU C CG    1 
ATOM   7466  C  CD    . GLU C 2  491  ? 2.862   -36.324 81.695  1.00   48.80  ? 491  GLU C CD    1 
ATOM   7467  O  OE1   . GLU C 2  491  ? 1.742   -35.773 81.756  1.00   43.34  ? 491  GLU C OE1   1 
ATOM   7468  O  OE2   . GLU C 2  491  ? 3.935   -35.705 81.855  1.00   51.40  ? 491  GLU C OE2   1 
ATOM   7469  N  N     . ASP C 2  492  ? 1.903   -39.818 78.408  1.00   51.31  ? 492  ASP C N     1 
ATOM   7470  C  CA    . ASP C 2  492  ? 0.517   -40.122 78.051  1.00   53.76  ? 492  ASP C CA    1 
ATOM   7471  C  C     . ASP C 2  492  ? 0.154   -41.604 78.182  1.00   56.59  ? 492  ASP C C     1 
ATOM   7472  O  O     . ASP C 2  492  ? -1.024  -41.961 78.173  1.00   56.05  ? 492  ASP C O     1 
ATOM   7473  C  CB    . ASP C 2  492  ? 0.211   -39.637 76.630  1.00   52.57  ? 492  ASP C CB    1 
ATOM   7474  C  CG    . ASP C 2  492  ? -0.105  -38.155 76.574  1.00   50.07  ? 492  ASP C CG    1 
ATOM   7475  O  OD1   . ASP C 2  492  ? -0.515  -37.673 75.497  1.00   48.29  ? 492  ASP C OD1   1 
ATOM   7476  O  OD2   . ASP C 2  492  ? 0.047   -37.474 77.610  1.00   52.39  ? 492  ASP C OD2   1 
ATOM   7477  N  N     . ARG C 2  493  ? 1.162   -42.461 78.308  1.00   57.52  ? 493  ARG C N     1 
ATOM   7478  C  CA    . ARG C 2  493  ? 0.941   -43.903 78.355  1.00   56.05  ? 493  ARG C CA    1 
ATOM   7479  C  C     . ARG C 2  493  ? 0.714   -44.442 79.767  1.00   63.13  ? 493  ARG C C     1 
ATOM   7480  O  O     . ARG C 2  493  ? 0.512   -45.644 79.947  1.00   69.04  ? 493  ARG C O     1 
ATOM   7481  C  CB    . ARG C 2  493  ? 2.120   -44.643 77.718  1.00   51.49  ? 493  ARG C CB    1 
ATOM   7482  C  CG    . ARG C 2  493  ? 2.468   -44.183 76.314  1.00   55.78  ? 493  ARG C CG    1 
ATOM   7483  C  CD    . ARG C 2  493  ? 3.575   -45.034 75.704  1.00   64.43  ? 493  ARG C CD    1 
ATOM   7484  N  NE    . ARG C 2  493  ? 3.130   -46.392 75.399  1.00   65.43  ? 493  ARG C NE    1 
ATOM   7485  C  CZ    . ARG C 2  493  ? 3.382   -47.455 76.157  1.00   65.02  ? 493  ARG C CZ    1 
ATOM   7486  N  NH1   . ARG C 2  493  ? 4.084   -47.325 77.275  1.00   66.78  ? 493  ARG C NH1   1 
ATOM   7487  N  NH2   . ARG C 2  493  ? 2.934   -48.650 75.796  1.00   66.66  ? 493  ARG C NH2   1 
ATOM   7488  N  N     . TYR C 2  494  ? 0.747   -43.567 80.769  1.00   54.62  ? 494  TYR C N     1 
ATOM   7489  C  CA    . TYR C 2  494  ? 0.697   -44.031 82.153  1.00   53.81  ? 494  TYR C CA    1 
ATOM   7490  C  C     . TYR C 2  494  ? -0.279  -43.276 83.053  1.00   55.04  ? 494  TYR C C     1 
ATOM   7491  O  O     . TYR C 2  494  ? -0.611  -42.117 82.806  1.00   55.31  ? 494  TYR C O     1 
ATOM   7492  C  CB    . TYR C 2  494  ? 2.099   -44.006 82.773  1.00   54.97  ? 494  TYR C CB    1 
ATOM   7493  C  CG    . TYR C 2  494  ? 3.121   -44.782 81.977  1.00   55.06  ? 494  TYR C CG    1 
ATOM   7494  C  CD1   . TYR C 2  494  ? 3.132   -46.170 81.992  1.00   62.10  ? 494  TYR C CD1   1 
ATOM   7495  C  CD2   . TYR C 2  494  ? 4.072   -44.128 81.207  1.00   55.43  ? 494  TYR C CD2   1 
ATOM   7496  C  CE1   . TYR C 2  494  ? 4.062   -46.885 81.262  1.00   68.21  ? 494  TYR C CE1   1 
ATOM   7497  C  CE2   . TYR C 2  494  ? 5.006   -44.834 80.473  1.00   61.27  ? 494  TYR C CE2   1 
ATOM   7498  C  CZ    . TYR C 2  494  ? 4.997   -46.213 80.505  1.00   63.57  ? 494  TYR C CZ    1 
ATOM   7499  O  OH    . TYR C 2  494  ? 5.925   -46.925 79.777  1.00   58.31  ? 494  TYR C OH    1 
ATOM   7500  N  N     . THR C 2  495  ? -0.729  -43.962 84.099  1.00   52.70  ? 495  THR C N     1 
ATOM   7501  C  CA    . THR C 2  495  ? -1.543  -43.360 85.144  1.00   42.63  ? 495  THR C CA    1 
ATOM   7502  C  C     . THR C 2  495  ? -0.602  -42.866 86.232  1.00   46.00  ? 495  THR C C     1 
ATOM   7503  O  O     . THR C 2  495  ? 0.084   -43.665 86.867  1.00   53.31  ? 495  THR C O     1 
ATOM   7504  C  CB    . THR C 2  495  ? -2.505  -44.393 85.759  1.00   43.40  ? 495  THR C CB    1 
ATOM   7505  O  OG1   . THR C 2  495  ? -3.323  -44.966 84.731  1.00   47.54  ? 495  THR C OG1   1 
ATOM   7506  C  CG2   . THR C 2  495  ? -3.392  -43.744 86.804  1.00   49.46  ? 495  THR C CG2   1 
ATOM   7507  N  N     . ILE C 2  496  ? -0.561  -41.555 86.449  1.00   50.84  ? 496  ILE C N     1 
ATOM   7508  C  CA    . ILE C 2  496  ? 0.426   -40.985 87.367  1.00   49.42  ? 496  ILE C CA    1 
ATOM   7509  C  C     . ILE C 2  496  ? -0.176  -40.285 88.588  1.00   46.76  ? 496  ILE C C     1 
ATOM   7510  O  O     . ILE C 2  496  ? -0.853  -39.267 88.464  1.00   53.89  ? 496  ILE C O     1 
ATOM   7511  C  CB    . ILE C 2  496  ? 1.376   -40.014 86.639  1.00   49.68  ? 496  ILE C CB    1 
ATOM   7512  C  CG1   . ILE C 2  496  ? 2.017   -40.703 85.432  1.00   45.69  ? 496  ILE C CG1   1 
ATOM   7513  C  CG2   . ILE C 2  496  ? 2.439   -39.498 87.595  1.00   49.48  ? 496  ILE C CG2   1 
ATOM   7514  C  CD1   . ILE C 2  496  ? 2.916   -39.799 84.615  1.00   47.16  ? 496  ILE C CD1   1 
ATOM   7515  N  N     . ALA C 2  497  ? 0.101   -40.829 89.769  1.00   46.01  ? 497  ALA C N     1 
ATOM   7516  C  CA    . ALA C 2  497  ? -0.439  -40.302 91.019  1.00   50.86  ? 497  ALA C CA    1 
ATOM   7517  C  C     . ALA C 2  497  ? 0.124   -38.929 91.383  1.00   51.77  ? 497  ALA C C     1 
ATOM   7518  O  O     . ALA C 2  497  ? 1.179   -38.528 90.894  1.00   51.84  ? 497  ALA C O     1 
ATOM   7519  C  CB    . ALA C 2  497  ? -0.194  -41.287 92.153  1.00   54.69  ? 497  ALA C CB    1 
ATOM   7520  N  N     . GLN C 2  498  ? -0.599  -38.213 92.241  1.00   52.47  ? 498  GLN C N     1 
ATOM   7521  C  CA    . GLN C 2  498  ? -0.155  -36.915 92.743  1.00   48.99  ? 498  GLN C CA    1 
ATOM   7522  C  C     . GLN C 2  498  ? 0.888   -37.065 93.847  1.00   46.85  ? 498  GLN C C     1 
ATOM   7523  O  O     . GLN C 2  498  ? 0.941   -38.088 94.528  1.00   51.81  ? 498  GLN C O     1 
ATOM   7524  C  CB    . GLN C 2  498  ? -1.345  -36.097 93.246  1.00   53.56  ? 498  GLN C CB    1 
ATOM   7525  C  CG    . GLN C 2  498  ? -2.202  -35.517 92.137  1.00   48.20  ? 498  GLN C CG    1 
ATOM   7526  C  CD    . GLN C 2  498  ? -1.443  -34.516 91.291  1.00   50.63  ? 498  GLN C CD    1 
ATOM   7527  O  OE1   . GLN C 2  498  ? -0.668  -33.711 91.808  1.00   50.75  ? 498  GLN C OE1   1 
ATOM   7528  N  NE2   . GLN C 2  498  ? -1.654  -34.568 89.981  1.00   51.20  ? 498  GLN C NE2   1 
ATOM   7529  N  N     . ALA C 2  499  ? 1.710   -36.036 94.021  1.00   42.57  ? 499  ALA C N     1 
ATOM   7530  C  CA    . ALA C 2  499  ? 2.816   -36.086 94.972  1.00   51.04  ? 499  ALA C CA    1 
ATOM   7531  C  C     . ALA C 2  499  ? 2.367   -36.050 96.433  1.00   58.72  ? 499  ALA C C     1 
ATOM   7532  O  O     . ALA C 2  499  ? 3.137   -36.382 97.334  1.00   63.09  ? 499  ALA C O     1 
ATOM   7533  C  CB    . ALA C 2  499  ? 3.799   -34.957 94.694  1.00   49.98  ? 499  ALA C CB    1 
ATOM   7534  N  N     . ASN C 2  500  ? 1.124   -35.646 96.668  1.00   58.43  ? 500  ASN C N     1 
ATOM   7535  C  CA    . ASN C 2  500  ? 0.622   -35.509 98.031  1.00   62.49  ? 500  ASN C CA    1 
ATOM   7536  C  C     . ASN C 2  500  ? -0.133  -36.737 98.540  1.00   70.18  ? 500  ASN C C     1 
ATOM   7537  O  O     . ASN C 2  500  ? -0.651  -36.730 99.656  1.00   76.85  ? 500  ASN C O     1 
ATOM   7538  C  CB    . ASN C 2  500  ? -0.253  -34.259 98.160  1.00   71.80  ? 500  ASN C CB    1 
ATOM   7539  C  CG    . ASN C 2  500  ? -1.555  -34.374 97.389  1.00   80.47  ? 500  ASN C CG    1 
ATOM   7540  O  OD1   . ASN C 2  500  ? -1.650  -35.118 96.413  1.00   81.51  ? 500  ASN C OD1   1 
ATOM   7541  N  ND2   . ASN C 2  500  ? -2.568  -33.635 97.826  1.00   79.49  ? 500  ASN C ND2   1 
ATOM   7542  N  N     . THR C 2  501  ? -0.201  -37.781 97.719  1.00   68.78  ? 501  THR C N     1 
ATOM   7543  C  CA    . THR C 2  501  ? -0.895  -39.009 98.102  1.00   65.64  ? 501  THR C CA    1 
ATOM   7544  C  C     . THR C 2  501  ? -0.214  -39.670 99.297  1.00   68.12  ? 501  THR C C     1 
ATOM   7545  O  O     . THR C 2  501  ? 0.987   -39.935 99.259  1.00   70.73  ? 501  THR C O     1 
ATOM   7546  C  CB    . THR C 2  501  ? -0.972  -40.009 96.934  1.00   64.45  ? 501  THR C CB    1 
ATOM   7547  O  OG1   . THR C 2  501  ? 0.351   -40.313 96.475  1.00   61.89  ? 501  THR C OG1   1 
ATOM   7548  C  CG2   . THR C 2  501  ? -1.781  -39.425 95.785  1.00   58.07  ? 501  THR C CG2   1 
ATOM   7549  N  N     . PRO C 2  502  ? -0.989  -39.934 100.364 1.00   69.95  ? 502  PRO C N     1 
ATOM   7550  C  CA    . PRO C 2  502  ? -0.497  -40.451 101.649 1.00   72.38  ? 502  PRO C CA    1 
ATOM   7551  C  C     . PRO C 2  502  ? 0.296   -41.745 101.508 1.00   76.57  ? 502  PRO C C     1 
ATOM   7552  O  O     . PRO C 2  502  ? -0.139  -42.668 100.818 1.00   74.81  ? 502  PRO C O     1 
ATOM   7553  C  CB    . PRO C 2  502  ? -1.784  -40.708 102.437 1.00   66.29  ? 502  PRO C CB    1 
ATOM   7554  C  CG    . PRO C 2  502  ? -2.779  -39.782 101.840 1.00   71.88  ? 502  PRO C CG    1 
ATOM   7555  C  CD    . PRO C 2  502  ? -2.448  -39.734 100.379 1.00   66.33  ? 502  PRO C CD    1 
ATOM   7556  N  N     . LEU C 2  503  ? 1.449   -41.804 102.165 1.00   74.73  ? 503  LEU C N     1 
ATOM   7557  C  CA    . LEU C 2  503  ? 2.318   -42.970 102.085 1.00   80.98  ? 503  LEU C CA    1 
ATOM   7558  C  C     . LEU C 2  503  ? 2.779   -43.418 103.467 1.00   89.32  ? 503  LEU C C     1 
ATOM   7559  O  O     . LEU C 2  503  ? 3.288   -42.616 104.252 1.00   92.75  ? 503  LEU C O     1 
ATOM   7560  C  CB    . LEU C 2  503  ? 3.546   -42.666 101.221 1.00   75.01  ? 503  LEU C CB    1 
ATOM   7561  C  CG    . LEU C 2  503  ? 3.347   -42.198 99.778  1.00   66.71  ? 503  LEU C CG    1 
ATOM   7562  C  CD1   . LEU C 2  503  ? 4.683   -41.820 99.157  1.00   68.68  ? 503  LEU C CD1   1 
ATOM   7563  C  CD2   . LEU C 2  503  ? 2.662   -43.265 98.948  1.00   60.54  ? 503  LEU C CD2   1 
ATOM   7564  N  N     . GLU C 2  504  ? 2.596   -44.701 103.762 1.00   88.36  ? 504  GLU C N     1 
ATOM   7565  C  CA    . GLU C 2  504  ? 3.211   -45.301 104.938 1.00   87.61  ? 504  GLU C CA    1 
ATOM   7566  C  C     . GLU C 2  504  ? 4.420   -46.112 104.484 1.00   87.26  ? 504  GLU C C     1 
ATOM   7567  O  O     . GLU C 2  504  ? 4.280   -47.151 103.837 1.00   86.70  ? 504  GLU C O     1 
ATOM   7568  C  CB    . GLU C 2  504  ? 2.209   -46.171 105.705 1.00   89.56  ? 504  GLU C CB    1 
ATOM   7569  C  CG    . GLU C 2  504  ? 1.339   -47.066 104.833 1.00   91.56  ? 504  GLU C CG    1 
ATOM   7570  C  CD    . GLU C 2  504  ? 0.366   -47.902 105.643 1.00   89.21  ? 504  GLU C CD    1 
ATOM   7571  O  OE1   . GLU C 2  504  ? 0.217   -47.635 106.854 1.00   90.02  ? 504  GLU C OE1   1 
ATOM   7572  O  OE2   . GLU C 2  504  ? -0.248  -48.827 105.070 1.00   81.01  ? 504  GLU C OE2   1 
ATOM   7573  N  N     . GLY C 2  505  ? 5.612   -45.627 104.816 1.00   83.26  ? 505  GLY C N     1 
ATOM   7574  C  CA    . GLY C 2  505  ? 6.829   -46.194 104.270 1.00   84.52  ? 505  GLY C CA    1 
ATOM   7575  C  C     . GLY C 2  505  ? 6.884   -45.919 102.779 1.00   75.66  ? 505  GLY C C     1 
ATOM   7576  O  O     . GLY C 2  505  ? 6.727   -44.778 102.349 1.00   79.93  ? 505  GLY C O     1 
ATOM   7577  N  N     . ASN C 2  506  ? 7.110   -46.962 101.988 1.00   72.45  ? 506  ASN C N     1 
ATOM   7578  C  CA    . ASN C 2  506  ? 7.084   -46.836 100.534 1.00   79.33  ? 506  ASN C CA    1 
ATOM   7579  C  C     . ASN C 2  506  ? 5.747   -47.238 99.914  1.00   79.64  ? 506  ASN C C     1 
ATOM   7580  O  O     . ASN C 2  506  ? 5.595   -47.233 98.693  1.00   71.22  ? 506  ASN C O     1 
ATOM   7581  C  CB    . ASN C 2  506  ? 8.225   -47.633 99.900  1.00   80.08  ? 506  ASN C CB    1 
ATOM   7582  C  CG    . ASN C 2  506  ? 9.574   -46.976 100.104 1.00   91.98  ? 506  ASN C CG    1 
ATOM   7583  O  OD1   . ASN C 2  506  ? 10.251  -47.219 101.103 1.00   101.79 ? 506  ASN C OD1   1 
ATOM   7584  N  ND2   . ASN C 2  506  ? 9.971   -46.133 99.157  1.00   89.43  ? 506  ASN C ND2   1 
ATOM   7585  N  N     . ARG C 2  507  ? 4.784   -47.587 100.761 1.00   80.33  ? 507  ARG C N     1 
ATOM   7586  C  CA    . ARG C 2  507  ? 3.489   -48.074 100.294 1.00   83.51  ? 507  ARG C CA    1 
ATOM   7587  C  C     . ARG C 2  507  ? 2.407   -46.995 100.348 1.00   83.20  ? 507  ARG C C     1 
ATOM   7588  O  O     . ARG C 2  507  ? 2.378   -46.177 101.268 1.00   79.55  ? 507  ARG C O     1 
ATOM   7589  C  CB    . ARG C 2  507  ? 3.059   -49.299 101.108 1.00   92.40  ? 507  ARG C CB    1 
ATOM   7590  C  CG    . ARG C 2  507  ? 1.779   -49.963 100.622 1.00   90.90  ? 507  ARG C CG    1 
ATOM   7591  C  CD    . ARG C 2  507  ? 1.492   -51.240 101.395 1.00   100.53 ? 507  ARG C CD    1 
ATOM   7592  N  NE    . ARG C 2  507  ? 2.568   -52.217 101.247 1.00   117.65 ? 507  ARG C NE    1 
ATOM   7593  C  CZ    . ARG C 2  507  ? 2.643   -53.104 100.259 1.00   115.84 ? 507  ARG C CZ    1 
ATOM   7594  N  NH1   . ARG C 2  507  ? 1.703   -53.140 99.324  1.00   107.77 ? 507  ARG C NH1   1 
ATOM   7595  N  NH2   . ARG C 2  507  ? 3.659   -53.955 100.205 1.00   103.75 ? 507  ARG C NH2   1 
ATOM   7596  N  N     . ILE C 2  508  ? 1.523   -47.002 99.354  1.00   79.98  ? 508  ILE C N     1 
ATOM   7597  C  CA    . ILE C 2  508  ? 0.421   -46.048 99.287  1.00   74.79  ? 508  ILE C CA    1 
ATOM   7598  C  C     . ILE C 2  508  ? -0.612  -46.324 100.376 1.00   76.72  ? 508  ILE C C     1 
ATOM   7599  O  O     . ILE C 2  508  ? -1.114  -47.441 100.500 1.00   79.72  ? 508  ILE C O     1 
ATOM   7600  C  CB    . ILE C 2  508  ? -0.262  -46.075 97.906  1.00   71.32  ? 508  ILE C CB    1 
ATOM   7601  C  CG1   . ILE C 2  508  ? 0.772   -45.861 96.799  1.00   71.44  ? 508  ILE C CG1   1 
ATOM   7602  C  CG2   . ILE C 2  508  ? -1.356  -45.022 97.831  1.00   73.66  ? 508  ILE C CG2   1 
ATOM   7603  C  CD1   . ILE C 2  508  ? 0.186   -45.858 95.404  1.00   65.52  ? 508  ILE C CD1   1 
ATOM   7604  N  N     . ALA C 2  509  ? -0.926  -45.297 101.161 1.00   76.54  ? 509  ALA C N     1 
ATOM   7605  C  CA    . ALA C 2  509  ? -1.793  -45.454 102.326 1.00   77.95  ? 509  ALA C CA    1 
ATOM   7606  C  C     . ALA C 2  509  ? -3.265  -45.126 102.065 1.00   72.01  ? 509  ALA C C     1 
ATOM   7607  O  O     . ALA C 2  509  ? -4.095  -45.230 102.968 1.00   82.37  ? 509  ALA C O     1 
ATOM   7608  C  CB    . ALA C 2  509  ? -1.263  -44.622 103.490 1.00   78.05  ? 509  ALA C CB    1 
ATOM   7609  N  N     . ALA C 2  510  ? -3.590  -44.730 100.839 1.00   64.64  ? 510  ALA C N     1 
ATOM   7610  C  CA    . ALA C 2  510  ? -4.966  -44.374 100.504 1.00   60.59  ? 510  ALA C CA    1 
ATOM   7611  C  C     . ALA C 2  510  ? -5.617  -45.405 99.586  1.00   68.52  ? 510  ALA C C     1 
ATOM   7612  O  O     . ALA C 2  510  ? -4.970  -45.950 98.692  1.00   71.22  ? 510  ALA C O     1 
ATOM   7613  C  CB    . ALA C 2  510  ? -5.019  -42.990 99.872  1.00   60.77  ? 510  ALA C CB    1 
ATOM   7614  N  N     . GLU C 2  511  ? -6.900  -45.670 99.814  1.00   69.32  ? 511  GLU C N     1 
ATOM   7615  C  CA    . GLU C 2  511  ? -7.649  -46.601 98.978  1.00   67.32  ? 511  GLU C CA    1 
ATOM   7616  C  C     . GLU C 2  511  ? -7.953  -45.960 97.630  1.00   67.17  ? 511  GLU C C     1 
ATOM   7617  O  O     . GLU C 2  511  ? -7.877  -46.607 96.585  1.00   63.55  ? 511  GLU C O     1 
ATOM   7618  C  CB    . GLU C 2  511  ? -8.953  -47.012 99.664  1.00   72.17  ? 511  GLU C CB    1 
ATOM   7619  C  CG    . GLU C 2  511  ? -9.729  -48.086 98.919  1.00   84.62  ? 511  GLU C CG    1 
ATOM   7620  C  CD    . GLU C 2  511  ? -11.129 -48.286 99.468  1.00   88.92  ? 511  GLU C CD    1 
ATOM   7621  O  OE1   . GLU C 2  511  ? -11.527 -49.452 99.675  1.00   82.53  ? 511  GLU C OE1   1 
ATOM   7622  O  OE2   . GLU C 2  511  ? -11.834 -47.276 99.683  1.00   94.29  ? 511  GLU C OE2   1 
ATOM   7623  N  N     . ARG C 2  512  ? -8.303  -44.680 97.667  1.00   71.88  ? 512  ARG C N     1 
ATOM   7624  C  CA    . ARG C 2  512  ? -8.582  -43.918 96.459  1.00   67.79  ? 512  ARG C CA    1 
ATOM   7625  C  C     . ARG C 2  512  ? -7.506  -42.855 96.270  1.00   67.31  ? 512  ARG C C     1 
ATOM   7626  O  O     . ARG C 2  512  ? -7.390  -41.928 97.072  1.00   71.80  ? 512  ARG C O     1 
ATOM   7627  C  CB    . ARG C 2  512  ? -9.963  -43.267 96.552  1.00   74.75  ? 512  ARG C CB    1 
ATOM   7628  C  CG    . ARG C 2  512  ? -11.096 -44.254 96.792  1.00   77.46  ? 512  ARG C CG    1 
ATOM   7629  C  CD    . ARG C 2  512  ? -12.393 -43.553 97.180  1.00   86.78  ? 512  ARG C CD    1 
ATOM   7630  N  NE    . ARG C 2  512  ? -12.966 -42.777 96.082  1.00   92.04  ? 512  ARG C NE    1 
ATOM   7631  C  CZ    . ARG C 2  512  ? -12.867 -41.456 95.965  1.00   82.99  ? 512  ARG C CZ    1 
ATOM   7632  N  NH1   . ARG C 2  512  ? -12.213 -40.753 96.880  1.00   77.19  ? 512  ARG C NH1   1 
ATOM   7633  N  NH2   . ARG C 2  512  ? -13.423 -40.837 94.931  1.00   72.48  ? 512  ARG C NH2   1 
ATOM   7634  N  N     . VAL C 2  513  ? -6.712  -43.001 95.215  1.00   62.42  ? 513  VAL C N     1 
ATOM   7635  C  CA    . VAL C 2  513  ? -5.622  -42.067 94.945  1.00   61.70  ? 513  VAL C CA    1 
ATOM   7636  C  C     . VAL C 2  513  ? -5.878  -41.234 93.687  1.00   59.41  ? 513  VAL C C     1 
ATOM   7637  O  O     . VAL C 2  513  ? -6.305  -41.757 92.652  1.00   56.67  ? 513  VAL C O     1 
ATOM   7638  C  CB    . VAL C 2  513  ? -4.251  -42.794 94.870  1.00   61.51  ? 513  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C 2  513  ? -4.437  -44.255 94.503  1.00   61.26  ? 513  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C 2  513  ? -3.320  -42.113 93.879  1.00   60.21  ? 513  VAL C CG2   1 
ATOM   7641  N  N     . VAL C 2  514  ? -5.633  -39.930 93.801  1.00   58.33  ? 514  VAL C N     1 
ATOM   7642  C  CA    . VAL C 2  514  ? -5.815  -38.997 92.696  1.00   54.64  ? 514  VAL C CA    1 
ATOM   7643  C  C     . VAL C 2  514  ? -4.656  -39.098 91.712  1.00   51.80  ? 514  VAL C C     1 
ATOM   7644  O  O     . VAL C 2  514  ? -3.494  -38.959 92.092  1.00   51.94  ? 514  VAL C O     1 
ATOM   7645  C  CB    . VAL C 2  514  ? -5.909  -37.547 93.201  1.00   56.18  ? 514  VAL C CB    1 
ATOM   7646  C  CG1   . VAL C 2  514  ? -6.224  -36.606 92.050  1.00   55.97  ? 514  VAL C CG1   1 
ATOM   7647  C  CG2   . VAL C 2  514  ? -6.962  -37.433 94.291  1.00   51.62  ? 514  VAL C CG2   1 
ATOM   7648  N  N     . ALA C 2  515  ? -4.979  -39.334 90.446  1.00   48.68  ? 515  ALA C N     1 
ATOM   7649  C  CA    . ALA C 2  515  ? -3.958  -39.539 89.426  1.00   48.56  ? 515  ALA C CA    1 
ATOM   7650  C  C     . ALA C 2  515  ? -4.360  -38.932 88.088  1.00   43.41  ? 515  ALA C C     1 
ATOM   7651  O  O     . ALA C 2  515  ? -5.506  -38.537 87.895  1.00   46.80  ? 515  ALA C O     1 
ATOM   7652  C  CB    . ALA C 2  515  ? -3.652  -41.019 89.268  1.00   49.91  ? 515  ALA C CB    1 
ATOM   7653  N  N     . ARG C 2  516  ? -3.401  -38.845 87.174  1.00   42.19  ? 516  ARG C N     1 
ATOM   7654  C  CA    . ARG C 2  516  ? -3.649  -38.297 85.849  1.00   42.80  ? 516  ARG C CA    1 
ATOM   7655  C  C     . ARG C 2  516  ? -3.474  -39.353 84.762  1.00   44.97  ? 516  ARG C C     1 
ATOM   7656  O  O     . ARG C 2  516  ? -2.519  -40.135 84.784  1.00   50.54  ? 516  ARG C O     1 
ATOM   7657  C  CB    . ARG C 2  516  ? -2.713  -37.116 85.577  1.00   50.57  ? 516  ARG C CB    1 
ATOM   7658  C  CG    . ARG C 2  516  ? -2.791  -36.011 86.619  1.00   56.50  ? 516  ARG C CG    1 
ATOM   7659  C  CD    . ARG C 2  516  ? -1.811  -34.883 86.327  1.00   48.31  ? 516  ARG C CD    1 
ATOM   7660  N  NE    . ARG C 2  516  ? -0.425  -35.340 86.321  1.00   42.61  ? 516  ARG C NE    1 
ATOM   7661  C  CZ    . ARG C 2  516  ? 0.319   -35.455 85.226  1.00   44.21  ? 516  ARG C CZ    1 
ATOM   7662  N  NH1   . ARG C 2  516  ? -0.189  -35.138 84.042  1.00   42.11  ? 516  ARG C NH1   1 
ATOM   7663  N  NH2   . ARG C 2  516  ? 1.571   -35.880 85.313  1.00   47.33  ? 516  ARG C NH2   1 
ATOM   7664  N  N     . ARG C 2  517  ? -4.410  -39.371 83.819  1.00   44.58  ? 517  ARG C N     1 
ATOM   7665  C  CA    . ARG C 2  517  ? -4.286  -40.189 82.621  1.00   44.54  ? 517  ARG C CA    1 
ATOM   7666  C  C     . ARG C 2  517  ? -4.420  -39.282 81.406  1.00   50.55  ? 517  ARG C C     1 
ATOM   7667  O  O     . ARG C 2  517  ? -5.497  -38.747 81.138  1.00   47.63  ? 517  ARG C O     1 
ATOM   7668  C  CB    . ARG C 2  517  ? -5.362  -41.275 82.595  1.00   44.55  ? 517  ARG C CB    1 
ATOM   7669  C  CG    . ARG C 2  517  ? -5.190  -42.346 83.662  1.00   54.25  ? 517  ARG C CG    1 
ATOM   7670  C  CD    . ARG C 2  517  ? -6.350  -43.332 83.663  1.00   57.25  ? 517  ARG C CD    1 
ATOM   7671  N  NE    . ARG C 2  517  ? -6.120  -44.445 84.582  1.00   56.88  ? 517  ARG C NE    1 
ATOM   7672  C  CZ    . ARG C 2  517  ? -7.019  -45.383 84.861  1.00   64.91  ? 517  ARG C CZ    1 
ATOM   7673  N  NH1   . ARG C 2  517  ? -8.219  -45.345 84.297  1.00   68.78  ? 517  ARG C NH1   1 
ATOM   7674  N  NH2   . ARG C 2  517  ? -6.720  -46.359 85.709  1.00   69.21  ? 517  ARG C NH2   1 
ATOM   7675  N  N     . LYS C 2  518  ? -3.321  -39.131 80.670  1.00   52.69  ? 518  LYS C N     1 
ATOM   7676  C  CA    . LYS C 2  518  ? -3.231  -38.172 79.568  1.00   47.74  ? 518  LYS C CA    1 
ATOM   7677  C  C     . LYS C 2  518  ? -3.665  -36.769 79.989  1.00   46.53  ? 518  LYS C C     1 
ATOM   7678  O  O     . LYS C 2  518  ? -4.316  -36.055 79.227  1.00   49.88  ? 518  LYS C O     1 
ATOM   7679  C  CB    . LYS C 2  518  ? -4.030  -38.645 78.349  1.00   44.20  ? 518  LYS C CB    1 
ATOM   7680  C  CG    . LYS C 2  518  ? -3.358  -39.761 77.563  1.00   48.34  ? 518  LYS C CG    1 
ATOM   7681  C  CD    . LYS C 2  518  ? -4.112  -40.066 76.276  1.00   56.34  ? 518  LYS C CD    1 
ATOM   7682  C  CE    . LYS C 2  518  ? -3.392  -41.115 75.439  1.00   52.68  ? 518  LYS C CE    1 
ATOM   7683  N  NZ    . LYS C 2  518  ? -3.301  -42.431 76.133  1.00   63.16  ? 518  LYS C NZ    1 
ATOM   7684  N  N     . GLY C 2  519  ? -3.307  -36.386 81.210  1.00   46.05  ? 519  GLY C N     1 
ATOM   7685  C  CA    . GLY C 2  519  ? -3.616  -35.062 81.719  1.00   52.29  ? 519  GLY C CA    1 
ATOM   7686  C  C     . GLY C 2  519  ? -4.964  -34.983 82.411  1.00   53.57  ? 519  GLY C C     1 
ATOM   7687  O  O     . GLY C 2  519  ? -5.213  -34.070 83.198  1.00   51.56  ? 519  GLY C O     1 
ATOM   7688  N  N     . GLU C 2  520  ? -5.833  -35.944 82.118  1.00   51.57  ? 520  GLU C N     1 
ATOM   7689  C  CA    . GLU C 2  520  ? -7.182  -35.959 82.673  1.00   52.38  ? 520  GLU C CA    1 
ATOM   7690  C  C     . GLU C 2  520  ? -7.176  -36.473 84.111  1.00   49.12  ? 520  GLU C C     1 
ATOM   7691  O  O     . GLU C 2  520  ? -6.564  -37.501 84.399  1.00   49.35  ? 520  GLU C O     1 
ATOM   7692  C  CB    . GLU C 2  520  ? -8.097  -36.832 81.811  1.00   58.77  ? 520  GLU C CB    1 
ATOM   7693  C  CG    . GLU C 2  520  ? -9.564  -36.437 81.859  1.00   69.52  ? 520  GLU C CG    1 
ATOM   7694  C  CD    . GLU C 2  520  ? -9.837  -35.132 81.134  1.00   83.46  ? 520  GLU C CD    1 
ATOM   7695  O  OE1   . GLU C 2  520  ? -10.724 -34.376 81.582  1.00   87.09  ? 520  GLU C OE1   1 
ATOM   7696  O  OE2   . GLU C 2  520  ? -9.166  -34.865 80.113  1.00   75.64  ? 520  GLU C OE2   1 
ATOM   7697  N  N     . PRO C 2  521  ? -7.848  -35.749 85.021  1.00   48.20  ? 521  PRO C N     1 
ATOM   7698  C  CA    . PRO C 2  521  ? -7.969  -36.164 86.424  1.00   41.54  ? 521  PRO C CA    1 
ATOM   7699  C  C     . PRO C 2  521  ? -8.821  -37.422 86.575  1.00   47.38  ? 521  PRO C C     1 
ATOM   7700  O  O     . PRO C 2  521  ? -9.901  -37.506 85.989  1.00   45.42  ? 521  PRO C O     1 
ATOM   7701  C  CB    . PRO C 2  521  ? -8.679  -34.975 87.082  1.00   35.99  ? 521  PRO C CB    1 
ATOM   7702  C  CG    . PRO C 2  521  ? -8.466  -33.828 86.151  1.00   49.20  ? 521  PRO C CG    1 
ATOM   7703  C  CD    . PRO C 2  521  ? -8.457  -34.431 84.785  1.00   54.41  ? 521  PRO C CD    1 
ATOM   7704  N  N     . VAL C 2  522  ? -8.334  -38.385 87.353  1.00   53.01  ? 522  VAL C N     1 
ATOM   7705  C  CA    . VAL C 2  522  ? -9.068  -39.623 87.602  1.00   54.50  ? 522  VAL C CA    1 
ATOM   7706  C  C     . VAL C 2  522  ? -8.732  -40.206 88.981  1.00   56.56  ? 522  VAL C C     1 
ATOM   7707  O  O     . VAL C 2  522  ? -7.593  -40.114 89.447  1.00   49.64  ? 522  VAL C O     1 
ATOM   7708  C  CB    . VAL C 2  522  ? -8.803  -40.668 86.487  1.00   47.69  ? 522  VAL C CB    1 
ATOM   7709  C  CG1   . VAL C 2  522  ? -7.341  -41.088 86.478  1.00   45.20  ? 522  VAL C CG1   1 
ATOM   7710  C  CG2   . VAL C 2  522  ? -9.718  -41.877 86.644  1.00   63.75  ? 522  VAL C CG2   1 
ATOM   7711  N  N     . ILE C 2  523  ? -9.734  -40.790 89.635  1.00   53.28  ? 523  ILE C N     1 
ATOM   7712  C  CA    . ILE C 2  523  ? -9.534  -41.450 90.919  1.00   50.78  ? 523  ILE C CA    1 
ATOM   7713  C  C     . ILE C 2  523  ? -9.314  -42.941 90.696  1.00   50.50  ? 523  ILE C C     1 
ATOM   7714  O  O     . ILE C 2  523  ? -10.153 -43.616 90.099  1.00   45.86  ? 523  ILE C O     1 
ATOM   7715  C  CB    . ILE C 2  523  ? -10.741 -41.251 91.851  1.00   47.12  ? 523  ILE C CB    1 
ATOM   7716  C  CG1   . ILE C 2  523  ? -11.054 -39.763 92.008  1.00   45.81  ? 523  ILE C CG1   1 
ATOM   7717  C  CG2   . ILE C 2  523  ? -10.475 -41.883 93.206  1.00   56.57  ? 523  ILE C CG2   1 
ATOM   7718  C  CD1   . ILE C 2  523  ? -9.938  -38.970 92.645  1.00   45.58  ? 523  ILE C CD1   1 
ATOM   7719  N  N     . VAL C 2  524  ? -8.185  -43.456 91.177  1.00   54.35  ? 524  VAL C N     1 
ATOM   7720  C  CA    . VAL C 2  524  ? -7.811  -44.842 90.897  1.00   55.27  ? 524  VAL C CA    1 
ATOM   7721  C  C     . VAL C 2  524  ? -7.391  -45.616 92.142  1.00   57.08  ? 524  VAL C C     1 
ATOM   7722  O  O     . VAL C 2  524  ? -7.201  -45.039 93.212  1.00   57.97  ? 524  VAL C O     1 
ATOM   7723  C  CB    . VAL C 2  524  ? -6.669  -44.922 89.863  1.00   56.04  ? 524  VAL C CB    1 
ATOM   7724  C  CG1   . VAL C 2  524  ? -7.131  -44.396 88.513  1.00   57.15  ? 524  VAL C CG1   1 
ATOM   7725  C  CG2   . VAL C 2  524  ? -5.454  -44.152 90.356  1.00   53.09  ? 524  VAL C CG2   1 
ATOM   7726  N  N     . SER C 2  525  ? -7.269  -46.931 91.992  1.00   56.51  ? 525  SER C N     1 
ATOM   7727  C  CA    . SER C 2  525  ? -6.785  -47.797 93.061  1.00   60.10  ? 525  SER C CA    1 
ATOM   7728  C  C     . SER C 2  525  ? -5.261  -47.850 93.021  1.00   60.33  ? 525  SER C C     1 
ATOM   7729  O  O     . SER C 2  525  ? -4.664  -47.621 91.970  1.00   63.79  ? 525  SER C O     1 
ATOM   7730  C  CB    . SER C 2  525  ? -7.360  -49.207 92.902  1.00   66.34  ? 525  SER C CB    1 
ATOM   7731  O  OG    . SER C 2  525  ? -8.776  -49.189 92.908  1.00   86.24  ? 525  SER C OG    1 
ATOM   7732  N  N     . PRO C 2  526  ? -4.625  -48.146 94.169  1.00   54.57  ? 526  PRO C N     1 
ATOM   7733  C  CA    . PRO C 2  526  ? -3.164  -48.274 94.235  1.00   53.50  ? 526  PRO C CA    1 
ATOM   7734  C  C     . PRO C 2  526  ? -2.605  -49.318 93.265  1.00   57.19  ? 526  PRO C C     1 
ATOM   7735  O  O     . PRO C 2  526  ? -1.457  -49.196 92.837  1.00   54.79  ? 526  PRO C O     1 
ATOM   7736  C  CB    . PRO C 2  526  ? -2.921  -48.712 95.680  1.00   50.59  ? 526  PRO C CB    1 
ATOM   7737  C  CG    . PRO C 2  526  ? -4.061  -48.133 96.432  1.00   49.82  ? 526  PRO C CG    1 
ATOM   7738  C  CD    . PRO C 2  526  ? -5.240  -48.226 95.506  1.00   53.70  ? 526  PRO C CD    1 
ATOM   7739  N  N     . GLU C 2  527  ? -3.404  -50.326 92.926  1.00   62.96  ? 527  GLU C N     1 
ATOM   7740  C  CA    . GLU C 2  527  ? -2.977  -51.349 91.974  1.00   64.71  ? 527  GLU C CA    1 
ATOM   7741  C  C     . GLU C 2  527  ? -2.814  -50.774 90.570  1.00   64.07  ? 527  GLU C C     1 
ATOM   7742  O  O     . GLU C 2  527  ? -2.007  -51.263 89.780  1.00   65.48  ? 527  GLU C O     1 
ATOM   7743  C  CB    . GLU C 2  527  ? -3.965  -52.520 91.939  1.00   55.35  ? 527  GLU C CB    1 
ATOM   7744  C  CG    . GLU C 2  527  ? -4.006  -53.360 93.205  1.00   50.76  ? 527  GLU C CG    1 
ATOM   7745  C  CD    . GLU C 2  527  ? -4.974  -52.816 94.235  1.00   69.16  ? 527  GLU C CD    1 
ATOM   7746  O  OE1   . GLU C 2  527  ? -5.745  -51.894 93.896  1.00   73.08  ? 527  GLU C OE1   1 
ATOM   7747  O  OE2   . GLU C 2  527  ? -4.969  -53.312 95.382  1.00   77.00  ? 527  GLU C OE2   1 
ATOM   7748  N  N     . GLU C 2  528  ? -3.583  -49.733 90.266  1.00   61.68  ? 528  GLU C N     1 
ATOM   7749  C  CA    . GLU C 2  528  ? -3.598  -49.158 88.926  1.00   59.25  ? 528  GLU C CA    1 
ATOM   7750  C  C     . GLU C 2  528  ? -2.498  -48.121 88.714  1.00   62.71  ? 528  GLU C C     1 
ATOM   7751  O  O     . GLU C 2  528  ? -2.223  -47.732 87.579  1.00   63.53  ? 528  GLU C O     1 
ATOM   7752  C  CB    . GLU C 2  528  ? -4.954  -48.509 88.643  1.00   59.82  ? 528  GLU C CB    1 
ATOM   7753  C  CG    . GLU C 2  528  ? -6.145  -49.267 89.193  1.00   56.85  ? 528  GLU C CG    1 
ATOM   7754  C  CD    . GLU C 2  528  ? -7.449  -48.529 88.963  1.00   59.46  ? 528  GLU C CD    1 
ATOM   7755  O  OE1   . GLU C 2  528  ? -8.217  -48.360 89.933  1.00   60.30  ? 528  GLU C OE1   1 
ATOM   7756  O  OE2   . GLU C 2  528  ? -7.705  -48.118 87.811  1.00   55.28  ? 528  GLU C OE2   1 
ATOM   7757  N  N     . VAL C 2  529  ? -1.868  -47.677 89.799  1.00   61.88  ? 529  VAL C N     1 
ATOM   7758  C  CA    . VAL C 2  529  ? -0.909  -46.580 89.704  1.00   52.57  ? 529  VAL C CA    1 
ATOM   7759  C  C     . VAL C 2  529  ? 0.450   -47.056 89.209  1.00   52.20  ? 529  VAL C C     1 
ATOM   7760  O  O     . VAL C 2  529  ? 1.131   -47.836 89.874  1.00   56.97  ? 529  VAL C O     1 
ATOM   7761  C  CB    . VAL C 2  529  ? -0.723  -45.885 91.068  1.00   55.36  ? 529  VAL C CB    1 
ATOM   7762  C  CG1   . VAL C 2  529  ? 0.420   -44.886 91.007  1.00   55.08  ? 529  VAL C CG1   1 
ATOM   7763  C  CG2   . VAL C 2  529  ? -2.014  -45.207 91.501  1.00   59.12  ? 529  VAL C CG2   1 
ATOM   7764  N  N     . GLU C 2  530  ? 0.834   -46.573 88.032  1.00   51.00  ? 530  GLU C N     1 
ATOM   7765  C  CA    . GLU C 2  530  ? 2.132   -46.882 87.443  1.00   56.67  ? 530  GLU C CA    1 
ATOM   7766  C  C     . GLU C 2  530  ? 3.259   -45.973 87.939  1.00   61.53  ? 530  GLU C C     1 
ATOM   7767  O  O     . GLU C 2  530  ? 4.368   -46.436 88.211  1.00   65.74  ? 530  GLU C O     1 
ATOM   7768  C  CB    . GLU C 2  530  ? 2.036   -46.868 85.915  1.00   52.68  ? 530  GLU C CB    1 
ATOM   7769  C  CG    . GLU C 2  530  ? 1.196   -48.013 85.363  1.00   55.19  ? 530  GLU C CG    1 
ATOM   7770  C  CD    . GLU C 2  530  ? 0.743   -47.783 83.935  1.00   60.13  ? 530  GLU C CD    1 
ATOM   7771  O  OE1   . GLU C 2  530  ? -0.100  -46.888 83.717  1.00   63.15  ? 530  GLU C OE1   1 
ATOM   7772  O  OE2   . GLU C 2  530  ? 1.226   -48.499 83.033  1.00   54.57  ? 530  GLU C OE2   1 
ATOM   7773  N  N     . PHE C 2  531  ? 2.968   -44.680 88.049  1.00   55.41  ? 531  PHE C N     1 
ATOM   7774  C  CA    . PHE C 2  531  ? 3.971   -43.694 88.446  1.00   48.42  ? 531  PHE C CA    1 
ATOM   7775  C  C     . PHE C 2  531  ? 3.403   -42.643 89.396  1.00   51.35  ? 531  PHE C C     1 
ATOM   7776  O  O     . PHE C 2  531  ? 2.190   -42.551 89.576  1.00   57.62  ? 531  PHE C O     1 
ATOM   7777  C  CB    . PHE C 2  531  ? 4.579   -43.016 87.216  1.00   51.17  ? 531  PHE C CB    1 
ATOM   7778  C  CG    . PHE C 2  531  ? 5.329   -43.955 86.315  1.00   57.45  ? 531  PHE C CG    1 
ATOM   7779  C  CD1   . PHE C 2  531  ? 4.710   -44.523 85.213  1.00   54.82  ? 531  PHE C CD1   1 
ATOM   7780  C  CD2   . PHE C 2  531  ? 6.652   -44.271 86.571  1.00   61.50  ? 531  PHE C CD2   1 
ATOM   7781  C  CE1   . PHE C 2  531  ? 5.398   -45.388 84.384  1.00   51.57  ? 531  PHE C CE1   1 
ATOM   7782  C  CE2   . PHE C 2  531  ? 7.346   -45.136 85.745  1.00   64.48  ? 531  PHE C CE2   1 
ATOM   7783  C  CZ    . PHE C 2  531  ? 6.717   -45.695 84.650  1.00   60.25  ? 531  PHE C CZ    1 
ATOM   7784  N  N     . MET C 2  532  ? 4.284   -41.853 90.003  1.00   52.27  ? 532  MET C N     1 
ATOM   7785  C  CA    . MET C 2  532  ? 3.862   -40.817 90.946  1.00   51.83  ? 532  MET C CA    1 
ATOM   7786  C  C     . MET C 2  532  ? 4.750   -39.575 90.855  1.00   47.65  ? 532  MET C C     1 
ATOM   7787  O  O     . MET C 2  532  ? 5.952   -39.686 90.650  1.00   48.32  ? 532  MET C O     1 
ATOM   7788  C  CB    . MET C 2  532  ? 3.871   -41.372 92.372  1.00   47.60  ? 532  MET C CB    1 
ATOM   7789  C  CG    . MET C 2  532  ? 3.547   -40.356 93.449  1.00   41.63  ? 532  MET C CG    1 
ATOM   7790  S  SD    . MET C 2  532  ? 3.788   -41.033 95.099  1.00   54.44  ? 532  MET C SD    1 
ATOM   7791  C  CE    . MET C 2  532  ? 3.565   -39.567 96.104  1.00   64.10  ? 532  MET C CE    1 
ATOM   7792  N  N     . ASP C 2  533  ? 4.154   -38.397 91.013  1.00   47.27  ? 533  ASP C N     1 
ATOM   7793  C  CA    . ASP C 2  533  ? 4.898   -37.140 90.939  1.00   45.08  ? 533  ASP C CA    1 
ATOM   7794  C  C     . ASP C 2  533  ? 6.051   -37.079 91.939  1.00   44.94  ? 533  ASP C C     1 
ATOM   7795  O  O     . ASP C 2  533  ? 5.965   -37.621 93.042  1.00   46.27  ? 533  ASP C O     1 
ATOM   7796  C  CB    . ASP C 2  533  ? 3.963   -35.948 91.153  1.00   49.26  ? 533  ASP C CB    1 
ATOM   7797  C  CG    . ASP C 2  533  ? 3.016   -35.731 89.990  1.00   52.82  ? 533  ASP C CG    1 
ATOM   7798  O  OD1   . ASP C 2  533  ? 2.779   -36.688 89.223  1.00   49.83  ? 533  ASP C OD1   1 
ATOM   7799  O  OD2   . ASP C 2  533  ? 2.507   -34.600 89.845  1.00   53.60  ? 533  ASP C OD2   1 
ATOM   7800  N  N     . VAL C 2  534  ? 7.131   -36.416 91.536  1.00   42.02  ? 534  VAL C N     1 
ATOM   7801  C  CA    . VAL C 2  534  ? 8.314   -36.268 92.374  1.00   38.67  ? 534  VAL C CA    1 
ATOM   7802  C  C     . VAL C 2  534  ? 8.077   -35.257 93.487  1.00   42.87  ? 534  VAL C C     1 
ATOM   7803  O  O     . VAL C 2  534  ? 8.491   -35.465 94.629  1.00   55.11  ? 534  VAL C O     1 
ATOM   7804  C  CB    . VAL C 2  534  ? 9.532   -35.817 91.541  1.00   42.27  ? 534  VAL C CB    1 
ATOM   7805  C  CG1   . VAL C 2  534  ? 10.712  -35.476 92.441  1.00   40.08  ? 534  VAL C CG1   1 
ATOM   7806  C  CG2   . VAL C 2  534  ? 9.913   -36.891 90.534  1.00   50.29  ? 534  VAL C CG2   1 
ATOM   7807  N  N     . SER C 2  535  ? 7.374   -34.179 93.150  1.00   45.40  ? 535  SER C N     1 
ATOM   7808  C  CA    . SER C 2  535  ? 7.192   -33.050 94.054  1.00   48.07  ? 535  SER C CA    1 
ATOM   7809  C  C     . SER C 2  535  ? 6.270   -32.021 93.410  1.00   44.33  ? 535  SER C C     1 
ATOM   7810  O  O     . SER C 2  535  ? 6.202   -31.930 92.186  1.00   48.56  ? 535  SER C O     1 
ATOM   7811  C  CB    . SER C 2  535  ? 8.548   -32.403 94.359  1.00   47.26  ? 535  SER C CB    1 
ATOM   7812  O  OG    . SER C 2  535  ? 8.443   -31.409 95.362  1.00   49.78  ? 535  SER C OG    1 
ATOM   7813  N  N     . PRO C 2  536  ? 5.539   -31.250 94.231  1.00   44.43  ? 536  PRO C N     1 
ATOM   7814  C  CA    . PRO C 2  536  ? 4.724   -30.155 93.694  1.00   43.73  ? 536  PRO C CA    1 
ATOM   7815  C  C     . PRO C 2  536  ? 5.581   -29.065 93.054  1.00   42.56  ? 536  PRO C C     1 
ATOM   7816  O  O     . PRO C 2  536  ? 5.065   -28.240 92.301  1.00   46.32  ? 536  PRO C O     1 
ATOM   7817  C  CB    . PRO C 2  536  ? 4.009   -29.608 94.937  1.00   44.78  ? 536  PRO C CB    1 
ATOM   7818  C  CG    . PRO C 2  536  ? 4.833   -30.066 96.093  1.00   47.53  ? 536  PRO C CG    1 
ATOM   7819  C  CD    . PRO C 2  536  ? 5.357   -31.405 95.683  1.00   56.08  ? 536  PRO C CD    1 
ATOM   7820  N  N     . LYS C 2  537  ? 6.876   -29.065 93.353  1.00   42.10  ? 537  LYS C N     1 
ATOM   7821  C  CA    . LYS C 2  537  ? 7.787   -28.053 92.830  1.00   43.89  ? 537  LYS C CA    1 
ATOM   7822  C  C     . LYS C 2  537  ? 8.003   -28.182 91.322  1.00   44.81  ? 537  LYS C C     1 
ATOM   7823  O  O     . LYS C 2  537  ? 8.304   -27.198 90.647  1.00   41.73  ? 537  LYS C O     1 
ATOM   7824  C  CB    . LYS C 2  537  ? 9.135   -28.125 93.553  1.00   41.30  ? 537  LYS C CB    1 
ATOM   7825  C  CG    . LYS C 2  537  ? 9.024   -28.223 95.066  1.00   47.91  ? 537  LYS C CG    1 
ATOM   7826  C  CD    . LYS C 2  537  ? 10.392  -28.249 95.729  1.00   46.14  ? 537  LYS C CD    1 
ATOM   7827  C  CE    . LYS C 2  537  ? 10.278  -28.580 97.211  1.00   53.93  ? 537  LYS C CE    1 
ATOM   7828  N  NZ    . LYS C 2  537  ? 9.372   -27.644 97.935  1.00   49.06  ? 537  LYS C NZ    1 
ATOM   7829  N  N     . GLN C 2  538  ? 7.840   -29.395 90.798  1.00   46.63  ? 538  GLN C N     1 
ATOM   7830  C  CA    . GLN C 2  538  ? 8.171   -29.679 89.402  1.00   49.23  ? 538  GLN C CA    1 
ATOM   7831  C  C     . GLN C 2  538  ? 7.227   -29.014 88.404  1.00   48.41  ? 538  GLN C C     1 
ATOM   7832  O  O     . GLN C 2  538  ? 7.533   -28.927 87.216  1.00   52.52  ? 538  GLN C O     1 
ATOM   7833  C  CB    . GLN C 2  538  ? 8.212   -31.190 89.148  1.00   45.45  ? 538  GLN C CB    1 
ATOM   7834  C  CG    . GLN C 2  538  ? 6.853   -31.870 89.122  1.00   42.16  ? 538  GLN C CG    1 
ATOM   7835  C  CD    . GLN C 2  538  ? 6.960   -33.367 88.898  1.00   43.16  ? 538  GLN C CD    1 
ATOM   7836  O  OE1   . GLN C 2  538  ? 6.569   -34.164 89.751  1.00   48.74  ? 538  GLN C OE1   1 
ATOM   7837  N  NE2   . GLN C 2  538  ? 7.490   -33.757 87.743  1.00   40.65  ? 538  GLN C NE2   1 
ATOM   7838  N  N     . VAL C 2  539  ? 6.084   -28.546 88.889  1.00   39.75  ? 539  VAL C N     1 
ATOM   7839  C  CA    . VAL C 2  539  ? 5.062   -27.974 88.022  1.00   42.56  ? 539  VAL C CA    1 
ATOM   7840  C  C     . VAL C 2  539  ? 5.356   -26.514 87.659  1.00   40.10  ? 539  VAL C C     1 
ATOM   7841  O  O     . VAL C 2  539  ? 4.854   -25.999 86.659  1.00   41.87  ? 539  VAL C O     1 
ATOM   7842  C  CB    . VAL C 2  539  ? 3.666   -28.111 88.668  1.00   42.77  ? 539  VAL C CB    1 
ATOM   7843  C  CG1   . VAL C 2  539  ? 2.564   -27.717 87.693  1.00   45.71  ? 539  VAL C CG1   1 
ATOM   7844  C  CG2   . VAL C 2  539  ? 3.455   -29.538 89.148  1.00   44.62  ? 539  VAL C CG2   1 
ATOM   7845  N  N     . PHE C 2  540  ? 6.198   -25.856 88.450  1.00   35.01  ? 540  PHE C N     1 
ATOM   7846  C  CA    . PHE C 2  540  ? 6.386   -24.415 88.302  1.00   37.33  ? 540  PHE C CA    1 
ATOM   7847  C  C     . PHE C 2  540  ? 7.832   -23.986 88.064  1.00   36.35  ? 540  PHE C C     1 
ATOM   7848  O  O     . PHE C 2  540  ? 8.772   -24.730 88.344  1.00   37.77  ? 540  PHE C O     1 
ATOM   7849  C  CB    . PHE C 2  540  ? 5.824   -23.691 89.527  1.00   41.45  ? 540  PHE C CB    1 
ATOM   7850  C  CG    . PHE C 2  540  ? 4.417   -24.086 89.864  1.00   41.56  ? 540  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C 2  540  ? 4.168   -25.155 90.707  1.00   41.05  ? 540  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C 2  540  ? 3.343   -23.396 89.331  1.00   42.90  ? 540  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C 2  540  ? 2.877   -25.525 91.014  1.00   39.65  ? 540  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C 2  540  ? 2.047   -23.762 89.636  1.00   43.43  ? 540  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C 2  540  ? 1.815   -24.827 90.480  1.00   40.27  ? 540  PHE C CZ    1 
ATOM   7856  N  N     . SER C 2  541  ? 7.993   -22.772 87.544  1.00   31.27  ? 541  SER C N     1 
ATOM   7857  C  CA    . SER C 2  541  ? 9.309   -22.187 87.315  1.00   32.29  ? 541  SER C CA    1 
ATOM   7858  C  C     . SER C 2  541  ? 9.989   -21.861 88.635  1.00   34.33  ? 541  SER C C     1 
ATOM   7859  O  O     . SER C 2  541  ? 9.335   -21.793 89.676  1.00   40.98  ? 541  SER C O     1 
ATOM   7860  C  CB    . SER C 2  541  ? 9.201   -20.918 86.468  1.00   37.44  ? 541  SER C CB    1 
ATOM   7861  O  OG    . SER C 2  541  ? 8.463   -19.917 87.145  1.00   35.32  ? 541  SER C OG    1 
ATOM   7862  N  N     . VAL C 2  542  ? 11.304  -21.678 88.584  1.00   31.21  ? 542  VAL C N     1 
ATOM   7863  C  CA    . VAL C 2  542  ? 12.088  -21.338 89.767  1.00   29.95  ? 542  VAL C CA    1 
ATOM   7864  C  C     . VAL C 2  542  ? 11.535  -20.112 90.499  1.00   37.32  ? 542  VAL C C     1 
ATOM   7865  O  O     . VAL C 2  542  ? 11.422  -20.113 91.726  1.00   42.54  ? 542  VAL C O     1 
ATOM   7866  C  CB    . VAL C 2  542  ? 13.563  -21.100 89.403  1.00   28.07  ? 542  VAL C CB    1 
ATOM   7867  C  CG1   . VAL C 2  542  ? 14.378  -20.817 90.653  1.00   30.52  ? 542  VAL C CG1   1 
ATOM   7868  C  CG2   . VAL C 2  542  ? 14.121  -22.304 88.661  1.00   31.23  ? 542  VAL C CG2   1 
ATOM   7869  N  N     . ASN C 2  543  ? 11.181  -19.076 89.746  1.00   35.76  ? 543  ASN C N     1 
ATOM   7870  C  CA    . ASN C 2  543  ? 10.594  -17.873 90.330  1.00   30.19  ? 543  ASN C CA    1 
ATOM   7871  C  C     . ASN C 2  543  ? 9.275   -18.150 91.038  1.00   27.49  ? 543  ASN C C     1 
ATOM   7872  O  O     . ASN C 2  543  ? 9.058   -17.698 92.161  1.00   27.69  ? 543  ASN C O     1 
ATOM   7873  C  CB    . ASN C 2  543  ? 10.381  -16.807 89.258  1.00   31.99  ? 543  ASN C CB    1 
ATOM   7874  C  CG    . ASN C 2  543  ? 11.678  -16.283 88.701  1.00   33.04  ? 543  ASN C CG    1 
ATOM   7875  O  OD1   . ASN C 2  543  ? 12.418  -17.011 88.041  1.00   36.95  ? 543  ASN C OD1   1 
ATOM   7876  N  ND2   . ASN C 2  543  ? 11.963  -15.012 88.957  1.00   29.77  ? 543  ASN C ND2   1 
ATOM   7877  N  N     . THR C 2  544  ? 8.398   -18.890 90.366  1.00   29.42  ? 544  THR C N     1 
ATOM   7878  C  CA    . THR C 2  544  ? 7.096   -19.245 90.918  1.00   31.16  ? 544  THR C CA    1 
ATOM   7879  C  C     . THR C 2  544  ? 7.262   -20.055 92.199  1.00   37.09  ? 544  THR C C     1 
ATOM   7880  O  O     . THR C 2  544  ? 6.508   -19.886 93.159  1.00   36.27  ? 544  THR C O     1 
ATOM   7881  C  CB    . THR C 2  544  ? 6.265   -20.060 89.911  1.00   27.76  ? 544  THR C CB    1 
ATOM   7882  O  OG1   . THR C 2  544  ? 6.180   -19.349 88.670  1.00   29.18  ? 544  THR C OG1   1 
ATOM   7883  C  CG2   . THR C 2  544  ? 4.864   -20.303 90.444  1.00   27.63  ? 544  THR C CG2   1 
ATOM   7884  N  N     . ASN C 2  545  ? 8.268   -20.924 92.210  1.00   35.66  ? 545  ASN C N     1 
ATOM   7885  C  CA    . ASN C 2  545  ? 8.562   -21.750 93.376  1.00   35.18  ? 545  ASN C CA    1 
ATOM   7886  C  C     . ASN C 2  545  ? 9.068   -20.957 94.579  1.00   34.16  ? 545  ASN C C     1 
ATOM   7887  O  O     . ASN C 2  545  ? 9.237   -21.511 95.661  1.00   35.75  ? 545  ASN C O     1 
ATOM   7888  C  CB    . ASN C 2  545  ? 9.555   -22.857 93.020  1.00   34.67  ? 545  ASN C CB    1 
ATOM   7889  C  CG    . ASN C 2  545  ? 8.931   -23.953 92.182  1.00   35.30  ? 545  ASN C CG    1 
ATOM   7890  O  OD1   . ASN C 2  545  ? 8.213   -24.809 92.697  1.00   34.54  ? 545  ASN C OD1   1 
ATOM   7891  N  ND2   . ASN C 2  545  ? 9.208   -23.937 90.885  1.00   37.70  ? 545  ASN C ND2   1 
ATOM   7892  N  N     . LEU C 2  546  ? 9.322   -19.667 94.383  1.00   32.77  ? 546  LEU C N     1 
ATOM   7893  C  CA    . LEU C 2  546  ? 9.787   -18.806 95.465  1.00   32.32  ? 546  LEU C CA    1 
ATOM   7894  C  C     . LEU C 2  546  ? 8.638   -18.108 96.191  1.00   31.68  ? 546  LEU C C     1 
ATOM   7895  O  O     . LEU C 2  546  ? 8.863   -17.305 97.098  1.00   28.74  ? 546  LEU C O     1 
ATOM   7896  C  CB    . LEU C 2  546  ? 10.780  -17.771 94.934  1.00   29.42  ? 546  LEU C CB    1 
ATOM   7897  C  CG    . LEU C 2  546  ? 12.142  -18.333 94.536  1.00   27.38  ? 546  LEU C CG    1 
ATOM   7898  C  CD1   . LEU C 2  546  ? 13.058  -17.228 94.047  1.00   22.95  ? 546  LEU C CD1   1 
ATOM   7899  C  CD2   . LEU C 2  546  ? 12.763  -19.067 95.713  1.00   34.68  ? 546  LEU C CD2   1 
ATOM   7900  N  N     . ILE C 2  547  ? 7.410   -18.418 95.789  1.00   29.04  ? 547  ILE C N     1 
ATOM   7901  C  CA    . ILE C 2  547  ? 6.232   -17.815 96.402  1.00   32.44  ? 547  ILE C CA    1 
ATOM   7902  C  C     . ILE C 2  547  ? 5.611   -18.720 97.464  1.00   32.92  ? 547  ILE C C     1 
ATOM   7903  O  O     . ILE C 2  547  ? 5.000   -19.738 97.138  1.00   34.04  ? 547  ILE C O     1 
ATOM   7904  C  CB    . ILE C 2  547  ? 5.157   -17.498 95.350  1.00   26.11  ? 547  ILE C CB    1 
ATOM   7905  C  CG1   . ILE C 2  547  ? 5.754   -16.688 94.202  1.00   23.83  ? 547  ILE C CG1   1 
ATOM   7906  C  CG2   . ILE C 2  547  ? 3.993   -16.757 95.988  1.00   29.65  ? 547  ILE C CG2   1 
ATOM   7907  C  CD1   . ILE C 2  547  ? 4.754   -16.357 93.122  1.00   29.04  ? 547  ILE C CD1   1 
ATOM   7908  N  N     . PRO C 2  548  ? 5.752   -18.343 98.743  1.00   24.40  ? 548  PRO C N     1 
ATOM   7909  C  CA    . PRO C 2  548  ? 5.162   -19.115 99.840  1.00   28.23  ? 548  PRO C CA    1 
ATOM   7910  C  C     . PRO C 2  548  ? 3.640   -19.071 99.785  1.00   30.39  ? 548  PRO C C     1 
ATOM   7911  O  O     . PRO C 2  548  ? 3.088   -18.101 99.269  1.00   27.75  ? 548  PRO C O     1 
ATOM   7912  C  CB    . PRO C 2  548  ? 5.671   -18.389 101.088 1.00   28.51  ? 548  PRO C CB    1 
ATOM   7913  C  CG    . PRO C 2  548  ? 5.954   -17.004 100.628 1.00   25.51  ? 548  PRO C CG    1 
ATOM   7914  C  CD    . PRO C 2  548  ? 6.454   -17.143 99.226  1.00   24.96  ? 548  PRO C CD    1 
ATOM   7915  N  N     . PHE C 2  549  ? 2.986   -20.108 100.306 1.00   34.15  ? 549  PHE C N     1 
ATOM   7916  C  CA    . PHE C 2  549  ? 1.527   -20.208 100.295 1.00   33.77  ? 549  PHE C CA    1 
ATOM   7917  C  C     . PHE C 2  549  ? 0.952   -19.973 98.902  1.00   29.65  ? 549  PHE C C     1 
ATOM   7918  O  O     . PHE C 2  549  ? -0.078  -19.317 98.751  1.00   31.06  ? 549  PHE C O     1 
ATOM   7919  C  CB    . PHE C 2  549  ? 0.904   -19.228 101.294 1.00   33.27  ? 549  PHE C CB    1 
ATOM   7920  C  CG    . PHE C 2  549  ? 1.382   -19.412 102.704 1.00   32.76  ? 549  PHE C CG    1 
ATOM   7921  C  CD1   . PHE C 2  549  ? 0.882   -20.435 103.492 1.00   38.98  ? 549  PHE C CD1   1 
ATOM   7922  C  CD2   . PHE C 2  549  ? 2.329   -18.558 103.245 1.00   34.94  ? 549  PHE C CD2   1 
ATOM   7923  C  CE1   . PHE C 2  549  ? 1.321   -20.607 104.793 1.00   44.02  ? 549  PHE C CE1   1 
ATOM   7924  C  CE2   . PHE C 2  549  ? 2.772   -18.722 104.544 1.00   35.00  ? 549  PHE C CE2   1 
ATOM   7925  C  CZ    . PHE C 2  549  ? 2.267   -19.748 105.319 1.00   40.31  ? 549  PHE C CZ    1 
ATOM   7926  N  N     . LEU C 2  550  ? 1.632   -20.506 97.893  1.00   28.72  ? 550  LEU C N     1 
ATOM   7927  C  CA    . LEU C 2  550  ? 1.237   -20.320 96.500  1.00   33.43  ? 550  LEU C CA    1 
ATOM   7928  C  C     . LEU C 2  550  ? -0.167  -20.852 96.225  1.00   34.46  ? 550  LEU C C     1 
ATOM   7929  O  O     . LEU C 2  550  ? -0.883  -20.331 95.368  1.00   32.60  ? 550  LEU C O     1 
ATOM   7930  C  CB    . LEU C 2  550  ? 2.246   -20.998 95.570  1.00   32.26  ? 550  LEU C CB    1 
ATOM   7931  C  CG    . LEU C 2  550  ? 1.951   -20.951 94.070  1.00   28.76  ? 550  LEU C CG    1 
ATOM   7932  C  CD1   . LEU C 2  550  ? 1.981   -19.519 93.561  1.00   29.72  ? 550  LEU C CD1   1 
ATOM   7933  C  CD2   . LEU C 2  550  ? 2.932   -21.821 93.304  1.00   35.68  ? 550  LEU C CD2   1 
ATOM   7934  N  N     . GLU C 2  551  ? -0.558  -21.885 96.965  1.00   35.66  ? 551  GLU C N     1 
ATOM   7935  C  CA    . GLU C 2  551  ? -1.864  -22.509 96.784  1.00   37.60  ? 551  GLU C CA    1 
ATOM   7936  C  C     . GLU C 2  551  ? -3.014  -21.572 97.149  1.00   33.77  ? 551  GLU C C     1 
ATOM   7937  O  O     . GLU C 2  551  ? -4.148  -21.770 96.713  1.00   33.22  ? 551  GLU C O     1 
ATOM   7938  C  CB    . GLU C 2  551  ? -1.959  -23.812 97.588  1.00   38.77  ? 551  GLU C CB    1 
ATOM   7939  C  CG    . GLU C 2  551  ? -1.708  -23.667 99.084  1.00   37.81  ? 551  GLU C CG    1 
ATOM   7940  C  CD    . GLU C 2  551  ? -0.233  -23.717 99.446  1.00   38.74  ? 551  GLU C CD    1 
ATOM   7941  O  OE1   . GLU C 2  551  ? 0.094   -23.598 100.646 1.00   43.92  ? 551  GLU C OE1   1 
ATOM   7942  O  OE2   . GLU C 2  551  ? 0.598   -23.878 98.530  1.00   40.99  ? 551  GLU C OE2   1 
ATOM   7943  N  N     . HIS C 2  552  ? -2.717  -20.551 97.947  1.00   32.86  ? 552  HIS C N     1 
ATOM   7944  C  CA    . HIS C 2  552  ? -3.735  -19.604 98.393  1.00   34.90  ? 552  HIS C CA    1 
ATOM   7945  C  C     . HIS C 2  552  ? -3.799  -18.338 97.532  1.00   36.51  ? 552  HIS C C     1 
ATOM   7946  O  O     . HIS C 2  552  ? -4.592  -17.436 97.809  1.00   36.04  ? 552  HIS C O     1 
ATOM   7947  C  CB    . HIS C 2  552  ? -3.513  -19.236 99.863  1.00   35.18  ? 552  HIS C CB    1 
ATOM   7948  C  CG    . HIS C 2  552  ? -3.485  -20.418 100.783 1.00   35.79  ? 552  HIS C CG    1 
ATOM   7949  N  ND1   . HIS C 2  552  ? -4.626  -20.966 101.327 1.00   35.64  ? 552  HIS C ND1   1 
ATOM   7950  C  CD2   . HIS C 2  552  ? -2.452  -21.155 101.255 1.00   33.98  ? 552  HIS C CD2   1 
ATOM   7951  C  CE1   . HIS C 2  552  ? -4.298  -21.991 102.094 1.00   36.01  ? 552  HIS C CE1   1 
ATOM   7952  N  NE2   . HIS C 2  552  ? -2.985  -22.126 102.068 1.00   33.65  ? 552  HIS C NE2   1 
ATOM   7953  N  N     . ASP C 2  553  ? -2.966  -18.275 96.496  1.00   34.19  ? 553  ASP C N     1 
ATOM   7954  C  CA    . ASP C 2  553  ? -2.929  -17.118 95.601  1.00   26.17  ? 553  ASP C CA    1 
ATOM   7955  C  C     . ASP C 2  553  ? -3.513  -17.443 94.230  1.00   26.33  ? 553  ASP C C     1 
ATOM   7956  O  O     . ASP C 2  553  ? -3.174  -18.465 93.634  1.00   28.63  ? 553  ASP C O     1 
ATOM   7957  C  CB    . ASP C 2  553  ? -1.493  -16.609 95.428  1.00   23.14  ? 553  ASP C CB    1 
ATOM   7958  C  CG    . ASP C 2  553  ? -0.940  -15.967 96.686  1.00   24.45  ? 553  ASP C CG    1 
ATOM   7959  O  OD1   . ASP C 2  553  ? 0.299   -15.948 96.853  1.00   17.91  ? 553  ASP C OD1   1 
ATOM   7960  O  OD2   . ASP C 2  553  ? -1.742  -15.479 97.508  1.00   29.81  ? 553  ASP C OD2   1 
ATOM   7961  N  N     . ASP C 2  554  ? -4.384  -16.570 93.733  1.00   25.52  ? 554  ASP C N     1 
ATOM   7962  C  CA    . ASP C 2  554  ? -4.932  -16.716 92.387  1.00   25.27  ? 554  ASP C CA    1 
ATOM   7963  C  C     . ASP C 2  554  ? -3.806  -16.671 91.361  1.00   24.40  ? 554  ASP C C     1 
ATOM   7964  O  O     . ASP C 2  554  ? -2.869  -15.886 91.499  1.00   27.56  ? 554  ASP C O     1 
ATOM   7965  C  CB    . ASP C 2  554  ? -5.968  -15.624 92.106  1.00   26.90  ? 554  ASP C CB    1 
ATOM   7966  C  CG    . ASP C 2  554  ? -6.392  -15.577 90.647  1.00   29.97  ? 554  ASP C CG    1 
ATOM   7967  O  OD1   . ASP C 2  554  ? -6.953  -16.578 90.153  1.00   32.03  ? 554  ASP C OD1   1 
ATOM   7968  O  OD2   . ASP C 2  554  ? -6.176  -14.532 89.998  1.00   29.55  ? 554  ASP C OD2   1 
ATOM   7969  N  N     . ALA C 2  555  ? -3.904  -17.518 90.339  1.00   26.01  ? 555  ALA C N     1 
ATOM   7970  C  CA    . ALA C 2  555  ? -2.841  -17.683 89.345  1.00   32.61  ? 555  ALA C CA    1 
ATOM   7971  C  C     . ALA C 2  555  ? -2.387  -16.375 88.689  1.00   29.16  ? 555  ALA C C     1 
ATOM   7972  O  O     . ALA C 2  555  ? -1.191  -16.161 88.471  1.00   24.95  ? 555  ALA C O     1 
ATOM   7973  C  CB    . ALA C 2  555  ? -3.262  -18.693 88.282  1.00   24.68  ? 555  ALA C CB    1 
ATOM   7974  N  N     . ASN C 2  556  ? -3.347  -15.507 88.383  1.00   29.82  ? 556  ASN C N     1 
ATOM   7975  C  CA    . ASN C 2  556  ? -3.054  -14.237 87.725  1.00   29.44  ? 556  ASN C CA    1 
ATOM   7976  C  C     . ASN C 2  556  ? -2.167  -13.321 88.565  1.00   28.90  ? 556  ASN C C     1 
ATOM   7977  O  O     . ASN C 2  556  ? -1.342  -12.583 88.026  1.00   32.39  ? 556  ASN C O     1 
ATOM   7978  C  CB    . ASN C 2  556  ? -4.351  -13.518 87.343  1.00   30.71  ? 556  ASN C CB    1 
ATOM   7979  C  CG    . ASN C 2  556  ? -5.191  -14.311 86.359  1.00   30.72  ? 556  ASN C CG    1 
ATOM   7980  O  OD1   . ASN C 2  556  ? -5.049  -14.163 85.145  1.00   29.50  ? 556  ASN C OD1   1 
ATOM   7981  N  ND2   . ASN C 2  556  ? -6.073  -15.159 86.879  1.00   29.60  ? 556  ASN C ND2   1 
ATOM   7982  N  N     . ARG C 2  557  ? -2.345  -13.364 89.881  1.00   24.52  ? 557  ARG C N     1 
ATOM   7983  C  CA    . ARG C 2  557  ? -1.512  -12.580 90.787  1.00   26.77  ? 557  ARG C CA    1 
ATOM   7984  C  C     . ARG C 2  557  ? -0.172  -13.268 91.039  1.00   29.03  ? 557  ARG C C     1 
ATOM   7985  O  O     . ARG C 2  557  ? 0.851   -12.607 91.242  1.00   30.73  ? 557  ARG C O     1 
ATOM   7986  C  CB    . ARG C 2  557  ? -2.240  -12.315 92.107  1.00   31.66  ? 557  ARG C CB    1 
ATOM   7987  C  CG    . ARG C 2  557  ? -2.191  -10.859 92.548  1.00   30.51  ? 557  ARG C CG    1 
ATOM   7988  C  CD    . ARG C 2  557  ? -2.928  -9.956  91.567  1.00   24.88  ? 557  ARG C CD    1 
ATOM   7989  N  NE    . ARG C 2  557  ? -2.474  -8.572  91.657  1.00   21.86  ? 557  ARG C NE    1 
ATOM   7990  C  CZ    . ARG C 2  557  ? -2.981  -7.570  90.946  1.00   26.66  ? 557  ARG C CZ    1 
ATOM   7991  N  NH1   . ARG C 2  557  ? -3.973  -7.795  90.094  1.00   26.29  ? 557  ARG C NH1   1 
ATOM   7992  N  NH2   . ARG C 2  557  ? -2.501  -6.341  91.094  1.00   27.72  ? 557  ARG C NH2   1 
ATOM   7993  N  N     . ALA C 2  558  ? -0.187  -14.598 91.027  1.00   29.53  ? 558  ALA C N     1 
ATOM   7994  C  CA    . ALA C 2  558  ? 1.032   -15.386 91.176  1.00   27.69  ? 558  ALA C CA    1 
ATOM   7995  C  C     . ALA C 2  558  ? 1.970   -15.110 90.012  1.00   31.20  ? 558  ALA C C     1 
ATOM   7996  O  O     . ALA C 2  558  ? 3.189   -15.147 90.163  1.00   37.92  ? 558  ALA C O     1 
ATOM   7997  C  CB    . ALA C 2  558  ? 0.707   -16.866 91.248  1.00   24.69  ? 558  ALA C CB    1 
ATOM   7998  N  N     . LEU C 2  559  ? 1.386   -14.842 88.849  1.00   29.92  ? 559  LEU C N     1 
ATOM   7999  C  CA    . LEU C 2  559  ? 2.150   -14.443 87.675  1.00   30.65  ? 559  LEU C CA    1 
ATOM   8000  C  C     . LEU C 2  559  ? 2.966   -13.187 87.970  1.00   30.85  ? 559  LEU C C     1 
ATOM   8001  O  O     . LEU C 2  559  ? 4.169   -13.135 87.710  1.00   32.41  ? 559  LEU C O     1 
ATOM   8002  C  CB    . LEU C 2  559  ? 1.201   -14.199 86.497  1.00   27.03  ? 559  LEU C CB    1 
ATOM   8003  C  CG    . LEU C 2  559  ? 1.759   -13.700 85.165  1.00   20.80  ? 559  LEU C CG    1 
ATOM   8004  C  CD1   . LEU C 2  559  ? 0.941   -14.280 84.033  1.00   24.41  ? 559  LEU C CD1   1 
ATOM   8005  C  CD2   . LEU C 2  559  ? 1.733   -12.184 85.097  1.00   23.23  ? 559  LEU C CD2   1 
ATOM   8006  N  N     . MET C 2  560  ? 2.297   -12.177 88.515  1.00   30.60  ? 560  MET C N     1 
ATOM   8007  C  CA    . MET C 2  560  ? 2.935   -10.904 88.819  1.00   27.90  ? 560  MET C CA    1 
ATOM   8008  C  C     . MET C 2  560  ? 3.990   -11.062 89.905  1.00   27.76  ? 560  MET C C     1 
ATOM   8009  O  O     . MET C 2  560  ? 5.100   -10.540 89.782  1.00   28.40  ? 560  MET C O     1 
ATOM   8010  C  CB    . MET C 2  560  ? 1.887   -9.876  89.243  1.00   24.88  ? 560  MET C CB    1 
ATOM   8011  C  CG    . MET C 2  560  ? 0.733   -9.755  88.266  1.00   25.07  ? 560  MET C CG    1 
ATOM   8012  S  SD    . MET C 2  560  ? -0.434  -8.465  88.722  1.00   23.33  ? 560  MET C SD    1 
ATOM   8013  C  CE    . MET C 2  560  ? -1.682  -8.680  87.456  1.00   28.93  ? 560  MET C CE    1 
ATOM   8014  N  N     . GLY C 2  561  ? 3.641   -11.789 90.963  1.00   27.21  ? 561  GLY C N     1 
ATOM   8015  C  CA    . GLY C 2  561  ? 4.576   -12.055 92.042  1.00   29.12  ? 561  GLY C CA    1 
ATOM   8016  C  C     . GLY C 2  561  ? 5.819   -12.771 91.546  1.00   30.02  ? 561  GLY C C     1 
ATOM   8017  O  O     . GLY C 2  561  ? 6.927   -12.540 92.030  1.00   28.02  ? 561  GLY C O     1 
ATOM   8018  N  N     . SER C 2  562  ? 5.628   -13.642 90.562  1.00   27.17  ? 562  SER C N     1 
ATOM   8019  C  CA    . SER C 2  562  ? 6.730   -14.382 89.973  1.00   27.56  ? 562  SER C CA    1 
ATOM   8020  C  C     . SER C 2  562  ? 7.610   -13.448 89.145  1.00   31.46  ? 562  SER C C     1 
ATOM   8021  O  O     . SER C 2  562  ? 8.833   -13.436 89.294  1.00   32.77  ? 562  SER C O     1 
ATOM   8022  C  CB    . SER C 2  562  ? 6.190   -15.522 89.106  1.00   28.48  ? 562  SER C CB    1 
ATOM   8023  O  OG    . SER C 2  562  ? 7.226   -16.387 88.679  1.00   38.62  ? 562  SER C OG    1 
ATOM   8024  N  N     . ASN C 2  563  ? 6.978   -12.655 88.284  1.00   28.43  ? 563  ASN C N     1 
ATOM   8025  C  CA    . ASN C 2  563  ? 7.699   -11.752 87.390  1.00   28.81  ? 563  ASN C CA    1 
ATOM   8026  C  C     . ASN C 2  563  ? 8.466   -10.648 88.107  1.00   28.92  ? 563  ASN C C     1 
ATOM   8027  O  O     . ASN C 2  563  ? 9.509   -10.196 87.633  1.00   32.41  ? 563  ASN C O     1 
ATOM   8028  C  CB    . ASN C 2  563  ? 6.737   -11.117 86.384  1.00   29.82  ? 563  ASN C CB    1 
ATOM   8029  C  CG    . ASN C 2  563  ? 6.328   -12.070 85.284  1.00   34.85  ? 563  ASN C CG    1 
ATOM   8030  O  OD1   . ASN C 2  563  ? 7.148   -12.825 84.760  1.00   46.12  ? 563  ASN C OD1   1 
ATOM   8031  N  ND2   . ASN C 2  563  ? 5.051   -12.040 84.924  1.00   35.06  ? 563  ASN C ND2   1 
ATOM   8032  N  N     . MET C 2  564  ? 7.942   -10.205 89.243  1.00   26.83  ? 564  MET C N     1 
ATOM   8033  C  CA    . MET C 2  564  ? 8.508   -9.048  89.927  1.00   28.42  ? 564  MET C CA    1 
ATOM   8034  C  C     . MET C 2  564  ? 9.736   -9.365  90.776  1.00   28.41  ? 564  MET C C     1 
ATOM   8035  O  O     . MET C 2  564  ? 10.502  -8.468  91.125  1.00   31.96  ? 564  MET C O     1 
ATOM   8036  C  CB    . MET C 2  564  ? 7.439   -8.327  90.749  1.00   23.23  ? 564  MET C CB    1 
ATOM   8037  C  CG    . MET C 2  564  ? 6.418   -7.614  89.885  1.00   20.80  ? 564  MET C CG    1 
ATOM   8038  S  SD    . MET C 2  564  ? 5.208   -6.699  90.840  1.00   20.76  ? 564  MET C SD    1 
ATOM   8039  C  CE    . MET C 2  564  ? 4.462   -8.016  91.794  1.00   31.59  ? 564  MET C CE    1 
ATOM   8040  N  N     . GLN C 2  565  ? 9.929   -10.637 91.103  1.00   27.91  ? 565  GLN C N     1 
ATOM   8041  C  CA    . GLN C 2  565  ? 11.117  -11.037 91.845  1.00   30.61  ? 565  GLN C CA    1 
ATOM   8042  C  C     . GLN C 2  565  ? 12.361  -10.831 90.986  1.00   33.34  ? 565  GLN C C     1 
ATOM   8043  O  O     . GLN C 2  565  ? 13.453  -10.593 91.498  1.00   37.30  ? 565  GLN C O     1 
ATOM   8044  C  CB    . GLN C 2  565  ? 11.005  -12.490 92.302  1.00   31.21  ? 565  GLN C CB    1 
ATOM   8045  C  CG    . GLN C 2  565  ? 9.943   -12.718 93.360  1.00   28.04  ? 565  GLN C CG    1 
ATOM   8046  C  CD    . GLN C 2  565  ? 9.891   -14.156 93.828  1.00   28.24  ? 565  GLN C CD    1 
ATOM   8047  O  OE1   . GLN C 2  565  ? 10.474  -14.506 94.853  1.00   30.00  ? 565  GLN C OE1   1 
ATOM   8048  N  NE2   . GLN C 2  565  ? 9.190   -14.999 93.077  1.00   28.46  ? 565  GLN C NE2   1 
ATOM   8049  N  N     . THR C 2  566  ? 12.179  -10.917 89.672  1.00   32.49  ? 566  THR C N     1 
ATOM   8050  C  CA    . THR C 2  566  ? 13.246  -10.650 88.719  1.00   32.44  ? 566  THR C CA    1 
ATOM   8051  C  C     . THR C 2  566  ? 13.659  -9.185  88.794  1.00   31.88  ? 566  THR C C     1 
ATOM   8052  O  O     . THR C 2  566  ? 14.809  -8.833  88.533  1.00   34.07  ? 566  THR C O     1 
ATOM   8053  C  CB    . THR C 2  566  ? 12.781  -10.956 87.285  1.00   35.81  ? 566  THR C CB    1 
ATOM   8054  O  OG1   . THR C 2  566  ? 12.199  -12.264 87.242  1.00   40.78  ? 566  THR C OG1   1 
ATOM   8055  C  CG2   . THR C 2  566  ? 13.943  -10.888 86.309  1.00   35.65  ? 566  THR C CG2   1 
ATOM   8056  N  N     . GLN C 2  567  ? 12.707  -8.335  89.162  1.00   32.35  ? 567  GLN C N     1 
ATOM   8057  C  CA    . GLN C 2  567  ? 12.928  -6.897  89.192  1.00   30.69  ? 567  GLN C CA    1 
ATOM   8058  C  C     . GLN C 2  567  ? 13.424  -6.420  90.553  1.00   30.30  ? 567  GLN C C     1 
ATOM   8059  O  O     . GLN C 2  567  ? 13.604  -5.221  90.769  1.00   32.25  ? 567  GLN C O     1 
ATOM   8060  C  CB    . GLN C 2  567  ? 11.640  -6.162  88.819  1.00   27.72  ? 567  GLN C CB    1 
ATOM   8061  C  CG    . GLN C 2  567  ? 11.014  -6.648  87.523  1.00   29.66  ? 567  GLN C CG    1 
ATOM   8062  C  CD    . GLN C 2  567  ? 9.773   -5.868  87.145  1.00   34.10  ? 567  GLN C CD    1 
ATOM   8063  O  OE1   . GLN C 2  567  ? 9.130   -5.249  87.993  1.00   37.25  ? 567  GLN C OE1   1 
ATOM   8064  N  NE2   . GLN C 2  567  ? 9.432   -5.888  85.863  1.00   45.85  ? 567  GLN C NE2   1 
ATOM   8065  N  N     . ALA C 2  568  ? 13.642  -7.358  91.468  1.00   30.72  ? 568  ALA C N     1 
ATOM   8066  C  CA    . ALA C 2  568  ? 14.082  -7.012  92.816  1.00   31.12  ? 568  ALA C CA    1 
ATOM   8067  C  C     . ALA C 2  568  ? 15.492  -6.431  92.817  1.00   28.68  ? 568  ALA C C     1 
ATOM   8068  O  O     . ALA C 2  568  ? 16.426  -7.032  92.286  1.00   30.31  ? 568  ALA C O     1 
ATOM   8069  C  CB    . ALA C 2  568  ? 14.002  -8.221  93.730  1.00   33.68  ? 568  ALA C CB    1 
ATOM   8070  N  N     . VAL C 2  569  ? 15.633  -5.258  93.422  1.00   24.97  ? 569  VAL C N     1 
ATOM   8071  C  CA    . VAL C 2  569  ? 16.914  -4.573  93.493  1.00   24.37  ? 569  VAL C CA    1 
ATOM   8072  C  C     . VAL C 2  569  ? 17.698  -5.014  94.722  1.00   34.95  ? 569  VAL C C     1 
ATOM   8073  O  O     . VAL C 2  569  ? 17.163  -5.020  95.832  1.00   43.30  ? 569  VAL C O     1 
ATOM   8074  C  CB    . VAL C 2  569  ? 16.714  -3.050  93.538  1.00   23.71  ? 569  VAL C CB    1 
ATOM   8075  C  CG1   . VAL C 2  569  ? 18.022  -2.347  93.842  1.00   26.95  ? 569  VAL C CG1   1 
ATOM   8076  C  CG2   . VAL C 2  569  ? 16.129  -2.561  92.226  1.00   28.63  ? 569  VAL C CG2   1 
ATOM   8077  N  N     . PRO C 2  570  ? 18.970  -5.403  94.525  1.00   32.98  ? 570  PRO C N     1 
ATOM   8078  C  CA    . PRO C 2  570  ? 19.826  -5.813  95.642  1.00   35.94  ? 570  PRO C CA    1 
ATOM   8079  C  C     . PRO C 2  570  ? 20.025  -4.668  96.623  1.00   39.43  ? 570  PRO C C     1 
ATOM   8080  O  O     . PRO C 2  570  ? 20.408  -3.567  96.221  1.00   34.62  ? 570  PRO C O     1 
ATOM   8081  C  CB    . PRO C 2  570  ? 21.155  -6.148  94.959  1.00   34.92  ? 570  PRO C CB    1 
ATOM   8082  C  CG    . PRO C 2  570  ? 20.796  -6.446  93.550  1.00   32.51  ? 570  PRO C CG    1 
ATOM   8083  C  CD    . PRO C 2  570  ? 19.657  -5.530  93.231  1.00   31.10  ? 570  PRO C CD    1 
ATOM   8084  N  N     . LEU C 2  571  ? 19.780  -4.938  97.900  1.00   35.66  ? 571  LEU C N     1 
ATOM   8085  C  CA    . LEU C 2  571  ? 19.883  -3.920  98.932  1.00   32.30  ? 571  LEU C CA    1 
ATOM   8086  C  C     . LEU C 2  571  ? 21.092  -4.211  99.804  1.00   34.39  ? 571  LEU C C     1 
ATOM   8087  O  O     . LEU C 2  571  ? 21.471  -5.368  99.978  1.00   39.61  ? 571  LEU C O     1 
ATOM   8088  C  CB    . LEU C 2  571  ? 18.614  -3.903  99.782  1.00   32.20  ? 571  LEU C CB    1 
ATOM   8089  C  CG    . LEU C 2  571  ? 17.301  -3.795  99.005  1.00   34.52  ? 571  LEU C CG    1 
ATOM   8090  C  CD1   . LEU C 2  571  ? 16.115  -4.046  99.922  1.00   39.26  ? 571  LEU C CD1   1 
ATOM   8091  C  CD2   . LEU C 2  571  ? 17.185  -2.434  98.337  1.00   33.61  ? 571  LEU C CD2   1 
ATOM   8092  N  N     . ILE C 2  572  ? 21.705  -3.160  100.338 1.00   34.54  ? 572  ILE C N     1 
ATOM   8093  C  CA    . ILE C 2  572  ? 22.870  -3.315  101.201 1.00   36.10  ? 572  ILE C CA    1 
ATOM   8094  C  C     . ILE C 2  572  ? 22.531  -4.123  102.455 1.00   39.58  ? 572  ILE C C     1 
ATOM   8095  O  O     . ILE C 2  572  ? 23.328  -4.940  102.919 1.00   45.18  ? 572  ILE C O     1 
ATOM   8096  C  CB    . ILE C 2  572  ? 23.469  -1.946  101.597 1.00   31.32  ? 572  ILE C CB    1 
ATOM   8097  C  CG1   . ILE C 2  572  ? 22.394  -1.034  102.193 1.00   32.37  ? 572  ILE C CG1   1 
ATOM   8098  C  CG2   . ILE C 2  572  ? 24.096  -1.277  100.388 1.00   33.10  ? 572  ILE C CG2   1 
ATOM   8099  C  CD1   . ILE C 2  572  ? 22.901  0.335   102.589 1.00   31.47  ? 572  ILE C CD1   1 
ATOM   8100  N  N     . ARG C 2  573  ? 21.342  -3.883  102.995 1.00   32.58  ? 573  ARG C N     1 
ATOM   8101  C  CA    . ARG C 2  573  ? 20.884  -4.547  104.208 1.00   32.73  ? 573  ARG C CA    1 
ATOM   8102  C  C     . ARG C 2  573  ? 19.987  -5.761  103.951 1.00   35.89  ? 573  ARG C C     1 
ATOM   8103  O  O     . ARG C 2  573  ? 19.412  -6.315  104.887 1.00   45.44  ? 573  ARG C O     1 
ATOM   8104  C  CB    . ARG C 2  573  ? 20.204  -3.542  105.140 1.00   38.54  ? 573  ARG C CB    1 
ATOM   8105  C  CG    . ARG C 2  573  ? 21.092  -2.357  105.495 1.00   39.71  ? 573  ARG C CG    1 
ATOM   8106  C  CD    . ARG C 2  573  ? 20.824  -1.860  106.906 1.00   44.02  ? 573  ARG C CD    1 
ATOM   8107  N  NE    . ARG C 2  573  ? 21.096  -2.891  107.904 1.00   44.38  ? 573  ARG C NE    1 
ATOM   8108  C  CZ    . ARG C 2  573  ? 20.856  -2.754  109.203 1.00   45.53  ? 573  ARG C CZ    1 
ATOM   8109  N  NH1   . ARG C 2  573  ? 20.338  -1.625  109.668 1.00   36.60  ? 573  ARG C NH1   1 
ATOM   8110  N  NH2   . ARG C 2  573  ? 21.134  -3.746  110.038 1.00   66.38  ? 573  ARG C NH2   1 
ATOM   8111  N  N     . ALA C 2  574  ? 19.866  -6.154  102.684 1.00   31.31  ? 574  ALA C N     1 
ATOM   8112  C  CA    . ALA C 2  574  ? 18.863  -7.131  102.244 1.00   34.02  ? 574  ALA C CA    1 
ATOM   8113  C  C     . ALA C 2  574  ? 18.806  -8.417  103.070 1.00   32.34  ? 574  ALA C C     1 
ATOM   8114  O  O     . ALA C 2  574  ? 19.835  -8.984  103.437 1.00   29.41  ? 574  ALA C O     1 
ATOM   8115  C  CB    . ALA C 2  574  ? 19.062  -7.462  100.766 1.00   33.46  ? 574  ALA C CB    1 
ATOM   8116  N  N     . GLN C 2  575  ? 17.585  -8.861  103.356 1.00   31.66  ? 575  GLN C N     1 
ATOM   8117  C  CA    . GLN C 2  575  ? 17.355  -10.038 104.185 1.00   31.26  ? 575  GLN C CA    1 
ATOM   8118  C  C     . GLN C 2  575  ? 16.646  -11.137 103.410 1.00   28.46  ? 575  GLN C C     1 
ATOM   8119  O  O     . GLN C 2  575  ? 15.912  -10.868 102.462 1.00   29.85  ? 575  GLN C O     1 
ATOM   8120  C  CB    . GLN C 2  575  ? 16.480  -9.679  105.384 1.00   36.56  ? 575  GLN C CB    1 
ATOM   8121  C  CG    . GLN C 2  575  ? 16.909  -8.458  106.163 1.00   38.00  ? 575  GLN C CG    1 
ATOM   8122  C  CD    . GLN C 2  575  ? 15.889  -8.080  107.217 1.00   41.48  ? 575  GLN C CD    1 
ATOM   8123  O  OE1   . GLN C 2  575  ? 14.876  -7.448  106.916 1.00   40.40  ? 575  GLN C OE1   1 
ATOM   8124  N  NE2   . GLN C 2  575  ? 16.142  -8.481  108.457 1.00   45.02  ? 575  GLN C NE2   1 
ATOM   8125  N  N     . ALA C 2  576  ? 16.860  -12.378 103.829 1.00   30.48  ? 576  ALA C N     1 
ATOM   8126  C  CA    . ALA C 2  576  ? 16.074  -13.495 103.328 1.00   32.89  ? 576  ALA C CA    1 
ATOM   8127  C  C     . ALA C 2  576  ? 14.678  -13.405 103.938 1.00   37.59  ? 576  ALA C C     1 
ATOM   8128  O  O     . ALA C 2  576  ? 14.520  -12.890 105.045 1.00   39.23  ? 576  ALA C O     1 
ATOM   8129  C  CB    . ALA C 2  576  ? 16.735  -14.809 103.698 1.00   37.94  ? 576  ALA C CB    1 
ATOM   8130  N  N     . PRO C 2  577  ? 13.658  -13.895 103.217 1.00   35.58  ? 577  PRO C N     1 
ATOM   8131  C  CA    . PRO C 2  577  ? 12.272  -13.840 103.699 1.00   36.72  ? 577  PRO C CA    1 
ATOM   8132  C  C     . PRO C 2  577  ? 12.058  -14.590 105.016 1.00   37.39  ? 577  PRO C C     1 
ATOM   8133  O  O     . PRO C 2  577  ? 12.676  -15.633 105.238 1.00   35.98  ? 577  PRO C O     1 
ATOM   8134  C  CB    . PRO C 2  577  ? 11.488  -14.524 102.575 1.00   31.58  ? 577  PRO C CB    1 
ATOM   8135  C  CG    . PRO C 2  577  ? 12.331  -14.350 101.366 1.00   28.25  ? 577  PRO C CG    1 
ATOM   8136  C  CD    . PRO C 2  577  ? 13.742  -14.446 101.853 1.00   30.53  ? 577  PRO C CD    1 
ATOM   8137  N  N     . VAL C 2  578  ? 11.194  -14.055 105.877 1.00   36.39  ? 578  VAL C N     1 
ATOM   8138  C  CA    . VAL C 2  578  ? 10.825  -14.726 107.122 1.00   36.80  ? 578  VAL C CA    1 
ATOM   8139  C  C     . VAL C 2  578  ? 10.119  -16.041 106.812 1.00   36.64  ? 578  VAL C C     1 
ATOM   8140  O  O     . VAL C 2  578  ? 10.366  -17.064 107.455 1.00   40.67  ? 578  VAL C O     1 
ATOM   8141  C  CB    . VAL C 2  578  ? 9.920   -13.837 108.000 1.00   32.46  ? 578  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C 2  578  ? 9.244   -14.659 109.083 1.00   35.76  ? 578  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C 2  578  ? 10.731  -12.718 108.627 1.00   34.08  ? 578  VAL C CG2   1 
ATOM   8144  N  N     . VAL C 2  579  ? 9.246   -16.008 105.812 1.00   31.00  ? 579  VAL C N     1 
ATOM   8145  C  CA    . VAL C 2  579  ? 8.612   -17.219 105.313 1.00   34.02  ? 579  VAL C CA    1 
ATOM   8146  C  C     . VAL C 2  579  ? 9.219   -17.597 103.961 1.00   37.27  ? 579  VAL C C     1 
ATOM   8147  O  O     . VAL C 2  579  ? 9.128   -16.837 102.996 1.00   34.80  ? 579  VAL C O     1 
ATOM   8148  C  CB    . VAL C 2  579  ? 7.092   -17.044 105.176 1.00   31.64  ? 579  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C 2  579  ? 6.450   -18.339 104.705 1.00   32.69  ? 579  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C 2  579  ? 6.495   -16.598 106.502 1.00   32.17  ? 579  VAL C CG2   1 
ATOM   8151  N  N     . MET C 2  580  ? 9.833   -18.775 103.902 1.00   38.76  ? 580  MET C N     1 
ATOM   8152  C  CA    . MET C 2  580  ? 10.547  -19.223 102.710 1.00   32.44  ? 580  MET C CA    1 
ATOM   8153  C  C     . MET C 2  580  ? 9.934   -20.491 102.136 1.00   32.13  ? 580  MET C C     1 
ATOM   8154  O  O     . MET C 2  580  ? 9.204   -21.205 102.821 1.00   38.58  ? 580  MET C O     1 
ATOM   8155  C  CB    . MET C 2  580  ? 12.016  -19.492 103.034 1.00   34.30  ? 580  MET C CB    1 
ATOM   8156  C  CG    . MET C 2  580  ? 12.806  -18.274 103.456 1.00   38.17  ? 580  MET C CG    1 
ATOM   8157  S  SD    . MET C 2  580  ? 14.530  -18.692 103.774 1.00   49.44  ? 580  MET C SD    1 
ATOM   8158  C  CE    . MET C 2  580  ? 14.347  -19.924 105.060 1.00   41.01  ? 580  MET C CE    1 
ATOM   8159  N  N     . THR C 2  581  ? 10.227  -20.760 100.869 1.00   28.28  ? 581  THR C N     1 
ATOM   8160  C  CA    . THR C 2  581  ? 9.790   -21.996 100.234 1.00   33.01  ? 581  THR C CA    1 
ATOM   8161  C  C     . THR C 2  581  ? 10.889  -23.051 100.285 1.00   38.87  ? 581  THR C C     1 
ATOM   8162  O  O     . THR C 2  581  ? 10.714  -24.167 99.795  1.00   41.83  ? 581  THR C O     1 
ATOM   8163  C  CB    . THR C 2  581  ? 9.383   -21.770 98.776  1.00   32.76  ? 581  THR C CB    1 
ATOM   8164  O  OG1   . THR C 2  581  ? 10.508  -21.276 98.038  1.00   35.88  ? 581  THR C OG1   1 
ATOM   8165  C  CG2   . THR C 2  581  ? 8.246   -20.767 98.694  1.00   31.83  ? 581  THR C CG2   1 
ATOM   8166  N  N     . GLY C 2  582  ? 12.025  -22.685 100.872 1.00   35.64  ? 582  GLY C N     1 
ATOM   8167  C  CA    . GLY C 2  582  ? 13.133  -23.609 101.036 1.00   38.47  ? 582  GLY C CA    1 
ATOM   8168  C  C     . GLY C 2  582  ? 14.007  -23.726 99.803  1.00   43.10  ? 582  GLY C C     1 
ATOM   8169  O  O     . GLY C 2  582  ? 14.984  -24.476 99.791  1.00   42.66  ? 582  GLY C O     1 
ATOM   8170  N  N     . LEU C 2  583  ? 13.649  -22.988 98.759  1.00   40.29  ? 583  LEU C N     1 
ATOM   8171  C  CA    . LEU C 2  583  ? 14.400  -23.009 97.512  1.00   33.13  ? 583  LEU C CA    1 
ATOM   8172  C  C     . LEU C 2  583  ? 15.397  -21.849 97.438  1.00   37.04  ? 583  LEU C C     1 
ATOM   8173  O  O     . LEU C 2  583  ? 16.167  -21.739 96.484  1.00   40.52  ? 583  LEU C O     1 
ATOM   8174  C  CB    . LEU C 2  583  ? 13.435  -22.978 96.324  1.00   28.98  ? 583  LEU C CB    1 
ATOM   8175  C  CG    . LEU C 2  583  ? 13.997  -23.367 94.958  1.00   30.63  ? 583  LEU C CG    1 
ATOM   8176  C  CD1   . LEU C 2  583  ? 14.966  -24.528 95.096  1.00   42.05  ? 583  LEU C CD1   1 
ATOM   8177  C  CD2   . LEU C 2  583  ? 12.877  -23.704 93.994  1.00   25.83  ? 583  LEU C CD2   1 
ATOM   8178  N  N     . GLU C 2  584  ? 15.392  -21.001 98.461  1.00   35.18  ? 584  GLU C N     1 
ATOM   8179  C  CA    . GLU C 2  584  ? 16.206  -19.787 98.472  1.00   34.02  ? 584  GLU C CA    1 
ATOM   8180  C  C     . GLU C 2  584  ? 17.717  -20.029 98.392  1.00   44.60  ? 584  GLU C C     1 
ATOM   8181  O  O     . GLU C 2  584  ? 18.449  -19.194 97.862  1.00   47.24  ? 584  GLU C O     1 
ATOM   8182  C  CB    . GLU C 2  584  ? 15.878  -18.929 99.699  1.00   39.13  ? 584  GLU C CB    1 
ATOM   8183  C  CG    . GLU C 2  584  ? 14.537  -18.204 99.626  1.00   46.58  ? 584  GLU C CG    1 
ATOM   8184  C  CD    . GLU C 2  584  ? 13.344  -19.119 99.854  1.00   45.30  ? 584  GLU C CD    1 
ATOM   8185  O  OE1   . GLU C 2  584  ? 12.201  -18.672 99.616  1.00   41.68  ? 584  GLU C OE1   1 
ATOM   8186  O  OE2   . GLU C 2  584  ? 13.543  -20.278 100.276 1.00   44.39  ? 584  GLU C OE2   1 
ATOM   8187  N  N     . GLU C 2  585  ? 18.181  -21.157 98.924  1.00   49.87  ? 585  GLU C N     1 
ATOM   8188  C  CA    . GLU C 2  585  ? 19.612  -21.476 98.922  1.00   44.54  ? 585  GLU C CA    1 
ATOM   8189  C  C     . GLU C 2  585  ? 20.118  -21.982 97.574  1.00   42.05  ? 585  GLU C C     1 
ATOM   8190  O  O     . GLU C 2  585  ? 21.172  -21.552 97.092  1.00   46.35  ? 585  GLU C O     1 
ATOM   8191  C  CB    . GLU C 2  585  ? 19.945  -22.487 100.022 1.00   59.03  ? 585  GLU C CB    1 
ATOM   8192  C  CG    . GLU C 2  585  ? 20.270  -21.852 101.365 1.00   72.74  ? 585  GLU C CG    1 
ATOM   8193  C  CD    . GLU C 2  585  ? 20.475  -22.876 102.467 1.00   80.57  ? 585  GLU C CD    1 
ATOM   8194  O  OE1   . GLU C 2  585  ? 19.502  -23.579 102.815 1.00   78.92  ? 585  GLU C OE1   1 
ATOM   8195  O  OE2   . GLU C 2  585  ? 21.607  -22.975 102.988 1.00   81.06  ? 585  GLU C OE2   1 
ATOM   8196  N  N     . ARG C 2  586  ? 19.368  -22.902 96.974  1.00   43.58  ? 586  ARG C N     1 
ATOM   8197  C  CA    . ARG C 2  586  ? 19.727  -23.456 95.672  1.00   51.26  ? 586  ARG C CA    1 
ATOM   8198  C  C     . ARG C 2  586  ? 19.831  -22.369 94.605  1.00   47.05  ? 586  ARG C C     1 
ATOM   8199  O  O     . ARG C 2  586  ? 20.702  -22.423 93.739  1.00   44.59  ? 586  ARG C O     1 
ATOM   8200  C  CB    . ARG C 2  586  ? 18.720  -24.524 95.233  1.00   48.73  ? 586  ARG C CB    1 
ATOM   8201  C  CG    . ARG C 2  586  ? 19.029  -25.924 95.736  1.00   49.13  ? 586  ARG C CG    1 
ATOM   8202  C  CD    . ARG C 2  586  ? 20.415  -26.374 95.294  1.00   52.10  ? 586  ARG C CD    1 
ATOM   8203  N  NE    . ARG C 2  586  ? 20.577  -26.344 93.842  1.00   42.02  ? 586  ARG C NE    1 
ATOM   8204  C  CZ    . ARG C 2  586  ? 20.336  -27.376 93.041  1.00   41.92  ? 586  ARG C CZ    1 
ATOM   8205  N  NH1   . ARG C 2  586  ? 19.918  -28.528 93.546  1.00   50.41  ? 586  ARG C NH1   1 
ATOM   8206  N  NH2   . ARG C 2  586  ? 20.513  -27.259 91.732  1.00   41.11  ? 586  ARG C NH2   1 
ATOM   8207  N  N     . VAL C 2  587  ? 18.940  -21.386 94.676  1.00   45.39  ? 587  VAL C N     1 
ATOM   8208  C  CA    . VAL C 2  587  ? 18.932  -20.291 93.715  1.00   38.24  ? 587  VAL C CA    1 
ATOM   8209  C  C     . VAL C 2  587  ? 20.228  -19.490 93.789  1.00   36.96  ? 587  VAL C C     1 
ATOM   8210  O  O     . VAL C 2  587  ? 20.830  -19.176 92.763  1.00   43.56  ? 587  VAL C O     1 
ATOM   8211  C  CB    . VAL C 2  587  ? 17.723  -19.358 93.928  1.00   38.57  ? 587  VAL C CB    1 
ATOM   8212  C  CG1   . VAL C 2  587  ? 17.816  -18.144 93.016  1.00   37.49  ? 587  VAL C CG1   1 
ATOM   8213  C  CG2   . VAL C 2  587  ? 16.425  -20.114 93.684  1.00   29.40  ? 587  VAL C CG2   1 
ATOM   8214  N  N     . VAL C 2  588  ? 20.661  -19.174 95.005  1.00   36.03  ? 588  VAL C N     1 
ATOM   8215  C  CA    . VAL C 2  588  ? 21.912  -18.452 95.201  1.00   42.07  ? 588  VAL C CA    1 
ATOM   8216  C  C     . VAL C 2  588  ? 23.089  -19.300 94.741  1.00   45.76  ? 588  VAL C C     1 
ATOM   8217  O  O     . VAL C 2  588  ? 24.036  -18.792 94.136  1.00   48.47  ? 588  VAL C O     1 
ATOM   8218  C  CB    . VAL C 2  588  ? 22.124  -18.062 96.678  1.00   43.23  ? 588  VAL C CB    1 
ATOM   8219  C  CG1   . VAL C 2  588  ? 23.432  -17.301 96.848  1.00   42.91  ? 588  VAL C CG1   1 
ATOM   8220  C  CG2   . VAL C 2  588  ? 20.963  -17.230 97.174  1.00   41.18  ? 588  VAL C CG2   1 
ATOM   8221  N  N     . ARG C 2  589  ? 23.019  -20.598 95.019  1.00   43.43  ? 589  ARG C N     1 
ATOM   8222  C  CA    . ARG C 2  589  ? 24.114  -21.502 94.685  1.00   48.60  ? 589  ARG C CA    1 
ATOM   8223  C  C     . ARG C 2  589  ? 24.321  -21.663 93.177  1.00   48.37  ? 589  ARG C C     1 
ATOM   8224  O  O     . ARG C 2  589  ? 25.441  -21.535 92.681  1.00   48.90  ? 589  ARG C O     1 
ATOM   8225  C  CB    . ARG C 2  589  ? 23.907  -22.868 95.345  1.00   49.88  ? 589  ARG C CB    1 
ATOM   8226  C  CG    . ARG C 2  589  ? 25.037  -23.852 95.092  1.00   53.22  ? 589  ARG C CG    1 
ATOM   8227  C  CD    . ARG C 2  589  ? 24.884  -25.108 95.933  1.00   59.96  ? 589  ARG C CD    1 
ATOM   8228  N  NE    . ARG C 2  589  ? 24.953  -24.820 97.363  1.00   64.94  ? 589  ARG C NE    1 
ATOM   8229  C  CZ    . ARG C 2  589  ? 26.086  -24.696 98.047  1.00   64.56  ? 589  ARG C CZ    1 
ATOM   8230  N  NH1   . ARG C 2  589  ? 27.254  -24.830 97.431  1.00   63.08  ? 589  ARG C NH1   1 
ATOM   8231  N  NH2   . ARG C 2  589  ? 26.053  -24.436 99.346  1.00   64.32  ? 589  ARG C NH2   1 
ATOM   8232  N  N     . ASP C 2  590  ? 23.240  -21.935 92.452  1.00   43.73  ? 590  ASP C N     1 
ATOM   8233  C  CA    . ASP C 2  590  ? 23.321  -22.210 91.019  1.00   40.28  ? 590  ASP C CA    1 
ATOM   8234  C  C     . ASP C 2  590  ? 23.576  -20.963 90.175  1.00   44.36  ? 590  ASP C C     1 
ATOM   8235  O  O     . ASP C 2  590  ? 24.041  -21.060 89.038  1.00   49.52  ? 590  ASP C O     1 
ATOM   8236  C  CB    . ASP C 2  590  ? 22.054  -22.920 90.534  1.00   38.49  ? 590  ASP C CB    1 
ATOM   8237  C  CG    . ASP C 2  590  ? 21.969  -24.355 91.015  1.00   40.46  ? 590  ASP C CG    1 
ATOM   8238  O  OD1   . ASP C 2  590  ? 22.476  -24.646 92.119  1.00   41.53  ? 590  ASP C OD1   1 
ATOM   8239  O  OD2   . ASP C 2  590  ? 21.396  -25.195 90.288  1.00   42.09  ? 590  ASP C OD2   1 
ATOM   8240  N  N     . SER C 2  591  ? 23.276  -19.793 90.731  1.00   44.51  ? 591  SER C N     1 
ATOM   8241  C  CA    . SER C 2  591  ? 23.463  -18.541 90.007  1.00   50.28  ? 591  SER C CA    1 
ATOM   8242  C  C     . SER C 2  591  ? 24.906  -18.067 90.111  1.00   50.29  ? 591  SER C C     1 
ATOM   8243  O  O     . SER C 2  591  ? 25.280  -17.052 89.522  1.00   57.07  ? 591  SER C O     1 
ATOM   8244  C  CB    . SER C 2  591  ? 22.531  -17.461 90.555  1.00   43.98  ? 591  SER C CB    1 
ATOM   8245  O  OG    . SER C 2  591  ? 22.908  -17.097 91.871  1.00   47.06  ? 591  SER C OG    1 
ATOM   8246  N  N     . LEU C 2  592  ? 25.702  -18.808 90.877  1.00   47.04  ? 592  LEU C N     1 
ATOM   8247  C  CA    . LEU C 2  592  ? 27.108  -18.489 91.114  1.00   49.97  ? 592  LEU C CA    1 
ATOM   8248  C  C     . LEU C 2  592  ? 27.290  -17.116 91.758  1.00   53.19  ? 592  LEU C C     1 
ATOM   8249  O  O     . LEU C 2  592  ? 28.348  -16.499 91.637  1.00   55.80  ? 592  LEU C O     1 
ATOM   8250  C  CB    . LEU C 2  592  ? 27.924  -18.595 89.823  1.00   39.36  ? 592  LEU C CB    1 
ATOM   8251  C  CG    . LEU C 2  592  ? 27.951  -19.980 89.175  1.00   40.37  ? 592  LEU C CG    1 
ATOM   8252  C  CD1   . LEU C 2  592  ? 28.862  -19.987 87.963  1.00   52.16  ? 592  LEU C CD1   1 
ATOM   8253  C  CD2   . LEU C 2  592  ? 28.392  -21.029 90.181  1.00   50.84  ? 592  LEU C CD2   1 
ATOM   8254  N  N     . ALA C 2  593  ? 26.244  -16.643 92.428  1.00   50.50  ? 593  ALA C N     1 
ATOM   8255  C  CA    . ALA C 2  593  ? 26.317  -15.418 93.213  1.00   56.62  ? 593  ALA C CA    1 
ATOM   8256  C  C     . ALA C 2  593  ? 27.357  -15.542 94.320  1.00   57.46  ? 593  ALA C C     1 
ATOM   8257  O  O     . ALA C 2  593  ? 28.398  -14.881 94.296  1.00   44.56  ? 593  ALA C O     1 
ATOM   8258  C  CB    . ALA C 2  593  ? 24.955  -15.090 93.804  1.00   57.26  ? 593  ALA C CB    1 
ATOM   8259  N  N     . ALA C 2  594  ? 27.055  -16.402 95.288  1.00   61.83  ? 594  ALA C N     1 
ATOM   8260  C  CA    . ALA C 2  594  ? 27.905  -16.605 96.456  1.00   63.06  ? 594  ALA C CA    1 
ATOM   8261  C  C     . ALA C 2  594  ? 29.149  -17.440 96.158  1.00   62.52  ? 594  ALA C C     1 
ATOM   8262  O  O     . ALA C 2  594  ? 29.193  -18.197 95.187  1.00   56.34  ? 594  ALA C O     1 
ATOM   8263  C  CB    . ALA C 2  594  ? 27.103  -17.235 97.587  1.00   58.15  ? 594  ALA C CB    1 
ATOM   8264  N  N     . LEU C 2  595  ? 30.156  -17.293 97.012  1.00   61.38  ? 595  LEU C N     1 
ATOM   8265  C  CA    . LEU C 2  595  ? 31.392  -18.052 96.898  1.00   54.51  ? 595  LEU C CA    1 
ATOM   8266  C  C     . LEU C 2  595  ? 31.393  -19.172 97.937  1.00   62.14  ? 595  LEU C C     1 
ATOM   8267  O  O     . LEU C 2  595  ? 31.024  -18.954 99.092  1.00   62.99  ? 595  LEU C O     1 
ATOM   8268  C  CB    . LEU C 2  595  ? 32.587  -17.125 97.112  1.00   44.74  ? 595  LEU C CB    1 
ATOM   8269  C  CG    . LEU C 2  595  ? 33.835  -17.355 96.260  1.00   56.97  ? 595  LEU C CG    1 
ATOM   8270  C  CD1   . LEU C 2  595  ? 34.763  -16.160 96.378  1.00   59.61  ? 595  LEU C CD1   1 
ATOM   8271  C  CD2   . LEU C 2  595  ? 34.555  -18.634 96.662  1.00   64.66  ? 595  LEU C CD2   1 
ATOM   8272  N  N     . TYR C 2  596  ? 31.805  -20.368 97.527  1.00   63.03  ? 596  TYR C N     1 
ATOM   8273  C  CA    . TYR C 2  596  ? 31.785  -21.526 98.417  1.00   63.65  ? 596  TYR C CA    1 
ATOM   8274  C  C     . TYR C 2  596  ? 33.150  -22.205 98.529  1.00   66.98  ? 596  TYR C C     1 
ATOM   8275  O  O     . TYR C 2  596  ? 34.038  -21.970 97.710  1.00   72.07  ? 596  TYR C O     1 
ATOM   8276  C  CB    . TYR C 2  596  ? 30.723  -22.532 97.962  1.00   66.92  ? 596  TYR C CB    1 
ATOM   8277  C  CG    . TYR C 2  596  ? 29.321  -21.964 97.931  1.00   63.62  ? 596  TYR C CG    1 
ATOM   8278  C  CD1   . TYR C 2  596  ? 28.783  -21.452 96.758  1.00   62.95  ? 596  TYR C CD1   1 
ATOM   8279  C  CD2   . TYR C 2  596  ? 28.536  -21.935 99.078  1.00   66.55  ? 596  TYR C CD2   1 
ATOM   8280  C  CE1   . TYR C 2  596  ? 27.502  -20.930 96.725  1.00   61.22  ? 596  TYR C CE1   1 
ATOM   8281  C  CE2   . TYR C 2  596  ? 27.255  -21.414 99.055  1.00   63.56  ? 596  TYR C CE2   1 
ATOM   8282  C  CZ    . TYR C 2  596  ? 26.743  -20.914 97.877  1.00   58.32  ? 596  TYR C CZ    1 
ATOM   8283  O  OH    . TYR C 2  596  ? 25.469  -20.395 97.850  1.00   49.20  ? 596  TYR C OH    1 
ATOM   8284  N  N     . ALA C 2  597  ? 33.311  -23.041 99.552  1.00   66.79  ? 597  ALA C N     1 
ATOM   8285  C  CA    . ALA C 2  597  ? 34.562  -23.764 99.771  1.00   69.42  ? 597  ALA C CA    1 
ATOM   8286  C  C     . ALA C 2  597  ? 34.702  -24.952 98.821  1.00   77.92  ? 597  ALA C C     1 
ATOM   8287  O  O     . ALA C 2  597  ? 33.789  -25.770 98.696  1.00   79.68  ? 597  ALA C O     1 
ATOM   8288  C  CB    . ALA C 2  597  ? 34.660  -24.226 101.216 1.00   76.09  ? 597  ALA C CB    1 
ATOM   8289  N  N     . GLU C 2  598  ? 35.855  -25.043 98.164  1.00   77.13  ? 598  GLU C N     1 
ATOM   8290  C  CA    . GLU C 2  598  ? 36.101  -26.072 97.156  1.00   75.81  ? 598  GLU C CA    1 
ATOM   8291  C  C     . GLU C 2  598  ? 36.301  -27.451 97.780  1.00   82.60  ? 598  GLU C C     1 
ATOM   8292  O  O     . GLU C 2  598  ? 35.946  -28.471 97.188  1.00   84.82  ? 598  GLU C O     1 
ATOM   8293  C  CB    . GLU C 2  598  ? 37.314  -25.691 96.304  1.00   74.92  ? 598  GLU C CB    1 
ATOM   8294  C  CG    . GLU C 2  598  ? 37.612  -26.646 95.164  1.00   82.00  ? 598  GLU C CG    1 
ATOM   8295  C  CD    . GLU C 2  598  ? 38.756  -26.165 94.295  1.00   91.90  ? 598  GLU C CD    1 
ATOM   8296  O  OE1   . GLU C 2  598  ? 39.025  -24.945 94.288  1.00   78.80  ? 598  GLU C OE1   1 
ATOM   8297  O  OE2   . GLU C 2  598  ? 39.389  -27.007 93.623  1.00   98.67  ? 598  GLU C OE2   1 
ATOM   8298  N  N     . GLU C 2  599  ? 36.875  -27.473 98.978  1.00   83.82  ? 599  GLU C N     1 
ATOM   8299  C  CA    . GLU C 2  599  ? 37.073  -28.710 99.722  1.00   86.14  ? 599  GLU C CA    1 
ATOM   8300  C  C     . GLU C 2  599  ? 37.067  -28.376 101.210 1.00   88.17  ? 599  GLU C C     1 
ATOM   8301  O  O     . GLU C 2  599  ? 36.846  -27.226 101.587 1.00   92.47  ? 599  GLU C O     1 
ATOM   8302  C  CB    . GLU C 2  599  ? 38.398  -29.367 99.326  1.00   89.70  ? 599  GLU C CB    1 
ATOM   8303  C  CG    . GLU C 2  599  ? 38.414  -30.885 99.451  1.00   96.18  ? 599  GLU C CG    1 
ATOM   8304  C  CD    . GLU C 2  599  ? 37.551  -31.568 98.407  1.00   99.45  ? 599  GLU C CD    1 
ATOM   8305  O  OE1   . GLU C 2  599  ? 37.396  -31.005 97.302  1.00   101.13 ? 599  GLU C OE1   1 
ATOM   8306  O  OE2   . GLU C 2  599  ? 37.026  -32.665 98.692  1.00   96.14  ? 599  GLU C OE2   1 
ATOM   8307  N  N     . ASP C 2  600  ? 37.300  -29.373 102.057 1.00   83.18  ? 600  ASP C N     1 
ATOM   8308  C  CA    . ASP C 2  600  ? 37.410  -29.126 103.488 1.00   75.45  ? 600  ASP C CA    1 
ATOM   8309  C  C     . ASP C 2  600  ? 38.739  -28.438 103.777 1.00   76.89  ? 600  ASP C C     1 
ATOM   8310  O  O     . ASP C 2  600  ? 39.723  -28.662 103.074 1.00   86.16  ? 600  ASP C O     1 
ATOM   8311  C  CB    . ASP C 2  600  ? 37.306  -30.432 104.276 1.00   77.12  ? 600  ASP C CB    1 
ATOM   8312  C  CG    . ASP C 2  600  ? 36.045  -31.209 103.953 1.00   81.57  ? 600  ASP C CG    1 
ATOM   8313  O  OD1   . ASP C 2  600  ? 35.673  -31.270 102.762 1.00   90.20  ? 600  ASP C OD1   1 
ATOM   8314  O  OD2   . ASP C 2  600  ? 35.423  -31.757 104.888 1.00   78.69  ? 600  ASP C OD2   1 
ATOM   8315  N  N     . GLY C 2  601  ? 38.766  -27.594 104.802 1.00   74.20  ? 601  GLY C N     1 
ATOM   8316  C  CA    . GLY C 2  601  ? 39.988  -26.900 105.162 1.00   80.54  ? 601  GLY C CA    1 
ATOM   8317  C  C     . GLY C 2  601  ? 39.791  -25.778 106.162 1.00   81.11  ? 601  GLY C C     1 
ATOM   8318  O  O     . GLY C 2  601  ? 38.677  -25.521 106.618 1.00   81.70  ? 601  GLY C O     1 
ATOM   8319  N  N     . GLU C 2  602  ? 40.888  -25.110 106.504 1.00   80.24  ? 602  GLU C N     1 
ATOM   8320  C  CA    . GLU C 2  602  ? 40.856  -23.995 107.441 1.00   80.75  ? 602  GLU C CA    1 
ATOM   8321  C  C     . GLU C 2  602  ? 41.085  -22.684 106.697 1.00   79.17  ? 602  GLU C C     1 
ATOM   8322  O  O     . GLU C 2  602  ? 41.946  -22.600 105.820 1.00   78.59  ? 602  GLU C O     1 
ATOM   8323  C  CB    . GLU C 2  602  ? 41.920  -24.183 108.526 1.00   86.07  ? 602  GLU C CB    1 
ATOM   8324  C  CG    . GLU C 2  602  ? 42.019  -23.036 109.522 1.00   80.42  ? 602  GLU C CG    1 
ATOM   8325  C  CD    . GLU C 2  602  ? 43.174  -23.205 110.491 1.00   76.48  ? 602  GLU C CD    1 
ATOM   8326  O  OE1   . GLU C 2  602  ? 43.736  -24.319 110.559 1.00   78.37  ? 602  GLU C OE1   1 
ATOM   8327  O  OE2   . GLU C 2  602  ? 43.523  -22.224 111.181 1.00   75.86  ? 602  GLU C OE2   1 
ATOM   8328  N  N     . VAL C 2  603  ? 40.310  -21.662 107.047 1.00   71.93  ? 603  VAL C N     1 
ATOM   8329  C  CA    . VAL C 2  603  ? 40.431  -20.364 106.398 1.00   68.05  ? 603  VAL C CA    1 
ATOM   8330  C  C     . VAL C 2  603  ? 41.671  -19.627 106.894 1.00   68.02  ? 603  VAL C C     1 
ATOM   8331  O  O     . VAL C 2  603  ? 41.825  -19.386 108.091 1.00   65.86  ? 603  VAL C O     1 
ATOM   8332  C  CB    . VAL C 2  603  ? 39.187  -19.496 106.639 1.00   62.25  ? 603  VAL C CB    1 
ATOM   8333  C  CG1   . VAL C 2  603  ? 39.365  -18.133 105.998 1.00   66.76  ? 603  VAL C CG1   1 
ATOM   8334  C  CG2   . VAL C 2  603  ? 37.948  -20.189 106.092 1.00   59.76  ? 603  VAL C CG2   1 
ATOM   8335  N  N     . ALA C 2  604  ? 42.547  -19.268 105.961 1.00   68.45  ? 604  ALA C N     1 
ATOM   8336  C  CA    . ALA C 2  604  ? 43.814  -18.628 106.297 1.00   70.26  ? 604  ALA C CA    1 
ATOM   8337  C  C     . ALA C 2  604  ? 43.662  -17.121 106.472 1.00   62.27  ? 604  ALA C C     1 
ATOM   8338  O  O     . ALA C 2  604  ? 43.878  -16.587 107.559 1.00   60.83  ? 604  ALA C O     1 
ATOM   8339  C  CB    . ALA C 2  604  ? 44.861  -18.937 105.237 1.00   73.71  ? 604  ALA C CB    1 
ATOM   8340  N  N     . LYS C 2  605  ? 43.300  -16.438 105.393 1.00   58.76  ? 605  LYS C N     1 
ATOM   8341  C  CA    . LYS C 2  605  ? 43.159  -14.989 105.429 1.00   58.37  ? 605  LYS C CA    1 
ATOM   8342  C  C     . LYS C 2  605  ? 41.734  -14.531 105.124 1.00   62.91  ? 605  LYS C C     1 
ATOM   8343  O  O     . LYS C 2  605  ? 41.037  -15.141 104.314 1.00   65.11  ? 605  LYS C O     1 
ATOM   8344  C  CB    . LYS C 2  605  ? 44.144  -14.337 104.458 1.00   62.29  ? 605  LYS C CB    1 
ATOM   8345  C  CG    . LYS C 2  605  ? 45.599  -14.441 104.885 1.00   64.97  ? 605  LYS C CG    1 
ATOM   8346  C  CD    . LYS C 2  605  ? 46.509  -13.681 103.931 1.00   72.61  ? 605  LYS C CD    1 
ATOM   8347  C  CE    . LYS C 2  605  ? 47.947  -13.668 104.424 1.00   66.97  ? 605  LYS C CE    1 
ATOM   8348  N  NZ    . LYS C 2  605  ? 48.850  -12.940 103.490 1.00   61.55  ? 605  LYS C NZ    1 
ATOM   8349  N  N     . VAL C 2  606  ? 41.305  -13.460 105.787 1.00   63.37  ? 606  VAL C N     1 
ATOM   8350  C  CA    . VAL C 2  606  ? 39.991  -12.869 105.541 1.00   57.74  ? 606  VAL C CA    1 
ATOM   8351  C  C     . VAL C 2  606  ? 40.087  -11.357 105.365 1.00   58.90  ? 606  VAL C C     1 
ATOM   8352  O  O     . VAL C 2  606  ? 40.528  -10.639 106.262 1.00   58.84  ? 606  VAL C O     1 
ATOM   8353  C  CB    . VAL C 2  606  ? 38.993  -13.177 106.675 1.00   58.96  ? 606  VAL C CB    1 
ATOM   8354  C  CG1   . VAL C 2  606  ? 37.724  -12.359 106.496 1.00   58.17  ? 606  VAL C CG1   1 
ATOM   8355  C  CG2   . VAL C 2  606  ? 38.670  -14.659 106.713 1.00   60.91  ? 606  VAL C CG2   1 
ATOM   8356  N  N     . ASP C 2  607  ? 39.666  -10.881 104.200 1.00   65.27  ? 607  ASP C N     1 
ATOM   8357  C  CA    . ASP C 2  607  ? 39.706  -9.462  103.886 1.00   65.74  ? 607  ASP C CA    1 
ATOM   8358  C  C     . ASP C 2  607  ? 38.474  -9.108  103.064 1.00   68.28  ? 607  ASP C C     1 
ATOM   8359  O  O     . ASP C 2  607  ? 37.848  -9.986  102.471 1.00   73.26  ? 607  ASP C O     1 
ATOM   8360  C  CB    . ASP C 2  607  ? 40.977  -9.137  103.099 1.00   67.17  ? 607  ASP C CB    1 
ATOM   8361  C  CG    . ASP C 2  607  ? 41.216  -7.648  102.957 1.00   70.04  ? 607  ASP C CG    1 
ATOM   8362  O  OD1   . ASP C 2  607  ? 40.733  -6.884  103.818 1.00   72.39  ? 607  ASP C OD1   1 
ATOM   8363  O  OD2   . ASP C 2  607  ? 41.892  -7.244  101.986 1.00   63.85  ? 607  ASP C OD2   1 
ATOM   8364  N  N     . GLY C 2  608  ? 38.119  -7.829  103.038 1.00   64.91  ? 608  GLY C N     1 
ATOM   8365  C  CA    . GLY C 2  608  ? 37.013  -7.375  102.216 1.00   64.38  ? 608  GLY C CA    1 
ATOM   8366  C  C     . GLY C 2  608  ? 37.304  -7.609  100.747 1.00   61.82  ? 608  GLY C C     1 
ATOM   8367  O  O     . GLY C 2  608  ? 36.399  -7.870  99.954  1.00   61.92  ? 608  GLY C O     1 
ATOM   8368  N  N     . ASN C 2  609  ? 38.579  -7.510  100.387 1.00   58.35  ? 609  ASN C N     1 
ATOM   8369  C  CA    . ASN C 2  609  ? 39.013  -7.717  99.012  1.00   62.29  ? 609  ASN C CA    1 
ATOM   8370  C  C     . ASN C 2  609  ? 39.188  -9.183  98.610  1.00   64.58  ? 609  ASN C C     1 
ATOM   8371  O  O     . ASN C 2  609  ? 38.875  -9.560  97.480  1.00   67.03  ? 609  ASN C O     1 
ATOM   8372  C  CB    . ASN C 2  609  ? 40.299  -6.934  98.739  1.00   65.66  ? 609  ASN C CB    1 
ATOM   8373  C  CG    . ASN C 2  609  ? 40.120  -5.438  98.923  1.00   63.12  ? 609  ASN C CG    1 
ATOM   8374  O  OD1   . ASN C 2  609  ? 39.040  -4.898  98.688  1.00   59.56  ? 609  ASN C OD1   1 
ATOM   8375  N  ND2   . ASN C 2  609  ? 41.181  -4.763  99.350  1.00   60.72  ? 609  ASN C ND2   1 
ATOM   8376  N  N     . ARG C 2  610  ? 39.686  -10.007 99.529  1.00   60.28  ? 610  ARG C N     1 
ATOM   8377  C  CA    . ARG C 2  610  ? 40.017  -11.393 99.198  1.00   61.72  ? 610  ARG C CA    1 
ATOM   8378  C  C     . ARG C 2  610  ? 39.930  -12.347 100.386 1.00   57.48  ? 610  ARG C C     1 
ATOM   8379  O  O     . ARG C 2  610  ? 39.990  -11.925 101.539 1.00   63.73  ? 610  ARG C O     1 
ATOM   8380  C  CB    . ARG C 2  610  ? 41.416  -11.464 98.579  1.00   70.24  ? 610  ARG C CB    1 
ATOM   8381  C  CG    . ARG C 2  610  ? 42.506  -10.804 99.417  1.00   76.05  ? 610  ARG C CG    1 
ATOM   8382  C  CD    . ARG C 2  610  ? 43.262  -11.811 100.276 1.00   73.54  ? 610  ARG C CD    1 
ATOM   8383  N  NE    . ARG C 2  610  ? 44.302  -11.168 101.076 1.00   74.34  ? 610  ARG C NE    1 
ATOM   8384  C  CZ    . ARG C 2  610  ? 44.236  -10.993 102.392 1.00   67.21  ? 610  ARG C CZ    1 
ATOM   8385  N  NH1   . ARG C 2  610  ? 43.182  -11.427 103.069 1.00   60.25  ? 610  ARG C NH1   1 
ATOM   8386  N  NH2   . ARG C 2  610  ? 45.230  -10.395 103.034 1.00   61.71  ? 610  ARG C NH2   1 
ATOM   8387  N  N     . ILE C 2  611  ? 39.795  -13.637 100.088 1.00   54.38  ? 611  ILE C N     1 
ATOM   8388  C  CA    . ILE C 2  611  ? 39.751  -14.674 101.117 1.00   59.15  ? 611  ILE C CA    1 
ATOM   8389  C  C     . ILE C 2  611  ? 40.697  -15.824 100.782 1.00   65.00  ? 611  ILE C C     1 
ATOM   8390  O  O     . ILE C 2  611  ? 40.527  -16.500 99.768  1.00   64.01  ? 611  ILE C O     1 
ATOM   8391  C  CB    . ILE C 2  611  ? 38.329  -15.250 101.290 1.00   55.90  ? 611  ILE C CB    1 
ATOM   8392  C  CG1   . ILE C 2  611  ? 37.350  -14.160 101.731 1.00   56.32  ? 611  ILE C CG1   1 
ATOM   8393  C  CG2   . ILE C 2  611  ? 38.333  -16.392 102.297 1.00   59.72  ? 611  ILE C CG2   1 
ATOM   8394  C  CD1   . ILE C 2  611  ? 35.944  -14.667 101.964 1.00   57.36  ? 611  ILE C CD1   1 
ATOM   8395  N  N     . VAL C 2  612  ? 41.687  -16.051 101.641 1.00   69.19  ? 612  VAL C N     1 
ATOM   8396  C  CA    . VAL C 2  612  ? 42.648  -17.131 101.433 1.00   65.57  ? 612  VAL C CA    1 
ATOM   8397  C  C     . VAL C 2  612  ? 42.299  -18.358 102.274 1.00   65.59  ? 612  VAL C C     1 
ATOM   8398  O  O     . VAL C 2  612  ? 42.083  -18.255 103.481 1.00   64.40  ? 612  VAL C O     1 
ATOM   8399  C  CB    . VAL C 2  612  ? 44.081  -16.680 101.760 1.00   63.91  ? 612  VAL C CB    1 
ATOM   8400  C  CG1   . VAL C 2  612  ? 45.068  -17.797 101.465 1.00   75.15  ? 612  VAL C CG1   1 
ATOM   8401  C  CG2   . VAL C 2  612  ? 44.434  -15.428 100.971 1.00   62.35  ? 612  VAL C CG2   1 
ATOM   8402  N  N     . VAL C 2  613  ? 42.250  -19.518 101.625 1.00   68.18  ? 613  VAL C N     1 
ATOM   8403  C  CA    . VAL C 2  613  ? 41.861  -20.757 102.288 1.00   74.70  ? 613  VAL C CA    1 
ATOM   8404  C  C     . VAL C 2  613  ? 42.890  -21.868 102.083 1.00   83.42  ? 613  VAL C C     1 
ATOM   8405  O  O     . VAL C 2  613  ? 43.318  -22.132 100.958 1.00   85.11  ? 613  VAL C O     1 
ATOM   8406  C  CB    . VAL C 2  613  ? 40.492  -21.253 101.777 1.00   69.93  ? 613  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C 2  613  ? 40.102  -22.554 102.463 1.00   78.50  ? 613  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C 2  613  ? 39.426  -20.191 101.994 1.00   68.56  ? 613  VAL C CG2   1 
ATOM   8409  N  N     . ARG C 2  614  ? 43.285  -22.514 103.176 1.00   80.46  ? 614  ARG C N     1 
ATOM   8410  C  CA    . ARG C 2  614  ? 44.152  -23.685 103.107 1.00   83.14  ? 614  ARG C CA    1 
ATOM   8411  C  C     . ARG C 2  614  ? 43.315  -24.955 103.214 1.00   91.03  ? 614  ARG C C     1 
ATOM   8412  O  O     . ARG C 2  614  ? 42.624  -25.167 104.210 1.00   91.28  ? 614  ARG C O     1 
ATOM   8413  C  CB    . ARG C 2  614  ? 45.195  -23.653 104.226 1.00   86.49  ? 614  ARG C CB    1 
ATOM   8414  C  CG    . ARG C 2  614  ? 46.031  -24.922 104.324 1.00   91.42  ? 614  ARG C CG    1 
ATOM   8415  C  CD    . ARG C 2  614  ? 47.064  -24.833 105.437 1.00   83.78  ? 614  ARG C CD    1 
ATOM   8416  N  NE    . ARG C 2  614  ? 48.087  -23.828 105.159 1.00   96.11  ? 614  ARG C NE    1 
ATOM   8417  C  CZ    . ARG C 2  614  ? 49.188  -24.058 104.450 1.00   92.93  ? 614  ARG C CZ    1 
ATOM   8418  N  NH1   . ARG C 2  614  ? 50.064  -23.084 104.247 1.00   79.55  ? 614  ARG C NH1   1 
ATOM   8419  N  NH2   . ARG C 2  614  ? 49.412  -25.262 103.941 1.00   87.47  ? 614  ARG C NH2   1 
ATOM   8420  N  N     . TYR C 2  615  ? 43.376  -25.796 102.186 1.00   92.77  ? 615  TYR C N     1 
ATOM   8421  C  CA    . TYR C 2  615  ? 42.595  -27.031 102.169 1.00   103.41 ? 615  TYR C CA    1 
ATOM   8422  C  C     . TYR C 2  615  ? 43.371  -28.217 102.740 1.00   106.97 ? 615  TYR C C     1 
ATOM   8423  O  O     . TYR C 2  615  ? 44.504  -28.068 103.201 1.00   105.88 ? 615  TYR C O     1 
ATOM   8424  C  CB    . TYR C 2  615  ? 42.103  -27.342 100.751 1.00   100.07 ? 615  TYR C CB    1 
ATOM   8425  C  CG    . TYR C 2  615  ? 41.104  -26.337 100.222 1.00   97.15  ? 615  TYR C CG    1 
ATOM   8426  C  CD1   . TYR C 2  615  ? 41.432  -25.480 99.178  1.00   90.37  ? 615  TYR C CD1   1 
ATOM   8427  C  CD2   . TYR C 2  615  ? 39.834  -26.237 100.775 1.00   94.18  ? 615  TYR C CD2   1 
ATOM   8428  C  CE1   . TYR C 2  615  ? 40.519  -24.558 98.697  1.00   84.69  ? 615  TYR C CE1   1 
ATOM   8429  C  CE2   . TYR C 2  615  ? 38.917  -25.318 100.302 1.00   84.42  ? 615  TYR C CE2   1 
ATOM   8430  C  CZ    . TYR C 2  615  ? 39.263  -24.482 99.264  1.00   82.70  ? 615  TYR C CZ    1 
ATOM   8431  O  OH    . TYR C 2  615  ? 38.347  -23.569 98.794  1.00   78.57  ? 615  TYR C OH    1 
ATOM   8432  N  N     . GLU C 2  616  ? 42.749  -29.394 102.708 1.00   106.61 ? 616  GLU C N     1 
ATOM   8433  C  CA    . GLU C 2  616  ? 43.367  -30.613 103.222 1.00   101.32 ? 616  GLU C CA    1 
ATOM   8434  C  C     . GLU C 2  616  ? 44.574  -31.016 102.384 1.00   108.39 ? 616  GLU C C     1 
ATOM   8435  O  O     . GLU C 2  616  ? 45.442  -31.759 102.842 1.00   110.98 ? 616  GLU C O     1 
ATOM   8436  C  CB    . GLU C 2  616  ? 42.351  -31.758 103.256 1.00   92.00  ? 616  GLU C CB    1 
ATOM   8437  C  CG    . GLU C 2  616  ? 41.140  -31.504 104.143 1.00   94.07  ? 616  GLU C CG    1 
ATOM   8438  C  CD    . GLU C 2  616  ? 41.462  -31.582 105.625 1.00   94.70  ? 616  GLU C CD    1 
ATOM   8439  O  OE1   . GLU C 2  616  ? 42.146  -30.673 106.142 1.00   94.31  ? 616  GLU C OE1   1 
ATOM   8440  O  OE2   . GLU C 2  616  ? 41.026  -32.555 106.275 1.00   99.08  ? 616  GLU C OE2   1 
ATOM   8441  N  N     . ASP C 2  617  ? 44.620  -30.519 101.152 1.00   112.61 ? 617  ASP C N     1 
ATOM   8442  C  CA    . ASP C 2  617  ? 45.726  -30.800 100.246 1.00   109.55 ? 617  ASP C CA    1 
ATOM   8443  C  C     . ASP C 2  617  ? 46.987  -30.068 100.695 1.00   105.32 ? 617  ASP C C     1 
ATOM   8444  O  O     . ASP C 2  617  ? 48.092  -30.390 100.259 1.00   104.38 ? 617  ASP C O     1 
ATOM   8445  C  CB    . ASP C 2  617  ? 45.361  -30.379 98.822  1.00   105.59 ? 617  ASP C CB    1 
ATOM   8446  C  CG    . ASP C 2  617  ? 43.951  -30.786 98.434  1.00   112.03 ? 617  ASP C CG    1 
ATOM   8447  O  OD1   . ASP C 2  617  ? 43.072  -30.819 99.322  1.00   112.01 ? 617  ASP C OD1   1 
ATOM   8448  O  OD2   . ASP C 2  617  ? 43.720  -31.070 97.240  1.00   111.32 ? 617  ASP C OD2   1 
ATOM   8449  N  N     . GLY C 2  618  ? 46.812  -29.082 101.570 1.00   101.62 ? 618  GLY C N     1 
ATOM   8450  C  CA    . GLY C 2  618  ? 47.917  -28.270 102.044 1.00   96.61  ? 618  GLY C CA    1 
ATOM   8451  C  C     . GLY C 2  618  ? 48.140  -27.071 101.143 1.00   95.50  ? 618  GLY C C     1 
ATOM   8452  O  O     . GLY C 2  618  ? 49.022  -26.248 101.389 1.00   89.63  ? 618  GLY C O     1 
ATOM   8453  N  N     . ARG C 2  619  ? 47.328  -26.975 100.096 1.00   95.51  ? 619  ARG C N     1 
ATOM   8454  C  CA    . ARG C 2  619  ? 47.450  -25.904 99.114  1.00   90.36  ? 619  ARG C CA    1 
ATOM   8455  C  C     . ARG C 2  619  ? 46.718  -24.639 99.551  1.00   88.23  ? 619  ARG C C     1 
ATOM   8456  O  O     . ARG C 2  619  ? 45.653  -24.703 100.166 1.00   92.06  ? 619  ARG C O     1 
ATOM   8457  C  CB    . ARG C 2  619  ? 46.937  -26.370 97.748  1.00   89.08  ? 619  ARG C CB    1 
ATOM   8458  C  CG    . ARG C 2  619  ? 45.501  -26.872 97.754  1.00   89.30  ? 619  ARG C CG    1 
ATOM   8459  C  CD    . ARG C 2  619  ? 45.159  -27.575 96.449  1.00   95.10  ? 619  ARG C CD    1 
ATOM   8460  N  NE    . ARG C 2  619  ? 43.802  -28.116 96.451  1.00   97.13  ? 619  ARG C NE    1 
ATOM   8461  C  CZ    . ARG C 2  619  ? 42.778  -27.568 95.805  1.00   92.47  ? 619  ARG C CZ    1 
ATOM   8462  N  NH1   . ARG C 2  619  ? 41.578  -28.130 95.864  1.00   86.12  ? 619  ARG C NH1   1 
ATOM   8463  N  NH2   . ARG C 2  619  ? 42.953  -26.461 95.097  1.00   87.34  ? 619  ARG C NH2   1 
ATOM   8464  N  N     . LEU C 2  620  ? 47.304  -23.489 99.237  1.00   86.02  ? 620  LEU C N     1 
ATOM   8465  C  CA    . LEU C 2  620  ? 46.689  -22.205 99.544  1.00   79.87  ? 620  LEU C CA    1 
ATOM   8466  C  C     . LEU C 2  620  ? 45.954  -21.659 98.326  1.00   82.95  ? 620  LEU C C     1 
ATOM   8467  O  O     . LEU C 2  620  ? 46.568  -21.362 97.301  1.00   79.68  ? 620  LEU C O     1 
ATOM   8468  C  CB    . LEU C 2  620  ? 47.746  -21.201 100.005 1.00   75.51  ? 620  LEU C CB    1 
ATOM   8469  C  CG    . LEU C 2  620  ? 47.521  -20.567 101.378 1.00   69.86  ? 620  LEU C CG    1 
ATOM   8470  C  CD1   . LEU C 2  620  ? 47.565  -21.628 102.460 1.00   75.30  ? 620  LEU C CD1   1 
ATOM   8471  C  CD2   . LEU C 2  620  ? 48.550  -19.480 101.645 1.00   55.79  ? 620  LEU C CD2   1 
ATOM   8472  N  N     . VAL C 2  621  ? 44.636  -21.536 98.442  1.00   80.79  ? 621  VAL C N     1 
ATOM   8473  C  CA    . VAL C 2  621  ? 43.820  -21.006 97.356  1.00   75.33  ? 621  VAL C CA    1 
ATOM   8474  C  C     . VAL C 2  621  ? 43.267  -19.636 97.725  1.00   66.20  ? 621  VAL C C     1 
ATOM   8475  O  O     . VAL C 2  621  ? 42.621  -19.478 98.759  1.00   66.14  ? 621  VAL C O     1 
ATOM   8476  C  CB    . VAL C 2  621  ? 42.650  -21.947 97.018  1.00   71.32  ? 621  VAL C CB    1 
ATOM   8477  C  CG1   . VAL C 2  621  ? 41.790  -21.350 95.915  1.00   62.71  ? 621  VAL C CG1   1 
ATOM   8478  C  CG2   . VAL C 2  621  ? 43.172  -23.319 96.616  1.00   76.62  ? 621  VAL C CG2   1 
ATOM   8479  N  N     . GLU C 2  622  ? 43.527  -18.644 96.879  1.00   61.84  ? 622  GLU C N     1 
ATOM   8480  C  CA    . GLU C 2  622  ? 43.049  -17.292 97.136  1.00   61.09  ? 622  GLU C CA    1 
ATOM   8481  C  C     . GLU C 2  622  ? 41.859  -16.942 96.252  1.00   65.83  ? 622  GLU C C     1 
ATOM   8482  O  O     . GLU C 2  622  ? 41.959  -16.953 95.025  1.00   64.82  ? 622  GLU C O     1 
ATOM   8483  C  CB    . GLU C 2  622  ? 44.166  -16.269 96.928  1.00   56.87  ? 622  GLU C CB    1 
ATOM   8484  C  CG    . GLU C 2  622  ? 43.775  -14.856 97.328  1.00   59.20  ? 622  GLU C CG    1 
ATOM   8485  C  CD    . GLU C 2  622  ? 44.744  -13.811 96.815  1.00   67.43  ? 622  GLU C CD    1 
ATOM   8486  O  OE1   . GLU C 2  622  ? 45.370  -13.118 97.644  1.00   68.96  ? 622  GLU C OE1   1 
ATOM   8487  O  OE2   . GLU C 2  622  ? 44.874  -13.678 95.580  1.00   85.27  ? 622  GLU C OE2   1 
ATOM   8488  N  N     . TYR C 2  623  ? 40.734  -16.634 96.886  1.00   68.27  ? 623  TYR C N     1 
ATOM   8489  C  CA    . TYR C 2  623  ? 39.537  -16.212 96.173  1.00   58.10  ? 623  TYR C CA    1 
ATOM   8490  C  C     . TYR C 2  623  ? 39.380  -14.699 96.255  1.00   55.13  ? 623  TYR C C     1 
ATOM   8491  O  O     . TYR C 2  623  ? 39.073  -14.162 97.320  1.00   55.16  ? 623  TYR C O     1 
ATOM   8492  C  CB    . TYR C 2  623  ? 38.298  -16.888 96.761  1.00   55.73  ? 623  TYR C CB    1 
ATOM   8493  C  CG    . TYR C 2  623  ? 38.329  -18.398 96.712  1.00   58.16  ? 623  TYR C CG    1 
ATOM   8494  C  CD1   . TYR C 2  623  ? 37.982  -19.082 95.555  1.00   64.98  ? 623  TYR C CD1   1 
ATOM   8495  C  CD2   . TYR C 2  623  ? 38.696  -19.141 97.826  1.00   59.96  ? 623  TYR C CD2   1 
ATOM   8496  C  CE1   . TYR C 2  623  ? 38.006  -20.462 95.505  1.00   66.79  ? 623  TYR C CE1   1 
ATOM   8497  C  CE2   . TYR C 2  623  ? 38.724  -20.522 97.786  1.00   66.14  ? 623  TYR C CE2   1 
ATOM   8498  C  CZ    . TYR C 2  623  ? 38.377  -21.177 96.623  1.00   67.89  ? 623  TYR C CZ    1 
ATOM   8499  O  OH    . TYR C 2  623  ? 38.403  -22.552 96.577  1.00   75.63  ? 623  TYR C OH    1 
ATOM   8500  N  N     . PRO C 2  624  ? 39.601  -14.003 95.132  1.00   58.45  ? 624  PRO C N     1 
ATOM   8501  C  CA    . PRO C 2  624  ? 39.376  -12.556 95.104  1.00   57.78  ? 624  PRO C CA    1 
ATOM   8502  C  C     . PRO C 2  624  ? 37.883  -12.258 95.112  1.00   56.81  ? 624  PRO C C     1 
ATOM   8503  O  O     . PRO C 2  624  ? 37.110  -12.977 94.478  1.00   55.94  ? 624  PRO C O     1 
ATOM   8504  C  CB    . PRO C 2  624  ? 39.998  -12.133 93.772  1.00   49.93  ? 624  PRO C CB    1 
ATOM   8505  C  CG    . PRO C 2  624  ? 39.896  -13.343 92.913  1.00   60.32  ? 624  PRO C CG    1 
ATOM   8506  C  CD    . PRO C 2  624  ? 40.077  -14.517 93.836  1.00   63.82  ? 624  PRO C CD    1 
ATOM   8507  N  N     . LEU C 2  625  ? 37.482  -11.214 95.827  1.00   55.86  ? 625  LEU C N     1 
ATOM   8508  C  CA    . LEU C 2  625  ? 36.073  -10.862 95.921  1.00   52.45  ? 625  LEU C CA    1 
ATOM   8509  C  C     . LEU C 2  625  ? 35.702  -9.741  94.960  1.00   54.34  ? 625  LEU C C     1 
ATOM   8510  O  O     . LEU C 2  625  ? 36.366  -8.706  94.911  1.00   55.46  ? 625  LEU C O     1 
ATOM   8511  C  CB    . LEU C 2  625  ? 35.711  -10.465 97.353  1.00   52.04  ? 625  LEU C CB    1 
ATOM   8512  C  CG    . LEU C 2  625  ? 35.770  -11.590 98.385  1.00   55.34  ? 625  LEU C CG    1 
ATOM   8513  C  CD1   . LEU C 2  625  ? 35.296  -11.102 99.744  1.00   54.37  ? 625  LEU C CD1   1 
ATOM   8514  C  CD2   . LEU C 2  625  ? 34.944  -12.775 97.917  1.00   49.27  ? 625  LEU C CD2   1 
ATOM   8515  N  N     . ARG C 2  626  ? 34.638  -9.958  94.193  1.00   51.31  ? 626  ARG C N     1 
ATOM   8516  C  CA    . ARG C 2  626  ? 34.098  -8.917  93.333  1.00   55.88  ? 626  ARG C CA    1 
ATOM   8517  C  C     . ARG C 2  626  ? 33.466  -7.847  94.214  1.00   63.67  ? 626  ARG C C     1 
ATOM   8518  O  O     . ARG C 2  626  ? 32.575  -8.139  95.011  1.00   67.57  ? 626  ARG C O     1 
ATOM   8519  C  CB    . ARG C 2  626  ? 33.054  -9.505  92.385  1.00   61.46  ? 626  ARG C CB    1 
ATOM   8520  C  CG    . ARG C 2  626  ? 32.312  -8.474  91.554  1.00   65.41  ? 626  ARG C CG    1 
ATOM   8521  C  CD    . ARG C 2  626  ? 31.339  -9.125  90.580  1.00   75.06  ? 626  ARG C CD    1 
ATOM   8522  N  NE    . ARG C 2  626  ? 32.018  -9.953  89.586  1.00   95.37  ? 626  ARG C NE    1 
ATOM   8523  C  CZ    . ARG C 2  626  ? 32.065  -11.281 89.622  1.00   100.85 ? 626  ARG C CZ    1 
ATOM   8524  N  NH1   . ARG C 2  626  ? 31.467  -11.942 90.604  1.00   89.51  ? 626  ARG C NH1   1 
ATOM   8525  N  NH2   . ARG C 2  626  ? 32.708  -11.950 88.674  1.00   91.42  ? 626  ARG C NH2   1 
ATOM   8526  N  N     . ARG C 2  627  ? 33.925  -6.608  94.066  1.00   62.79  ? 627  ARG C N     1 
ATOM   8527  C  CA    . ARG C 2  627  ? 33.489  -5.529  94.948  1.00   54.98  ? 627  ARG C CA    1 
ATOM   8528  C  C     . ARG C 2  627  ? 32.960  -4.312  94.199  1.00   57.32  ? 627  ARG C C     1 
ATOM   8529  O  O     . ARG C 2  627  ? 33.704  -3.638  93.485  1.00   65.87  ? 627  ARG C O     1 
ATOM   8530  C  CB    . ARG C 2  627  ? 34.626  -5.112  95.884  1.00   52.82  ? 627  ARG C CB    1 
ATOM   8531  C  CG    . ARG C 2  627  ? 34.688  -5.905  97.178  1.00   58.72  ? 627  ARG C CG    1 
ATOM   8532  C  CD    . ARG C 2  627  ? 33.450  -5.656  98.019  1.00   52.05  ? 627  ARG C CD    1 
ATOM   8533  N  NE    . ARG C 2  627  ? 33.554  -6.257  99.344  1.00   54.99  ? 627  ARG C NE    1 
ATOM   8534  C  CZ    . ARG C 2  627  ? 32.666  -6.071  100.315 1.00   65.36  ? 627  ARG C CZ    1 
ATOM   8535  N  NH1   . ARG C 2  627  ? 31.609  -5.297  100.107 1.00   56.97  ? 627  ARG C NH1   1 
ATOM   8536  N  NH2   . ARG C 2  627  ? 32.835  -6.655  101.495 1.00   68.55  ? 627  ARG C NH2   1 
ATOM   8537  N  N     . PHE C 2  628  ? 31.671  -4.042  94.382  1.00   54.56  ? 628  PHE C N     1 
ATOM   8538  C  CA    . PHE C 2  628  ? 31.007  -2.872  93.813  1.00   46.64  ? 628  PHE C CA    1 
ATOM   8539  C  C     . PHE C 2  628  ? 31.159  -2.787  92.298  1.00   49.17  ? 628  PHE C C     1 
ATOM   8540  O  O     . PHE C 2  628  ? 31.421  -1.717  91.750  1.00   51.76  ? 628  PHE C O     1 
ATOM   8541  C  CB    . PHE C 2  628  ? 31.507  -1.590  94.483  1.00   43.23  ? 628  PHE C CB    1 
ATOM   8542  C  CG    . PHE C 2  628  ? 31.310  -1.570  95.974  1.00   47.79  ? 628  PHE C CG    1 
ATOM   8543  C  CD1   . PHE C 2  628  ? 30.179  -0.998  96.528  1.00   48.28  ? 628  PHE C CD1   1 
ATOM   8544  C  CD2   . PHE C 2  628  ? 32.254  -2.126  96.821  1.00   55.05  ? 628  PHE C CD2   1 
ATOM   8545  C  CE1   . PHE C 2  628  ? 29.995  -0.979  97.898  1.00   52.45  ? 628  PHE C CE1   1 
ATOM   8546  C  CE2   . PHE C 2  628  ? 32.075  -2.111  98.191  1.00   51.13  ? 628  PHE C CE2   1 
ATOM   8547  C  CZ    . PHE C 2  628  ? 30.945  -1.537  98.729  1.00   48.44  ? 628  PHE C CZ    1 
ATOM   8548  N  N     . TYR C 2  629  ? 30.997  -3.924  91.629  1.00   57.97  ? 629  TYR C N     1 
ATOM   8549  C  CA    . TYR C 2  629  ? 31.039  -3.976  90.172  1.00   65.54  ? 629  TYR C CA    1 
ATOM   8550  C  C     . TYR C 2  629  ? 29.678  -3.606  89.596  1.00   55.43  ? 629  TYR C C     1 
ATOM   8551  O  O     . TYR C 2  629  ? 28.645  -4.085  90.068  1.00   49.06  ? 629  TYR C O     1 
ATOM   8552  C  CB    . TYR C 2  629  ? 31.450  -5.372  89.692  1.00   74.86  ? 629  TYR C CB    1 
ATOM   8553  C  CG    . TYR C 2  629  ? 32.946  -5.578  89.562  1.00   83.39  ? 629  TYR C CG    1 
ATOM   8554  C  CD1   . TYR C 2  629  ? 33.783  -5.474  90.667  1.00   80.28  ? 629  TYR C CD1   1 
ATOM   8555  C  CD2   . TYR C 2  629  ? 33.517  -5.892  88.335  1.00   86.91  ? 629  TYR C CD2   1 
ATOM   8556  C  CE1   . TYR C 2  629  ? 35.150  -5.667  90.551  1.00   78.06  ? 629  TYR C CE1   1 
ATOM   8557  C  CE2   . TYR C 2  629  ? 34.882  -6.087  88.210  1.00   93.49  ? 629  TYR C CE2   1 
ATOM   8558  C  CZ    . TYR C 2  629  ? 35.693  -5.973  89.321  1.00   86.68  ? 629  TYR C CZ    1 
ATOM   8559  O  OH    . TYR C 2  629  ? 37.050  -6.167  89.199  1.00   80.33  ? 629  TYR C OH    1 
ATOM   8560  N  N     . ARG C 2  630  ? 29.681  -2.751  88.578  1.00   48.88  ? 630  ARG C N     1 
ATOM   8561  C  CA    . ARG C 2  630  ? 28.441  -2.323  87.940  1.00   46.03  ? 630  ARG C CA    1 
ATOM   8562  C  C     . ARG C 2  630  ? 27.856  -3.425  87.063  1.00   42.49  ? 630  ARG C C     1 
ATOM   8563  O  O     . ARG C 2  630  ? 28.557  -4.017  86.243  1.00   45.62  ? 630  ARG C O     1 
ATOM   8564  C  CB    . ARG C 2  630  ? 28.666  -1.060  87.107  1.00   44.54  ? 630  ARG C CB    1 
ATOM   8565  C  CG    . ARG C 2  630  ? 27.471  -0.684  86.247  1.00   43.03  ? 630  ARG C CG    1 
ATOM   8566  C  CD    . ARG C 2  630  ? 27.832  0.344   85.191  1.00   46.24  ? 630  ARG C CD    1 
ATOM   8567  N  NE    . ARG C 2  630  ? 26.942  0.257   84.036  1.00   42.75  ? 630  ARG C NE    1 
ATOM   8568  C  CZ    . ARG C 2  630  ? 25.780  0.894   83.936  1.00   39.81  ? 630  ARG C CZ    1 
ATOM   8569  N  NH1   . ARG C 2  630  ? 25.361  1.674   84.922  1.00   41.79  ? 630  ARG C NH1   1 
ATOM   8570  N  NH2   . ARG C 2  630  ? 25.037  0.752   82.848  1.00   38.15  ? 630  ARG C NH2   1 
ATOM   8571  N  N     . SER C 2  631  ? 26.568  -3.695  87.244  1.00   38.71  ? 631  SER C N     1 
ATOM   8572  C  CA    . SER C 2  631  ? 25.879  -4.705  86.455  1.00   38.73  ? 631  SER C CA    1 
ATOM   8573  C  C     . SER C 2  631  ? 25.308  -4.087  85.190  1.00   43.39  ? 631  SER C C     1 
ATOM   8574  O  O     . SER C 2  631  ? 25.463  -2.890  84.950  1.00   44.27  ? 631  SER C O     1 
ATOM   8575  C  CB    . SER C 2  631  ? 24.749  -5.337  87.264  1.00   41.09  ? 631  SER C CB    1 
ATOM   8576  O  OG    . SER C 2  631  ? 23.733  -4.388  87.534  1.00   42.18  ? 631  SER C OG    1 
ATOM   8577  N  N     . ASN C 2  632  ? 24.644  -4.912  84.387  1.00   48.48  ? 632  ASN C N     1 
ATOM   8578  C  CA    . ASN C 2  632  ? 24.028  -4.452  83.147  1.00   50.50  ? 632  ASN C CA    1 
ATOM   8579  C  C     . ASN C 2  632  ? 22.943  -3.404  83.381  1.00   47.99  ? 632  ASN C C     1 
ATOM   8580  O  O     . ASN C 2  632  ? 22.791  -2.469  82.594  1.00   48.06  ? 632  ASN C O     1 
ATOM   8581  C  CB    . ASN C 2  632  ? 23.457  -5.636  82.363  1.00   45.24  ? 632  ASN C CB    1 
ATOM   8582  C  CG    . ASN C 2  632  ? 24.495  -6.310  81.486  1.00   48.42  ? 632  ASN C CG    1 
ATOM   8583  O  OD1   . ASN C 2  632  ? 25.696  -6.076  81.630  1.00   48.70  ? 632  ASN C OD1   1 
ATOM   8584  N  ND2   . ASN C 2  632  ? 24.035  -7.153  80.569  1.00   49.25  ? 632  ASN C ND2   1 
ATOM   8585  N  N     . GLN C 2  633  ? 22.195  -3.567  84.467  1.00   41.79  ? 633  GLN C N     1 
ATOM   8586  C  CA    . GLN C 2  633  ? 21.110  -2.651  84.796  1.00   38.99  ? 633  GLN C CA    1 
ATOM   8587  C  C     . GLN C 2  633  ? 21.561  -1.564  85.765  1.00   45.62  ? 633  GLN C C     1 
ATOM   8588  O  O     . GLN C 2  633  ? 20.769  -0.713  86.168  1.00   58.21  ? 633  GLN C O     1 
ATOM   8589  C  CB    . GLN C 2  633  ? 19.914  -3.412  85.375  1.00   36.54  ? 633  GLN C CB    1 
ATOM   8590  C  CG    . GLN C 2  633  ? 19.075  -4.145  84.337  1.00   39.80  ? 633  GLN C CG    1 
ATOM   8591  C  CD    . GLN C 2  633  ? 19.809  -5.306  83.690  1.00   44.50  ? 633  GLN C CD    1 
ATOM   8592  O  OE1   . GLN C 2  633  ? 20.804  -5.802  84.221  1.00   45.24  ? 633  GLN C OE1   1 
ATOM   8593  N  NE2   . GLN C 2  633  ? 19.320  -5.744  82.535  1.00   46.01  ? 633  GLN C NE2   1 
ATOM   8594  N  N     . GLY C 2  634  ? 22.834  -1.599  86.139  1.00   41.15  ? 634  GLY C N     1 
ATOM   8595  C  CA    . GLY C 2  634  ? 23.385  -0.588  87.021  1.00   43.61  ? 634  GLY C CA    1 
ATOM   8596  C  C     . GLY C 2  634  ? 23.222  -0.898  88.497  1.00   42.70  ? 634  GLY C C     1 
ATOM   8597  O  O     . GLY C 2  634  ? 23.486  -0.047  89.344  1.00   43.98  ? 634  GLY C O     1 
ATOM   8598  N  N     . THR C 2  635  ? 22.782  -2.113  88.810  1.00   44.98  ? 635  THR C N     1 
ATOM   8599  C  CA    . THR C 2  635  ? 22.700  -2.548  90.200  1.00   43.48  ? 635  THR C CA    1 
ATOM   8600  C  C     . THR C 2  635  ? 24.082  -2.986  90.673  1.00   45.70  ? 635  THR C C     1 
ATOM   8601  O  O     . THR C 2  635  ? 24.827  -3.622  89.929  1.00   49.20  ? 635  THR C O     1 
ATOM   8602  C  CB    . THR C 2  635  ? 21.692  -3.703  90.391  1.00   37.88  ? 635  THR C CB    1 
ATOM   8603  O  OG1   . THR C 2  635  ? 22.116  -4.852  89.646  1.00   36.06  ? 635  THR C OG1   1 
ATOM   8604  C  CG2   . THR C 2  635  ? 20.308  -3.284  89.925  1.00   38.80  ? 635  THR C CG2   1 
ATOM   8605  N  N     . ALA C 2  636  ? 24.428  -2.640  91.908  1.00   43.06  ? 636  ALA C N     1 
ATOM   8606  C  CA    . ALA C 2  636  ? 25.755  -2.946  92.427  1.00   41.44  ? 636  ALA C CA    1 
ATOM   8607  C  C     . ALA C 2  636  ? 25.891  -4.418  92.798  1.00   41.49  ? 636  ALA C C     1 
ATOM   8608  O  O     . ALA C 2  636  ? 25.144  -4.932  93.632  1.00   37.90  ? 636  ALA C O     1 
ATOM   8609  C  CB    . ALA C 2  636  ? 26.071  -2.064  93.624  1.00   46.20  ? 636  ALA C CB    1 
ATOM   8610  N  N     . LEU C 2  637  ? 26.854  -5.092  92.179  1.00   44.20  ? 637  LEU C N     1 
ATOM   8611  C  CA    . LEU C 2  637  ? 27.124  -6.487  92.490  1.00   50.00  ? 637  LEU C CA    1 
ATOM   8612  C  C     . LEU C 2  637  ? 28.418  -6.584  93.284  1.00   55.85  ? 637  LEU C C     1 
ATOM   8613  O  O     . LEU C 2  637  ? 29.502  -6.371  92.740  1.00   62.84  ? 637  LEU C O     1 
ATOM   8614  C  CB    . LEU C 2  637  ? 27.245  -7.309  91.206  1.00   46.92  ? 637  LEU C CB    1 
ATOM   8615  C  CG    . LEU C 2  637  ? 26.110  -7.209  90.184  1.00   39.18  ? 637  LEU C CG    1 
ATOM   8616  C  CD1   . LEU C 2  637  ? 26.387  -8.120  89.000  1.00   37.56  ? 637  LEU C CD1   1 
ATOM   8617  C  CD2   . LEU C 2  637  ? 24.767  -7.542  90.816  1.00   42.14  ? 637  LEU C CD2   1 
ATOM   8618  N  N     . ASP C 2  638  ? 28.308  -6.910  94.568  1.00   55.53  ? 638  ASP C N     1 
ATOM   8619  C  CA    . ASP C 2  638  ? 29.493  -7.031  95.412  1.00   59.55  ? 638  ASP C CA    1 
ATOM   8620  C  C     . ASP C 2  638  ? 29.426  -8.226  96.354  1.00   59.69  ? 638  ASP C C     1 
ATOM   8621  O  O     . ASP C 2  638  ? 28.378  -8.537  96.923  1.00   54.17  ? 638  ASP C O     1 
ATOM   8622  C  CB    . ASP C 2  638  ? 29.749  -5.743  96.200  1.00   53.22  ? 638  ASP C CB    1 
ATOM   8623  C  CG    . ASP C 2  638  ? 28.699  -5.482  97.257  1.00   64.79  ? 638  ASP C CG    1 
ATOM   8624  O  OD1   . ASP C 2  638  ? 27.517  -5.813  97.024  1.00   72.57  ? 638  ASP C OD1   1 
ATOM   8625  O  OD2   . ASP C 2  638  ? 29.060  -4.942  98.323  1.00   67.74  ? 638  ASP C OD2   1 
ATOM   8626  N  N     . GLN C 2  639  ? 30.562  -8.892  96.507  1.00   59.76  ? 639  GLN C N     1 
ATOM   8627  C  CA    . GLN C 2  639  ? 30.663  -10.045 97.382  1.00   59.88  ? 639  GLN C CA    1 
ATOM   8628  C  C     . GLN C 2  639  ? 31.294  -9.631  98.704  1.00   59.60  ? 639  GLN C C     1 
ATOM   8629  O  O     . GLN C 2  639  ? 32.261  -8.869  98.727  1.00   60.18  ? 639  GLN C O     1 
ATOM   8630  C  CB    . GLN C 2  639  ? 31.486  -11.146 96.709  1.00   64.46  ? 639  GLN C CB    1 
ATOM   8631  C  CG    . GLN C 2  639  ? 30.900  -11.627 95.386  1.00   59.03  ? 639  GLN C CG    1 
ATOM   8632  C  CD    . GLN C 2  639  ? 31.818  -12.583 94.648  1.00   58.92  ? 639  GLN C CD    1 
ATOM   8633  O  OE1   . GLN C 2  639  ? 33.001  -12.301 94.454  1.00   62.34  ? 639  GLN C OE1   1 
ATOM   8634  N  NE2   . GLN C 2  639  ? 31.276  -13.723 94.234  1.00   54.63  ? 639  GLN C NE2   1 
ATOM   8635  N  N     . ARG C 2  640  ? 30.737  -10.125 99.805  1.00   55.79  ? 640  ARG C N     1 
ATOM   8636  C  CA    . ARG C 2  640  ? 31.249  -9.797  101.128 1.00   56.07  ? 640  ARG C CA    1 
ATOM   8637  C  C     . ARG C 2  640  ? 31.601  -11.076 101.875 1.00   55.53  ? 640  ARG C C     1 
ATOM   8638  O  O     . ARG C 2  640  ? 30.882  -12.069 101.778 1.00   56.36  ? 640  ARG C O     1 
ATOM   8639  C  CB    . ARG C 2  640  ? 30.203  -9.001  101.909 1.00   57.03  ? 640  ARG C CB    1 
ATOM   8640  C  CG    . ARG C 2  640  ? 29.694  -7.769  101.176 1.00   57.27  ? 640  ARG C CG    1 
ATOM   8641  C  CD    . ARG C 2  640  ? 28.460  -7.186  101.845 1.00   67.00  ? 640  ARG C CD    1 
ATOM   8642  N  NE    . ARG C 2  640  ? 27.354  -8.140  101.866 1.00   70.80  ? 640  ARG C NE    1 
ATOM   8643  C  CZ    . ARG C 2  640  ? 26.526  -8.348  100.848 1.00   70.75  ? 640  ARG C CZ    1 
ATOM   8644  N  NH1   . ARG C 2  640  ? 26.676  -7.669  99.718  1.00   71.37  ? 640  ARG C NH1   1 
ATOM   8645  N  NH2   . ARG C 2  640  ? 25.548  -9.237  100.957 1.00   64.43  ? 640  ARG C NH2   1 
ATOM   8646  N  N     . PRO C 2  641  ? 32.717  -11.059 102.621 1.00   56.02  ? 641  PRO C N     1 
ATOM   8647  C  CA    . PRO C 2  641  ? 33.138  -12.261 103.350 1.00   54.70  ? 641  PRO C CA    1 
ATOM   8648  C  C     . PRO C 2  641  ? 32.190  -12.607 104.496 1.00   55.06  ? 641  PRO C C     1 
ATOM   8649  O  O     . PRO C 2  641  ? 31.868  -11.747 105.316 1.00   50.58  ? 641  PRO C O     1 
ATOM   8650  C  CB    . PRO C 2  641  ? 34.516  -11.873 103.894 1.00   59.49  ? 641  PRO C CB    1 
ATOM   8651  C  CG    . PRO C 2  641  ? 34.492  -10.383 103.965 1.00   58.65  ? 641  PRO C CG    1 
ATOM   8652  C  CD    . PRO C 2  641  ? 33.642  -9.930  102.819 1.00   55.83  ? 641  PRO C CD    1 
ATOM   8653  N  N     . ARG C 2  642  ? 31.742  -13.858 104.537 1.00   56.22  ? 642  ARG C N     1 
ATOM   8654  C  CA    . ARG C 2  642  ? 30.906  -14.348 105.630 1.00   57.09  ? 642  ARG C CA    1 
ATOM   8655  C  C     . ARG C 2  642  ? 31.673  -15.168 106.673 1.00   59.51  ? 642  ARG C C     1 
ATOM   8656  O  O     . ARG C 2  642  ? 31.086  -15.669 107.634 1.00   58.62  ? 642  ARG C O     1 
ATOM   8657  C  CB    . ARG C 2  642  ? 29.703  -15.121 105.084 1.00   50.84  ? 642  ARG C CB    1 
ATOM   8658  C  CG    . ARG C 2  642  ? 28.649  -14.219 104.460 1.00   45.93  ? 642  ARG C CG    1 
ATOM   8659  C  CD    . ARG C 2  642  ? 28.088  -13.247 105.492 1.00   53.84  ? 642  ARG C CD    1 
ATOM   8660  N  NE    . ARG C 2  642  ? 27.231  -12.225 104.896 1.00   53.37  ? 642  ARG C NE    1 
ATOM   8661  C  CZ    . ARG C 2  642  ? 27.594  -10.960 104.710 1.00   52.84  ? 642  ARG C CZ    1 
ATOM   8662  N  NH1   . ARG C 2  642  ? 28.801  -10.551 105.077 1.00   49.98  ? 642  ARG C NH1   1 
ATOM   8663  N  NH2   . ARG C 2  642  ? 26.747  -10.099 104.161 1.00   51.55  ? 642  ARG C NH2   1 
ATOM   8664  N  N     . VAL C 2  643  ? 32.981  -15.301 106.479 1.00   55.23  ? 643  VAL C N     1 
ATOM   8665  C  CA    . VAL C 2  643  ? 33.807  -16.131 107.351 1.00   50.74  ? 643  VAL C CA    1 
ATOM   8666  C  C     . VAL C 2  643  ? 34.909  -15.320 108.023 1.00   55.29  ? 643  VAL C C     1 
ATOM   8667  O  O     . VAL C 2  643  ? 35.233  -14.215 107.590 1.00   56.54  ? 643  VAL C O     1 
ATOM   8668  C  CB    . VAL C 2  643  ? 34.449  -17.299 106.580 1.00   50.54  ? 643  VAL C CB    1 
ATOM   8669  C  CG1   . VAL C 2  643  ? 33.378  -18.214 106.015 1.00   50.40  ? 643  VAL C CG1   1 
ATOM   8670  C  CG2   . VAL C 2  643  ? 35.349  -16.773 105.473 1.00   59.17  ? 643  VAL C CG2   1 
ATOM   8671  N  N     . VAL C 2  644  ? 35.477  -15.875 109.088 1.00   57.56  ? 644  VAL C N     1 
ATOM   8672  C  CA    . VAL C 2  644  ? 36.530  -15.195 109.832 1.00   65.18  ? 644  VAL C CA    1 
ATOM   8673  C  C     . VAL C 2  644  ? 37.808  -16.035 109.836 1.00   70.29  ? 644  VAL C C     1 
ATOM   8674  O  O     . VAL C 2  644  ? 37.772  -17.234 109.551 1.00   60.12  ? 644  VAL C O     1 
ATOM   8675  C  CB    . VAL C 2  644  ? 36.087  -14.885 111.280 1.00   56.21  ? 644  VAL C CB    1 
ATOM   8676  C  CG1   . VAL C 2  644  ? 36.276  -16.105 112.169 1.00   61.67  ? 644  VAL C CG1   1 
ATOM   8677  C  CG2   . VAL C 2  644  ? 36.848  -13.684 111.833 1.00   51.67  ? 644  VAL C CG2   1 
ATOM   8678  N  N     . VAL C 2  645  ? 38.934  -15.391 110.133 1.00   74.69  ? 645  VAL C N     1 
ATOM   8679  C  CA    . VAL C 2  645  ? 40.238  -16.048 110.149 1.00   67.64  ? 645  VAL C CA    1 
ATOM   8680  C  C     . VAL C 2  645  ? 40.266  -17.244 111.097 1.00   63.58  ? 645  VAL C C     1 
ATOM   8681  O  O     . VAL C 2  645  ? 39.832  -17.149 112.246 1.00   53.06  ? 645  VAL C O     1 
ATOM   8682  C  CB    . VAL C 2  645  ? 41.355  -15.060 110.554 1.00   56.13  ? 645  VAL C CB    1 
ATOM   8683  C  CG1   . VAL C 2  645  ? 42.717  -15.731 110.483 1.00   49.83  ? 645  VAL C CG1   1 
ATOM   8684  C  CG2   . VAL C 2  645  ? 41.323  -13.827 109.666 1.00   56.33  ? 645  VAL C CG2   1 
ATOM   8685  N  N     . GLY C 2  646  ? 40.768  -18.372 110.602 1.00   66.26  ? 646  GLY C N     1 
ATOM   8686  C  CA    . GLY C 2  646  ? 40.932  -19.562 111.417 1.00   68.54  ? 646  GLY C CA    1 
ATOM   8687  C  C     . GLY C 2  646  ? 39.716  -20.468 111.441 1.00   66.88  ? 646  GLY C C     1 
ATOM   8688  O  O     . GLY C 2  646  ? 39.754  -21.555 112.020 1.00   71.28  ? 646  GLY C O     1 
ATOM   8689  N  N     . GLN C 2  647  ? 38.635  -20.025 110.811 1.00   63.05  ? 647  GLN C N     1 
ATOM   8690  C  CA    . GLN C 2  647  ? 37.391  -20.786 110.803 1.00   64.31  ? 647  GLN C CA    1 
ATOM   8691  C  C     . GLN C 2  647  ? 37.518  -22.091 110.022 1.00   65.92  ? 647  GLN C C     1 
ATOM   8692  O  O     . GLN C 2  647  ? 38.004  -22.104 108.891 1.00   69.77  ? 647  GLN C O     1 
ATOM   8693  C  CB    . GLN C 2  647  ? 36.254  -19.940 110.228 1.00   59.06  ? 647  GLN C CB    1 
ATOM   8694  C  CG    . GLN C 2  647  ? 34.939  -20.682 110.079 1.00   59.19  ? 647  GLN C CG    1 
ATOM   8695  C  CD    . GLN C 2  647  ? 33.817  -19.779 109.612 1.00   57.22  ? 647  GLN C CD    1 
ATOM   8696  O  OE1   . GLN C 2  647  ? 33.958  -18.556 109.597 1.00   55.96  ? 647  GLN C OE1   1 
ATOM   8697  N  NE2   . GLN C 2  647  ? 32.695  -20.377 109.226 1.00   51.99  ? 647  GLN C NE2   1 
ATOM   8698  N  N     . ARG C 2  648  ? 37.085  -23.188 110.637 1.00   66.49  ? 648  ARG C N     1 
ATOM   8699  C  CA    . ARG C 2  648  ? 37.058  -24.480 109.964 1.00   72.92  ? 648  ARG C CA    1 
ATOM   8700  C  C     . ARG C 2  648  ? 35.846  -24.562 109.044 1.00   71.42  ? 648  ARG C C     1 
ATOM   8701  O  O     . ARG C 2  648  ? 34.719  -24.302 109.465 1.00   70.83  ? 648  ARG C O     1 
ATOM   8702  C  CB    . ARG C 2  648  ? 37.011  -25.621 110.982 1.00   81.15  ? 648  ARG C CB    1 
ATOM   8703  C  CG    . ARG C 2  648  ? 38.228  -25.720 111.889 1.00   90.79  ? 648  ARG C CG    1 
ATOM   8704  C  CD    . ARG C 2  648  ? 38.067  -26.862 112.884 1.00   104.44 ? 648  ARG C CD    1 
ATOM   8705  N  NE    . ARG C 2  648  ? 39.190  -26.958 113.812 1.00   115.38 ? 648  ARG C NE    1 
ATOM   8706  C  CZ    . ARG C 2  648  ? 39.262  -27.833 114.810 1.00   105.42 ? 648  ARG C CZ    1 
ATOM   8707  N  NH1   . ARG C 2  648  ? 38.272  -28.692 115.013 1.00   100.14 ? 648  ARG C NH1   1 
ATOM   8708  N  NH2   . ARG C 2  648  ? 40.322  -27.850 115.607 1.00   90.96  ? 648  ARG C NH2   1 
ATOM   8709  N  N     . VAL C 2  649  ? 36.080  -24.921 107.786 1.00   72.43  ? 649  VAL C N     1 
ATOM   8710  C  CA    . VAL C 2  649  ? 34.995  -25.047 106.818 1.00   71.45  ? 649  VAL C CA    1 
ATOM   8711  C  C     . VAL C 2  649  ? 35.070  -26.365 106.050 1.00   75.18  ? 649  VAL C C     1 
ATOM   8712  O  O     . VAL C 2  649  ? 36.154  -26.826 105.691 1.00   76.43  ? 649  VAL C O     1 
ATOM   8713  C  CB    . VAL C 2  649  ? 34.974  -23.866 105.822 1.00   69.75  ? 649  VAL C CB    1 
ATOM   8714  C  CG1   . VAL C 2  649  ? 34.528  -22.590 106.519 1.00   72.09  ? 649  VAL C CG1   1 
ATOM   8715  C  CG2   . VAL C 2  649  ? 36.340  -23.682 105.176 1.00   66.64  ? 649  VAL C CG2   1 
ATOM   8716  N  N     . ARG C 2  650  ? 33.912  -26.970 105.809 1.00   78.31  ? 650  ARG C N     1 
ATOM   8717  C  CA    . ARG C 2  650  ? 33.842  -28.212 105.049 1.00   76.54  ? 650  ARG C CA    1 
ATOM   8718  C  C     . ARG C 2  650  ? 33.554  -27.928 103.581 1.00   76.82  ? 650  ARG C C     1 
ATOM   8719  O  O     . ARG C 2  650  ? 33.453  -26.771 103.171 1.00   74.27  ? 650  ARG C O     1 
ATOM   8720  C  CB    . ARG C 2  650  ? 32.765  -29.138 105.619 1.00   76.92  ? 650  ARG C CB    1 
ATOM   8721  C  CG    . ARG C 2  650  ? 32.989  -29.549 107.065 1.00   79.88  ? 650  ARG C CG    1 
ATOM   8722  C  CD    . ARG C 2  650  ? 31.946  -30.563 107.512 1.00   85.86  ? 650  ARG C CD    1 
ATOM   8723  N  NE    . ARG C 2  650  ? 32.043  -30.858 108.938 1.00   99.24  ? 650  ARG C NE    1 
ATOM   8724  C  CZ    . ARG C 2  650  ? 31.381  -30.198 109.883 1.00   100.23 ? 650  ARG C CZ    1 
ATOM   8725  N  NH1   . ARG C 2  650  ? 30.571  -29.201 109.552 1.00   98.23  ? 650  ARG C NH1   1 
ATOM   8726  N  NH2   . ARG C 2  650  ? 31.527  -30.533 111.158 1.00   93.54  ? 650  ARG C NH2   1 
ATOM   8727  N  N     . LYS C 2  651  ? 33.419  -28.990 102.794 1.00   81.08  ? 651  LYS C N     1 
ATOM   8728  C  CA    . LYS C 2  651  ? 33.143  -28.860 101.369 1.00   82.42  ? 651  LYS C CA    1 
ATOM   8729  C  C     . LYS C 2  651  ? 31.724  -28.355 101.140 1.00   86.99  ? 651  LYS C C     1 
ATOM   8730  O  O     . LYS C 2  651  ? 30.760  -28.936 101.643 1.00   84.98  ? 651  LYS C O     1 
ATOM   8731  C  CB    . LYS C 2  651  ? 33.340  -30.205 100.667 1.00   79.56  ? 651  LYS C CB    1 
ATOM   8732  C  CG    . LYS C 2  651  ? 33.208  -30.155 99.154  1.00   73.59  ? 651  LYS C CG    1 
ATOM   8733  C  CD    . LYS C 2  651  ? 33.330  -31.547 98.550  1.00   80.47  ? 651  LYS C CD    1 
ATOM   8734  C  CE    . LYS C 2  651  ? 33.320  -31.504 97.030  1.00   74.38  ? 651  LYS C CE    1 
ATOM   8735  N  NZ    . LYS C 2  651  ? 34.513  -30.798 96.487  1.00   73.92  ? 651  LYS C NZ    1 
ATOM   8736  N  N     . GLY C 2  652  ? 31.603  -27.271 100.381 1.00   82.21  ? 652  GLY C N     1 
ATOM   8737  C  CA    . GLY C 2  652  ? 30.307  -26.699 100.068 1.00   76.73  ? 652  GLY C CA    1 
ATOM   8738  C  C     . GLY C 2  652  ? 29.884  -25.597 101.020 1.00   80.07  ? 652  GLY C C     1 
ATOM   8739  O  O     . GLY C 2  652  ? 28.833  -24.983 100.839 1.00   82.48  ? 652  GLY C O     1 
ATOM   8740  N  N     . ASP C 2  653  ? 30.696  -25.343 102.039 1.00   83.26  ? 653  ASP C N     1 
ATOM   8741  C  CA    . ASP C 2  653  ? 30.397  -24.278 102.991 1.00   78.22  ? 653  ASP C CA    1 
ATOM   8742  C  C     . ASP C 2  653  ? 30.526  -22.900 102.348 1.00   70.19  ? 653  ASP C C     1 
ATOM   8743  O  O     . ASP C 2  653  ? 31.219  -22.735 101.345 1.00   68.60  ? 653  ASP C O     1 
ATOM   8744  C  CB    . ASP C 2  653  ? 31.304  -24.380 104.218 1.00   78.42  ? 653  ASP C CB    1 
ATOM   8745  C  CG    . ASP C 2  653  ? 30.792  -25.378 105.242 1.00   79.46  ? 653  ASP C CG    1 
ATOM   8746  O  OD1   . ASP C 2  653  ? 31.001  -25.153 106.454 1.00   76.52  ? 653  ASP C OD1   1 
ATOM   8747  O  OD2   . ASP C 2  653  ? 30.176  -26.385 104.837 1.00   77.83  ? 653  ASP C OD2   1 
ATOM   8748  N  N     . LEU C 2  654  ? 29.868  -21.911 102.942 1.00   60.05  ? 654  LEU C N     1 
ATOM   8749  C  CA    . LEU C 2  654  ? 29.800  -20.576 102.368 1.00   55.10  ? 654  LEU C CA    1 
ATOM   8750  C  C     . LEU C 2  654  ? 31.003  -19.734 102.789 1.00   55.48  ? 654  LEU C C     1 
ATOM   8751  O  O     . LEU C 2  654  ? 31.189  -19.452 103.972 1.00   59.60  ? 654  LEU C O     1 
ATOM   8752  C  CB    . LEU C 2  654  ? 28.507  -19.910 102.841 1.00   53.46  ? 654  LEU C CB    1 
ATOM   8753  C  CG    . LEU C 2  654  ? 27.850  -18.742 102.100 1.00   46.65  ? 654  LEU C CG    1 
ATOM   8754  C  CD1   . LEU C 2  654  ? 26.698  -18.287 102.937 1.00   48.33  ? 654  LEU C CD1   1 
ATOM   8755  C  CD2   . LEU C 2  654  ? 28.785  -17.581 101.871 1.00   50.74  ? 654  LEU C CD2   1 
ATOM   8756  N  N     . LEU C 2  655  ? 31.823  -19.352 101.815 1.00   57.45  ? 655  LEU C N     1 
ATOM   8757  C  CA    . LEU C 2  655  ? 32.936  -18.436 102.054 1.00   54.56  ? 655  LEU C CA    1 
ATOM   8758  C  C     . LEU C 2  655  ? 32.556  -16.950 102.009 1.00   51.74  ? 655  LEU C C     1 
ATOM   8759  O  O     . LEU C 2  655  ? 32.948  -16.174 102.881 1.00   49.29  ? 655  LEU C O     1 
ATOM   8760  C  CB    . LEU C 2  655  ? 34.086  -18.729 101.085 1.00   50.50  ? 655  LEU C CB    1 
ATOM   8761  C  CG    . LEU C 2  655  ? 34.765  -20.089 101.278 1.00   51.68  ? 655  LEU C CG    1 
ATOM   8762  C  CD1   . LEU C 2  655  ? 35.877  -20.305 100.264 1.00   58.12  ? 655  LEU C CD1   1 
ATOM   8763  C  CD2   . LEU C 2  655  ? 35.303  -20.208 102.693 1.00   58.81  ? 655  LEU C CD2   1 
ATOM   8764  N  N     . ALA C 2  656  ? 31.775  -16.563 101.003 1.00   52.54  ? 656  ALA C N     1 
ATOM   8765  C  CA    . ALA C 2  656  ? 31.407  -15.159 100.822 1.00   50.92  ? 656  ALA C CA    1 
ATOM   8766  C  C     . ALA C 2  656  ? 30.011  -14.967 100.220 1.00   47.41  ? 656  ALA C C     1 
ATOM   8767  O  O     . ALA C 2  656  ? 29.574  -15.742 99.370  1.00   43.24  ? 656  ALA C O     1 
ATOM   8768  C  CB    . ALA C 2  656  ? 32.455  -14.441 99.988  1.00   55.79  ? 656  ALA C CB    1 
ATOM   8769  N  N     . ASP C 2  657  ? 29.315  -13.929 100.679 1.00   50.91  ? 657  ASP C N     1 
ATOM   8770  C  CA    . ASP C 2  657  ? 27.945  -13.657 100.251 1.00   50.31  ? 657  ASP C CA    1 
ATOM   8771  C  C     . ASP C 2  657  ? 27.898  -12.793 98.998  1.00   55.08  ? 657  ASP C C     1 
ATOM   8772  O  O     . ASP C 2  657  ? 28.457  -11.697 98.970  1.00   61.42  ? 657  ASP C O     1 
ATOM   8773  C  CB    . ASP C 2  657  ? 27.171  -12.959 101.372 1.00   51.80  ? 657  ASP C CB    1 
ATOM   8774  C  CG    . ASP C 2  657  ? 26.017  -13.792 101.892 1.00   53.24  ? 657  ASP C CG    1 
ATOM   8775  O  OD1   . ASP C 2  657  ? 25.497  -14.634 101.130 1.00   53.27  ? 657  ASP C OD1   1 
ATOM   8776  O  OD2   . ASP C 2  657  ? 25.627  -13.600 103.063 1.00   52.00  ? 657  ASP C OD2   1 
ATOM   8777  N  N     . GLY C 2  658  ? 27.218  -13.283 97.968  1.00   49.89  ? 658  GLY C N     1 
ATOM   8778  C  CA    . GLY C 2  658  ? 27.038  -12.517 96.748  1.00   51.50  ? 658  GLY C CA    1 
ATOM   8779  C  C     . GLY C 2  658  ? 25.980  -11.443 96.920  1.00   55.79  ? 658  GLY C C     1 
ATOM   8780  O  O     . GLY C 2  658  ? 25.427  -11.285 98.010  1.00   57.16  ? 658  GLY C O     1 
ATOM   8781  N  N     . PRO C 2  659  ? 25.689  -10.695 95.843  1.00   56.38  ? 659  PRO C N     1 
ATOM   8782  C  CA    . PRO C 2  659  ? 24.646  -9.665  95.897  1.00   57.03  ? 659  PRO C CA    1 
ATOM   8783  C  C     . PRO C 2  659  ? 23.269  -10.295 96.073  1.00   49.90  ? 659  PRO C C     1 
ATOM   8784  O  O     . PRO C 2  659  ? 23.029  -11.382 95.542  1.00   49.24  ? 659  PRO C O     1 
ATOM   8785  C  CB    . PRO C 2  659  ? 24.750  -8.992  94.525  1.00   47.36  ? 659  PRO C CB    1 
ATOM   8786  C  CG    . PRO C 2  659  ? 25.327  -10.037 93.637  1.00   40.95  ? 659  PRO C CG    1 
ATOM   8787  C  CD    . PRO C 2  659  ? 26.284  -10.810 94.500  1.00   50.09  ? 659  PRO C CD    1 
ATOM   8788  N  N     . ALA C 2  660  ? 22.392  -9.622  96.813  1.00   37.84  ? 660  ALA C N     1 
ATOM   8789  C  CA    . ALA C 2  660  ? 21.046  -10.122 97.081  1.00   39.43  ? 660  ALA C CA    1 
ATOM   8790  C  C     . ALA C 2  660  ? 21.066  -11.483 97.771  1.00   42.82  ? 660  ALA C C     1 
ATOM   8791  O  O     . ALA C 2  660  ? 20.247  -12.352 97.477  1.00   39.18  ? 660  ALA C O     1 
ATOM   8792  C  CB    . ALA C 2  660  ? 20.224  -10.183 95.796  1.00   38.86  ? 660  ALA C CB    1 
ATOM   8793  N  N     . SER C 2  661  ? 22.011  -11.662 98.688  1.00   47.96  ? 661  SER C N     1 
ATOM   8794  C  CA    . SER C 2  661  ? 22.138  -12.918 99.416  1.00   48.78  ? 661  SER C CA    1 
ATOM   8795  C  C     . SER C 2  661  ? 22.452  -12.686 100.890 1.00   51.61  ? 661  SER C C     1 
ATOM   8796  O  O     . SER C 2  661  ? 23.396  -11.971 101.229 1.00   55.87  ? 661  SER C O     1 
ATOM   8797  C  CB    . SER C 2  661  ? 23.222  -13.794 98.782  1.00   53.61  ? 661  SER C CB    1 
ATOM   8798  O  OG    . SER C 2  661  ? 23.393  -15.004 99.499  1.00   55.87  ? 661  SER C OG    1 
ATOM   8799  N  N     . GLU C 2  662  ? 21.655  -13.292 101.764 1.00   45.77  ? 662  GLU C N     1 
ATOM   8800  C  CA    . GLU C 2  662  ? 21.908  -13.219 103.195 1.00   46.50  ? 662  GLU C CA    1 
ATOM   8801  C  C     . GLU C 2  662  ? 22.261  -14.601 103.728 1.00   52.91  ? 662  GLU C C     1 
ATOM   8802  O  O     . GLU C 2  662  ? 21.401  -15.480 103.806 1.00   52.57  ? 662  GLU C O     1 
ATOM   8803  C  CB    . GLU C 2  662  ? 20.686  -12.670 103.935 1.00   41.00  ? 662  GLU C CB    1 
ATOM   8804  C  CG    . GLU C 2  662  ? 20.923  -12.421 105.416 1.00   40.89  ? 662  GLU C CG    1 
ATOM   8805  C  CD    . GLU C 2  662  ? 19.660  -12.024 106.152 1.00   40.81  ? 662  GLU C CD    1 
ATOM   8806  O  OE1   . GLU C 2  662  ? 18.586  -12.572 105.826 1.00   39.60  ? 662  GLU C OE1   1 
ATOM   8807  O  OE2   . GLU C 2  662  ? 19.741  -11.164 107.054 1.00   39.75  ? 662  GLU C OE2   1 
ATOM   8808  N  N     . ASN C 2  663  ? 23.528  -14.777 104.095 1.00   54.34  ? 663  ASN C N     1 
ATOM   8809  C  CA    . ASN C 2  663  ? 24.030  -16.044 104.623 1.00   47.52  ? 663  ASN C CA    1 
ATOM   8810  C  C     . ASN C 2  663  ? 23.671  -17.255 103.763 1.00   47.30  ? 663  ASN C C     1 
ATOM   8811  O  O     . ASN C 2  663  ? 23.368  -18.328 104.284 1.00   46.11  ? 663  ASN C O     1 
ATOM   8812  C  CB    . ASN C 2  663  ? 23.562  -16.253 106.067 1.00   47.91  ? 663  ASN C CB    1 
ATOM   8813  C  CG    . ASN C 2  663  ? 23.980  -15.119 106.987 1.00   49.58  ? 663  ASN C CG    1 
ATOM   8814  O  OD1   . ASN C 2  663  ? 25.044  -14.523 106.815 1.00   41.25  ? 663  ASN C OD1   1 
ATOM   8815  N  ND2   . ASN C 2  663  ? 23.139  -14.814 107.970 1.00   54.01  ? 663  ASN C ND2   1 
ATOM   8816  N  N     . GLY C 2  664  ? 23.714  -17.076 102.445 1.00   45.99  ? 664  GLY C N     1 
ATOM   8817  C  CA    . GLY C 2  664  ? 23.482  -18.168 101.514 1.00   50.19  ? 664  GLY C CA    1 
ATOM   8818  C  C     . GLY C 2  664  ? 22.051  -18.240 101.017 1.00   55.00  ? 664  GLY C C     1 
ATOM   8819  O  O     . GLY C 2  664  ? 21.755  -18.940 100.048 1.00   52.16  ? 664  GLY C O     1 
ATOM   8820  N  N     . PHE C 2  665  ? 21.162  -17.514 101.685 1.00   51.04  ? 665  PHE C N     1 
ATOM   8821  C  CA    . PHE C 2  665  ? 19.752  -17.481 101.315 1.00   46.19  ? 665  PHE C CA    1 
ATOM   8822  C  C     . PHE C 2  665  ? 19.457  -16.258 100.455 1.00   40.98  ? 665  PHE C C     1 
ATOM   8823  O  O     . PHE C 2  665  ? 20.043  -15.197 100.658 1.00   41.46  ? 665  PHE C O     1 
ATOM   8824  C  CB    . PHE C 2  665  ? 18.874  -17.472 102.565 1.00   53.17  ? 665  PHE C CB    1 
ATOM   8825  C  CG    . PHE C 2  665  ? 18.990  -18.718 103.400 1.00   56.41  ? 665  PHE C CG    1 
ATOM   8826  C  CD1   . PHE C 2  665  ? 18.089  -19.760 103.242 1.00   57.88  ? 665  PHE C CD1   1 
ATOM   8827  C  CD2   . PHE C 2  665  ? 19.993  -18.845 104.347 1.00   54.69  ? 665  PHE C CD2   1 
ATOM   8828  C  CE1   . PHE C 2  665  ? 18.190  -20.904 104.010 1.00   61.23  ? 665  PHE C CE1   1 
ATOM   8829  C  CE2   . PHE C 2  665  ? 20.100  -19.986 105.116 1.00   58.51  ? 665  PHE C CE2   1 
ATOM   8830  C  CZ    . PHE C 2  665  ? 19.198  -21.017 104.948 1.00   60.93  ? 665  PHE C CZ    1 
ATOM   8831  N  N     . LEU C 2  666  ? 18.553  -16.411 99.491  1.00   34.51  ? 666  LEU C N     1 
ATOM   8832  C  CA    . LEU C 2  666  ? 18.258  -15.340 98.540  1.00   34.98  ? 666  LEU C CA    1 
ATOM   8833  C  C     . LEU C 2  666  ? 17.539  -14.169 99.203  1.00   37.75  ? 666  LEU C C     1 
ATOM   8834  O  O     . LEU C 2  666  ? 16.468  -14.335 99.786  1.00   41.33  ? 666  LEU C O     1 
ATOM   8835  C  CB    . LEU C 2  666  ? 17.419  -15.887 97.382  1.00   31.73  ? 666  LEU C CB    1 
ATOM   8836  C  CG    . LEU C 2  666  ? 16.975  -14.885 96.318  1.00   27.02  ? 666  LEU C CG    1 
ATOM   8837  C  CD1   . LEU C 2  666  ? 18.175  -14.168 95.729  1.00   28.58  ? 666  LEU C CD1   1 
ATOM   8838  C  CD2   . LEU C 2  666  ? 16.179  -15.581 95.232  1.00   23.67  ? 666  LEU C CD2   1 
ATOM   8839  N  N     . ALA C 2  667  ? 18.132  -12.983 99.109  1.00   39.39  ? 667  ALA C N     1 
ATOM   8840  C  CA    . ALA C 2  667  ? 17.532  -11.793 99.698  1.00   38.32  ? 667  ALA C CA    1 
ATOM   8841  C  C     . ALA C 2  667  ? 17.115  -10.809 98.620  1.00   38.30  ? 667  ALA C C     1 
ATOM   8842  O  O     . ALA C 2  667  ? 17.952  -10.119 98.045  1.00   38.54  ? 667  ALA C O     1 
ATOM   8843  C  CB    . ALA C 2  667  ? 18.530  -11.137 100.632 1.00   37.78  ? 667  ALA C CB    1 
ATOM   8844  N  N     . LEU C 2  668  ? 15.815  -10.723 98.368  1.00   34.15  ? 668  LEU C N     1 
ATOM   8845  C  CA    . LEU C 2  668  ? 15.314  -9.822  97.345  1.00   33.65  ? 668  LEU C CA    1 
ATOM   8846  C  C     . LEU C 2  668  ? 14.799  -8.510  97.926  1.00   39.94  ? 668  LEU C C     1 
ATOM   8847  O  O     . LEU C 2  668  ? 14.415  -7.601  97.189  1.00   39.31  ? 668  LEU C O     1 
ATOM   8848  C  CB    . LEU C 2  668  ? 14.228  -10.509 96.520  1.00   31.51  ? 668  LEU C CB    1 
ATOM   8849  C  CG    . LEU C 2  668  ? 14.703  -11.708 95.701  1.00   33.62  ? 668  LEU C CG    1 
ATOM   8850  C  CD1   . LEU C 2  668  ? 13.577  -12.254 94.838  1.00   32.16  ? 668  LEU C CD1   1 
ATOM   8851  C  CD2   . LEU C 2  668  ? 15.904  -11.329 94.848  1.00   28.11  ? 668  LEU C CD2   1 
ATOM   8852  N  N     . GLY C 2  669  ? 14.809  -8.410  99.250  1.00   33.44  ? 669  GLY C N     1 
ATOM   8853  C  CA    . GLY C 2  669  ? 14.224  -7.265  99.920  1.00   29.97  ? 669  GLY C CA    1 
ATOM   8854  C  C     . GLY C 2  669  ? 14.251  -7.395  101.428 1.00   32.83  ? 669  GLY C C     1 
ATOM   8855  O  O     . GLY C 2  669  ? 15.052  -8.149  101.979 1.00   35.50  ? 669  GLY C O     1 
ATOM   8856  N  N     . GLN C 2  670  ? 13.373  -6.656  102.098 1.00   33.58  ? 670  GLN C N     1 
ATOM   8857  C  CA    . GLN C 2  670  ? 13.387  -6.590  103.554 1.00   30.53  ? 670  GLN C CA    1 
ATOM   8858  C  C     . GLN C 2  670  ? 12.172  -7.270  104.171 1.00   33.97  ? 670  GLN C C     1 
ATOM   8859  O  O     . GLN C 2  670  ? 11.104  -7.344  103.555 1.00   33.96  ? 670  GLN C O     1 
ATOM   8860  C  CB    . GLN C 2  670  ? 13.435  -5.131  104.017 1.00   29.25  ? 670  GLN C CB    1 
ATOM   8861  C  CG    . GLN C 2  670  ? 14.430  -4.257  103.265 1.00   34.64  ? 670  GLN C CG    1 
ATOM   8862  C  CD    . GLN C 2  670  ? 15.853  -4.410  103.765 1.00   35.58  ? 670  GLN C CD    1 
ATOM   8863  O  OE1   . GLN C 2  670  ? 16.789  -3.869  103.175 1.00   30.65  ? 670  GLN C OE1   1 
ATOM   8864  N  NE2   . GLN C 2  670  ? 16.023  -5.141  104.862 1.00   36.82  ? 670  GLN C NE2   1 
ATOM   8865  N  N     . ASN C 2  671  ? 12.348  -7.775  105.388 1.00   35.42  ? 671  ASN C N     1 
ATOM   8866  C  CA    . ASN C 2  671  ? 11.229  -8.258  106.182 1.00   30.05  ? 671  ASN C CA    1 
ATOM   8867  C  C     . ASN C 2  671  ? 10.753  -7.128  107.075 1.00   33.30  ? 671  ASN C C     1 
ATOM   8868  O  O     . ASN C 2  671  ? 11.437  -6.746  108.024 1.00   43.14  ? 671  ASN C O     1 
ATOM   8869  C  CB    . ASN C 2  671  ? 11.659  -9.441  107.047 1.00   30.40  ? 671  ASN C CB    1 
ATOM   8870  C  CG    . ASN C 2  671  ? 12.025  -10.658 106.229 1.00   32.44  ? 671  ASN C CG    1 
ATOM   8871  O  OD1   . ASN C 2  671  ? 11.263  -11.091 105.365 1.00   30.51  ? 671  ASN C OD1   1 
ATOM   8872  N  ND2   . ASN C 2  671  ? 13.198  -11.219 106.497 1.00   35.51  ? 671  ASN C ND2   1 
ATOM   8873  N  N     . VAL C 2  672  ? 9.572   -6.601  106.779 1.00   27.62  ? 672  VAL C N     1 
ATOM   8874  C  CA    . VAL C 2  672  ? 9.071   -5.439  107.499 1.00   29.29  ? 672  VAL C CA    1 
ATOM   8875  C  C     . VAL C 2  672  ? 7.798   -5.764  108.264 1.00   33.48  ? 672  VAL C C     1 
ATOM   8876  O  O     . VAL C 2  672  ? 7.057   -6.673  107.894 1.00   32.82  ? 672  VAL C O     1 
ATOM   8877  C  CB    . VAL C 2  672  ? 8.800   -4.268  106.543 1.00   24.67  ? 672  VAL C CB    1 
ATOM   8878  C  CG1   . VAL C 2  672  ? 10.108  -3.645  106.087 1.00   25.84  ? 672  VAL C CG1   1 
ATOM   8879  C  CG2   . VAL C 2  672  ? 7.983   -4.740  105.353 1.00   26.32  ? 672  VAL C CG2   1 
ATOM   8880  N  N     . LEU C 2  673  ? 7.546   -5.018  109.333 1.00   32.68  ? 673  LEU C N     1 
ATOM   8881  C  CA    . LEU C 2  673  ? 6.327   -5.205  110.101 1.00   30.65  ? 673  LEU C CA    1 
ATOM   8882  C  C     . LEU C 2  673  ? 5.216   -4.390  109.456 1.00   32.47  ? 673  LEU C C     1 
ATOM   8883  O  O     . LEU C 2  673  ? 5.280   -3.161  109.407 1.00   31.07  ? 673  LEU C O     1 
ATOM   8884  C  CB    . LEU C 2  673  ? 6.535   -4.766  111.550 1.00   31.12  ? 673  LEU C CB    1 
ATOM   8885  C  CG    . LEU C 2  673  ? 5.424   -5.129  112.534 1.00   27.93  ? 673  LEU C CG    1 
ATOM   8886  C  CD1   . LEU C 2  673  ? 5.209   -6.633  112.553 1.00   25.67  ? 673  LEU C CD1   1 
ATOM   8887  C  CD2   . LEU C 2  673  ? 5.756   -4.613  113.925 1.00   27.10  ? 673  LEU C CD2   1 
ATOM   8888  N  N     . VAL C 2  674  ? 4.195   -5.082  108.965 1.00   33.53  ? 674  VAL C N     1 
ATOM   8889  C  CA    . VAL C 2  674  ? 3.114   -4.426  108.245 1.00   28.90  ? 674  VAL C CA    1 
ATOM   8890  C  C     . VAL C 2  674  ? 1.800   -4.511  109.005 1.00   30.79  ? 674  VAL C C     1 
ATOM   8891  O  O     . VAL C 2  674  ? 1.507   -5.508  109.668 1.00   35.33  ? 674  VAL C O     1 
ATOM   8892  C  CB    . VAL C 2  674  ? 2.926   -5.005  106.819 1.00   27.45  ? 674  VAL C CB    1 
ATOM   8893  C  CG1   . VAL C 2  674  ? 4.241   -4.988  106.059 1.00   32.29  ? 674  VAL C CG1   1 
ATOM   8894  C  CG2   . VAL C 2  674  ? 2.352   -6.415  106.867 1.00   24.90  ? 674  VAL C CG2   1 
ATOM   8895  N  N     . ALA C 2  675  ? 1.023   -3.439  108.919 1.00   28.38  ? 675  ALA C N     1 
ATOM   8896  C  CA    . ALA C 2  675  ? -0.325  -3.419  109.456 1.00   30.22  ? 675  ALA C CA    1 
ATOM   8897  C  C     . ALA C 2  675  ? -1.259  -3.177  108.288 1.00   30.69  ? 675  ALA C C     1 
ATOM   8898  O  O     . ALA C 2  675  ? -1.040  -2.254  107.503 1.00   29.22  ? 675  ALA C O     1 
ATOM   8899  C  CB    . ALA C 2  675  ? -0.469  -2.316  110.488 1.00   26.59  ? 675  ALA C CB    1 
ATOM   8900  N  N     . ILE C 2  676  ? -2.302  -3.990  108.161 1.00   33.34  ? 676  ILE C N     1 
ATOM   8901  C  CA    . ILE C 2  676  ? -3.185  -3.824  107.021 1.00   32.37  ? 676  ILE C CA    1 
ATOM   8902  C  C     . ILE C 2  676  ? -4.417  -3.052  107.468 1.00   29.26  ? 676  ILE C C     1 
ATOM   8903  O  O     . ILE C 2  676  ? -5.327  -3.597  108.088 1.00   33.45  ? 676  ILE C O     1 
ATOM   8904  C  CB    . ILE C 2  676  ? -3.617  -5.192  106.456 1.00   28.27  ? 676  ILE C CB    1 
ATOM   8905  C  CG1   . ILE C 2  676  ? -2.406  -6.113  106.295 1.00   21.87  ? 676  ILE C CG1   1 
ATOM   8906  C  CG2   . ILE C 2  676  ? -4.341  -5.024  105.133 1.00   26.35  ? 676  ILE C CG2   1 
ATOM   8907  C  CD1   . ILE C 2  676  ? -2.754  -7.489  105.776 1.00   18.97  ? 676  ILE C CD1   1 
ATOM   8908  N  N     . MET C 2  677  ? -4.427  -1.768  107.129 1.00   25.76  ? 677  MET C N     1 
ATOM   8909  C  CA    . MET C 2  677  ? -5.544  -0.885  107.409 1.00   23.86  ? 677  MET C CA    1 
ATOM   8910  C  C     . MET C 2  677  ? -5.576  0.217   106.360 1.00   25.60  ? 677  MET C C     1 
ATOM   8911  O  O     . MET C 2  677  ? -4.536  0.575   105.810 1.00   32.48  ? 677  MET C O     1 
ATOM   8912  C  CB    . MET C 2  677  ? -5.403  -0.287  108.809 1.00   22.95  ? 677  MET C CB    1 
ATOM   8913  C  CG    . MET C 2  677  ? -4.039  0.329   109.084 1.00   22.32  ? 677  MET C CG    1 
ATOM   8914  S  SD    . MET C 2  677  ? -3.877  0.982   110.759 1.00   23.16  ? 677  MET C SD    1 
ATOM   8915  C  CE    . MET C 2  677  ? -5.154  2.241   110.764 1.00   24.10  ? 677  MET C CE    1 
ATOM   8916  N  N     . PRO C 2  678  ? -6.763  0.766   106.077 1.00   23.64  ? 678  PRO C N     1 
ATOM   8917  C  CA    . PRO C 2  678  ? -6.786  1.983   105.263 1.00   24.23  ? 678  PRO C CA    1 
ATOM   8918  C  C     . PRO C 2  678  ? -6.196  3.123   106.079 1.00   23.86  ? 678  PRO C C     1 
ATOM   8919  O  O     . PRO C 2  678  ? -6.519  3.234   107.261 1.00   27.70  ? 678  PRO C O     1 
ATOM   8920  C  CB    . PRO C 2  678  ? -8.282  2.228   105.036 1.00   27.22  ? 678  PRO C CB    1 
ATOM   8921  C  CG    . PRO C 2  678  ? -8.941  0.912   105.303 1.00   26.52  ? 678  PRO C CG    1 
ATOM   8922  C  CD    . PRO C 2  678  ? -8.115  0.262   106.365 1.00   26.71  ? 678  PRO C CD    1 
ATOM   8923  N  N     . PHE C 2  679  ? -5.335  3.945   105.489 1.00   20.78  ? 679  PHE C N     1 
ATOM   8924  C  CA    . PHE C 2  679  ? -4.807  5.078   106.232 1.00   23.71  ? 679  PHE C CA    1 
ATOM   8925  C  C     . PHE C 2  679  ? -4.984  6.377   105.452 1.00   26.16  ? 679  PHE C C     1 
ATOM   8926  O  O     . PHE C 2  679  ? -4.286  6.617   104.469 1.00   28.31  ? 679  PHE C O     1 
ATOM   8927  C  CB    . PHE C 2  679  ? -3.325  4.835   106.529 1.00   22.41  ? 679  PHE C CB    1 
ATOM   8928  C  CG    . PHE C 2  679  ? -2.750  5.746   107.577 1.00   27.43  ? 679  PHE C CG    1 
ATOM   8929  C  CD1   . PHE C 2  679  ? -2.833  5.416   108.920 1.00   28.14  ? 679  PHE C CD1   1 
ATOM   8930  C  CD2   . PHE C 2  679  ? -2.107  6.920   107.218 1.00   26.14  ? 679  PHE C CD2   1 
ATOM   8931  C  CE1   . PHE C 2  679  ? -2.297  6.248   109.887 1.00   27.33  ? 679  PHE C CE1   1 
ATOM   8932  C  CE2   . PHE C 2  679  ? -1.571  7.754   108.179 1.00   22.17  ? 679  PHE C CE2   1 
ATOM   8933  C  CZ    . PHE C 2  679  ? -1.664  7.418   109.514 1.00   24.90  ? 679  PHE C CZ    1 
ATOM   8934  N  N     . ASP C 2  680  ? -5.920  7.206   105.915 1.00   31.04  ? 680  ASP C N     1 
ATOM   8935  C  CA    . ASP C 2  680  ? -6.128  8.577   105.430 1.00   33.02  ? 680  ASP C CA    1 
ATOM   8936  C  C     . ASP C 2  680  ? -6.080  8.764   103.909 1.00   32.60  ? 680  ASP C C     1 
ATOM   8937  O  O     . ASP C 2  680  ? -5.658  9.814   103.424 1.00   30.72  ? 680  ASP C O     1 
ATOM   8938  C  CB    . ASP C 2  680  ? -5.179  9.556   106.129 1.00   35.95  ? 680  ASP C CB    1 
ATOM   8939  C  CG    . ASP C 2  680  ? -5.650  9.924   107.528 1.00   41.62  ? 680  ASP C CG    1 
ATOM   8940  O  OD1   . ASP C 2  680  ? -6.362  9.109   108.155 1.00   36.84  ? 680  ASP C OD1   1 
ATOM   8941  O  OD2   . ASP C 2  680  ? -5.310  11.030  108.000 1.00   44.75  ? 680  ASP C OD2   1 
ATOM   8942  N  N     . GLY C 2  681  ? -6.524  7.757   103.164 1.00   30.09  ? 681  GLY C N     1 
ATOM   8943  C  CA    . GLY C 2  681  ? -6.484  7.808   101.714 1.00   28.24  ? 681  GLY C CA    1 
ATOM   8944  C  C     . GLY C 2  681  ? -5.087  7.838   101.111 1.00   33.34  ? 681  GLY C C     1 
ATOM   8945  O  O     . GLY C 2  681  ? -4.931  8.027   99.905  1.00   34.25  ? 681  GLY C O     1 
ATOM   8946  N  N     . TYR C 2  682  ? -4.067  7.660   101.944 1.00   32.59  ? 682  TYR C N     1 
ATOM   8947  C  CA    . TYR C 2  682  ? -2.691  7.642   101.458 1.00   25.08  ? 682  TYR C CA    1 
ATOM   8948  C  C     . TYR C 2  682  ? -2.321  6.298   100.836 1.00   25.70  ? 682  TYR C C     1 
ATOM   8949  O  O     . TYR C 2  682  ? -1.467  6.233   99.956  1.00   35.47  ? 682  TYR C O     1 
ATOM   8950  C  CB    . TYR C 2  682  ? -1.709  8.017   102.568 1.00   25.44  ? 682  TYR C CB    1 
ATOM   8951  C  CG    . TYR C 2  682  ? -1.596  9.507   102.808 1.00   33.80  ? 682  TYR C CG    1 
ATOM   8952  C  CD1   . TYR C 2  682  ? -0.729  10.285  102.052 1.00   32.00  ? 682  TYR C CD1   1 
ATOM   8953  C  CD2   . TYR C 2  682  ? -2.352  10.135  103.791 1.00   36.14  ? 682  TYR C CD2   1 
ATOM   8954  C  CE1   . TYR C 2  682  ? -0.617  11.645  102.267 1.00   32.15  ? 682  TYR C CE1   1 
ATOM   8955  C  CE2   . TYR C 2  682  ? -2.248  11.498  104.012 1.00   31.40  ? 682  TYR C CE2   1 
ATOM   8956  C  CZ    . TYR C 2  682  ? -1.379  12.247  103.245 1.00   31.47  ? 682  TYR C CZ    1 
ATOM   8957  O  OH    . TYR C 2  682  ? -1.266  13.601  103.455 1.00   33.45  ? 682  TYR C OH    1 
ATOM   8958  N  N     . ASN C 2  683  ? -2.955  5.228   101.304 1.00   23.01  ? 683  ASN C N     1 
ATOM   8959  C  CA    . ASN C 2  683  ? -2.791  3.913   100.686 1.00   23.53  ? 683  ASN C CA    1 
ATOM   8960  C  C     . ASN C 2  683  ? -3.880  3.597   99.659  1.00   22.16  ? 683  ASN C C     1 
ATOM   8961  O  O     . ASN C 2  683  ? -3.972  2.476   99.159  1.00   24.82  ? 683  ASN C O     1 
ATOM   8962  C  CB    . ASN C 2  683  ? -2.653  2.799   101.729 1.00   23.92  ? 683  ASN C CB    1 
ATOM   8963  C  CG    . ASN C 2  683  ? -3.726  2.850   102.790 1.00   26.84  ? 683  ASN C CG    1 
ATOM   8964  O  OD1   . ASN C 2  683  ? -4.767  3.481   102.612 1.00   32.73  ? 683  ASN C OD1   1 
ATOM   8965  N  ND2   . ASN C 2  683  ? -3.477  2.180   103.908 1.00   27.90  ? 683  ASN C ND2   1 
ATOM   8966  N  N     . PHE C 2  684  ? -4.710  4.597   99.376  1.00   20.50  ? 684  PHE C N     1 
ATOM   8967  C  CA    . PHE C 2  684  ? -5.786  4.499   98.390  1.00   26.59  ? 684  PHE C CA    1 
ATOM   8968  C  C     . PHE C 2  684  ? -5.305  3.996   97.025  1.00   27.10  ? 684  PHE C C     1 
ATOM   8969  O  O     . PHE C 2  684  ? -4.336  4.509   96.466  1.00   25.97  ? 684  PHE C O     1 
ATOM   8970  C  CB    . PHE C 2  684  ? -6.459  5.872   98.253  1.00   27.36  ? 684  PHE C CB    1 
ATOM   8971  C  CG    . PHE C 2  684  ? -7.380  6.003   97.069  1.00   28.01  ? 684  PHE C CG    1 
ATOM   8972  C  CD1   . PHE C 2  684  ? -8.666  5.489   97.110  1.00   27.87  ? 684  PHE C CD1   1 
ATOM   8973  C  CD2   . PHE C 2  684  ? -6.974  6.682   95.931  1.00   24.77  ? 684  PHE C CD2   1 
ATOM   8974  C  CE1   . PHE C 2  684  ? -9.518  5.627   96.029  1.00   23.33  ? 684  PHE C CE1   1 
ATOM   8975  C  CE2   . PHE C 2  684  ? -7.822  6.823   94.849  1.00   22.14  ? 684  PHE C CE2   1 
ATOM   8976  C  CZ    . PHE C 2  684  ? -9.095  6.296   94.899  1.00   23.35  ? 684  PHE C CZ    1 
ATOM   8977  N  N     . GLU C 2  685  ? -6.000  2.991   96.500  1.00   27.52  ? 685  GLU C N     1 
ATOM   8978  C  CA    . GLU C 2  685  ? -5.669  2.399   95.202  1.00   25.98  ? 685  GLU C CA    1 
ATOM   8979  C  C     . GLU C 2  685  ? -4.238  1.876   95.087  1.00   25.01  ? 685  GLU C C     1 
ATOM   8980  O  O     . GLU C 2  685  ? -3.476  2.326   94.234  1.00   31.80  ? 685  GLU C O     1 
ATOM   8981  C  CB    . GLU C 2  685  ? -5.989  3.358   94.048  1.00   25.41  ? 685  GLU C CB    1 
ATOM   8982  C  CG    . GLU C 2  685  ? -7.473  3.457   93.710  1.00   28.07  ? 685  GLU C CG    1 
ATOM   8983  C  CD    . GLU C 2  685  ? -8.016  2.229   92.992  1.00   33.70  ? 685  GLU C CD    1 
ATOM   8984  O  OE1   . GLU C 2  685  ? -7.258  1.255   92.789  1.00   39.72  ? 685  GLU C OE1   1 
ATOM   8985  O  OE2   . GLU C 2  685  ? -9.211  2.244   92.623  1.00   29.11  ? 685  GLU C OE2   1 
ATOM   8986  N  N     . ASP C 2  686  ? -3.877  0.964   95.985  1.00   26.92  ? 686  ASP C N     1 
ATOM   8987  C  CA    . ASP C 2  686  ? -2.606  0.234   95.925  1.00   29.40  ? 686  ASP C CA    1 
ATOM   8988  C  C     . ASP C 2  686  ? -1.372  1.042   96.330  1.00   28.97  ? 686  ASP C C     1 
ATOM   8989  O  O     . ASP C 2  686  ? -0.262  0.511   96.350  1.00   31.37  ? 686  ASP C O     1 
ATOM   8990  C  CB    . ASP C 2  686  ? -2.396  -0.428  94.556  1.00   29.76  ? 686  ASP C CB    1 
ATOM   8991  C  CG    . ASP C 2  686  ? -3.508  -1.389  94.200  1.00   37.53  ? 686  ASP C CG    1 
ATOM   8992  O  OD1   . ASP C 2  686  ? -4.161  -1.915  95.127  1.00   38.93  ? 686  ASP C OD1   1 
ATOM   8993  O  OD2   . ASP C 2  686  ? -3.729  -1.621  92.994  1.00   42.97  ? 686  ASP C OD2   1 
ATOM   8994  N  N     . ALA C 2  687  ? -1.559  2.319   96.640  1.00   24.78  ? 687  ALA C N     1 
ATOM   8995  C  CA    . ALA C 2  687  ? -0.470  3.128   97.176  1.00   23.68  ? 687  ALA C CA    1 
ATOM   8996  C  C     . ALA C 2  687  ? -0.046  2.584   98.541  1.00   27.25  ? 687  ALA C C     1 
ATOM   8997  O  O     . ALA C 2  687  ? -0.809  1.882   99.205  1.00   27.36  ? 687  ALA C O     1 
ATOM   8998  C  CB    . ALA C 2  687  ? -0.885  4.580   97.284  1.00   22.50  ? 687  ALA C CB    1 
ATOM   8999  N  N     . ILE C 2  688  ? 1.181   2.891   98.948  1.00   29.56  ? 688  ILE C N     1 
ATOM   9000  C  CA    . ILE C 2  688  ? 1.734   2.351   100.186 1.00   27.00  ? 688  ILE C CA    1 
ATOM   9001  C  C     . ILE C 2  688  ? 2.297   3.461   101.071 1.00   27.56  ? 688  ILE C C     1 
ATOM   9002  O  O     . ILE C 2  688  ? 2.888   4.419   100.577 1.00   29.98  ? 688  ILE C O     1 
ATOM   9003  C  CB    . ILE C 2  688  ? 2.854   1.327   99.893  1.00   29.51  ? 688  ILE C CB    1 
ATOM   9004  C  CG1   . ILE C 2  688  ? 2.386   0.292   98.868  1.00   28.58  ? 688  ILE C CG1   1 
ATOM   9005  C  CG2   . ILE C 2  688  ? 3.307   0.640   101.167 1.00   27.49  ? 688  ILE C CG2   1 
ATOM   9006  C  CD1   . ILE C 2  688  ? 3.441   -0.727  98.511  1.00   26.51  ? 688  ILE C CD1   1 
ATOM   9007  N  N     . VAL C 2  689  ? 2.108   3.330   102.380 1.00   31.98  ? 689  VAL C N     1 
ATOM   9008  C  CA    . VAL C 2  689  ? 2.665   4.285   103.331 1.00   34.96  ? 689  VAL C CA    1 
ATOM   9009  C  C     . VAL C 2  689  ? 3.731   3.618   104.197 1.00   36.43  ? 689  VAL C C     1 
ATOM   9010  O  O     . VAL C 2  689  ? 3.471   2.603   104.845 1.00   35.94  ? 689  VAL C O     1 
ATOM   9011  C  CB    . VAL C 2  689  ? 1.576   4.875   104.239 1.00   32.06  ? 689  VAL C CB    1 
ATOM   9012  C  CG1   . VAL C 2  689  ? 2.128   6.057   105.016 1.00   30.03  ? 689  VAL C CG1   1 
ATOM   9013  C  CG2   . VAL C 2  689  ? 0.375   5.294   103.412 1.00   29.34  ? 689  VAL C CG2   1 
ATOM   9014  N  N     . ILE C 2  690  ? 4.926   4.202   104.216 1.00   35.25  ? 690  ILE C N     1 
ATOM   9015  C  CA    . ILE C 2  690  ? 6.056   3.611   104.927 1.00   32.67  ? 690  ILE C CA    1 
ATOM   9016  C  C     . ILE C 2  690  ? 6.580   4.536   106.018 1.00   33.74  ? 690  ILE C C     1 
ATOM   9017  O  O     . ILE C 2  690  ? 6.314   5.738   106.014 1.00   36.66  ? 690  ILE C O     1 
ATOM   9018  C  CB    . ILE C 2  690  ? 7.221   3.287   103.977 1.00   27.55  ? 690  ILE C CB    1 
ATOM   9019  C  CG1   . ILE C 2  690  ? 7.853   4.581   103.460 1.00   30.17  ? 690  ILE C CG1   1 
ATOM   9020  C  CG2   . ILE C 2  690  ? 6.746   2.408   102.832 1.00   24.71  ? 690  ILE C CG2   1 
ATOM   9021  C  CD1   . ILE C 2  690  ? 9.113   4.370   102.665 1.00   31.36  ? 690  ILE C CD1   1 
ATOM   9022  N  N     . SER C 2  691  ? 7.334   3.962   106.949 1.00   31.29  ? 691  SER C N     1 
ATOM   9023  C  CA    . SER C 2  691  ? 7.841   4.711   108.089 1.00   32.91  ? 691  SER C CA    1 
ATOM   9024  C  C     . SER C 2  691  ? 9.225   5.283   107.824 1.00   34.20  ? 691  SER C C     1 
ATOM   9025  O  O     . SER C 2  691  ? 10.051  4.652   107.166 1.00   41.62  ? 691  SER C O     1 
ATOM   9026  C  CB    . SER C 2  691  ? 7.881   3.824   109.332 1.00   40.13  ? 691  SER C CB    1 
ATOM   9027  O  OG    . SER C 2  691  ? 8.215   4.586   110.480 1.00   47.14  ? 691  SER C OG    1 
ATOM   9028  N  N     . GLU C 2  692  ? 9.472   6.481   108.343 1.00   31.66  ? 692  GLU C N     1 
ATOM   9029  C  CA    . GLU C 2  692  ? 10.770  7.128   108.202 1.00   31.80  ? 692  GLU C CA    1 
ATOM   9030  C  C     . GLU C 2  692  ? 11.860  6.309   108.890 1.00   32.80  ? 692  GLU C C     1 
ATOM   9031  O  O     . GLU C 2  692  ? 13.043  6.422   108.557 1.00   29.70  ? 692  GLU C O     1 
ATOM   9032  C  CB    . GLU C 2  692  ? 10.720  8.541   108.783 1.00   36.79  ? 692  GLU C CB    1 
ATOM   9033  C  CG    . GLU C 2  692  ? 11.893  9.424   108.398 1.00   36.02  ? 692  GLU C CG    1 
ATOM   9034  C  CD    . GLU C 2  692  ? 11.762  10.830  108.952 1.00   49.21  ? 692  GLU C CD    1 
ATOM   9035  O  OE1   . GLU C 2  692  ? 11.071  11.003  109.979 1.00   49.60  ? 692  GLU C OE1   1 
ATOM   9036  O  OE2   . GLU C 2  692  ? 12.344  11.763  108.357 1.00   51.36  ? 692  GLU C OE2   1 
ATOM   9037  N  N     . GLU C 2  693  ? 11.451  5.475   109.844 1.00   43.65  ? 693  GLU C N     1 
ATOM   9038  C  CA    . GLU C 2  693  ? 12.377  4.597   110.554 1.00   50.40  ? 693  GLU C CA    1 
ATOM   9039  C  C     . GLU C 2  693  ? 13.022  3.589   109.598 1.00   40.57  ? 693  GLU C C     1 
ATOM   9040  O  O     . GLU C 2  693  ? 14.102  3.066   109.875 1.00   41.48  ? 693  GLU C O     1 
ATOM   9041  C  CB    . GLU C 2  693  ? 11.671  3.873   111.709 1.00   35.79  ? 693  GLU C CB    1 
ATOM   9042  C  CG    . GLU C 2  693  ? 10.698  2.791   111.261 1.00   46.54  ? 693  GLU C CG    1 
ATOM   9043  C  CD    . GLU C 2  693  ? 9.967   2.131   112.418 1.00   52.09  ? 693  GLU C CD    1 
ATOM   9044  O  OE1   . GLU C 2  693  ? 10.635  1.497   113.261 1.00   63.10  ? 693  GLU C OE1   1 
ATOM   9045  O  OE2   . GLU C 2  693  ? 8.722   2.242   112.482 1.00   47.89  ? 693  GLU C OE2   1 
ATOM   9046  N  N     . LEU C 2  694  ? 12.359  3.322   108.476 1.00   28.90  ? 694  LEU C N     1 
ATOM   9047  C  CA    . LEU C 2  694  ? 12.929  2.458   107.449 1.00   31.91  ? 694  LEU C CA    1 
ATOM   9048  C  C     . LEU C 2  694  ? 14.150  3.117   106.823 1.00   34.55  ? 694  LEU C C     1 
ATOM   9049  O  O     . LEU C 2  694  ? 15.155  2.459   106.555 1.00   40.93  ? 694  LEU C O     1 
ATOM   9050  C  CB    . LEU C 2  694  ? 11.899  2.136   106.364 1.00   30.23  ? 694  LEU C CB    1 
ATOM   9051  C  CG    . LEU C 2  694  ? 10.852  1.065   106.671 1.00   28.52  ? 694  LEU C CG    1 
ATOM   9052  C  CD1   . LEU C 2  694  ? 9.957   0.844   105.463 1.00   22.01  ? 694  LEU C CD1   1 
ATOM   9053  C  CD2   . LEU C 2  694  ? 11.520  -0.233  107.085 1.00   30.80  ? 694  LEU C CD2   1 
ATOM   9054  N  N     . LEU C 2  695  ? 14.057  4.422   106.592 1.00   33.68  ? 695  LEU C N     1 
ATOM   9055  C  CA    . LEU C 2  695  ? 15.166  5.166   106.010 1.00   31.99  ? 695  LEU C CA    1 
ATOM   9056  C  C     . LEU C 2  695  ? 16.251  5.393   107.054 1.00   35.92  ? 695  LEU C C     1 
ATOM   9057  O  O     . LEU C 2  695  ? 17.439  5.402   106.731 1.00   36.08  ? 695  LEU C O     1 
ATOM   9058  C  CB    . LEU C 2  695  ? 14.688  6.507   105.448 1.00   27.62  ? 695  LEU C CB    1 
ATOM   9059  C  CG    . LEU C 2  695  ? 13.492  6.466   104.495 1.00   22.10  ? 695  LEU C CG    1 
ATOM   9060  C  CD1   . LEU C 2  695  ? 13.327  7.800   103.787 1.00   21.22  ? 695  LEU C CD1   1 
ATOM   9061  C  CD2   . LEU C 2  695  ? 13.639  5.335   103.495 1.00   29.37  ? 695  LEU C CD2   1 
ATOM   9062  N  N     . LYS C 2  696  ? 15.832  5.577   108.304 1.00   37.63  ? 696  LYS C N     1 
ATOM   9063  C  CA    . LYS C 2  696  ? 16.768  5.799   109.401 1.00   34.05  ? 696  LYS C CA    1 
ATOM   9064  C  C     . LYS C 2  696  ? 17.746  4.639   109.539 1.00   33.89  ? 696  LYS C C     1 
ATOM   9065  O  O     . LYS C 2  696  ? 18.950  4.845   109.678 1.00   43.46  ? 696  LYS C O     1 
ATOM   9066  C  CB    . LYS C 2  696  ? 16.020  6.009   110.719 1.00   33.59  ? 696  LYS C CB    1 
ATOM   9067  C  CG    . LYS C 2  696  ? 15.193  7.282   110.777 1.00   37.94  ? 696  LYS C CG    1 
ATOM   9068  C  CD    . LYS C 2  696  ? 14.440  7.393   112.095 1.00   40.71  ? 696  LYS C CD    1 
ATOM   9069  C  CE    . LYS C 2  696  ? 13.574  8.642   112.131 1.00   44.54  ? 696  LYS C CE    1 
ATOM   9070  N  NZ    . LYS C 2  696  ? 12.820  8.764   113.409 1.00   47.96  ? 696  LYS C NZ    1 
ATOM   9071  N  N     . ARG C 2  697  ? 17.225  3.418   109.492 1.00   30.76  ? 697  ARG C N     1 
ATOM   9072  C  CA    . ARG C 2  697  ? 18.063  2.231   109.632 1.00   36.07  ? 697  ARG C CA    1 
ATOM   9073  C  C     . ARG C 2  697  ? 18.540  1.681   108.289 1.00   36.18  ? 697  ARG C C     1 
ATOM   9074  O  O     . ARG C 2  697  ? 19.105  0.589   108.222 1.00   38.82  ? 697  ARG C O     1 
ATOM   9075  C  CB    . ARG C 2  697  ? 17.392  1.151   110.491 1.00   42.63  ? 697  ARG C CB    1 
ATOM   9076  C  CG    . ARG C 2  697  ? 16.133  0.525   109.920 1.00   35.73  ? 697  ARG C CG    1 
ATOM   9077  C  CD    . ARG C 2  697  ? 15.676  -0.603  110.834 1.00   35.26  ? 697  ARG C CD    1 
ATOM   9078  N  NE    . ARG C 2  697  ? 14.447  -1.244  110.382 1.00   40.95  ? 697  ARG C NE    1 
ATOM   9079  C  CZ    . ARG C 2  697  ? 13.232  -0.903  110.798 1.00   43.02  ? 697  ARG C CZ    1 
ATOM   9080  N  NH1   . ARG C 2  697  ? 13.083  0.081   111.674 1.00   40.59  ? 697  ARG C NH1   1 
ATOM   9081  N  NH2   . ARG C 2  697  ? 12.166  -1.544  110.338 1.00   45.85  ? 697  ARG C NH2   1 
ATOM   9082  N  N     . ASP C 2  698  ? 18.273  2.435   107.225 1.00   35.97  ? 698  ASP C N     1 
ATOM   9083  C  CA    . ASP C 2  698  ? 18.748  2.113   105.878 1.00   38.29  ? 698  ASP C CA    1 
ATOM   9084  C  C     . ASP C 2  698  ? 18.151  0.834   105.297 1.00   33.86  ? 698  ASP C C     1 
ATOM   9085  O  O     . ASP C 2  698  ? 18.826  0.100   104.576 1.00   34.01  ? 698  ASP C O     1 
ATOM   9086  C  CB    . ASP C 2  698  ? 20.282  2.056   105.824 1.00   39.62  ? 698  ASP C CB    1 
ATOM   9087  C  CG    . ASP C 2  698  ? 20.910  3.412   105.558 1.00   43.59  ? 698  ASP C CG    1 
ATOM   9088  O  OD1   . ASP C 2  698  ? 21.668  3.896   106.426 1.00   43.99  ? 698  ASP C OD1   1 
ATOM   9089  O  OD2   . ASP C 2  698  ? 20.658  3.987   104.476 1.00   35.76  ? 698  ASP C OD2   1 
ATOM   9090  N  N     . PHE C 2  699  ? 16.888  0.572   105.613 1.00   33.71  ? 699  PHE C N     1 
ATOM   9091  C  CA    . PHE C 2  699  ? 16.152  -0.477  104.925 1.00   33.08  ? 699  PHE C CA    1 
ATOM   9092  C  C     . PHE C 2  699  ? 15.773  0.031   103.541 1.00   36.53  ? 699  PHE C C     1 
ATOM   9093  O  O     . PHE C 2  699  ? 15.495  1.219   103.367 1.00   36.63  ? 699  PHE C O     1 
ATOM   9094  C  CB    . PHE C 2  699  ? 14.902  -0.885  105.706 1.00   29.84  ? 699  PHE C CB    1 
ATOM   9095  C  CG    . PHE C 2  699  ? 15.125  -2.033  106.649 1.00   34.35  ? 699  PHE C CG    1 
ATOM   9096  C  CD1   . PHE C 2  699  ? 16.380  -2.279  107.180 1.00   38.07  ? 699  PHE C CD1   1 
ATOM   9097  C  CD2   . PHE C 2  699  ? 14.082  -2.880  106.987 1.00   35.65  ? 699  PHE C CD2   1 
ATOM   9098  C  CE1   . PHE C 2  699  ? 16.587  -3.341  108.043 1.00   36.93  ? 699  PHE C CE1   1 
ATOM   9099  C  CE2   . PHE C 2  699  ? 14.284  -3.943  107.849 1.00   33.46  ? 699  PHE C CE2   1 
ATOM   9100  C  CZ    . PHE C 2  699  ? 15.538  -4.173  108.377 1.00   33.66  ? 699  PHE C CZ    1 
ATOM   9101  N  N     . TYR C 2  700  ? 15.774  -0.870  102.563 1.00   34.90  ? 700  TYR C N     1 
ATOM   9102  C  CA    . TYR C 2  700  ? 15.481  -0.516